2G81E

Crystal structure of the bowman-birk inhibitor from vigna unguiculata seeds in complex with beta-trypsin at 1.55 angstrons resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Bowman-Birk Inhibitor from Vigna unguiculata Seeds in Complex with {beta}-Trypsin at 1.55 A Resolution and Its Structural Properties in Association with Proteinases
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g81E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g81E02
4IS5A 2ZHEH 3QTVH 1VITF 2J34A 1AO5A 1SFQB 2BLVA 1OWKA 2VU8E 1F0TA 3PO1C 4OGYA 3SJIA 1D9IA 3KHVA 3SJ9A 2D1JA 5F6MA 1O2YA 3GY8A 1UK3A 1CA0C 3A7ZA 3STIA 1DY8A 4I32A 4A6LA 1BOQA 2ZEBA 2ZCHP 4B75A 1KXAA 4X0WU 4YT7H 2NU2E 3CS0A 1EOLA 4INLA 1CT2E 2HNTC 1D3DB 1LVBA 1GGDC 1BMLA 2B7DH 1VCPA 2A7HA 2YOLA 2SNVA 1O34A 1G37A 2PSXA 1BMNH 3SUEA 1C9PA 1SGEE 1WTHD 3RU4T 2FOGA 3S9BA 4NCYA 3A87A 1ANEA 1YPKH 1LQDB 4JK5A 3V13A 1Y3WA 3S7KB 1LHDH 1HDTH 3ZZCA 4NIWA 2FLRH 4LK4A 4MG3A 3SHCH 4K1SA 2I6SA 4DVAU 2C8XB 3GICB 3LGYA 2BY9X 3BF6H 2RCEA 4ISLA 4TWWA 4ZHAA 7GCHG 2HVXA 5LPEA 4UEHH 2ANWA 3NXPA 1EUFA 1N8OB 1CT4E 1UVTH 2V3HH 2H9TH 3PWBA 1WU1A 1AB9C 3P8OA 2C4FH 2TRMA 3ZZ3A 4XBCA 3PROA 3UNQA 1C1RA 1P01A 4ISOA 2ZKSA 1SR5C 3NZIA 4O97A 3SNEA 4CHAC 2PWXA 4A1VA 1O3KA 1T4UH 4IN1A 3AW1A 4FXGH 1SGQE 2GD4B 4D7GA 2ODQA 3UPEA 1O32A 2IN2A 3DT0H 2ZU3A 1RS0A 5LPRA 1TB6H 2CN0H 1UTJA 3SGBE 1C4Y2 2C3SA 4D76A 3KGPA 3LU9B 1O2HA 2KAIB 5JBBS 2A45B 2FLBH 1BMMH 2GP9B 2QXGA 3SJKA 4B74A 1O37A 1V2UT 2BD2A 2G8TA 5GWZA 2HLCA 2XTTB 1Z1IA 3SGQE 4BTIB 3LH3A 1TNGA 1C2IA 3P8NA 4AFUA 1SPJA 1O2PA 1PQ8A 1K1IA 1TQ0B 3HGNA 1UMAH 2FDAA 5DPAA 4ZXXH 1YPHC 1GHAG 5DP5A 1JWTA 3E90B 1GBAA 5EQRA 2ZHQH 3RXPA 4BAQB 3RXVA 4B76A 1EAUA 3ESTA 2WUBA 5L2ZH 1FDPA 1QL9A 3AVZA 1YPMH 1UTMA 1QGFA 1X7AC 1AZ8A 1XUFA 2FOMB 1GBKA 3ODFA 4GHQA 3UQOA 1P2KA 1QA7A 3PV4A 2ANYA 3OYPA 1QIXB 1C1QA 1F92A 4Z6AH 3BEIB 3B8JA 8ESTE 3P6ZB 4E7NA 3F6UH 1TA2A 3GCNA 3RM0H 4ZHLU 1BTWA 1EOJA 1QRWA 4IMQA 1XM1A 4X6MA 3RXCA 2F9BH 1NFXA 3K6ZA 4CRCA 1SGCA 1ZR0A 1P04A 3L33A 1P12E 2ZU2A 1SGDE 4JK6A 3ELAH 3NWUA 3CP7A 1TRYA 1GJDB 2W3IA 2BX4A 1WBGB 4H6TA 1DM4B 1SOTA 1WQSA 2PSYA 2AFQB 1NRQH 1YC0A 5DP8A 1ESAA 1UK4A 1XKBC 1MTUA 3PTBA 1GHVH 4IC6A 5EXNA 2ZTYA 3IITA 1C1MA 3TK9A 1P11E 4TPYA 3PLBA 1GI5A 1JIRA 3LONA 1BUIA 1QURH 2VGCC 1XUIA 1QRXA 3ATMA 3K9XB 3UREA 1QQUA 3O8BA 2HNTF 1FPHH 1QRZA 1ELEE 3GY2A 2PGBB 1AFQC 2R0KA 3KL6A 1NESE 3EE0B 4AGKA 1BDAA 2FS8A 1GBHA 1SLXB 5I46H 1NTPA 3PWCA 2F3CE 3K65B 1SVPA 1H4WA 1KYNA 3U8TH 1EQ9A 2QIQA 5K0HA 5LGOA 1L1NA 2H9EH 1ZTKA 3VB7A 1UTPA 4I8HA 1HJAB 1BRCE 5FPTA 3U69H 1SLWB 2ALPA 3T25A 4AX9H 4WXIA 5C1UA 1ELFA 2VIVA 1MKXH 2WV5A 5C67A 2FOEA 1LDTT 1IQNA 3TGIE 3O8RA 1YPEH 2J38A 3BTDE 3SGAE 2G00A 3TJVA 1VJAU 1TFXA 3P95A 3ZVAA 4ZKOU 3CS7A 3VEQB 4GLYA 4U30A 1W2KH 3LGVA 1Z8RA 5A8XA 4GUXA 1GI9B 4MNXA 1UVPA 1QA0A 4NA9H 2Y80A 2Z3EA 4NFEA 5EGMA 5F03A 2F9VA 5B6OA 3KNXA 3VGCC 1GGDB 1QB1A 1QL8A 4O9VA 2Z94A 2AYWA 1O3PB 1OP8A 1DSTA 1GMDG 2FXRA 2IPHA 5BPEA 8LPRA 3CENA 1WYKA 2QF0A 1MZDA 2Y7ZA 3TK5A 1HJAC 3OTJE 4ABBA 5T6DA 1O3MA 2QCYA 3HK3B 1ELVA 3D23A 3FAOA 3LH1A 2ZPRA 1O5DH 3M7QA 3DD2H 1E37B 1GVZA 2QY0B 3OY6U 1TLDA 5EODA 1FUJA 1O3EA 1QJ7B 2Z9IA 1AD8H 3MMGA 4XE4A 1QHRB 2ZIQH 1Y5BT 1TBZH 4ZROA 1F0RA 3SUGA 1BRAA 4NIXA 1ANDA 2SGDE 1K1LA 5J4SA 4YOGA 1C5NH 3U8OH 1L4DA 2ZDAH 1A3EH 2PUQH 2XC0A 1DWCH 5JBCS 5EU8A 1BB0B 3C27B 3P17H 1MTWA 4KTSA 1A1RA 1FAKH 2V6NA 1LO6A 4NZQA 1OPHB 2XNIA 2FOHA 3SOSA 2FP7B 2C93B 2P93A 1J15A 4JZDH 5EXMA 2ULLA 3SORA 1GI3A 1MU8B 1KXFA 5HM9A 3G01A 3ZZDA 4AG1A 2UWOA 2OBQA 4GHTA 1HAGE 1JXPA 1CVWH 2OC0A 4OS1A 2JKHA 1CSOE 4QT8C 2STBE 1MZAA 4GVUA 1S5SA 4R0IA 1ELBA 1OWDA 1AVGH 1P09A 3IG6B 1NRNH 1ZSJA 1CGJE 1G3CA 2XC4A 1MAYA 1DLKB 1RTKA 4MVNA 4O3TA 5ETXA 3UY9A 2ZDMA 2XCFA 1GBFA 1EP5A 1O5GH 2G52A 3GYMA 5EW2H 1AFQB 1GBJA 2BDBA 2O8MA 1UVUH 2B5TB 1OWHA 4ZKRU 1ELCA 4BAKB 2BZ6H 3T27A 1O2MA 1O35A 1NU7B 1CT0E 2PTNA 7LPRA 1HJ9A 1BTPA 4ISHH 1O3LA 4RKJB 1TNHA 1GCTC 3TNSA 3T62A 1LHEH 3RXAA 1C1UH 2AS9A 1UHBA 4WMEA 5AFYH 4JYVH 1DFPA 3W95A 1F0SA 1KDQA 1SGTA 1C2KA 1ETTH 1M9UA 1OX1A 1TNJA 2ZGJA 3GOVB 2BDHA 7KMEH 1O2OA 2D8WA 3BG4C 5CHAB 2BYAX 3SNDA 2XW9A 1ANCA 2JETB 3JZ1B 5FPYA 1CGHA 1XXDA 2GVFA 1GBTA 2BY8X 1GI4A 2ZCLP 2GZ8A 3ZZ8A 3UQVA 2ZDKA 1AUTC 2JH6D 2BLQA 1L2EA 1THPB 3A85A 5A0BA 1W11U 3M5MA 3H7TA 1TX8A 2Y82A 3M35A 1WUNH 1XKAC 4A5TS 1NRPH 2BD9A 4DT7B 1TMBH 1LKAA 4VGCC 4B2CA 1SGPE 1GHBF 2OD3B 4UFDH 1G3DA 2FI3E 3D49H 3B23B 1ZJDA 1W12U 3TJOA 2BY5X 3SU3A 4DJZB 1OYTH 1GBBA 2FI4E 1A0LA 1O5BB 1WOFA 3QTOH 4B1TA 5E0GA 2XBWA 3M3SA 3MHWU 5T6FA 1QTFA 1C2JA 1V2OT 1YPHE 1YCPM 4JZEH 3SI4H 2F9PA 2VVUA 2UUKB 1P57B 1BCUH 2A5AA 2GT7A 4JMYA 3BEFB 3ZYEA 3SV2H 1ZMJA 4JYTA 3SNAA 1OWJA 3M5LA 4I7YH 1ZLRA 4MQAA 3FZZA 4JZ1A 2PV9B 4D7FA 1SFIA 2BVXH 1IQEA 4A1XA 2Z3DA 1NM6A 4ISIH 3ZVBA 2BXUH 3BN9A 1MQ5A 2W7SA 2ZFPH 1ZRBA 2PKSB 1HIAA 3BSQA 4LXBH 1A46H 2VH0A 2SGQE 2TIOA 4WH6A 1YBWA 4AG2A 3GY7A 3TU7H 3KF2A 3C1KA 2XXLA 2BVRH 2ZGHA 1IQFA 5TCAA 4UD9H 5C20A 1CHOG 1JOUB 1IQLA 1LKBA 1PYTC 1JRTA 4X2WA 4DY7B 5HM2A 1V2TT 