2G81E

Crystal structure of the bowman-birk inhibitor from vigna unguiculata seeds in complex with beta-trypsin at 1.55 angstrons resolution
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Crystal Structure of the Bowman-Birk Inhibitor from Vigna unguiculata Seeds in Complex with {beta}-Trypsin at 1.55 A Resolution and Its Structural Properties in Association with Proteinases
pubmed doi rcsb
total genus 51
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2006-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g81E01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2g81E02
1NRPH 1KTSB 2BD4A 1FDPA 1XX9A 3LGUA 2GV6A 3RXIA 1TYNA 4IMZA 3SJ9A 2OD3B 4YO9A 2TGAA 4DVAU 4F49A 1P2OA 4K2YA 2ZHEH 3RC4A 3A7TA 3F68H 1BTUA 1F0RA 2GDEH 2ZU4A 1O3PB 4JZIA 1E34B 1P02A 2J4IA 1QGFA 1ZR0A 1O39A 1DDJA 3GY2A 2BY9X 1GBJA 5FBEA 5L2ZH 1OWHA 1O35A 2OBQA 2GGVB 3WY8A 2PHBA 1O2IA 4NSVA 1EP6A 3TNTA 1BBRE 2OC8A 4ZKOU 2OQ5A 3OU0A 1P05A 3RXDA 1Q3XA 1WTGH 2AS9A 1H9IE 1NM6A 3VGCB 1Y5UT 1GCTB 1SGIB 1H9LB 1LVMA 1P3EA 5FPTA 3QN7A 1QNJA 4TPYA 2AYWA 3M7QA 5DG6A 1C2KA 5EQQA 1CVWH 2IN2A 1UCYK 2JKHA 1ELGA 2ZFRH 3ZZCA 2G52A 1IQEA 1FZZA 2O8LA 1AY6H 1SGTA 1ELAA 1A1RA 1Y3UA 1O2KA 2R2MB 1GL1A 2W3IA 3KQCA 1KDQB 4NA9H 1TRYA 1O2NA 1BBRH 1V2VT 1P04A 3HGNA 4ISNA 1E37B 4MPWA 1FJSA 2FOGA 1VITH 4O3TA 3BTFE 1ETTH 1AMHA 1BUIA 1RTLA 1GGDC 1VCWA 2A4GA 5JPMH 1GHBG 2QXJA 3ITIA 2NU2E 4JCNA 1HAHH 4MTBA 4R0IA 3KHVA 2Z9KA 5C20A 3TH3H 3EA9A 1QB1A 1VJAU 4NSYA 2Z9JA 1DPOA 1M9UA 2B5TB 3UPEA 1F5RA 3VEQB 4TWYA 2OC0A 2Y7XA 4HTCH 1FLEE 3LJOA 2VWNA 2ZCHP 1O2TA 3UUZA 3ZZ9A 4FVDA 1LVOA 3ODDA 2ZC9H 1DOJA 1GHWH 1BTZA 1ANBA 1CQQA 4X8TH 3SUDA 4K1EA 3BTME 3E0PB 4WXVA 1Y5AT 3IITA 3PMJA 4FUGA 1MQ5A 5HM9A 4KTUA 4BOHA 1IHTH 1DXWA 2P95A 1JWTA 1P57B 1K1OA 1K1IA 1S81A 2ZHFH 1UVPA 1DWCH 1C5PA 2Z9GA 1QBNA 2XC5A 4NFEA 3MO6A 1F0TA 4SGAE 5DP6A 3UOUA 1P9SA 1TMUH 2A5AA 1ABIH 1Z6EA 2OTVA 1GHBF 3V13A 4ZKSU 1YPMH 2EI8A 2J9NA 3A87A 1TMBH 1GJ4H 1JIMA 4KKDA 4ABJA 4A1XA 4I33A 5FX5A 3BTWE 1MZAA 3A8CA 1GGDB 2BDIA 1C5TA 1TX6A 1P0SH 4X6NA 1TBZH 1VZQH 4ZXXH 4B74A 3NWUA 1GI3A 3M7UA 4X2VA 3SHCH 1P3CA 2FIRH 1K28D 3TGJE 2CMYA 1DANH 4NG9H 4DIIH 1OWKA 2GZ9A 4QT8C 4X1SU 1B5GH 3M36A 1J8AA 2ILNA 1FIWA 3TJUA 4ABGA 4JK6A 1N6XA 4AFSA 4CRFA 3TU7H 1V2WT 3SN8A 4AYVB 3SU0A 1DVAH 3UNSA 2FWWA 1V6DA 4IGDA 5B6OA 1Z8IB 1TGNA 3A89A 4YM9A 1UTOA 4X8UH 1C2IA 2FOBA 3QWCH 2V6NA 5GPIB 1CSOE 1MTSA 1CE5A 1T8OA 2BDCA 5E2OA 1XUJA 3GY3A 3T27A 4Q7YA 2WYGA 1NFUA 1LPGB 1ZHRA 2PTNA 3GCOA 3SORA 3GYLB 1UTNA 1UTMA 1UCYE 2WPLS 1PQ8A 3MO9A 3W94A 2FODA 4U2WA 3BIUH 5HXFA 2BD8A 1NRNH 3DHKH 1WOFA 2FS9A 4Y0ZE 3KL6A 1MTWA 3E6PH 3BEUA 1AIXH 2FOCA 2O8WA 4IBLH 1DWBH 5TJXA 3M61U 1QB6A 4Y7BA 3DD2H 2F9OA 5EXMA 1N6YA 1MUEB 3A8AA 4GVUA 4MG3A 1HJ9A 1TBQH 1ZGVA 2UWPA 3AAUA 2BVRH 3TK9A 8LPRA 5I46H 3O8RA 4MDSA 1AGJA 2BTCE 2C8ZB 5LGOA 3GICB 2D26C 3EE0B 2B0FA 2VB0A 2FMJA 3PLBA 3RXJA 4YT7H 4ZMAH 3BTQE 2ZQ2A 1HCGA 1SI5H 3M37A 1EOLA 1BIOA 1UCYH 4WMEA 3FFGA 2ZU1A 4ZXYH 1C5MD 5JYIA 1ZSJA 2B8OH 1O5CB 1TWXB 3MU8A 1EQ9A 3TVJB 1H8IH 3UNRA 2VVVA 1QJ1B 1V2RT 4CHAC 1JRSA 4JZFH 1AU8A 2ZPQA 3ELAH 2Q6FA 1YPHC 2C8WB 3B8JA 4FUFA 2Y82A 4HI3A 1LKBA 3LGYA 1X7AC 3TIUA 2QF0A 7LPRA 3A7WA 1FMGA 1GBIA 1NRQH 2UUFB 1CHOG 3PO1C 1PFXC 3LGWA 2ZP0H 1GJ5H 1C5OH 3MOCA 1HIAA 2ESTE 1S6HA 2DE8A 5E0HA 2J94A 1SL3A 2ZGXH 3A83A 1BJUA 3BTKE 4YESB 2THFB 1YPGH 3MNBA 2ZHQH 2ZHDA 1K9OE 1T4UH 4SGBE 4ABDA 4ZH8A 1Z7KA 2OUAA 2WPKS 3ZV9A 2XWBI 2QXIA 4ISOA 1HXFH 1O2PA 1ARCA 1ZTKA 1O3OA 3D62A 3F1SB 4WH8A 2O8MA 2PR3A 1L0ZA 3UTUH 1K1JA 1G3EA 1QQ4A 1W0YH 1SC8U 1TGCA 3M5NA 1IQIA 2FM2A 3MH5A 1O5DH 3SV7A 2WINI 4ASHA 1LHEH 2XTTB 4WMDA 4BAOB 2ZI2H 1O2OA 4AN7A 1DLEA 3OSYA 4NZQA 1ETSH 3LH3A 2RA3A 1GJ6A 1D6WA 4B75A 3HPTB 1Y5BT 4AYYB 3S9AA 1HB0B 3BSQA 5LPRA 2VINA 1GBAA 1KDQA 1F0SA 2G4TA 1BTHH 1MU6B 1OPHB 2JETC 3AAVA 1BTXA 4TPIZ 4CHAB 2A5IA 3MH4A 5E0GA 3SU3A 1QRZA 1O3MA 3MH6A 1BB0B 1O3GA 2GV7A 1AVGH 2VIOA 1O3BA 1SGRE 2LNCA 1CHOF 1GBFA 1MKXK 4KTCA 2V3OH 1BCUH 1K1NA 3QLPH 5DK1A 1KLTA 1RXPA 1C1PA 1TQ0B 1Z71A 2FO9A 4CBNA 2VIVA 2AERH 1DX5M 4K3JA 4A1TA 3LGIA 3PO1B 1P12E 3S9CA 3SI4H 1HFDA 1P2QA 4INKA 4DY7B 2AMPA 1G2LA 1AFQB 2BD5A 1XVMA 3F9HA 1YLDA 1VITF 1NRRH 2BY5X 4U32A 1GMDG 4Y79A 5GIBA 3MNXA 1GJ9B 2FX4A 1NC6A 1QRXA 5FXLA 3QDZB 5LPEA 3KIDU 1SHHB 1CGIE 3AW0A 2UWLA 1ZGIA 4K8BA 1S0QA 3SU4A 1C5XB 3R3GB 4DGJA 4NZLA 4A5TS 1EXFA 1SMFE 2FS8A 1D3DB 3NXPA 2P3UB 1C1NA 2ZPSA 1MD8A 1V2LT 4BNRA 4D7GA 3FZZA 1DWDH 1PPBH 1S0RA 1TNKA 2BY6X 5JB9S 3UWIA 1EZXC 1T8NA 4IC6A 1XMNB 4CBOA 2XYAA 1ID5H 1NS3A 1UK3A 3STIA 1GHXH 1F5LA 1HV7A 3DFLA 3BTGE 1B7XB 1CGHA 4H6SB 3V7TA 1GI5A 3PMAB 1NZQH 1DITH 4FUCA 5CE1A 1TOCB 6CHAC 5IDKA 1IQLA 5A0CA 2C4FH 3GCTG 1P9UA 1LHGH 1A5GH 1Y3VA 1C2LA 1V2ST 1W14U 4UFGH 2P8OC 2FXRA 5J4QA 2FEQH 2F9NA 1GMDF 2Z6BD 3UOPA 3M5OA 4Y8XA 1EZQA 2FLRH 2FYRA 1C2HA 1V2KT 3ZVBA 3Q3YA 4OS7A 3SGAE 3L33A 1IQKA 2F91A 2QN5T 1BMLA 2FOEA 1MTVA 1GHAF 3SI3H 2TGTA 4O97A 3JZ2B 1XM1A 1GVZA 1MBMA 1YGCH 1GJCB 3D65E 1OP0A 5JDUB 3ATLA 2ZFTA 4AOQA 1FN6A 4DCDA 4GAWA 4HZHA 4CRDA 3MO3A 3T28A 1DT2A 