1GI9B

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
total genus 54
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi9B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi9B01
1A5IA 1TNGA 3UOUA 3SJOA 2F9BH 3RP2A 5LGOA 3M3SA 1P0SH 1UMAH 2FI4E 1MQ6A 4X1QU 2A32A 3VB3A 4TYDA 4ZMAH 1TNJA 1HAOH 4YO9A 1UHBB 5CE1A 1IQEA 1ZOMA 4DT7B 1YCPM 1PQ5A 1AUJA 4FUDA 4OS2A 1XVOA 1EZQA 1FPCH 3ZZAA 1C4U2 1XMNB 1AVGH 3MH7A 3W94A 2W5EA 2NU1E 2Y80A 4UFDH 2BTCE 3BTQE 4ISOA 3PWBA 1XUIA 2ZU1A 4OGYA 3SNBA 2FIRH 1W3CA 1RD3B 4X8SH 4D76A 5C2ZA 1GJDB 1Y3UA 4VGCB 1IQKA 1P2KA 2AMPA 5GCHG 3LKWA 1DY8A 2BZAA 4X1NU 1RTLA 2D8WA 1O2MA 2QA9E 3SU6A 1NRSH 4H4FA 1EAIA 1O5AB 4AN7A 3RXFA 1VCPA 2PGQB 3HGNA 2ZU5A 2FS8A 5AVDA 1HAXB 2ZPRA 4ABEA 2ZI2H 1DE7H 3P8NA 4TPYA 1GHXH 2RA3A 2WPIS 1K2I1 5DP5A 1BRBE 3JZ1B 1C5ZB 3A7TA 5DP9A 1IQIA 3MNCA 1DICA 5FPTA 2FOMB 4NFEA 5TCCA 5JPMH 1TAWA 4ABHA 1P12E 4FVDA 3MU1A 3SUEA 1ZHMA 4JYUH 1BHXB 1NFWA 3EYDA 2XBYA 5EQQA 1TOCB 1SQOA 1V2MT 1EB1H 4YOIA 4LK4A 4AG2A 5EG4A 3RU4T 5EODA 2BY5X 3BTME 3S9AA 3TJVA 2C8XB 1TA2A 2JH5D 3JZ2B 2C8ZB 1KDQB 1C2HA 1Q2WA 3QZRA 1J9CH 1QR3E 2H6MA 2WPKS 1ZPBA 1GBLA 4DIHH 2ZG0H 1VCQA 5FPSA 2QXIA 3F68H 1BBRE 1E0FD 2ZP0H 4H6TA 1QURH 1P2IA 4DW2U 4CBOA 1GBCA 2EI8A 3M5LA 2ESTE 3PMJA 3GY2A 1QNJA 1MKXH 3UY9A 3D62A 3O8RA 2ODYB 1AWHB 1THPB 5JB9S 1BCUH 4RSPA 2P93A 3MU8A 1E35B 2ZGBH 2XBWA 2A5AA 1GHAG 1C9TA 4J2YB 4NWKA 3RLYH 1N8OC 3SU1A 1YCPH 1L4ZA 2FOCA 2P3TB 4JK6A 3LGUA 1Y8TA 1SGDE 3P70B 1TQ7B 5T3HA 2H9TH 3TGKE 1LKBA 4X6PA 2WINI 3MNBA 5ETXA 3ZZ6A 1OX1A 1EPTC 1GI8B 1MAYA 1SGFG 3MNXA 3M36A 5AF9H 1NT1A 2BY8X 4I8LA 2VIVA 1D6WA 1ANBA 1O2GH 2FS9A 3OU0A 3K65B 4AFSA 1EAUA 1S85A 2CHAC 1TALA 1L4DA 1CE5A 3ODFA 5DG6A 1BRUP 5HXFA 2F9VA 1W0ZU 1INCA 3OY6U 4YM9A 2QXHA 4ZKSU 3M5NA 2VINA 4FUBA 3A83A 5E2OA 1AE8H 3HKJB 2BVRH 1O2YA 2PSYA 4AB8A 2FESH 3LDXH 3M5OA 1ZSLA 2AGEX 3OY5U 3RMMH 4YOJA 3SJKA 1L1GA 3NUMA 1SOZA 1H9IE 3ZZ3A 1ANEA 1SFIA 1TGTA 3KGPA 1WQVH 2QXJA 1O2VA 2VGCB 5EXMA 3GCHC 2GP9B 4YESB 4UEHH 2K1QA 3RXDA 2GDEH 2FWWA 1K1LA 2OCVB 1MU6B 2A4RA 1L2EA 4R0IA 1HFDA 3A88A 3SNDA 1DUAA 4IMZA 1WCZA 4RN6A 1OWJA 1P05A 2Z9KA 1AN1E 5C1UA 1PPHE 2Z9GA 2ZDKA 2FDAA 4X2YA 1SL3A 2OBQA 4B74A 1NU7B 4PROA 4WXVA 1HAZB 2CN0H 1DWEH 4INKA 2FOHA 1DX5M 1GBJA 1RGQA 3FZZA 4Y76A 4ZXXH 3TH2H 3CENA 4JMYA 5I25A 2VWOA 4NA7A 2QV1A 4ZHLU 1ARBA 2ZZUH 1HIAB 3M7QA 4E7NA 4K1EA 1MU8B 3BEUA 2STAE 1QBOA 4I8GA 5G4BA 2GKVE 1GG6C 1W14U 3TGIE 2ZF0H 1H8DH 3U1IB 1O3NA 1GBKA 1Z71A 4X1PU 3RMLH 5TJXA 1Q3XA 2AS9A 3ZZBA 1QQ4A 1GJAB 2SGQE 1O2UA 3HKIB 1SGNE 1W13U 2AYWA 5EW1H 3GCHB 4D7GA 1AU8A 2C90B 2PSXA 2CMYA 3BTTE 1O31A 2VU8E 2FXRA 2A5KA 3MHWU 1G2MA 2XWBI 3BTEE 1ESBA 5DO4H 3T5FH 5J4QA 1S6FA 1AMHA 1GJ5H 4M7GA 4BAKB 4ZHMU 2SGAA 1EZSC 1MCVA 2FPZA 2HRVA 2EC9H 2ALPA 1QJ7B 1P03A 1O2TA 1P8VC 1RTKA 3QTVH 3RXBA 1NPMA 2H2ZA 5DP7A 1VCWA 2VIOA 1AUTC 2EI7A 1ABIH 3NXPA 1LMWB 4CRCA 1KLTA 4JZDH 1ELEE 1C5UA 1IAUA 2IOTA 1EJNA 1MKWH 2BY6X 4JK5A 4THNH 1AHTH 3VXEH 2WYJA 1LVBA 1O32A 2AMQA 4KTCA 1EXFA 1FDPA 2AGGX 3LGWA 3SJ8A 1GCDA 8ESTE 2PTNA 2ZQ1A 2BDYA 4FU8A 2AH4X 2BHGA 3L6PA 4B71A 1C1WH 1KLJH 3SN8A 1UTLM 1V2OT 3VEQB 1YLDA 2BD8A 3ZZ8A 1AB9B 3BEIB 1UO6A 1V6DA 1RS0A 1O3KA 3SBKA 1CHOF 1O2LA 1AWFH 4MVNA 1V2UT 2UWPA 2VNTA 1T4VH 3QLPH 3VGCC 4MG3A 2HNTC 1O2HA 4LOYH 4B73A 1BZXE 1Y5AT 1K28D 2ODPA 2ZHDA 3P8GA 5A2MH 1F0UA 1EJMA 4FUGA 3U98H 4DG4A 3LGIA 1TNHA 2PWXA 2BY9X 4YOGA 3O8CA 3GICB 1FN8A 1EB2A 1ELVA 1HXFH 3UIRA 1TPPA 3GYLB 4B2CA 1VITH 3RXJA 1XX9A 2WPLS 3RXRA 1KSNA 3SORA 4MQAA 4Q7ZA 1YPGH 3NWUA 1UHBA 4O9VA 2AIPA 1LDTT 2OXSA 2V3OH 4YT7H 1SLWB 3IG6B 1SC8U 1GHBG 1AQ7A 2ZDNA 2ZHFH 1N6YA 1QCPA 1EASA 1SLXB 1AKSB 4AORA 4ZHAA 3V13A 6CHAC 3QUMP 1ZZZA 2IJOB 4WH6A 1VR1H 3H7TA 2J95A 4ZKRU 3NZIA 1PFXC 3LGVA 1QL7A 2FLBH 1O38A 2Y82A 4O3TA 1XUGA 4ZKOU 4IGDA 2R3UA 2PHBA 5A8XA 4UFFH 3IITA 1FV9A 7KMEH 4ABDA 4CRGA 1GGDC 4Y8ZA 4UDWH 1BMLA 2O8TA 3M35A 2PFEA 1ZTJA 1JOUB 5C1YA 2CGAA 1P10A 1F0SA 1FIWA 3OX7U 1C5XB 4IW4E 3ZVBA 1E37B 3C27B 1M9UA 1XXFA 3OSYA 1AFEH 2H5CA 1FY3A 1NM6A 4OS5A 1J16A 2FEQH 1MZDA 1DITH 5A0BA 3MI4A 1Y3VA 1A3BH 1ESTA 4BAOB 1NS3A 1BT7A 1QJ6B 1HAHH 1FY5A 1T8MA 4GSOA 4IMQA 3TU7H 1Y3XA 1JMOH 3ATIA 3MTYA 2ZC9H 2WUBA 4Q7YA 1TRMA 2SGDE 1ZLRA 4K69A 4Y8XA 4DCDA 3PO1B 1NU9A 2GMTB 3KIDU 1ANCA 9LPRA 3S9BA 2ZDMA 2O8LA 3BTDE 1PYTC 1E38B 4NFFA 3U8RH 1UTJA 2FYRA 3SNAA 2ZFPH 1OWHA 4X8TH 4H6SB 2HPPH 3PLPA 3RXIA 1Y5BT 1FAKH 1SGFA 1Z1IA 5FX6A 2ILNA 4B76A 4ZAEA 4X2XA 1GG6B 1O3HA 2ASUB 5I46H 2B7DH 4CHAC 2G51A 5DP8A 1D4PB 1BIOA 3ZYDA 3ZVCA 2PUXB 1BA8B 1C5NH 1MKWK 3MWIU 1QRZA 3E90B 2F3CE 1J8AA 1Z8RA 2BVXH 1Z6JH 1HLTH 2UUYA 1ELFA 1MTSA 3BN9A 1YC0A 1G37A 3KN2A 3LGTA 1ZPCA 1QGFA 2SGFE 1ORFA 5GJ4B 2H5DA 1BRAA 1YGCH 3K6YA 1FUJA 3GOVB 1OSSA 4X0WU 2QXGA 5GIBA 3GCTG 4DGJA 1MTUA 3T29A 2AGIX 2GCTC 4FUFA 1VITF 1KIGH 3MU5A 1GJBB 3RXAA 1THSH 3R0FA 4Z0KA 1VZQH 2ANMH 4BTIB 1IQLA 2OLGA 4O3UA 2IN2A 4B1TA 2ZU3A 2BLVA 3TH3H 2V3HH 3M3VA 1GJCB 5HMAA 3MO6A 4AFZA 4U2WA 3SNEA 5CHAB 4Y11E 1P2JA 1TBQH 1TONA 4X1RU 1UCYH 5C5NA 