5EW1H 2AIPA 1ZZZA 4Y6DA 5T6GA 4INHA 2GCHF 3FP7E 1FY5A 2AERH 1C5MD 3GY3A 1P2IA 2HALA 3KN2A 4FUCA 1S81A 5JYIA 2A4OA 3EYDA 1S6FA 4MPWA 1VITH 3M37A 2BY7X 2D26C 1C5UA 3BIVH 3M61U 1O38A 1C5QA 1ZGIA 3DFJA 1BBRH 1RXPA 3UR9A 4LZ4B 1LVMA 4KGAA 4YT6H 2BD4A 5HGGA 2ILNA 3A8BA 2AH4X 4X8VH 4X8TH 5DK1A 4AORA 1C5OH 1V2WT 2BD8A 1WV7H 1J16A 2A4QA 2XWBI 4F49A 2OLGA 4FUFA 1C2DA 2ZDVH 1V2LT 5AVDA 7GCHF 3MU0A 2FO9A 1F7ZA 2ZHDA 1AY6H 1HXEH 1OSSA 1TPAE 3DFLA 3U1JB 2A4RA 1SMFE 2FYQA 4AB9A 4AYYB 1ZSKA 2TGTA 2ZGBH 1MH0A 2Y5HA 1QB9A 3TJNA 4NWLA 2P8OB 2GZ9A 3VB4A 1B5GH 4BAMB 2VJ1A 2OINA 1KIGH 1NZQH 5AF9H 1P10A 3ATIA 2CHAC 3SU5A 3ZZ9A 4YOJA 5FHTA 4Y7AA 4ABIA 2ZU5A 4E06H 1EJNA 3ZZAA 5T3HA 1DXPA 5JDUB 2O8WA 1ELTA 1O2QA 3QUMP 5FX5A 1P0SH 2FTLE 3UNSA 4KTUA 1GCDA 5L30H 1TGBA 3S0NA 1G30B 1ANBA 1H9LB 3A8DA 3RDZA 1DT2A 4ASHA 3UWJH 2LPRA 4TPIZ 3OSYA 1MAXA 2SGAA 4CRGA 5GPIB 1K28D 1SLVB 1SLUB 3GCTG 2BM2A 1O2JA 4XSKU 2XBYA 4TYDA 5FBEA 2ZWLH 4Q2KA 2Z9GA 1SGFG 2PR3A 2F83A 1P03A 4ZHMU 1UVSH 1D4PB 4RKOB 1BBRE 1QJ6B 3WY8A 4GSOA 2VIWA 1GBIA 4K1EA 3SV8A 1O3DA 1VZQH 3PMJA 7ESTE 1GJ5H 1O2KA 5HXFA 3EAJA 2ZNKH 2P3FH 4FUEA 1O2RA 1AUJA 1DY9A 3MO9A 4KP0A 1W10U 1V2PT 3T2NA 4MDSA 1KLTA 1HAPH 4OS5A 3GISB 4NG9H 3RXTA 4NSYA 2PKAA 4CREA 1C1VH 1XX9A 1T32A 1AGJA 1CHOF 2BHGA 3A7TA 1LTOA 3K6YA 3RLYH 4DCDA 5AFZH 1EB1H 2XRCA 3RC6A 2J95A 3LPRA 2OCVB 2P16A 1O2IA 2QXJA 1G36A 2GT8A 3ZVDA 2QC2A 1IQJA 2LNCA 1DITH 3D65E 3ZVGA 3HK6B 2VGCB 3ZZ5A 2VWOA 1A61H 4TWYA 4NZLA 1CO7E 2ZA5A 1O3JA 3MWIU 1UCYE 2HGTH 1ESTA 4NFFA 1O33A 2BD5A 1CGIE 3VXEH 2C8WB 1UO6A 1E36B 2ASUB 3EA7A 3BTGE 1PPCE 2F9NA 3HPTB 4AFZA 1EAIA 3RUOA 1V2KT 3O8DA 1Y8TA 9ESTA 3MU4A 3RXMA 1A4WH 1H8IH 1PPEE 1C2FA 2Q1JA 5HMAA 3HKJB 1KLIH 6CHAB 3MH4A 5JPMH 2BLWA 1LHGH 3A88A 5DP4A 2J94A 4YLQH 2ZHWH 4JZFH 3URCA 1DSUA 4AYVB 4R8TB 5AHGH 4DURA 4WXVA 2AMPA 1O3AA 1QR3E 2FPZA 5EG4A 1MU6B 5C1YA 4FUJA 1KXCA 5EQSA 1BRBE 4A1TA 2Y81A 4X6NA 2PUXB 2XCNA 2QA9E 3S9CA 3MNBA 4Y71A 3M3VA 1MD8A 1JRSA 4CR9A 1AMHA 2AMQA 1ESBA 2GCTC 2AGIX 3A7WA 4MPVA 2Q6FA 3OX7U 4X2VA 1HFDA 1YKTA 2IJOB 4ZAEA 1FV9A 3P8FA 4XDEA 3M5OA 4Y0YE 5ABWA 1MBMA 3RM2H 1ZPZA 1T8MA 2SGPE 4BNRA 2AEIH 2FS9A 1GG6C 2FYRA 1SGYE 4MPXA 4Y11E 2EC9H 1P2OA 3H7OA 1EZUC 3BV9B 1O3GA 3SU6A 1ACBE 1AZZA 3SZNA 2Y5GA 4CH2B 5DP6A 2QF3A 1YM0A 4UFEH 5LPFA 3A86A 3HGPA 1PPFE 2XC5A 1O2XA 1HAHH 1JBUH 4IC5A 4D9QA 5E2PA 3RMMH 2BOKA 3ITIA 1ID5H 2ZZUH 4IW4E 1PPHE 2V3OH 2Z6BD 1NRRH 2Z3CA 1O2SA 1IHTH 1S82A 2NWNA 2YNAA 2EI8A 3TVJB 2VWMA 1FY8E 5C3NA 1ABJH 1H9HE 1SL3A 1IQGA 1NO9H 4X6PA 3LJOA 2P3UB 1XVMA 1AKSB 1GJ8B 1IQIA 2FESH 4OS2A 5GDSH 2G4TA 2VH6A 1K1MA 1QBVH 2G55A 3PB1E 1DS2E 2BD3A 2VINA 2DUCA 1W13U 5K7RA 1K1NA 5E0JA 1DDJA 1BT7A 2A1DB 2FEQH 1RRKA 3SV6A 1C1NA 3LGIA 3MI4A 1V2RT 4YESB 4WF8A 2GKVE 2JH0D 1ZMNA 3GY5A 2ZQ1A 1K1OA 4FVDA 4NGAH 1Z6JH 2GMTB 4U32A 4VGCB 4K2YA 1QBOA 5A2MH 1TIOA 5DG6A 4X1QU 1K1PA 4J2YB 5DP7A 4DGJA 1GJ9B 3M5NA 4X8SH 3KQBA 3A7VA 1P2NA 3HKIB 1VCQA 1TMTH 1HAXB 4ABAA 1GL1A 2P59A 3ZZ6A 1F5KU 2CXVA 1XUGA 3UOPA 3PMBB 2Q6DA 1T8NA 1TGTA 1L0ZA 1D3PB 2RA3A 4BAOB 1DWBH 1GL0E 4NA7A 4INKA 3RP2A 3UFAA 2BDAA 1SBWA 1VJ9U 3PM3A 2ZFTA 1HCGA 2WPMS 3MU1A 2AGGX 4LZ1H 1BITA 2ZC9H 4AFQA 1GCTB 3FANA 1PQAA 1A5HA 3A7XA 3OU0A 3PLKA 2R2MB 5F8XA 1RTLA 2ZTXA 1P06A 1O2LA 3MU8A 4I8JA 4HI3A 1GI6A 4UE7H 2WPJS 3VB6A 1P3CA 3F9GA 2ALVA 1BRUP 4B73A 3BTKE 5IYTA 3TH4H 1T8OA 1QFKH 1LMWB 3JZ2B 1FQ3A 1O2NA 3GCHC 5E2OA 2Y5FA 3NK8A 4X2XA 5BRRE 1JIMA 2ZPSA 4K69A 3VB3A 2PKSC 1S0QA 5FAHA 5L2YH 1PYTD 1PQ5A 1EJMA 4JYUH 2PGQB 2EI7A 1L4ZA 2QN5T 3QDZB 4BXWA 1Y59T 3P8GA 1MTSA 1GMDF 1AU8A 3ODDA 4AZ2B 2VIPA 3TH2H 1YPJH 3S69A 1UCYK 1SHHB 4WMFA 4Y0ZE 1OP2A 3FZDA 1CE5A 2BDCA 2ZQ2A 2R3UA 6GCHG 2NU4E 1JMOH 2RG3A 1C2GA 1TX7A 4X8UH 5GIBA 1TNIA 1ZGVA 3UIRA 4K8YA 3FP6E 2EA3A 5FPSA 4CRDA 5DO4H 1P2QA 1P2JA 4FUIA 1RFNA 1TOMH 3Q77A 4E05H 4YLUA 5EXLA 2VIDA 3TLOA 4ABJA 1SQTA 2W26A 3LOXA 3D62A 1DICA 1F5RA 2ZDNA 1FAXA 3T29A 2FM2A 1W0YH 2A4GA 3UR6A 1SB1H 2GV6A 3GDVA 1J8AA 1KDQB 1TRMA 2RA0A 1SC8U 1SI5H 1SQOA 2ODYB 4NIYA 1RIWC 4MNWA 1UTLM 4MTBA 1B7XB 1YPGH 1GJCB 2TBSA 4FUHA 1AB9B 1Z8IB 3RU4E 1FPCH 3MU5A 2J4IA 3O8CA 1G32B 1TPOA 1ZSLA 1BQYA 3RXIA 2PTCE 2O9QA 1DE7H 1J9CH 1OP0A 1G9IE 4AFSA 1GHYH 1VR1H 1B0EA 1A0JA 1ARBA 3VFEA 1PPGE 4RSPA 1E38B 1Q3XA 3URDA 2OBOA 1UK2A 4UDWH 1GBMA 2CV3A 3BG8A 3AAVA 1EZQA 4DG4A 2BXTH 1LPKB 2F9UA 2V35A 2PFEA 4AOQA 3FP8E 1ELAA 2R9PA 2FWWA 1FY4A 9LPRA 5L6NH 1K22H 3F9FA 4F4OC 3BTHE 1YLDA 1W7XH 1BTXA 4CRBA 1HLTH 2OC1A 1GHXH 2P94A 3A82A 2G81E 1Q31A 2CJIA 4THNH 1FY3A 2B8OH 1V2QT 2C90B 3B9FH 1E34B 1EX3A 2JETC 2H1UA 2YNBA 1O3NA 1LVOA 1UCYH 4UFGH 3N7OA 1EPTC 1Y5UT 5G4BA 3BG4B 1SHYA 1AI8H 3LJJA 3GCTF 1QBNA 3MH7A 5C5NA 1XXFA 1C5PA 4ABDA 2VB0A 4IN2A 3RXJA 2ZG0H 4LOYH 5GXPA 4X1PU 1ELGA 1V2JT 1ZJKA 3UUZA 1OYQA 1P2MA 1GJ7B 1A7SA 4CBNA 2GV7A 2ZTZA 4WJG2 4AGJA 5A8YA 3SJ8A 2BQ7B 1C5ZB 2CGAA 1TE0A 3A84A 1FXYA 1S0RA 4JZIA 3RXSA 2ZGXH 1TQ7B 3TPIZ 2UWLA 2UWPA 3UOUA 2Y6TA 1ZHRA 3SO3A 1UTOA 2NU1E 2O8TA 3TGJE 1N1LA 2HNTE 1SGNE 1NN6A 4BOHA 1D6RA 2BOHB 4I33A 2BTCE 1KLJH 1O3HA 5EOKA 4DIIH 