2PSXA 1V2UT 1C5QA 1MTUA 3NPSA 4FUBA 2SGAA 5T6GA 5F8ZA 1W13U 1SGYE 1SHYA 3BTHE 3MI4A 5I25A 1OP8A 4WMFA 3A8BA 3MFJA 4YLUA 3RXLA 1BJVA 1J15A 2NU4E 4OGYA 3GCTF 1O3NA 2H9EH 2ZDMA 2FI5E 4Q2KA 1D3QB 2QAAA 4UFDH 3RXAA 1L1GA 4GHTA 4UFFH 3GISB 3MMGA 4GHQA 3RM0H 1GMHF 1GG6B 1ZMJA 3PTNA 4KP0A 6CHAB 1ZRKA 2BZ6H 1HYLA 1ZPZA 1XKAC 1AO5A 2WPJS 5C3NA 4IN2A 1EZSC 4NWKA 4I8GA 2GMTC 1OXGA 2A31A 1OSSA 2P8OB 4NCYA 2BVXH 4ZAEA 4CRGA 3ZVAA 1QL9A 2H5CA 3MHWU 1HAZB 1ZRBA 1J9CH 1ZPBA 2VIPA 3PYHA 1C5LH 1G3BA 2FI4E 8GCHG 1L1NA 2ZDNA 1DY8A 1QY6A 3A7VA 3A86A 3RXRA 1ZMNA 1KTTB 2W3KA 4D76A 3L3TA 3K6YA 4OS1A 3UR6A 3VFEA 5J4SA 1D3PB 2ODYB 1TFXA 4XBBA 1AVWA 3NCLA 4K69A 1FAKH 2SNWA 4XSKU 2A2QH 1MCTA 1DXPA 1OWDA 4B76A 3F9GA 3ZZAA 1HAPH 1UO6A 1P01A 2BM2A 3BEIB 1O2XA 3C27B 3SUGA 3DUXH 1WAYB 2Q1JA 3BTEE 1G32B 1PYTD 5DPAA 3T62A 1C5RA 2BXTH 2F9VA 1ZYOA 1EPTC 1VR1H 1TPOA 4K5ZA 3E1XB 2VWMA 1P2IA 5DP5A 3ATKA 1GI8B 1TPAE 3SNBA 3CENA 3SBKA 4B2BA 1S85A 1J14A 1C5NH 1S82A 3SU5A 2BMGB 1EAWA 5DKMA 4AORA 2B7DH 1HIAB 2TRMA 2A5KA 3U8TH 4IW4E 7GCHG 2SGPE 3OTJE 3VB7A 1AB9B 1S84A 4THNH 4YLQH 8GCHF 2D8WA 2C3SA 2GMTB 1O3EA 2AMQA 4NFFA 1EB1H 1LHFH 3T26A 1RD3B 4JZ1A 3UQOA 3ZYEA 1NFXA 1SGQE 1YP9A 5FAHA 1XXDA 2ZKSA 2ZO3H 1BRUP 4XE4A 1SGEE 1EAUA 1FPCH 1RIWC 1V2QT 4AFZA 4MNVA 1NRSH 3B9FH 3QGNB 1HJAC 3P17H 4FU8A 2G5NA 2W5EA 1TNIA 1VCQA 1ZJDA 4H4FA 2A2XH 3H5CB 5C5OA 1O2QA 4ESTE 4BAMB 1TGBA 1XUKA 1ESTA 3RXMA 1CHGA 5DP3A 1F0UA 1AN1E 2D2DA 4M7GA 1YBWA 2ZNKH 3DA9B 2BZAA 3RXKA 1WQVH 1P2JA 2Q6GA 3Q3XA 3KEEA 2UUJB 1ELDE 1F92A 1GI6A 1ZTLA 2IJOB 1C2MA 1O30A 4ABIA 1VGCC 5FCRA 1JMOH 2GCTC 1EPTB 5PTPA 3SJOA 2BY7X 2EA3A 1FUJA 2P16A 1K22H 1H1BA 3PV4A 2ZCKP 1BHXF 1EAIA 2Z94A 1FY8E 1AWFH 1MD7A 3HKJB 4AX9H 3UQVA 2BXUH 2HVXA 2FYQA 5JBCS 1BOQA 2WUCA 5A8YA 2PW8H 3Q3KA 4O03A 1UK4A 4I8LA 1O36A 1UVUH 4UFEH 4X6MA 2G55A 5L30H 1TAWA 4NA7A 3SHAH 4E05H 2J34A 1A7SA 1RTKA 4X1RU 3RLWH 3RXEA 4ABHA 2FTMA 1F7ZA 1GHVH 3B23B 3P8FA 3PM3A 1SFQB 3TK5A 1W7GH 1O38A 2BD3A 2OINA 2FP7B 3LPRA 1GBEA 2ZGBH 2HOBA 2GVFA 1HJAB 2Y80A 2BHGA 4MNWA 4I8HA 3H7TA 1SGCA 2A7HA 1KXAA 1C1QA 4D8NA 4Y8YA 1GVLA 2CN0H 2P59A 2BLVA 3RXVA 2C90B 1FN8A 2BX3A 1GI9B 3ENSB 3TH2H 1MKWK 2I6SA 1SG8B 1O5AB 2KAIB 1B0FA 3GY4A 2J92A 3W95A 1BTWA 1C2JA 1NY22 3LC3A 4I8JA 3BIVH 2A1DB 1KXBA 2GZ8A 4Y7AA 1QJ6B 3A7XA 3SQHE 3MWIU 2G00A 5HGGA 1AE5A 5AFZH 3A85A 1C2EA 2UWOA 8ESTE 2AFQB 1P2KA 2JH5D 1VGCB 3GY5A 2P94A 2VNTA 1W12U 2GCTB 2R0LA 5K7RA 3ZV8A 3D49H 4Q80A 3LKWA 4TY6A 5DP9A 2ZDVH 3F9EA 1G37A 1O2JA 1S6FA 1QA7A 2HNTE 2W7UA 4X2XA 1C4V2 1V2PT 1LQEA 3ZVEA 1BMAA 3VPKA 3E90B 3ESTA 2F83A 3FP7E 1SLXB 1HJ8A 3QO6A 5EQSA 2A7CA 1FY1A 5K0HA 3A8DA 4A6LA 2AGGX 2VWOA 1UTPA 2UUKB 1TLDA 1Z6JH 2HRVA 2ZG0H 5LPFA 4YZUA 4Y6DA 1D4PB 1T7CA 4Y0YE 5GJ4B 2ODQA 2A4OA 1MMJN 2HPPH 3HK6B 2ZGHA 3RDZA 2FI3E 3TJOA 4MQAA 3UREA 1GMCG 3TJVA 3EAJA 5BRRE 8KME2 3SNEA 3OYPA 1T8MA 4DW2U 5LH8A 1EJMA 1C2DA 4BAQB 4O9VA 2SGFE 3P8OA 1QRWA 5GCHG 3TITA 1O2HA 4AGJA 4CRCA 1GHYH 2ASUB 2ZFQH 2WPMS 4IS5A 3PROA 1D6RA 1GI7B 5EPNA 5EW1H 1OWIA 1XXFA 2GT8A 3QTOH 2DE9A 1DFPA 1D9IA 1AUJA 4DJZB 1EJNA 1ELCA 4OS6A 1UJ1A 3T2NA 1PPHE 4R8TB 1IHSH 1LDTT 2ZA5A 1IOEA 1ESAA 1O5EH 5A8XA 2ANKH 2ZTYA 1HGTH 1KXEA 1DS2E 2GD4B 2O8TA 1TX7A 3UIRA 1YCPM 2F9PA 3ZZ4A 1KXDA 4INLA 3RC6A 3SOSA 3SO3A 2A45B 1AKSB 1WCZA 1YYY1 4FUIA 2C93B 1EOJA 4ABBA 2VVUA 1ZZZA 1GMCF 3ZZ6A 1OOKB 5EXLA 2OC7A 1O5BB 1CA8B 1S83A 2CF8H 1EASA 1P2NA 4CR5A 3ZZ7A 5L6NH 1O2GH 1LHDH 1UTLM 2Y6TA 2HWLB 2BVSH 1C9PA 1LO6A 1K1PA 3HKIB 1C4U2 4X2WA 1T8LA 4JYTA 5SGAE 3TLOA 1A61H 1DUAA 2VU8E 2ZTZA 1ANDA 1ELFA 2Z7FE 5ESBA 5GCHF 1NROH 1W10U 2FOHA 2BQWB 5DP7A 1A3BH 1G9IE 1V2MT 3NUMA 1MTNC 3AASA 1A0HB 4MPUA 3DT0H 6LPRA 1GBBA 2CHAC 5CMXH 2SGDE 4GLYA 1SFIA 1YCPK 3TK6A 2J38A 2A32A 1C1UH 2V3HH 3PWBA 1GCDA 5F03A 3RM2H 1C4Y2 1QHRB 3E0NB 3GYMA 4Y76A 1KY9A 2PGBB 2BDBA 3SJKA 2HNTC 3TNSA 1H8DH 4WWYA 5DP8A 1TNHA 5EW2H 3Q00A 3BTTE 2ZF0H 1SSXA 2ZWLH 3TH4H 1LPZB 3ZZDA 1W3CA 1K21H 3M3TA 4Y11E 1K2I1 1PPCE 2VH0A 3JZ1B 1E35B 1FY3A 2P3FH 5C1YA 1RTFB 3Q77A 1GJ8B 4XFQA 1JBUH 1MKWH 1LCYA 1UHBB 1ELTA 3V0XA 1IQHA 1O3IA 5DO4H 3RMMH 1EZUC 5TCAA 2Y7ZA 1PQ5A 3RXSA 4JYVH 4ISIH 1EB2A 3SZNA 4Q7XA 2CXVA 3G01A 3RXFA 3SNAA 1NU7B 4DURA 3DFJA 3VB4A 3NKKA 3V12A 1EPTA 1IQJA 1SQTA 2VH6A 3MNCA 1SLVB 2FOFA 2SGQE 1C5WB 3S9BA 3ZZ3A 1O33A 3UY9A 1HRTH 1UTQA 5C67A 1U6QA 1GBLA 4XBDA 1WQSA 3KGPA 3SV6A 3R0FA 1SLUB 4WH6A 1A46H 2PFEA 1SGPE 1W11U 1ZSKA 2Y5HA 4CRBA 1IQMA 1TX8A 4FUEA 4YOIA 1TIOA 1DICA 4X8VH 1P09A 4MVNA 3KN2A 5AHGH 1C5ZB 2A4RA 5EXNA 1HPGA 2R3UA 1XUGA 2QA9E 4FUJA 1V2TT 4MNXA 2H9TH 2R3YA 4FU7A 1L1JA 4Z0KA 3SGBE 1NO9H 1QURH 1VCPA 5EOKA 3I78A 4BAKB 2F3CE 2FESH 1QQUA 1P03A 2BOHB 1AZZA 2KAIA 5DJ7A 4NIYA 4AG2A 1DY9A 1H9HE 5GDSH 2OBOA 3A80A 4ZROA 1GDQA 2JETB 4XBCA 5AVDA 2Z9IA 3ATWA 2AH4X 3NZIA 1RJXB 4NIWA 1TRNA 1E0FD 4AB8A 1GL0E 3QZRA 4WVPE 4B2AA 3ZZ5A 3T29A 3K2UA 4CH8B 1LTOA 2PTCE 3E16B 2H6MA 2ZECA 1B0EA 1FIZA 1PPFE 3SJ8A 1AI8H 3FZDA 5A8ZA 4CREA 3A7YA 2F9BH 2XXLA 2GTBA 3FAOA 3GCHC 4D7FA 3N7OA 1HAOH 4CH2B 2QC2A 2ZPRA 3K65B 4NWLA 3RU4D 2FOAA 1UVTH 1GJAB 4CRAA 1BBRK 