1GI9B

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting, hydrolase
total genus 54
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi9B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi9B01
3V3MA 2BD4A 3QO6A 2C93B 1T32A 1QFKH 2P8OB 3MTYA 4FVDA 1YM0A 1Y59T 2ZDVH 3GY6A 1A2CH 2A2XH 1DSTA 2M5TA 2G8TA 4X2VA 2H5DA 1N8OB 3SHAH 1GCTC 3RC5A 1TNLA 1BRAA 4MNXA 3TIUA 1O5CB 4FUEA 1P2MA 2JH5D 1XXDA 1FLEE 2J95A 3ZZDA 2OC1A 4CRCA 2TIOA 2ZF0H 1NM6A 1GBCA 1XUHA 1SVPA 2A45B 2P8OC 2VB0A 1FDPA 1AB9B 1OWHA 2F9VA 2ZGJA 4I33A 1N8OC 1VJ9U 3KN2A 5EW2H 3BTEE 2KAIA 3DHKH 1MQ6A 1P2NA 4X1RU 2FOFA 2A5KA 4JMYA 4IC5A 5J4QA 1HB0B 1QIXB 4D9QA 1K28D 3BIUH 3A8DA 2QXGA 3ZVCA 1O5DH 4GPGA 4ZUHA 3SORA 2YNBA 1AB9C 2J2UA 2OBOA 1O5BB 3PB1E 1CGIE 4AB8A 1D3TB 1YF4A 5ETXA 1EUFA 4WWYA 2G4UA 1BMAA 2STAE 2ZFQH 5T3HA 1XVOA 2OD3B 4Y71A 3S69A 2A4RA 2ZZUH 5IYTA 1Y5BT 3RXFA 4BTTB 1QBOA 2ZHFH 1ZRBA 1S0QA 4XBCA 3ATIA 3L33A 3RXPA 1A1RA 3U1IB 3T62A 5C5OA 2BLVA 3GCNA 3NZIA 4O03A 5E0HA 2ALPA 1OYTH 1EPTB 1H9LB 4OS4A 5HXFA 2FOGA 3A83A 7KMEH 5H4IB 4O97A 4AYVB 3TGJE 1XVMA 4X6MA 2XW9A 2XBYA 2OC7A 2PKAB 2P16A 5ESBA 1BA8B 3RXEA 2Q6GA 4NA9H 3URCA 1TNJA 5TCCA 4DVAU 3MFJA 1O3LA 2KAIB 3EDXB 1O33A 4ESTE 1HDTH 3ZZ8A 1BBRE 3FAOA 3I78A 1QQ4A 3SHCH 2ZTYA 2QXHA 1EPTC 3QGJA 3ZZBA 1DITH 3AAVA 1ARBA 1RTFB 3RM0H 5EQQA 3RMMH 1O2LA 3MHWU 2RCEA 1TMUH 2ZGHA 2ZA5A 3M35A 2GDDA 1FY5A 4AGKA 1CT0E 1NRQH 2HNTE 1ESBA 5A2MH 1UJ1A 1Y3YA 2TGTA 2Z9KA 2ZFRH 4OGYA 5HMAA 1VJAU 4K1EA 1OYQA 4THNH 4CBOA 3D62A 1IHTH 1V2MT 1CT2E 3HGNA 5F8XA 1O35A 1XKAC 1S6FA 1FQ3A 1G32B 2FI5E 2R2MB 3PV4A 1C1QA 4NSVA 4UE7H 3B9FH 4BTIB 4Q7XA 1ABJH 1C5OH 3VB5A 2H5CA 3PLPA 4PROA 4FU9A 2FM2A 2P93A 1YPEH 4ABAA 2VGCB 3JZ1B 2GD4B 1OWEA 4R8TB 1TBZH 2P94A 3M5MA 2RA0A 1K9OE 1YYY1 3P8OA 3SW2B 4CH8B 2P3TB 1GJ7B 2EEKA 1FZZA 2Q6DA 4BXWA 1FMGA 3FVFB 3BG4B 1SLXB 2WPLS 1PPCE 2ODQA 1TNKA 2W3IA 3K2UA 4CREA 4A1VA 5C67A 2EI6A 3FFGA 3VXFH 1TOMH 2FZZA 5DG6A 3TNSA 1VITG 1W3CA 1F0UA 2VGCC 3M7QA 1QTFA 5JYIA 2AEIH 4BNRA 3VB3A 1VCQA 1QHRB 2A5IA 3TLOA 2BY5X 3SNDA 4D8NA 2ZDKA 1J9CH 1J16A 3KQCA 1ELCA 3BG4C 1GHAF 4D9RA 2H9TH 1NN6A 3UY9A 3S7HB 1MAXA 2BZ6H 4BAMB 3PROA 2R2WU 4ZXYH 1TGTA 1C1OA 1FN6A 1O3CA 2BQ6B 2Q6FA 2PFEA 1B0FA 4KTCA 5TCAA 1GBBA 5G4BA 4CRFA 3RXMA 2TGAA 2XC0A 2VIVA 4IMQA 3TK6A 3MU0A 2BLOA 4U30A 2VVUA 3R3GB 1L1GA 2FOHA 4TY6A 3M3VA 1XUIA 2ZCHP 1JIMA 1H9HE 3T25A 1O2YA 5DP5A 2PHBA 3F68H 2V6NA 3LH3A 1GL0E 1YPLH 1U6QA 1E34B 1SFIA 1MH0A 1VZQH 3MO9A 1C2HA 2BYAX 2ZGBH 2GV6A 1IQLA 1KXDA 1LPKB 3PMAB 4Y7BA 2QYIA 3TNTA 2R0KA 2SNWA 3OSYA 1DUAA 1DE7H 1DT2A 1SOTA 1Y3WA 2Z3EA 3SOSA 2WYJA 3QK1A 1P01A 1FXYA 3SGBE 3H5CB 3E91A 1LDTT 1O3PB 1TBRH 2FODA 2ZNKH 1ZSJA 2GTBA 4JZDH 2A7HA 4M7GA 2TBSA 2G55A 2XBXA 2QGRA 1O2KA 1MQ5A 4YOGA 1SGRE 1GI8B 1PPBH 1LVYA 4XSKU 1WOFA 1HJ9A 1QR3E 1IQGA 3LT3A 3TH2H 2ZTXA 2VIOA 1K1OA 1XXFA 1TGSZ 2QV1A 1W2KH 1PYTD 7GCHF 3NCLA 1ELGA 4DJZB 1MKXH 5DP4A 3SJ9A 1ELTA 1ZSLA 1C5NH 2R0LA 2ZTZA 1EATA 3TH4H 1D6RA 2HOBA 3Q3YA 3LIWA 4YTAA 1D3DB 1TAWA 2JETB 1WV7H 2C3SA 2GGVB 3E8LA 1RGQA 4NZLA 3IG6B 5CMXH 4WY3A 2O8UA 4I31A 2BY9X 4Y0ZE 2G51A 1QJ6B 1NPMA 3TJVA 3ITIA 1TA2A 2WYGA 1YKTA 4Y76A 1C5UA 3BV9B 3ESTA 2QCYA 3RU4E 4AFUA 3ZZ6A 4Y8XA 1O2OA 1NRSH 3MNBA 3V7TA 3BTGE 1P3CA 1RJXB 2B9LA 2JETC 4AG2A 1C5WB 4KKDA 4OS5A 4ABEA 1GHXH 3SV2H 1HAGE 1WSSH 1PPZA 1ELFA 4X2XA 4DIIH 1O2PA 1IQNA 4Z0KA 1BTHH 2WV5A 2Z9GA 2J92A 2G81E 1ARCA 1ZPZA 3PTBA 4BOHA 3GY2A 1EP6A 4UFDH 1BITA 3A7VA 1N6YA 3L3TA 1ZTLA 3RXCA 4K8BA 1V2JT 1Y5UT 3HPTB 4BANB 3OU0A 4TPYA 1HYLA 3RC6A 1GJAB 2GVFA 1TQ7B 4I8KA 1P09A 3TU7H 1J15A 3SJKA 4JK5A 3RMNH 2ZDLA 3LGUA 2QN5T 2ZHDA 1E38B 1W10U 2NU1E 2ODYB 3A86A 5C1YA 3SJOA 2BDAA 1LHEH 2FDAA 4ISNA 1P57B 2W7SA 4DY7B 2FWWA 4OS2A 4MQAA 5JDUB 1TA6A 2F9PA 3TK5A 3LGTA 3DT0H 1B7XB 1A3BH 2ODPA 1LTOA 2BD9A 5DP6A 3ZZ9A 2OUAA 4YZUA 3ZZAA 4A6LA 3MWIU 1OPHB 4JZIA 4B75A 5LPRA 2QXJA 2HRVA 1CSOE 4GAWA 2PV9B 3GDUA 3V12A 1YBWA 1XUKA 1BMLA 1ESTA 1WU1A 2FPZA 1GBEA 1AU8A 1FNIA 2PGQB 4FUDA 1GI9B 1SGTA 2PUXB 3LOXA 1ETRH 3ZVFA 2LNCA 3Q77A 3CS7A 1E37B 2O8WA 4Y6DA 1W12U 4TY7A 1QA7A 3AVZA 5DK1A 1LVOA 4E06H 1K1LA 1O37A 1FY4A 3P17H 4X1SU 1AE8H 3UREA 1ZRKA 5BPEA 4MLFB 4O3UA 5LPEA 4QT8C 4X6NA 4AOQA 1ANEA 3SNCA 4E7NA 4FUFA 4ABFA 2WPIS 4ZKSU 2VH0A 1GJ9B 1BTUA 1MTUA 3KQBA 4CRGA 1WQSA 1QURH 4DGJA 4AFQA 2BHGA 1DY8A 2VIWA 2XXLA 3TGKE 4WMDA 1QL9A 4RKJB 4A1XA 3EA7A 4NWLA 1P2QA 1PYTC 1F0RA 3MNSA 3RMLH 2VIQA 4F4OC 1IOEA 1TNIA 4YESB 1HNEE 1BZXE 1O5EH 1IQIA 3ZZ3A 2NU4E 3A8CA 4KTUA 2BMGB 1VCWA 2VVVA 1SHHB 2FOAA 3UNRA 4BAHB 1MTVA 1NROH 2Z9IA 1AWFH 5DO4H 3VEQB 1S6HA 1MD8A 5DJ7A 1OXGA 3W95A 1UVSH 5EXLA 1VITF 4TYDA 4U32A 1AIXH 3V13A 1P9SA 1GI6A 1XKBC 3RM2H 2STBE 3SQEE 2FEQH 2VU8E 3RXKA 2FI3E 2FP7B 4Z6AH 3LC5A 3RC4A 1JMOH 4I8JA 4O9VA 1GJ5H 1O2NA 1BCUH 1UMAH 3UTUH 4WH6A 1Z6JH 4KGAA 2AGIX 1K1NA 1C4Y2 2WV4A 2BX4A 2GP9B 5HM2A 1G9IE 1HFDA 5EPYA 6ESTA 1NFYA 2ZFSA 1SGEE 4DW2U 1SOZA 4AB9A 1P9UA 5I25A 2HPQH 3GOVB 1UHBA 2A2QH 4IBLH 1MU6B 2Y5HA 4NFEA 1W14U 4YM9A 1RFNA 5L6NH 2BDCA 3PM3A 4H6TA 