2A32A 1UTNA 3F1SB 3MH5A 3RXGA 1LPZB 4XBDA 3AAUA 3KCGH 3P92A 5J4QA 1EATA 1AE8H 2ZU4A 2ZFFH 3LGUA 1OWEA 2H5CA 4JCNA 1MUEB 3ZVCA 3ATLA 3K2UA 1C5SA 1AWHB 3I29A 3UTUH 3QK1A 4NA8A 4BAHB 3QLPH 3AW0A 4GCHF 1UJ1A 3A8AA 1DWDH 1V2VT 1QCPA 2R0LA 3TJUA 2TPIZ 3ENSB 2O8UA 5HYOA 2ZDLA 2RDLA 1C2EA 1HIAB 1MKWK 1GBEA 4ABGA 3LC3A 1CBWC 3MYWA 3VXFH 4BTTB 4K60A 4WH8A 1N6YA 4X1RU 2GCHG 2W3KA 3SJOA 1MCVA 1O3OA 2GGVB 1J14A 2ZCKP 4Q7YA 1QL7A 1P02A 1AE5A 1FJSA 1O39A 3QZRA 4J1YA 1O30A 3GY6A 1C1WH 2SNWA 1FIZA 1YPLH 2G5VA 1GVKB 3RC5A 2HPQH 4ISNA 4OS4A 3E3TA 4O3UA 4A7IB 2B0FA 3VGCB 1C2HA 2UUYA 2VVVA 1TPPA 4UONA 1ARCA 1P05A 2R2WU 3NCLA 2ANKH 1O36A 2SFAA 2HRVA 4FU7A 3SU4A 4DOQA 1BZXE 1IQKA 1GJAB 3TNTA 2UUFB 3DUXH 2C8YB 4U2WA 4Y10E 1LPGB 1MKXK 1NFWA 2ZO3H 5E8EH 1EAWA 1C5WB 3R0FA 4H4FA 2BB4A 3QZQA 3E8LA 1W14U 4X1NU 2VWLA 1J17T 4AN7A 1TAWA 4KKDA 1RGQA 1LHFH 2GDEH 1Z6EA 1GMCF 1GJ4H 1Y3UA 2BX3A 2FIRH 1G2LA 1BIOA 5EPYA 1XUHA 1C5LH 1NY22 1Z71A 3RXOA 1O5FH 5CMXH 3QX5H 1O5CB 4Q80A 4K5ZA 5GCHG 1BBRK 2SGEE 1PPZA 1C4V2 1GJBB 3V3MA 3LC5A 1GI7B 3MOCA 3SU1A 2H9HA 1HUTH 4ZXYH 4NIVA 1E35B 5EQQA 4B2BA 5F8ZA 1TNKA 1BTUA 4H42U 4FVBA 1FY1A 4M7GA 1QQ4A 1ETRH 1BMAA 5DP9A 2G5NA 2OUAA 1EZXC 1S83A 3V0XA 1C1PA 5A0CA 4GPGA 4H6SB 2QGRA 2A7CA 2B9LA 3KQDA 3PYHA 4DIHH 2GTBA 1XUKA 4Q7XA 2QYIA 4CHAB 4XOJA 1C4U2 3ZVEA 4YM9A 2ODPA 3RXRA 2Z9LA 1GBCA 4Y8YA 3EGKH 1GDUA 1IAUA 2WPIS 1BTYA 4CRAA 1AVXA 3QGJA 1Z1JA 5JB9S 1DXWA 1GBLA 1HAVB 1SGIB 3I77A 1Y5AT 1T4VH 2ZF0H 2A5KA 1GDQA 1DLEA 2K1QA 2Z7FE 4OGXA 4SGAE 1O2TA 1TGCA 3SNCA 1QJ1B 5FXLA 5A0AE 4FU9A 1GMHF 1NT1A 2FOBA 1AFEH 2EI6A 1C5XB 3MNSA 2WPLS 4PROA 1RTFB 1C5RA 4I8KA 3U9AH 3LIWA 4YTAA 4Y7BA 5C2ZA 2NU3E 2GDDA 2W7UA 4NWKA 1IHSH 3L6PA 4GAWA 1HAIH 1CA8B 1AIXH 1G2MA 2CMYA 4A92A 3V7TA 4CBOA 4I31A 2BLOA 1RD3B 2G4UA 1MMJN 3F68H 4FU8A 1C9TA 1TABE 1THSH 1SGRE 3U1IB 1V2NT 3A81A 1HJ8A 3E0PB 4ZKNU 4BANB 1L1JA 2ZP0H 1G3EA 2PKAB 1AWFH 1WAYB 2TGDA 1H9IE 1TNLA 1H1BA 5JB8S 1C5VA 1OS8A 1Z7KA 3KIDU 1GDNA 2OXSA 5FCKA 1NPMA 4ESTE 2HWLB 2I6QA 2IOTA 1P9UA 5CHAC 2H6MA 1HV7A 1TWXB 2WV4A 1A5IA 1HGTH 1AHTH 1GI2A 4OS7A 1EB2A 3GDSA 1GPZA 1FONA 1OKXA 1UTKA 4XBBA 1PPBH 3HATH 2OC7A 3BTFE 3RU4D 1K9OE 2QAAA 1RJXB 2ANMH 4Y79A 4WWYA 1EPTB 5DGJA 1ZTLA 3STJA 1TONA 1ZPCA 1NRSH 1HAYB 1O2UA 2BQ6B 1P8VC 4Y8ZA 2VIOA 4D8NA 4B71A 3GCOA 1TMUH 1KSNA 5EPNA 5TCCA 2XWAA 3H5CB 2QV1A 3NUMA 1Z8GA 2WUCA 1GHWH 3MNCA 2ZGCA 1NFUA 1FN8A 8GCHF 3BIUH 3P70B 3T26A 2ZFRH 3E16B 4WVPE 2WYJA 3SN8A 3PLPA 1TBQH 2PW8H 3F9EA 3UNRA 1F0UA 1S85A 2F91A 1O5EH 3BTQE 1TOCB 4SGBE 5DKMA 1DOJA 3QWCH 1FNIA 3M7UA 5PTPA 2DE9A 3I78A 2AIQA 1A2CH 4YO9A 1O5AB 2G51A 2NU0E 3RXQA 3OY5U 1D6WA 1MBQA 1P3EA 1Y3XA 3GYLB 4Q7ZA 3SI3H 2FZZA 1XMNB 1SGFA 2FX6A 1LVYA 5JBTA 1ELDE 1YP9A 3ATKA 1O31A 1TA6A 1HNEE 2OTVA 1NS3A 3EA9A 1F2SE 2WINI 6GCHF 4FUDA 2HPPH 2VWNA 5A8ZA 4TY7A 4DW2U 4Y8XA 1NU9A 3W94A 1GWAA 1ZHMA 1SSXA 1ZOMA 4KTCA 1EAXA 2ZFSA 5DP3A 3RC4A 3ATWA 1WSSH 2BY6X 3M3TA 5H4IB 4D9RA 1EKBB 2AMDA 1W8BH 5FCRA 1LQEA 2GZ7A 4BTUB 3LGTA 4Y76A 4CH8B 1DANH 2SGFE 2WPKS 1ORFA 2O8LA 2J92A 1V2ST 2BQWB 2WYGA 2ESTE 1DUAA 3EQ0H 4IGDA 2J9NA 4X6OA 4MNVA 1LCYA 2OC8A 2ZECA 3RXDA 3PTNA 2P8OC 3SQEE 1C1OA 2A2QH 2GMTC 4YZUA 5I25A 4KELA 1KXEA 1IQHA 1EZSC 4XFQA 5IDKA 5FBIA 5LH8A 6LPRA 1P9SA 2PHBA 2FOFA 3DHKH 3RXUA 4NSVA 2KAIA 4FUBA 3ZV9A 2OQ5A 1V2MT 3U8RH 3SNBA 1B0FA 1C5TA 4HTCH 4CR5A 4ABHA 3T5FH 6ESTA 1BJVA 4E7RG 1HYLA 1Z8JB 2FODA 1DUEA 3ZYDA 2FI5E 1SQAA 1G3BA 1HRTH 1FIWA 3BTWE 2A2XH 1GVLA 1TX6A 2XYAA 3A7YA 2ZPQA 5JBAS 3MTYA 3SHAH 3A80A 1ZTJA 4Z0KA 1EXFA 3SUDA 4HGCA 3NPSA 1MTNB 4ZUHA 1YF4A 2J2UA 2VNTA 3BEUA 3Q3KA 3FVFB 5E0HA 1TYNA 4MLFB 1Q2WA 1OWIA 1C2LA 1NROH 1O2VA 1Y3VA 5DJ7A 3S7HB 2M5TA 1EASA 3DA9B 3GCHB 2GX4A 2OQUA 1BHXB 1GBDA 4I8GA 3SV9A 1FI8A 1O3BA 2WPHS 3SUFA 2QXIA 3SU0A 3NKKA 3L3TA 2ZU1A 2XBVA 1DX5M 1O2WA 4ZKSU 1S84A 1YCPH 1HAVA 1ZRKA 5SGAE 2H5DA 1O3IA 1T7CA 3E1XB 4K8BA 4ZH8A 5GCHF 1FLEE 1GMCG 3TITA 4AB8A 1EPTA 1A5GH 2FTMA 5TJXA 3RXKA 2BD7A 1O2ZA 1T8LA 1GHBG 1VGCC 2C8ZB 3ZV8A 3PMHB 3TGKE 1ZHPA 3U98H 1VGCB 1C5YB 3LKWA 1OOKB 2TGPZ 1K1JA 1O3FA 1W0ZU 1GI0A 2PLXA 5A09A 3RXBA 1ETSH 1E0FD 1ABIH 1ZPBA 1A3BH 3KEEA 1AN1E 2A5IA 2V0BA 3QN7A 3T28A 1MCTA 4MNYA 1WCZA 1BTHH 1MKWH 3V12A 3SW2B 1W7GH 5GJ4B 1FN6A 3EA8A 4ABFA 4B2AA 1INCA 1LHCH 1N6XA 2P3TB 1BTZA 2Z9JA 4ZMAH 1O3CA 3Q76A 1TRNA 2CF9H 4WMDA 3QO6A 3FFGA 1C1SA 1FMGA 3BTTE 1TALA 1WTGH 1PFXC 2TGAA 1HBTH 4IBLH 1TGNA 4K1TA 3RMNH 3Q3YA 1WQVH 3BTEE 4UFFH 3TK6A 2HOBA 4FUGA 1T31A 3MO3A 2CF8H 1XVOA 2FOCA 2BDGA 1CHGA 4O03A 1GI8B 1OXGA 2FMJA 2H2ZA 3Q3XA 1C1TA 3RXLA 1NFYA 4RN6A 1IQMA 2D2DA 1YGCH 3RXHA 3ZVFA 1MTVA 4IMZA 3RXEA 1H8DH 2BDIA 2ZHFH 2BVSH 1AVWA 2Z9KA 1SG8B 1XUJA 1BJUA 1NC6A 3EDXB 3A83A 3VPKA 1KTTB 5F8TA 1EJAA 1L1GA 1V6DA 2DE8A 4GCHG 2FX4A 3LT3A 1DVAH 4OS6A 1HXFH 1KXBA 1TGSZ 2UUJB 1DPOA 3ZZBA 2BDYA 1K2I1 1W3CA 3A8CA 2GCTB 1GHZA 1D3QB 4YOIA 3KQEA 4WY3A 1QY6A 1THRH 2A7JA 1QB6A 1GMHG 1HAZB 5ESTE 1S6HA 3IWMA 2R3YA 1YCPK 2XBXA 1CA0B 1TPSA 2FOAA 3RMLH 1KY9A 1CU1A 1MQ6A 4X1SU 1MD7A 3PO1B 1CBWB 1Y3YA 3TH3H 1N8OC 2BMGB 3GY4A 1HAOH 3RXFA 6CHAC 3ZZ7A 1U6QA 2THFB 1VCWA 1ZYOA 3R3GB 3MO6A 1EP6A 4HZHA 2Q6GA 1HB0B 1QNJA 1PJPA 2ZFQH 1AQ7A 3PMAB 2ZI2H 2STAE 1GI1A 1FZZA 2F9OA 3LGWA 3BTME 2A31A 3M36A 1D3TB 1CQQA 3GDUA 3SQHE 3LDXH 3A89A 1GG6B 1DWEH 2BZAA 2AGEX 2P95A 4ABEA 1C2MA 3F9HA 4BXSA 3AASA 2W5EA 3E6PH 2QXHA 1BHXF 2OP9A 5ESBA 1GJ6A 1HPGA 3KQCA 5FX6A 3M7TA 1GHAF 3ZZ4A 3SBKA 3SU2A 1RIWB 4TY6A 5C5OA 3VB5A 1O0DH 1V3XA 1TBRH 2A0QB 4X2YA 1ZMLA 8KME2 1KTSB 5C1XA 2VIQA 1YYY1 1BA8B 1YLCA 1MTNC 1IOEA 3Q00A 4HFPB 2EEKA 3UWIA 1O2GH 2JH5D 3MH6A 3QGNB 2CHAB 1VITG 1F5LA 1UTQA 2VVCA 1UHBB 3S9AA 5CE1A 4I8LA 1AKSA 3TIUA 1PQ7A 3E91A 3SV7A 8GCHG 4MPUA 3RLWH 1A0HB 1SOZA 1UVOA 1K21H 2Y7XA 4CRFA 1KXDA 3MNXA 3MFJA 3RMOH 4U01A 4K3JA 3E0NB