2W7SA 1SBWA 1TONA 3M7TA 2HALA 3LH1A 4NIVA 2PV9B 1AZ8A 1GVKB 1FQ3A 2ZZUH 1DSTA 2XC4A 4NA8A 1BRCE 2H9HA 4NGAH 1PJPA 3I77A 4UD9H 2G81E 3GDVA 1SVPA 1FY5A 2VVCA 1LMWB 5C2ZA 2GT7A 3MU5A 3RXCA 4H42U 4ZUHA 1DWEH 3URCA 1C5SA 1THPB 3PLKA 2BDGA 2OP9A 1BRAA 2Z9LA 1GI0A 2GX4A 2STAE 2ZEBA 4I31A 1VJ9U 1PYTC 1WYKA 4ZKNU 2XRCA 1J17T 2A4QA 3QUMP 3PMHB 3LC5A 2ANYA 1HUTH 2SGEE 1TABE 2BQ7B 5EPYA 1LVBA 2Z3DA 3LOXA 3LONA 2JH6D 1GBDA 2ZQ1A 1WTHD 2G8TA 4BTUB 3ATIA 1A0LA 6GCHG 3CP7A 1C1OA 1TNLA 2VWLA 5G4BA 1AVXA 1TRMA 5DGJA 1CGJE 4I7YH 4RN6A 3A88A 3C1KA 3MH7A 3NK8A 2BX4A 2ZFPH 1C2FA 2I6QA 3VB5A 3RXQA 4BAHB 1UK2A 2VGCC 1BHXB 2Y5GA 3KQEA 3OY5U 1OX1A 4OS2A 2O8UA 3Q76A 1ELVA 1RGQA 2HNTF 5C1UA 3P92A 1C5YB 4ZKRU 4LK4A 1AKSA 1O2WA 2ZTXA 2BYAX 4INHA 3QX5H 4J1YA 4VGCC 2OCVB 3F9FA 1ESBA 4GCHG 4GUXA 7KMEH 2ZU3A 1YPKH 1QCPA 1OP2A 4B73A 1BMNH 4Z6AH 1A0JA 2TBSA 3GDSA 1UTJA 1MKXH 5JBTA 1V2OT 1O2YA 1A3EH 3RXGA 2EC9H 2ULLA 2PUQH 1GJBB 1O5FH 1XUIA 1BQYA 1G36A 2BDHA 2QY0B 1C9TA 1AD8H 4K1TA 3CS7A 5FCKA 3PMBB 2OC1A 3RC5A 2ZDAH 5FHTA 1C1TA 2G51A 1P10A 1WBGB 1Y3XA 3KNXA 3RXOA 1QTFA 2WUBA 2FX6A 4ZHAA 2EI6A 3AVZA 3EQ0H 4RKJB 4LZ4B 1OWJA 1FV9A 5FPYA 2QXHA 3FANA 1CT4E 2QF3A 4ABAA 4B1TA 3QTVH 1AWHB 1H4WA 1HDTH 2YNAA 1W7XH 1UMAH 2HLCA 1DM4B 4LXBH 2VGCB 1S5SA 3LIWA 4GCHF 1MBQA 2STBE 4MNYA 1HAYB 1TPSA 1ACBE 2ODPA 1BTPA 3M35A 3M3SA 2RDLA 4ISHH 1AFEH 1A4WH 1O34A 2BQ6B 4JZEH 1UHBA 4I8KA 3KQBA 4VGCB 1GPZA 1AE8H 1YKTA 3ZYDA 3EGKH 5FPSA 1TNJA 2FZZA 2J2UA 1EUFA 2A0QB 3PB1E 1P11E 3LT3A 1LHCH 3TGKE 4E06H 1OKXA 4U30A 2LPRA 2PLXA 2QV1A 4X6OA 5JB8S 5EODA 2FTLE 1DLKB 1O3FA 1AQ7A 2XCNA 3VB3A 1K1MA 1GBMA 2H5DA 3RXTA 1BDAA 5EG4A 3A84A 4LOYH 1EP5A 3U98H 1ZSLA 3SU6A 2GCHG 5H4IB 2RA0A 1MAYA 1O0DH 4D9RA 1ETRH 1O3DA 1HAVB 7GCHF 1IQNA 5T6FA 3ZVFA 1YPEH 4DG4A 1WSSH 5ETXA 2ZFSA 5BPEA 1BRBE 1ZHPA 2OLGA 2CJIA 3VXFH 3MTYA 3RU4T 2GKVE 5F8TA 3SV2H 2ZCLP 3GY7A 1Q31A 3GOVB 1NN6A 3SNCA 2TGPZ 4ABEA 3A81A 1A2CH 1TA2A 2WPHS 1TGTA 1WV7H 2BLOA 4Y8ZA 1KXCA 3GCNA 1P8VC 2V35A 4YOJA 2BB4A 3O8BA 5T3HA 2A7JA 2UUYA 2GZ7A 3ZVCA 3KQDA 1RIWB 2GP9B 1LQDB 1W0ZU 3TJNA 4OS5A 1WU1A 2DUCA 4JYUH 3RLYH 2VIWA 4KELA 3K6ZA 1ZHMA 1ABJH 4X6PA 3RP2A 2B9LA 4WXIA 3MYWA 1ARBA 3SU1A 1C5VA 3RMLH 1LKAA 4IC5A 2GCHF 3RXBA 5EQRA 4GPGA 1TNGA 3VB6A 1YPHE 1TGSZ 2PGQB 3EA7A 4RSPA 4JZDH 2FOMB 1T4VH 3IG6B 2G5VA 4AG1A 4AB9A 1GBCA 3P8GA 1SGFG 4MLFB 4B2CA 1NU9A 4FVBA 2BDYA 5EGMA 3ZZBA 2XCFA 2G4UA 2XW9A 3RXUA 3QZQA 2PKAB 3U8OH 1YLCA 5AF9H 2V0BA 5F8XA 1QA0A 4NIXA 1Z8JB 4Y10E 1KYNA 3SJIA 2SNVA 3T5FH 1XUFA 2ZGCA 1ZMLA 5HM2A 1TALA 5C1XA 4J2YB 5FX6A 1CU1A 1NPMA 5JBBS 1GJDB 3D23A 3UNQA 1TB6H 3RXHA 1Y3WA 4ISLA 1Y8TA 2D1JA 4K8YA 5E2PA 1NFWA 1O37A 3RMOH 4MPVA 1G3CA 1KSNA 1N8OC 1AUTC 2ANMH 3UR9A 4O3UA 2F9UA 4RKOB 4JMYA 3RUOA 4AFQA 1JOUB 1O3KA 1GDNA 1BMMH 1RS0A 2O9QA 3RU4E 3EA8A 4BANB 2CF9H 1KXFA 1CA0C 1CT2E 1Z8RA 2AEIH 1GI2A 3LJJA 4E7NA 3AW1A 2EEKA 3FP6E 5F6MA 1EAXA 1YPJH 1PQ7A 3S7KB 1A5HA 4UEHH 1IAUA 5GXPA 1CBWC 4Y71A 3SV8A 5ABWA 1GHZA 1ZTJA 2YNBA 1KIGH 3U9AH 1TPPA 1ZOMA 5E8EH 1O2SA 4KGAA 1IQGA 3U1JB 3QGJA 1GWAA 1MH0A 2R9PA 1EX3A 1JRTA 1ELEE 1TMTH 2AGIX 2XBYA 3EYDA 3STJA 1BITA 1QR3E 2IPHA 1C2GA 4B71A 2P93A 3MNSA 1DE7H 3SNDA 4LZ1H 1P06A 3BTDE 4MPXA 2ZIQH 2QGRA 1FAXA 3SQEE 2VIDA 3TGIE 5CHAC 3KF2A 9ESTA 4AGKA 3TPIZ 3I29A 1E38B 1MU8B 3MU4A 1WUNH 3URDA 1QL7A 3SUFA 1UTKA 1C1MA 4FXGH 2ZDKA 1BTYA 1V3XA 3BG8A 1N8OB 1QL8A 1O3HA 2AIQA 2WV4A 1ZJKA 1XUHA 4IMQA 1QB9A 1HBTH 1W8BH 1OWEA 4OGXA 2XNIA 1Q2WA 1ZPCA 3SV9A 1ZLRA 1KLJH 1CA0B 4KTSA 2BD7A 1BA8B 3PWCA 3BN9A 5HYOA 1OS8A 2FDAA 1GJ7B 1GBTA 2H2ZA 3OX7U 3KCGH 2WYJA 4K1SA 1O2ZA 4WY3A 1AFQC 4X0WU 3LGTA 1DSUA 3T25A 1CBWB 3S0NA 2CGAA 1KLIH 1N1LA 4DOQA 3ATMA 2ZU2A 3H7OA 4BTTB 4HGCA 5L2YH 1PPGE 2P3TB 1VITG 5T6DA 1GI4A 3EDXB 3A7ZA 1FI8A 5AFYH 4ZHMU 5CHAB 2ALVA 3L6PA 1CT0E 4H6TA 4CR9A 1G3DA 1QBOA 4X8SH 1CO7E 2JH0D 1O32A 1INCA 2W26A 2YOLA 3VXEH 1SGFA 1C1SA 1HAVA 1JIRA 1MZDA 3U69H 2ZHWH 2R2WU 1HAGE 1HAIH 1QBVH 1W2KH 3HGPA 3K9XB 2RCEA 3SU2A 1Z1IA 1DUEA 1AHTH 1MTNB 2BD9A 2XWAA 3ODFA 1HXEH 1K1LA 3RXPA 2CHAB 2WV5A 2TIOA 1TE0A 2R0KA 4U01A 6ESTA 2QCYA 5EU8A 3OY6U 3E8LA 3FVFB 4XDEA 1BT7A 2RG3A 1HNEE 1MQ6A 1SGNE 2PKSC 3GY6A 1O3AA 3BEFB 1NESE 3HK3B 4HFPB 4BTIB 5A09A 3LU9B 1FONA 1O2MA 3P70B 1OYQA 3S7HB 4DT7B 1D3TB 3BG4C 2ANWA 2TPIZ 1ELBA 1MAXA 3A82A 4PROA 1PPEE 1C1RA 1O3JA 3BV9B 2Z3EA 3LDXH 3RMNH 1G30B 1THSH 4A7IB 4UDWH 1J16A 2XC0A 1SB1H 3O8CA 3S69A 4AFUA 5A2MH 1FPHH 1NTPA 2AMDA 4GSOA 3PLPA 3QK1A 4K60A 4I32A 5ESTE 2FPZA 5E0JA 1GHAG 2AIPA 1L4ZA 5TCCA 4F4OC 4YOGA 1SQAA 3ZVDA 1YPLH 3M5LA 1FXYA 2GDDA 2XBXA 3CS0A 1GBKA 3V3MA 1SGDE 2EI7A 4Q7ZA 3E3TA 1XVOA 3M3VA 2BOKA 1GDUA 1SOTA 2VIQA 2XBVA 2Y5FA 1Z1JA 2H1UA 2PKAA 3ZVGA 4YTAA 1RRKA 1YM0A 2Q6DA 2C8XB 1RFNA 2HPQH 5IYTA 1GBHA 1GG6C 2NWNA 1SQOA 1O2UA 1XKBC 2PUXB 2TGDA 2PSYA 3MU1A 5A0BA 1SPJA 3U1IB 2AGEX 1T32A 1BZXE 4DIHH 2ZU5A 2BD2A 2PKSB 4BXSA 1JXPA 1GMHG 1C5UA 2QXGA 5HMAA 3HATH 1E36B 3SUEA 3BG4B 1NFYA 4BXWA 2C8YB 4A1VA 4FU9A 7ESTE 4UE7H 2QYIA 2ALPA 9LPRA 2FLBH 4TY7A 4XOJA 1O2LA 1LPKB 1NT1A 4X2YA 1P2MA 1GI1A 2ZFFH 1SLWB 2Z3CA 