4INLA 2Q6DA 2ALVA 1TWXB 1NFYA 4AFUA 3UNSA 1OWDA 4K8YA 3ATMA 3F9FA 2OC8A 1C5WB 3MO9A 1ZGVA 4MNYA 4AX9H 2NU2E 1C5OH 5LPRA 4OS4A 2O8MA 3E3TA 3I78A 4ZH8A 1D3QB 1C2EA 1ACBE 4WWYA 2AEIH 2CV3A 1GMCF 2BVSH 1W11U 4ZKNU 2ZIQH 1O3AA 4KELA 1MD7A 3S9CA 2OUAA 3PMHB 1C2GA 1EOLA 1TPSA 2IPHA 4JYVH 3SV9A 1CT2E 1A1RA 5DP4A 2GDDA 1WU1A 1LKAA 3ELAH 1FJSA 3DFJA 3ESTA 4K3JA 2BOHB 2C93B 4WXIA 3VB4A 2XW9A 1HJAC 1XUHA 8KME2 2P3FH 1NN6A 1NTPA 1P2OA 3E0PB 3NPSA 4D8NA 2J4IA 3PMAB 1KTTB 1PPEE 5ESBA 1CO7E 3ZZ9A 4A92A 4I7YH 1E34B 2P94A 2QAAA 3P92A 1S0RA 4A1VA 1PQ8A 3TLOA 2B9LA 1KLIH 3QX5H 3KHVA 4CH2B 1DM4B 4XOJA 2VVUA 1SGIB 1DLKB 1Z8GA 3A80A 2ULLA 4SGBE 3T62A 1TB6H 4TWWA 2A7JA 4Y7BA 1AZZA 3RXTA 4BTUB 3EA8A 1HPGA 2OP9A 3KQEA 3PM3A 3LH3A 5EQRA 2TGDA 1MMJN 2PKAA 1JXPA 1SGYE 1G2LA 1HNEE 5JBBS 1JRSA 3ZVAA 1IQNA 3KL6A 2EA3A 4D7FA 2XC0A 1O3MA 2PKAB 3GY4A 1O37A 5GXPA 4GHQA 2B0FA 2FOBA 4A1TA 4GUXA 1GI6A 4MPWA 2ZGJA 1HJ8A 1L1NA 1P3EA 3SNCA 3UOPA 4TY7A 4Y7AA 1NRNH 3SUDA 3AVZA 1P3CA 2UWOA 3QTOH 5FCKA 1SGPE 2FX4A 1TPAE 1C2KA 2ANKH 3EDXB 1OXGA 1V2PT 1SHYA 5IDKA 3Q00A 1GDNA 1K1IA 1C5PA 2BD2A 2PKSB 1RRKA 1QL8A 3DD2H 1GDQA 1CA8B 4MPVA 1O5EH 2OQUA 2Q6GA 3GYMA 5A0AE 1GBEA 1S81A 1Y3WA 4FUIA 3RLWH 1S6HA 3P8OA 1WV7H 3ZVDA 4X2WA 2ZDAH 1UCYK 1MH0A 1O3DA 3SGBE 2CJIA 1C2IA 1FI8A 4MNVA 1AFQC 2FOAA 5FBEA 1UTOA 3RXOA 1UTQA 1P04A 1FXYA 3SZNA 1VJ9U 3GDSA 4BANB 1AGJA 1AE5A 3RC4A 1KY9A 2C8WB 1LTOA 1P11E 1W10U 2WV5A 2W7SA 2VIPA 5AFZH 5H4IB 1K1JA 1BJUA 1BHXF 2BMGB 5A09A 2P8OC 1C5TA 3GCOA 3UPEA 2FOGA 2Z3DA 1PPCE 1BB0B 1TFXA 1QHRB 1YBWA 1C5LH 1ELAA 2GT7A 1S5SA 2FM2A 4HFPB 1XUJA 2A0QB 1GVLA 1KXBA 5L2ZH 2VB0A 2KAIA 1FMGA 1V2TT 2W3KA 2J34A 1EAXA 2ODQA 2YNAA 1CT0E 1F5LA 1GHZA 3F9EA 3VB6A 3WY8A 1KXEA 1UCYE 2HPQH 4JYTA 1TYNA 3U8OH 4AYVB 2C8YB 2QY0B 2QIQA 1JIMA 2KAIB 3OTJE 2G5VA 1WSSH 3BG4C 3QGJA 4JCNA 3AW0A 2HVXA 1YPLH 5FX5A 3RMNH 4Q7XA 3FP7E 3UWIA 2ZHEH 2G55A 1UK3A 2PGBB 1O34A 1HUTH 5F8ZA 1L0ZA 4FXGH 3UREA 1O3OA 3LONA 1TLDA 2YNBA 3QGNB 4O97A 1LO6A 3QO6A 3UTUH 2OTVA 2HWLB 1MQ5A 1MTNC 1DY9A 1TGBA 2AERH 4NZQA 1O2XA 4XBCA 1P2MA 1MKXK 2BYAX 3A82A 4ABIA 1T32A 1XKAC 3RU4D 1ANDA 1C1PA 3SGQE 1CBWC 5C1XA 3BG8A 1UK2A 1JRTA 5EOKA 1ETTH 1V2KT 2Z94A 4K2YA 1QRWA 1LQDB 3BF6H 3SI3H 1LVYA 1C1VH 4MPUA 5A8ZA 1RJXB 2F9UA 4I32A 1XKBC 2FO9A 1GI0A 3KCGH 1SOTA 1TOMH 2OC0A 1O2KA 3T2NA 4D9RA 2TPIZ 1CHGA 1UVOA 1DOJA 2H9EH 1EP6A 3NK8A 1GBAA 3E8LA 2Y6TA 2BDIA 2SGEE 2XBXA 1T4UH 2Q6FA 4B2BA 1TE0A 2B5TB 3F9HA 2BD5A 3TNSA 1YLCA 3ODDA 3CP7A 1AY6H 2D1JA 5HM2A 1EUFA 4I33A 1HV7A 1SQAA 3RXVA 1O30A 1G3DA 1KXAA 1YM0A 4IC6A 3E1XB 2VVVA 2SNVA 2C4FH 4CBNA 1LPZB 1ZMJA 1KXDA 5C20A 1O3LA 5FBIA 2QF0A 1ZTLA 1P9SA 2OQ5A 1ZPZA 2WV4A 2FX6A 1MAXA 3SGAE 2BDCA 5JBCS 5FHTA 2THFB 4KP0A 2BB4A 1IQJA 4K1SA 3RC5A 1QTFA 1CSOE 5AFYH 1SGQE 1GJ6A 1HXEH 1Z8JB 3SUFA 4BNRA 3RM2H 1TABE 4NZLA 1GWAA 1O3EA 2BDAA 4MNXA 1JIRA 2G8TA 1O5DH 3KQCA 3LC5A 2A4GA 3O8BA 2D2DA 2FODA 3V0XA 3NKKA 2O8WA 2VIDA 1BJVA 1ZGIA 5FXLA 1O5FH 5CMXH 1C2LA 2BDHA 1DSTA 3KQBA 3DFLA 3SV7A 1ZJKA 2XRCA 2F91A 1EATA 1LHDH 2ZU2A 1UVTH 1SG8B 2A7CA 1SHHB 3SU3A 1W7GH 2VH6A 1BMNH 1S82A 1C1TA 3A8BA 4O03A 2ZNKH 1UTPA 1VJAU 3EA7A 1FY8E 1HYLA 4KGAA 4WF8A 1OYTH 3RUOA 5A8YA 5GWZA 5C5OA 1WOFA 1O35A 1ELGA 1ZRKA 1CGIE 3U8TH 2J2UA 1GI5A 2R2WU 2ZGHA 2HNTF 2LPRA 1YPHC 1P09A 2CF9H 2BX3A 6GCHG 1MTVA 3A84A 2FLRH 5B6OA 1EKBB 3K6ZA 1H4WA 4KTSA 1CA0C 4A1XA 5TCAA 1W2KH 2GX4A 1ZYOA 1QB1A 1TA6A 1JBUH 3VB7A 3ZZCA 1LHEH 3FVFB 1Z6EA 7ESTE 2ZCKP 1DWCH 2GCHF 1EAWA 2P8OB 4GLYA 3M61U 4LZ4B 3MFJA 1D3TB 3DA9B 2CXVA 2UUKB 4B2AA 2R0KA 5ESTE 3TH4H 1K1PA 1F5KU 3IWMA 3ZZ5A 1PPBH 5GDSH 3UFAA 4ABAA 1AIXH 1B5GH 1TGCA 4AZ2B 1F2SE 1OWIA 3A8AA 3RXMA 1EZUC 1O2RA 2BDGA 2DUCA 5T6FA 3TPIZ 3T26A 2BQ6B 1BTWA 1ID5H 3FZDA 1ELDE 4SGAE 2R3YA 1A2CH 1SGRE 1FN6A 3ZVEA 3BTWE 1C5RA 2ANWA 4UE7H 1NROH 1P2QA 1GHVH 5F8XA 1BTHH 1W0YH 1B0EA 2ZTYA 4NG9H 5LPFA 1OPHB 1CQQA 3ZVFA 3UQOA 1GI7B 1CA0B 3RMOH 1DXPA 3MMGA 4AG1A 2BQ7B 2FOEA 1SGEE 3P6ZB 4NIXA 2HOBA 2R9PA 2Y7XA 5T6GA 5LPEA 3L3TA 4X8VH 4YLQH 3LH1A 4I31A 2TRMA 3GY5A 5IYTA 5BPEA 1LHCH 3FP6E 1IOEA 1ELTA 2Y5HA 1P01A 3BSQA 4GPGA 1F0RA 3DUXH 3KNXA 3QN7A 5L2YH 1F92A 4ZROA 1GI2A 4OS6A 1O36A 1DWBH 3RXUA 2CHAB 1O3CA 4VGCC 2W26A 1G30B 1HGTH 1DWDH 8LPRA 5JDUB 1GPZA 1W7XH 1C1SA 2BXUH 5F6MA 3BEFB 1AB9C 2GTBA 1YPMH 4ZUHA 3A8DA 3NCLA 2D26C 3ZV8A 4BXWA 2Z9IA 1BOQA 3GCNA 2QC2A 5DPAA 1ZMNA 1BBRK 2ZCLP 4CR9A 5HYOA 1UTKA 2PUQH 2H9HA 1A0JA 1H1BA 1L1JA 2ZGCA 3PLBA 4X6MA 3VXFH 3M37A 1W8BH 3SI4H 2FP7B 2WPHS 1BMAA 1ZHRA 1G3BA 1C5QA 1QIXB 1YP9A 3F1SB 5J4SA 2ZKSA 1MD8A 3MH6A 3I29A 3A7VA 4E06H 4FUEA 2TGTA 2VGCC 2TBSA 4FUHA 3Q76A 2Y7ZA 4MLFB 3URCA 4X6OA 4CR5A 3RXHA 3V3MA 1QJ1B 1SB1H 5E0GA 3TIUA 1AVXA 2V0BA 2VWNA 3DHKH 2DE8A 1Z7KA 1BTUA 1A0HB 1ZTKA 4I8HA 1Y3YA 2Y5FA 5F8TA 1TNKA 2YOLA 3B9FH 2FI5E 1QL9A 3I77A 1AVWA 4NIYA 2FMJA 1OWEA 1LHGH 3RXGA 1GJ4H 5LH8A 1KYNA 4A5TS 5ABWA 2GV7A 1THRH 2ZFRH 1QQUA 3A7ZA 4NSYA 2Z6BD 4CH8B 4XE4A 5SGAE 6GCHF 1TBZH 3B23B 1IHSH 4A7IB 1S0QA 2Z3CA 1IQFA 3STIA 1NZQH 3A86A 4D9QA 1AD8H 4ISLA 