chains in the Genus database with same CATH superfamily
4IS5A 2ZHEH 3QTVH 1VITF 2J34A 1AO5A 1SFQB 2BLVA 1OWKA 2VU8E 1F0TA 3PO1C 4OGYA 3SJIA 1D9IA 3KHVA 3SJ9A 2D1JA 1NBME 5F6MA 1O2YA 5IK2D 3F0OA 3GY8A 1UK3A 1CA0C 3A7ZA 3STIA 1DY8A 4I32A 4A6LA 1BOQA 2ZEBA 2ZCHP 4B75A 1KXAA 4X0WU 4YT7H 2NU2E 3CS0A 1E79D 1EOLA 4INLA 1CT2E 2HNTC 1D3DB 1LVBA 1GGDC 1BMLA 2B7DH 1VCPA 2A7HA 2YOLA 2SNVA 1O34A 1G37A 2PSXA 1BMNH 3F2FA 3SUEA 1C9PA 1SGEE 1WTHD 3RU4T 2FOGA 3S9BA 2KCOA 4NCYA 3A87A 1ANEA 1FX0B 1YPKH 1LQDB 4JK5A 3V13A 1Y3WA 3S7KB 1LHDH 1HDTH 3ZZCA 4NIWA 2FLRH 4LK4A 4MG3A 3SHCH 4K1SA 2I6SA 4DVAU 2C8XB 3GICB 3LGYA 2BY9X 3BF6H 2RCEA 4ISLA 4TWWA 4ZHAA 7GCHG 2HVXA 5LPEA 4UEHH 2ANWA 3NXPA 1EUFA 1N8OB 1CT4E 1UVTH 2V3HH 2H9TH 3PWBA 1WU1A 1AB9C 3P8OA 2C4FH 2TRMA 3ZZ3A 4XBCA 3PROA 3UNQA 3OEHD 1C1RA 1P01A 4ISOA 2ZKSA 1SR5C 3NZIA 4O97A 3SNEA 4CHAC 2PWXA 4A1VA 1O3KA 1T4UH 4IN1A 4OM9A 3AW1A 4FXGH 1SGQE 4B6EA 2GD4B 2PP6A 4D7GA 1W0JD 2ODQA 3UPEA 1O32A 2IN2A 3DT0H 2ZU3A 1RS0A 5LPRA 1TB6H 2CN0H 1UTJA 3SGBE 1C4Y2 2C3SA 4D76A 3KGPA 3LU9B 1O2HA 2KAIB 5JBBS 2A45B 2FLBH 1BMMH 2GP9B 2QXGA 3SJKA 4B74A 1O37A 1V2UT 2BD2A 2G8TA 5GWZA 1QZ8A 2HLCA 2XTTB 1Z1IA 3SGQE 4BTIB 3LH3A 1TNGA 1C2IA 3P8NA 4AFUA 1SPJA 1O2PA 1PQ8A 1K1IA 1TQ0B 3HGNA 1UMAH 2FDAA 5DPAA 4ZXXH 1YPHC 1GHAG 5DP5A 1JWTA 3E90B 1GBAA 5EQRA 2ZHQH 3RXPA 4BAQB 3RXVA 4B76A 1EAUA 3ESTA 2WUBA 5L2ZH 1FDPA 1QL9A 3AVZA 1YPMH 1UTMA 1QGFA 1X7AC 1AZ8A 1XUFA 3FKSD 2FOMB 1GBKA 3ODFA 4GHQA 3UQOA 3W1EA 1P2KA 4M9FA 1QA7A 3PV4A 2LP6A 2ANYA 3OYPA 1QIXB 1C1QA 1F92A 4Z6AH 3BEIB 3B8JA 8ESTE 3P6ZB 4E7NA 2WPDD 3F6UH 1TA2A 3GCNA 3RM0H 4ZHLU 1BTWA 1EOJA 1QRWA 4IMQA 1XM1A 4X6MA 4I86A 4TSFD 3RXCA 2F9BH 1NFXA 3K6ZA 4CRCA 1SGCA 1SQRA 1ZR0A 1P04A 3L33A 1P12E 2ZU2A 1SGDE 4JK6A 3ELAH 3OE7D 3NWUA 3CP7A 1TRYA 1GJDB 2W3IA 2BX4A 1WBGB 4H6TA 1DM4B 1SOTA 1WQSA 2PSYA 2AFQB 1NRQH 1YC0A 5EIYA 5DP8A 1ESAA 1UK4A 1XKBC 1MTUA 3PTBA 1GHVH 4IC6A 5EXNA 2ZTYA 3IITA 1C1MA 3TK9A 1P11E 4TPYA 3PLBA 1GI5A 1JIRA 3LONA 1BUIA 1QURH 2VGCC 1XUIA 1QRXA 3ATMA 3K9XB 3UREA 1QQUA 3O8BA 2HNTF 1FPHH 1QRZA 1ELEE 3GY2A 2PGBB 1AFQC 2R0KA 3KL6A 1NESE 3EE0B 4AGKA 1BDAA 2FS8A 1GBHA 1SLXB 5I46H 1NTPA 3PWCA 2F3CE 3K65B 1SVPA 1H4WA 1KYNA 3U8TH 1EQ9A 2QIQA 5K0HA 5LGOA 1L1NA 2H9EH 1ZTKA 3GS9A 3VB7A 1UTPA 4I8HA 1HJAB 1BRCE 5FPTA 3U69H 1SLWB 2ALPA 3T25A 4AX9H 4WXIA 5C1UA 1ELFA 2VIVA 1MKXH 2WV5A 5KECA 5C67A 2FOEA 1BMFD 1LDTT 1IQNA 3TGIE 3O8RA 1YPEH 2J38A 3BTDE 3SGAE 2G00A 3TJVA 2L6OA 1VJAU 1TFXA 3P95A 3ZVAA 4ZKOU 3CS7A 3VEQB 4GLYA 4U30A 1W2KH 3LGVA 1Z8RA 5A8XA 4ACAA 4GUXA 1GI9B 4MNXA 1UVPA 1QA0A 4NA9H 2Y80A 2Z3EA 4NFEA 5EGMA 5F03A 2F9VA 5B6OA 3KNXA 3VGCC 1GGDB 1QB1A 1QL8A 4O9VA 2Z94A 2AYWA 1O3PB 1OP8A 1DSTA 1GMDG 2FXRA 2IPHA 5BPEA 8LPRA 3CENA 1WYKA 2QF0A 1MZDA 2Y7ZA 3TK5A 1HJAC 3OTJE 4ABBA 5T6DA 1O3MA 2QCYA 3HK3B 1ELVA 3D23A 3FAOA 3LH1A 2ZPRA 1O5DH 3M7QA 3DD2H 1E37B 1GVZA 2KFWA 2QY0B 1TLDA 3OY6U 5EODA 1FUJA 1O3EA 1QJ7B 2Z9IA 1AD8H 3MMGA 4XE4A 1QHRB 1YLNA 2ZIQH 5EJZA 1Y5BT 1TBZH 4ZROA 1F0RA 3SUGA 2W6ID 1BRAA 4NIXA 1ANDA 2SGDE 1K1LA 5J4SA 4YOGA 1C5NH 3U8OH 1L4DA 2ZDAH 1A3EH 2PUQH 2XC0A 1DWCH 5JBCS 5EU8A 1BB0B 3C27B 3P17H 1MTWA 4KTSA 1A1RA 1FAKH 2V6NA 1LO6A 4NZQA 1OPHB 2XNIA 2FOHA 3SOSA 2FP7B 2C93B 3UAIC 2P93A 1J15A 4JZDH 4F48B 5EXMA 2ULLA 3SORA 1GI3A 2KCPA 1MU8B 1KXFA 5HM9A 3G01A 3ZZDA 4AG1A 2UWOA 2OBQA 4GHTA 1HAGE 1JXPA 1CVWH 2OC0A 4OS1A 2JKHA 1CSOE 4QT8C 2STBE 1MZAA 4GVUA 1S5SA 4R0IA 1ELBA 1OWDA 1AVGH 1P09A 3IG6B 1NRNH 1ZSJA 1CGJE 1G3CA 1MAYA 2XC4A 1DLKB 1RTKA 4MVNA 4O3TA 5ETXA 3UY9A 2ZDMA 5C17A 2XCFA 1GBFA 1EP5A 1O5GH 2G52A 3GYMA 5EW2H 3N7DA 1AFQB 1GBJA 2BDBA 2O8MA 1UVUH 2B5TB 1OWHA 4ZKRU 1ELCA 4BAKB 2BZ6H 3T27A 1O2MA 1O35A 1NU7B 1CT0E 2PTNA 7LPRA 1HJ9A 1BTPA 4ISHH 1O3LA 4RKJB 1TNHA 1GCTC 3TNSA 3T62A 1LHEH 3RXAA 1C1UH 2AS9A 1UHBA 4WMEA 5AFYH 4JYVH 1DFPA 3W95A 1F0SA 1KDQA 1SGTA 1C2KA 1ETTH 1M9UA 1OX1A 1TNJA 2ZGJA 3GOVB 2BDHA 7KMEH 1O2OA 2D8WA 3BG4C 5CHAB 2BYAX 3SNDA 2XW9A 1ANCA 2JETB 3JZ1B 5FPYA 1CGHA 1XXDA 2GVFA 1GBTA 2BY8X 1GI4A 2ZCLP 2GZ8A 3ZZ8A 3OTPA 4Q63A 3UQVA 2ZDKA 1AUTC 2JH6D 2BLQA 1L2EA 1THPB 3A85A 5A0BA 1W11U 3M5MA 3H7TA 1TX8A 2Y82A 3M35A 1WUNH 1SKYE 1XKAC 4A5TS 1NRPH 2BD9A 4DT7B 1TMBH 1LKAA 4VGCC 4B2CA 1SGPE 1GHBF 2OD3B 4UFDH 1G3DA 2FI3E 3D49H 3B23B 1ZJDA 1W12U 3TJOA 2BY5X 3SU3A 4DJZB 1OYTH 1GBBA 2FI4E 1A0LA 