1GI9B

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
total genus 54
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi9B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi9B01
1VR1H 1INCA 1P2KA 1O30A 3RXIA 1B5GH 1K2I1 2BYAX 4JCNA 5A09A 2ZO3H 1UMAH 3AW1A 1YBWA 3TH4H 4O3TA 1FY3A 1NRQH 1GJ7B 2H5CA 4TY7A 4FUGA 1AN1E 3T26A 3SU4A 3S9CA 4CREA 3A7ZA 4UONA 1T8LA 2PWXA 3DD2H 4XOJA 4X8SH 5HM2A 3PV4A 1HAZB 4AOQA 1TONA 3R3GB 5LPFA 1ARCA 1IQHA 4ABDA 1P09A 4I8JA 4CH2B 2UUJB 4NIXA 3MFJA 4FU8A 1DWEH 3ENSB 3U1IB 3U8OH 2FI3E 3VFEA 2VWNA 3LJJA 2ALPA 1O2ZA 1HLTH 1O5EH 4XBDA 1GDNA 2IPHA 7GCHG 2NU3E 4X6OA 2P3FH 3TITA 4X2XA 4F49A 5FBEA 2P16A 3R0FA 1LVMA 1D6RA 3ZYEA 3HKJB 2JETC 3SZNA 3E8LA 1TGCA 1P03A 2ASUB 5GWZA 3B9FH 1C5ZB 1HUTH 1J14A 1LQEA 4WMDA 5C3NA 4JZFH 2WYJA 2ANWA 1SFIA 3MH7A 2Y5GA 1QRXA 1QRWA 1XM1A 1SGFG 1IQEA 3KGPA 4BAOB 2Z3DA 1C5SA 1QHRB 2O8WA 2J9NA 4DGJA 2PUQH 1K22H 1OP0A 1C2HA 1KYNA 3MU1A 3I29A 1MU8B 3RXEA 2ZFQH 4FUHA 1F0RA 1QBOA 5HGGA 2WV4A 3UWIA 2PUXB 1QGFA 4MNWA 1CT0E 2BB4A 1LO6A 4I8GA 3RC6A 2BZAA 3KQBA 2ZQ1A 3CENA 3QLPH 1NU7B 3OYPA 4K8BA 4UE7H 4HI3A 6LPRA 5EW1H 1P2QA 1Y3XA 1H9LB 3RXVA 1DXPA 4BAMB 2A4GA 3LH3A 1V2RT 1LPGB 3LDXH 3M36A 4NFEA 1Z8GA 1FY5A 1AMHA 2FOAA 1OX1A 4A7IB 4IGDA 1P2JA 4D7FA 3AW0A 1YF4A 2PGBB 4X2VA 3BTDE 2SGFE 2B0FA 1V2WT 3ZV8A 2VIDA 1CGHA 4K3JA 2FWWA 2PW8H 3LH1A 3MWIU 3TU7H 2TGAA 1U6QA 2VVUA 2FMJA 2W5EA 1KXFA 3SHAH 1OXGA 3ZZDA 4NSVA 1LMWB 1MTWA 1UVOA 3FVFB 1W8BH 2G51A 1IQFA 3DUXH 2ZU1A 2WUCA 4XFQA 4TPIZ 2JKHA 5EPYA 2P8OC 2G81E 1TNIA 4ZKOU 2GVFA 5F8TA 4B1TA 1UVPA 2ODYB 1MU6B 3VB3A 2GKVE 2DE9A 5FXLA 2XBVA 1AI8H 2J92A 2QYIA 2AMDA 2FO9A 1XXFA 1GCTC 1P12E 1ZYOA 3C27B 1HJAC 3Q3KA 2ILNA 2A2XH 1L1GA 2C90B 2R2MB 3BF6H 1NESE 1O3DA 1UCYH 1WCZA 2TGDA 3NPSA 2DUCA 3SQEE 3V7TA 1FDPA 4X1NU 3SOSA 1RTFB 4ABAA 1SC8U 1NPMA 1EB1H 1YPEH 1G2MA 4MPVA 4UFEH 3A87A 3OU0A 5FCKA 1ANCA 4AX9H 3EA9A 1UHBA 5C5NA 2QGRA 1MTUA 4THNH 1GI4A 1O5CB 3D23A 4Q2KA 4Q7ZA 2ODPA 1C5NH 1FMGA 1PFXC 3BTGE 3DFLA 1LVBA 1WAYB 4Y79A 3ZZ9A 3SI4H 3SHCH 3LU9B 1N8OC 1YKTA 3O8RA 2A5AA 1AO5A 1S5SA 3UIRA 2ZFRH 1ZPCA 1DOJA 1EJMA 1KTSB 5T6GA 1THPB 9LPRA 2CV3A 1AE5A 4IW4E 4U32A 4X1QU 2ZU3A 4D7GA 1TIOA 2Y82A 1ACBE 3GCTG 3HGPA 4YO9A 3SUDA 1S81A 1UTOA 2BZ6H 4ISOA 1AE8H 2A32A 2P59A 2XC4A 2R3YA 1EJNA 3EQ0H 1IOEA 1OOKB 2FYRA 2YNBA 3ZVGA 1HFDA 2HPQH 1SQTA 2ZIQH 3MMGA 4KTCA 1BHXF 1P06A 1GBJA 4YLQH 2FM2A 1BJVA 1SBWA 2BLWA 3QK1A 2UUYA 1UJ1A 1RIWB 2RA3A 1C9TA 1O2JA 4IC5A 1Q3XA 1O2KA 2HNTF 2ANMH 1JXPA 1UTKA 1Y8TA 3UQOA 4BTUB 2PHBA 4BAQB 2ZU5A 1MBMA 2CF9H 2PTNA 2A7JA 1F0SA 1DLEA 3PWBA 1C1RA 3EA8A 4X8VH 2QCYA 1C5XB 1L4DA 5EXLA 1TB6H 3M5OA 2HRVA 1F92A 4ISHH 1N6YA 1HAHH 3UR9A 2AGEX 4BTTB 4ESTE 1Z1IA 3ATKA 4Y10E 4H4FA 2ZFTA 4JMYA 4NFFA 3RU4T 1G32B 1C4Y2 2NU0E 2C3SA 3IITA 3V3MA 2UWLA 4I8LA 1L1NA 3LGYA 1T8MA 4MLFB 2CGAA 1DWDH 1MCTA 3MH4A 2ZQ2A 3RXKA 4RKJB 1AGJA 3M3VA 3GDVA 3U69H 1ZZZA 2DE8A 1EOJA 1QIXB 4FU7A 3SUEA 5G4BA 1GJAB 1O3KA 4KKDA 4OGXA 1ELTA 1SGPE 3E1XB 1E0FD 4HGCA 2FOGA 1SHHB 3CP7A 3RXBA 3TGJE 5L6NH 2FI5E 1HAGE 3MNSA 1CGJE 1YGCH 3FZDA 5L2YH 2AEIH 1AUJA 4WVPE 4HZHA 1FV9A 3RU4D 2UWOA 1E36B 1PJPA 3SW2B 4ABJA 2EI7A 1HAXB 1EUFA 1O2IA 1SL3A 2BX4A 5L30H 5EOKA 3NZIA 2WYGA 3Q77A 2R0LA 5T6FA 3VXEH 3SUGA 2OP9A 1GHYH 1L2EA 1OWKA 1LHGH 2OXSA 2ZGJA 1MTNC 4UFGH 2XBWA 1GBTA 1UHBB 1WQSA 4Y0YE 1L4ZA 1FJSA 1NU9A 1YPLH 4XE4A 2VU8E 2XRCA 4CBOA 2FXRA 4X8UH 5T6DA 3A8AA 1BMNH 2W7SA 3LT3A 2OINA 1HAPH 2XCFA 5AHGH 3M5LA 1HGTH 1TLDA 1GI7B 2OCVB 1P11E 1TMBH 3MO3A 2IJOB 3TJVA 4MPUA 1HIAA 1P3EA 1QB1A 2ANYA 2ZGXH 1HAIH 2FOMB 1GMHF 1TA2A 4DURA 5L2ZH 1QR3E 1OP8A 1DY8A 3PO1C 1C1PA 1BMLA 1O3CA 1A1RA 1T4VH 1BITA 2OD3B 1GMCG 4A6LA 1OP2A 2FLBH 2V6NA 3QN7A 1O2TA 2ZZUH 3NUMA 4NIYA 2OTVA 1UVSH 2ZECA 4IN1A 1O3GA 3ELAH 3KN2A 1AWHB 1O2GH 2Q6FA 2D2DA 2ZPRA 2VWMA 3KF2A 1NM6A 2XXLA 1E34B 2D1JA 5EQQA 3GICB 1ZRKA 2BY9X 2GZ9A 2VNTA 1MTSA 1C2EA 3SUFA 1DANH 1TGBA 1JWTA 4KELA 2HOBA 1GBMA 3G01A 3F9HA 4OS4A 2F9BH 4ZKNU 1GHVH 4NA8A 2OLGA 2BMGB 2Q1JA 4JK6A 4CRAA 4DCDA 2EEKA 4UFDH 2ZP0H 4X6MA 4X8TH 2TBSA 2I6QA 1M9UA 2VB0A 4AORA 1FI8A 3GCNA 3SQHE 7GCHF 4YOJA 1ESTA 1TNKA 5TCCA 1H9IE 1ABIH 3S0NA 3AASA 2A31A 3KEEA 4HFPB 4XSKU 5TJXA 3TH3H 1QQ4A 4MNVA 1TE0A 4E7RG 3V12A 1Y5UT 1KY9A 3Q3XA 4BANB 3LGVA 1C5WB 1C1OA 3E16B 3PLBA 1UVUH 3H5CB 1CT4E 3VB5A 1ELBA 4H6TA 3MU0A 1V2KT 1TYNA 4NZQA 5GPIB 1EP6A 2ZDNA 1LPKB 3MNCA 3UNSA 2VIWA 1MUEB 3NKKA 2BD4A 1K1PA 4X6NA 1P3CA 4H42U 3RXFA 1HAYB 1O37A 5C67A 1V2TT 3LGTA 1RD3B 1P2OA 3TGIE 4K5ZA 5ETXA 4IC6A 1DM4B 1EKBB 3ITIA 1BRBE 1KXDA 1LCYA 4YTAA 1VCWA 1RRKA 1ELVA 1OYQA 3TJNA 1Y5BT 3A84A 1TX8A 4AFQA 1BMMH 2H9HA 1GI6A 2H1UA 2J38A 1C5PA 1BQYA 1O31A 3N7OA 1TGNA 1T4UH 2STBE 2THFB 1O2HA 5GCHG 1GHBG 1MQ6A 1D3PB 5GXPA 1GVKB 3TJOA 3LC3A 1TOMH 4TWYA 4JYVH 4X1RU 3ZYDA 1GI0A 2VIVA 3M35A 5EXNA 2HVXA 4JYTA 2Q6GA 3W94A 1PPZA 1LPZB 1XKAC 3BTKE 3F1SB 1HIAB 2GCTB 1QA7A 3ZZCA 3O8CA 1QB6A 3VB7A 2VH0A 1C2JA 1IAUA 1FIZA 4NZLA 2BD9A 4Q7XA 3SU5A 8GCHG 4HTCH 1QY6A 1LHFH 4CRCA 2A4OA 1UTMA 2ZHDA 