1GI9B

A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting, hydrolase
molecule keywords UROKINASE-TYPE PLASMINOGEN ACTIVATOR
publication title A novel serine protease inhibition motif involving a multi-centered short hydrogen bonding network at the active site.
pubmed doi rcsb
source organism Homo sapiens
total genus 54
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2001-01-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi9B02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gi9B01
3P6ZB 1AI8H 1QJ7B 1L0ZA 3QZRA 4X1PU 3RXDA 3TVJB 4ZMAH 5E0GA 4UE7H 1E36B 3F1SB 3SNDA 5SGAE 1MQ6A 1S84A 4M7GA 1GJ5H 5CHAC 3BIVH 3RUOA 2ASUB 1KXEA 3T25A 1QRZA 1ZPCA 4E7RG 1YPMH 1O3MA 2G5NA 3DFJA 1THSH 3GOVB 2R9PA 3SGBE 3O8RA 1OOKB 5EPNA 1YCPK 5DP8A 3SU6A 4YOIA 8ESTE 1C5RA 1N6XA 1JBUH 4OS4A 4I31A 3M5OA 1O5FH 2ALPA 3GCOA 3ZZ5A 4R8TB 3NCLA 1OS8A 1CA8B 4BTTB 5JBTA 2FMJA 4LXBH 3AVZA 3SV2H 3MH5A 3UTUH 1DX5M 2ZDMA 1FLEE 1O33A 3N7OA 2OXSA 2GP9B 2B0FA 1C5TA 4HZHA 4ABJA 1KXBA 4GVUA 4JCNA 3T2NA 2AEIH 1PQ8A 2Q6FA 1S83A 4FUIA 1O3LA 3E0NB 3M35A 2HGTH 3GCTG 1RD3B 2BX3A 1HXEH 2BQWB 1QRWA 1O3HA 3MH6A 2Z6BD 3FP7E 3KF2A 4LZ4B 5AFZH 1GMHF 4UFGH 4WMFA 2BD8A 1GBBA 2SGQE 3L3TA 2RA0A 1GHAF 1YPHE 1GVZA 2WYGA 3TJVA 2K1QA 1NRPH 1HB0B 1OWHA 1A3BH 1L1GA 2ZFQH 1XKBC 5JYIA 2UUFB 4TY7A 2FXRA 4AGKA 4ZXYH 1SGPE 3LGUA 3E8LA 1GBJA 1PYTD 1P2MA 3RXGA 1MKWH 5L30H 4ZXXH 2ALVA 6LPRA 1S0RA 4YT7H 2XCFA 3NKKA 1NRSH 4J2YB 1O2RA 2VB0A 2QCYA 3ZV8A 5FPSA 4I33A 4ISOA 1UTOA 1GHZA 3ZYDA 4B74A 1WBGB 1G2MA 1RXPA 1SGDE 3MWIU 4D9QA 4A7IB 1SB1H 1BCUH 2FI3E 4B2CA 1SGTA 3STJA 3G01A 4GHTA 1WUNH 4FVBA 3TGIE 3Q3YA 1DM4B 2BDIA 2PKAA 2JH0D 4CRBA 1G37A 3RC5A 4U01A 2I6SA 1HGTH 1T8NA 1ZMNA 3DHKH 3TJUA 2QXGA 5ESTE 2OD3B 1WOFA 4ASHA 2WPJS 2ANKH 4NWKA 4XBBA 1P01A 1ZYOA 4JZDH 3PLBA 1Z8JB 2A5IA 1KIGH 1LHCH 1D3DB 4RKJB 1SGQE 4FUCA 1CT4E 2YOLA 1OSSA 1Y59T 1EX3A 5FBEA 1XUKA 1EQ9A 2QV1A 2GKVE 3BTQE 2LNCA 2ZWLH 3VB3A 2CJIA 4B2BA 4MNVA 2B8OH 4OS5A 1C1PA 3VXEH 1ID5H 1UK3A 1GMDF 1K28D 1LHDH 1ZTLA 3VB7A 1O37A 1O5GH 1YPHC 2HNTF 4ABDA 4INLA 2FOBA 1Y8TA 3TH4H 3M3TA 2BDHA 1O2PA 2ZCHP 3ZZDA 4D76A 2STBE 2VU8E 3U1JB 1P0SH 1ZSJA 1QB9A 2BY5X 2OP9A 1RIWC 5BPEA 2UUYA 1HAVB 1TRNA 2BLOA 2QXJA 