1O5BB 1WOFA 3QTOH 4B1TA 5E0GA 2XBWA 3M3SA 3MHWU 5T6FA 1QTFA 5HIYA 1C2JA 1V2OT 1YPHE 1YCPM 4JZEH 3SI4H 2F9PA 2VVUA 2UUKB 1P57B 1BCUH 2A5AA 2GT7A 4JMYA 3BEFB 3ZYEA 3SV2H 1ZMJA 4JYTA 3SNAA 4ZCNA 1OWJA 3M5LA 4I7YH 1ZLRA 4MQAA 3FZZA 4JZ1A 2PV9B 4D7FA 1SFIA 2BVXH 1IQEA 4A1XA 2Z3DA 1NM6A 4ISIH 3ZVBA 2BXUH 3BN9A 1MQ5A 2W7SA 2ZFPH 1ZRBA 2PKSB 1HIAA 3BSQA 4LXBH 1A46H 2VH0A 2SGQE 2TIOA 4WH6A 1YBWA 4AG2A 3GY7A 3TU7H 3KF2A 3C1KA 2XXLA 2BVRH 2ZGHA 1IQFA 1WXRA 5TCAA 4UD9H 5C20A 1CHOG 1JOUB 1IQLA 1LKBA 1PYTC 1JRTA 4X2WA 2GJGA 5HM2A 4DY7B 1V2TT 5EW1H 5EJLA 2AIPA 1ZZZA 4Y6DA 5T6GA 4INHA 2GCHF 3FP7E 1FY5A 2AERH 1C5MD 3GY3A 1P2IA 2HALA 3KN2A 4FUCA 1S81A 5JYIA 2A4OA 3EYDA 1S6FA 4MPWA 2RDEA 1VITH 3M37A 2BY7X 2D26C 1C5UA 3BIVH 3M61U 1O38A 1C5QA 2YMSD 1ZGIA 3DFJA 1BBRH 1RXPA 3UR9A 4LZ4B 1LVMA 4KGAA 4YT6H 2BD4A 5HGGA 2ILNA 3A8BA 2AH4X 2JDID 4X8VH 4X8TH 4YXWD 2EQNA 5DK1A 4AORA 1C5OH 1V2WT 2BD8A 1WV7H 1J16A 2A4QA 2XWBI 4F49A 2OLGA 4FUFA 1C2DA 2ZDVH 1V2LT 5AVDA 7GCHF 3MU0A 2FO9A 1F7ZA 2ZHDA 2WSSD 5DN6D 1AY6H 1HXEH 1OSSA 1TPAE 3DFLA 3U1JB 2A4RA 1SMFE 2FYQA 4AB9A 4AYYB 1ZSKA 2TGTA 2ZGBH 1MH0A 2Y5HA 1QB9A 3TJNA 4NWLA 2P8OB 2GZ9A 3VB4A 1B5GH 4BAMB 2VJ1A 2OINA 1KIGH 1NZQH 5AF9H 1P10A 3ATIA 2CHAC 3SU5A 3ZZ9A 4YOJA 5FHTA 4Y7AA 4ABIA 2ZU5A 4E06H 1EJNA 3ZZAA 5T3HA 1DXPA 1KMHB 5JDUB 2XOKD 2O8WA 1ELTA 1O2QA 3QUMP 5FX5A 1P0SH 2FTLE 3UNSA 4KTUA 1GCDA 3KQ5A 5L30H 1TGBA 3S0NA 1G30B 1ANBA 1H9LB 2WV9A 3A8DA 1DT2A 3RDZA 4ASHA 3UWJH 2LPRA 4TPIZ 3OSYA 1MAXA 2SGAA 5HIZA 5GPIB 4CRGA 1K28D 1SLVB 1SLUB 3GCTG 4FOUC 2BM2A 4Q4LA 1O2JA 4XSKU 2XBYA 4TYDA 5FBEA 2ZWLH 4Q2KA 2Z9GA 1SGFG 2PR3A 2F83A 1P03A 4ZHMU 1UVSH 1D4PB 4RKOB 5GNDA 1BBRE 1QJ6B 3WY8A 3OEED 4GSOA 2VIWA 1GBIA 4K1EA 3SV8A 1O3DA 1VZQH 3PMJA 7ESTE 1GJ5H 1O2KA 5HXFA 3EAJA 2ZNKH 2P3FH 4FUEA 1O2RA 1AUJA 1DY9A 3MO9A 4KP0A 1W10U 1V2PT 3T2NA 2JJ1D 4MDSA 1KLTA 1HAPH 4OS5A 3GISB 4NG9H 3RXTA 2V3MA 4NSYA 2PKAA 4CREA 1C1VH 1XX9A 1T32A 1AGJA 1CHOF 2BHGA 3A7TA 1LTOA 3K6YA 3RLYH 3WW7A 5AFZH 4DCDA 1EB1H 2XRCA 3RC6A 2J95A 3LPRA 2J97A 2OCVB 2P16A 1O2IA 2QXJA 1G36A 2GT8A 3ZVDA 2QC2A 1IQJA 2LNCA 1DITH 3D65E 3ZVGA 3HK6B 2VGCB 3ZZ5A 2VWOA 1A61H 4TWYA 2RFKC 4NZLA 1CO7E 2ZA5A 1O3JA 3MWIU 1UCYE 2HGTH 1ESTA 4NFFA 1O33A 2BD5A 1CGIE 3VXEH 2C8WB 1UO6A 2M2AA 1E36B 2ASUB 3EA7A 3BTGE 1PPCE 2F9NA 3HPTB 4AFZA 1EAIA 3RUOA 2K0QA 1V2KT 3KYGA 3O8DA 1Y8TA 9ESTA 3MU4A 3RXMA 1A4WH 1H8IH 1PPEE 1C2FA 2Q1JA 5HMAA 3HKJB 1KLIH 6CHAB 3MH4A 5JPMH 2BLWA 1LHGH 3A88A 5DP4A 2J94A 4YLQH 2ZHWH 4JZFH 3URCA 1DSUA 4AYVB 4R8TB 5AHGH 4DURA 4WXVA 2AMPA 1O3AA 1QR3E 2FPZA 5EG4A 1MU6B 5C1YA 4FUJA 1KXCA 5EQSA 1BRBE 4A1TA 2Y81A 4X6NA 2PUXB 2XCNA 2QA9E 3S9CA 3MNBA 4Y71A 3M3VA 1MD8A 1JRSA 4CR9A 2YMSC 3U28C 1AMHA 2AMQA 1ESBA 2GCTC 2AGIX 3A7WA 4MPVA 2Q6FA 3OX7U 4X2VA 1HFDA 1YKTA 2HVYB 2IJOB 4ZAEA 1FV9A 3P8FA 4XDEA 3M5OA 4Y0YE 5ABWA 1MBMA 3RM2H 1ZPZA 1T8MA 2SGPE 4BNRA 2AEIH 2FS9A 1GG6C 2FYRA 1SGYE 4MPXA 4Y11E 2EC9H 1P2OA 3H7OA 5HKKD 1EZUC 3BV9B 1O3GA 3SU6A 2KR7A 1ACBE 1AZZA 2AHME 1YY3A 3SZNA 2Y5GA 4CH2B 5DP6A 2QF3A 1YM0A 5EJ1A 4UFEH 5LPFA 3A86A 3HGPA 1PPFE 2XC5A 1O2XA 1HAHH 1JBUH 4IC5A 4D9QA 5E2PA 3RMMH 2BOKA 3ITIA 1ID5H 2ZZUH 4IW4E 1PPHE 2V3OH 2Z6BD 1NRRH 2Z3CA 1O2SA 1IHTH 1S82A 2NWNA 2YNAA 2EI8A 3TVJB 2VWMA 1FY8E 5C3NA 1ABJH 1H9HE 1SL3A 1IQGA 1NO9H 4X6PA 3LJOA 2P3UB 1XVMA 1AKSB 1GJ8B 1IQIA 2FESH 4OS2A 5GDSH 2G4TA 2VH6A 1K1MA 1QBVH 3DSPA 2G55A 3PB1E 1DS2E 2BD3A 2VINA 3H09A 2DUCA 1W13U 5K7RA 1K1NA 5E0JA 3CNRA 1DDJA 1BT7A 2A1DB 2FEQH 5C94A 1RRKA 3SV6A 1C1NA 3LGIA 3MI4A 1V2RT 4YESB 4WF8A 2GKVE 2JH0D 1ZMNA 3GY5A 2ZQ1A 1K1OA 4FVDA 4NGAH 1Z6JH 2GMTB 4U32A 4VGCB 4K2YA 1QBOA 5A2MH 1TIOA 5DG6A 4X1QU 1K1PA 4J2YB 5DP7A 4F55A 4DGJA 1GJ9B 3M5NA 4X8SH 3KQBA 3A7VA 1P2NA 3HKIB 1VCQA 1TMTH 1HAXB 4ABAA 1GL1A 2P59A 2JJ2D 1F5KU 3ZZ6A 2CXVA 1XUGA 3UOPA 3PMBB 2Q6DA 1T8NA 1TGTA 1L0ZA 1D3PB 2RA3A 4BAOB 1DWBH 1GL0E 4NA7A 4INKA 3RP2A 3UFAA 2BDAA 1SBWA 1VJ9U 3PM3A 2ZFTA 1HCGA 1UW7A 2WPMS 2AGGX 3MU1A 4LZ1H 1BITA 2ZC9H 4AFQA 1GCTB 3FANA 1PQAA 1A5HA 3A7XA 3OU0A 3PLKA 2R2MB 5F8XA 1RTLA 2ZTXA 1P06A 1O2LA 3MU8A 4I8JA 4HI3A 1GI6A 4UE7H 2WPJS 3VB6A 2CK3D 4P00A 1P3CA 3F9GA 3AK5A 2ALVA 1BRUP 4B73A 3BTKE 5IYTA 3TH4H 1T8OA 1QFKH 1LMWB 3JZ2B 1FQ3A 1O2NA 3GCHC 5E2OA 2Y5FA 3NK8A 4X2XA 5BRRE 1JIMA 2ZPSA 4P02A 4K69A 3VB3A 2PKSC 1S0QA 5FAHA 5L2YH 1PYTD 1PQ5A 1EJMA 1S6LA 4JYUH 2PGQB 2EI7A 1L4ZA 2V7QD 2QN5T 3QDZB 4BXWA 1Y59T 3P8GA 1MTSA 1GMDF 1AU8A 3ODDA 4AZ2B 2VIPA 3TH2H 1YPJH 3S69A 1UCYK 1SHHB 4WMFA 4Y0ZE 1OP2A 3FZDA 1CE5A 2BDCA 2ZQ2A 2R3UA 6GCHG 2NU4E 1JMOH 2RG3A 1C2GA 1TX7A 5C0UA 4X8UH 5GIBA 1TNIA 1ZGVA 3UIRA 4K8YA 3FP6E 2EA3A 5FPSA 4CRDA 5DO4H 1P2QA 1P2JA 4FUIA 1RFNA 1TOMH 3Q77A 4E05H 4YLUA 5EXLA 2VIDA 3TLOA 4ABJA 1SQTA 2W26A 3LOXA 3D62A 1DICA 1F5RA 2ZDNA 1FAXA 3T29A 2FM2A 1W0YH 2A4GA 3UR6A 1SB1H 3SZEA 2GV6A 3GDVA 1J8AA 1KDQB 1TRMA 2RA0A 1SC8U 1SI5H 1SQOA 2ODYB 3FN8A 4NIYA 1RIWC 4MNWA 1UTLM 4MTBA 1B7XB 1YPGH 1GJCB 2TBSA 4FUHA 4XD7D 1AB9B 1Z8IB 3RU4E 1FPCH 3MU5A 2J98B 2J4IA 4XRNA 3O8CA 1G32B 1TPOA 1ZSLA 1BQYA 3RXIA 2JIZD 2PTCE 