2C8XB 3F9GA 2Z6BD 3VB4A 3C27B 2GCHG 1GHZA 1MTNB 1FPCH 1A5HA 4OS1A 1FY3A 2ASUB 1TNGA 1O2RA 4Y8ZA 1GBMA 1P2KA 2B5TB 3FP6E 2CF8H 4X8TH 1A7SA 1AUJA 2Z9LA 3BEIB 3Q3XA 1ETTH 2WPHS 3KF2A 1O3OA 1DM4B 4ABDA 1DY9A 3VGCB 1EPTA 2QA9E 1RS0A 2V0BA 4NGAH 5DP3A 3UNQA 1NU9A 1NTPA 3SUFA 1MTNC 6GCHF 1JRTA 4NIXA 1WTHD 4UFFH 1FIWA 1SHYA 2H9EH 5C20A 1DWDH 2PKAA 3BTWE 1ELBA 2ULLA 1GDUA 1X7AC 1GJ8B 3RXLA 2V3OH 1QL8A 4TWYA 1UHBB 1BIOA 2I6SA 3S9AA 4K3JA 4X6OA 1P04A 1DWEH 3VGCC 5C1UA 1HAYB 3U69H 3F1SB 1KXEA 3ZZ7A 1O2WA 2CV3A 3WY8A 1KLIH 2BVXH 7ESTE 1L0ZA 1JIRA 3NPSA 1TALA 1SGNE 1XM1A 1GCDA 4FUGA 4AFZA 1V2OT 1N1LA 2GZ7A 2AH4X 1ZOMA 1BJVA 1UTMA 2JH0D 1FI8A 1CVWH 3E0PB 9ESTA 1C5PA 1KIGH 4FVBA 4B2BA 3G01A 1S82A 1SMFE 3VPKA 4RN6A 1G2MA 4ISHH 1A0HB 1O38A 3P8GA 3LJJA 5EXMA 1HJAB 1H9IE 5HYOA 3T27A 1YPHC 5ESTE 3O8RA 3SU6A 2ZU3A 1CE5A 3SU1A 4CRDA 1ANBA 2GCTB 4K1SA 4U01A 2ANYA 2FLBH 4LXBH 5GWZA 1DPOA 1EAWA 3LKWA 2BXTH 3RU4T 1CQQA 3QTOH 1CGJE 1MZAA 3GCTF 1EZXC 4OS7A 4WF8A 2C8YB 1YP9A 3SN8A 3RXIA 4LK4A 3RLYH 3SV7A 1C4V2 1HJAC 1EJNA 1MZDA 1GBIA 1O2JA 2ZFPH 4BXSA 1GJCB 3P8NA 1S85A 1V6DA 5FPSA 1G3EA 2NU3E 2CMYA 2GCTC 1C5ZB 1GHVH 2H9HA 2O8LA 4ZMAH 2VWLA 3EAJA 4MDSA 3GCOA 1ZSKA 5A8ZA 4OS6A 2Y5GA 2Z7FE 3OTJE 3S9BA 1TPOA 1C1RA 2D1JA 3AASA 4K69A 5GPIB 1TONA 3GYLB 2NU2E 2P59A 2ZU5A 2W7UA 2OP9A 1LVMA 2A4OA 3BEUA 2ILNA 2PLXA 3EYDA 3RLWH 4TWWA 1J17T 4CBNA 1Z8IB 3A7TA 3RUOA 1EJMA 3FANA 3M3SA 3ATWA 1P0SH 1AO5A 1AFQB 1BMNH 3T29A 5J4SA 4AN7A 2VIDA 3HKIB 2NU0E 1AGJA 1F2SE 1YPGH 3A87A 5BRRE 5AFYH 1G3DA 1H8IH 3A7XA 3MU8A 4GCHG 1HBTH 2K1QA 1OSSA 1ELVA 1ZR0A 2BX3A 1K1PA 2BQWB 1C5TA 3QN7A 3M37A 3IWMA 1NZQH 1GL1A 1UO6A 2OXSA 3M7TA 3RXDA 1AFQC 1C5YB 3RXUA 2CXVA 1BBRH 1GMHG 1NRPH 3MO6A 1GDQA 3HATH 4FU7A 1AZ8A 5EU8A 2TRMA 3OX7U 2J34A 1G37A 3PWCA 5L2ZH 2J38A 3NWUA 3TJOA 8GCHG 2BDGA 1TMBH 1C5MD 3URDA 4X1NU 2A4QA 1NT1A 3SGAE 4IS5A 1S0RA 5C1XA 1SLVB 3SUGA 1JRSA 1V2PT 4ZXXH 2GV7A 1D6WA 1O2IA 4XE4A 1IQMA 1HAZB 4F49A 1NESE 3U1JB 2B8OH 2ZFTA 1AVWA 1O3DA 4I8HA 3LGVA 3UUZA 4DIHH 1C5RA 3BTME 1ZMNA 1GI4A 3P95A 2XC5A 1O3GA 1V2WT 2RDLA 1O2UA 1DXWA 1UK4A 1MAYA 2JH6D 1C2LA 2QY0B 1HAVA 1O2TA 5DGJA 1O2MA 4XDEA 2O9QA 2HPPH 3NUMA 1LQEA 1IHSH 1W7GH 3M61U 3A85A 3MNCA 2R3YA 1L4DA 3CP7A 3EGKH 1VCPA 2PGBB 1W0YH 3SJ8A 3TVJB 3VB7A 7LPRA 2UWLA 1Z8JB 4A7IB 2BDBA 2A0QB 3KCGH 4INHA 3IITA 3M5LA 2ZPSA 3PWBA 1C2IA 4B2AA 5A8XA 1B5GH 1UCYK 1AVXA 2SNVA 3PMBB 4ABJA 3A88A 2OC0A 3Q76A 5A8YA 3ZVGA 3MOCA 2TGDA 1OWIA 2HVXA 1T8NA 2J94A 4Q2KA 2FTLE 1TBQH 1HAXB 2VWNA 2Y7ZA 3ZZCA 1O2XA 4K60A 5EQRA 1DSUA 4KP0A 2WINI 1A46H 3ZVDA 1PPEE 1O0DH 1J8AA 3QTVH 1T8MA 1Y8TA 1C2EA 4J2YB 2G5VA 1K1MA 5A0AE 3K6ZA 1O3NA 2BY8X 1A5GH 4YOJA 2FIRH 1A5IA 2AMPA 1H4WA 1C5QA 1T4UH 1DDJA 5FBIA 1HAVB 3TJUA 4D7FA 3A8BA 1O5FH 2BOHB 4Y10E 4YO9A 2D26C 2J4IA 2P3FH 1ZTKA 3BTHE 4ABBA 1LO6A 1CHOF 1EZUC 1HAIH 1QNJA 2TGPZ 3MU5A 1GHBG 3AW0A 1O39A 1GWAA 3GY7A 1AMHA 4O3TA 1XUFA 2GZ8A 2GCHF 3BSQA 4B2CA 1SL3A 2ZEBA 3SUEA 5AVDA 2B7DH 3QGNB 2XYAA 5B6OA 4ZROA 3GY3A 1K1IA 2OC8A 1RTLA 3M7UA 2IN2A 4X8SH 3V0XA 1J14A 1C1VH 4FUCA 1WUNH 1DVAH 1MTWA 4ASHA 2PTCE 1O3AA 1HCGA 1KY9A 4K8YA 4U2WA 3H7TA 3GISB 1FPHH 2OTVA 3NK8A 3U8OH 1OP8A 5AFZH 1EXFA 2SGPE 4Y7AA 2PSYA 3RXQA 2RA3A 3SJIA 3U8RH 1F7ZA 1V2LT 5EW1H 1AKSA 2ZECA 3JZ2B 4K1TA 2P3UB 4WMEA 2EC9H 1K21H 3UR9A 5C3NA 1C4U2 1YCPK 4J1YA 1TGNA 3E1XB 1PPGE 1Z1JA 3SV9A 4XOJA 5FCRA 1S81A 3A7ZA 1O36A 1IQHA 3RXJA 1TGCA 2HNTC 2ZU4A 1O3IA 1V2KT 2VH6A 2XWAA 1F5LA 1SB1H 1EASA 2PUQH 1QY6A 2ZHQH 1TRNA 1XMNB 4HFPB 1GJ4H 3DFLA 3LU9B 3UPEA 1QL7A 3HK6B 3SU4A 1HAPH 3B23B 3K65B 1SGCA 3ZZ5A 1ELDE 1DLKB 3SU2A 1ESAA 4MPVA 3UOPA 2CHAB 2W5EA 4AFSA 1H1BA 2FLRH 3STIA 1ANCA 2RG3A 1C2FA 1TQ0B 3P6ZB 2F9BH 2R9PA 3BTKE 3FZZA 1GJDB 1P2JA 3GICB 3FP8E 1AKSB 1OWDA 3RXTA 3C1KA 2Z3DA 1LPGB 1O3HA 1Y3UA 5DPAA 2ZP0H 1C1WH 3SV8A 4UDWH 4UD9H 3RU4D 1QBNA 5CE1A 2OQUA 2D2DA 3D23A 1AWHB 2BDYA 3Q00A 1HXEH 5E8EH 3VXEH 1C2JA 4ZKNU 2CHAC 1ABIH 1GI1A 1E36B 2OINA 1C2DA 1ZGVA 4OGXA 3ZVBA 4MG3A 2NWNA 4D76A 1MKXK 1MCTA 4CR5A 3KGPA 5EOKA 1W7XH 1EZQA 2ZPRA 3TJNA 5AF9H 3E3TA 2ANKH 4NIYA 1ID5H 4YLUA 3EA9A 4NIVA 1WTGH 4I8LA 1QB1A 2FI4E 1RD3B 1GJ6A 4AX9H 1HIAB 8LPRA 1TWXB 3BTQE 2A1DB 4JCNA 2HLCA 1GI0A 3F6UH 3VFEA 1P05A 4FUIA 1UK3A 4GCHF 2AERH 1ACBE 1EJAA 1TPSA 1NRNH 4Y11E 1TGBA 3SGQE 3ELAH 2Y81A 1GHAG 1GVZA 1GMCG 1C5SA 1MUEB 5F6MA 3ENSB 1ZPBA 1ELAA 1UTPA 1Y5AT 2TPIZ 2Z9JA 3OY6U 2FO9A 3HKJB 1F5RA 1NU7B 1EQ9A 1O2VA 2UWPA 1YCPM 1MCVA 4UFEH 2BZAA 3BEFB 4ISOA 1LPZB 2W26A 4X1PU 1SR5C 5E0JA 1BHXB 2BY6X 1FY8E 1ZHPA 4X2YA 2XCFA 3MH7A 2XRCA 8GCHF 2ZC9H 3BF6H 1AY6H 1V2ST 2QF3A 4INLA 1RXPA 1FV9A 3QX5H 1PFXC 5HGGA 4ZHMU 1BT7A 4B76A 1G2LA 3TH3H 3ZZ4A 6CHAB 2VNTA 1C5VA 3K6YA 1ZZZA 4NIWA 2IJOB 1UVUH 2XBVA 1Z1IA 3SUDA 5FPTA 1P2OA 2ZCKP 4CRBA 2G52A 2GKVE 3UWIA 3LJOA 4UONA 2A5AA 1TPPA 1TX6A 5EXNA 2AGEX 1UVPA 1SPJA 3M5NA 3OY5U 1E35B 1BTPA 1T7CA 4MNYA 4CH2B 6CHAC 4Q80A 1V2TT 3MI4A 2XBWA 1XUGA 1FAXA 5F8ZA 2ZDNA 3BTDE 1FIZA 5FPYA 4R0IA 3TK9A 1T8OA 4AYYB 4JZ1A 4ZHAA 3KQEA 4RKOB 1W11U 2H6MA 2BLWA 