2Y7XA 2ZNKH 3UNRA 4R8TB 2FX4A 1LKAA 1MCVA 2QN5T 1YYY1 1JMOH 2D26C 1DT2A 1BBRE 1O3BA 4TPYA 5FPTA 1O3MA 1T31A 1DDJA 1K1IA 3QGJA 2XCNA 1G3DA 1O35A 5DP4A 1EPTA 3L3TA 3SI3H 1Z8IB 1VJ9U 2GCHG 1HJ9A 1GHWH 3H7OA 5I25A 1GI2A 5DP7A 1MKWH 1O3LA 1P57B 4O9VA 3SU6A 2FX6A 4YT6H 1Z8JB 1ZR0A 1NRRH 4XBCA 3QWCH 2VIOA 4DG4A 3RXLA 2A1DB 1CBWB 1MD8A 3VB6A 1FUJA 3HATH 2EI6A 3LOXA 1TRNA 6CHAC 1SLWB 8ESTE 1C5UA 2G5VA 2O8MA 4SGAE 4AYVB 5EQRA 3RXUA 2RDLA 2BD5A 4KTUA 9ESTA 2BM2A 3BIVH 3GY2A 4WXVA 1DFPA 3UOPA 1ZHPA 3ATMA 2KAIA 4D9QA 1TPPA 5A0AE 2PSXA 2BD3A 4Y7BA 4DIHH 2H5DA 1NRNH 1ETTH 2F9UA 1C1TA 2QXGA 4M7GA 5CHAB 4JYUH 4X2YA 2FTMA 2FZZA 1SFQB 3UOUA 1QCPA 3SV8A 3BTEE 3GCTF 3UWJH 5JB8S 1J15A 1ZGIA 2VH6A 2BVSH 3SN8A 1PYTC 2VGCC 3SU2A 3ODDA 2AGIX 3JZ1B 1C9PA 1MKXH 1LKBA 4BXSA 8LPRA 3BG8A 3SNBA 1FY4A 2GDDA 5GJ4B 3URDA 1PQ7A 3SGQE 5AFZH 1OWEA 1ZSKA 3SGAE 4MPWA 2Z9JA 1UK2A 1QA0A 2ZDAH 3GCHB 2FPZA 2G52A 3S9BA 1YM0A 2FS8A 1MKWK 2NU1E 2GD4B 4DIIH 1AFQB 1X7AC 2GMTB 2P94A 1A7SA 1PQAA 1ARBA 1Q31A 2C8WB 4WWYA 1PPEE 1P8VC 2IOTA 5LH8A 1Z8RA 1P10A 1PPGE 1SGRE 1RIWC 3T29A 3M7TA 4J2YB 2WUBA 1AVWA 2H2ZA 1UK3A 1FIWA 6ESTA 3K6YA 1D3DB 1QURH 1UVTH 2Y80A 3ZZ5A 4A5TS 3T28A 2B5TB 4MNXA 3IWMA 1DUEA 2W3IA 4ZHAA 1ETRH 1ANDA 1G37A 1GL0E 3HKIB 1GJ9B 5K0HA 2PKSB 5CE1A 1XUHA 2JH5D 2BXUH 1T7CA 4BAKB 1C2DA 1OWJA 2QF3A 3S9AA 1O3PB 2V3OH 3STJA 3T2NA 4Y7AA 4ABFA 1P02A 2VIQA 1DSUA 2SFAA 1TX6A 3F9EA 1P01A 1CVWH 3ZZ6A 4WMFA 1S0QA 1ZHMA 2QC2A 2YOLA 2BOKA 2Y5HA 3KNXA 3M3SA 2F9VA 5AFYH 1NTPA 1MKXK 2WV5A 3QDZB 1EPTB 1GBFA 1YCPM 1EOLA 1V2PT 2NU4E 1B7XB 3EDXB 3I78A 2XC5A 3BG4B 2GZ7A 5DO4H 1GG6C 1HXEH 3SNAA 3MO6A 3U1JB 2HNTC 2VINA 1KDQB 2VWOA 2A45B 5EGMA 2JH0D 4X2WA 3BTFE 1KLJH 2VWLA 4GAWA 4B2AA 1NFUA 1O5DH 1O2VA 3GISB 1ID5H 4ABBA 1W7GH 1UTNA 1O2OA 1THSH 2Z3CA 1F2SE 1JOUB 3A80A 2ODQA 4GUXA 1O2WA 1S0RA 4FVBA 3SJKA 3UY9A 4ZROA 4NIWA 3FFGA 4DW2U 4FUJA 1K21H 1NFYA 4Y71A 1L1JA 2F9NA 1F0UA 2R3UA 4ZKSU 1GHZA 1ZMLA 1ABJH 1W12U 1K1MA 3P92A 3ZZ3A 1J17T 1DWBH 1GMCF 2ZHQH 5LPRA 1O2NA 4ZH8A 2O8LA 1AIXH 3PMBB 1O32A 2WINI 2XYAA 2UWPA 1UTLM 1CA0C 2WPLS 1PPHE 1QQUA 2PKAA 3FAOA 1TNGA 1RTKA 1HPGA 2P3UB 1ELGA 1T32A 1PYTD 4K69A 4KTSA 4LOYH 1BT7A 1GI5A 1AHTH 1EATA 1ESAA 1BA8B 1JRTA 3KQDA 4E7NA 1HYLA 2D8WA 3H7TA 1TQ7B 4IMZA 1JRSA 4AN7A 1O2LA 1GBIA 4SGBE 2Z3EA 2BDAA 4WY3A 4NG9H 1O3HA 1NFXA 1S84A 3OX7U 1BTWA 1A5GH 1PQ8A 3P8NA 1A0LA 3ZVBA 1EXFA 1RXPA 5E2PA 3MU8A 5DJ7A 1C1SA 1SGDE 2AS9A 1DY9A 1UCYK 3K65B 1XUIA 1O2YA 1SOZA 2BD2A 1SGTA 2FYQA 3A83A 1DX5M 4XBBA 3O8DA 3QX5H 2BDBA 1FY8E 1UO6A 1O38A 3FP7E 2JH6D 4NA9H 1TAWA 3ZVAA 1ZTKA 2PGQB 3W95A 2J34A 3GDSA 1KXCA 3MO9A 4A92A 2FS9A 2BQWB 1IQLA 2SGPE 4K60A 1EASA 1C4U2 5FHTA 1C2GA 2GV7A 1S6FA 3GY7A 5BRRE 2F3CE 3TGKE 1HB0B 3A7YA 1GBAA 1G3EA 2VJ1A 1C2FA 2QAAA 1NN6A 4BTIB 2TRMA 2C93B 1DXWA 1TBQH 1XUGA 3BSQA 2YNAA 1GVZA 1Y3UA 1SB1H 1BJUA 2XBYA 3MH5A 1NFWA 3KCGH 1TRYA 4K1TA 1IHSH 3DHKH 2Z9IA 2BX3A 3EE0B 1BOQA 3SNDA 1SGYE 4Y6DA 1ELAA 4MVNA 3UUZA 1ETSH 5E0GA 2BY5X 1TWXB 3MNBA 1K9OE 2ANKH 1F7ZA 4NWLA 5GCHF 3RXTA 1GHBF 2Y7ZA 3QGNB 1V6DA 3M7UA 1OSSA 5EU8A 1NZQH 2BOHB 2BD7A 1SGCA 2BVXH 3A88A 4K8YA 4YOGA 5HM9A 1MD7A 3T27A 1O3JA 1BZXE 1BHXB 1HV7A 3E0PB 1C5VA 1S6HA 4OS6A 1C1VH 3MI4A 3LGIA 2AIPA 2AMQA 3PLKA 1D9IA 2BLOA 3RUOA 2AERH 3ZZ8A 1GPZA 1KXEA 1OWHA 1PPFE 3E3TA 1FXYA 3ZZ4A 1HNEE 1XUKA 4A1XA 8GCHF 1F5RA 3ATIA 3D49H 3M37A 2STAE 2G4TA 4AGJA 3B23B 1GGDB 2C8XB 1VCQA 1ANEA 3I77A 2FLRH 2Y81A 1WTHD 3Q76A 4WH8A 1ZTJA 2CJIA 4ZAEA 1ZHRA 2V3HH 4Q80A 2GCTC 3E90B 2ZPQA 4A1TA 3S69A 3RXJA 1S83A 5DKMA 5A0BA 2GCHF 2J94A 2WPIS 5GIBA 1AQ7A 1GJ4H 1UCYE 1VJAU 1O0DH 1EQ9A 1FAKH 5HYOA 4LZ4B 3KL6A 3A8BA 2R0KA 3LIWA 1V2NT 3RMNH 2BD8A 1W7XH 3D65E 1EZUC 1JIRA 4X1PU 1V2OT 5E0HA 1A0HB 2FIRH 4H6SB 1GBKA 1V2UT 1XXDA 1A3BH 2OC0A 4LXBH 2ZDLA 4Y11E 4ABIA 3UNQA 2A7CA 1DE7H 5HMAA 4LZ1H 2ZTYA 1O3OA 3A7VA 3RXOA 1MAXA 1J8AA 3K9XB 3RXGA 2PSYA 2CF8H 2G5NA 3CS0A 2BY6X 1TMUH 1O5AB 1N8OB 3BEFB 3PMHB 1O33A 3F9FA 5F8ZA 3ZVEA 4IMQA 5A0CA 3HGNA 1C5LH 2Z94A 2FDAA 4OS7A 2H6MA 3GY3A 3RMOH 5JBAS 2GX4A 1KXBA 4CRGA 2O8UA 2W7UA 4DOQA 1WSSH 3BTWE 1A3EH 1W3CA 1LVYA 3HK3B 4E06H 1PPCE 3PMJA 4D8NA 1GI9B 4BAHB 1W11U 2GTBA 1TOCB 2ZDVH 3LJOA 1ANBA 2EC9H 1AZ8A 1SLXB 1Y59T 2QXIA 2HNTE 2ZGCA 3RU4E 1C1NA 1EB2A 4AG1A 1Y5AT 3SV9A 1K28D 3ZV9A 3TH2H 1WTGH 4JZDH 4Y8ZA 3SU3A 3BTME 2VVVA 3VGCB 3ESTA 5F03A 1TBRH 3UREA 3B8JA 4Y8YA 2FOCA 2HWLB 1O2UA 5JB9S 1ORFA 2ZC9H 2NWNA 1TA6A 3PYHA 3OTJE 2LNCA 6GCHG 4WH6A 1V2QT 4OS5A 1GHAG 4MG3A 4TYDA 5A2MH 1C5MD 1FN8A 1N1LA 1W14U 1SVPA 2A7HA 3QTVH 4AB9A 3UPEA 5AF9H 3M61U 2FESH 2QA9E 1F5LA 1GJ6A 3SNEA 1WBGB 2NU2E 1PQ5A 1EX3A 2CHAB 2P93A 1WQVH 1KLIH 2R2WU 1DLKB 3BEUA 5IYTA 4GHQA 1WU1A 3RXAA 1W2KH 1FAXA 3QO6A 1AVGH 1WYKA 5C20A 2HGTH 4DY7B 1UK4A 2C8YB 1QJ6B 4B73A 3QTOH 2H9TH 3SJ9A 4CH8B 4YZUA 1MH0A 3LGWA 1RGQA 3K6ZA 4JZEH 1SGQE 2A4QA 1D6WA 1GVLA 1HJ8A 2P95A 1FPCH 4KP0A 5B6OA 1KTTB 1MTNB 1RTLA 4NIVA 1IQGA 4CR9A 4MNYA 3MU4A 3E6PH 3E0NB 3MOCA 4E05H 4I32A 3A7XA 3PM3A 1E35B 4CHAB 1GI1A 1TPAE 2BHGA 5ESBA 1EPTC 