2O9QA 1DE7H 1J9CH 1OP0A 1G9IE 4AFSA 1GHYH 1VR1H 1B0EA 1A0JA 1ARBA 3VFEA 1PPGE 4RSPA 1E38B 1Q3XA 3URDA 2OBOA 1UK2A 4UDWH 1GBMA 2CV3A 2IJD1 4RT0A 3BG8A 3AAVA 1EZQA 4DG4A 2BXTH 1LPKB 2F9UA 1WDIA 2V35A 2PFEA 4AOQA 3FP8E 1ELAA 2R9PA 2FWWA 1FY4A 9LPRA 5L6NH 1K22H 2WHXA 3F9FA 4F4OC 3BTHE 3OFND 1YLDA 1W7XH 1BTXA 1VKYA 4CRBA 1HLTH 3WWBA 2OC1A 1GHXH 2KCAA 2P94A 3A82A 2G81E 1Q31A 2CJIA 4THNH 1FY3A 2B8OH 1V2QT 2C90B 3B9FH 1E34B 1EX3A 2JETC 2H1UA 2YNBA 1O3NA 1LVOA 1UCYH 4UFGH 3N7OA 1EPTC 1Y5UT 5G4BA 2IPQX 3BG4B 1SHYA 1AI8H 3LJJA 3GCTF 1QBNA 1H8ED 3MH7A 5C5NA 1XXFA 2YMSB 1C5PA 4ABDA 2VB0A 4IN2A 3RXJA 2ZG0H 4LOYH 5GXPA 4X1PU 1ELGA 1V2JT 1ZJKA 3UUZA 1OYQA 1P2MA 1GJ7B 1A7SA 4CBNA 2GV7A 2ZTZA 4WJG2 4AGJA 5A8YA 3SJ8A 2BQ7B 5DSFA 1C5ZB 2CGAA 1TE0A 3A84A 1FXYA 1S0RA 4JZIA 3RXSA 2ZGXH 1TQ7B 3TPIZ 2UWLA 3KYFA 3F3BA 2UWPA 3UOUA 2Y6TA 1ZHRA 3SO3A 1UTOA 2NU1E 2O8TA 3TGJE 1N1LA 2HNTE 1SGNE 5CDFE 1NN6A 4BOHA 1D6RA 2BOHB 4I33A 2BTCE 1KLJH 1O3HA 5EOKA 4DIIH 2A32A 1UTNA 5C0TA 3F1SB 3MH5A 3RXGA 2KZ4A 1LPZB 5FL7D 4XBDA 3AAUA 3KCGH 3P92A 4DT4A 5J4QA 1EATA 1AE8H 2ZU4A 2ZFFH 3LGUA 1OWEA 2H5CA 4JCNA 1MUEB 3ZVCA 3ATLA 3K2UA 1C5SA 1AWHB 3I29A 3UTUH 3QK1A 4NA8A 4BAHB 3QLPH 3AW0A 4GCHF 1UJ1A 4Z1MD 3A8AA 1DWDH 1V2VT 1QCPA 2R0LA 3TJUA 2TPIZ 3ENSB 2O8UA 5HYOA 2ZDLA 2RDLA 1C2EA 1HIAB 1MKWK 1GBEA 4ABGA 3LC3A 1CBWC 3MYWA 3VXFH 4BTTB 4K60A 4WH8A 1N6YA 4X1RU 2GCHG 2W3KA 3SJOA 1MCVA 1O3OA 2GGVB 1J14A 2ZCKP 4Q7YA 4TT3D 1QL7A 1P02A 1AE5A 1FJSA 1O39A 3QZRA 4J1YA 1O30A 3GY6A 1C1WH 2SNWA 1FIZA 1YPLH 2G5VA 2J98A 1GVKB 3RC5A 2HPQH 4ISNA 4OS4A 3E3TA 4O3UA 4A7IB 2B0FA 3VGCB 1C2HA 2UUYA 2VVVA 1TPPA 4UONA 1ARCA 1P05A 2R2WU 3NCLA 2ANKH 1O36A 2SFAA 2HRVA 4FU7A 3SU4A 4DOQA 1BZXE 1IQKA 1GJAB 3TNTA 2UUFB 3DUXH 3DSGA 2C8YB 4U2WA 4Y10E 1LPGB 1MKXK 1NFWA 2ZO3H 5E8EH 1EAWA 1C5WB 3R0FA 4H4FA 5KGOA 2BB4A 5CHBA 3QZQA 3E8LA 1W14U 4X1NU 2VWLA 1J17T 4AN7A 1TAWA 3MQKC 4KKDA 1RGQA 1LHFH 2GDEH 1Z6EA 1GMCF 1GJ4H 2FIRH 1Y3UA 2BX3A 1G2LA 1BIOA 5EPYA 1XUHA 1C5LH 1NY22 1Z71A 3RXOA 1O5FH 5CMXH 3QX5H 1O5CB 4Q80A 4K5ZA 5GCHG 1BBRK 2SGEE 1PPZA 1C4V2 1GJBB 3V3MA 3LC5A 3PV5A 2WZQA 1GI7B 3MOCA 2OK5A 3SU1A 2H9HA 1HUTH 4ZXYH 4NIVA 1E35B 5EQQA 4B2BA 5F8ZA 1TNKA 1BTUA 4H42U 4FVBA 1FY1A 4M7GA 1QQ4A 1ETRH 1BMAA 5DP9A 2G5NA 2OUAA 4FETA 1EZXC 1S83A 3V0XA 1C1PA 5A0CA 4GPGA 4H6SB 2QGRA 2A7CA 2B9LA 3KQDA 3PYHA 4DIHH 2GTBA 1XUKA 4Q7XA 2QYIA 4CHAB 4XOJA 1C4U2 3ZVEA 4YM9A 2ODPA 3RXRA 2Z9LA 1GBCA 4Y8YA 3EGKH 1GDUA 1IAUA 2WPIS 1BTYA 4CRAA 1AVXA 3QGJA 1Z1JA 5JB9S 1DXWA 1GBLA 1HAVB 1SGIB 3I77A 1Y5AT 1T4VH 2ZF0H 2A5KA 1GDQA 1DLEA 2K1QA 2Z7FE 4OGXA 4SGAE 3N7EA 2L74A 1O2TA 1TGCA 3SNCA 1YWUA 1QJ1B 5FXLA 5A0AE 4FU9A 1GMHF 1NT1A 2FOBA 1AFEH 2EI6A 1C5XB 3MNSA 2WPLS 4PROA 1RTFB 1C5RA 4I8KA 3U9AH 3LIWA 4YTAA 2QE7D 4Y7BA 5C2ZA 2NU3E 3N99A 3F2HA 2GDDA 2K8IA 2W7UA 1IHSH 4NWKA 3L6PA 4GAWA 1HAIH 1CA8B 1AIXH 1G2MA 2CMYA 4A92A 3V7TA 4CBOA 4I31A 2BLOA 1RD3B 2G4UA 1MMJN 3F68H 4FU8A 1C9TA 1TABE 1THSH 1SGRE 3U1IB 1V2NT 3A81A 1HJ8A 3E0PB 4ZKNU 4BANB 1L1JA 2ZP0H 1G3EA 2F4LA 2PKAB 1AWFH 1WAYB 2TGDA 1H9IE 1TNLA 1H1BA 5JB8S 2KM0A 1C5VA 1OS8A 1Z7KA 3KIDU 1GDNA 2OXSA 3DSOA 5FCKA 1NPMA 3FOAA 4ESTE 2HWLB 2I6QA 2IOTA 1P9UA 5CHAC 2H6MA 1HV7A 3VG8A 1TWXB 2WV4A 3UB0A 1A5IA 1HGTH 1AHTH 1GI2A 4OS7A 1EB2A 3GDSA 1GPZA 1FONA 1OKXA 1UTKA 4XBBA 1PPBH 3HATH 2OC7A 3BTFE 3RU4D 1K9OE 2QAAA 4ASUD 1RJXB 2ANMH 1K0HA 4Y79A 4WWYA 2LELA 1EPTB 5DGJA 2W6JD 1ZTLA 3STJA 1TONA 1ZPCA 1NRSH 1HAYB 1O2UA 2BQ6B 1P8VC 4Y8ZA 2VIOA 4D8NA 4B71A 3GCOA 1TMUH 1KSNA 5EPNA 5TCCA 2XWAA 3H5CB 2QV1A 3NUMA 1Z8GA 2WUCA 1GHWH 3MNCA 2ZGCA 1NFUA 1FN8A 8GCHF 3BIUH 3P70B 3T26A 2ZFRH 3E16B 4WVPE 2WYJA 3SN8A 3PLPA 1TBQH 2PW8H 3F9EA 3UNRA 1F0UA 1S85A 2F91A 1MABB 1O5EH 4ACBA 3BTQE 1TOCB 2VBCA 4SGBE 5DKMA 1DOJA 3QWCH 1FNIA 3M7UA 5PTPA 2DE9A 3I78A 2AIQA 1A2CH 4YO9A 1O5AB 2G51A 2NU0E 3RXQA 3OY5U 1D6WA 1MBQA 1P3EA 1Y3XA 3GYLB 4Q7ZA 3SI3H 3SYJA 2FZZA 1XMNB 1SGFA 2FX6A 1LVYA 5JBTA 1ELDE 1YP9A 3ATKA 3DCLA 1O31A 1TA6A 1HNEE 2OTVA 1NS3A 3EA9A 3EE7A 1F2SE 2WINI 6GCHF 4FUDA 2HPPH 2VWNA 5A8ZA 4TY7A 4DW2U 4Y8XA 1NU9A 3W94A 1GWAA 1ZHMA 4RT1A 1SSXA 1ZOMA 4KTCA 1EAXA 2ZFSA 5DP3A 3RC4A 3ATWA 1WSSH 2BY6X 3M3TA 5H4IB 4D9RA 1EKBB 2AMDA 1W8BH 2HLDD 5FCRA 1LQEA 2GZ7A 3PV2A 4BTUB 3LGTA 4Y76A 4CH8B 1DANH 2SGFE 2WPKS 2QF5A 1ORFA 2O8LA 4RI0A 2J92A 1V2ST 2BQWB 2WYGA 2ESTE 1DUAA 3EQ0H 4IGDA 1OHHD 2J9NA 4B6FA 4X6OA 1E1QD 4MNVA 1LCYA 2OC8A 2ZECA 4AC9A 3RXDA 3PTNA 2P8OC 3SQEE 1C1OA 2A2QH 2GMTC 4YZUA 5I25A 4KELA 1KXEA 1IQHA 5B6LA 1EZSC 4XFQA 5IDKA 5FBIA 5LH8A 6LPRA 1P9SA 1H8HD 2PHBA 2FOFA 3DHKH 3RXUA 4NSVA 2EY4C 2KAIA 4FUBA 3ZV9A 2OQ5A 1V2MT 3U8RH 3SNBA 1B0FA 1E1RD 1C5TA 4HTCH 4CR5A 4ABHA 3T5FH 6ESTA 1BJVA 4E7RG 5T1VA 1HYLA 1Z8JB 2FODA 1DUEA 3ZYDA 2FI5E 1SQAA 1G3BA 3F2GA 1HRTH 1FIWA 3BTWE 2A2XH 1GVLA 1TX6A 2XYAA 3A7YA 2ZPQA 5JBAS 3MTYA 3SHAH 3A80A 1ZTJA 4Z0KA 1EXFA 3SUDA 4HGCA 3NPSA 1MTNB 4ZUHA 1YF4A 1COWD 2J2UA 2VNTA 3BEUA 3Q3KA 3FVFB 5E0HA 1TYNA 4MLFB 1Q2WA 2F43B 1OWIA 3NRLA 1C2LA 1NROH 1O2VA 1Y3VA 5DJ7A 3S7HB 2M5TA 1EASA 3DA9B 3GCHB 2GX4A 