2F91A 1QRXA 1UTLM 5JB8S 2VWOA 4X8VH 5IDKA 2O8MA 2FYQA 2BLQA 3T5FH 4DCDA 4ABHA 1GBTA 2WPJS 4D7GA 1CA0B 2J9NA 1Z71A 1EOLA 2C4FH 4A1TA 1P3EA 4E7RG 3LDXH 5FX6A 2A4GA 3ZV8A 3O8CA 1L1JA 1MKWK 1O3MA 4BAKB 1EKBB 7GCHG 1GGDB 3RXGA 1OKXA 1GJBB 2I6QA 1CA0C 3DFJA 1PQAA 4JYVH 1EX3A 5T6FA 1UK2A 1BUIA 4HTCH 2QIQA 1IQJA 2ALVA 4GHTA 3UOUA 3GDSA 1C2GA 3LGYA 1PQ5A 1DOJA 3MH6A 3O8BA 2SGEE 1YPKH 3GYMA 1MMJN 5JBBS 3SZNA 2G5NA 1HGTH 3RXVA 4Y0YE 1GGDC 5LH8A 3KEEA 2GT7A 2ZQ2A 1DLEA 1GHBF 1D3QB 1INCA 2D8WA 1QRZA 1QCPA 4FXGH 1O2ZA 3P70B 1KYNA 2FXRA 1M9UA 1SBWA 1C1TA 3CS0A 1TFXA 1ZTJA 5SGAE 1FONA 4JYTA 1JOUB 5LGOA 3U98H 2ZPQA 4YOIA 2FOEA 3DD2H 3SNAA 4CHAB 1ELEE 3E0NB 1WBGB 1VGCB 1OX1A 2FMJA 1ZMLA 2AGGX 2GX4A 3EA8A 1PQ8A 1LCYA 2HGTH 3BTFE 1HJ8A 3GCHB 3TPIZ 1O3EA 5HM9A 9LPRA 1Q2WA 1QQUA 3B8JA 4WMFA 3MU4A 1EOJA 3A80A 2PWXA 1UCYE 2AIPA 1S5SA 3UQVA 1CGHA 4AG1A 4JZFH 1O5GH 3RP2A 4E05H 4CHAC 5JPMH 2C8ZB 2ZHEH 1VGCC 1HPGA 2PKSB 2YOLA 2H2ZA 4ZHLU 1UTQA 1LVBA 1O5AB 2BM2A 4ISLA 3UIRA 3GCHC 4GUXA 1NFWA 1GHWH 2SGAA 1NO9H 2BD2A 2GT8A 2XNIA 3S9CA 2UUYA 1PQ7A 2PR3A 3SU0A 1BRUP 2ZDMA 1SFQB 1TABE 1DS2E 3RXHA 8ESTE 1MD7A 1UTNA 3E90B 2HWLB 3NKKA 3A89A 4MTBA 2PKSC 1GI7B 1BJUA 4I32A 2BDHA 2OCVB 4Y79A 1IQKA 2BOKA 2FOMB 2DE9A 1P06A 1QGFA 1OWKA 2Z94A 1OOKB 3E16B 5A09A 4ZKRU 5GCHG 2H1UA 1DXPA 1O2QA 4ABGA 2Y7XA 1HV7A 1KSNA 1TIOA 1WAYB 2ZGXH 1SQTA 2FOCA 1KDQA 2VIPA 3SU3A 4AGJA 3GY8A 2YNAA 1HLTH 1KXCA 3QZRA 3VB6A 1A0LA 1DX5M 2V3HH 1UCYH 4LOYH 2ZG0H 2ZU2A 1RIWB 4FUJA 5PTPA 3SU5A 4GSOA 2F9UA 3EE0B 3K9XB 2F9OA 4NA8A 3RMOH 1D4PB 2G00A 1KTTB 3BTTE 1SLWB 2PW8H 4IW4E 3A82A 2LPRA 4MNVA 2ZGCA 4AORA 1O3FA 2HNTF 1LMWB 1F0SA 1Q31A 1GVKB 1C5LH 1KXFA 2CF9H 4IGDA 1BOQA 4AZ2B 4WJG2 1C9TA 1RIWC 2FESH 4XBDA 1O32A 3CENA 1KXBA 3UFAA 4NZQA 1AN1E 1DICA 1G3CA 1TOCB 3PO1B 4CR9A 2FS8A 1QB6A 2AFQB 3MH4A 5C2ZA 4HZHA 4BTUB 2Y5FA 1LKAA 1AI8H 3UQOA 4DURA 1Z6EA 1Y3XA 2QAAA 3BN9A 1F92A 4RSPA 3F9HA 3SNBA 1B0EA 2C8WB 4B73A 1SGQE 1OP0A 1KDQB 3W94A 1HRTH 1GMDG 1G3BA 4WVPE 4BAQB 1NS3A 4K2YA 4INKA 1IQFA 4Y8YA 1Q3XA 1HXFH 1ZHRA 2AIQA 3PO1C 3D65E 3PMHB 1GMCF 2HALA 1GHYH 1P03A 5EQSA 2BD3A 1EAXA 1TMTH 4Q7ZA 3TITA 1SGFA 3E6PH 3R0FA 2ZCLP 4BAOB 3RXOA 2ZFFH 3ZVEA 3FZDA 1NRRH 1P02A 1O2SA 4NSYA 1AVGH 1LHDH 2ANWA 1JWTA 2XC4A 4I7YH 4GLYA 1BTXA 4MNWA 1K1JA 3UNSA 3SO3A 2OQ5A 2V35A 1VR1H 3U8TH 1S84A 2WUCA 1GPZA 1W8BH 2A32A 5GXPA 1A3EH 1TX7A 1O3BA 2AYWA 4HGCA 4WH8A 4DG4A 2Z3CA 4H4FA 1YCPH 4IN2A 1ETSH 1TB6H 3DA9B 5F03A 3MH5A 1FUJA 1AFEH 1FAKH 4UEHH 1RRKA 1O30A 4IMZA 2ZU1A 5EODA 2F3CE 2QF0A 1L1NA 3KL6A 3GY4A 1KXAA 1UTOA 2QC2A 3PLBA 3T28A 1OWJA 5GDSH 3A84A 3U9AH 1L2EA 3QWCH 1SC8U 1UVOA 2AMQA 2FS9A 4TPIZ 4A92A 1O3JA 5FXLA 3ZVAA 1GVLA 3ATLA 1PPFE 1BBRK 1BTYA 3PYHA 3HGPA 2BTCE 5FAHA 1A0JA 2SGDE 3H7OA 2A31A 2Y82A 6GCHG 1SQOA 1SGYE 5DP7A 1K2I1 5JB9S 4LZ1H 2Y80A 1V2UT 3RXRA 1HAOH 4ABIA 2ZO3H 3AW1A 1C1UH 2GMTB 5DP9A 4ZH8A 3SNEA 1GDNA 2FX4A 2UWOA 4I8GA 3UR6A 1YLDA 2BXUH 1O2GH 2SFAA 3MU1A 2PTNA 1P11E 1P8VC 2ZI2H 5I46H 1UTKA 2Q1JA 2F9NA 2R3UA 2CN0H 5A0BA 5JBTA 1H8DH 1QBVH 1ZPCA 2CGAA 3P92A 1EP5A 4WXVA 1KLTA 3HK3B 1CO7E 4MPXA 4GVUA 4NFFA 1SSXA 2GMTC 2BB4A 4B71A 1TE0A 4X0WU 1SG8B 1O34A 1BHXF 2BD5A 5E0GA 1FJSA 3MMGA 1ZMJA 1MBQA 3I77A 1EB1H 4IC6A 4WXIA 1GBKA 5LPFA 3KQDA 3RXAA 3TGIE 3KHVA 3P8FA 1TX8A 3F9FA 1Y3VA 1CBWB 2QXIA 2VWMA 2XWBI 3N7OA 4H6SB 2UUFB 2XCNA 1LHGH 5E2PA 3M36A 1DUEA 3STJA 3SQHE 1DWBH 3ZYDA 1THSH 4FUBA 4YLQH 4GHQA 3LC3A 1SGIB 2GDEH 5T6GA 2WPKS 3GCTG 2ZDAH 4ISIH 4CRAA 1O31A 1Z8GA 5EPNA 1BTZA 1C1PA 1F0TA 1K22H 3I29A 5C5NA 3L6PA 2VVCA 4X6PA 1CBWC 1UVTH 1ZLRA 1BQYA 3ATMA 1IQEA 4X8UH 4A5TS 1P10A 1ZGIA 2AS9A 3S7KB 2ESTE 3KNXA 1PPHE 2A7CA 2JKHA 1EZSC 3M3TA 1A4WH 1A61H 1TRYA 1SGFG 2ZIQH 1OP2A 1HIAA 4X2WA 5F8TA 4H42U 4JYUH 1T31A 1T4VH 3EQ0H 5GIBA 5K7RA 1TNHA 2BVSH 1FN8A 3MYWA 1XUJA 2FOBA 1LHFH 1NY22 1AD8H 2IPHA 1LQDB 2BY7X 3LPRA 1TLDA 1CHGA 1DFPA 5T6DA 4MVNA 2DE8A 2CJIA 4ZKOU 4DT7B 2W3KA 5JBCS 3LGWA 3T26A 2A7JA 3SI4H 1GG6B 3PLKA 3KIDU 1AE5A 1YPMH 1GBFA 4DOQA 3RXBA 3QUMP 5K0HA 2BDIA 4K5ZA 2OBQA 4KELA 1YPHE 8KME2 1C1MA 2O8TA 4JZEH 3QZQA 3LGIA 4UFGH 2ANMH 2BQ7B 1ZJKA 4FU8A 1BB0B 1N6XA 1PJPA 4NWKA 3NXPA 3UWJH 1E0FD 1S83A 1TYNA 2ZKSA 1QJ1B 1JBUH 1GI2A 5FX5A 3ZYEA 1BRCE 1G36A 4B74A 1GG6C 5E2OA 1GBDA 1QA0A 3GDVA 1C1NA 5L2YH 1OS8A 1HUTH 4LZ4B 3M5OA 1Z7KA 2OLGA 4YT7H 1NFUA 1EAUA 3BG8A 1SGPE 4YT6H 1AUTC 3OYPA 1V3XA 1CU1A 3A81A 5GCHF 6LPRA 1WQVH 4X1QU 1AHTH 3SI3H 1XX9A 2P95A 2SGQE 1GI3A 2C90B 5CHAB 1C1SA 3ODDA 2UUKB 1P2IA 4VGCB 4KTSA 5DKMA 2THFB 3PTNA 1KLJH 2WUBA 2BVRH 4XFQA 4IN1A 3RXSA 1SGDE 1F5KU 1BRBE 1BTWA 1YLCA 1P12E 2EI7A 2ZHWH 1BMMH 1V2VT 1V2QT 2BD8A 2EI8A 4Q7YA 1V2NT 1AZZA 1G30B 5FBEA 1EB2A 5EG4A 3A8AA 1ZHMA 1MTSA 4XBBA 5DP8A 1GBHA 5FCKA 1THPB 4MPUA 3AAUA 1MKWH 1GMHF 5CHAC 1BDAA 1LHCH 1SLUB 4ZAEA 1YGCH 1ORFA 1V2RT 1AQ7A 4VGCC 1RTKA 1ZJDA 1NC6A 4SGBE 1TPAE 1D9IA 2DUCA 5AHGH 4NG9H 3A7WA 2ZQ1A 2BD7A 1ANDA 1LKBA 1KTSB 2ZWLH 2EA3A 4NCYA 2B0FA 1CT4E 1IAUA 3GY5A 3F9EA 1YPJH 1WCZA 3SBKA 3O8DA 3A7YA 2IOTA 4JK6A 1C2KA 5JBAS 1YC0A 2AMDA 1FY1A 2PSXA 2F83A 3QLPH 2FX6A 2XTTB 3QDZB 1GBJA 3ODFA 1GMDF 1T8LA 2UUJB 1O3KA 3FP7E 3ATKA 1O2HA 1Z8RA 1C5XB 1UTJA 1CA8B 1WYKA 4B1TA 3Q3KA 1GI5A 1VITH 3BIVH 4FUHA 3ZV9A 1D3PB 3LONA 1SQAA 3LH1A 1DANH 3DUXH 4NA7A 1QJ7B 2WPMS 1C2MA 1MBMA 5L30H 1GBLA 2VJ1A 1TRMA 1MU8B 1W13U 2G4TA 2SGFE 3T2NA 1HAHH 2FYRA 2GZ9A 4MPWA 5GJ4B 3RDZA 5TJXA 3S0NA 4HI3A 1L4ZA 3SV6A 3MO3A 2VINA 5ABWA 5FHTA 1NFXA 5EGMA 1QB9A 3MNXA 3PMJA 1GBAA 1GCTB 1THRH 1W0ZU 1ZYOA 3D49H 1EAIA 1JXPA 1CHOG 1QRWA 5A0CA 2FTMA 1DWCH 4SGAE 1SI5H 1C9PA 2Y6TA