1TOMH 1O2VA 4AZ2B 1Z8GA 1SR5C 2OXSA 3UFAA 1A5IA 2SFAA 4TWWA 3P8NA 3ZZ8A 5A0AE 3GY8A 1YCPH 1F5KU 3GDUA 4X1PU 1ANEA 4X1NU 1F2SE 1O2RA 1YC0A 2ZDLA 4UONA 2VJ1A 1L4DA 2BLWA 2BY8X 5GWZA 3UWJH 1O3CA 1QJ7B 1Y59T 1QFKH 4TYDA 1FY4A 1OYTH 1O31A 1PPZA 4D9QA 1EKBB 3GCHB 1YF4A 4FUDA 5C5NA 1UVOA 4FUHA 1TQ7B 4A92A 1TBRH 2PWXA 2ZGJA 2NU1E 1G2MA 1V2NT 1T31A 3BF6H 2XBWA 2IOTA 1EATA 1SOZA 2NU3E 2HGTH 2K1QA 2Y81A 1Y3YA 3LGVA 3U8RH 5FBIA 2J95A 3SGQE 5JBAS 1O5GH 1O3LA 2QIQA 1AB9C 2BLQA 1L2EA 1HLTH 3F6UH 4ABFA 1ANCA 1ORFA 3E91A 4IN1A 3VGCC 1UVSH 1GCTC 2WPIS 3FP8E 4OS4A 3O8DA 1C1VH 1QIXB 5DP4A 2M5TA 1TA6A 3MU0A 1C1WH 1FNIA 3P95A 1HAXB 2CV3A 1EJAA 1LVYA 4WJG2 3IWMA 4X1QU 3M5MA 3P6ZB 3PTBA 2BDAA 1THRH 1IQFA 2NU0E 3SW2B 1PQAA 4E7RG 2OQUA 4JK5A 4YT6H 6GCHF 1MCVA 1V2JT 4ZHLU 4WF8A
chains in the Genus database with same CATH superfamily
1NRPH 1KTSB 2BD4A 1FDPA 1XX9A 3LGUA 2GV6A 3RXIA 3KYGA 4P02A 1TYNA 4IMZA 3SJ9A 2OD3B 4YO9A 2TGAA 3AK5A 4DVAU 4F49A 1P2OA 4K2YA 2ZHEH 3RC4A 3A7TA 3F68H 1BTUA 1F0RA 2GDEH 2ZU4A 1O3PB 4JZIA 1E34B 1P02A 2J4IA 1QGFA 1ZR0A 1YY3A 1O39A 2W6ID 1DDJA 3GY2A 2BY9X 1GBJA 5FBEA 5L2ZH 1OWHA 1O35A 2OBQA 2GGVB 3WY8A 2PHBA 1O2IA 4NSVA 1EP6A 3TNTA 1BBRE 2OC8A 4ZKOU 2OQ5A 3OU0A 1P05A 3RXDA 1Q3XA 1UW7A 1WTGH 2AS9A 1H9IE 4HG6A 1NM6A 3VGCB 1Y5UT 1GCTB 1SGIB 1H9LB 1LVMA 1P3EA 5FPTA 3QN7A 1QNJA 2PP6A 4TPYA 2AYWA 3M7QA 5DG6A 1C2KA 5EQQA 1CVWH 3OAAD 2IN2A 1UCYK 2JKHA 1ELGA 2ZFRH 3ZZCA 2G52A 1IQEA 1FZZA 2O8LA 1AY6H 1SGTA 1ELAA 1A1RA 1Y3UA 1O2KA 2R2MB 1GL1A 2W3IA 2RFKC 3KQCA 1KDQB 4NA9H 1TRYA 4RI0A 1O2NA 1BBRH 1V2VT 1P04A 3HGNA 4ISNA 1E37B 4MPWA 1FJSA 2FOGA 1VITH 4O3TA 3BTFE 1ETTH 1FX0B 1AMHA 1BUIA 1RTLA 1GGDC 1VCWA 2A4GA 5JPMH 1GHBG 2QXJA 3ITIA 2NU2E 4JCNA 1HAHH 4MTBA 4R0IA 3KHVA 2Z9KA 5C20A 3TH3H 3H09A 3EA9A 1QB1A 1VJAU 4NSYA 2Z9JA 1DPOA 1M9UA 2B5TB 3UPEA 1F5RA 3VEQB 4TWYA 2OC0A 2Y7XA 4HTCH 1FLEE 3LJOA 2VWNA 2ZCHP 1O2TA 3UUZA 3ZZ9A 4FVDA 1LVOA 3ODDA 4Q63A 2ZC9H 1DOJA 1GHWH 1BTZA 1ANBA 1CQQA 4X8TH 3SUDA 4K1EA 3BTME 3E0PB 4WXVA 1Y5AT 5GNDA 3IITA 3PMJA 4FUGA 1MQ5A 5HM9A 4KTUA 4BOHA 1IHTH 1DXWA 2P95A 3WW7A 1JWTA 1P57B 1K1OA 1K1IA 1S81A 2ZHFH 1UVPA 1DWCH 1C5PA 2Z9GA 3FN8A 1QBNA 2XC5A 4NFEA 3MO6A 1F0TA 4SGAE 3UB0A 5DP6A 3UOUA 1P9SA 1TMUH 2XNDD 2A5AA 1ABIH 1Z6EA 2OTVA 1GHBF 3V13A 4ZKSU 1YPMH 2EI8A 2J9NA 3A87A 1TMBH 1GJ4H 1JIMA 1W0KD 5B6LA 4KKDA 4ABJA 4A1XA 3MQKC 4I33A 5FX5A 3BTWE 1MZAA 3A8CA 1GGDB 2BDIA 1C5TA 1TX6A 1P0SH 4X6NA 1TBZH 1VZQH 4ZXXH 4B74A 3F3BA 3NWUA 1GI3A 3M7UA 4X2VA 3SHCH 1P3CA 3PV5A 2FIRH 1K28D 5IK2D 3TGJE 2CMYA 1DANH 4NG9H 4DIIH 1OWKA 2F43B 2GZ9A 4QT8C 4X1SU 1B5GH 3M36A 1J8AA 2ILNA 1FIWA 3TJUA 4ABGA 4JK6A 1N6XA 4AFSA 4CRFA 3TU7H 1V2WT 3SN8A 4AYVB 3SU0A 1DVAH 3UNSA 2WV9A 2FWWA 1V6DA 4IGDA 5B6OA 1Z8IB 1TGNA 3A89A 4YM9A 1UTOA 4X8UH 1C2IA 2FOBA 3QWCH 2V6NA 5GPIB 4Z1MD 1CSOE 1MTSA 1CE5A 1T8OA 2BDCA 5E2OA 1XUJA 3GY3A 1VKYA 4Q7YA 3T27A 2WYGA 1NFUA 1LPGB 1ZHRA 2PTNA 3GCOA 3SORA 3DSPA 3GYLB 1UTNA 1UTMA 1UCYE 2WPLS 1PQ8A 3MO9A 3W94A 3WWFA 2FODA 4U2WA 3BIUH 5HXFA 2BD8A 1NRNH 3DHKH 1WOFA 2FS9A 4Y0ZE 3KL6A 1MTWA 3E6PH 3BEUA 1AIXH 2FOCA 2O8WA 4IBLH 1DWBH 5TJXA 3M61U 1QB6A 4Y7BA 3F2FA 3DD2H 2F9OA 5EXMA 1N6YA 1MUEB 3A8AA 4GVUA 4MG3A 1HJ9A 1TBQH 1ZGVA 2UWPA 3AAUA 2BVRH 3TK9A 8LPRA 5I46H 3O8RA 4MDSA 1AGJA 2BTCE 1YWUA 2C8ZB 5LGOA 3GICB 2D26C 3EE0B 2B0FA 2VB0A 2FMJA 3PRBA 3PLBA 3RXJA 4YT7H 5C0UA 4ZMAH 3BTQE 2ZQ2A 1HCGA 1SI5H 1W0JD 1EOLA 1BIOA 1UCYH 3M37A 4WMEA 3FFGA 2ZU1A 4ZXYH 1C5MD 5JYIA 1ZSJA 2B8OH 1O5CB 3N7EA 1TWXB 3MU8A 1EQ9A 3TVJB 1H8IH 3UNRA 2VVVA 1QJ1B 1V2RT 4CHAC 2KM0A 1JRSA 4JZFH 1AU8A 2ZPQA 3ELAH 2Q6FA 1YPHC 2C8WB 3B8JA 4FUFA 2Y82A 4HI3A 1LKBA 3LGYA 1X7AC 3TIUA 2QF0A 7LPRA 2L6OA 3A7WA 1FMGA 1GBIA 1NRQH 2QE7D 5C0TA 2UUFB 1CHOG 3PO1C 1PFXC 3LGWA 2ZP0H 1GJ5H 1C5OH 3MOCA 1HIAA 2ESTE 1S6HA 2DE8A 5E0HA 2J94A 1SL3A 2ZGXH 3A83A 1BJUA 3BTKE 4YESB 2THFB 1YPGH 3MNBA 2ZHQH 2ZHDA 1K9OE 1T4UH 4SGBE 2J5UA 4ABDA 4ZH8A 1Z7KA 2OUAA 2WPKS 3ZV9A 2XWBI 2QXIA 4ISOA 1HXFH 1O2PA 1ARCA 1ZTKA 1O3OA 3D62A 3F1SB 4WH8A 2O8MA 2PR3A 1L0ZA 3UTUH 1K1JA 1G3EA 1QQ4A 1W0YH 1SC8U 1TGCA 3M5NA 1IQIA 2FM2A 3MH5A 1O5DH 3SV7A 5F53A 2WINI 4ASHA 1LHEH 2XTTB 4WMDA 4BAOB 2ZI2H 1O2OA 4AN7A 1DLEA 3OSYA 4NZQA 1ETSH 2JJ1D 3LH3A 2YMSD 2RA3A 1GJ6A 1D6WA 2F4LA 4B75A 3HPTB 1Y5BT 4AYYB 3S9AA 1HB0B 3BSQA 5LPRA 2VINA 5EIYA 1GBAA 1KDQA 1F0SA 2G4TA 1BTHH 1MU6B 1OPHB 2JETC 3AAVA 1BTXA 4TPIZ 4CHAB 2A5IA 3MH4A 5E0GA 3SU3A 1QRZA 1O3MA 3MH6A 1BB0B 1O3GA 2GV7A 4RT0A 1AVGH 2VIOA 1O3BA 1SGRE 2LNCA 1CHOF 1GBFA 1MKXK 4KTCA 1H8ED 2V3OH 1BCUH 1K1NA 3QLPH 5DK1A 1KLTA 1RXPA 1C1PA 1TQ0B 1Z71A 2FO9A 4CBNA 2VIVA 2AERH 1DX5M 4K3JA 3U28C 4A1TA 3LGIA 3PO1B 1P12E 3S9CA 3SI4H 1HFDA 1P2QA 4INKA 4DY7B 3N99A 2AMPA 1G2LA 1AFQB 2BD5A 2WHXA 1XVMA 3F9HA 1YLDA 3CNRA 1VITF 1NRRH 2BY5X 4U32A 1GMDG 4Y79A 5GIBA 3MNXA 1GJ9B 2FX4A 1NC6A 1QRXA 5FXLA 3QDZB 5LPEA 3FO8D 3KIDU 1SHHB 1CGIE 3AW0A 2UWLA 1ZGIA 4K8BA 1S0QA 3SU4A 1C5XB 3R3GB 4DGJA 4NZLA 4A5TS 1EXFA 1SMFE 2FS8A 1D3DB 3NXPA 2P3UB 1C1NA 2ZPSA 1MD8A 4I86A 1V2LT 4BNRA 4D7GA 3FZZA 1NBME 1DWDH 1PPBH 1S0RA 