4ABJA 1A4WH 2GZ8A 4IS5A 2WPMS 1YPKH 4ABGA 1HIAA 3A81A 3CS0A 3BTKE 4DOQA 1GVKB 4IN2A 3RDZA 1EOJA 2BQWB 6LPRA 3ATKA 3UNQA 1SGCA 2HNTE 1H8IH 1K21H 1N8OB 1ZSKA 2J38A 2TGAA 1C2JA 1EPTA 1TX8A 1RTFB 1O3BA 1A3EH 4MNWA 3TGJE 3SQHE 3KF2A 4JZFH 5AHGH 3V12A 3Q3YA 1WTHD 4FUCA 1O3FA 1XXDA 2ZDVH 5K7RA 1EPTB 4BAQB 1C1QA 5F03A 3SOSA 1DPOA 1O39A 1U6QA 4ZXYH 1ARCA 2VJ1A 2BD3A 1GMDF 1T7CA 2J92A 2ZDLA 3F6UH 3ZZ7A 2J9NA 4Y79A 3AAVA 3SJIA 1O2OA 1TMBH 4BOHA 1F5RA 3D23A 3SW2B 3V7TA 1CHOG 4AGKA 2GMTC 3H5CB 4ISIH 4XBBA 1QA7A 2PV9B 1QA0A 1XUFA 1WAYB 2P3UB 1GI1A 1NESE 2ZGXH 1P9UA 3U1JB 3H7OA 3ENSB 3SV2H 1O3PB 5A0CA 3VGCB 1Z8IB 2ZO3H 7GCHF 1YPJH 3EAJA 3UR6A 2I6QA 1FY1A 1T8NA 3SJ9A 2ZHWH 3Q77A 1GBIA 1C5SA 3LC3A 1W12U 1XUKA 3D65E 4Y6DA 5HM9A 1HJ9A 4NWLA 3TITA 5E0JA 3UR9A 1FAXA 4ESTE 2BDBA 3UQVA 3P17H 3HATH 2ZFTA 2Z7FE 2SGPE 3E91A 3M7UA 4RKJB 2G52A 3GY3A 4AOQA 4TPIZ 1O5CB 2GD4B 1E36B 2JETC 1SI5H 4R8TB 4XBDA 3HPTB 4XFQA 3D49H 4DURA 3RU4E 3AAUA 1GDUA 3LJJA 1YF4A 4A6LA 2A5IA 1HBTH 4X8UH 3E16B 1DT2A 5GCHF 1OYQA 1K1OA 3A8CA 3GY6A 1AKSA 4UFGH 2GCHG 4AB9A 2XYAA 1YCPK 3TJUA 1IQGA 4Y0ZE 4DIIH 6CHAB 4X6NA 2OBOA 1CU1A 4E05H 3GY7A 3TK6A 1HRTH 4NA9H 4FU9A 1Z1JA 3FAOA 4BAMB 2GV6A 5DP6A 4QT8C 4Q80A 4Y71A 3R3GB 1A61H 2UUJB 3PTBA 4K8BA 1O5BB 2G00A 4WMFA 1GBTA 3Q3XA 2STBE 4YT6H 2OC1A 1O3IA 2HGTH 1KTSB 3PTNA 1T8OA 3A7XA 1O2WA 3OYPA 3TJOA 3STJA 4DVAU 3PROA 4GCHG 5DGJA 2BD7A 1A7SA 1NC6A 4J1YA 1CGJE 1ELCA 2BLQA 5L30H 1K1NA 5EU8A 1O2NA 1SMFE 1BUIA 3GY8A 1QBVH 1XVMA 1GGDB 1EX3A 1FPHH 2A4QA 4Y10E 3SUGA 3SHCH 2P16A 1O2PA 5EXLA 3FANA 5FAHA 1GJ9B 2Q1JA 3A89A 1ESAA 2C3SA 3AASA 1QBNA 2TIOA 3CS7A 4U32A 1FIZA 1SSXA 3QWCH 1EQ9A 1HJAB 2PR3A 1TPOA 1OP8A 2XCFA 2RCEA 2ZECA 1ZRBA 1OP2A 1DFPA 2ANYA 3QDZB 3SQEE 3VB5A 1NRQH 5E0HA 3T28A 1K9OE 2ZPQA 1GMHF 2W7UA 1SGTA 3LJOA 3ATLA 2O9QA 1V3XA 5C3NA 3RXPA 1KDQA 1GI3A 1TMUH 3E6PH 3SV6A 4JZEH 2M5TA 1LVOA 2PLXA 2A4OA 3PO1C 5T6DA 4XSKU 4CREA 3PMBB 1MUEB 2G81E 2XXLA 4CHAB 2VIWA 1DLEA 1HAVB 1ZHPA 1CT4E 1ZJDA 3SHAH 5EXNA 4K5ZA 3ZZDA 1TQ0B 4U30A 3SV8A 3AW1A 1GL1A 2NWNA 3PB1E 4Q2KA 2Z9LA 4WVPE 2W3IA 1EJAA 1HAVA 1HAGE 4GVUA 2ZA5A 3TJNA 3U9AH 1GHBF 1T8LA 3EA9A 3P8FA 1O3JA 1V2ST 2ZFQH 2BD9A 1BITA 2FTMA 2VIQA 1LQEA 3ZVGA 1DXWA 3L33A 2Z3EA 1ZR0A 1XM1A 2F9OA 1UTNA 1MBQA 1GBHA 1S84A 4HTCH 3ATWA 2UUFB 3BTHE 2ZHQH 1JWTA 2F9NA 1DDJA 2Y5GA 4ASHA 2QGRA 4X2VA 1TRNA 4TWYA 4BXSA 6ESTA 1AO5A 1HAPH 3SO3A 3HGPA 1WTGH 2ZTZA 3GDVA 1C1UH 3MO3A 3T25A 8GCHF 4UD9H 1VGCC 4NIWA 5L6NH 3E0NB 1S83A 1GVZA 2GZ9A 1UVSH 1Q31A 2ZEBA 7LPRA 1BTXA 1LPKB 3S69A 1C1MA 4F4OC 3K2UA 1RXPA 4WY3A 1TGNA 1O2IA 1O5GH 4JZ1A 1LHFH 1FZZA 1A46H 1ZMLA 4AFQA 1UVPA 1G3EA 4WJG2 2AMDA 4XDEA 1CVWH 3BIUH 1GBMA 5EGMA 1X7AC 1HAIH 4FUJA 2OINA 2OD3B 1QY6A 1G32B 2B8OH 2AIQA 2XC4A 3EE0B 1BTYA 1P06A 3T27A 4BTTB 1PQAA 3TK9A 2ZCHP 1GCTB 3UWJH 1V2WT 1PPZA 3C1KA 5EW2H 2EEKA 3Q3KA 1CGHA 1TBRH 1LVMA 2A31A 2G4TA 4MTBA 3VFEA 3RXSA 1PJPA 1PYTD 4YLUA 2RDLA 2HLCA 4YZUA 2QYIA 4NIVA 3RXCA 3EGKH 4GAWA 4UONA 4Y0YE 2JETB 4DJZB 4U01A 1HDTH 2QCYA 2JH0D 1GMCG 2VVCA 3UNRA 5PTPA 1YPEH 4NSVA 4CRDA 1UTMA 2ZFSA 1G36A 2A1DB 3MOCA 1VGCB 2ZTXA 4ISHH 1RIWB 2FTLE 1TGSZ 2H1UA 1C1OA 1GHYH 2PW8H 2WPJS 2ZFFH 3GCTF 3RC6A 1NRPH 2XCNA 3SU4A 3BG4B 2Y81A 2FZZA 2NU4E 2WUCA 3MU4A 1BRCE 1GBFA 1DUEA 1FONA 3A85A 1V2JT 1FQ3A 5JBTA 4K60A 4WMEA 5DP3A 1SLUB 1TIOA 1O0DH 1TX6A 1DANH 1SFQB 1BMMH 1P2NA 1SPJA 1B7XB 4I8KA 3BV9B 3TK5A 3W95A 1GCTC 4Y8YA 3M3TA 1HB0B 2GVFA 2SNWA 2EI6A 1D9IA 2GT8A 1IHTH 3A7WA 3KQDA 1N6XA 1C2DA 5GPIB 1TRYA 3MH4A 2GGVB 1C1NA 1P57B 4KTUA 1A5HA 2FOFA 1FNIA 2VH0A 1OP0A 4HI3A 1C4V2 1SBWA 2HALA 4TY6A 4AYYB 1GI4A 3QK1A 4CRAA 1GL0E 1BTZA 2PKSC 4WH8A 3QZQA 1SQTA 4Z6AH 1FLEE 1PPGE 2VWLA 3UUZA 3N7OA 2A2QH 2FI3E 1PQ7A 1MTWA 1DSUA 3BTGE 1ETRH 3RM0H 1SR5C 1AFQB 2GCTB 1V2QT 2ZPSA 3BIVH 2LNCA 3MNSA 1PPFE 4K1TA 4AGJA 1C5MD 1DVAH 1NRRH 5DJ7A 5FPYA 2R2MB 3K9XB 3PYHA 3RXEA 2JH6D 1WBGB 3BTFE 4GHTA 1LPGB 1IQHA 2V35A 5EPNA 2BOKA 2JKHA 1P02A 1G3CA 1O2QA 5CHAC 1F7ZA 2J94A 3PWCA 2BLWA 4HZHA 1V2NT 1C2FA 2I6SA 2SFAA 2DE9A 4OS1A 5EQSA 1GJ8B 1KXCA 4ABFA 3LPRA 1C9PA 2Z9JA 3O8DA 1O3GA 1TNIA 1A0LA 4CRFA 1YYY1 2GZ7A 1GI9B 1TX7A 1QFKH 2R0LA 4LZ1H 4UFEH 4KKDA 1V2VT 1VITG 1TNLA 2PTCE 4IC5A 3RXLA 5C67A 1ELBA 1MCTA 2FYQA 3LT3A 2A45B 3HK6B 1Y5UT 1C5YB 4NCYA 4H42U 1V2LT 2P95A 3LGYA 3RXKA 1RFNA 3P95A 1AZ8A 3LIWA 3LOXA 3FP8E 3MH5A 2BD4A 3S7HB 2QN5T 3PLKA 1C4Y2 1EP5A 1NO9H 1K22H 2O8UA 3A7YA 2UWLA 3ITIA 2TGPZ 3URDA 3TVJB 2XNIA 3S7KB 1KXFA 1A5GH 1MZAA 4YTAA 4IN1A 4NGAH 1OS8A 1BQYA 1UK4A 2XWAA 3ZV9A 5JBAS 1V2RT 2ZU4A 2ZQ2A 1UJ1A 1ABJH 1UVUH 2WYGA 5JB8S 2G5NA 1J15A 4NA8A 1H9LB 2VWMA 2BY7X 1O2ZA 3LU9B 1FY4A 2A2XH 3FFGA 2BZ6H 1C1RA 1SLVB 1BDAA 4CRBA 3F9GA 1GHAF 4I8JA 5BRRE 1C2MA 1D3PB 4WMDA 1N1LA 3EQ0H 2XC5A 2P59A 2XBVA 2XTTB 1YPHE 8GCHG 2F83A 3MYWA 1C5VA 4OGXA 4E7RG 1QB6A 1OOKB 4GCHF 5HGGA 3GDUA 5DKMA 1WYKA 3KEEA 5K0HA 1ZSJA 5EPYA 4INHA 3ZYEA 2F9PA 2A7HA 3SU2A 3VPKA 3RXQA 1D6RA 1O2SA 1G9IE 7GCHG 4ISNA 1AI8H 1QB9A 4MPXA 1GMHG 3SU0A 5JYIA 1WUNH 5DK1A 4B75A 4MDSA 4JZIA 2CF8H 1NY22 1NFXA 4X1SU 3SU5A 3DT0H 1H9HE 2BLOA 4OS7A 1Y59T 1J14A 1MTNB 1SVPA 2NU3E 1GMDG 2NU0E 1GBBA 1F0TA 5FCRA 1OKXA 3U69H 3ZZ4A 4RKOB 4FVBA 1O2JA 4ABBA 9ESTA 1GHWH 1D3DB 1YKTA 1J17T 4DY7B 3GISB 1CBWB 1LCYA 2RA0A 2BXTH 1BBRH 4HGCA 1WQSA 2V6NA 3A87A 2AFQB 1BTPA 3M7TA 2RG3A 1GBDA 1DS2E 1T31A 1OWKA 3B8JA 3M5MA 5E8EH 1EZXC 4FU7A 3G01A 3HK3B 1TMTH 1QRXA 1HCGA 2BM2A 2G4UA 1ETSH 3S0NA 1IQMA 1GJ7B 3MU0A 2ZWLH 4BAHB 4IBLH 1B0FA 2BX4A 3TNTA 4LXBH 1MBMA 1RIWC 1NFUA 5E2PA 1O33A 4F49A 2OC7A 2QF3A 1HAYB 3PV4A 1K1MA