chains in the Genus database with same CATH superfamily
3V3MA 2BD4A 3QO6A 2C93B 1T32A 1QFKH 2P8OB 3MTYA 4FVDA 1YM0A 1Y59T 2ZDVH 3GY6A 1A2CH 2A2XH 3W1EA 1DSTA 2M5TA 2G8TA 4X2VA 2H5DA 1N8OB 3SHAH 1GCTC 3RC5A 1TNLA 1BRAA 4MNXA 3TIUA 1O5CB 4FUEA 1P2MA 2JH5D 3FOAA 1XXDA 1FLEE 2J95A 3ZZDA 2OC1A 4CRCA 2TIOA 2ZF0H 1NM6A 1GBCA 1XUHA 2KM0A 1SVPA 2A45B 4Q63A 2P8OC 1E1RD 2VB0A 1FDPA 1AB9B 1OWHA 2F9VA 2ZGJA 4I33A 1N8OC 1VJ9U 3KN2A 5EW2H 2J5UA 3BTEE 2KAIA 2L6OA 3DHKH 1MQ6A 1P2NA 4X1RU 2FOFA 2A5KA 3CNRA 4JMYA 4IC5A 5J4QA 3OEHD 1HB0B 1QIXB 4D9QA 1K28D 3BIUH 3A8DA 2QXGA 3ZVCA 1O5DH 4GPGA 4ZUHA 3SORA 2YNBA 1AB9C 3NRLA 5EJLA 2J2UA 2OBOA 1O5BB 3PB1E 1CGIE 4AB8A 1D3TB 1YF4A 5ETXA 1EUFA 4WWYA 2G4UA 1BMAA 2STAE 2WHXA 2ZFQH 5T3HA 1XVOA 2OD3B 4Y71A 3S69A 2A4RA 2ZZUH 5IYTA 1Y5BT 3RXFA 4BTTB 1QBOA 2ZHFH 1ZRBA 1S0QA 4XBCA 3ATIA 3L33A 3RXPA 1A1RA 3U1IB 3T62A 5C5OA 2BLVA 2VBCA 3GCNA 3NZIA 4O03A 5E0HA 2ALPA 1OYTH 1EPTB 1H9LB 3DSGA 4OS4A 5HXFA 2FOGA 3A83A 7KMEH 5H4IB 4O97A 4AYVB 3TGJE 1XVMA 4X6MA 2XW9A 2XBYA 2OC7A 2PKAB 2P16A 5ESBA 1BA8B 3RXEA 2Q6GA 4NA9H 3URCA 1TNJA 2J97A 5TCCA 4DVAU 3MFJA 1O3LA 2KAIB 3EDXB 1O33A 4ESTE 1HDTH 3ZZ8A 1BBRE 3FAOA 3I78A 1QQ4A 1QZ8A 3SHCH 2ZTYA 2QXHA 1EPTC 3QGJA 3ZZBA 1DITH 3AAVA 1ARBA 1RTFB 3RM0H 5EQQA 3RMMH 1O2LA 3MHWU 2RCEA 1TMUH 2KX4A 2ZGHA 2ZA5A 3EE7A 3M35A 2GDDA 1FY5A 4AGKA 1CT0E 1NRQH 2HNTE 1ESBA 5A2MH 1UJ1A 1Y3YA 3PRBA 2TGTA 2Z9KA 2ZFRH 4OGYA 1MABB 1VJAU 4K1EA 1OYQA 4THNH 5HMAA 3D62A 4CBOA 1IHTH 1V2MT 1CT2E 3HGNA 2JJ1D 5F8XA 1O35A 1XKAC 1S6FA 1FQ3A 1G32B 2FI5E 2R2MB 3PV4A 1C1QA 4NSVA 4UE7H 3B9FH 4BTIB 4Q7XA 1ABJH 1C5OH 3F2HA 3VB5A 2H5CA 3PLPA 4PROA 4FU9A 2FM2A 2P93A 1YPEH 4ABAA 2VGCB 3JZ1B 2GD4B 1OWEA 4R8TB 1TBZH 2JIZD 2P94A 3M5MA 2RA0A 4ACAA 1K9OE 1YYY1 3P8OA 3SW2B 4CH8B 2P3TB 1GJ7B 2EEKA 5HKKD 1FZZA 2Q6DA 4BXWA 1FMGA 3FVFB 3BG4B 1SLXB 2WPLS 1PPCE 2ODQA 1TNKA 2W3IA 3K2UA 4CREA 4A1VA 5C67A 2EI6A 5B6LA 3FFGA 3VXFH 1TOMH 2FZZA 5DG6A 3TNSA 1VITG 1W3CA 1F0UA 2VGCC 2RFKC 3M7QA 1QTFA 5JYIA 2AEIH 4BNRA 3VB3A 1VCQA 1QHRB 2A5IA 1K0HA 3TLOA 2BY5X 3SNDA 4D8NA 2ZDKA 1J9CH 1J16A 3KQCA 1ELCA 3BG4C 1GHAF 4D9RA 2H9TH 1NN6A 3UY9A 3S7HB 1MAXA 2BZ6H 4BAMB 3PROA 2R2WU 4ZXYH 1TGTA 1C1OA 1FN6A 1O3CA 2BQ6B 2Q6FA 2PFEA 1B0FA 4KTCA 5TCAA 3FO8D 1GBBA 2EQNA 5G4BA 4CRFA 3RXMA 2TGAA 2XC0A 2VIVA 4IMQA 3TK6A 3MU0A 2BLOA 4U30A 2VVUA 3R3GB 1L1GA 2FOHA 4TY6A 3M3VA 1XUIA 2ZCHP 1JIMA 1H9HE 3T25A 1O2YA 5DP5A 2PHBA 3F68H 2V6NA 3LH3A 1GL0E 1YPLH 1U6QA 1E34B 1SFIA 1MH0A 3WW7A 5DSFA 1VZQH 3MO9A 1C2HA 2BYAX 2ZGBH 2GV6A 1IQLA 1KXDA 5IK2D 1LPKB 3PMAB 4Y7BA 5C17A 2QYIA 5GNDA 3TNTA 2R0KA 2SNWA 3OSYA 1DUAA 1DE7H 1DT2A 1SOTA 1Y3WA 2Z3EA 3SOSA 2WYJA 3QK1A 1P01A 1FXYA 3SGBE 3H5CB 3E91A 2YMSD 1LDTT 1O3PB 1TBRH 2FODA 2ZNKH 2RDEA 1ZSJA 5T1VA 2GTBA 4JZDH 2A7HA 4M7GA 1S6LA 2TBSA 2G55A 2XBXA 2QGRA 1O2KA 3DCLA 1MQ5A 4YOGA 1SGRE 1GI8B 1PPBH 1LVYA 4XSKU 1WOFA 1HJ9A 1QR3E 1IQGA 3LT3A 3OEED 2ZTXA 3TH2H 2VIOA 3OTPA 1K1OA 1XXFA 1TGSZ 2QV1A 1W2KH 1PYTD 7GCHF 3MQKC 3NCLA 1ELGA 4DJZB 1MKXH 5DP4A 3SJ9A 1ELTA 1ZSLA 1C5NH 2R0LA 2ZTZA 1EATA 3TH4H 1D6RA 2HOBA 3Q3YA 3LIWA 4YTAA 1D3DB 1TAWA 2JETB 1WV7H 2C3SA 2GGVB 3E8LA 1RGQA 4NZLA 3IG6B 5CMXH 4WY3A 2O8UA 4I31A 2BY9X 4Y0ZE 2G51A 1QJ6B 4ZCNA 1NPMA 3TJVA 3AK5A 3ITIA 1TA2A 2WYGA 1YKTA 4Y76A 1C5UA 3BV9B 3ESTA 2QCYA 3RU4E 4AFUA 3ZZ6A 4Y8XA 4TT3D 1O2OA 1NRSH 3PV5A 3MNBA 3V7TA 3BTGE 1P3CA 1RJXB 2B9LA 2JETC 4AG2A 1C5WB 4KKDA 4OS5A 4ABEA 1GHXH 3SV2H 1HAGE 1WSSH 1PPZA 1ELFA 4X2XA 4DIIH 1O2PA 1IQNA 4Z0KA 1BTHH 2WV5A 2Z9GA 2J92A 2G81E 1ARCA 1ZPZA 3PTBA 4BOHA 3GY2A 1EP6A 4UFDH 1BITA 3A7VA 1N6YA 3L3TA 1ZTLA 3RXCA 2KCAA 4K8BA 1V2JT 1Y5UT 3HPTB 4BANB 3OU0A 4TPYA 1HYLA 3RC6A 1GJAB 2GVFA 1TQ7B 4I8KA 1P09A 3TU7H 1J15A 3SJKA 4JK5A 3RMNH 2ZDLA 3LGUA 2M2AA 2QN5T 2ZHDA 1E38B 1W10U 2NU1E 2ODYB 3A86A 5C1YA 3SJOA 2BDAA 1LHEH 2FDAA 2LP6A 2V3MA 4ISNA 1P57B 4P00A 1SQRA 2W7SA 4DY7B 2FWWA 4OS2A 4MQAA 5JDUB 1E79D 1TA6A 2F9PA 3TK5A 3LGTA 4RT1A 2WZQA 1B7XB 3DT0H 1A3BH 2ODPA 1LTOA 2BD9A 5DP6A 3ZZ9A 2OUAA 4YZUA 3ZZAA 4A6LA 2YMSB 3MWIU 1OPHB 4JZIA 4B75A 5LPRA 3WWFA 2QXJA 2HRVA 1CSOE 4GAWA 2PV9B 3GDUA 3V12A 1YBWA 1XUKA 1BMLA 1ESTA 1WU1A 2FPZA 1GBEA 1AU8A 3OE7D 1FNIA 2PGQB 4FUDA 1GI9B 1SGTA 2PUXB 3LOXA 1ETRH 3ZVFA 2LNCA 3Q77A 3CS7A 1E37B 2YMSC 5C94A 2O8WA 4Y6DA 1W12U 4TY7A 1QA7A 3AVZA 5DK1A 1LVOA 4E06H 1K1LA 1O37A 1FY4A 3P17H 4X1SU 3F0OA 1AE8H 3UREA 1ZRKA 2WPDD 5BPEA 4MLFB 4O3UA 5LPEA 4QT8C 4X6NA 4AOQA 1ANEA 3SNCA 4E7NA 4FUFA 4ABFA 