1V2LT 3SU0A 3NK8A 4PROA 1SGNE 1HAVA 2FOHA 3M5NA 4ISLA 3BG4C 2O8TA 1CHOG 1GJDB 1NC6A 1Z7KA 5PTPA 2J2UA 2F9PA 3L6PA 1XX9A 2XTTB 3VXFH 1OWIA 3RXRA 1Y3VA 4B71A 2Z6BD 4AZ2B 1GL1A 1C2KA 2GT7A 3T62A 3GY4A 1YP9A 4RSPA 1CT2E 4I8HA 1BTXA 2ZFSA 5A8ZA 5CMXH 1TABE 5TCAA 3PLPA 3PO1B 4OS2A 2BDIA 2WPMS 3SGBE 2SNVA 3SU1A 1S85A 1AVXA 4FVDA 4AG2A 3U98H 1AD8H 4DJZB 3GOVB 3PTNA 1BCUH 1W0ZU 2SGQE 1C2IA 3HPTB 2BDHA 3E91A 5JBTA 1P9SA 2FODA 1J16A 4Q7YA 5C1YA 3U8RH 1GI8B 5JPMH 4FUIA 5T3HA 1VITH 3UQVA 3FZZA 5A8YA 2ZWLH 1AB9B 1EAWA 1A0JA 3VB4A 3SO3A 2W3KA 5DP5A 4ZMAH 3MNXA 3RLWH 1G9IE 7KMEH 4ASHA 4AFSA 1B0EA 1V2ST 1VITF 1QL8A 2PFEA 2SGDE 2ZCKP 1UTPA 1KSNA 5EPNA 5FBIA 1EJAA 1L0ZA 4I31A 1V2MT 4K1SA 1A5HA 5ABWA 1EAUA 3TLOA 4AGKA 3PB1E 1MZDA 4IBLH 4FUCA 1LTOA 1O2MA 1QBVH 1GJBB 2FP7B 3AVZA 1UTJA 3V13A 3A85A 4UDWH 3FP6E 3GY5A 4ABHA 1ZMJA 3RC5A 2AYWA 3PMAB 2ZHEH 4GCHG 4WF8A 1O5BB 1GBDA 2HLCA 3TVJB 3RXQA 3UR6A 4MTBA 4JZIA 4IS5A 1ZTLA 1FPHH 5DP9A 1SR5C 3TIUA 1C5RA 1OS8A 2QY0B 2ZTZA 3VPKA 3A8DA 5DK1A 1YCPH 1GBEA 1ESBA 1D3TB 1D4PB 2HALA 2ZDKA 3MYWA 3SJ8A 4U2WA 2Z7FE 1O39A 3MH6A 4ZHMU 1YLDA 4RKOB 5K7RA 1GBHA 1K1JA 4CBNA 3Q3YA 3ATWA 1N6XA 3NXPA 1C1MA 4AYYB 2K1QA 4B76A 3RM0H 5DG6A 1MZAA 1HCGA 4Y8XA 1FNIA 3M7QA 4R0IA 1H8DH 1O2XA 1SQOA 1UTQA 4Z0KA 3BV9B 1XVOA 1HAVB 2EA3A 3T25A 3A81A 5F8XA 2FEQH 5FCRA 1BTHH 1C2LA 1K1NA 4U01A 4VGCB 2H9EH 2B7DH 1YPKH 1OPHB 1ZMNA 4I8KA 1QL9A 1W10U 3NWUA 2V0BA 2OC7A 4GPGA 1NO9H 1XKBC 8KME2 1MTVA 2FOBA 2PLXA 1SSXA 1WV7H 2QIQA 4ISIH 1GHXH 3F68H 4GVUA 2Z9GA 3GY8A 1O2PA 3ZVCA 1EP5A 2UUKB 5E2OA 1LHEH 1WOFA 5JBCS 1VGCB 4I33A 4ZHLU 5DPAA 5E8EH 1DUAA 1XMNB 3WY8A 2ZHFH 5ESTE 2BVRH 1ELEE 2CXVA 1T8NA 1YCPK 2BLVA 2KAIB 5EODA 3TJUA 1BTYA 3DT0H 1H8IH 3GCOA 2A0QB 1OYTH 2BDYA 1GGDC 4GLYA 3LC5A 4X1SU 1XUFA 1TRMA 1MAYA 5FX6A 1AZZA 3Q00A 1JIMA 1YPMH 4D76A 2BQ7B 1EZSC 3K2UA 1XVMA 1HXFH 1ELDE 1C2MA 3RC4A 6CHAB 1BDAA 2F83A 3F9GA 4ZKRU 3JZ2B 4FU9A 1P9UA 2V35A 3ODFA 5HXFA 3P6ZB 5C2ZA 1YPHC 3BEIB 2QXHA 1WUNH 1BUIA 1DVAH 4GSOA 1QJ1B 4ISNA 5C1XA 1TNJA 4O3UA 1EZXC 4X6PA 4YLUA 3M5MA 3P8OA 2W26A 3BIUH 2OC1A 2QF0A 4NCYA 1SLVB 2VIPA 3ZZBA 1DSTA 1G3BA 5EW2H 1C5TA 1NRPH 2ALVA 3EA7A 3TK6A 3ATLA 1VITG 3RXSA 2ZEBA 2VGCB 3C1KA 4NSYA 4Y0ZE 1DICA 2HPPH 4BOHA 3HK6B 3DA9B 2ZF0H 7LPRA 3GDUA 1ZJDA 3FANA 4Z6AH 1A2CH 3T5FH 4ABEA 2O9QA 5A8XA 1BB0B 2Q6DA 4J1YA 1P05A 3BTQE 4D9RA 4ZUHA 1ELCA 5DP3A 5EQSA 1C1QA 1QJ7B 1CE5A 2C4FH 2ZU4A 4NWKA 1QBNA 3RXDA 5LGOA 2WPHS 1Z6EA 2JETB 3OY6U 1SGIB 3EAJA 4NA7A 1TPSA 1S82A 4WXIA 1FQ3A 6GCHF 2XWAA 5JBBS 3RMLH 2ZHWH 1GHAF 3SBKA 3S7HB 1T8OA 1MBQA 4WJG2 1BIOA 1RFNA 2TPIZ 2ESTE 4LK4A 3U9AH 3BTTE 3U8TH 1NRSH 2BTCE 1AFEH 4INKA 3RMMH 1V2VT 4UD9H 1TPOA 1B0FA 3MU5A 1F5KU 3VGCC 1O34A 1BMAA 1SOTA 2G8TA 2ZPSA 1CQQA 2B8OH 4CRDA 5J4QA 3P17H 1VZQH 1K1OA 2BQ6B 2G00A 5IDKA 1P04A 1KIGH 2Y6TA 5FPYA 2A4RA 1QB9A 1HDTH 2BDCA 1BTZA 1QRZA 1P2MA 1ZJKA 4OS1A 2AMPA 3GYMA 5DP6A 2A5KA 1GBBA 3RXMA 4DVAU 2CHAC 1W13U 2I6SA 3V0XA 1GMDF 3SV6A 1O3NA 2AFQB 1O3EA 1SQAA 5FX5A 3F6UH 1C1UH 1GWAA 1ZGVA 1G2LA 1O2SA 1NT1A 1V3XA 2OBOA 1P2IA 3RP2A 5F6MA 2QXJA 1YLCA 1Y3YA 2WPJS 4F4OC 1HAOH 3GYLB 3P70B 2VVCA 3AAUA 2AGGX 3ZVFA 1CSOE 2LPRA 3RXPA 2AH4X 3MHWU 1P0SH 1GG6B 2CN0H 2ZA5A 3KHVA 4FXGH 1EAXA 3IG6B 2P8OB 3S7KB 1SGEE 4X0WU 1QNJA 1BRAA 1CHGA 1EZQA 2M5TA 4YESB 2BLQA 4B74A 1RS0A 3SJIA 1H4WA 3A82A 1CHOF 2PKAB 1GCTB 1ZRBA 1HJAB 7ESTE 3CS7A 4OGYA 1TNHA 4YOIA 4INHA 1O3IA 2XWBI 1LQDB 1TBZH 3A86A 4ZXYH 1OKXA 4B2BA 2FI4E 3L33A 2OC8A 4CHAC 1QFKH 4RN6A 1IQJA 3A7TA 1D3QB 2C8ZB 3KQCA 1Z6JH 3LKWA 3A89A 1BBRH 2RG3A 1GI3A 1CU1A 1HRTH 1AKSA 4Y76A 3UTUH 4CRBA 1C5OH 1J9CH 1CA0B 1SGFA 3KQEA 4O97A 4CRFA 2GGVB 3ZVDA 1H9HE 5DP8A 2Z9KA 1SPJA 1TFXA 4AFUA 1ZPZA 4XDEA 1CBWC 2G4UA 4GHTA 4MDSA 2ZCLP 2BY8X 1FONA 1P2NA 5C1UA 1A61H 1ZOMA 1SLUB 3LPRA 3OY5U 2CMYA 2A2QH 2GT8A 4TWWA 1DITH 1SHYA 1SI5H 2ZTXA 1EAIA 2FOFA 2TIOA 1XUJA 5EG4A 1NS3A 1QTFA 2BY7X 2QV1A 3LONA 1DS2E 4NGAH 4YM9A 3RDZA 1Z1JA 2ULLA 4YT7H 4JZ1A 2RA0A 5JDUB 1O3AA 3TK5A 1AB9C 1BRCE 2Y5FA 5CHAC 4FUFA 1IQNA 1C5YB 1FN6A 1ZSJA 4I7YH 3M3TA 2OBQA 1THRH 2P3TB 3ZZAA 1FY1A 3A8CA 3SV7A 4B75A 4AFZA 2Z9LA 1AUTC 4GCHF 2UUFB 1CGIE 2ZDMA 2AIQA 2ZGHA 1ELFA 2WPKS 1TMTH 1BBRK 2PR3A 1C4V2 2XC0A 3PTBA 4U30A 5JYIA 2ZG0H 1A4WH 3RLYH 3P8FA 2ZFFH 1AY6H 1GBCA 1TNLA 2J4IA 3TNSA 3RXCA 3GCHC 1GBLA 1Z71A 4BNRA 1SG8B 1MQ5A 4DT7B 2OUAA 1AFQC 2B9LA 1F0TA 1TQ0B 2GMTC 1GDUA 1Y3WA 4TY6A 4ZXXH 1K1LA 2XNIA 1HBTH 2XW9A 4MPXA 1TALA 3GY6A 1FLEE 1E38B 2A5IA 1IQKA 3P95A 4CR5A 3QZQA 1AWFH 1YPHE 5GDSH 3TNTA 1BTUA 3OSYA 5I46H 2OQ5A 3FP8E 1TGTA 3VEQB 2BXTH 2F9OA 1O5FH 1ZPBA 4IN2A 2PKSC 1LDTT 2EI8A 1GMDG 1V2JT 1MMJN 1FZZA 5AVDA 1KLTA 3QUMP 3TPIZ 4WMEA 3P8GA 1LHDH 3UFAA 1TGSZ 1TX7A 2J95A 4BXWA 1VCPA 2SGEE 1O5GH 2GDEH 1CO7E 2PTCE 5H4IB 3BN9A 1YPGH 1G30B 1LHCH 3QZRA 5BPEA 2FTLE 1NY22 5E0JA 5EXMA 1A5IA 4A1VA 4MQAA 1G3CA 1GDQA 4K2YA 1IHTH 4AB8A 1C1WH 2ZKSA 2XBXA 3SORA 4FUEA 1AKSB 5LPEA 4O03A 2OQUA 4VGCC 1E37B 2ZFPH 3KIDU 4JK5A 4KGAA 1ZLRA 3PROA 1BRUP 2TGPZ 2PV9B 3STIA 1H1BA 2ZU2A 1GJ5H 5FPSA 1O2QA 1YC0A 1GJCB 1KXAA 4QT8C 1A46H 4FUDA 5C5OA 5DGJA 3PWCA 1O3FA 2ZCHP 4K1EA 1SMFE 3SJOA 1PPBH 1DWCH 1Q2WA 1C5QA 3TK9A 1OWDA 2TGTA 2GZ8A 5FAHA 1GCDA 1IQMA 1ZSLA 1NROH 2F91A 3D62A 2FOEA 1VGCC 3LGUA 1O36A 2GV6A 3BTHE 3MTYA 3A7WA 3SV2H 1DPOA 2SNWA 4UFFH 1W0YH 1QL7A 1AU8A 4B2CA 2ZI2H 1G36A 1LVOA 2ZGBH 1RJXB 3NCLA 1BTPA 4UEHH 3O8BA 3EYDA 5J4SA 3RM2H 1JBUH 3URCA 1YPJH 2GP9B 1O2RA 2R9PA 1GJ8B 1GMHG 3AAVA 3DFJA 3SNCA 1IQIA 4ABGA 2RCEA 3ZZ7A 1KDQA 2G55A 2SGAA 3RXHA 4INLA 4FUBA 3EGKH 1CA8B 5SGAE 2IN2A 2BDGA