chains in the Genus database with same CATH superfamily
1A5IA 1TNGA 3UOUA 3SJOA 2F9BH 3RP2A 5LGOA 5HIYA 3M3SA 1P0SH 1UMAH 2FI4E 1MQ6A 4X1QU 2YMSB 1WDIA 2A32A 3VB3A 4TYDA 4ZMAH 1TNJA 1HAOH 5F53A 4YO9A 1UHBB 5CE1A 1IQEA 1ZOMA 4DT7B 1YCPM 1PQ5A 1AUJA 1EFRD 4FUDA 3WWBA 4OS2A 1XVOA 1EZQA 1FPCH 3ZZAA 1C4U2 1XMNB 1AVGH 3MH7A 3W94A 2W5EA 2NU1E 2Y80A 4UFDH 2BTCE 3BTQE 4ISOA 3PWBA 1XUIA 2ZU1A 4OGYA 3SNBA 2FIRH 1W3CA 1RD3B 4X8SH 4D76A 5C2ZA 1GJDB 1Y3UA 4VGCB 5DN6D 1IQKA 1P2KA 2AMPA 5GCHG 3LKWA 1DY8A 2BZAA 4X1NU 1RTLA 2D8WA 1O2MA 2QA9E 5HIZA 3SU6A 1NRSH 4H4FA 1EAIA 1O5AB 4AN7A 3RXFA 1VCPA 3KQ5A 2PGQB 3HGNA 2ZU5A 2FS8A 5AVDA 1HAXB 2ZPRA 4ABEA 2ZI2H 1DE7H 3P8NA 4TPYA 1GHXH 2RA3A 3OE7D 2WPIS 1K2I1 5DP5A 1BRBE 3JZ1B 1C5ZB 3A7TA 5DP9A 1IQIA 3MNCA 1DICA 5FPTA 2FOMB 4NFEA 5TCCA 5JPMH 1TAWA 4ABHA 1P12E 4FVDA 3MU1A 3SUEA 1ZHMA 4JYUH 1BHXB 1NFWA 3EYDA 2XBYA 5EQQA 1TOCB 1SQOA 4XD7D 1V2MT 1EB1H 4YOIA 4LK4A 4AG2A 5EG4A 3RU4T 5EODA 2BY5X 3BTME 3S9AA 3TJVA 1UW7A 2C8XB 1TA2A 2JH5D 4I86A 3JZ2B 2C8ZB 1KDQB 1C2HA 1Q2WA 3QZRA 5EJ1A 1J9CH 1QR3E 2H6MA 2WPKS 1ZPBA 1GBLA 4DIHH 2ZG0H 1VCQA 5FPSA 2QXIA 3F68H 1BBRE 1E0FD 2ZP0H 4H6TA 1QURH 2KCAA 2L74A 1P2IA 4DW2U 4CBOA 1GBCA 2EI8A 3M5LA 2ESTE 3PMJA 3GY2A 1QNJA 1MKXH 3UY9A 3D62A 4RT0A 3O8RA 2ODYB 1AWHB 1THPB 5JB9S 1BCUH 4RSPA 2P93A 3MU8A 5CHBA 1E35B 2ZGBH 2XBWA 1NBMD 2A5AA 3N7EA 1GHAG 1C9TA 4J2YB 4NWKA 3RLYH 1N8OC 3SU1A 1YCPH 2WSSD 1L4ZA 2FOCA 2P3TB 4JK6A 3LGUA 1Y8TA 1SGDE 3P70B 1TQ7B 5T3HA 2H9TH 3TGKE 1LKBA 4X6PA 2WINI 3MNBA 5ETXA 3ZZ6A 1OX1A 1EPTC 1GI8B 1MAYA 1SGFG 3MNXA 3M36A 5AF9H 1NT1A 2BY8X 4I8LA 2VIVA 1D6WA 1ANBA 1O2GH 2FS9A 3OU0A 3K65B 4AFSA 1EAUA 1S85A 2CHAC 1TALA 4Q63A 1L4DA 1CE5A 3ODFA 5DG6A 1BRUP 5HXFA 2F9VA 1W0ZU 1INCA 3OY6U 4YM9A 2QXHA 4ZKSU 3M5NA 2VINA 4FUBA 3A83A 5E2OA 1AE8H 3HKJB 2BVRH 1O2YA 2PSYA 4AB8A 2FESH 3LDXH 3M5OA 1ZSLA 2OK5A 3SYJA 2AGEX 3OY5U 3RMMH 4YOJA 3SJKA 1L1GA 3NUMA 1SOZA 1H9IE 3ZZ3A 1ANEA 1SFIA 1TGTA 3KGPA 1WQVH 2QXJA 1O2VA 2VGCB 5EXMA 2K0QA 3GCHC 2GP9B 4YESB 4UEHH 2K1QA 3RXDA 2GDEH 2FWWA 1K1LA 2OCVB 2KCOA 1MU6B 2A4RA 1L2EA 4R0IA 1HFDA 3A88A 2JIZD 3SNDA 1DUAA 4IMZA 1WCZA 4RN6A 1OWJA 1P05A 2Z9KA 1AN1E 5C1UA 1PPHE 2Z9GA 2ZDKA 2FDAA 4X2YA 1SL3A 2OBQA 4B74A 1NU7B 4PROA 4WXVA 1HAZB 2CN0H 1DWEH 4INKA 2FOHA 1DX5M 1GBJA 1RGQA 3FZZA 4Y76A 4ZXXH 3TH2H 3CENA 4JMYA 5I25A 2VWOA 4NA7A 2QV1A 4ZHLU 1ARBA 2ZZUH 1HIAB 3M7QA 4E7NA 4K1EA 1MU8B 3BEUA 2STAE 1QBOA 5EJLA 4Q4LA 4I8GA 5G4BA 2GKVE 1GG6C 1W14U 3TGIE 2ZF0H 1H8DH 3U1IB 3F2GA 2WV9A 1O3NA 2EY4C 1GBKA 1Z71A 4X1PU 3RMLH 5TJXA 1Q3XA 2AS9A 3ZZBA 1QQ4A 1GJAB 2SGQE 1O2UA 3HKIB 1SGNE 1W13U 2AYWA 5EW1H 3GCHB 4D7GA 1AU8A 2C90B 2PSXA 2CMYA 3BTTE 1O31A 2VU8E 2FXRA 2A5KA 3MHWU 1G2MA 2XWBI 3BTEE 1ESBA 5DO4H 3T5FH 5J4QA 1S6FA 1AMHA 1GJ5H 4M7GA 4BAKB 4ZHMU 2SGAA 1EZSC 1MCVA 5C94A 2FPZA 2HRVA 2EC9H 2ALPA 1QJ7B 1P03A 1O2TA 1P8VC 1QZ8A 1RTKA 3QTVH 3RXBA 1NPMA 2H2ZA 5DP7A 1VCWA 1AUTC 2VIOA 2EI7A 1ABIH 3NXPA 1LMWB 4CRCA 1KLTA 4JZDH 5IK2D 1ELEE 1C5UA 1IAUA 2RDEA 2IOTA 1EJNA 1MKWH 2BY6X 4JK5A 4THNH 1AHTH 3VXEH 2WYJA 1LVBA 1O32A 2AMQA 4KTCA 1EXFA 1FDPA 2AGGX 3LGWA 3SJ8A 1GCDA 8ESTE 2PTNA 2ZQ1A 2BDYA 4FU8A 4TSFD 2AH4X 2BHGA 3L6PA 4B71A 1C1WH 1KLJH 3SN8A 1UTLM 1V2OT 3VEQB 1YLDA 2BD8A 3ZZ8A 1AB9B 3BEIB 1UO6A 1V6DA 1RS0A 1O3KA 3SBKA 1CHOF 1O2LA 1AWFH 4MVNA 1V2UT 2UWPA 2VNTA 1T4VH 3QLPH 3VGCC 4MG3A 2HNTC 1O2HA 4LOYH 4B73A 1BZXE 1Y5AT 1K28D 2ODPA 2ZHDA 3P8GA 5A2MH 1F0UA 1EJMA 3F0OA 4FUGA 3U98H 4DG4A 3LGIA 1TNHA 2PWXA 2BY9X 4YOGA 2HLDD 3O8CA 3GICB 1FN8A 1EB2A 1ELVA 1HXFH 3UIRA 1TPPA 3GYLB 4B2CA 1VITH 2J98A 3RXJA 4ACBA 1XX9A 2WPLS 3RXRA 1KSNA 3SORA 4MQAA 2L6OA 3KYFA 4Q7ZA 1YPGH 2K8IA 1UHBA 3NWUA 4O9VA 2AIPA 1LDTT 2OXSA 2V3OH 4YT7H 1SLWB 3IG6B 1SC8U 1GHBG 1AQ7A 2ZDNA 2ZHFH 1N6YA 1QCPA 1EASA 1SLXB 1AKSB 4AORA 2RFKC 4ZHAA 4DT4A 3V13A 6CHAC 3QUMP 1ZZZA 2IJOB 4WH6A 1K0HA 1VR1H 3H7TA 2J95A 4ZKRU 3NZIA 1PFXC 3LGVA 1QL7A 2FLBH 1O38A 2Y82A 4O3TA 1XUGA 4ZKOU 4IGDA 2R3UA 2PHBA 5A8XA 4UFFH 3IITA 1FV9A 7KMEH 4ABDA 4CRGA 1GGDC 4Y8ZA 4UDWH 1BMLA 2O8TA 3M35A 2PFEA 1ZTJA 1JOUB 5C1YA 2CGAA 1P10A 1F0SA 1FIWA 3OX7U 1C5XB 3F0PA 4IW4E 3ZVBA 1E37B 3C27B 1M9UA 1XXFA 3OSYA 1AFEH 2H5CA 1FY3A 1NM6A 4OS5A 1J16A 2FEQH 1MZDA 1DITH 5A0BA 3UAIC 3MI4A 1Y3VA 3F3BA 1A3BH 1ESTA 4BAOB 1NS3A 1BT7A 1QJ6B 1HAHH 1FY5A 1T8MA 4GSOA 4IMQA 3TU7H 1Y3XA 1JMOH 3U28C 3ATIA 2KFWA 3MTYA 2ZC9H 2WUBA 4Q7YA 1TRMA 2SGDE 1ZLRA 4K69A 4Y8XA 4DCDA 3PO1B 1NU9A 2GMTB 3KIDU 1ANCA 9LPRA 3H09A 3S9BA 