2WPIS 4ZKSU 2VH0A 1GJ9B 1BTUA 1MTUA 3KQBA 4CRGA 1WQSA 1QURH 4DGJA 4AFQA 2BHGA 1DY8A 2VIWA 2XXLA 3TGKE 4WMDA 1QL9A 4RKJB 4A1XA 3EA7A 4NWLA 1P2QA 1PYTC 1F0RA 3MNSA 2LELA 3RMLH 2VIQA 2J98A 4F4OC 1IOEA 1TNIA 4YESB 1HNEE 1BZXE 1O5EH 1IQIA 3ZZ3A 2NU4E 3A8CA 4KTUA 2BMGB 1VCWA 2VVVA 1SHHB 2FOAA 3UNRA 4BAHB 1MTVA 1NROH 2Z9IA 1AWFH 5DO4H 3VEQB 1S6HA 1MD8A 5DJ7A 1OXGA 3W95A 1UVSH 5EXLA 1VITF 4TYDA 4U32A 1AIXH 3V13A 1P9SA 1GI6A 1XKBC 3RM2H 2STBE 3SQEE 2FEQH 2VU8E 3RXKA 2FI3E 2FP7B 4Z6AH 3LC5A 3RC4A 1JMOH 1NBME 4I8JA 4O9VA 1GJ5H 1O2NA 1BCUH 1UMAH 3UTUH 4WH6A 1Z6JH 4KGAA 2AGIX 2KFWA 1K1NA 1C4Y2 2KCPA 2WV4A 2BX4A 2GP9B 5HM2A 1G9IE 1HFDA 5EPYA 6ESTA 1NFYA 2ZFSA 1SGEE 4DW2U 1SOZA 4AB9A 1H8HD 1P9UA 5I25A 2HPQH 3GOVB 1UHBA 2A2QH 4IBLH 1MU6B 2Y5HA 4NFEA 1W14U 4YM9A 1RFNA 2J98B 5L6NH 2BDCA 3PM3A 4H6TA 2C8XB 2W6JD 3F9GA 2Z6BD 3VB4A 4RT0A 3C27B 2GCHG 1GHZA 1MTNB 1FPCH 1A5HA 4OS1A 1FY3A 2ASUB 1TNGA 1O2RA 4Y8ZA 1GBMA 2HVYB 1P2KA 1WXRA 2B5TB 3FP6E 2CF8H 4X8TH 1A7SA 1AUJA 2Z9LA 3BEIB 3Q3XA 1ETTH 2WPHS 4TSFD 3KF2A 1O3OA 1DM4B 4ABDA 1DY9A 3VGCB 1EPTA 2QA9E 1RS0A 2V0BA 4NGAH 5DP3A 3UNQA 1NU9A 1NTPA 3SUFA 1MTNC 6GCHF 1JRTA 1NBMD 4NIXA 1WTHD 4UFFH 1FIWA 1SHYA 2H9EH 4XRNA 5C20A 1DWDH 2PKAA 3BTWE 1ELBA 2ULLA 1GDUA 1X7AC 1GJ8B 3RXLA 2V3OH 1QL8A 4TWYA 1UHBB 4AC9A 1BIOA 2I6SA 3PV2A 3S9AA 4K3JA 4X6OA 1P04A 1DWEH 3VGCC 5C1UA 1HAYB 3U69H 3F1SB 1KXEA 3ZZ7A 1O2WA 2CV3A 3WY8A 1KLIH 2BVXH 7ESTE 1L0ZA 1JIRA 3NPSA 1TALA 1SGNE 1XM1A 1GCDA 4FUGA 3WWBA 1V2OT 4AFZA 1N1LA 2GZ7A 2AH4X 1ZOMA 1BJVA 1UTMA 2JH0D 1FI8A 1CVWH 3E0PB 9ESTA 1C5PA 1KIGH 4FVBA 4B2BA 3G01A 1S82A 1SMFE 3VPKA 4RN6A 1G2MA 4ISHH 1A0HB 1O38A 3P8GA 3LJJA 5EXMA 1HJAB 1H9IE 5HYOA 3T27A 1YPHC 5ESTE 3O8RA 3SU6A 2ZU3A 1CE5A 3SU1A 4CRDA 1ANBA 2GCTB 4K1SA 4U01A 2ANYA 2FLBH 4LXBH 5GWZA 1DPOA 1EAWA 3LKWA 2BXTH 3RU4T 1CQQA 3QTOH 1CGJE 1MZAA 3GCTF 1EZXC 4OS7A 4WF8A 2C8YB 1YP9A 3SN8A 3N7DA 3RXIA 4LK4A 3RLYH 3SV7A 1C4V2 1HJAC 1EJNA 1MZDA 1GBIA 1O2JA 2ZFPH 5F53A 4BXSA 1GJCB 3P8NA 1S85A 1V6DA 5FPSA 1G3EA 2NU3E 2CMYA 2GCTC 1C5ZB 1GHVH 2H9HA 2O8LA 4ZMAH 2VWLA 3EAJA 4MDSA 3GCOA 1ZSKA 5A8ZA 4OS6A 2Y5GA 2Z7FE 3OTJE 4F48B 1TPOA 3S9BA 1C1RA 2D1JA 3AASA 4K69A 5GPIB 1TONA 3GYLB 2NU2E 2P59A 2ZU5A 2W7UA 2OP9A 1LVMA 2A4OA 1YY3A 2EY4C 1SKYE 3BEUA 2ILNA 2PLXA 3EYDA 3RLWH 4TWWA 1J17T 4CBNA 1Z8IB 3A7TA 3RUOA 1EJMA 3FANA 3M3SA 3ATWA 1P0SH 1AO5A 1AFQB 1BMNH 3T29A 5J4SA 4AN7A 2VIDA 3HKIB 2NU0E 1AGJA 1F2SE 1YPGH 3A87A 5BRRE 5AFYH 1G3DA 1H8IH 3A7XA 3MU8A 4GCHG 1HBTH 2K1QA 1OSSA 1ELVA 1ZR0A 2BX3A 1K1PA 2BQWB 1C5TA 3QN7A 3M37A 2AHME 3IWMA 1NZQH 1GL1A 1UO6A 2OXSA 3M7TA 3RXDA 1AFQC 1C5YB 3RXUA 2CXVA 1BBRH 1GMHG 1NRPH 3MO6A 1GDQA 3HATH 4FU7A 1AZ8A 5EU8A 2TRMA 3OX7U 2J34A 1G37A 3PWCA 5L2ZH 2J38A 3NWUA 3TJOA 8GCHG 2BDGA 1TMBH 1C5MD 3URDA 4X1NU 2A4QA 1NT1A 3SGAE 4IS5A 1S0RA 5C1XA 1SLVB 3SUGA 1JRSA 1V2PT 4ZXXH 3OAAD 2GV7A 1D6WA 1O2IA 1YWUA 3DSPA 1IQMA 1HAZB 4XE4A 4F49A 4Q4LA 1NESE 3U1JB 2CK3D 2B8OH 2ZFTA 1AVWA 1O3DA 4I8HA 3LGVA 3UUZA 4DIHH 1C5RA 3BTME 1ZMNA 1GI4A 3P95A 2XC5A 1O3GA 1V2WT 4OM9A 2RDLA 1O2UA 1DXWA 1UK4A 1MAYA 2JH6D 1C2LA 2QY0B 1HAVA 1O2TA 5DGJA 1O2MA 4XDEA 2O9QA 2HPPH 3NUMA 1LQEA 1IHSH 1W7GH 3M61U 3A85A 3MNCA 2R3YA 1L4DA 3CP7A 3EGKH 1VCPA 2PGBB 1W0YH 3SJ8A 3TVJB 3VB7A 7LPRA 2UWLA 1Z8JB 4A7IB 2BDBA 2A0QB 3KCGH 4INHA 3IITA 3M5LA 4FETA 2ZPSA 3PWBA 1C2IA 4B2AA 5A8XA 1B5GH 1UCYK 2W6ID 1AVXA 2SNVA 3PMBB 4ABJA 3A88A 2OC0A 3Q76A 5A8YA 3ZVGA 3MOCA 2TGDA 1OWIA 2HVXA 1T8NA 2J94A 4Q2KA 2FTLE 1TBQH 1HAXB 2VWNA 2Y7ZA 3ZZCA 1O2XA 4K60A 5EQRA 1DSUA 5DN6D 4KP0A 2WINI 1A46H 3ZVDA 1PPEE 1O0DH 1J8AA 3QTVH 1T8MA 1Y8TA 1C2EA 4J2YB 2G5VA 1K1MA 4RI0A 5A0AE 3K6ZA 1O3NA 2BY8X 1A5GH 4YOJA 2FIRH 1A5IA 2AMPA 1H4WA 1C5QA 1T4UH 1DDJA 5FBIA 1HAVB 3TJUA 4D7FA 3A8BA 1O5FH 2BOHB 4Y10E 4YO9A 2D26C 2J4IA 2P3FH 1ZTKA 3BTHE 4ABBA 1LO6A 1CHOF 1EZUC 1HAIH 1QNJA 2TGPZ 3MU5A 1GHBG 3AW0A 1O39A 1GWAA 3GY7A 1AMHA 4O3TA 1XUFA 2K8IA 2GZ8A 2GCHF 3BSQA 4B2CA 1SL3A 2ZEBA 3SUEA 5AVDA 2B7DH 3QGNB 2XYAA 5B6OA 2QF4A 4ZROA 3GY3A 1K1IA 2OC8A 1RTLA 3M7UA 2IN2A 4X8SH 3V0XA 1J14A 5EJ1A 1C1VH 4FUCA 1WUNH 1DVAH 1MTWA 4ASHA 2PTCE 1O3AA 1HCGA 1KY9A 2IJD1 4HG6A 3F3BA 4K8YA 4U2WA 1W0KD 3H7TA 3GISB 1FPHH 2OTVA 3NK8A 3U8OH 1OP8A 5AFZH 1EXFA 2SGPE 4Y7AA 2PSYA 3RXQA 2RA3A 3SJIA 3U8RH 1F7ZA 1V2LT 5EW1H 1AKSA 1WDIA 2ZECA 3JZ2B 4I86A 4K1TA 2IPQX 2P3UB 4WMEA 2EC9H 1K21H 3UR9A 5C3NA 1C4U2 1YCPK 4J1YA 3FN8A 1TGNA 2KR7A 1PPGE 1Z1JA 3E1XB 2GJGA 3SV9A 4XOJA 5FCRA 1S81A 3A7ZA 1O36A 1IQHA 3RXJA 1TGCA 2HNTC 2ZU4A 1O3IA 1V2KT 2VH6A 2XWAA 1F5LA 1SB1H 1EASA 2PUQH 1QY6A 2ZHQH 1TRNA 1XMNB 4HFPB 1GJ4H 2KCOA 3DFLA 3LU9B 3UPEA 1QL7A 3HK6B 3SU4A 1HAPH 3B23B 3K65B 1SGCA 3ZZ5A 1ELDE 1DLKB 3SU2A 1ESAA 4MPVA 3UOPA 2CHAB 2W5EA 4AFSA 1H1BA 2FLRH 3STIA 1ANCA 2RG3A 1C2FA 1TQ0B 3P6ZB 2F9BH 2R9PA 3BTKE 3FZZA 1GJDB 1P2JA 3GICB 3FP8E 1AKSB 1OWDA 3RXTA 3C1KA 2Z3DA 1LPGB 1O3HA 1Y3UA 5DPAA 2ZP0H 1C1WH 3SV8A 4UDWH 4UD9H 3RU4D 1QBNA 5CE1A 2OQUA 2D2DA 3D23A 1AWHB 2BDYA 3Q00A 1HXEH 5E8EH 3VXEH 1C2JA 1YLNA 2CHAC 