chains in the Genus database with same CATH superfamily
5C0UA 1VR1H 1INCA 1W0JD 1P2KA 1O30A 3RXIA 1B5GH 1K2I1 2BYAX 4JCNA 5A09A 2ZO3H 1UMAH 3GS9A 3AW1A 1YBWA 3TH4H 4O3TA 1FY3A 1NRQH 1GJ7B 2H5CA 4TY7A 4FUGA 1AN1E 3T26A 3SU4A 3S9CA 4CREA 3A7ZA 4UONA 1T8LA 2PWXA 3DD2H 4XOJA 4X8SH 5HM2A 3PV4A 1HAZB 4AOQA 1TONA 3R3GB 5LPFA 1ARCA 1IQHA 4ABDA 1P09A 4I8JA 4CH2B 2UUJB 4NIXA 3MFJA 4FU8A 1DWEH 3ENSB 3U1IB 3U8OH 2FI3E 3VFEA 2VWNA 3LJJA 2ALPA 1O2ZA 1HLTH 1O5EH 4XBDA 1GDNA 2IPHA 7GCHG 2NU3E 4X6OA 2P3FH 3TITA 4X2XA 4F49A 5FBEA 2YMSC 2P16A 3R0FA 1LVMA 1D6RA 3ZYEA 3HKJB 2JETC 4FETA 3SZNA 3E8LA 1TGCA 1P03A 2ASUB 5GWZA 3PV2A 3B9FH 1C5ZB 1HUTH 1J14A 1LQEA 4WMDA 5C3NA 4JZFH 2WYJA 2ANWA 1SFIA 3MH7A 2Y5GA 1QRXA 1QRWA 1XM1A 1SGFG 1IQEA 3KGPA 4BAOB 1SQRA 2Z3DA 1C5SA 1QHRB 2O8WA 2J9NA 4DGJA 2PUQH 1K22H 1OP0A 1C2HA 4B6FA 1KYNA 2GJGA 3MU1A 3I29A 1MU8B 3RXEA 3F0OA 2ZFQH 4FUHA 1F0RA 1QBOA 5HGGA 3N99A 2WV4A 3UWIA 2PUXB 1QGFA 4MNWA 1CT0E 2BB4A 1LO6A 4I8GA 3RC6A 2BZAA 3KQBA 2ZQ1A 3CENA 3OFND 3QLPH 1NU7B 2CK3D 3OYPA 4K8BA 4HI3A 4UE7H 6LPRA 5EW1H 1P2QA 1Y3XA 1H9LB 3RXVA 1DXPA 4BAMB 2A4GA 3LH3A 1V2RT 1LPGB 2VBCA 3LDXH 3M36A 4P00A 4NFEA 1Z8GA 1FY5A 4HG6A 1AMHA 2FOAA 1OX1A 4A7IB 4IGDA 1P2JA 4D7FA 3AW0A 1YF4A 2PGBB 4X2VA 3BTDE 2SGFE 3DSGA 2B0FA 1V2WT 2V7QD 2VIDA 3ZV8A 1CGHA 4K3JA 2FWWA 2PW8H 3LH1A 3MWIU 3TU7H 2TGAA 1U6QA 3FKSD 2VVUA 2FMJA 2W5EA 1KXFA 3SHAH 1OXGA 3ZZDA 4NSVA 1LMWB 1MTWA 1UVOA 3FVFB 1W8BH 2G51A 1IQFA 3DUXH 2ZU1A 2WUCA 4XFQA 5EIYA 4TPIZ 2JKHA 5EPYA 2P8OC 2G81E 1TNIA 4ZKOU 2GVFA 5F8TA 4B1TA 1UVPA 2ODYB 2W6ID 1MU6B 3VB3A 2GKVE 2DE9A 5FXLA 2XBVA 1AI8H 2J92A 2QYIA 2AMDA 2FO9A 1XXFA 1GCTC 1P12E 1ZYOA 3C27B 1HJAC 3Q3KA 3WWFA 2ILNA 2A2XH 1L1GA 2C90B 2R2MB 3BF6H 1NESE 1O3DA 1UCYH 1WCZA 2TGDA 3NPSA 2DUCA 3SQEE 3V7TA 1FDPA 4X1NU 3SOSA 1RTFB 4ABAA 1SC8U 1NPMA 1EB1H 1YPEH 1G2MA 4MPVA 4UFEH 3A87A 3OU0A 5FCKA 1ANCA 4AX9H 3EA9A 1UHBA 5C5NA 2QGRA 1MTUA 4THNH 1GI4A 1O5CB 3D23A 4Q2KA 1H8HD 4Q7ZA 2ODPA 1C5NH 1FMGA 1PFXC 3BTGE 3UAIC 3DFLA 3VG8A 1LVBA 1WAYB 3H09A 4Y79A 3ZZ9A 3SI4H 3SHCH 3LU9B 1N8OC 1YKTA 3O8RA 2A5AA 1AO5A 1S5SA 3UIRA 2ZFRH 1ZPCA 1DOJA 1EJMA 1KTSB 5T6GA 1THPB 9LPRA 2CV3A 4Z1MD 1AE5A 4IW4E 4U32A 4X1QU 2ZU3A 4D7GA 1TIOA 2Y82A 1ACBE 3GCTG 3HGPA 4YO9A 3SUDA 1S81A 1UTOA 5HIYA 2BZ6H 4ISOA 1AE8H 2YMSD 2A32A 2P59A 2XC4A 2R3YA 1EJNA 3EQ0H 1IOEA 1OOKB 2FYRA 2YNBA 3ZVGA 1HFDA 2HPQH 1SQTA 2ZIQH 3MMGA 4KTCA 1BHXF 1P06A 1GBJA 4YLQH 2FM2A 1BJVA 1SBWA 2BLWA 3QK1A 2UUYA 1UJ1A 3DCLA 1RIWB 2RA3A 1C9TA 1O2JA 4IC5A 1Q3XA 1O2KA 2HNTF 2ANMH 1JXPA 1UTKA 1Y8TA 3UQOA 2WPDD 4BTUB 2PHBA 4BAQB 2ZU5A 1MBMA 2CF9H 2PTNA 2A7JA 1F0SA 1DLEA 3PWBA 1C1RA 3EA8A 4X8VH 2QCYA 1C5XB 1L4DA 5EXLA 1TB6H 3M5OA 2HRVA 1F92A 4ISHH 1N6YA 1HAHH 3UR9A 2AGEX 4BTTB 4ESTE 1Z1IA 3ATKA 4FOUC 4Y10E 4H4FA 2ZFTA 4JMYA 4NFFA 3RU4T 1G32B 1C4Y2 2NU0E 2C3SA 3IITA 3V3MA 2UWLA 4I8LA 1L1NA 3LGYA 4XRNA 1T8MA 4MLFB 2CGAA 1DWDH 1MCTA 3MH4A 2ZQ2A 3RXKA 4RKJB 1AGJA 1NBMD 3GDVA 3M3VA 3U69H 1ZZZA 2DE8A 1EOJA 1QIXB 4FU7A 3SUEA 5G4BA 1GJAB 1O3KA 4KKDA 4OGXA 1ELTA 1SGPE 3E1XB 1E0FD 4HGCA 2FOGA 1SHHB 3CP7A 3RXBA 3TGJE 5L6NH 2FI5E 1HAGE 3MNSA 1CGJE 1YGCH 3FZDA 5L2YH 2AEIH 1AUJA 4WVPE 4HZHA 1FV9A 3RU4D 2UWOA 1E36B 1KMHB 1PJPA 3SW2B 4ABJA 2EI7A 1HAXB 1EUFA 1H8ED 1O2IA 1SL3A 2BX4A 4P02A 5L30H 5EOKA 3NZIA 2WYGA 3Q77A 2R0LA 5T6FA 3VXEH 3SUGA 2OP9A 1GHYH 1L2EA 1OWKA 1LHGH 2OXSA 2ZGJA 1MTNC 4UFGH 3F3BA 2XBWA 1GBTA 1UHBB 1WQSA 4Y0YE 1L4ZA 1FJSA 1NU9A 1YPLH 4XE4A 2VU8E 2XRCA 4CBOA 2FXRA 2WV9A 4X8UH 5T6DA 3A8AA 5KGOA 4Q4LA 1BMNH 2W7SA 3LT3A 2OINA 1HAPH 2XCFA 1EFRD 3M5LA 5AHGH 1HGTH 1TLDA 1GI7B 1P11E 1TMBH 2OCVB 3MO3A 2IJOB 3TJVA 4MPUA 1HIAA 1P3EA 1QB1A 2ANYA 1SKYE 2ZGXH 1HAIH 2FOMB 1GMHF 1TA2A 4DURA 5L2ZH 1QR3E 1OP8A 1WDIA 1DY8A 3PO1C 1C1PA 1BMLA 1O3CA 2KCAA 1A1RA 1T4VH 1BITA 2OD3B 1GMCG 4A6LA 1OP2A 2FLBH 2V6NA 3QN7A 1O2TA 2ZZUH 3NUMA 4NIYA 2OTVA 1UVSH 2ZECA 4IN1A 1O3GA 3ELAH 3KN2A 1AWHB 1O2GH 2Q6FA 2IJD1 2D2DA 2ZPRA 2VWMA 3KF2A 1NM6A 2XXLA 1E34B 2D1JA 5EQQA 3GICB 1ZRKA 2BY9X 2GZ9A 2VNTA 1MTSA 1C2EA 3SUFA 1DANH 1TGBA 1JWTA 4KELA 2HOBA 1GBMA 3G01A 3F9HA 4OS4A 2F9BH 4ZKNU 1GHVH 4NA8A 2OLGA 2BMGB 2RFKC 2Q1JA 4JK6A 4CRAA 4DCDA 2EEKA 4M9FA 4UFDH 2J5UA 2ZP0H 4X6MA 4X8TH 2TBSA 2K8IA 4I86A 2I6QA 1M9UA 2VB0A 4AORA 1FI8A 2HVYB 1E79D 3GCNA 3SQHE 7GCHF 4YOJA 1ESTA 1TNKA 5TCCA 1H9IE 1ABIH 3S0NA 3AASA 2A31A 3KEEA 4HFPB 4XSKU 5TJXA 3TH3H 1QQ4A 4MNVA 1TE0A 4E7RG 2L6OA 3V12A 1Y5UT 1KY9A 3Q3XA 4BANB 3LGVA 1C5WB 1C1OA 