2ZDMA 2O8LA 3BTDE 1PYTC 3CNRA 1E38B 4NFFA 3U8RH 1UTJA 2FYRA 3SNAA 2ZFPH 1OWHA 4X8TH 4H6SB 2HPPH 3PLPA 3RXIA 1Y5BT 1FAKH 1SGFA 1Z1IA 5FX6A 2ILNA 4RI0A 4B76A 4ZAEA 4X2XA 1GG6B 1O3HA 2ASUB 5I46H 2B7DH 4CHAC 2G51A 5DP8A 1D4PB 1BIOA 3ZYDA 3ZVCA 2PUXB 1BA8B 1C5NH 1MKWK 3MWIU 1QRZA 3E90B 2F3CE 1J8AA 1Z8RA 2BVXH 1Z6JH 2V3MA 1HLTH 2UUYA 1ELFA 1MTSA 3BN9A 1YC0A 1G37A 3KN2A 3LGTA 1ZPCA 1QGFA 2SGFE 1ORFA 5GJ4B 2H5DA 1BRAA 1YGCH 3K6YA 1FUJA 3GOVB 1OSSA 4X0WU 2QXGA 5GIBA 3GCTG 4DGJA 1MTUA 3T29A 2AGIX 2GCTC 4FUFA 3PRBA 1VITF 1KIGH 3MU5A 1GJBB 3RXAA 1THSH 3R0FA 4Z0KA 1VZQH 2ANMH 4BTIB 1IQLA 2VBCA 2OLGA 4O3UA 2IN2A 4B1TA 2ZU3A 2BLVA 3TH3H 2V3HH 3M3VA 1GJCB 5HMAA 3MO6A 4AFZA 4U2WA 3SNEA 5CHAB 4Y11E 1P2JA 1TBQH 1TONA 4X1RU 1UCYH 5C5NA 4INLA 2Q6DA 2ALVA 1TWXB 1NFYA 4AFUA 3UNSA 2F4LA 1OWDA 4K8YA 3ATMA 3F9FA 2OC8A 3N99A 1C5WB 3MO9A 1YWUA 1ZGVA 4MNYA 4AX9H 2NU2E 1C5OH 5LPRA 4OS4A 2O8MA 3E3TA 3I78A 4ZH8A 1D3QB 1C2EA 1ACBE 4WWYA 2AEIH 2CV3A 2YMSD 4B6EA 1GMCF 4B6FA 2BVSH 1W11U 4ZKNU 2ZIQH 1O3AA 4KELA 1MD7A 3S9CA 2OUAA 3PMHB 1C2GA 1EOLA 1TPSA 2IPHA 4JYVH 3SV9A 1CT2E 1A1RA 5DP4A 2GDDA 1WU1A 1LKAA 3ELAH 1FJSA 3DFJA 3ESTA 4K3JA 2BOHB 2C93B 4WXIA 3VB4A 2XW9A 1HJAC 1XUHA 8KME2 1YY3A 2P3FH 1NN6A 1NTPA 1P2OA 3E0PB 3NPSA 4D8NA 2J4IA 3PMAB 1KTTB 1PPEE 5ESBA 3KYGA 1CO7E 3ZZ9A 4A92A 4YXWD 4I7YH 1E34B 2P94A 2QAAA 3P92A 1S0RA 4A1VA 5CDFE 1PQ8A 3TLOA 2B9LA 1KLIH 3QX5H 3KHVA 4CH2B 1DM4B 3UB0A 4XOJA 2VVUA 1SGIB 1DLKB 1Z8GA 3A80A 2ULLA 4SGBE 3T62A 1TB6H 4TWWA 2A7JA 4Y7BA 1AZZA 5C17A 3RXTA 4BTUB 3EA8A 1HPGA 2OP9A 3KQEA 3PM3A 2XNDD 3LH3A 5EQRA 1OHHD 2TGDA 1MMJN 2PKAA 1JXPA 1SGYE 1G2LA 1HNEE 5JBBS 1JRSA 3ZVAA 1IQNA 3KL6A 2EA3A 4D7FA 2XC0A 1O3MA 2PKAB 3GY4A 1O37A 5GXPA 4GHQA 2B0FA 2FOBA 4A1TA 4GUXA 1GI6A 4MPWA 3MQKC 2ZGJA 1HJ8A 1L1NA 1P3EA 3SNCA 3UOPA 4TY7A 4Y7AA 1NRNH 3SUDA 3AVZA 1P3CA 2UWOA 3QTOH 5FCKA 1SGPE 2FX4A 1TPAE 1C2KA 2ANKH 3EDXB 1OXGA 1V2PT 1SHYA 5IDKA 3Q00A 1GDNA 1K1IA 1C5PA 2BD2A 2PKSB 1RRKA 1QL8A 3DD2H 1GDQA 1CA8B 4MPVA 1O5EH 2OQUA 2Q6GA 3GYMA 5A0AE 1GBEA 1S81A 1Y3WA 4FUIA 3RLWH 1S6HA 3P8OA 1WV7H 3ZVDA 4X2WA 2J97A 2ZDAH 1UCYK 1MH0A 1O3DA 3SGBE 2CJIA 1C2IA 1FI8A 2KCPA 4MNVA 1AFQC 5KGOA 2FOAA 5FBEA 1COWD 1UTOA 5KEDA 3RXOA 1UTQA 1P04A 1FXYA 3SZNA 2EQNA 1VJ9U 3GDSA 4BANB 1AGJA 1AE5A 3RC4A 1KY9A 2C8WB 3PRDA 1LTOA 3ZIAD 1P11E 1W10U 2WV5A 2W7SA 2VIPA 5AFZH 5H4IB 1K1JA 1BJUA 1BHXF 2BMGB 5A09A 2P8OC 1C5TA 3GCOA 3UPEA 2FOGA 4ACAA 3AK5A 2Z3DA 1PPCE 1BB0B 1TFXA 1QHRB 1YBWA 1C5LH 1ELAA 4FOUC 2GT7A 1S5SA 2FM2A 4HFPB 1XUJA 2A0QB 1GVLA 1KXBA 5L2ZH 2VB0A 2KAIA 1FMGA 1V2TT 2W3KA 2J34A 1EAXA 2ODQA 2YNAA 2QE7D 5EJZA 1CT0E 1F5LA 1GHZA 3F9EA 3VB6A 3WY8A 1KXEA 1UCYE 2HPQH 4JYTA 1TYNA 3U8OH 4AYVB 2C8YB 2QY0B 2QIQA 1JIMA 2KAIB 3OTJE 2G5VA 1WSSH 3BG4C 3QGJA 2KR7A 3AW0A 2HVXA 1YPLH 4JCNA 5FX5A 3RMNH 4Q7XA 3FP7E 3UWIA 2ZHEH 2G55A 1UK3A 2PGBB 1O34A 4ASUD 1HUTH 5F8ZA 1L0ZA 4FXGH 3UREA 1O3OA 3LONA 1TLDA 2YNBA 3QGNB 4O97A 1LO6A 3QO6A 3UTUH 2OTVA 2HWLB 1MQ5A 1MTNC 1DY9A 1TGBA 2AERH 4NZQA 1O2XA 4XBCA 1P2MA 1MKXK 2BYAX 3A82A 4ABIA 1T32A 1XKAC 3RU4D 1ANDA 1C1PA 3SGQE 1CBWC 5C1XA 3BG8A 4TT3D 1UK2A 1JRTA 5EOKA 1ETTH 1V2KT 2Z94A 4K2YA 1QRWA 1LQDB 3BF6H 3SI3H 1LVYA 1C1VH 4MPUA 5A8ZA 2JDID 1RJXB 2F9UA 3OEHD 1XKBC 4I32A 2FO9A 1GI0A 3KCGH 1SOTA 1TOMH 2OC0A 1O2KA 3T2NA 4D9RA 2TPIZ 4HG6A 1CHGA 1UVOA 1DOJA 2H9EH 1EP6A 3NK8A 5C0TA 1GBAA 3E8LA 2Y6TA 2BDIA 2SGEE 2XBXA 1T4UH 2Q6FA 4B2BA 1TE0A 2B5TB 3F9HA 2BD5A 3TNSA 1YLCA 3ODDA 3CP7A 1AY6H 2D1JA 5HM2A 1EUFA 4I33A 1HV7A 1SQAA 3RXVA 1O30A 1G3DA 1KXAA 1YM0A 4IC6A 3E1XB 2VVVA 2SNVA 2C4FH 4CBNA 1LPZB 2M2AA 1ZMJA 1KXDA 5C20A 1O3LA 5FBIA 2QF0A 1VKYA 1P9SA 1ZTLA 2OQ5A 1ZPZA 4RT1A 3WWFA 4FETA 2WV4A 2FX6A 1MAXA 3SGAE 2BDCA 5JBCS 5FHTA 2THFB 4KP0A 2BB4A 2J98B 1IQJA 4K1SA 3RC5A 1QTFA 1CSOE 5AFYH 1SGQE 1GJ6A 2KM0A 1HXEH 1Z8JB 3SUFA 4BNRA 3RM2H 1TABE 4NZLA 1GWAA 1O3EA 2BDAA 4MNXA 1JIRA 2G8TA 1O5DH 3KQCA 3LC5A 2A4GA 3O8BA 2D2DA 2FODA 3V0XA 3FOAA 3NKKA 2O8WA 2VIDA 1BJVA 1ZGIA 5FXLA 1O5FH 5CMXH 1C2LA 2BDHA 1DSTA 3KQBA 3DFLA 3SV7A 1ZJKA 2XRCA 2F91A 1EATA 1LHDH 2ZU2A 1UVTH 2LELA 1SG8B 2A7CA 1H8ED 1SHHB 3SU3A 1W7GH 2VH6A 1BMNH 1S82A 1C1TA 3A8BA 4O03A 2ZNKH 3SZEA 1UTPA 1VJAU 3EA7A 1FY8E 1HYLA 4KGAA 4WF8A 1OYTH 3RUOA 5A8YA 5GWZA 5C5OA 1YLNA 1WOFA 1O35A 1ELGA 1ZRKA 1CGIE 3U8TH 2J2UA 1GI5A 2R2WU 2ZGHA 2HNTF 2LPRA 2LP6A 1YPHC 1P09A 2CF9H 2BX3A 6GCHG 1MTVA 3A84A 2FLRH 5B6OA 1EKBB 3K6ZA 1H4WA 4KTSA 1CA0C 4A1XA 5TCAA 1W2KH 2GX4A 3VG8A 1ZYOA 1QB1A 1TA6A 1JBUH 3VB7A 3ZZCA 1LHEH 3FVFB 1Z6EA 7ESTE 2ZCKP 1DWCH 2GCHF 1EAWA 2P8OB 4GLYA 3M61U 4LZ4B 3MFJA 1D3TB 3DA9B 2CXVA 2UUKB 4B2AA 2R0KA 5ESTE 3TH4H 1K1PA 1F5KU 3IWMA 3ZZ5A 1PPBH 5GDSH 3UFAA 4ABAA 1AIXH 1B5GH 1TGCA 4AZ2B 1F2SE 1OWIA 3A8AA 3RXMA 1EZUC 1O2RA 2BDGA 2DUCA 5T6FA 3TPIZ 3T26A 2BQ6B 1BTWA 1ID5H 3FZDA 1ELDE 4SGAE 2R3YA 1A2CH 1SGRE 1FN6A 3ZVEA 3BTWE 1C5RA 2ANWA 4UE7H 1NROH 1P2QA 1GHVH 5F8XA 5EIYA 1BTHH 1W0YH 1B0EA 2ZTYA 4NG9H 5LPFA 1OPHB 1CQQA 3ZVFA 3UQOA 1GI7B 1CA0B 3RMOH 1DXPA 3MMGA 4AG1A 2BQ7B 