1TNKA 2BY6X 3PRDA 5JB9S 3UWIA 1EZXC 1T8NA 4IC6A 1XMNB 4CBOA 2XYAA 1ID5H 1NS3A 1UK3A 3STIA 1GHXH 3F2HA 1F5LA 1HV7A 3DFLA 3BTGE 1B7XB 1CGHA 4H6SB 3V7TA 1GI5A 3PMAB 1NZQH 1DITH 4FUCA 5CE1A 1TOCB 6CHAC 5IDKA 1IQLA 5A0CA 2C4FH 3GCTG 1P9UA 1LHGH 1A5GH 1Y3VA 1C2LA 1V2ST 1W14U 4UFGH 2P8OC 2FXRA 5J4QA 2FEQH 2F9NA 1GMDF 2Z6BD 3UOPA 3M5OA 4Y8XA 1EZQA 2FLRH 2FYRA 1C2HA 1V2KT 3ZVBA 3Q3YA 4OS7A 3SGAE 3L33A 1IQKA 2F91A 2QN5T 1BMLA 3ZIAD 2FOEA 1MTVA 1GHAF 3SI3H 2TGTA 4DT4A 4O97A 4M9FA 3JZ2B 1XM1A 1GVZA 1MBMA 1YGCH 1GJCB 3D65E 1OP0A 5JDUB 3ATLA 2ZFTA 2LP6A 4AOQA 1FN6A 4DCDA 4GAWA 1E1QD 4HZHA 4TSFD 4CRDA 3MO3A 3T28A 1DT2A 2PSXA 1V2UT 5CDFE 1C5QA 1MTUA 3NPSA 4FUBA 2SGAA 5T6GA 5F8ZA 1W13U 1SGYE 1SHYA 3BTHE 3MI4A 5I25A 1OP8A 4WMFA 3A8BA 3MFJA 4YLUA 3RXLA 4OM9A 1BJVA 1J15A 2NU4E 4OGYA 3GCTF 1O3NA 2H9EH 2ZDMA 2FI5E 4Q2KA 1D3QB 2QAAA 4UFDH 3RXAA 1COWD 1L1GA 4GHTA 4UFFH 3GISB 3MMGA 4GHQA 3RM0H 1GMHF 1GG6B 1ZMJA 3DCLA 3PTNA 4KP0A 6CHAB 1ZRKA 2BZ6H 1HYLA 1ZPZA 1XKAC 1AO5A 2WPJS 5C3NA 4IN2A 1EZSC 4NWKA 4I8GA 2GMTC 1OXGA 2A31A 1OSSA 2P8OB 4NCYA 2BVXH 4ZAEA 4CRGA 3ZVAA 1QL9A 2H5CA 3MHWU 1HAZB 1ZRBA 1J9CH 1ZPBA 2VIPA 3PYHA 1C5LH 1G3BA 2FI4E 8GCHG 1L1NA 2ZDNA 1DY8A 1QY6A 3A7VA 3A86A 3RXRA 1ZMNA 1KTTB 2W3KA 4D76A 3L3TA 3K6YA 4OS1A 4ASUD 3UR6A 3VFEA 5J4SA 1D3PB 1QZ8A 1TFXA 2ODYB 4XBBA 1AVWA 3NCLA 4K69A 1FAKH 2SNWA 4XSKU 2A2QH 1MCTA 1DXPA 1OWDA 4B76A 3F9GA 3ZZAA 2QF5A 1HAPH 1UO6A 1P01A 5C94A 3DSGA 2BM2A 3BEIB 1O2XA 3C27B 3SUGA 3DUXH 1WAYB 2Q1JA 3BTEE 1G32B 1PYTD 5DPAA 3T62A 1C5RA 2BXTH 2F9VA 1ZYOA 1EPTC 1VR1H 1TPOA 4K5ZA 2KCPA 2VWMA 1P2IA 3E1XB 5C17A 5DP5A 3ATKA 1GI8B 1TPAE 3SNBA 3CENA 3SBKA 4B2BA 1S85A 1J14A 1C5NH 1S82A 3SU5A 3KYFA 2BMGB 1EAWA 5DKMA 4AORA 2B7DH 1HIAB 2TRMA 2A5KA 3U8TH 4IW4E 7GCHG 2SGPE 3OTJE 3VB7A 1AB9B 1S84A 4THNH 4YLQH 8GCHF 2D8WA 2C3SA 2GMTB 1O3EA 2AMQA 4NFFA 1EB1H 1LHFH 3T26A 1RD3B 4JZ1A 3UQOA 3ZYEA 1NFXA 3W1EA 1SGQE 1YP9A 5FAHA 1XXDA 2ZKSA 2ZO3H 1BRUP 4XE4A 1SGEE 1EAUA 1FPCH 1RIWC 1V2QT 4AFZA 4MNVA 1NRSH 3B9FH 3QGNB 1HJAC 3P17H 4FU8A 2G5NA 3OTPA 2W5EA 1TNIA 1VCQA 1ZJDA 4H4FA 1E1RD 2A2XH 3H5CB 5C5OA 1O2QA 4ESTE 4BAMB 1TGBA 1XUKA 1ESTA 3RXMA 1CHGA 5DP3A 1F0UA 1AN1E 2D2DA 4M7GA 1YBWA 2ZNKH 3DA9B 2BZAA 3RXKA 1WQVH 1NBMD 1BMFD 1P2JA 2Q6GA 3Q3XA 3KEEA 2UUJB 1ELDE 1F92A 1GI6A 2OK5A 1ZTLA 1SQRA 2IJOB 1C2MA 1O30A 4ABIA 1VGCC 5FCRA 2GJGA 1JMOH 5EJZA 2GCTC 1EPTB 2KCAA 5PTPA 3SJOA 4F55A 2BY7X 2EA3A 1FUJA 2P16A 1K22H 1H1BA 3PV4A 2ZCKP 1BHXF 1EAIA 2Z94A 1FY8E 1AWFH 1MD7A 2IPQX 3HKJB 4AX9H 3UQVA 2BXUH 2HVXA 2FYQA 5JBCS 1BOQA 2WUCA 5A8YA 2PW8H 3Q3KA 4O03A 1UK4A 4I8LA 1O36A 1UVUH 4UFEH 4X6MA 5KECA 2G55A 5L30H 1TAWA 4NA7A 3SHAH 4E05H 2J34A 1A7SA 1RTKA 4X1RU 3RLWH 3RXEA 3UAIC 4ABHA 2FTMA 1F7ZA 1GHVH 3B23B 3P8FA 3PM3A 1SFQB 3TK5A 1W7GH 1O38A 2BD3A 2OINA 2FP7B 3LPRA 1GBEA 2ZGBH 2HOBA 2GVFA 1HJAB 2Y80A 2BHGA 4MNWA 4I8HA 3H7TA 1SGCA 2A7HA 1KXAA 1C1QA 4D8NA 4Y8YA 1GVLA 2CN0H 2P59A 2BLVA 5DN6D 3RXVA 2C90B 1FN8A 2BX3A 1GI9B 3ENSB 3TH2H 1MKWK 2I6SA 1SG8B 1O5AB 2KAIB 1B0FA 3GY4A 2J92A 3W95A 1BTWA 1C2JA 1NY22 3LC3A 4I8JA 3BIVH 4TT3D 2A1DB 1KXBA 2GZ8A 4Y7AA 1QJ6B 3A7XA 3SQHE 3MWIU 2G00A 5HGGA 1AE5A 5AFZH 3A85A 1C2EA 2UWOA 8ESTE 2AFQB 1P2KA 2JH5D 1VGCB 3GY5A 2P94A 2VNTA 1W12U 2GCTB 2R0LA 5K7RA 3ZV8A 3D49H 4Q80A 3LKWA 4TY6A 5DP9A 2ZDVH 3F9EA 1G37A 1O2JA 1S6FA 1QA7A 2HNTE 2W7UA 4X2XA 1C4V2 1V2PT 1LQEA 3ZVEA 1BMAA 3VPKA 3E90B 3ESTA 2F83A 3FP7E 1SLXB 1HJ8A 3QO6A 5EQSA 2A7CA 1FY1A 5K0HA 3A8DA 4A6LA 2AGGX 2VWOA 1UTPA 2UUKB 1TLDA 1Z6JH 2HRVA 2ZG0H 5LPFA 4YZUA 4Y6DA 1D4PB 1T7CA 4Y0YE 5GJ4B 2ODQA 2A4OA 1MMJN 2HPPH 3HK6B 2ZGHA 3RDZA 2FI3E 3TJOA 4MQAA 3OFND 3UREA 1GMCG 3TJVA 3EAJA 5BRRE 8KME2 3SNEA 3OYPA 1T8MA 4DW2U 5LH8A 1EJMA 1C2DA 4BAQB 4O9VA 2SGFE 3P8OA 1QRWA 5GCHG 2WZQA 3TITA 1O2HA 4AGJA 4CRCA 1GHYH 2ASUB 2ZFQH 2WPMS 4IS5A 3PROA 1D6RA 1GI7B 5EPNA 5EW1H 1OWIA 1XXFA 2GT8A 3QTOH 2DE9A 1DFPA 1D9IA 1AUJA 4DJZB 1EJNA 1ELCA 3KQ5A 1UJ1A 4OS6A 3T2NA 1PPHE 4R8TB 1IHSH 1LDTT 2ZA5A 1IOEA 1ESAA 1O5EH 5A8XA 2ANKH 2ZTYA 1HGTH 1KXEA 1DS2E 2GD4B 2O8TA 1TX7A 3UIRA 1YCPM 2F9PA 3ZZ4A 1KXDA 4INLA 3RC6A 3SZEA 3SOSA 2CK3D 3SO3A 2A45B 1AKSB 1WCZA 1YYY1 4FUIA 2C93B 1EOJA 4ABBA 2VVUA 1ZZZA 1GMCF 3ZZ6A 1OOKB 5EXLA 2OC7A 1O5BB 1CA8B 1S83A 2CF8H 1EASA 1P2NA 4CR5A 3ZZ7A 5L6NH 1O2GH 1LHDH 1UTLM 2Y6TA 2HWLB 2BVSH 1C9PA 1LO6A 1K1PA 3HKIB 1C4U2 4X2WA 1T8LA 4JYTA 5SGAE 3TLOA 1A61H 2KR7A 1DUAA 2VU8E 2ZTZA 1ANDA 1ELFA 2Z7FE 5ESBA 5GCHF 1NROH 1W10U 2FOHA 2BQWB 5DP7A 1A3BH 1G9IE 1V2MT 3NUMA 1MTNC 3AASA 1A0HB 4MPUA 3DT0H 6LPRA 1GBBA 2CHAC 5CMXH 2SGDE 4GLYA 1SFIA 1YCPK 3TK6A 2J38A 2A32A 1C1UH 2V3HH 3PWBA 1GCDA 5F03A 3RM2H 1C4Y2 1QHRB 3E0NB 3GYMA 5HIZA 4Y76A 1KY9A 2PGBB 2BDBA 3SJKA 2HNTC 3TNSA 1H8DH 4WWYA 5DP8A 1TNHA 5EW2H 3Q00A 2VBCA 3BTTE 2ZF0H 5KEDA 1SSXA 2ZWLH 3TH4H 1LPZB 3N7DA 3ZZDA 1W3CA 4B6EA 1K21H 3M3TA 4Y11E 1K2I1 1PPCE 2VH0A 3JZ1B 1E35B 1FY3A 2P3FH 2EQNA 4P00A 5C1YA 1RTFB 3Q77A 1GJ8B 4XFQA 1JBUH 1MKWH 1LCYA 1UHBB 1ELTA 3V0XA 1IQHA 1O3IA 5DO4H 3RMMH 1EZUC 5TCAA 2Y7ZA 1PQ5A 3RXSA 4JYVH 4ISIH 1EB2A 3SZNA 4Q7XA 2CXVA 3G01A 