3E16B 3PLBA 1UVUH 3H5CB 1CT4E 3VB5A 1ELBA 4H6TA 3MU0A 1V2KT 4DT4A 1TYNA 4NZQA 5GPIB 1EP6A 2ZDNA 1LPKB 3MNCA 3UNSA 2VIWA 3N7DA 1MUEB 3NKKA 2BD4A 1K1PA 4X6NA 1P3CA 4H42U 3RXFA 1HAYB 1O37A 5C67A 1V2TT 3LGTA 1RD3B 1P2OA 3TGIE 4K5ZA 5ETXA 4IC6A 1DM4B 1EKBB 3ITIA 1BRBE 1KXDA 1LCYA 4YTAA 1VCWA 1RRKA 1ELVA 1OYQA 3TJNA 1Y5BT 3A84A 1S6LA 1TX8A 4AFQA 1BMMH 2H9HA 1GI6A 2H1UA 2J38A 5C0TA 1C5PA 1BQYA 1O31A 3N7OA 1TGNA 1T4UH 2STBE 2THFB 1O2HA 5GCHG 1GHBG 1MQ6A 1D3PB 5GXPA 1GVKB 3TJOA 3LC3A 1TOMH 4TWYA 4JYVH 4X1RU 3ZYDA 1GI0A 2VIVA 3M35A 5EXNA 2HVXA 4JYTA 2Q6GA 3W94A 1PPZA 1LPZB 1XKAC 3BTKE 3F1SB 3DSOA 1HIAB 2GCTB 1QA7A 3ZZCA 3O8CA 1QB6A 3VB7A 2VH0A 1C2JA 1IAUA 1FIZA 4NZLA 2BD9A 4Q7XA 3SU5A 8GCHG 4HTCH 1QY6A 4ASUD 1LHFH 4CRCA 3EE7A 2A4OA 1UTMA 2ZHDA 2Y7XA 2ZNKH 3UNRA 4R8TB 2FX4A 1LKAA 1MCVA 2QN5T 1YYY1 1JMOH 2D26C 5HIZA 1DT2A 1BBRE 1O3BA 4TPYA 5FPTA 1O3MA 1T31A 1DDJA 1K1IA 3QGJA 2XCNA 1G3DA 1O35A 5DP4A 1EPTA 3L3TA 3SI3H 4F48B 1Z8IB 1VJ9U 2GCHG 1HJ9A 1GHWH 3H7OA 5I25A 2V3MA 1GI2A 3N7EA 5DP7A 1MKWH 1O3LA 1P57B 4O9VA 3SU6A 2FX6A 5F53A 4YT6H 2JIZD 2QF5A 1Z8JB 1ZR0A 1NRRH 4XBCA 3QWCH 2VIOA 4DG4A 2HLDD 3RXLA 2A1DB 1CBWB 1MD8A 3VB6A 1FUJA 3HATH 2EI6A 3LOXA 1TRNA 6CHAC 1SLWB 8ESTE 1C5UA 2G5VA 2O8MA 4SGAE 4AYVB 5EQRA 3RXUA 2RDLA 2BD5A 4KTUA 9ESTA 2BM2A 1K0HA 3BIVH 3GY2A 4WXVA 1DFPA 3UOPA 2XNDD 1ZHPA 3ATMA 2KAIA 4D9QA 1TPPA 5A0AE 2JDID 2PSXA 2BD3A 5EJLA 4Y7BA 4DIHH 2LP6A 2H5DA 3OAAD 1NRNH 1ETTH 2F9UA 1C1TA 2QXGA 4M7GA 5CHAB 4JYUH 4X2YA 2FTMA 2FZZA 1SFQB 3UOUA 1QCPA 3SV8A 3BTEE 3GCTF 3UWJH 5JB8S 1J15A 1ZGIA 2VH6A 2BVSH 3SN8A 1PYTC 2VGCC 3SU2A 3ODDA 2AGIX 3JZ1B 1C9PA 1MKXH 1LKBA 4BXSA 8LPRA 3BG8A 3SNBA 1FY4A 2GDDA 5GJ4B 3URDA 1PQ7A 3SGQE 5AFZH 1OWEA 1ZSKA 3SGAE 4MPWA 2Z9JA 1UK2A 1QA0A 2ZDAH 3GCHB 2FPZA 2G52A 3S9BA 1YM0A 2FS8A 1MKWK 2NU1E 2GD4B 4DIIH 1AFQB 1X7AC 2GMTB 2P94A 1A7SA 1PQAA 1ARBA 1Q31A 2C8WB 4WWYA 1PPEE 1P8VC 2IOTA 5LH8A 1Z8RA 1P10A 1PPGE 1SGRE 1RIWC 3T29A 3M7TA 4J2YB 2WUBA 1AVWA 2H2ZA 1UK3A 1FIWA 6ESTA 3K6YA 1D3DB 1QURH 1UVTH 2Y80A 3ZZ5A 4A5TS 3T28A 2B5TB 4MNXA 3IWMA 1DUEA 2W3IA 4ZHAA 1ETRH 1ANDA 1G37A 1GL0E 3HKIB 1GJ9B 5K0HA 2PKSB 5CE1A 1XUHA 2JH5D 2BXUH 1T7CA 4BAKB 1C2DA 1OWJA 2QF3A 3S9AA 1O3PB 2V3OH 3STJA 3T2NA 4Y7AA 4ABFA 1P02A 2VIQA 1DSUA 2SFAA 1TX6A 3F9EA 1P01A 1CVWH 3ZZ6A 4WMFA 1S0QA 1ZHMA 2QC2A 2YOLA 2BOKA 2Y5HA 3KNXA 3M3SA 2F9VA 5AFYH 1NTPA 1MKXK 2WV5A 3QDZB 1EPTB 1GBFA 1YCPM 1EOLA 1V2PT 2NU4E 1B7XB 3EDXB 3I78A 2XC5A 3BG4B 2GZ7A 5DO4H 1GG6C 1HXEH 3SNAA 3MO6A 3U1JB 2HNTC 2VINA 3PV5A 1KDQB 2VWOA 2A45B 5EGMA 2JH0D 4RI0A 4X2WA 3BTFE 1KLJH 2VWLA 4GAWA 4B2AA 1NFUA 1O5DH 1O2VA 3GISB 1COWD 1ID5H 4ABBA 1W7GH 1UTNA 1O2OA 1THSH 2Z3CA 1F2SE 1JOUB 3A80A 2ODQA 4GUXA 1O2WA 1S0RA 4FVBA 3SJKA 3UY9A 4ZROA 4NIWA 3FFGA 4DW2U 4FUJA 1K21H 1NFYA 4Y71A 1L1JA 2F9NA 1F0UA 2R3UA 4ZKSU 1GHZA 1ZMLA 1ABJH 1W12U 1K1MA 3P92A 3ZZ3A 1J17T 1DWBH 1GMCF 2ZHQH 5EJZA 5LPRA 1O2NA 4ZH8A 2O8LA 1AIXH 3PMBB 1O32A 2WINI 2XYAA 2UWPA 1UTLM 1CA0C 2WPLS 1PPHE 1QQUA 2PKAA 3FAOA 1TNGA 1RTKA 1HPGA 2P3UB 1ELGA 1T32A 1PYTD 2OK5A 4K69A 2J98A 4KTSA 4LOYH 4YXWD 1BT7A 2M2AA 1GI5A 1AHTH 2JJ1D 1EATA 1ESAA 1BA8B 1JRTA 3KQDA 4E7NA 1HYLA 2D8WA 3H7TA 1TQ7B 4IMZA 1JRSA 4AN7A 1O2LA 1GBIA 4SGBE 2Z3EA 2BDAA 4WY3A 4NG9H 1O3HA 1NFXA 1S84A 3OX7U 1BTWA 1A5GH 1PQ8A 3P8NA 1A0LA 3ZVBA 1EXFA 2KM0A 1RXPA 5E2PA 3MU8A 5DJ7A 3KYFA 1UW7A 1C1SA 1SGDE 2AS9A 3F2GA 1DY9A 2YMSB 1UCYK 3K65B 1XUIA 1O2YA 1SOZA 2BD2A 1SGTA 2FYQA 3A83A 1DX5M 4XBBA 3O8DA 3QX5H 2BDBA 1FY8E 1UO6A 1O38A 3FP7E 2JH6D 4NA9H 1TAWA 3ZVAA 1ZTKA 2PGQB 3W95A 2J34A 3GDSA 1KXCA 3MO9A 4A92A 2FS9A 2BQWB 2KFWA 1IQLA 2SGPE 4K60A 1EASA 1C4U2 5FHTA 1C2GA 2GV7A 1S6FA 5KEDA 3GY7A 5BRRE 2F3CE 3TGKE 1HB0B 3A7YA 1GBAA 1G3EA 2VJ1A 1C2FA 2QAAA 1NN6A 4BTIB 2TRMA 2C93B 1DXWA 1TBQH 1XUGA 3BSQA 2YNAA 1GVZA 1FX0B 1Y3UA 1SB1H 1BJUA 2XBYA 3MH5A 1NFWA 3KCGH 1TRYA 4K1TA 1IHSH 3DHKH 2Z9IA 2BX3A 3EE0B 1BOQA 4ZCNA 3SNDA 1SGYE 4Y6DA 1ELAA 4MVNA 3UUZA 1ETSH 5E0GA 2BY5X 1TWXB 3MNBA 1K9OE 2ANKH 1F7ZA 4NWLA 5GCHF 3RXTA 1GHBF 2Y7ZA 3QGNB 1V6DA 3M7UA 1OSSA 5EU8A 1NZQH 2BOHB 2BD7A 1SGCA 2BVXH 3A88A 4K8YA 4YOGA 4OM9A 5HM9A 1MD7A 3T27A 1O3JA 1BZXE 1BHXB 1HV7A 3E0PB 1C5VA 1S6HA 4OS6A 1C1VH 3MI4A 3LGIA 2AIPA 2AMQA 3PLKA 1D9IA 2BLOA 3RUOA 2AERH 3ZZ8A 1GPZA 1KXEA 1OWHA 1PPFE 3E3TA 1FXYA 3U28C 3ZZ4A 1HNEE 1XUKA 4A1XA 8GCHF 1F5RA 3ATIA 3D49H 3M37A 2STAE 2G4TA 4AGJA 3B23B 1GGDB 2C8XB 1VCQA 1ANEA 3I77A 2FLRH 2Y81A 1WTHD 3Q76A 4WH8A 5C17A 1ZTJA 2CJIA 4ZAEA 1ZHRA 2V3HH 4Q80A 2GCTC 3E90B 2ZPQA 4A1TA 3S69A 3RXJA 4ACBA 1S83A 5DKMA 5A0BA 2GCHF 2J94A 2WPIS 4ACAA 5GIBA 1AQ7A 1GJ4H 1UCYE 1VJAU 1O0DH 1EQ9A 1FAKH 5HYOA 4LZ4B 3KL6A 3A8BA 2R0KA 3LIWA 1V2NT 3RMNH 1E1QD 2BD8A 1W7XH 3D65E 1EZUC 1JIRA 4X1PU 1V2OT 5E0HA 1A0HB 2FIRH 4H6SB 1GBKA 1V2UT 1XXDA 1A3BH 2OC0A 4LXBH 2ZDLA 4Y11E 4ABIA 3UNQA 2A7CA 1DE7H 5HMAA 4LZ1H 2ZTYA 1O3OA 3A7VA 3RXOA 3FO8D 1MAXA 1J8AA 3K9XB 3RXGA 2PSYA 2CF8H 2G5NA 3CS0A 2BY6X 1TMUH 1O5AB 1N8OB 3BEFB 2XOKD 3PMHB 1O33A 3F9FA 5F8ZA 3ZVEA 4IMQA 5A0CA 