4ZKNU 1ABIH 1GI1A 5EIYA 1E36B 2OINA 1C2DA 1ZGVA 4OGXA 3ZVBA 4MG3A 2NWNA 4XD7D 4D76A 1MKXK 1MCTA 4CR5A 3KGPA 5EOKA 1W7XH 1EZQA 2JDID 2ZPRA 3TJNA 5AF9H 3E3TA 2ANKH 4NIYA 1ID5H 4YLUA 3EA9A 3N7EA 4NIVA 1WTGH 4I8LA 1QB1A 2FI4E 1RD3B 1GJ6A 4AX9H 1HIAB 8LPRA 1TWXB 3BTQE 2A1DB 4JCNA 2HLCA 1GI0A 3F6UH 3VFEA 1P05A 4FUIA 1UK3A 4GCHF 2AERH 1ACBE 1EJAA 1TPSA 1NRNH 4Y11E 1TGBA 3SGQE 3ELAH 2Y81A 5CDFE 1GHAG 1GVZA 1GMCG 1C5SA 1MUEB 5F6MA 3ENSB 1ZPBA 1ELAA 1UTPA 1Y5AT 2TPIZ 2Z9JA 3OY6U 2FO9A 3HKJB 1F5RA 1NU7B 1EQ9A 1O2VA 2UWPA 3KYGA 4P02A 2KCYA 1YCPM 1MCVA 4UFEH 2WSSD 2BZAA 3BEFB 4ISOA 1LPZB 2W26A 4X1PU 1SR5C 5E0JA 1BHXB 2BY6X 1FY8E 1ZHPA 4X2YA 2XCFA 3MH7A 2XRCA 8GCHF 2ZC9H 3BF6H 1AY6H 1V2ST 2QF3A 4INLA 1RXPA 1FV9A 3QX5H 1PFXC 5HGGA 4ZHMU 1BT7A 4B76A 1G2LA 3TH3H 3ZZ4A 6CHAB 2VNTA 1C5VA 3GS9A 3K6YA 1ZZZA 4NIWA 2IJOB 1UVUH 2XBVA 1Z1IA 3SUDA 5FPTA 1P2OA 2ZCKP 4CRBA 2G52A 5C0UA 2GKVE 3UWIA 3LJOA 4UONA 2A5AA 1TPPA 1TX6A 5EXNA 2AGEX 1UVPA 1SPJA 3M5NA 3OY5U 1E35B 1BTPA 1T7CA 4MNYA 4CH2B 6CHAC 4Q80A 1V2TT 3MI4A 2XBWA 1XUGA 1FAXA 5F8ZA 2ZDNA 3BTDE 1FIZA 5FPYA 4R0IA 3TK9A 1T8OA 4AYYB 4JZ1A 4ZHAA 3KQEA 4RKOB 1W11U 2H6MA 2BLWA 2F91A 1QRXA 1UTLM 5JB8S 2VWOA 4X8VH 3F2FA 5IDKA 2O8MA 2FYQA 2BLQA 3T5FH 4DCDA 4ABHA 1GBTA 2WPJS 4D7GA 1CA0B 2J9NA 1Z71A 1EOLA 2C4FH 2OK5A 4A1TA 1P3EA 4E7RG 3LDXH 5FX6A 2A4GA 3ZV8A 3O8CA 1L1JA 1MKWK 1O3MA 4BAKB 1EKBB 1H8ED 7GCHG 1E1QD 1GGDB 3RXGA 1OKXA 1GJBB 2I6QA 1CA0C 3F2GA 3DFJA 1PQAA 5C0TA 4JYVH 1EX3A 5T6FA 1UK2A 1BUIA 4HTCH 2QIQA 1IQJA 2ALVA 4GHTA 3UOUA 3GDSA 1C2GA 3LGYA 1PQ5A 1DOJA 3MH6A 3O8BA 2SGEE 1YPKH 3GYMA 1MMJN 5JBBS 3SZNA 2G5NA 1HGTH 3RXVA 4Y0YE 1GGDC 5LH8A 3KEEA 2GT7A 2ZQ2A 1DLEA 1GHBF 1D3QB 1INCA 2D8WA 1QRZA 1QCPA 4FXGH 1O2ZA 3P70B 1KYNA 2FXRA 1M9UA 1SBWA 1C1TA 3CS0A 1TFXA 1ZTJA 5SGAE 1FONA 4JYTA 1JOUB 5LGOA 3U98H 2ZPQA 4YOIA 2FOEA 3DD2H 3SNAA 4CHAB 1ELEE 3E0NB 1WBGB 1VGCB 1OX1A 2FMJA 1ZMLA 2AGGX 2GX4A 3EA8A 1PQ8A 1UW7A 1LCYA 2HGTH 3BTFE 1HJ8A 3GCHB 3TPIZ 1O3EA 5HM9A 9LPRA 1Q2WA 1QQUA 3B8JA 4WMFA 3MU4A 1EOJA 3A80A 2PWXA 1UCYE 2AIPA 1S5SA 3UQVA 1CGHA 4AG1A 4JZFH 1O5GH 3RP2A 4E05H 4CHAC 5JPMH 2C8ZB 2ZHEH 1VGCC 1HPGA 2PKSB 2YOLA 2H2ZA 4ZHLU 1UTQA 1LVBA 1O5AB 2BM2A 4ISLA 3UIRA 3GCHC 2K0QA 1NFWA 1GHWH 2JJ2D 4GUXA 2SGAA 1NO9H 2BD2A 2GT8A 2XNIA 3S9CA 2UUYA 1PQ7A 2QF5A 2PR3A 3SU0A 1BRUP 2ZDMA 1SFQB 1TABE 1DS2E 3RXHA 8ESTE 1MD7A 1UTNA 3E90B 2HWLB 3NKKA 3A89A 4MTBA 2PKSC 1GI7B 1BJUA 4I32A 2BDHA 2OCVB 4Y79A 1IQKA 2BOKA 2FOMB 2DE9A 1P06A 1QGFA 1OWKA 2Z94A 1OOKB 3E16B 5A09A 4ZKRU 5GCHG 2H1UA 1DXPA 1O2QA 1BMFD 4ABGA 2Y7XA 1HV7A 1KSNA 1TIOA 1WAYB 1VKYA 2ZGXH 3SYJA 1SQTA 2FOCA 1KDQA 2VIPA 3SU3A 4AGJA 3GY8A 2YNAA 1HLTH 3VG8A 1KXCA 3QZRA 3VB6A 1A0LA 1DX5M 2V3HH 1UCYH 4LOYH 1KMHB 2ZG0H 2ZU2A 1RIWB 4FUJA 5PTPA 3SU5A 4GSOA 2F9UA 3EE0B 3K9XB 2F9OA 4NA8A 3RMOH 1D4PB 2G00A 1KTTB 3BTTE 1SLWB 1W0JD 2PW8H 4IW4E 3A82A 2LPRA 4MNVA 2ZGCA 4AORA 1O3FA 2HNTF 1LMWB 1F0SA 1Q31A 1GVKB 1C5LH 1KXFA 2CF9H 3F0PA 4IGDA 5HIYA 1BOQA 4AZ2B 4WJG2 1C9TA 1RIWC 2FESH 4XBDA 1O32A 3CENA 1KXBA 3UFAA 4NZQA 1AN1E 1DICA 1G3CA 1TOCB 3PO1B 4CR9A 2FS8A 1QB6A 2AFQB 3MH4A 5C2ZA 4HZHA 4BTUB 2Y5FA 1LKAA 1AI8H 3UQOA 4DURA 1Z6EA 1Y3XA 2F43B 2QAAA 3BN9A 1F92A 4RSPA 3F9HA 3SNBA 3ZIAD 1B0EA 3UB0A 2C8WB 4B73A 1SGQE 1OP0A 1KDQB 3W94A 1HRTH 1GMDG 1G3BA 4WVPE 4BAQB 4F55A 1NS3A 4K2YA 4INKA 1IQFA 4Y8YA 1Q3XA 1HXFH 1ZHRA 2AIQA 3PO1C 3D65E 3PMHB 1GMCF 2HALA 1GHYH 1P03A 5EQSA 2BD3A 1EAXA 1TMTH 4Q7ZA 3TITA 1SGFA 3E6PH 3R0FA 2ZCLP 4BAOB 3RXOA 2ZFFH 3ZVEA 3FZDA 1NRRH 1P02A 1O2SA 4NSYA 1AVGH 1LHDH 2ANWA 1JWTA 2XC4A 4I7YH 4GLYA 1BTXA 4MNWA 1K1JA 3UNSA 3SO3A 2OQ5A 2V35A 1VR1H 3U8TH 1S84A 2WUCA 1GPZA 1W8BH 2A32A 5GXPA 1A3EH 3KQ5A 1TX7A 1O3BA 2AYWA 4HGCA 4WH8A 4DG4A 3UAIC 2Z3CA 4H4FA 1YCPH 4IN2A 1ETSH 1TB6H 3DA9B 5F03A 3MH5A 1FUJA 1AFEH 4ASUD 1FAKH 4UEHH 1RRKA 1EFRD 1O30A 4IMZA 2ZU1A 5EODA 3KYFA 2F3CE 2QF0A 1L1NA 3KL6A 3GY4A 1KXAA 1UTOA 2QC2A 3PLBA 3T28A 1OWJA 5GDSH 3A84A 3U9AH 2XOKD 1L2EA 3QWCH 1SC8U 1UVOA 2AMQA 2FS9A 4TPIZ 4A92A 1O3JA 5FXLA 3ZVAA 1GVLA 3ATLA 1PPFE 1BBRK 1BTYA 3PYHA 3HGPA 2BTCE 5FAHA 1A0JA 2SGDE 3H7OA 2A31A 2Y82A 6GCHG 1SQOA 1SGYE 5DP7A 1K2I1 5JB9S 4LZ1H 2Y80A 1V2UT 3RXRA 1HAOH 4ABIA 2ZO3H 3AW1A 1C1UH 2GMTB 5DP9A 4ZH8A 3SNEA 5KECA 1GDNA 2FX4A 2UWOA 4I8GA 3UR6A 1YLDA 2BXUH 1O2GH 2SFAA 3MU1A 2PTNA 1P11E 1P8VC 2ZI2H 5I46H 1UTKA 2Q1JA 2F9NA 2R3UA 2CN0H 1FX0B 5A0BA 1H8DH 1QBVH 1ZPCA 5JBTA 2CGAA 3P92A 1EP5A 4WXVA 1KLTA 3HK3B 1CO7E 4MPXA 2HLDD 4GVUA 4NFFA 1SSXA 2GMTC 2BB4A 4B71A 1TE0A 4X0WU 1SG8B 1O34A 1BHXF 2BD5A 5E0GA 1FJSA 3MMGA 1ZMJA 1MBQA 3I77A 1EB1H 4IC6A 4WXIA 1GBKA 5LPFA 3KQDA 3RXAA 3TGIE 3KHVA 3P8FA 1TX8A 3F9FA 1Y3VA 1CBWB 2QXIA 2VWMA 2XWBI 3N7OA 4H6SB 2UUFB 2XCNA 1LHGH 4FOUC 3M36A 5E2PA 1DUEA 3STJA 3SQHE 1DWBH 3ZYDA 1THSH 4FUBA 4YLQH 4GHQA 3LC3A 1SGIB 2GDEH 5T6GA 2WPKS 3GCTG 2ZDAH 4ISIH 2PP6A 4CRAA 1O31A 1Z8GA 5EPNA 1BTZA 1C1PA 1F0TA 1K22H 3I29A 5C5NA 3L6PA 4B6EA 2VVCA 4X6PA 1CBWC 1UVTH 1ZLRA 1BQYA 3ATMA 1IQEA 4X8UH 4A5TS 1P10A 1ZGIA 2AS9A 3S7KB 