3RXFA 3SNAA 1NU7B 4DURA 3DFJA 3VB4A 3NKKA 3V12A 1EPTA 1IQJA 1SQTA 2VH6A 3MNCA 1SLVB 2FOFA 2SGQE 1C5WB 3S9BA 3ZZ3A 1O33A 3UY9A 1HRTH 1UTQA 1YLNA 5C67A 1U6QA 1GBLA 4XBDA 1WQSA 3KGPA 3SV6A 3R0FA 1SLUB 4WH6A 1A46H 2PFEA 1SGPE 1W11U 1ZSKA 2Y5HA 4CRBA 1SKYE 1IQMA 1TX8A 4FUEA 3F0PA 1TIOA 4YOIA 1DICA 4X8VH 1P09A 4MVNA 2KCOA 3KN2A 5AHGH 1C5ZB 2A4RA 5EXNA 1HPGA 2R3UA 1XUGA 2QA9E 3EE7A 4FUJA 1V2TT 4MNXA 2H9TH 2R3YA 4FU7A 1L1JA 4Z0KA 3SGBE 1NO9H 1QURH 1VCPA 5EOKA 3I78A 4BAKB 2F3CE 1WDIA 2FESH 1QQUA 1P03A 2BOHB 1AZZA 2KAIA 5HKKD 5DJ7A 4NIYA 4AG2A 1DY9A 1H9HE 5GDSH 2OBOA 3A80A 4ZROA 1GDQA 2JETB 4XBCA 5AVDA 2Z9IA 3ATWA 2AH4X 3NZIA 4YXWD 1RJXB 4NIWA 1TRNA 1E0FD 4AB8A 1GL0E 3QZRA 4WVPE 4B2AA 3ZZ5A 3T29A 3K2UA 4CH8B 2IJD1 1LTOA 2KZ4A 2PTCE 3E16B 2H6MA 2ZECA 1B0EA 1FIZA 1PPFE 3SJ8A 1AI8H 3FZDA 5A8ZA 4CREA 3A7YA 2F9BH 2XXLA 2GTBA 3FAOA 3GCHC 4D7FA 3N7OA 1HAOH 4CH2B 2QC2A 2ZPRA 3K65B 4NWLA 3RU4D 2FOAA 1UVTH 1GJAB 4CRAA 1BBRK 2W7SA 1SBWA 1TONA 3M7TA 2HALA 3LH1A 4NIVA 2PV9B 1AZ8A 1GVKB 1FQ3A 2ZZUH 2QF4A 1DSTA 2XC4A 2EY4C 4NA8A 1BRCE 2H9HA 4NGAH 1PJPA 3I77A 4UD9H 2G81E 3GDVA 1SVPA 1FY5A 2VVCA 1LMWB 5C2ZA 2GT7A 3MU5A 3RXCA 4H42U 4ZUHA 1DWEH 3URCA 1C5SA 1THPB 3FKSD 3PLKA 2BDGA 2OP9A 1BRAA 2Z9LA 1GI0A 2GX4A 2STAE 2ZEBA 3OEED 1VJ9U 1PYTC 1WYKA 4I31A 2XRCA 4ZKNU 1J17T 2A4QA 2W6JD 3QUMP 3PMHB 3LC5A 2ANYA 1HUTH 2SGEE 1TABE 2BQ7B 5EPYA 1LVBA 2Z3DA 3LOXA 3LONA 2JH6D 1GBDA 2ZQ1A 1WTHD 2G8TA 4BTUB 3ATIA 1A0LA 6GCHG 3CP7A 1C1OA 1TNLA 2VWLA 5G4BA 1AVXA 1TRMA 5DGJA 1CGJE 4I7YH 2WSSD 4RN6A 3A88A 3C1KA 3MH7A 3NK8A 2BX4A 2ZFPH 1C2FA 2I6QA 3VB5A 3RXQA 4BAHB 1UK2A 2VGCC 1BHXB 2Y5GA 3KQEA 3OY5U 1OX1A 4OS2A 2O8UA 3Q76A 1ELVA 1RGQA 2HNTF 5C1UA 3P92A 1C5YB 4ZKRU 4LK4A 1AKSA 1O2WA 2ZTXA 2BYAX 4INHA 3QX5H 4J1YA 4VGCC 2OCVB 3F9FA 1ESBA 4GCHG 4GUXA 2XOKD 7KMEH 2ZU3A 1YPKH 1QCPA 1OP2A 4B73A 3OE7D 4AC9A 1BMNH 4Z6AH 1A0JA 2TBSA 3GDSA 1UTJA 1MKXH 5JBTA 1V2OT 1O2YA 1A3EH 3RXGA 2EC9H 2ULLA 2PUQH 1GJBB 1O5FH 1XUIA 1BQYA 1G36A 2BDHA 2QY0B 1C9TA 1AD8H 4K1TA 3CS7A 5FCKA 3PMBB 2OC1A 5EJ1A 3RC5A 2ZDAH 5FHTA 1C1TA 2G51A 1P10A 1WBGB 1Y3XA 3KNXA 3RXOA 1QTFA 2WUBA 2FX6A 4ZHAA 2EI6A 3AVZA 3EQ0H 4RKJB 4LZ4B 1OWJA 2L74A 1FV9A 5FPYA 2QXHA 3FANA 1CT4E 2QF3A 4ABAA 4B1TA 3QTVH 1AWHB 2J98B 1H4WA 1HDTH 2YNAA 1W7XH 1UMAH 2HLCA 1DM4B 4LXBH 2VGCB 1S5SA 3LIWA 4GCHF 1MBQA 2STBE 4MNYA 1HAYB 1TPSA 1ACBE 2ODPA 1BTPA 3M35A 3M3SA 2RDLA 4ISHH 1AFEH 1A4WH 1O34A 2BQ6B 4JZEH 1UHBA 4I8KA 3KQBA 4VGCB 1GPZA 1AE8H 1YKTA 3ZYDA 3EGKH 5FPSA 2M2AA 1TNJA 2FZZA 2J2UA 1EUFA 2A0QB 3PB1E 1P11E 3LT3A 1LHCH 3TGKE 4E06H 1OKXA 4U30A 2LPRA 2PLXA 2QV1A 4X6OA 5JB8S 5EODA 2FTLE 1DLKB 1O3FA 1AQ7A 2XCNA 3VB3A 1K1MA 1E79D 1GBMA 2H5DA 3RXTA 1BDAA 5EG4A 3A84A 4LOYH 1EP5A 3U98H 1ZSLA 3SU6A 4ACAA 2GCHG 5H4IB 2RA0A 1MAYA 1O0DH 4D9RA 1ETRH 1O3DA 1HAVB 7GCHF 1IQNA 5T6FA 3ZVFA 1YPEH 4DG4A 1WSSH 5ETXA 2ZFSA 5BPEA 1BRBE 1ZHPA 2OLGA 2CJIA 2WPDD 2JJ2D 3VXFH 3PV2A 3MTYA 3RU4T 2GKVE 5F8TA 3SV2H 2ZCLP 3GY7A 5DSFA 1Q31A 3GOVB 1NN6A 3SNCA 2TGPZ 4ABEA 3A81A 1A2CH 1TA2A 2WPHS 1TGTA 1WV7H 2BLOA 4Y8ZA 1KXCA 3GCNA 1P8VC 2V35A 4YOJA 2BB4A 3O8BA 5T3HA 2A7JA 2UUYA 2GZ7A 3ZVCA 3KQDA 1RIWB 2GP9B 1LQDB 1W0ZU 3TJNA 4OS5A 2HVYB 2KX4A 4XD7D 2V3MA 4XRNA 1WU1A 2DUCA 4JYUH 3RLYH 2VIWA 3F2GA 4KELA 3K6ZA 1ZHMA 1ABJH 4X6PA 3RP2A 2B9LA 4WXIA 3MYWA 1ARBA 3SU1A 1C5VA 3RMLH 1LKAA 4IC5A 2GCHF 3RXBA 5EQRA 4GPGA 1TNGA 3VB6A 1YPHE 1TGSZ 5KGOA 2PGQB 3EA7A 4RSPA 4JZDH 2FOMB 1T4VH 3IG6B 2G5VA 4AG1A 5FL7D 4AB9A 1GBCA 3P8GA 1SGFG 4MLFB 4B2CA 1NU9A 4FVBA 2BDYA 5EGMA 3ZZBA 2XCFA 2G4UA 2XW9A 3RXUA 3QZQA 2PKAB 3U8OH 1YLCA 5AF9H 2V0BA 5F8XA 1QA0A 4NIXA 1Z8JB 4Y10E 1KYNA 3SJIA 2SNVA 3T5FH 1XUFA 2ZGCA 1ZMLA 5HM2A 1TALA 5C1XA 4J2YB 5FX6A 1CU1A 1NPMA 5JBBS 2JDID 1GJDB 3D23A 3UNQA 1TB6H 3RXHA 1Y3WA 4ISLA 1Y8TA 2D1JA 4K8YA 5E2PA 1NFWA 1O37A 3RMOH 4MPVA 1G3CA 1KSNA 1N8OC 1AUTC 2ANMH 3UR9A 4O3UA 2F9UA 4RKOB 4JMYA 3RUOA 4AFQA 1JOUB 1O3KA 1GDNA 1BMMH 1RS0A 2O9QA 4ZCNA 3RU4E 3EA8A 4BANB 2CF9H 1KXFA 1CA0C 1CT2E 1Z8RA 4FETA 2AEIH 1GI2A 3LJJA 4E7NA 3AW1A 2EEKA 3FP6E 5F6MA 1EAXA 1YPJH 1PQ7A 3S7KB 1A5HA 2YMSC 1IAUA 4UEHH 5GXPA 1CBWC 4Y71A 3SV8A 5ABWA 1GHZA 1ZTJA 2YNBA 1KIGH 3U9AH 1TPPA 1ZOMA 5E8EH 1O2SA 4KGAA 1IQGA 3U1JB 3QGJA 1GWAA 1MH0A 2R9PA 1EX3A 1JRTA 1ELEE 1TMTH 2AGIX 2XBYA 3EYDA 3STJA 1BITA 1QR3E 2IPHA 1C2GA 4B71A 2P93A 3MNSA 1DE7H 3SNDA 4LZ1H 1KMHB 1P06A 3BTDE 4MPXA 2ZIQH 2QGRA 1FAXA 3SQEE 2VIDA 4RT1A 3TGIE 5CHAC 3KF2A 9ESTA 4AGKA 3TPIZ 3I29A 1E38B 1MU8B 3MU4A 1WUNH 3URDA 1QL7A 3SUFA 1UTKA 1C1MA 4FXGH 2ZDKA 1BTYA 1V3XA 3BG8A 1N8OB 1QL8A 1O3HA 2AIQA 2WV4A 1ZJKA 1XUHA 4IMQA 1QB9A 1HBTH 2J98A 1W8BH 1OWEA 4OGXA 2XNIA 1Q2WA 2K0QA 1ZPCA 3SV9A 1ZLRA 1KLJH 1CA0B 4KTSA 2BD7A 1BA8B 3PWCA 3BN9A 5HYOA 1OS8A 2FDAA 1GJ7B 1GBTA 2H2ZA 3OX7U 3KCGH 2WYJA 4K1SA 1O2ZA 4WY3A 1AFQC 4X0WU 2YMSB 3LGTA 1DSUA 3T25A 1CBWB 3S0NA 2CGAA 1KLIH 1N1LA 4DOQA 3ATMA 2ZU2A 3H7OA 4BTTB 4HGCA 5L2YH 1PPGE 2P3TB 1VITG 5T6DA 3GS9A 1GI4A 3EDXB 3A7ZA 1FI8A 5AFYH 4ZHMU 5CHAB 2ALVA 3L6PA 1CT0E 4H6TA 4CR9A 1G3DA 1QBOA 4X8SH 1CO7E 2JH0D 1O32A 1INCA 2W26A 2YOLA 