3HGNA 1C5LH 2Z94A 2FDAA 4OS7A 2H6MA 3GY3A 3RMOH 5JBAS 2GX4A 1KXBA 4CRGA 2O8UA 2W7UA 3NRLA 4DOQA 1NBME 1WSSH 3BTWE 1A3EH 1W3CA 1LVYA 3HK3B 3F2FA 4E06H 1PPCE 3PMJA 4D8NA 1GI9B 4BAHB 1W11U 2GTBA 1TOCB 2ZDVH 3LJOA 1ANBA 2EC9H 1AZ8A 1SLXB 1Y59T 2QXIA 2HNTE 2ZGCA 3RU4E 1C1NA 1EB2A 4AG1A 5GNDA 1Y5AT 3SZEA 3SV9A 1K28D 3ZV9A 3TH2H 1WTGH 4JZDH 4Y8ZA 3SU3A 3BTME 2VVVA 3VGCB 3ESTA 5T1VA 5F03A 1TBRH 3UREA 3B8JA 4Y8YA 2FOCA 2HWLB 1O2UA 5JB9S 1ORFA 2ZC9H 2NWNA 1TA6A 3PYHA 3OTJE 2LNCA 6GCHG 4WH6A 1V2QT 4OS5A 1GHAG 4MG3A 4TYDA 5A2MH 1C5MD 1FN8A 1N1LA 1W14U 1SVPA 2A7HA 3QTVH 4AB9A 3UPEA 5AF9H 3M61U 2FESH 2QA9E 1F5LA 1GJ6A 3SNEA 2JJ2D 1WBGB 1PQ5A 2NU2E 1EX3A 2CHAB 2P93A 1WQVH 3F2HA 1KLIH 2R2WU 1DLKB 3BEUA 5IYTA 4GHQA 1WU1A 3RXAA 1W2KH 1FAXA 3QO6A 1AVGH 1WYKA 5C20A 2HGTH 4DY7B 1UK4A 2C8YB 3PRDA 1QJ6B 4B73A 5EJ1A 3QTOH 2H9TH 3SJ9A 4CH8B 4YZUA 1MH0A 3LGWA 1RGQA 3K6ZA 4JZEH 1SGQE 2A4QA 1D6WA 1GVLA 1HJ8A 2P95A 4TT3D 1WXRA 1FPCH 4KP0A 5B6LA 5B6OA 3OEHD 1KTTB 1MTNB 1RTLA 1MABB 4NIVA 1IQGA 4CR9A 4MNYA 3MU4A 3E6PH 3E0NB 3MOCA 4E05H 4I32A 3A7XA 3PM3A 1E35B 4CHAB 1GI1A 1TPAE 2BHGA 5ESBA 1EPTC 1V2LT 3SU0A 3NK8A 4PROA 1SGNE 1HAVA 2FOHA 3M5NA 1OHHD 4ISLA 3BG4C 2O8TA 1CHOG 1GJDB 1NC6A 1Z7KA 5PTPA 2J2UA 2F9PA 3L6PA 1XX9A 2XTTB 3VXFH 1OWIA 3RXRA 1Y3VA 4B71A 2Z6BD 2WHXA 4AZ2B 1GL1A 1C2KA 2GT7A 3T62A 4F55A 3GY4A 1W0KD 1YP9A 4RSPA 1CT2E 4I8HA 1BTXA 2ZFSA 5A8ZA 5CHBA 5CMXH 1TABE 2W6JD 5TCAA 3PLPA 3PO1B 3PRBA 4OS2A 2BDIA 2WPMS 3SGBE 2SNVA 3SU1A 1S85A 1AVXA 4FVDA 4AG2A 3U98H 1AD8H 4DJZB 3GOVB 3PTNA 1BCUH 1W0ZU 2SGQE 1C2IA 4B6EA 3HPTB 2BDHA 3E91A 5JBTA 1P9SA 2FODA 1J16A 4Q7YA 5C1YA 3U8RH 1GI8B 3F0PA 5JPMH 4FUIA 5T3HA 1VITH 3UQVA 5FL7D 3FZZA 5A8YA 2ZWLH 1AB9B 1EAWA 1A0JA 3VB4A 3SO3A 2W3KA 5DP5A 4ZMAH 3MNXA 3RLWH 1G9IE 7KMEH 4ASHA 4AFSA 1B0EA 1V2ST 1VITF 1QL8A 2IPQX 2PFEA 2SGDE 2ZCKP 1UTPA 1KSNA 5EPNA 5FBIA 1EJAA 1L0ZA 4I31A 1V2MT 4K1SA 1A5HA 5ABWA 1EAUA 3TLOA 4AGKA 3PB1E 1MZDA 4IBLH 4FUCA 1LTOA 1O2MA 1QBVH 1GJBB 2FP7B 3AVZA 1UTJA 3V13A 3A85A 4UDWH 2QE7D 3FP6E 3GY5A 4ABHA 1ZMJA 3RC5A 2AYWA 3PMAB 2ZHEH 4GCHG 4WF8A 1O5BB 1GBDA 2WSSD 2HLCA 3TVJB 3RXQA 3UR6A 4MTBA 4JZIA 4IS5A 1ZTLA 1FPHH 5DP9A 1SR5C 3TIUA 1C5RA 1OS8A 2QY0B 2ZTZA 3VPKA 3A8DA 5DK1A 1YCPH 1GBEA 1ESBA 1D3TB 1D4PB 2HALA 2KZ4A 2ZDKA 3MYWA 3SJ8A 4U2WA 2Z7FE 1O39A 3MH6A 4ZHMU 1YLDA 4RKOB 5K7RA 1GBHA 1K1JA 4CBNA 3Q3YA 2KCPA 3ATWA 1N6XA 3NXPA 1C1MA 4AYYB 2K1QA 4B76A 3RM0H 5DG6A 1MZAA 1HCGA 4Y8XA 1FNIA 3M7QA 2L74A 4R0IA 1H8DH 1O2XA 1SQOA 1UTQA 4Z0KA 3BV9B 1XVOA 1HAVB 2EA3A 4TSFD 3T25A 3A81A 5F8XA 2FEQH 5FCRA 1BTHH 1C2LA 1K1NA 4U01A 4VGCB 2H9EH 2B7DH 1YPKH 1OPHB 1ZMNA 4I8KA 1QL9A 1W10U 3NWUA 2V0BA 2OC7A 4GPGA 1NO9H 1XKBC 8KME2 1BMFD 1MTVA 2FOBA 2PLXA 1SSXA 1WV7H 2QIQA 4ISIH 1GHXH 2LELA 3F68H 4GVUA 5IK2D 2Z9GA 3GY8A 1O2PA 3ZVCA 1EP5A 3WW7A 2UUKB 4Q63A 5E2OA 5CDFE 1LHEH 1WOFA 5JBCS 1VGCB 4I33A 4ZHLU 5DPAA 3DSPA 5E8EH 1DUAA 1XMNB 3WY8A 2ZHFH 5ESTE 2BVRH 1ELEE 1YY3A 2CXVA 1T8NA 1YCPK 2BLVA 2KAIB 4RT1A 5EODA 3TJUA 1BTYA 3DT0H 1H8IH 3GCOA 2A0QB 1OYTH 2BDYA 1GGDC 4GLYA 3LC5A 4X1SU 1XUFA 1TRMA 1MAYA 5FX6A 1AZZA 3Q00A 1JIMA 1YPMH 4D76A 2BQ7B 1EZSC 3K2UA 1XVMA 1HXFH 1ELDE 1C2MA 3RC4A 6CHAB 2PP6A 1BDAA 2F83A 3F9GA 4ZKRU 3JZ2B 4FU9A 1P9UA 2V35A 3ODFA 5HXFA 3P6ZB 5C2ZA 1YPHC 3BEIB 2QXHA 1WUNH 1BUIA 1DVAH 4GSOA 1QJ1B 4ISNA 5C1XA 1TNJA 1E1RD 4O3UA 1EZXC 4X6PA 4YLUA 3M5MA 3P8OA 2W26A 3BIUH 2OC1A 2QF0A 4NCYA 1SLVB 2VIPA 3ZZBA 1DSTA 1G3BA 5EW2H 1C5TA 1NRPH 2ALVA 3EA7A 3TK6A 3ATLA 1VITG 3RXSA 2ZEBA 2VGCB 3C1KA 4NSYA 4Y0ZE 1DICA 2HPPH 4BOHA 3HK6B 3DA9B 2ZF0H 7LPRA 3GDUA 1ZJDA 3FANA 4Z6AH 1A2CH 2RDEA 3T5FH 4ABEA 2O9QA 5A8XA 1BB0B 2Q6DA 4J1YA 1P05A 3BTQE 4D9RA 4ZUHA 1ELCA 5DP3A 5EQSA 1C1QA 1QJ7B 1CE5A 2C4FH 2ZU4A 4NWKA 1QBNA 3RXDA 5LGOA 2WPHS 1Z6EA 2JETB 3OY6U 1SGIB 3EAJA 4NA7A 1TPSA 1S82A 4WXIA 1FQ3A 6GCHF 2XWAA 5JBBS 3RMLH 2ZHWH 1GHAF 3SBKA 3S7HB 1T8OA 1MBQA 4WJG2 1BIOA 1RFNA 2TPIZ 3OTPA 2ESTE 4LK4A 3U9AH 3BTTE 3U8TH 1NRSH 2BTCE 1AFEH 4INKA 3RMMH 1V2VT 4UD9H 1TPOA 1B0FA 3MU5A 1F5KU 3VGCC 1O34A 1BMAA 1SOTA 2G8TA 2ZPSA 1CQQA 2B8OH 4CRDA 5J4QA 3P17H 1VZQH 1K1OA 2BQ6B 2G00A 5IDKA 1P04A 1KIGH 2Y6TA 5FPYA 2A4RA 1QB9A 1HDTH 2BDCA 1BTZA 1QRZA 1P2MA 1ZJKA 4OS1A 2AMPA 3GYMA 5DP6A 2A5KA 1GBBA 3RXMA 3CNRA 4DVAU 2CHAC 1W13U 3KYGA 2I6SA 3V0XA 1GMDF 3SV6A 1O3NA 2AFQB 1O3EA 1SQAA 5FX5A 3F6UH 1C1UH 1GWAA 1ZGVA 1G2LA 1O2SA 1NT1A 1V3XA 2OBOA 1P2IA 3RP2A 5F6MA 2QXJA 1YLCA 1Y3YA 2WPJS 4F4OC 1HAOH 3GYLB 3P70B 5HKKD 2VVCA 3AAUA 2AGGX 3ZVFA 1CSOE 2F43B 2LPRA 3RXPA 2AH4X 3MHWU 1P0SH 1GG6B 2CN0H 2ZA5A 3KHVA 4FXGH 1EAXA 3IG6B 2P8OB 3S7KB 1SGEE 4X0WU 1QNJA 1BRAA 1CHGA 1EZQA 2M5TA 4YESB 2BLQA 3SYJA 4B74A 1RS0A 3SJIA 1H4WA 3A82A 1CHOF 2PKAB 1GCTB 1ZRBA 1HJAB 7ESTE 3CS7A 4OGYA 1TNHA 4YOIA 4INHA 1O3IA 2XWBI 1LQDB 1TBZH 3A86A 4ZXYH 1OKXA 4B2BA 2FI4E 2J98B 3L33A 2OC8A 4CHAC 1QFKH 3KQ5A 4RN6A 1IQJA 3A7TA 1D3QB 2C8ZB 3KQCA 1Z6JH 2AHME 3LKWA 1VKYA 3A89A 1BBRH 5KECA 2RG3A 1GI3A 1CU1A 1HRTH 1AKSA 4Y76A 3UTUH 4CRBA 1C5OH 1J9CH 1CA0B 1SGFA 3KQEA 