2ESTE 3KNXA 1PPHE 2A7CA 2JKHA 1EZSC 3M3TA 1A4WH 1A61H 1TRYA 1SGFG 2ZIQH 1OP2A 1HIAA 4X2WA 5F8TA 4H42U 4JYUH 1T31A 1T4VH 3EQ0H 5GIBA 2QE7D 5K7RA 1TNHA 2BVSH 1FN8A 3MYWA 1XUJA 2FOBA 1LHFH 1NY22 1AD8H 2IPHA 1LQDB 2BY7X 3LPRA 1TLDA 1CHGA 1DFPA 5T6DA 4MVNA 2DE8A 2KZ4A 2CJIA 4ZKOU 4DT7B 2W3KA 3DSOA 5JBCS 3LGWA 3T26A 1COWD 2L74A 2A7JA 3SI4H 1GG6B 3PLKA 3KIDU 1AE5A 1YPMH 1GBFA 4DOQA 3RXBA 3QUMP 5K0HA 2BDIA 3FKSD 2OBQA 4K5ZA 4KELA 1YPHE 8KME2 1C1MA 2O8TA 4JZEH 3QZQA 3LGIA 4UFGH 2ANMH 2BQ7B 1ZJKA 4FU8A 1BB0B 1N6XA 1PJPA 4NWKA 3NXPA 3UWJH 1E0FD 1S83A 1TYNA 2ZKSA 1QJ1B 1JBUH 1GI2A 5FX5A 3ZYEA 1BRCE 1G36A 3OFND 1GG6C 4B74A 5E2OA 1GBDA 1QA0A 3GDVA 1C1NA 5L2YH 1OS8A 4ACBA 1HUTH 4LZ4B 3M5OA 1Z7KA 2OLGA 4YT7H 1NFUA 1EAUA 2WV9A 3BG8A 1SGPE 4YT6H 1AUTC 3OYPA 1V3XA 1CU1A 3A81A 5GCHF 6LPRA 1WQVH 4X1QU 1AHTH 3N99A 1XX9A 3H09A 2P95A 2SGQE 3SI3H 1GI3A 2C90B 5CHAB 1C1SA 3ODDA 2UUKB 1P2IA 5CHBA 4VGCB 4KTSA 5DKMA 2THFB 3PTNA 1KLJH 2WUBA 2BVRH 4XFQA 4IN1A 3RXSA 1SGDE 5KGOA 1F5KU 1BRBE 1OHHD 1BTWA 1YLCA 1P12E 2EI7A 2ZHWH 1BMMH 1V2VT 1V2QT 2BD8A 2EI8A 4Q7YA 1V2NT 1AZZA 1G30B 5FBEA 1EB2A 5EG4A 3A8AA 1ZHMA 1MTSA 4M9FA 4XBBA 5DP8A 1GBHA 5FCKA 2XNDD 1THPB 4MPUA 3AAUA 1MKWH 2F4LA 1GMHF 5CHAC 1BDAA 1LHCH 1SLUB 4ZAEA 1YGCH 1ORFA 1V2RT 1AQ7A 4VGCC 4YXWD 1RTKA 1ZJDA 1NC6A 4SGBE 1TPAE 1D9IA 5KEDA 5HIZA 2DUCA 5AHGH 4NG9H 3A7WA 2ZQ1A 2BD7A 1ANDA 1LKBA 1KTSB 2ZWLH 2EA3A 4NCYA 2B0FA 1CT4E 1IAUA 3GY5A 3F9EA 1YPJH 3U28C 1WCZA 3SBKA 3O8DA 3A7YA 2IOTA 4JK6A 1C2KA 3SZEA 5JBAS 1YC0A 2AMDA 5FL7D 1FY1A 2PSXA 2F83A 3QLPH 2FX6A 2XTTB 4Z1MD 3QDZB 4DT4A 1GBJA 3ODFA 1GMDF 1T8LA 2UUJB 1O3KA 3FP7E 3ATKA 1O2HA 1Z8RA 1C5XB 1UTJA 1CA8B 1WYKA 4B1TA 3Q3KA 1GI5A 1VITH 3BIVH 4FUHA 3ZV9A 1D3PB 3LONA 1SQAA 3LH1A 1DANH 3DUXH 4NA7A 1QJ7B 2WPMS 5EJZA 1C2MA 1MBMA 5L30H 1GBLA 2VJ1A 1TRMA 1MU8B 1W13U 2G4TA 2SGFE 3T2NA 1HAHH 2FYRA 2GZ9A 4MPWA 5GJ4B 3RDZA 5TJXA 3S0NA 4HI3A 1L4ZA 3SV6A 3MO3A 4B6FA 2VINA 5ABWA 5FHTA 1NFXA 5EGMA 2V7QD 1QB9A 3MNXA 3PMJA 1GBAA 3PRDA 1GCTB 1THRH 1W0ZU 1ZYOA 3D49H 1EAIA 1JXPA 1CHOG 1QRWA 5A0CA 2FTMA 1DWCH 4SGAE 1SI5H 1C9PA 2Y6TA
chains in the Genus database with same CATH topology
3V3MA 2BD4A 3QO6A 2C93B 1T32A 1QFKH 2P8OB 3MTYA 4FVDA 1YM0A 1Y59T 2ZDVH 3GY6A 1A2CH 2A2XH 1DSTA 2M5TA 2G8TA 4X2VA 2H5DA 1N8OB 3SHAH 1GCTC 3RC5A 1TNLA 1BRAA 4MNXA 3TIUA 1O5CB 4FUEA 1P2MA 2JH5D 1XXDA 1FLEE 2J95A 3ZZDA 2OC1A 4CRCA 2TIOA 2ZF0H 1NM6A 1GBCA 1XUHA 1SVPA 2A45B 2P8OC 2VB0A 1FDPA 1AB9B 1OWHA 2F9VA 2ZGJA 4I33A 1N8OC 1VJ9U 3KN2A 5EW2H 3BTEE 2KAIA 3DHKH 1MQ6A 1P2NA 4X1RU 2FOFA 2A5KA 4JMYA 4IC5A 5J4QA 1HB0B 1QIXB 4D9QA 1K28D 3BIUH 3A8DA 2QXGA 3ZVCA 1O5DH 4GPGA 4ZUHA 3SORA 2YNBA 1AB9C 2J2UA 2OBOA 1O5BB 3PB1E 1CGIE 4AB8A 1D3TB 1YF4A 5ETXA 1EUFA 4WWYA 2G4UA 1BMAA 2STAE 2ZFQH 5T3HA 1XVOA 2OD3B 4Y71A 3S69A 2A4RA 2ZZUH 5IYTA 1Y5BT 3RXFA 4BTTB 1QBOA 2ZHFH 1ZRBA 1S0QA 4XBCA 3ATIA 3L33A 3RXPA 1A1RA 3U1IB 3T62A 5C5OA 2BLVA 3GCNA 3NZIA 4O03A 5E0HA 2ALPA 1OYTH 1EPTB 1H9LB 4OS4A 5HXFA 2FOGA 3A83A 7KMEH 5H4IB 4O97A 4AYVB 3TGJE 1XVMA 4X6MA 2XW9A 2XBYA 2OC7A 2PKAB 2P16A 5ESBA 1BA8B 3RXEA 2Q6GA 4NA9H 3URCA 1TNJA 5TCCA 4DVAU 3MFJA 1O3LA 2KAIB 3EDXB 1O33A 4ESTE 1HDTH 3ZZ8A 1BBRE 3FAOA 3I78A 1QQ4A 3SHCH 2ZTYA 2QXHA 1EPTC 3QGJA 3ZZBA 1DITH 3AAVA 1ARBA 1RTFB 3RM0H 5EQQA 3RMMH 1O2LA 3MHWU 2RCEA 1TMUH 2ZGHA 2ZA5A 3M35A 2GDDA 1FY5A 4AGKA 1CT0E 1NRQH 2HNTE 1ESBA 5A2MH 1UJ1A 1Y3YA 2TGTA 2Z9KA 2ZFRH 4OGYA 5HMAA 1VJAU 4K1EA 1OYQA 4THNH 4CBOA 3D62A 1IHTH 1V2MT 1CT2E 3HGNA 5F8XA 1O35A 1XKAC 1S6FA 1FQ3A 1G32B 2FI5E 2R2MB 3PV4A 1C1QA 4NSVA 4UE7H 3B9FH 4BTIB 4Q7XA 1ABJH 1C5OH 3VB5A 2H5CA 3PLPA 4PROA 4FU9A 2FM2A 2P93A 1YPEH 4ABAA 2VGCB 3JZ1B 2GD4B 1OWEA 4R8TB 1TBZH 2P94A 3M5MA 2RA0A 1K9OE 1YYY1 3P8OA 3SW2B 4CH8B 2P3TB 1GJ7B 2EEKA 1FZZA 2Q6DA 4BXWA 1FMGA 3FVFB 3BG4B 1SLXB 2WPLS 1PPCE 2ODQA 1TNKA 2W3IA 3K2UA 4CREA 4A1VA 5C67A 2EI6A 3FFGA 3VXFH 1TOMH 2FZZA 5DG6A 3TNSA 1VITG 1W3CA 1F0UA 2VGCC 3M7QA 1QTFA 5JYIA 2AEIH 4BNRA 3VB3A 1VCQA 1QHRB 2A5IA 3TLOA 2BY5X 3SNDA 4D8NA 2ZDKA 1J9CH 1J16A 3KQCA 1ELCA 3BG4C 1GHAF 4D9RA 2H9TH 1NN6A 3UY9A 3S7HB 1MAXA 2BZ6H 4BAMB 3PROA 2R2WU 4ZXYH 1TGTA 1C1OA 1FN6A 1O3CA 2BQ6B 2Q6FA 2PFEA 1B0FA 4KTCA 5TCAA 1GBBA 5G4BA 4CRFA 3RXMA 2TGAA 2XC0A 2VIVA 4IMQA 3TK6A 3MU0A 2BLOA 4U30A 2VVUA 3R3GB 1L1GA 2FOHA 4TY6A 3M3VA 1XUIA 2ZCHP 1JIMA 1H9HE 3T25A 1O2YA 5DP5A 2PHBA 3F68H 2V6NA 3LH3A 1GL0E 1YPLH 1U6QA 1E34B 1SFIA 1MH0A 1VZQH 3MO9A 1C2HA 2BYAX 2ZGBH 2GV6A 1IQLA 1KXDA 1LPKB 3PMAB 4Y7BA 2QYIA 3TNTA 2R0KA 2SNWA 3OSYA 1DUAA 1DE7H 1DT2A 1SOTA 1Y3WA 2Z3EA 3SOSA 2WYJA 3QK1A 1P01A 1FXYA 3SGBE 3H5CB 3E91A 1LDTT 1O3PB 1TBRH 2FODA 2ZNKH 1ZSJA 2GTBA 4JZDH 2A7HA 4M7GA 2TBSA 2G55A 2XBXA 2QGRA 1O2KA 1MQ5A 4YOGA 1SGRE 1GI8B 1PPBH 1LVYA 4XSKU 1WOFA 1HJ9A 1QR3E 1IQGA 3LT3A 3TH2H 2ZTXA 2VIOA 1K1OA 1XXFA 1TGSZ 2QV1A 1W2KH 1PYTD 7GCHF 3NCLA 1ELGA 4DJZB 1MKXH 5DP4A 3SJ9A 1ELTA 1ZSLA 1C5NH 2R0LA 2ZTZA 1EATA 3TH4H 1D6RA 2HOBA 3Q3YA 3LIWA 4YTAA 1D3DB 1TAWA 2JETB 1WV7H 2C3SA 2GGVB 3E8LA 1RGQA 4NZLA 3IG6B 