2OQUA 1BHXB 1GBDA 4I8GA 3SV9A 1FI8A 1O3BA 2WPHS 3SUFA 2QXIA 3SU0A 3NKKA 3L3TA 2ZU1A 2XBVA 1DX5M 1O2WA 4ZKSU 1S84A 1YCPH 1HAVA 1ZRKA 5SGAE 2H5DA 1O3IA 1T7CA 3E1XB 4K8BA 4ZH8A 5GCHF 1FLEE 1GMCG 3TITA 4AB8A 1EPTA 1A5GH 2FTMA 5TJXA 3RXKA 2BD7A 1O2ZA 1T8LA 1GHBG 1VGCC 2C8ZB 3ZV8A 3PMHB 3TGKE 1ZHPA 3U98H 1VGCB 1C5YB 2QF4A 3LKWA 3OAAD 1OOKB 2TGPZ 2XNDD 1K1JA 1O3FA 1W0ZU 1GI0A 2PLXA 5A09A 3RXBA 1ETSH 1E0FD 1ABIH 1ZPBA 1A3BH 3KEEA 1AN1E 2A5IA 3WWFA 2V0BA 5KEDA 3QN7A 3T28A 1MCTA 4MNYA 1WCZA 1BTHH 1MKWH 3V12A 3SW2B 1W7GH 5GJ4B 1FN6A 3EA8A 4ABFA 4B2AA 1INCA 1LHCH 1N6XA 2P3TB 1BTZA 2Z9JA 4ZMAH 1O3CA 3Q76A 1TRNA 2CF9H 4WMDA 3QO6A 3FFGA 1C1SA 1FMGA 3ZIAD 3BTTE 1TALA 1WTGH 1PFXC 2TGAA 1HBTH 4IBLH 1TGNA 4K1TA 3RMNH 3Q3YA 1WQVH 3BTEE 4UFFH 3TK6A 2HOBA 4FUGA 1T31A 3MO3A 2CF8H 1XVOA 2FOCA 2BDGA 1CHGA 4O03A 1GI8B 1OXGA 2FMJA 2H2ZA 3Q3XA 1C1TA 3RXLA 1NFYA 4RN6A 1IQMA 2D2DA 1YGCH 3RXHA 3ZVFA 1MTVA 4IMZA 3RXEA 1H8DH 2BDIA 2ZHFH 2BVSH 1AVWA 2Z9KA 1SG8B 1XUJA 1BJUA 2KCYA 1NC6A 3EDXB 3A83A 3VPKA 1KTTB 5F8TA 1EJAA 1L1GA 1V6DA 2DE8A 4GCHG 2FX4A 3LT3A 1DVAH 3F0PA 4OS6A 1HXFH 1KXBA 1TGSZ 2UUJB 1DPOA 3ZZBA 2BDYA 1K2I1 1W3CA 3A8CA 2GCTB 1GHZA 1D3QB 4YOIA 3KQEA 4WY3A 1W0KD 1QY6A 1THRH 2A7JA 1QB6A 1GMHG 1HAZB 5ESTE 1S6HA 3IWMA 2R3YA 1YCPK 2XBXA 1CA0B 1TPSA 2FOAA 3RMLH 1KY9A 1CU1A 1MQ6A 1NBMD 4X1SU 1MD7A 3PO1B 1CBWB 1Y3YA 3TH3H 1N8OC 3FO8D 2BMGB 3GY4A 1HAOH 3RXFA 6CHAC 3ZZ7A 1U6QA 2THFB 1VCWA 1ZYOA 3R3GB 3MO6A 1EP6A 4HZHA 2Q6GA 1HB0B 1QNJA 1PJPA 2ZFQH 1AQ7A 3PMAB 2ZI2H 2STAE 1GI1A 5F53A 1FZZA 2F9OA 3LGWA 3BTME 1EFRD 2A31A 3M36A 1D3TB 1CQQA 3GDUA 3SQHE 3LDXH 3PRDA 2J5UA 2KX4A 3A89A 1GG6B 1DWEH 2BZAA 2AGEX 2P95A 4ABEA 1C2MA 3F9HA 4BXSA 3AASA 2W5EA 3E6PH 2QXHA 1BHXF 2OP9A 5ESBA 1GJ6A 1HPGA 3KQCA 5FX6A 3M7TA 1GHAF 3ZZ4A 3SBKA 4HG6A 3SU2A 1RIWB 4TY6A 5C5OA 3VB5A 1O0DH 1V3XA 1TBRH 2A0QB 4X2YA 1ZMLA 8KME2 1KTSB 5C1XA 2VIQA 1YYY1 1BA8B 1YLCA 1MTNC 1IOEA 3Q00A 4HFPB 2EEKA 3UWIA 1O2GH 2JH5D 3MH6A 3QGNB 2CHAB 1VITG 1F5LA 1UTQA 2VVCA 1UHBB 3S9AA 5CE1A 4I8LA 1AKSA 3TIUA 1PQ7A 3E91A 3SV7A 8GCHG 4MPUA 3PRBA 3RLWH 1A0HB 1SOZA 1UVOA 1K21H 2Y7XA 4CRFA 1KXDA 3MNXA 3MFJA 3RMOH 4U01A 4K3JA 3E0NB
chains in the Genus database with same CATH topology
4IS5A 2ZHEH 3QTVH 1VITF 2J34A 1AO5A 1SFQB 2BLVA 1OWKA 2VU8E 1F0TA 3PO1C 4OGYA 3SJIA 1D9IA 3KHVA 3SJ9A 2D1JA 5F6MA 1O2YA 3GY8A 1UK3A 1CA0C 3A7ZA 3STIA 1DY8A 4I32A 4A6LA 1BOQA 2ZEBA 2ZCHP 4B75A 1KXAA 4X0WU 4YT7H 2NU2E 3CS0A 1EOLA 4INLA 1CT2E 2HNTC 1D3DB 1LVBA 1GGDC 1BMLA 2B7DH 1VCPA 2A7HA 2YOLA 2SNVA 1O34A 1G37A 2PSXA 1BMNH 3SUEA 1C9PA 1SGEE 1WTHD 3RU4T 2FOGA 3S9BA 4NCYA 3A87A 1ANEA 1YPKH 1LQDB 4JK5A 3V13A 1Y3WA 3S7KB 1LHDH 1HDTH 3ZZCA 4NIWA 2FLRH 4LK4A 4MG3A 3SHCH 4K1SA 2I6SA 4DVAU 2C8XB 3GICB 3LGYA 2BY9X 3BF6H 2RCEA 4ISLA 4TWWA 4ZHAA 7GCHG 2HVXA 5LPEA 4UEHH 2ANWA 3NXPA 1EUFA 1N8OB 1CT4E 1UVTH 2V3HH 2H9TH 3PWBA 1WU1A 1AB9C 3P8OA 2C4FH 2TRMA 3ZZ3A 4XBCA 3PROA 3UNQA 1C1RA 1P01A 4ISOA 2ZKSA 1SR5C 3NZIA 4O97A 3SNEA 4CHAC 2PWXA 4A1VA 1O3KA 1T4UH 4IN1A 3AW1A 4FXGH 1SGQE 2GD4B 4D7GA 2ODQA 3UPEA 1O32A 2IN2A 3DT0H 2ZU3A 1RS0A 5LPRA 1TB6H 2CN0H 1UTJA 3SGBE 1C4Y2 2C3SA 4D76A 3KGPA 3LU9B 1O2HA 2KAIB 5JBBS 2A45B 2FLBH 1BMMH 2GP9B 2QXGA 3SJKA 4B74A 1O37A 1V2UT 2BD2A 2G8TA 5GWZA 2HLCA 2XTTB 1Z1IA 3SGQE 4BTIB 3LH3A 1TNGA 1C2IA 3P8NA 4AFUA 1SPJA 1O2PA 1PQ8A 1K1IA 1TQ0B 3HGNA 1UMAH 2FDAA 5DPAA 4ZXXH 1YPHC 1GHAG 5DP5A 1JWTA 3E90B 1GBAA 5EQRA 2ZHQH 3RXPA 4BAQB 3RXVA 4B76A 1EAUA 3ESTA 2WUBA 5L2ZH 1FDPA 1QL9A 3AVZA 1YPMH 1UTMA 1QGFA 1X7AC 1AZ8A 1XUFA 2FOMB 1GBKA 3ODFA 4GHQA 3UQOA 1P2KA 1QA7A 3PV4A 2ANYA 3OYPA 1QIXB 1C1QA 1F92A 4Z6AH 3BEIB 3B8JA 8ESTE 3P6ZB 4E7NA 3F6UH 1TA2A 3GCNA 3RM0H 4ZHLU 1BTWA 1EOJA 1QRWA 4IMQA 1XM1A 4X6MA 3RXCA 2F9BH 1NFXA 3K6ZA 4CRCA 1SGCA 1ZR0A 1P04A 3L33A 1P12E 2ZU2A 1SGDE 4JK6A 3ELAH 3NWUA 3CP7A 1TRYA 1GJDB 2W3IA 2BX4A 1WBGB 4H6TA 1DM4B 1SOTA 1WQSA 2PSYA 2AFQB 1NRQH 1YC0A 5DP8A 1ESAA 1UK4A 1XKBC 1MTUA 3PTBA 1GHVH 4IC6A 5EXNA 2ZTYA 3IITA 1C1MA 3TK9A 1P11E 4TPYA 3PLBA 1GI5A 1JIRA 3LONA 1BUIA 1QURH 2VGCC 1XUIA 1QRXA 3ATMA 3K9XB 3UREA 1QQUA 3O8BA 2HNTF 1FPHH 1QRZA 1ELEE 3GY2A 2PGBB 1AFQC 2R0KA 3KL6A 1NESE 3EE0B 4AGKA 1BDAA 2FS8A 1GBHA 1SLXB 5I46H 1NTPA 3PWCA 2F3CE 3K65B 1SVPA 1H4WA 1KYNA 3U8TH 1EQ9A 2QIQA 5K0HA 5LGOA 1L1NA 2H9EH 1ZTKA 3VB7A 1UTPA 4I8HA 1HJAB 1BRCE 5FPTA 3U69H 1SLWB 2ALPA 3T25A 4AX9H 4WXIA 5C1UA 1ELFA 2VIVA 1MKXH 2WV5A 5C67A 2FOEA 1LDTT 1IQNA 3TGIE 3O8RA 1YPEH 2J38A 3BTDE 3SGAE 2G00A 3TJVA 1VJAU 1TFXA 3P95A 3ZVAA 4ZKOU 3CS7A 3VEQB 4GLYA 4U30A 1W2KH 3LGVA 1Z8RA 5A8XA 4GUXA 1GI9B 4MNXA 1UVPA 1QA0A 4NA9H 2Y80A 2Z3EA 4NFEA 5EGMA 5F03A 2F9VA 5B6OA 3KNXA 3VGCC 1GGDB 1QB1A 1QL8A 4O9VA 2Z94A 2AYWA 1O3PB 1OP8A 1DSTA 1GMDG 2FXRA 2IPHA 5BPEA 8LPRA 3CENA 1WYKA 2QF0A 1MZDA 2Y7ZA 3TK5A 1HJAC 3OTJE 4ABBA 5T6DA 1O3MA 2QCYA 3HK3B 1ELVA 3D23A 3FAOA 3LH1A 2ZPRA 1O5DH 3M7QA 3DD2H 1E37B 1GVZA 2QY0B 3OY6U 1TLDA 5EODA 1FUJA 1O3EA 1QJ7B 2Z9IA 1AD8H 3MMGA 4XE4A 1QHRB 2ZIQH 1Y5BT 1TBZH 4ZROA 1F0RA 3SUGA 1BRAA 4NIXA 1ANDA 2SGDE 1K1LA 5J4SA 4YOGA 1C5NH 