4O97A 4CRFA 3OE7D 3WWBA 2GGVB 3ZVDA 2KCYA 1H9HE 5DP8A 2Z9KA 1SPJA 1TFXA 4AFUA 1ZPZA 2K0QA 4XDEA 1CBWC 2G4UA 4GHTA 4MDSA 2ZCLP 2BY8X 1FONA 1P2NA 5C1UA 1A61H 1ZOMA 1SLUB 3LPRA 3OY5U 2CMYA 2A2QH 2GT8A 4TWWA 1DITH 1SHYA 1SI5H 2ZTXA 1EAIA 2FOFA 2TIOA 1XUJA 5EG4A 1NS3A 5DN6D 1QTFA 2BY7X 2QV1A 3LONA 1DS2E 4NGAH 4YM9A 3RDZA 1Z1JA 2ULLA 4YT7H 4JZ1A 2RA0A 5JDUB 1O3AA 3TK5A 1AB9C 1BRCE 2Y5FA 5CHAC 4FUFA 1IQNA 1C5YB 1FN6A 1ZSJA 4I7YH 3M3TA 2OBQA 1THRH 2P3TB 3ZZAA 1FY1A 3A8CA 3SV7A 4B75A 4AFZA 2QF4A 2Z9LA 1AUTC 4GCHF 2UUFB 1CGIE 2ZDMA 2AIQA 2ZGHA 2F4LA 1ELFA 2WPKS 1TMTH 2KR7A 1BBRK 2PR3A 1C4V2 2XC0A 3PTBA 4U30A 5JYIA 2ZG0H 1A4WH 3RLYH 3P8FA 2ZFFH 1AY6H 1GBCA 1TNLA 2KCOA 2J4IA 3TNSA 3RXCA 3GCHC 1GBLA 1Z71A 4BNRA 3AK5A 1SG8B 1MQ5A 4DT7B 2OUAA 1AFQC 2B9LA 1F0TA 1TQ0B 2GMTC 1GDUA 3ZIAD 1Y3WA 3UB0A 4TY6A 4ZXXH 1YWUA 1K1LA 2XNIA 1HBTH 2XW9A 4MPXA 1TALA 3GY6A 1FLEE 2EQNA 1YLNA 1E38B 2A5IA 1IQKA 3OEED 3P95A 4CR5A 3QZQA 1AWFH 1YPHE 5GDSH 3TNTA 1BTUA 3OSYA 5I46H 2OQ5A 3FP8E 1TGTA 3VEQB 2BXTH 2F9OA 3W1EA 1O5FH 1ZPBA 4IN2A 2PKSC 1LDTT 2EI8A 1GMDG 1V2JT 1MMJN 1FZZA 5AVDA 3FOAA 1KLTA 3QUMP 3TPIZ 4WMEA 3P8GA 1LHDH 3UFAA 1TGSZ 1TX7A 2J95A 4BXWA 1VCPA 2SGEE 1O5GH 2GDEH 1CO7E 2PTCE 5H4IB 3BN9A 1YPGH 1G30B 5C94A 3FN8A 1LHCH 4AC9A 3QZRA 5BPEA 2FTLE 1NY22 5E0JA 5EXMA 1A5IA 4A1VA 4MQAA 1G3CA 1GDQA 4K2YA 1IHTH 4AB8A 1C1WH 2ZKSA 2XBXA 3SORA 4FUEA 1AKSB 5LPEA 4O03A 2OQUA 4VGCC 1E37B 2ZFPH 3KIDU 4JK5A 4KGAA 1ZLRA 3PROA 2J97A 1BRUP 2TGPZ 2PV9B 3STIA 1H1BA 2ZU2A 1GJ5H 5FPSA 1O2QA 1YC0A 1GJCB 2WZQA 1KXAA 4QT8C 1A46H 4FUDA 5C5OA 5DGJA 3PWCA 1O3FA 2KX4A 2ZCHP 4K1EA 1SMFE 3SJOA 1PPBH 1DWCH 1Q2WA 1C5QA 3TK9A 1OWDA 2TGTA 2GZ8A 5FAHA 1GCDA 1IQMA 1ZSLA 4XD7D 1NROH 2F91A 3D62A 2FOEA 1VGCC 3LGUA 1QZ8A 1O36A 2GV6A 3BTHE 3MTYA 3A7WA 3SV2H 1DPOA 2SNWA 4UFFH 1W0YH 1QL7A 1AU8A 4B2CA 2ZI2H 1G36A 1LVOA 2ZGBH 1RJXB 3NCLA 1BTPA 4UEHH 3O8BA 5DSFA 3EYDA 5J4SA 3RM2H 1JBUH 3URCA 1YPJH 2GP9B 1O2RA 2R9PA 4RT0A 1GJ8B 1GMHG 3AAVA 3DFJA 3SNCA 1IQIA 4ABGA 2RCEA 3ZZ7A 1KDQA 2G55A 2SGAA 3RXHA 4INLA 2EY4C 4FUBA 3EGKH 1CA8B 5SGAE 3MQKC 2IN2A 2BDGA
chains in the Genus database with same CATH topology
1VR1H 1INCA 1P2KA 1O30A 3RXIA 1B5GH 1K2I1 2BYAX 4JCNA 5A09A 2ZO3H 1UMAH 3AW1A 1YBWA 3TH4H 4O3TA 1FY3A 1NRQH 1GJ7B 2H5CA 4TY7A 4FUGA 1AN1E 3T26A 3SU4A 3S9CA 4CREA 3A7ZA 4UONA 1T8LA 2PWXA 3DD2H 4XOJA 4X8SH 5HM2A 3PV4A 1HAZB 4AOQA 1TONA 3R3GB 5LPFA 1ARCA 1IQHA 4ABDA 1P09A 4I8JA 4CH2B 2UUJB 4NIXA 3MFJA 4FU8A 1DWEH 3ENSB 3U1IB 3U8OH 2FI3E 3VFEA 2VWNA 3LJJA 2ALPA 1O2ZA 1HLTH 1O5EH 4XBDA 1GDNA 2IPHA 7GCHG 2NU3E 4X6OA 2P3FH 3TITA 4X2XA 4F49A 5FBEA 2P16A 3R0FA 1LVMA 1D6RA 3ZYEA 3HKJB 2JETC 3SZNA 3E8LA 1TGCA 1P03A 2ASUB 5GWZA 3B9FH 1C5ZB 1HUTH 1J14A 1LQEA 4WMDA 5C3NA 4JZFH 2WYJA 2ANWA 1SFIA 3MH7A 2Y5GA 1QRXA 1QRWA 1XM1A 1SGFG 1IQEA 3KGPA 4BAOB 2Z3DA 1C5SA 1QHRB 2O8WA 2J9NA 4DGJA 2PUQH 1K22H 1OP0A 1C2HA 1KYNA 3MU1A 3I29A 1MU8B 3RXEA 2ZFQH 4FUHA 1F0RA 1QBOA 5HGGA 2WV4A 3UWIA 2PUXB 1QGFA 4MNWA 1CT0E 2BB4A 1LO6A 4I8GA 3RC6A 2BZAA 3KQBA 2ZQ1A 3CENA 3QLPH 1NU7B 3OYPA 4K8BA 4UE7H 4HI3A 6LPRA 5EW1H 1P2QA 1Y3XA 1H9LB 3RXVA 1DXPA 4BAMB 2A4GA 3LH3A 1V2RT 1LPGB 3LDXH 3M36A 4NFEA 1Z8GA 1FY5A 1AMHA 2FOAA 1OX1A 4A7IB 4IGDA 1P2JA 4D7FA 3AW0A 1YF4A 2PGBB 4X2VA 3BTDE 2SGFE 2B0FA 1V2WT 3ZV8A 2VIDA 1CGHA 4K3JA 2FWWA 2PW8H 3LH1A 3MWIU 3TU7H 2TGAA 1U6QA 2VVUA 2FMJA 2W5EA 1KXFA 3SHAH 1OXGA 3ZZDA 4NSVA 1LMWB 1MTWA 1UVOA 3FVFB 1W8BH 2G51A 1IQFA 3DUXH 2ZU1A 2WUCA 4XFQA 4TPIZ 2JKHA 5EPYA 2P8OC 2G81E 1TNIA 4ZKOU 2GVFA 5F8TA 4B1TA 1UVPA 2ODYB 1MU6B 3VB3A 2GKVE 2DE9A 5FXLA 2XBVA 1AI8H 2J92A 2QYIA 2AMDA 2FO9A 1XXFA 1GCTC 1P12E 1ZYOA 3C27B 1HJAC 3Q3KA 2ILNA 2A2XH 1L1GA 2C90B 2R2MB 3BF6H 1NESE 1O3DA 1UCYH 1WCZA 2TGDA 3NPSA 2DUCA 3SQEE 3V7TA 1FDPA 4X1NU 3SOSA 1RTFB 4ABAA 1SC8U 1NPMA 1EB1H 1YPEH 1G2MA 4MPVA 4UFEH 3A87A 3OU0A 5FCKA 1ANCA 4AX9H 3EA9A 1UHBA 5C5NA 2QGRA 1MTUA 4THNH 1GI4A 1O5CB 3D23A 4Q2KA 4Q7ZA 2ODPA 1C5NH 1FMGA 1PFXC 3BTGE 3DFLA 1LVBA 1WAYB 4Y79A 3ZZ9A 3SI4H 3SHCH 3LU9B 1N8OC 1YKTA 3O8RA 2A5AA 1AO5A 1S5SA 3UIRA 2ZFRH 1ZPCA 1DOJA 1EJMA 1KTSB 5T6GA 1THPB 9LPRA 2CV3A 1AE5A 4IW4E 4U32A 4X1QU 2ZU3A 4D7GA 1TIOA 2Y82A 1ACBE 3GCTG 3HGPA 4YO9A 3SUDA 1S81A 1UTOA 2BZ6H 4ISOA 1AE8H 2A32A 2P59A 2XC4A 2R3YA 1EJNA 3EQ0H 1IOEA 1OOKB 2FYRA 2YNBA 3ZVGA 1HFDA 2HPQH 1SQTA 2ZIQH 3MMGA 4KTCA 1BHXF 1P06A 1GBJA 4YLQH 2FM2A 1BJVA 1SBWA 2BLWA 3QK1A 2UUYA 1UJ1A 1RIWB 2RA3A 1C9TA 1O2JA 4IC5A 1Q3XA 1O2KA 2HNTF 2ANMH 1JXPA 1UTKA 1Y8TA 3UQOA 4BTUB 2PHBA 4BAQB 2ZU5A 1MBMA 2CF9H 2PTNA 2A7JA 1F0SA 1DLEA 3PWBA 1C1RA 3EA8A 4X8VH 2QCYA 1C5XB 1L4DA 5EXLA 1TB6H 3M5OA 2HRVA 1F92A 4ISHH 1N6YA 1HAHH 3UR9A 2AGEX 4BTTB 4ESTE 1Z1IA 3ATKA 4Y10E 4H4FA 2ZFTA 4JMYA 4NFFA 3RU4T 1G32B 1C4Y2 2NU0E 2C3SA 3IITA 3V3MA 2UWLA 4I8LA 1L1NA 3LGYA 1T8MA 4MLFB 2CGAA 1DWDH 1MCTA 3MH4A 2ZQ2A 3RXKA 4RKJB 1AGJA 3M3VA 3GDVA 3U69H 1ZZZA 2DE8A 1EOJA 1QIXB 4FU7A 3SUEA 5G4BA 1GJAB 1O3KA 4KKDA 4OGXA 1ELTA 1SGPE 3E1XB 1E0FD 4HGCA 2FOGA 1SHHB 3CP7A 3RXBA 3TGJE 5L6NH 