4Q4LA 3VXEH 1SGFA 1C1SA 1HAVA 1JIRA 1MZDA 3U69H 3SYJA 2ZHWH 2LELA 2R2WU 1HAGE 1HAIH 1QBVH 1W2KH 3HGPA 3K9XB 2RCEA 5HIYA 3SU2A 1Z1IA 1DUEA 1AHTH 1MTNB 2BD9A 2XWAA 3ODFA 1HXEH 1K1LA 3RXPA 2CHAB 2WV5A 2TIOA 1TE0A 2R0KA 4U01A 6ESTA 2QCYA 5EU8A 3OY6U 3E8LA 3FVFB 4XDEA 1BT7A 2RG3A 2KFWA 1HNEE 1MQ6A 1SGNE 2PKSC 3GY6A 1O3AA 3BEFB 1MABB 1NESE 3HK3B 4HFPB 4BTIB 4F48B 3LU9B 5A09A 1FONA 1O2MA 2JIZD 3P70B 1OYQA 3S7HB 4DT7B 1D3TB 3BG4C 2ANWA 2TPIZ 1ELBA 1MAXA 3A82A 2KCYA 4PROA 2K8IA 1K0HA 1PPEE 1C1RA 2AHME 1O3JA 3BV9B 2Z3EA 3LDXH 3RMNH 1G30B 1THSH 4A7IB 4UDWH 1J16A 2XC0A 1SB1H 3O8CA 3S69A 4AFUA 5A2MH 1FPHH 1NTPA 2AMDA 4GSOA 3NRLA 3OEHD 3PLPA 1OHHD 3QK1A 4I32A 4K60A 5ESTE 2FPZA 5E0JA 1GHAG 2AIPA 5CHBA 4FOUC 1L4ZA 3DSOA 5TCCA 4F4OC 4YOGA 1SQAA 3ZVDA 1YPLH 3M5LA 1FXYA 2GDDA 2XBXA 3CS0A 1GBKA 3V3MA 1SGDE 2EI7A 4Q7ZA 3E3TA 3FOAA 1XVOA 3M3VA 2BOKA 1GDUA 1SOTA 2VIQA 2XBVA 2Y5FA 1Z1JA 2H1UA 2PKAA 3ZVGA 4YTAA 1H8HD 1RRKA 1YM0A 2Q6DA 2C8XB 1RFNA 2HPQH 5IYTA 1GBHA 1GG6C 2NWNA 1SQOA 3VG8A 1O2UA 1XKBC 2PUXB 2TGDA 2PSYA 3MU1A 5A0BA 1SPJA 3U1IB 2AGEX 1T32A 1BZXE 4DIHH 2ZU5A 2BD2A 2PKSB 4BXSA 5T1VA 1EFRD 1JXPA 4ACBA 1GMHG 1C5UA 2QXGA 2V7QD 5HMAA 3HATH 1E36B 3SUEA 3BG4B 1NFYA 4BXWA 2C8YB 4A1VA 4FU9A 7ESTE 4UE7H 2QYIA 2ALPA 9LPRA 2FLBH 4TY7A 4XOJA 1O2LA 1LPKB 1NT1A 4X2YA 1P2MA 1GI1A 2ZFFH 1SLWB 2Z3CA 1TOMH 1O2VA 4AZ2B 1Z8GA 1SR5C 2OXSA 3UFAA 1A5IA 2SFAA 4TWWA 3P8NA 3ZZ8A 5A0AE 3GY8A 1YCPH 1F5KU 3GDUA 4X1PU 1ANEA 4X1NU 1F2SE 1O2RA 1YC0A 2RDEA 2ZDLA 4UONA 2VJ1A 1L4DA 2BLWA 2BY8X 5GWZA 3UWJH 1O3CA 1QJ7B 1Y59T 1QFKH 4TYDA 1FY4A 1OYTH 1O31A 1WXRA 2J97A 1PPZA 4D9QA 1EKBB 3GCHB 1YF4A 4FUDA 5C5NA 1UVOA 4FUHA 1TQ7B 4A92A 1TBRH 2PWXA 2ZGJA 2NU1E 1G2MA 1V2NT 2HLDD 1T31A 3BF6H 2XBWA 2IOTA 1EATA 1SOZA 2NU3E 2HGTH 2K1QA 2Y81A 1Y3YA 3LGVA 3U8RH 5FBIA 2J95A 3SGQE 5EJLA 1S6LA 5JBAS 1O5GH 1O3LA 2QIQA 1AB9C 2BLQA 1L2EA 1HLTH 3F6UH 4ABFA 1ANCA 1ORFA 3E91A 3F0OA 4IN1A 3VGCC 1UVSH 1GCTC 2WPIS 3FP8E 4OS4A 3O8DA 1C1VH 1QIXB 5DP4A 2M5TA 1TA6A 3MU0A 1C1WH 1FNIA 3P95A 1HAXB 2CV3A 4B6FA 1EJAA 1LVYA 4WJG2 3IWMA 4X1QU 3M5MA 3P6ZB 3PTBA 2BDAA 1THRH 1IQFA 2NU0E 3SW2B 3WWBA 1PQAA 4E7RG 2OQUA 4JK5A 4YT6H 6GCHF 1MCVA 1V2JT 4ZHLU 4WF8A
chains in the Genus database with same CATH topology
1NRPH 1KTSB 2BD4A 1FDPA 1XX9A 3LGUA 2GV6A 3RXIA 1TYNA 4IMZA 3SJ9A 2OD3B 4YO9A 2TGAA 4DVAU 4F49A 1P2OA 4K2YA 2ZHEH 3RC4A 3A7TA 3F68H 1BTUA 1F0RA 2GDEH 2ZU4A 1O3PB 4JZIA 1E34B 1P02A 2J4IA 1QGFA 1ZR0A 1O39A 1DDJA 3GY2A 2BY9X 1GBJA 5FBEA 5L2ZH 1OWHA 1O35A 2OBQA 2GGVB 3WY8A 2PHBA 1O2IA 4NSVA 1EP6A 3TNTA 1BBRE 2OC8A 4ZKOU 2OQ5A 3OU0A 1P05A 3RXDA 1Q3XA 1WTGH 2AS9A 1H9IE 1NM6A 3VGCB 1Y5UT 1GCTB 1SGIB 1H9LB 1LVMA 1P3EA 5FPTA 3QN7A 1QNJA 4TPYA 2AYWA 3M7QA 5DG6A 1C2KA 5EQQA 1CVWH 2IN2A 1UCYK 2JKHA 1ELGA 2ZFRH 3ZZCA 2G52A 1IQEA 1FZZA 2O8LA 1AY6H 1SGTA 1ELAA 1A1RA 1Y3UA 1O2KA 2R2MB 1GL1A 2W3IA 3KQCA 1KDQB 4NA9H 1TRYA 1O2NA 1BBRH 1V2VT 1P04A 3HGNA 4ISNA 1E37B 4MPWA 1FJSA 2FOGA 1VITH 4O3TA 3BTFE 1ETTH 1AMHA 1BUIA 1RTLA 1GGDC 1VCWA 2A4GA 5JPMH 1GHBG 2QXJA 3ITIA 2NU2E 4JCNA 1HAHH 4MTBA 4R0IA 3KHVA 2Z9KA 5C20A 3TH3H 3EA9A 1QB1A 1VJAU 4NSYA 2Z9JA 1DPOA 1M9UA 2B5TB 3UPEA 1F5RA 3VEQB 4TWYA 2OC0A 2Y7XA 4HTCH 1FLEE 3LJOA 2VWNA 2ZCHP 1O2TA 3UUZA 3ZZ9A 4FVDA 1LVOA 3ODDA 2ZC9H 1DOJA 1GHWH 1BTZA 1ANBA 1CQQA 4X8TH 3SUDA 4K1EA 3BTME 3E0PB 4WXVA 1Y5AT 3IITA 3PMJA 4FUGA 1MQ5A 5HM9A 4KTUA 4BOHA 1IHTH 1DXWA 2P95A 1JWTA 1P57B 1K1OA 1K1IA 1S81A 2ZHFH 1UVPA 1DWCH 1C5PA 2Z9GA 1QBNA 2XC5A 4NFEA 3MO6A 1F0TA 4SGAE 5DP6A 3UOUA 1P9SA 1TMUH 2A5AA 1ABIH 1Z6EA 2OTVA 1GHBF 3V13A 4ZKSU 1YPMH 2EI8A 2J9NA 3A87A 1TMBH 1GJ4H 1JIMA 4KKDA 4ABJA 4A1XA 4I33A 5FX5A 3BTWE 1MZAA 3A8CA 1GGDB 2BDIA 1C5TA 1TX6A 1P0SH 4X6NA 1TBZH 1VZQH 4ZXXH 4B74A 3NWUA 1GI3A 3M7UA 4X2VA 3SHCH 1P3CA 2FIRH 1K28D 3TGJE 2CMYA 1DANH 4NG9H 4DIIH 1OWKA 2GZ9A 4QT8C 4X1SU 1B5GH 3M36A 1J8AA 2ILNA 1FIWA 3TJUA 4ABGA 4JK6A 1N6XA 4AFSA 4CRFA 3TU7H 1V2WT 3SN8A 4AYVB 3SU0A 1DVAH 3UNSA 2FWWA 1V6DA 4IGDA 5B6OA 1Z8IB 1TGNA 3A89A 4YM9A 1UTOA 4X8UH 1C2IA 2FOBA 3QWCH 2V6NA 5GPIB 1CSOE 1MTSA 1CE5A 1T8OA 2BDCA 5E2OA 1XUJA 3GY3A 3T27A 4Q7YA 2WYGA 1NFUA 1LPGB 1ZHRA 2PTNA 3GCOA 3SORA 3GYLB 1UTNA 1UTMA 1UCYE 2WPLS 1PQ8A 3MO9A 3W94A 2FODA 4U2WA 3BIUH 5HXFA 2BD8A 1NRNH 3DHKH 1WOFA 2FS9A 4Y0ZE 3KL6A 1MTWA 3E6PH 3BEUA 1AIXH 2FOCA 2O8WA 4IBLH 1DWBH 5TJXA 3M61U 1QB6A 4Y7BA 3DD2H 2F9OA 5EXMA 1N6YA 1MUEB 3A8AA 4GVUA 4MG3A 1HJ9A 1TBQH 1ZGVA 2UWPA 3AAUA 2BVRH 3TK9A 8LPRA 5I46H 3O8RA 4MDSA 1AGJA 2BTCE 2C8ZB 5LGOA 3GICB 2D26C 3EE0B 2B0FA 2VB0A 2FMJA 3PLBA 3RXJA 4YT7H 4ZMAH 3BTQE 2ZQ2A 1HCGA 1SI5H 3M37A 1EOLA 1BIOA 1UCYH 4WMEA 3FFGA 2ZU1A 4ZXYH 1C5MD 5JYIA 1ZSJA 2B8OH 1O5CB 1TWXB 3MU8A 1EQ9A 3TVJB 1H8IH 3UNRA 2VVVA 1QJ1B 1V2RT 4CHAC 1JRSA 4JZFH 1AU8A 2ZPQA 3ELAH 2Q6FA 1YPHC 2C8WB 3B8JA 4FUFA 2Y82A 4HI3A 1LKBA 3LGYA 1X7AC 3TIUA 2QF0A 7LPRA 3A7WA 1FMGA 1GBIA 1NRQH 2UUFB 1CHOG 3PO1C 1PFXC 3LGWA 2ZP0H 1GJ5H 1C5OH 3MOCA 1HIAA 2ESTE 1S6HA 2DE8A 5E0HA 2J94A 1SL3A 2ZGXH 3A83A 1BJUA 3BTKE 4YESB 2THFB 1YPGH 3MNBA 2ZHQH 2ZHDA 1K9OE 1T4UH 4SGBE 4ABDA 