3U8OH 1L4DA 2ZDAH 1A3EH 2PUQH 2XC0A 1DWCH 5JBCS 5EU8A 1BB0B 3C27B 3P17H 1MTWA 4KTSA 1A1RA 1FAKH 2V6NA 1LO6A 4NZQA 1OPHB 2XNIA 2FOHA 3SOSA 2FP7B 2C93B 2P93A 1J15A 4JZDH 5EXMA 2ULLA 3SORA 1GI3A 1MU8B 1KXFA 5HM9A 3G01A 3ZZDA 4AG1A 2UWOA 2OBQA 4GHTA 1HAGE 1JXPA 1CVWH 2OC0A 4OS1A 2JKHA 1CSOE 4QT8C 2STBE 1MZAA 4GVUA 1S5SA 4R0IA 1ELBA 1OWDA 1AVGH 1P09A 3IG6B 1NRNH 1ZSJA 1CGJE 1G3CA 2XC4A 1MAYA 1DLKB 1RTKA 4MVNA 4O3TA 5ETXA 3UY9A 2ZDMA 2XCFA 1GBFA 1EP5A 1O5GH 2G52A 3GYMA 5EW2H 1AFQB 1GBJA 2BDBA 2O8MA 1UVUH 2B5TB 1OWHA 4ZKRU 1ELCA 4BAKB 2BZ6H 3T27A 1O2MA 1O35A 1NU7B 1CT0E 2PTNA 7LPRA 1HJ9A 1BTPA 4ISHH 1O3LA 4RKJB 1TNHA 1GCTC 3TNSA 3T62A 1LHEH 3RXAA 1C1UH 2AS9A 1UHBA 4WMEA 5AFYH 4JYVH 1DFPA 3W95A 1F0SA 1KDQA 1SGTA 1C2KA 1ETTH 1M9UA 1OX1A 1TNJA 2ZGJA 3GOVB 2BDHA 7KMEH 1O2OA 2D8WA 3BG4C 5CHAB 2BYAX 3SNDA 2XW9A 1ANCA 2JETB 3JZ1B 5FPYA 1CGHA 1XXDA 2GVFA 1GBTA 2BY8X 1GI4A 2ZCLP 2GZ8A 3ZZ8A 3UQVA 2ZDKA 1AUTC 2JH6D 2BLQA 1L2EA 1THPB 3A85A 5A0BA 1W11U 3M5MA 3H7TA 1TX8A 2Y82A 3M35A 1WUNH 1XKAC 4A5TS 1NRPH 2BD9A 4DT7B 1TMBH 1LKAA 4VGCC 4B2CA 1SGPE 1GHBF 2OD3B 4UFDH 1G3DA 2FI3E 3D49H 3B23B 1ZJDA 1W12U 3TJOA 2BY5X 3SU3A 4DJZB 1OYTH 1GBBA 2FI4E 1A0LA 1O5BB 1WOFA 3QTOH 4B1TA 5E0GA 2XBWA 3M3SA 3MHWU 5T6FA 1QTFA 1C2JA 1V2OT 1YPHE 1YCPM 4JZEH 3SI4H 2F9PA 2VVUA 2UUKB 1P57B 1BCUH 2A5AA 2GT7A 4JMYA 3BEFB 3ZYEA 3SV2H 1ZMJA 4JYTA 3SNAA 1OWJA 3M5LA 4I7YH 1ZLRA 4MQAA 3FZZA 4JZ1A 2PV9B 4D7FA 1SFIA 2BVXH 1IQEA 4A1XA 2Z3DA 1NM6A 4ISIH 3ZVBA 2BXUH 3BN9A 1MQ5A 2W7SA 2ZFPH 1ZRBA 2PKSB 1HIAA 3BSQA 4LXBH 1A46H 2VH0A 2SGQE 2TIOA 4WH6A 1YBWA 4AG2A 3GY7A 3TU7H 3KF2A 3C1KA 2XXLA 2BVRH 2ZGHA 1IQFA 5TCAA 4UD9H 5C20A 1CHOG 1JOUB 1IQLA 1LKBA 1PYTC 1JRTA 4X2WA 4DY7B 5HM2A 1V2TT 5EW1H 2AIPA 1ZZZA 4Y6DA 5T6GA 4INHA 2GCHF 3FP7E 1FY5A 2AERH 1C5MD 3GY3A 1P2IA 2HALA 3KN2A 4FUCA 1S81A 5JYIA 2A4OA 3EYDA 1S6FA 4MPWA 1VITH 3M37A 2BY7X 2D26C 1C5UA 3BIVH 3M61U 1O38A 1C5QA 1ZGIA 3DFJA 1BBRH 1RXPA 3UR9A 4LZ4B 1LVMA 4KGAA 4YT6H 2BD4A 5HGGA 2ILNA 3A8BA 2AH4X 4X8VH 4X8TH 5DK1A 4AORA 1C5OH 1V2WT 2BD8A 1WV7H 1J16A 2A4QA 2XWBI 4F49A 2OLGA 4FUFA 1C2DA 2ZDVH 1V2LT 5AVDA 7GCHF 3MU0A 2FO9A 1F7ZA 2ZHDA 1AY6H 1HXEH 1OSSA 1TPAE 3DFLA 3U1JB 2A4RA 1SMFE 2FYQA 4AB9A 4AYYB 1ZSKA 2TGTA 2ZGBH 1MH0A 2Y5HA 1QB9A 3TJNA 4NWLA 2P8OB 2GZ9A 3VB4A 1B5GH 4BAMB 2VJ1A 2OINA 1KIGH 1NZQH 5AF9H 1P10A 3ATIA 2CHAC 3SU5A 3ZZ9A 4YOJA 5FHTA 4Y7AA 4ABIA 2ZU5A 4E06H 1EJNA 3ZZAA 5T3HA 1DXPA 5JDUB 2O8WA 1ELTA 1O2QA 3QUMP 5FX5A 1P0SH 2FTLE 3UNSA 4KTUA 1GCDA 5L30H 1TGBA 3S0NA 1G30B 1ANBA 1H9LB 3A8DA 3RDZA 1DT2A 4ASHA 3UWJH 2LPRA 4TPIZ 3OSYA 1MAXA 2SGAA 4CRGA 5GPIB 1K28D 1SLVB 1SLUB 3GCTG 2BM2A 1O2JA 4XSKU 2XBYA 4TYDA 5FBEA 2ZWLH 4Q2KA 2Z9GA 1SGFG 2PR3A 2F83A 1P03A 4ZHMU 1UVSH 1D4PB 4RKOB 1BBRE 1QJ6B 3WY8A 4GSOA 2VIWA 1GBIA 4K1EA 3SV8A 1O3DA 1VZQH 3PMJA 7ESTE 1GJ5H 1O2KA 5HXFA 3EAJA 2ZNKH 2P3FH 4FUEA 1O2RA 1AUJA 1DY9A 3MO9A 4KP0A 1W10U 1V2PT 3T2NA 4MDSA 1KLTA 1HAPH 4OS5A 3GISB 4NG9H 3RXTA 4NSYA 2PKAA 4CREA 1C1VH 1XX9A 1T32A 1AGJA 1CHOF 2BHGA 3A7TA 1LTOA 3K6YA 3RLYH 4DCDA 5AFZH 1EB1H 2XRCA 3RC6A 2J95A 3LPRA 2OCVB 2P16A 1O2IA 2QXJA 1G36A 2GT8A 3ZVDA 2QC2A 1IQJA 2LNCA 1DITH 3D65E 3ZVGA 3HK6B 2VGCB 3ZZ5A 2VWOA 1A61H 4TWYA 4NZLA 1CO7E 2ZA5A 1O3JA 3MWIU 1UCYE 2HGTH 1ESTA 4NFFA 1O33A 2BD5A 1CGIE 3VXEH 2C8WB 1UO6A 1E36B 2ASUB 3EA7A 3BTGE 1PPCE 2F9NA 3HPTB 4AFZA 1EAIA 3RUOA 1V2KT 3O8DA 1Y8TA 9ESTA 3MU4A 3RXMA 1A4WH 1H8IH 1PPEE 1C2FA 2Q1JA 5HMAA 3HKJB 1KLIH 6CHAB 3MH4A 5JPMH 2BLWA 1LHGH 3A88A 5DP4A 2J94A 4YLQH 2ZHWH 4JZFH 3URCA 1DSUA 4AYVB 4R8TB 5AHGH 4DURA 4WXVA 2AMPA 1O3AA 1QR3E 2FPZA 5EG4A 1MU6B 5C1YA 4FUJA 1KXCA 5EQSA 1BRBE 4A1TA 2Y81A 4X6NA 2PUXB 2XCNA 2QA9E 3S9CA 3MNBA 4Y71A 3M3VA 1MD8A 1JRSA 4CR9A 1AMHA 2AMQA 1ESBA 2GCTC 2AGIX 3A7WA 4MPVA 2Q6FA 3OX7U 4X2VA 1HFDA 1YKTA 2IJOB 4ZAEA 1FV9A 3P8FA 4XDEA 3M5OA 4Y0YE 5ABWA 1MBMA 3RM2H 1ZPZA 1T8MA 2SGPE 4BNRA 2AEIH 2FS9A 1GG6C 2FYRA 1SGYE 4MPXA 4Y11E 2EC9H 1P2OA 3H7OA 1EZUC 3BV9B 1O3GA 3SU6A 1ACBE 1AZZA 3SZNA 2Y5GA 4CH2B 5DP6A 2QF3A 1YM0A 4UFEH 5LPFA 3A86A 3HGPA 1PPFE 2XC5A 1O2XA 1HAHH 1JBUH 4IC5A 4D9QA 5E2PA 3RMMH 2BOKA 3ITIA 1ID5H 2ZZUH 4IW4E 1PPHE 2V3OH 2Z6BD 1NRRH 2Z3CA 1O2SA 1IHTH 1S82A 2NWNA 2YNAA 2EI8A 3TVJB 2VWMA 1FY8E 5C3NA 1ABJH 1H9HE 1SL3A 1IQGA 1NO9H 4X6PA 3LJOA 2P3UB 1XVMA 1AKSB 1GJ8B 1IQIA 2FESH 4OS2A 5GDSH 2G4TA 2VH6A 1K1MA 1QBVH 2G55A 3PB1E 1DS2E 2BD3A 2VINA 2DUCA 1W13U 5K7RA 1K1NA 5E0JA 1DDJA 1BT7A 2A1DB 2FEQH 1RRKA 3SV6A 1C1NA 3LGIA 3MI4A 1V2RT 4YESB 4WF8A 2GKVE 2JH0D 1ZMNA 3GY5A 2ZQ1A 1K1OA 4FVDA 4NGAH 1Z6JH 2GMTB 4U32A 4VGCB 4K2YA 1QBOA 5A2MH 1TIOA 5DG6A 4X1QU 1K1PA 4J2YB 5DP7A 4DGJA 1GJ9B 3M5NA 4X8SH 3KQBA 3A7VA 1P2NA 3HKIB 1VCQA 1TMTH 1HAXB 4ABAA 1GL1A 2P59A 3ZZ6A 1F5KU 2CXVA 1XUGA 3UOPA 3PMBB 2Q6DA 1T8NA 1TGTA 1L0ZA 1D3PB 2RA3A 4BAOB 1DWBH 1GL0E 4NA7A 4INKA 3RP2A 3UFAA 2BDAA 1SBWA 1VJ9U 3PM3A 2ZFTA 1HCGA 2WPMS 3MU1A 2AGGX 4LZ1H 1BITA 2ZC9H 4AFQA 1GCTB 3FANA 1PQAA 1A5HA 3A7XA 3OU0A 3PLKA 2R2MB 5F8XA 1RTLA 2ZTXA 1P06A 1O2LA 3MU8A 4I8JA 4HI3A 1GI6A 4UE7H 2WPJS 3VB6A 1P3CA