2FOEA 1SGEE 3P6ZB 5HKKD 3NRLA 4NIXA 2HOBA 2R9PA 2Y7XA 5T6GA 5LPEA 3L3TA 4X8VH 4YLQH 3LH1A 4I31A 2TRMA 3GY5A 5IYTA 5BPEA 1LHCH 3FP6E 1IOEA 1ELTA 2Y5HA 1P01A 3BSQA 4GPGA 1F0RA 3DUXH 3KNXA 3QN7A 5L2YH 1F92A 4ZROA 1GI2A 4OS6A 1O36A 1DWBH 3RXUA 1H8HD 2CHAB 1O3CA 4VGCC 2W26A 2JJ1D 1G30B 1HGTH 1S6LA 1DWDH 3GS9A 8LPRA 5JDUB 1GPZA 1W7XH 1C1SA 2BXUH 5F6MA 3BEFB 1AB9C 2GTBA 1YPMH 4ZUHA 3A8DA 3NCLA 2D26C 2IJD1 3ZV8A 4BXWA 2Z9IA 1BOQA 3GCNA 2QC2A 5DPAA 5C0UA 1ZMNA 1BBRK 2ZCLP 4CR9A 5HYOA 1UTKA 4F55A 2KCYA 2PUQH 2H9HA 1A0JA 1H1BA 1L1JA 2ZGCA 3PLBA 4X6MA 3VXFH 3M37A 1W8BH 3SI4H 2FP7B 2WPHS 1BMAA 1ZHRA 1G3BA 1C5QA 1QIXB 1YP9A 3F1SB 3PV2A 5J4SA 2ZKSA 1MD8A 3MH6A 3I29A 3A7VA 4E06H 4FUEA 2TGTA 2VGCC 2TBSA 4FUHA 3Q76A 2Y7ZA 4MLFB 3URCA 4X6OA 4CR5A 3RXHA 3V3MA 1QJ1B 1SB1H 5E0GA 3TIUA 1AVXA 2V0BA 2VWNA 3DHKH 2DE8A 1Z7KA 3F2FA 1BTUA 1A0HB 1ZTKA 4I8HA 1Y3YA 2Y5FA 5F8TA 1TNKA 2YOLA 3B9FH 2FI5E 2QF5A 1QL9A 3I77A 1AVWA 4XRNA 4NIYA 2FMJA 1OWEA 1LHGH 3RXGA 1GJ4H 5LH8A 1KYNA 4A5TS 5ABWA 2GV7A 1THRH 2ZFRH 1QQUA 3A7ZA 4NSYA 2Z6BD 4CH8B 4XE4A 5SGAE 6GCHF 1TBZH 3B23B 1IHSH 4A7IB 1S0QA 2Z3CA 1IQFA 3STIA 1NZQH 3A86A 4D9QA 1AD8H 4ISLA 4ABJA 1A4WH 2GZ8A 4IS5A 2WPMS 1YPKH 4ABGA 1HIAA 3A81A 3CS0A 3BTKE 4DOQA 2W6JD 1GVKB 4IN2A 3RDZA 1W0KD 1EOJA 2BQWB 6LPRA 3ATKA 3UNQA 1SGCA 2HNTE 1H8IH 1K21H 1N8OB 1ZSKA 2J38A 2TGAA 1C2JA 3WW7A 1EPTA 2GJGA 1TX8A 1RTFB 1O3BA 1A3EH 4MNWA 3TGJE 3SQHE 3KF2A 4JZFH 5AHGH 3V12A 3Q3YA 1WTHD 4FUCA 1O3FA 1XXDA 2ZDVH 5K7RA 1EPTB 4BAQB 1C1QA 5F03A 3SOSA 1DPOA 1O39A 5T1VA 1U6QA 4ZXYH 1ARCA 3DSGA 2VJ1A 1BMFD 2BD3A 1GMDF 1T7CA 2J92A 2ZDLA 3F6UH 3ZZ7A 2J9NA 4Y79A 3AAVA 3SJIA 1O2OA 1TMBH 4BOHA 1F5RA 3D23A 3SW2B 3V7TA 1CHOG 4AGKA 2GMTC 3H5CB 4ISIH 4XBBA 1QA7A 3DSPA 2PV9B 1QA0A 1XUFA 1WAYB 2P3UB 1GI1A 1NESE 2ZGXH 1P9UA 3U1JB 3H7OA 3ENSB 3SV2H 1O3PB 5A0CA 3VGCB 1Z8IB 2ZO3H 7GCHF 1YPJH 3EAJA 3UR6A 2I6QA 1FY1A 1T8NA 3SJ9A 2ZHWH 3Q77A 1GBIA 1C5SA 3LC3A 1W12U 1XUKA 3D65E 4Y6DA 5HM9A 1HJ9A 4NWLA 3TITA 5E0JA 3UR9A 1FAXA 4ESTE 2BDBA 3UQVA 3P17H 3HATH 3F2HA 2ZFTA 2Z7FE 2SGPE 3E91A 3M7UA 3FN8A 4RKJB 2G52A 3GY3A 4AOQA 3EE7A 1KMHB 1O5CB 4TPIZ 2GD4B 1E36B 2JETC 1SI5H 4R8TB 4XBDA 3HPTB 4XFQA 3D49H 4DURA 3RU4E 3AAUA 1GDUA 3LJJA 1YF4A 4A6LA 2A5IA 1HBTH 5KECA 4X8UH 3E16B 1DT2A 5GCHF 1OYQA 1K1OA 3A8CA 1SKYE 1AKSA 3GY6A 4UFGH 2GCHG 4AB9A 2XYAA 1YCPK 3TJUA 1IQGA 4Y0ZE 4DIIH 6CHAB 4X6NA 2OBOA 1CU1A 4E05H 3GY7A 3TK6A 1HRTH 4NA9H 4FU9A 1Z1JA 3FAOA 4BAMB 2GV6A 5DP6A 4QT8C 4Q80A 4Y71A 3R3GB 1A61H 2UUJB 3PTBA 4K8BA 1O5BB 2G00A 4WMFA 1GBTA 3Q3XA 2STBE 3DCLA 4YT6H 2OC1A 1O3IA 2HGTH 1KTSB 3PTNA 1T8OA 3A7XA 1O2WA 3OYPA 3TJOA 3STJA 1FX0B 4DVAU 3PROA 4GCHG 5DGJA 2BD7A 1A7SA 1NC6A 2PP6A 4J1YA 1CGJE 1ELCA 2BLQA 5L30H 1K1NA 5EU8A 1O2NA 1SMFE 1BUIA 3GY8A 1QBVH 2J5UA 1XVMA 1GGDB 1EX3A 1FPHH 2A4QA 4Y10E 3SUGA 3SHCH 2P16A 1O2PA 5EXLA 3OFND 3FANA 5FAHA 1GJ9B 2Q1JA 3A89A 1ESAA 2C3SA 3AASA 1QBNA 2TIOA 3CS7A 4U32A 1FIZA 1SSXA 3QWCH 1EQ9A 1HJAB 2XOKD 2PR3A 1TPOA 1OP8A 2XCFA 2RCEA 3FO8D 2ZECA 1ZRBA 1OP2A 1DFPA 2ANYA 3QDZB 3SQEE 3VB5A 4F48B 1NRQH 5E0HA 3T28A 1K9OE 2ZPQA 1GMHF 2W7UA 1SGTA 3LJOA 3ATLA 2O9QA 1V3XA 5C3NA 1E1RD 3RXPA 1KDQA 1GI3A 1TMUH 3E6PH 3SV6A 4JZEH 2M5TA 1LVOA 2PLXA 2A4OA 3PO1C 5T6DA 4XSKU 4CREA 3PMBB 1MUEB 2G81E 2XXLA 4CHAB 2VIWA 1DLEA 2KZ4A 1HAVB 1ZHPA 1CT4E 1ZJDA 3SHAH 5EXNA 4K5ZA 3ZZDA 1TQ0B 4U30A 3SV8A 3AW1A 1GL1A 2NWNA 3PB1E 4Q2KA 2Z9LA 4WVPE 2W3IA 1EJAA 5DSFA 1HAVA 1HAGE 4GVUA 2ZA5A 3TJNA 3U9AH 1GHBF 4M9FA 1T8LA 3EA9A 3P8FA 1O3JA 1V2ST 2ZFQH 2BD9A 1BITA 2FTMA 2VIQA 1LQEA 3ZVGA 1DXWA 3L33A 2Z3EA 1ZR0A 2JJ2D 1XM1A 2F9OA 1UTNA 1MBQA 1GBHA 1S84A 4HTCH 2W6ID 3ATWA 2UUFB 1E79D 2ZHQH 1JWTA 2F9NA 3BTHE 1DDJA 2Y5GA 4ASHA 2QGRA 4X2VA 1TRNA 4TWYA 4BXSA 6ESTA 1AO5A 1HAPH 3SO3A 3HGPA 1WTGH 2ZTZA 3GDVA 1C1UH 3MO3A 3T25A 8GCHF 4UD9H 1VGCC 4NIWA 4P00A 5L6NH 3E0NB 1S83A 1GVZA 1MABB 2GZ9A 1UVSH 1Q31A 2ZEBA 7LPRA 1BTXA 1LPKB 3S69A 1C1MA 4F4OC 3K2UA 1RXPA 4WY3A 1TGNA 1O2IA 1O5GH 4JZ1A 1LHFH 1FZZA 1A46H 1ZMLA 4AFQA 1UVPA 1G3EA 4WJG2 2AMDA 4XDEA 1CVWH 3BIUH 1GBMA 5EGMA 1X7AC 1HAIH 4FUJA 2OINA 2OD3B 1QY6A 3W1EA 1G32B 2B8OH 2AIQA 2XC4A 3EE0B 1BTYA 1P06A 3T27A 4BTTB 1PQAA 3TK9A 2ZCHP 1GCTB 4P02A 3UWJH 1V2WT 1PPZA 3C1KA 5EW2H 2EEKA 3Q3KA 1CGHA 2WPDD 1TBRH 1LVMA 2A31A 2G4TA 4MTBA 3VFEA 3RXSA 1PJPA 1PYTD 4YLUA 2RDLA 2HLCA 4YZUA 2QYIA 4NIVA 3RXCA 3EGKH 4GAWA 4UONA 4Y0YE 5FL7D 2JETB 4DJZB 4U01A 1HDTH 2QCYA 2JH0D 1GMCG 2VVCA 3UNRA 2IPQX 3N7DA 5PTPA 1YPEH 4NSVA 4CRDA 2WHXA 1UTMA 2ZFSA 1G36A 2A1DB 3MOCA 2AHME 1VGCB 2ZTXA 4ISHH 1RIWB 2FTLE 1TGSZ 2H1UA 1C1OA 1GHYH 2PW8H 2WPJS 2ZFFH 3GCTF 3RC6A 1NRPH 2XCNA 3SU4A 3BG4B 2Y81A 2FZZA 2NU4E 2WUCA 3OAAD 3MU4A 1BRCE 1GBFA 1DUEA 1FONA 1E1QD 1WXRA 3A85A 1V2JT 1FQ3A 5JBTA 4K60A 4WMEA 5DP3A 1SLUB 1TIOA 1O0DH 1TX6A 1DANH 1SFQB 1BMMH 1P2NA 1SPJA 1B7XB 4I8KA 3BV9B 3TK5A 3W95A 1GCTC 4Y8YA 3M3TA 1HB0B 2GVFA 2SNWA 2EI6A 1D9IA 2GT8A 1IHTH 3OEED 3A7WA 3KQDA 1N6XA 1C2DA 5GPIB 1TRYA 3MH4A 2GGVB 1C1NA 1P57B 4KTUA 1A5HA 2FOFA 1FNIA 2VH0A 1OP0A 