2FI5E 1HAGE 3MNSA 1CGJE 1YGCH 3FZDA 5L2YH 2AEIH 1AUJA 4WVPE 4HZHA 1FV9A 3RU4D 2UWOA 1E36B 1PJPA 3SW2B 4ABJA 2EI7A 1HAXB 1EUFA 1O2IA 1SL3A 2BX4A 5L30H 5EOKA 3NZIA 2WYGA 3Q77A 2R0LA 5T6FA 3VXEH 3SUGA 2OP9A 1GHYH 1L2EA 1OWKA 1LHGH 2OXSA 2ZGJA 1MTNC 4UFGH 2XBWA 1GBTA 1UHBB 1WQSA 4Y0YE 1L4ZA 1FJSA 1NU9A 1YPLH 4XE4A 2VU8E 2XRCA 4CBOA 2FXRA 4X8UH 5T6DA 3A8AA 1BMNH 2W7SA 3LT3A 2OINA 1HAPH 2XCFA 5AHGH 3M5LA 1HGTH 1TLDA 1GI7B 2OCVB 1P11E 1TMBH 3MO3A 2IJOB 3TJVA 4MPUA 1HIAA 1P3EA 1QB1A 2ANYA 2ZGXH 1HAIH 2FOMB 1GMHF 1TA2A 4DURA 5L2ZH 1QR3E 1OP8A 1DY8A 3PO1C 1C1PA 1BMLA 1O3CA 1A1RA 1T4VH 1BITA 2OD3B 1GMCG 4A6LA 1OP2A 2FLBH 2V6NA 3QN7A 1O2TA 2ZZUH 3NUMA 4NIYA 2OTVA 1UVSH 2ZECA 4IN1A 1O3GA 3ELAH 3KN2A 1AWHB 1O2GH 2Q6FA 2D2DA 2ZPRA 2VWMA 3KF2A 1NM6A 2XXLA 1E34B 2D1JA 5EQQA 3GICB 1ZRKA 2BY9X 2GZ9A 2VNTA 1MTSA 1C2EA 3SUFA 1DANH 1TGBA 1JWTA 4KELA 2HOBA 1GBMA 3G01A 3F9HA 4OS4A 2F9BH 4ZKNU 1GHVH 4NA8A 2OLGA 2BMGB 2Q1JA 4JK6A 4CRAA 4DCDA 2EEKA 4UFDH 2ZP0H 4X6MA 4X8TH 2TBSA 2I6QA 1M9UA 2VB0A 4AORA 1FI8A 3GCNA 3SQHE 7GCHF 4YOJA 1ESTA 1TNKA 5TCCA 1H9IE 1ABIH 3S0NA 3AASA 2A31A 3KEEA 4HFPB 4XSKU 5TJXA 3TH3H 1QQ4A 4MNVA 1TE0A 4E7RG 3V12A 1Y5UT 1KY9A 3Q3XA 4BANB 3LGVA 1C5WB 1C1OA 3E16B 3PLBA 1UVUH 3H5CB 1CT4E 3VB5A 1ELBA 4H6TA 3MU0A 1V2KT 1TYNA 4NZQA 5GPIB 1EP6A 2ZDNA 1LPKB 3MNCA 3UNSA 2VIWA 1MUEB 3NKKA 2BD4A 1K1PA 4X6NA 1P3CA 4H42U 3RXFA 1HAYB 1O37A 5C67A 1V2TT 3LGTA 1RD3B 1P2OA 3TGIE 4K5ZA 5ETXA 4IC6A 1DM4B 1EKBB 3ITIA 1BRBE 1KXDA 1LCYA 4YTAA 1VCWA 1RRKA 1ELVA 1OYQA 3TJNA 1Y5BT 3A84A 1TX8A 4AFQA 1BMMH 2H9HA 1GI6A 2H1UA 2J38A 1C5PA 1BQYA 1O31A 3N7OA 1TGNA 1T4UH 2STBE 2THFB 1O2HA 5GCHG 1GHBG 1MQ6A 1D3PB 5GXPA 1GVKB 3TJOA 3LC3A 1TOMH 4TWYA 4JYVH 4X1RU 3ZYDA 1GI0A 2VIVA 3M35A 5EXNA 2HVXA 4JYTA 2Q6GA 3W94A 1PPZA 1LPZB 1XKAC 3BTKE 3F1SB 1HIAB 2GCTB 1QA7A 3ZZCA 3O8CA 1QB6A 3VB7A 2VH0A 1C2JA 1IAUA 1FIZA 4NZLA 2BD9A 4Q7XA 3SU5A 8GCHG 4HTCH 1QY6A 1LHFH 4CRCA 2A4OA 1UTMA 2ZHDA 2Y7XA 2ZNKH 3UNRA 4R8TB 2FX4A 1LKAA 1MCVA 2QN5T 1YYY1 1JMOH 2D26C 1DT2A 1BBRE 1O3BA 4TPYA 5FPTA 1O3MA 1T31A 1DDJA 1K1IA 3QGJA 2XCNA 1G3DA 1O35A 5DP4A 1EPTA 3L3TA 3SI3H 1Z8IB 1VJ9U 2GCHG 1HJ9A 1GHWH 3H7OA 5I25A 1GI2A 5DP7A 1MKWH 1O3LA 1P57B 4O9VA 3SU6A 2FX6A 4YT6H 1Z8JB 1ZR0A 1NRRH 4XBCA 3QWCH 2VIOA 4DG4A 3RXLA 2A1DB 1CBWB 1MD8A 3VB6A 1FUJA 3HATH 2EI6A 3LOXA 1TRNA 6CHAC 1SLWB 8ESTE 1C5UA 2G5VA 2O8MA 4SGAE 4AYVB 5EQRA 3RXUA 2RDLA 2BD5A 4KTUA 9ESTA 2BM2A 3BIVH 3GY2A 4WXVA 1DFPA 3UOPA 1ZHPA 3ATMA 2KAIA 4D9QA 1TPPA 5A0AE 2PSXA 2BD3A 4Y7BA 4DIHH 2H5DA 1NRNH 1ETTH 2F9UA 1C1TA 2QXGA 4M7GA 5CHAB 4JYUH 4X2YA 2FTMA 2FZZA 1SFQB 3UOUA 1QCPA 3SV8A 3BTEE 3GCTF 3UWJH 5JB8S 1J15A 1ZGIA 2VH6A 2BVSH 3SN8A 1PYTC 2VGCC 3SU2A 3ODDA 2AGIX 3JZ1B 1C9PA 1MKXH 1LKBA 4BXSA 8LPRA 3BG8A 3SNBA 1FY4A 2GDDA 5GJ4B 3URDA 1PQ7A 3SGQE 5AFZH 1OWEA 1ZSKA 3SGAE 4MPWA 2Z9JA 1UK2A 1QA0A 2ZDAH 3GCHB 2FPZA 2G52A 3S9BA 1YM0A 2FS8A 1MKWK 2NU1E 2GD4B 4DIIH 1AFQB 1X7AC 2GMTB 2P94A 1A7SA 1PQAA 1ARBA 1Q31A 2C8WB 4WWYA 1PPEE 1P8VC 2IOTA 5LH8A 1Z8RA 1P10A 1PPGE 1SGRE 1RIWC 3T29A 3M7TA 4J2YB 2WUBA 1AVWA 2H2ZA 1UK3A 1FIWA 6ESTA 3K6YA 1D3DB 1QURH 1UVTH 2Y80A 3ZZ5A 4A5TS 3T28A 2B5TB 4MNXA 3IWMA 1DUEA 2W3IA 4ZHAA 1ETRH 1ANDA 1G37A 1GL0E 3HKIB 1GJ9B 5K0HA 2PKSB 5CE1A 1XUHA 2JH5D 2BXUH 1T7CA 4BAKB 1C2DA 1OWJA 2QF3A 3S9AA 1O3PB 2V3OH 3STJA 3T2NA 4Y7AA 4ABFA 1P02A 2VIQA 1DSUA 2SFAA 1TX6A 3F9EA 1P01A 1CVWH 3ZZ6A 4WMFA 1S0QA 1ZHMA 2QC2A 2YOLA 2BOKA 2Y5HA 3KNXA 3M3SA 2F9VA 5AFYH 1NTPA 1MKXK 2WV5A 3QDZB 1EPTB 1GBFA 1YCPM 1EOLA 1V2PT 2NU4E 1B7XB 3EDXB 3I78A 2XC5A 3BG4B 2GZ7A 5DO4H 1GG6C 1HXEH 3SNAA 3MO6A 3U1JB 2HNTC 2VINA 1KDQB 2VWOA 2A45B 5EGMA 2JH0D 4X2WA 3BTFE 1KLJH 2VWLA 4GAWA 4B2AA 1NFUA 1O5DH 1O2VA 3GISB 1ID5H 4ABBA 1W7GH 1UTNA 1O2OA 1THSH 2Z3CA 1F2SE 1JOUB 3A80A 2ODQA 4GUXA 1O2WA 1S0RA 4FVBA 3SJKA 3UY9A 4ZROA 4NIWA 3FFGA 4DW2U 4FUJA 1K21H 1NFYA 4Y71A 1L1JA 2F9NA 1F0UA 2R3UA 4ZKSU 1GHZA 1ZMLA 1ABJH 1W12U 1K1MA 3P92A 3ZZ3A 1J17T 1DWBH 1GMCF 2ZHQH 5LPRA 1O2NA 4ZH8A 2O8LA 1AIXH 3PMBB 1O32A 2WINI 2XYAA 2UWPA 1UTLM 1CA0C 2WPLS 1PPHE 1QQUA 2PKAA 3FAOA 1TNGA 1RTKA 1HPGA 2P3UB 1ELGA 1T32A 1PYTD 4K69A 4KTSA 4LOYH 1BT7A 1GI5A 1AHTH 1EATA 1ESAA 1BA8B 1JRTA 3KQDA 4E7NA 1HYLA 2D8WA 3H7TA 1TQ7B 4IMZA 1JRSA 4AN7A 1O2LA 1GBIA 4SGBE 2Z3EA 2BDAA 4WY3A 4NG9H 1O3HA 1NFXA 1S84A 3OX7U 1BTWA 1A5GH 1PQ8A 3P8NA 1A0LA 3ZVBA 1EXFA 1RXPA 5E2PA 3MU8A 5DJ7A 1C1SA 1SGDE 2AS9A 1DY9A 1UCYK 3K65B 1XUIA 1O2YA 1SOZA 2BD2A 1SGTA 2FYQA 3A83A 1DX5M 4XBBA 3O8DA 3QX5H 2BDBA 1FY8E 1UO6A 1O38A 3FP7E 2JH6D 4NA9H 1TAWA 3ZVAA 1ZTKA 2PGQB 3W95A 2J34A 3GDSA 1KXCA 3MO9A 4A92A 2FS9A 2BQWB 1IQLA 2SGPE 4K60A 1EASA 1C4U2 5FHTA 1C2GA 2GV7A 1S6FA 3GY7A 5BRRE 2F3CE 3TGKE 1HB0B 3A7YA 1GBAA 1G3EA 2VJ1A 1C2FA 2QAAA 1NN6A 4BTIB 2TRMA 2C93B 1DXWA 1TBQH 1XUGA 3BSQA 2YNAA 1GVZA 1Y3UA 1SB1H 1BJUA 2XBYA 3MH5A 1NFWA 3KCGH 1TRYA 4K1TA 1IHSH 3DHKH 2Z9IA 2BX3A 3EE0B 1BOQA 3SNDA 1SGYE 4Y6DA 1ELAA 4MVNA 3UUZA 1ETSH 5E0GA 2BY5X 1TWXB 3MNBA 1K9OE 2ANKH 1F7ZA 4NWLA 5GCHF 3RXTA 1GHBF </