5CMXH 4WY3A 2O8UA 4I31A 2BY9X 4Y0ZE 2G51A 1QJ6B 1NPMA 3TJVA 3ITIA 1TA2A 2WYGA 1YKTA 4Y76A 1C5UA 3BV9B 3ESTA 2QCYA 3RU4E 4AFUA 3ZZ6A 4Y8XA 1O2OA 1NRSH 3MNBA 3V7TA 3BTGE 1P3CA 1RJXB 2B9LA 2JETC 4AG2A 1C5WB 4KKDA 4OS5A 4ABEA 1GHXH 3SV2H 1HAGE 1WSSH 1PPZA 1ELFA 4X2XA 4DIIH 1O2PA 1IQNA 4Z0KA 1BTHH 2WV5A 2Z9GA 2J92A 2G81E 1ARCA 1ZPZA 3PTBA 4BOHA 3GY2A 1EP6A 4UFDH 1BITA 3A7VA 1N6YA 3L3TA 1ZTLA 3RXCA 4K8BA 1V2JT 1Y5UT 3HPTB 4BANB 3OU0A 4TPYA 1HYLA 3RC6A 1GJAB 2GVFA 1TQ7B 4I8KA 1P09A 3TU7H 1J15A 3SJKA 4JK5A 3RMNH 2ZDLA 3LGUA 2QN5T 2ZHDA 1E38B 1W10U 2NU1E 2ODYB 3A86A 5C1YA 3SJOA 2BDAA 1LHEH 2FDAA 4ISNA 1P57B 2W7SA 4DY7B 2FWWA 4OS2A 4MQAA 5JDUB 1TA6A 2F9PA 3TK5A 3LGTA 3DT0H 1B7XB 1A3BH 2ODPA 1LTOA 2BD9A 5DP6A 3ZZ9A 2OUAA 4YZUA 3ZZAA 4A6LA 3MWIU 1OPHB 4JZIA 4B75A 5LPRA 2QXJA 2HRVA 1CSOE 4GAWA 2PV9B 3GDUA 3V12A 1YBWA 1XUKA 1BMLA 1ESTA 1WU1A 2FPZA 1GBEA 1AU8A 1FNIA 2PGQB 4FUDA 1GI9B 1SGTA 2PUXB 3LOXA 1ETRH 3ZVFA 2LNCA 3Q77A 3CS7A 1E37B 2O8WA 4Y6DA 1W12U 4TY7A 1QA7A 3AVZA 5DK1A 1LVOA 4E06H 1K1LA 1O37A 1FY4A 3P17H 4X1SU 1AE8H 3UREA 1ZRKA 5BPEA 4MLFB 4O3UA 5LPEA 4QT8C 4X6NA 4AOQA 1ANEA 3SNCA 4E7NA 4FUFA 4ABFA 2WPIS 4ZKSU 2VH0A 1GJ9B 1BTUA 1MTUA 3KQBA 4CRGA 1WQSA 1QURH 4DGJA 4AFQA 2BHGA 1DY8A 2VIWA 2XXLA 3TGKE 4WMDA 1QL9A 4RKJB 4A1XA 3EA7A 4NWLA 1P2QA 1PYTC 1F0RA 3MNSA 3RMLH 2VIQA 4F4OC 1IOEA 1TNIA 4YESB 1HNEE 1BZXE 1O5EH 1IQIA 3ZZ3A 2NU4E 3A8CA 4KTUA 2BMGB 1VCWA 2VVVA 1SHHB 2FOAA 3UNRA 4BAHB 1MTVA 1NROH 2Z9IA 1AWFH 5DO4H 3VEQB 1S6HA 1MD8A 5DJ7A 1OXGA 3W95A 1UVSH 5EXLA 1VITF 4TYDA 4U32A 1AIXH 3V13A 1P9SA 1GI6A 1XKBC 3RM2H 2STBE 3SQEE 2FEQH 2VU8E 3RXKA 2FI3E 2FP7B 4Z6AH 3LC5A 3RC4A 1JMOH 4I8JA 4O9VA 1GJ5H 1O2NA 1BCUH 1UMAH 3UTUH 4WH6A 1Z6JH 4KGAA 2AGIX 1K1NA 1C4Y2 2WV4A 2BX4A 2GP9B 5HM2A 1G9IE 1HFDA 5EPYA 6ESTA 1NFYA 2ZFSA 1SGEE 4DW2U 1SOZA 4AB9A 1P9UA 5I25A 2HPQH 3GOVB 1UHBA 2A2QH 4IBLH 1MU6B 2Y5HA 4NFEA 1W14U 4YM9A 1RFNA 5L6NH 2BDCA 3PM3A 4H6TA 2C8XB 3F9GA 2Z6BD 3VB4A 3C27B 2GCHG 1GHZA 1MTNB 1FPCH 1A5HA 4OS1A 1FY3A 2ASUB 1TNGA 1O2RA 4Y8ZA 1GBMA 1P2KA 2B5TB 3FP6E 2CF8H 4X8TH 1A7SA 1AUJA 2Z9LA 3BEIB 3Q3XA 1ETTH 2WPHS 3KF2A 1O3OA 1DM4B 4ABDA 1DY9A 3VGCB 1EPTA 2QA9E 1RS0A 2V0BA 4NGAH 5DP3A 3UNQA 1NU9A 1NTPA 3SUFA 1MTNC 6GCHF 1JRTA 4NIXA 1WTHD 4UFFH 1FIWA 1SHYA 2H9EH 5C20A 1DWDH 2PKAA 3BTWE 1ELBA 2ULLA 1GDUA 1X7AC 1GJ8B 3RXLA 2V3OH 1QL8A 4TWYA 1UHBB 1BIOA 2I6SA 3S9AA 4K3JA 4X6OA 1P04A 1DWEH 3VGCC 5C1UA 1HAYB 3U69H 3F1SB 1KXEA 3ZZ7A 1O2WA 2CV3A 3WY8A 1KLIH 2BVXH 7ESTE 1L0ZA 1JIRA 3NPSA 1TALA 1SGNE 1XM1A 1GCDA 4FUGA 4AFZA 1V2OT 1N1LA 2GZ7A 2AH4X 1ZOMA 1BJVA 1UTMA 2JH0D 1FI8A 1CVWH 3E0PB 9ESTA 1C5PA 1KIGH 4FVBA 4B2BA 3G01A 1S82A 1SMFE 3VPKA 4RN6A 1G2MA 4ISHH 1A0HB 1O38A 3P8GA 3LJJA 5EXMA 1HJAB 1H9IE 5HYOA 3T27A 1YPHC 5ESTE 3O8RA 3SU6A 2ZU3A 1CE5A 3SU1A 4CRDA 1ANBA 2GCTB 4K1SA 4U01A 2ANYA 2FLBH 4LXBH 5GWZA 1DPOA 1EAWA 3LKWA 2BXTH 3RU4T 1CQQA 3QTOH 1CGJE 1MZAA 3GCTF 1EZXC 4OS7A 4WF8A 2C8YB 1YP9A 3SN8A 3RXIA 4LK4A 3RLYH 3SV7A 1C4V2 1HJAC 1EJNA 1MZDA 1GBIA 1O2JA 2ZFPH 4BXSA 1GJCB 3P8NA 1S85A 1V6DA 5FPSA 1G3EA 2NU3E 2CMYA 2GCTC 1C5ZB 1GHVH 2H9HA 2O8LA 4ZMAH 2VWLA 3EAJA 4MDSA 3GCOA 1ZSKA 5A8ZA 4OS6A 2Y5GA 2Z7FE 3OTJE 3S9BA 1TPOA 1C1RA 2D1JA 3AASA 4K69A 5GPIB 1TONA 3GYLB 2NU2E 2P59A 2ZU5A 2W7UA 2OP9A 1LVMA 2A4OA 3BEUA 2ILNA 2PLXA 3EYDA 3RLWH 4TWWA 1J17T 4CBNA 1Z8IB 3A7TA 3RUOA 1EJMA 3FANA 3M3SA 3ATWA 1P0SH 1AO5A 1AFQB 1BMNH 3T29A 5J4SA 4AN7A 2VIDA 3HKIB 2NU0E 1AGJA 1F2SE 1YPGH 3A87A 5BRRE 5AFYH 1G3DA 1H8IH 3A7XA 3MU8A 4GCHG 1HBTH 2K1QA 1OSSA 1ELVA 1ZR0A 2BX3A 1K1PA 2BQWB 1C5TA 3QN7A 3M37A 3IWMA 1NZQH 1GL1A 1UO6A 2OXSA 3M7TA 3RXDA 1AFQC 1C5YB 3RXUA 2CXVA 1BBRH 1GMHG 1NRPH 3MO6A 1GDQA 3HATH 4FU7A 1AZ8A 5EU8A 2TRMA 3OX7U 2J34A 1G37A 3PWCA 5L2ZH 2J38A 3NWUA 3TJOA 8GCHG 2BDGA 1TMBH 1C5MD 3URDA 4X1NU 2A4QA 1NT1A 3SGAE 4IS5A 1S0RA 5C1XA 1SLVB 3SUGA 1JRSA 1V2PT 4ZXXH 2GV7A 1D6WA 1O2IA 4XE4A 1IQMA 1HAZB 4F49A 1NESE 3U1JB 2B8OH 2ZFTA 1AVWA 1O3DA 4I8HA 3LGVA 3UUZA 4DIHH 1C5RA 3BTME 1ZMNA 1GI4A 3P95A 2XC5A 1O3GA 1V2WT 2RDLA 1O2UA 1DXWA 1UK4A 1MAYA 2JH6D 1C2LA 2QY0B 1HAVA 1O2TA 5DGJA 1O2MA 4XDEA 2O9QA 2HPPH 3NUMA 1LQEA 1IHSH 1W7GH 3M61U 3A85A 3MNCA 2R3YA 1L4DA 3CP7A 3EGKH 1VCPA 2PGBB 1W0YH 3SJ8A 3TVJB 3VB7A 7LPRA 2UWLA 1Z8JB 4A7IB 2BDBA 2A0QB 3KCGH 4INHA 3IITA 3M5LA 2ZPSA 3PWBA 1C2IA 4B2AA 5A8XA 1B5GH 1UCYK 1AVXA 2SNVA 3PMBB 4ABJA 3A88A 2OC0A 3Q76A 5A8YA 3ZVGA 3MOCA 2TGDA 1OWIA 2HVXA 1T8NA 2J94A 4Q2KA 2FTLE 1TBQH 1HAXB 2VWNA 2Y7ZA 3ZZCA 1O2XA 4K60A 5EQRA 1DSUA 4KP0A 2WINI 1A46H 3ZVDA 1PPEE 1O0DH 1J8AA 3QTVH 1T8MA 1Y8TA 1C2EA 4J2YB 2G5VA 1K1MA 5A0AE 3K6ZA 1O3NA 2BY8X 1A5GH 4YOJA 2FIRH 1A5IA 2AMPA 1H4WA 1C5QA 1T4UH 1DDJA 5FBIA 1HAVB 3TJUA 4D7FA 3A8BA 1O5FH 2BOHB 4Y10E 4YO9A 2D26C 2J4IA 2P3FH 1ZTKA 3BTHE 4ABBA 1LO6A 1CHOF 1EZUC 1HAIH 1QNJA 2TGPZ 3MU5A 1GHBG 3AW0A 1O39A 1GWAA 3GY7A 1AMHA 4O3TA 1XUFA 2GZ8A 2GCHF 3BSQA 4B2CA 1SL3A 2ZEBA 3SUEA 5AVDA 2B7DH 3QGNB 2XYAA 5B6OA 4ZROA 3GY3A 1K1IA 2OC8A 1RTLA 3M7UA 2IN2A 4X8SH 3V0XA 1J14A 1C1VH </