4HI3A 1C4V2 1SBWA 2HALA 4TY6A 4AYYB 1GI4A 3QK1A 4CRAA 1GL0E 1BTZA 2PKSC 4WH8A 3QZQA 1SQTA 4Z6AH 1FLEE 1PPGE 2VWLA 3UUZA 3N7OA 2A2QH 2FI3E 1PQ7A 1MTWA 1DSUA 3BTGE 1ETRH 3RM0H 1SR5C 1AFQB 2GCTB 1V2QT 2ZPSA 3BIVH 2F43B 2LNCA 3MNSA 1PPFE 4K1TA 4AGJA 1C5MD 1DVAH 1NRRH 3OTPA 5DJ7A 5FPYA 2R2MB 3K9XB 3PYHA 3RXEA 2JH6D 1WBGB 3BTFE 4GHTA 1LPGB 1IQHA 2V35A 5EPNA 2BOKA 2JKHA 1P02A 1G3CA 1O2QA 5CHAC 1F7ZA 2J94A 3PWCA 2BLWA 4HZHA 1V2NT 2I6SA 1C2FA 2SFAA 2DE9A 4OS1A 5EQSA 1GJ8B 1KXCA 4ABFA 3LPRA 1C9PA 2Z9JA 3DSOA 3O8DA 1O3GA 1TNIA 1A0LA 4CRFA 1YYY1 2GZ7A 1GI9B 1TX7A 1QFKH 2R0LA 4LZ1H 4UFEH 4KKDA 1V2VT 1VITG 1TNLA 2PTCE 4IC5A 3RXLA 5C67A 1ELBA 1MCTA 2FYQA 3LT3A 2A45B 3HK6B 1Y5UT 1C5YB 4NCYA 4H42U 1V2LT 2P95A 3LGYA 3RXKA 1RFNA 3P95A 1AZ8A 3LIWA 3LOXA 3FP8E 3MH5A 2BD4A 3S7HB 2QN5T 3PLKA 1C4Y2 1EP5A 1NBME 1NO9H 1K22H 2O8UA 3A7YA 2UWLA 3ITIA 2TGPZ 3URDA 3TVJB 2XNIA 3S7KB 1KXFA 1A5GH 1MZAA 4YTAA 4AC9A 4IN1A 4NGAH 1OS8A 1BQYA 4ZCNA 1UK4A 2XWAA 3ZV9A 5JBAS 1V2RT 2ZU4A 2ZQ2A 1UJ1A 1ABJH 1UVUH 2WYGA 5JB8S 2G5NA 1J15A 4NA8A 1H9LB 2VWMA 2BY7X 2QF4A 1O2ZA 3LU9B 1FY4A 2A2XH 3FFGA 2BZ6H 1C1RA 1SLVB 1BDAA 4CRBA 3F9GA 1GHAF 4I8JA 5BRRE 1C2MA 1D3PB 4WMDA 1W0JD 1N1LA 3EQ0H 5B6LA 2XC5A 2P59A 2XBVA 2XTTB 1YPHE 8GCHG 2F83A 2WZQA 3MYWA 1C5VA 4OGXA 4E7RG 1QB6A 1OOKB 5GNDA 4GCHF 5HGGA 3GDUA 5DKMA 1WYKA 3KEEA 5K0HA 1SQRA 1ZSJA 5EPYA 4INHA 3ZYEA 2F9PA 2A7HA 3SU2A 3VPKA 3RXQA 1D6RA 1O2SA 1G9IE 7GCHG 4ISNA 1AI8H 1QB9A 4MPXA 1GMHG 4OM9A 3SU0A 5JYIA 1WUNH 5DK1A 2YMSC 4MDSA 4B75A 4JZIA 2CF8H 1NY22 1NFXA 4X1SU 3SU5A 3DT0H 1H9HE 2BLOA 4OS7A 1Y59T 1J14A 1MTNB 1SVPA 2HVYB 2NU3E 1GMDG 2NU0E 1GBBA 1F0TA 5FCRA 1OKXA 3U69H 3ZZ4A 4RKOB 4FVBA 1O2JA 4ABBA 9ESTA 1GHWH 1D3DB 1YKTA 2CK3D 1J17T 4DY7B 3GISB 1CBWB 1LCYA 2RA0A 3PV5A 2BXTH 4Z1MD 1BBRH 4HGCA 1WQSA 2V6NA 3A87A 2AFQB 1BTPA 3M7TA 2RG3A 3FKSD 1GBDA 1DS2E 1T31A 1OWKA 3B8JA 3M5MA 5E8EH 1EZXC 4FU7A 3G01A 3HK3B 1TMTH 1QRXA 1HCGA 2BM2A 2G4UA 1ETSH 3S0NA 1IQMA 1GJ7B 3MU0A 2ZWLH 4BAHB 4IBLH 1B0FA 2BX4A 3TNTA 2V7QD 4LXBH 1MBMA 1RIWC 1NFUA 5E2PA 1O33A 4F49A 2OC7A 2QF3A 2KX4A 1HAYB 3PV4A 1K1MA
chains in the Genus database with same CATH topology
1A5IA 1TNGA 3UOUA 3SJOA 2F9BH 3RP2A 5LGOA 3M3SA 1P0SH 1UMAH 2FI4E 1MQ6A 4X1QU 2A32A 3VB3A 4TYDA 4ZMAH 1TNJA 1HAOH 4YO9A 1UHBB 5CE1A 1IQEA 1ZOMA 4DT7B 1YCPM 1PQ5A 1AUJA 4FUDA 4OS2A 1XVOA 1EZQA 1FPCH 3ZZAA 1C4U2 1XMNB 1AVGH 3MH7A 3W94A 2W5EA 2NU1E 2Y80A 4UFDH 2BTCE 3BTQE 4ISOA 3PWBA 1XUIA 2ZU1A 4OGYA 3SNBA 2FIRH 1W3CA 1RD3B 4X8SH 4D76A 5C2ZA 1GJDB 1Y3UA 4VGCB 1IQKA 1P2KA 2AMPA 5GCHG 3LKWA 1DY8A 2BZAA 4X1NU 1RTLA 2D8WA 1O2MA 2QA9E 3SU6A 1NRSH 4H4FA 1EAIA 1O5AB 4AN7A 3RXFA 1VCPA 2PGQB 3HGNA 2ZU5A 2FS8A 5AVDA 1HAXB 2ZPRA 4ABEA 2ZI2H 1DE7H 3P8NA 4TPYA 1GHXH 2RA3A 2WPIS 1K2I1 5DP5A 1BRBE 3JZ1B 1C5ZB 3A7TA 5DP9A 1IQIA 3MNCA 1DICA 5FPTA 2FOMB 4NFEA 5TCCA 5JPMH 1TAWA 4ABHA 1P12E 4FVDA 3MU1A 3SUEA 1ZHMA 4JYUH 1BHXB 1NFWA 3EYDA 2XBYA 5EQQA 1TOCB 1SQOA 1V2MT 1EB1H 4YOIA 4LK4A 4AG2A 5EG4A 3RU4T 5EODA 2BY5X 3BTME 3S9AA 3TJVA 2C8XB 1TA2A 2JH5D 3JZ2B 2C8ZB 1KDQB 1C2HA 1Q2WA 3QZRA 1J9CH 1QR3E 2H6MA 2WPKS 1ZPBA 1GBLA 4DIHH 2ZG0H 1VCQA 5FPSA 2QXIA 3F68H 1BBRE 1E0FD 2ZP0H 4H6TA 1QURH 1P2IA 4DW2U 4CBOA 1GBCA 2EI8A 3M5LA 2ESTE 3PMJA 3GY2A 1QNJA 1MKXH 3UY9A 3D62A 3O8RA 2ODYB 1AWHB 1THPB 5JB9S 1BCUH 4RSPA 2P93A 3MU8A 1E35B 2ZGBH 2XBWA 2A5AA 1GHAG 1C9TA 4J2YB 4NWKA 3RLYH 1N8OC 3SU1A 1YCPH 1L4ZA 2FOCA 2P3TB 4JK6A 3LGUA 1Y8TA 1SGDE 3P70B 1TQ7B 5T3HA 2H9TH 3TGKE 1LKBA 4X6PA 2WINI 3MNBA 5ETXA 3ZZ6A 1OX1A 1EPTC 1GI8B 1MAYA 1SGFG 3MNXA 3M36A 5AF9H 1NT1A 2BY8X 4I8LA 2VIVA 1D6WA 1ANBA 1O2GH 2FS9A 3OU0A 3K65B 4AFSA 1EAUA 1S85A 2CHAC 1TALA 1L4DA 1CE5A 3ODFA 5DG6A 1BRUP 5HXFA 2F9VA 1W0ZU 1INCA 3OY6U 4YM9A 2QXHA 4ZKSU 3M5NA 2VINA 4FUBA 3A83A 5E2OA 1AE8H 3HKJB 2BVRH 1O2YA 2PSYA 4AB8A 2FESH 3LDXH 3M5OA 1ZSLA 2AGEX 3OY5U 3RMMH 4YOJA 3SJKA 1L1GA 3NUMA 1SOZA 1H9IE 3ZZ3A 1ANEA 1SFIA 1TGTA 3KGPA 1WQVH 2QXJA 1O2VA 2VGCB 5EXMA 3GCHC 2GP9B 4YESB 4UEHH 2K1QA 3RXDA 2GDEH 2FWWA 1K1LA 2OCVB 1MU6B 2A4RA 1L2EA 4R0IA 1HFDA 3A88A 3SNDA 1DUAA 4IMZA 1WCZA 4RN6A 1OWJA 1P05A 2Z9KA 1AN1E 5C1UA 1PPHE 2Z9GA 2ZDKA 2FDAA 4X2YA 1SL3A 2OBQA 4B74A 1NU7B 4PROA 4WXVA 1HAZB 2CN0H 1DWEH 4INKA 2FOHA 1DX5M 1GBJA 1RGQA 3FZZA 4Y76A 4ZXXH 3TH2H 3CENA 4JMYA 5I25A 2VWOA 4NA7A 2QV1A 4ZHLU 1ARBA 2ZZUH 1HIAB 3M7QA 4E7NA 4K1EA 1MU8B 3BEUA 2STAE 1QBOA 4I8GA 5G4BA 2GKVE 1GG6C 1W14U 3TGIE 2ZF0H 1H8DH 3U1IB 1O3NA 1GBKA 1Z71A 4X1PU 3RMLH 5TJXA 1Q3XA 2AS9A 3ZZBA 1QQ4A 1GJAB 2SGQE 1O2UA 3HKIB 1SGNE 1W13U 2AYWA 5EW1H 3GCHB 4D7GA 1AU8A 2C90B 2PSXA 2CMYA 3BTTE 1O31A 2VU8E 2FXRA 2A5KA 3MHWU 1G2MA 2XWBI 3BTEE 1ESBA 5DO4H 3T5FH 5J4QA 1S6FA 1AMHA 1GJ5H 4M7GA 4BAKB 4ZHMU 2SGAA 1EZSC 1MCVA 2FPZA 2HRVA 2EC9H 2ALPA 1QJ7B 1P03A 1O2TA 1P8VC 1RTKA 3QTVH 3RXBA 1NPMA 2H2ZA 5DP7A 1VCWA 2VIOA 1AUTC 2EI7A 1ABIH 3NXPA 1LMWB 4CRCA 1KLTA 4JZDH 1ELEE 1C5UA 1IAUA 2IOTA 1EJNA 1MKWH 2BY6X 4JK5A 4THNH 1AHTH 3VXEH 2WYJA 1LVBA 1O32A 2AMQA 4KTCA 1EXFA 1FDPA 2AGGX 3LGWA 3SJ8A 1GCDA 