4ZH8A 1Z7KA 2OUAA 2WPKS 3ZV9A 2XWBI 2QXIA 4ISOA 1HXFH 1O2PA 1ARCA 1ZTKA 1O3OA 3D62A 3F1SB 4WH8A 2O8MA 2PR3A 1L0ZA 3UTUH 1K1JA 1G3EA 1QQ4A 1W0YH 1SC8U 1TGCA 3M5NA 1IQIA 2FM2A 3MH5A 1O5DH 3SV7A 2WINI 4ASHA 1LHEH 2XTTB 4WMDA 4BAOB 2ZI2H 1O2OA 4AN7A 1DLEA 3OSYA 4NZQA 1ETSH 3LH3A 2RA3A 1GJ6A 1D6WA 4B75A 3HPTB 1Y5BT 4AYYB 3S9AA 1HB0B 3BSQA 5LPRA 2VINA 1GBAA 1KDQA 1F0SA 2G4TA 1BTHH 1MU6B 1OPHB 2JETC 3AAVA 1BTXA 4TPIZ 4CHAB 2A5IA 3MH4A 5E0GA 3SU3A 1QRZA 1O3MA 3MH6A 1BB0B 1O3GA 2GV7A 1AVGH 2VIOA 1O3BA 1SGRE 2LNCA 1CHOF 1GBFA 1MKXK 4KTCA 2V3OH 1BCUH 1K1NA 3QLPH 5DK1A 1KLTA 1RXPA 1C1PA 1TQ0B 1Z71A 2FO9A 4CBNA 2VIVA 2AERH 1DX5M 4K3JA 4A1TA 3LGIA 3PO1B 1P12E 3S9CA 3SI4H 1HFDA 1P2QA 4INKA 4DY7B 2AMPA 1G2LA 1AFQB 2BD5A 1XVMA 3F9HA 1YLDA 1VITF 1NRRH 2BY5X 4U32A 1GMDG 4Y79A 5GIBA 3MNXA 1GJ9B 2FX4A 1NC6A 1QRXA 5FXLA 3QDZB 5LPEA 3KIDU 1SHHB 1CGIE 3AW0A 2UWLA 1ZGIA 4K8BA 1S0QA 3SU4A 1C5XB 3R3GB 4DGJA 4NZLA 4A5TS 1EXFA 1SMFE 2FS8A 1D3DB 3NXPA 2P3UB 1C1NA 2ZPSA 1MD8A 1V2LT 4BNRA 4D7GA 3FZZA 1DWDH 1PPBH 1S0RA 1TNKA 2BY6X 5JB9S 3UWIA 1EZXC 1T8NA 4IC6A 1XMNB 4CBOA 2XYAA 1ID5H 1NS3A 1UK3A 3STIA 1GHXH 1F5LA 1HV7A 3DFLA 3BTGE 1B7XB 1CGHA 4H6SB 3V7TA 1GI5A 3PMAB 1NZQH 1DITH 4FUCA 5CE1A 1TOCB 6CHAC 5IDKA 1IQLA 5A0CA 2C4FH 3GCTG 1P9UA 1LHGH 1A5GH 1Y3VA 1C2LA 1V2ST 1W14U 4UFGH 2P8OC 2FXRA 5J4QA 2FEQH 2F9NA 1GMDF 2Z6BD 3UOPA 3M5OA 4Y8XA 1EZQA 2FLRH 2FYRA 1C2HA 1V2KT 3ZVBA 3Q3YA 4OS7A 3SGAE 3L33A 1IQKA 2F91A 2QN5T 1BMLA 2FOEA 1MTVA 1GHAF 3SI3H 2TGTA 4O97A 3JZ2B 1XM1A 1GVZA 1MBMA 1YGCH 1GJCB 3D65E 1OP0A 5JDUB 3ATLA 2ZFTA 4AOQA 1FN6A 4DCDA 4GAWA 4HZHA 4CRDA 3MO3A 3T28A 1DT2A 2PSXA 1V2UT 1C5QA 1MTUA 3NPSA 4FUBA 2SGAA 5T6GA 5F8ZA 1W13U 1SGYE 1SHYA 3BTHE 3MI4A 5I25A 1OP8A 4WMFA 3A8BA 3MFJA 4YLUA 3RXLA 1BJVA 1J15A 2NU4E 4OGYA 3GCTF 1O3NA 2H9EH 2ZDMA 2FI5E 4Q2KA 1D3QB 2QAAA 4UFDH 3RXAA 1L1GA 4GHTA 4UFFH 3GISB 3MMGA 4GHQA 3RM0H 1GMHF 1GG6B 1ZMJA 3PTNA 4KP0A 6CHAB 1ZRKA 2BZ6H 1HYLA 1ZPZA 1XKAC 1AO5A 2WPJS 5C3NA 4IN2A 1EZSC 4NWKA 4I8GA 2GMTC 1OXGA 2A31A 1OSSA 2P8OB 4NCYA 2BVXH 4ZAEA 4CRGA 3ZVAA 1QL9A 2H5CA 3MHWU 1HAZB 1ZRBA 1J9CH 1ZPBA 2VIPA 3PYHA 1C5LH 1G3BA 2FI4E 8GCHG 1L1NA 2ZDNA 1DY8A 1QY6A 3A7VA 3A86A 3RXRA 1ZMNA 1KTTB 2W3KA 4D76A 3L3TA 3K6YA 4OS1A 3UR6A 3VFEA 5J4SA 1D3PB 2ODYB 1TFXA 4XBBA 1AVWA 3NCLA 4K69A 1FAKH 2SNWA 4XSKU 2A2QH 1MCTA 1DXPA 1OWDA 4B76A 3F9GA 3ZZAA 1HAPH 1UO6A 1P01A 2BM2A 3BEIB 1O2XA 3C27B 3SUGA 3DUXH 1WAYB 2Q1JA 3BTEE 1G32B 1PYTD 5DPAA 3T62A 1C5RA 2BXTH 2F9VA 1ZYOA 1EPTC 1VR1H 1TPOA 4K5ZA 3E1XB 2VWMA 1P2IA 5DP5A 3ATKA 1GI8B 1TPAE 3SNBA 3CENA 3SBKA 4B2BA 1S85A 1J14A 1C5NH 1S82A 3SU5A 2BMGB 1EAWA 5DKMA 4AORA 2B7DH 1HIAB 2TRMA 2A5KA 3U8TH 4IW4E 7GCHG 2SGPE 3OTJE 3VB7A 1AB9B 1S84A 4THNH 4YLQH 8GCHF 2D8WA 2C3SA 2GMTB 1O3EA 2AMQA 4NFFA 1EB1H 1LHFH 3T26A 1RD3B 4JZ1A 3UQOA 3ZYEA 1NFXA 1SGQE 1YP9A 5FAHA 1XXDA 2ZKSA 2ZO3H 1BRUP 4XE4A 1SGEE 1EAUA 1FPCH 1RIWC 1V2QT 4AFZA 4MNVA 1NRSH 3B9FH 3QGNB 1HJAC 3P17H 4FU8A 2G5NA 2W5EA 1TNIA 1VCQA 1ZJDA 4H4FA 2A2XH 3H5CB 5C5OA 1O2QA 4ESTE 4BAMB 1TGBA 1XUKA 1ESTA 3RXMA 1CHGA 5DP3A 1F0UA 1AN1E 2D2DA 4M7GA 1YBWA 2ZNKH 3DA9B 2BZAA 3RXKA 1WQVH 1P2JA 2Q6GA 3Q3XA 3KEEA 2UUJB 1ELDE 1F92A 1GI6A 1ZTLA 2IJOB 1C2MA 1O30A 4ABIA 1VGCC 5FCRA 1JMOH 2GCTC 1EPTB 5PTPA 3SJOA 2BY7X 2EA3A 1FUJA 2P16A 1K22H 1H1BA 3PV4A 2ZCKP 1BHXF 1EAIA 2Z94A 1FY8E 1AWFH 1MD7A 3HKJB 4AX9H 3UQVA 2BXUH 2HVXA 2FYQA 5JBCS 1BOQA 2WUCA 5A8YA 2PW8H 3Q3KA 4O03A 1UK4A 4I8LA 1O36A 1UVUH 4UFEH 4X6MA 2G55A 5L30H 1TAWA 4NA7A 3SHAH 4E05H 2J34A 1A7SA 1RTKA 4X1RU 3RLWH 3RXEA 4ABHA 2FTMA 1F7ZA 1GHVH 3B23B 3P8FA 3PM3A 1SFQB 3TK5A 1W7GH 1O38A 2BD3A 2OINA 2FP7B 3LPRA 1GBEA 2ZGBH 2HOBA 2GVFA 1HJAB 2Y80A 2BHGA 4MNWA 4I8HA 3H7TA 1SGCA 2A7HA 1KXAA 1C1QA 4D8NA 4Y8YA 1GVLA 2CN0H 2P59A 2BLVA 3RXVA 2C90B 1FN8A 2BX3A 1GI9B 3ENSB 3TH2H 1MKWK 2I6SA 1SG8B 1O5AB 2KAIB 1B0FA 3GY4A 2J92A 3W95A 1BTWA 1C2JA 1NY22 3LC3A 4I8JA 3BIVH 2A1DB 1KXBA 2GZ8A 4Y7AA 1QJ6B 3A7XA 3SQHE 3MWIU 2G00A 5HGGA 1AE5A 5AFZH 3A85A 1C2EA 2UWOA 8ESTE 2AFQB 1P2KA 2JH5D 1VGCB 3GY5A 2P94A 2VNTA 1W12U 2GCTB 2R0LA 5K7RA 3ZV8A 3D49H 4Q80A 3LKWA 4TY6A 5DP9A 2ZDVH 3F9EA 1G37A 1O2JA 1S6FA 1QA7A 2HNTE 2W7UA 4X2XA 1C4V2 1V2PT 1LQEA 3ZVEA 1BMAA 3VPKA 3E90B 3ESTA 2F83A 3FP7E 1SLXB 1HJ8A 3QO6A 5EQSA 2A7CA 1FY1A 5K0HA 3A8DA 4A6LA 2AGGX 2VWOA 1UTPA 2UUKB 1TLDA 1Z6JH 2HRVA 2ZG0H 5LPFA 4YZUA 4Y6DA 1D4PB 1T7CA 4Y0YE 5GJ4B 2ODQA 2A4OA 1MMJN 2HPPH 3HK6B 2ZGHA 3RDZA 2FI3E 3TJOA 4MQAA 3UREA 1GMCG 3TJVA 3EAJA 5BRRE 8KME2 3SNEA 3OYPA 1T8MA 4DW2U 5LH8A 1EJMA 1C2DA 4BAQB 4O9VA 2SGFE 3P8OA 1QRWA 5GCHG 3TITA 1O2HA 4AGJA 4CRCA 1GHYH 2ASUB 2ZFQH 2WPMS 4IS5A 3PROA 1D6RA 1GI7B 5EPNA 5EW1H 1OWIA 1XXFA 2GT8A 3QTOH 2DE9A 1DFPA 1D9IA 1AUJA 4DJZB 1EJNA 1ELCA 4OS6A 1UJ1A 3T2NA 1PPHE 4R8TB 1IHSH 1LDTT 2ZA5A 1IOEA 1ESAA 1O5EH 5A8XA 2ANKH 2ZTYA 1HGTH 1KXEA 1DS2E 2GD4B 2O8TA 1TX7A 3UIRA 1YCPM 2F9PA 3ZZ4A 1KXDA 4INLA 3RC6A 3SOSA 3SO3A 2A45B 1AKSB 1WCZA 1YYY1 4FUIA 2C93B 1EOJA 4ABBA 2VVUA 1ZZZA 1GMCF 3ZZ6A 1OOKB 5EXLA 2OC7A 1O5BB 1CA8B 1S83A 2CF8H 1EASA 1P2NA 4CR5A 3ZZ7A 5L6NH