8ESTE 2PTNA 2ZQ1A 2BDYA 4FU8A 2AH4X 2BHGA 3L6PA 4B71A 1C1WH 1KLJH 3SN8A 1UTLM 1V2OT 3VEQB 1YLDA 2BD8A 3ZZ8A 1AB9B 3BEIB 1UO6A 1V6DA 1RS0A 1O3KA 3SBKA 1CHOF 1O2LA 1AWFH 4MVNA 1V2UT 2UWPA 2VNTA 1T4VH 3QLPH 3VGCC 4MG3A 2HNTC 1O2HA 4LOYH 4B73A 1BZXE 1Y5AT 1K28D 2ODPA 2ZHDA 3P8GA 5A2MH 1F0UA 1EJMA 4FUGA 3U98H 4DG4A 3LGIA 1TNHA 2PWXA 2BY9X 4YOGA 3O8CA 3GICB 1FN8A 1EB2A 1ELVA 1HXFH 3UIRA 1TPPA 3GYLB 4B2CA 1VITH 3RXJA 1XX9A 2WPLS 3RXRA 1KSNA 3SORA 4MQAA 4Q7ZA 1YPGH 3NWUA 1UHBA 4O9VA 2AIPA 1LDTT 2OXSA 2V3OH 4YT7H 1SLWB 3IG6B 1SC8U 1GHBG 1AQ7A 2ZDNA 2ZHFH 1N6YA 1QCPA 1EASA 1SLXB 1AKSB 4AORA 4ZHAA 3V13A 6CHAC 3QUMP 1ZZZA 2IJOB 4WH6A 1VR1H 3H7TA 2J95A 4ZKRU 3NZIA 1PFXC 3LGVA 1QL7A 2FLBH 1O38A 2Y82A 4O3TA 1XUGA 4ZKOU 4IGDA 2R3UA 2PHBA 5A8XA 4UFFH 3IITA 1FV9A 7KMEH 4ABDA 4CRGA 1GGDC 4Y8ZA 4UDWH 1BMLA 2O8TA 3M35A 2PFEA 1ZTJA 1JOUB 5C1YA 2CGAA 1P10A 1F0SA 1FIWA 3OX7U 1C5XB 4IW4E 3ZVBA 1E37B 3C27B 1M9UA 1XXFA 3OSYA 1AFEH 2H5CA 1FY3A 1NM6A 4OS5A 1J16A 2FEQH 1MZDA 1DITH 5A0BA 3MI4A 1Y3VA 1A3BH 1ESTA 4BAOB 1NS3A 1BT7A 1QJ6B 1HAHH 1FY5A 1T8MA 4GSOA 4IMQA 3TU7H 1Y3XA 1JMOH 3ATIA 3MTYA 2ZC9H 2WUBA 4Q7YA 1TRMA 2SGDE 1ZLRA 4K69A 4Y8XA 4DCDA 3PO1B 1NU9A 2GMTB 3KIDU 1ANCA 9LPRA 3S9BA 2ZDMA 2O8LA 3BTDE 1PYTC 1E38B 4NFFA 3U8RH 1UTJA 2FYRA 3SNAA 2ZFPH 1OWHA 4X8TH 4H6SB 2HPPH 3PLPA 3RXIA 1Y5BT 1FAKH 1SGFA 1Z1IA 5FX6A 2ILNA 4B76A 4ZAEA 4X2XA 1GG6B 1O3HA 2ASUB 5I46H 2B7DH 4CHAC 2G51A 5DP8A 1D4PB 1BIOA 3ZYDA 3ZVCA 2PUXB 1BA8B 1C5NH 1MKWK 3MWIU 1QRZA 3E90B 2F3CE 1J8AA 1Z8RA 2BVXH 1Z6JH 1HLTH 2UUYA 1ELFA 1MTSA 3BN9A 1YC0A 1G37A 3KN2A 3LGTA 1ZPCA 1QGFA 2SGFE 1ORFA 5GJ4B 2H5DA 1BRAA 1YGCH 3K6YA 1FUJA 3GOVB 1OSSA 4X0WU 2QXGA 5GIBA 3GCTG 4DGJA 1MTUA 3T29A 2AGIX 2GCTC 4FUFA 1VITF 1KIGH 3MU5A 1GJBB 3RXAA 1THSH 3R0FA 4Z0KA 1VZQH 2ANMH 4BTIB 1IQLA 2OLGA 4O3UA 2IN2A 4B1TA 2ZU3A 2BLVA 3TH3H 2V3HH 3M3VA 1GJCB 5HMAA 3MO6A 4AFZA 4U2WA 3SNEA 5CHAB 4Y11E 1P2JA 1TBQH 1TONA 4X1RU 1UCYH 5C5NA 4INLA 2Q6DA 2ALVA 1TWXB 1NFYA 4AFUA 3UNSA 1OWDA 4K8YA 3ATMA 3F9FA 2OC8A 1C5WB 3MO9A 1ZGVA 4MNYA 4AX9H 2NU2E 1C5OH 5LPRA 4OS4A 2O8MA 3E3TA 3I78A 4ZH8A 1D3QB 1C2EA 1ACBE 4WWYA 2AEIH 2CV3A 1GMCF 2BVSH 1W11U 4ZKNU 2ZIQH 1O3AA 4KELA 1MD7A 3S9CA 2OUAA 3PMHB 1C2GA 1EOLA 1TPSA 2IPHA 4JYVH 3SV9A 1CT2E 1A1RA 5DP4A 2GDDA 1WU1A 1LKAA 3ELAH 1FJSA 3DFJA 3ESTA 4K3JA 2BOHB 2C93B 4WXIA 3VB4A 2XW9A 1HJAC 1XUHA 8KME2 2P3FH 1NN6A 1NTPA 1P2OA 3E0PB 3NPSA 4D8NA 2J4IA 3PMAB 1KTTB 1PPEE 5ESBA 1CO7E 3ZZ9A 4A92A 4I7YH 1E34B 2P94A 2QAAA 3P92A 1S0RA 4A1VA 1PQ8A 3TLOA 2B9LA 1KLIH 3QX5H 3KHVA 4CH2B 1DM4B 4XOJA 2VVUA 1SGIB 1DLKB 1Z8GA 3A80A 2ULLA 4SGBE 3T62A 1TB6H 4TWWA 2A7JA 4Y7BA 1AZZA 3RXTA 4BTUB 3EA8A 1HPGA 2OP9A 3KQEA 3PM3A 3LH3A 5EQRA 2TGDA 1MMJN 2PKAA 1JXPA 1SGYE 1G2LA 1HNEE 5JBBS 1JRSA 3ZVAA 1IQNA 3KL6A 2EA3A 4D7FA 2XC0A 1O3MA 2PKAB 3GY4A 1O37A 5GXPA 4GHQA 2B0FA 2FOBA 4A1TA 4GUXA 1GI6A 4MPWA 2ZGJA 1HJ8A 1L1NA 1P3EA 3SNCA 3UOPA 4TY7A 4Y7AA 1NRNH 3SUDA 3AVZA 1P3CA 2UWOA 3QTOH 5FCKA 1SGPE 2FX4A 1TPAE 1C2KA 2ANKH 3EDXB 1OXGA 1V2PT 1SHYA 5IDKA 3Q00A 1GDNA 1K1IA 1C5PA 2BD2A 2PKSB 1RRKA 1QL8A 3DD2H 1GDQA 1CA8B 4MPVA 1O5EH 2OQUA 2Q6GA 3GYMA 5A0AE 1GBEA 1S81A 1Y3WA 4FUIA 3RLWH 1S6HA 3P8OA 1WV7H 3ZVDA 4X2WA 2ZDAH 1UCYK 1MH0A 1O3DA 3SGBE 2CJIA 1C2IA 1FI8A 4MNVA 1AFQC 2FOAA 5FBEA 1UTOA 3RXOA 1UTQA 1P04A 1FXYA 3SZNA 1VJ9U 3GDSA 4BANB 1AGJA 1AE5A 3RC4A 1KY9A 2C8WB 1LTOA 1P11E 1W10U 2WV5A 2W7SA 2VIPA 5AFZH 5H4IB 1K1JA 1BJUA 1BHXF 2BMGB 5A09A 2P8OC 1C5TA 3GCOA 3UPEA 2FOGA 2Z3DA 1PPCE 1BB0B 1TFXA 1QHRB 1YBWA 1C5LH 1ELAA 2GT7A 1S5SA 2FM2A 4HFPB 1XUJA 2A0QB 1GVLA 1KXBA 5L2ZH 2VB0A 2KAIA 1FMGA 1V2TT 2W3KA 2J34A 1EAXA 2ODQA 2YNAA 1CT0E 1F5LA 1GHZA 3F9EA 3VB6A 3WY8A 1KXEA 1UCYE 2HPQH 4JYTA 1TYNA 3U8OH 4AYVB 2C8YB 2QY0B 2QIQA 1JIMA 2KAIB 3OTJE 2G5VA 1WSSH 3BG4C 3QGJA 4JCNA 3AW0A 2HVXA 1YPLH 5FX5A 3RMNH 4Q7XA 3FP7E 3UWIA 2ZHEH 2G55A 1UK3A 2PGBB 1O34A 1HUTH 5F8ZA 1L0ZA 4FXGH 3UREA 1O3OA 3LONA 1TLDA 2YNBA 3QGNB 4O97A 1LO6A 3QO6A 3UTUH 2OTVA 2HWLB 1MQ5A 1MTNC 1DY9A 1TGBA 2AERH 4NZQA 1O2XA 4XBCA 1P2MA 1MKXK 2BYAX 3A82A 4ABIA 1T32A 1XKAC 3RU4D 1ANDA 1C1PA 3SGQE 1CBWC 5C1XA 3BG8A 1UK2A 1JRTA 5EOKA 1ETTH 1V2KT 2Z94A 4K2YA 1QRWA 1LQDB 3BF6H 3SI3H 1LVYA 1C1VH 4MPUA 5A8ZA 1RJXB 2F9UA 4I32A 1XKBC 2FO9A 1GI0A 3KCGH 1SOTA 1TOMH 2OC0A 1O2KA 3T2NA 4D9RA 2TPIZ 1CHGA 1UVOA 1DOJA 2H9EH 1EP6A 3NK8A 1GBAA 3E8LA 2Y6TA 2BDIA 2SGEE 2XBXA 1T4UH 2Q6FA 4B2BA 1TE0A 2B5TB 3F9HA 2BD5A 3TNSA 1YLCA 3ODDA 3CP7A 1AY6H 2D1JA 5HM2A 1EUFA 4I33A 1HV7A 1SQAA 3RXVA 1O30A 1G3DA 1KXAA 1YM0A 4IC6A 3E1XB 2VVVA 2SNVA 2C4FH 4CBNA 1LPZB 1ZMJA 1KXDA 5C20A 1O3LA 5FBIA 2QF0A 1ZTLA 1P9SA 2OQ5A 1ZPZA 2WV4A 2FX6A 1MAXA 3SGAE 2BDCA 5JBCS 5FHTA 2THFB 4KP0A 2BB4A 1IQJA 4K1SA 3RC5A 1QTFA 1CSOE 5AFYH 1SGQE 1GJ6A 1HXEH 1Z8JB 3SUFA 4BNRA 3RM2H 1TABE 4NZLA 1GWAA 1O3EA 2BDAA 4MNXA 1JIRA 2G8TA 1O5DH 3KQCA 3LC5A 2A4GA 3O8BA 2D2DA 2FODA 3V0XA 3NKKA 2O8WA 2VIDA 1BJVA 1ZGIA 5FXLA 1O5FH 5CMXH 1C2LA 2BDHA 1DSTA 3KQBA 3DFLA 3SV7A 1ZJKA 2XRCA 2F91A 1EATA 1LHDH 2ZU2A