2H2ZA 3M7QA 1C2GA 4I32A 4A92A 5IDKA 1W0YH 5DK1A 4AB9A 1L4DA 1V2WT 2V3HH 6CHAC 3OU0A 1YC0A 4U30A 3K9XB 1E35B 3RXVA 1BJUA 5E0HA 3RXAA 4Q7YA 4NIXA 3A89A 1V2OT 1SGFG 2ZHWH 2AIPA 4ABBA 5FHTA 3L33A 1KXCA 4MPVA 3SHCH 2W26A 5ABWA 1OPHB 4MTBA 2OQUA 1E38B 3M5NA 4Y8XA 5TCCA 2P59A 2M5TA 2TGAA 1S0QA 3U69H 3TNSA 3SUEA 1WU1A 1A5IA 1EPTB 2A5AA 1ELVA 4CH8B 3LKWA 2BOHB 1K1LA 1CHOF 2GCTC 1VGCC 2IN2A 3TGJE 3DUXH 1A0LA 2C4FH 2A4RA 1QRXA 1O32A 2BD7A 2GZ9A 1GI3A 3SZNA 3A7TA 4X8VH 1V2JT 5A2MH 3UFAA 2BDGA 2HVXA 2OTVA 2TPIZ 1QTFA 1TQ7B 1FUJA 1GJBB 3ZVEA 1GHBG 1BOQA 1H9HE 1P11E 4Q2KA 1YCPH 2R0KA 3E1XB 3LDXH 1JIMA 3P95A 4K5ZA 4NWLA 2GDEH 4NSVA 3SHAH 2VWNA 3MO3A 1GL0E 1CA0B 1H9LB 4TPYA 2HALA 3M36A 2J94A 1LHGH 1B0FA 1ABIH 1DWBH 2ZFSA 2HNTC 4DOQA 5C5NA 4H6TA 2Y7ZA 4UONA 4AG2A 3PWBA 1QJ1B 1LTOA 1TA6A 1FY4A 2H5DA 1GG6B 2WUBA 4NSYA 3HPTB 3TLOA 1MBQA 1UCYK 4MLFB 2A5KA 4NZLA 3ATMA 7GCHG 1K2I1 1K1PA 1BMMH 3VPKA 4SGAE 5EXMA 4Y8YA 3RM0H 4MQAA 1P09A 3IITA 1QB1A 1FZZA 4X6MA 4XOJA 1C1SA 1EB2A 1T4VH 2J92A 1TWXB 1BHXF 1O3KA 1UVTH 2IPHA 4NA7A 1GWAA 1LVYA 2O8LA 2ILNA 1P2JA 5DP4A 1F0RA 2GMTB 2VNTA 3C27B 5FCRA 3MTYA 1DPOA 2BDYA 4CH2B 3RXHA 3HATH 1FN8A 1PFXC 2BD2A 3E0PB 1GGDC 2JH6D 4AGJA 1GMHG 3MMGA 3V12A 1BIOA 3EE0B 1GHAG 2J34A 2JH5D 1MUEB 3ZZ9A 1V2KT 2WINI 3BG4C 2ZHDA 3TK9A 2XWAA 3GYMA 1O5BB 2OC7A 2DE8A 2PKSC 3UNRA 1GDQA 1D3TB 1OX1A 1TOCB 1ZTKA 4ISIH 1GBAA 2H9EH 3AASA 2BDBA 2FWWA 5A0AE 2XBWA 4ZHMU 4RSPA 3S0NA 4J1YA 1PPEE 4I8LA 1BDAA 2A32A 3MI4A 1LKBA 5A8ZA 5EW2H 3MU4A 2FDAA 3KCGH 3SV6A 2ZQ1A 4B73A 8LPRA 4UFEH 1Z1IA 2XTTB 1QY6A 4INHA 2AMPA 4DJZB 5FCKA 1ORFA 1C1UH 2H5CA 1THPB 3VB5A 2IJOB 2BYAX 2VWOA 1HUTH 3BTDE 1YLDA 5HYOA 1D3QB 1ZHPA 4IW4E 4A5TS 3P8NA 1XVOA 1TNKA 4CBOA 2WPMS 4O3TA 4XE4A 2FI4E 1HAIH 1W14U 1AN1E 4U32A 1O3AA 1C1OA 1RJXB 3ATWA 1FY8E 5E8EH 3ZZ8A 2Z9IA 1C1MA 1Z6JH 1MMJN 1HJAB 1J16A 5HGGA 1MTVA 2ANMH 2A2QH 1AB9C 2KAIB 1M9UA 3T29A 2ESTE 3UR6A 1G36A 2BMGB 1DUEA 2THFB 2CHAC 1A3EH 1AZ8A 1BBRK 2ZKSA 4O97A 1LDTT 2XC5A 3PM3A 4BOHA 2FOMB 1XKAC 3A7YA 5FX6A 1THRH 1TBQH 2CV3A 3A7ZA 5F8XA 1IHTH 2GV7A 4D9RA 1G2LA 3FAOA 1KXFA 1NFXA 2ODPA 1CT2E 1ZPBA 2UWPA 2ZF0H 2CN0H 1AIXH 1TPSA 2IOTA 1AO5A 1JRSA 2FODA 1QB6A 1XMNB 1Z1JA 1SLWB 4B1TA 4YM9A 1PYTC 1MBMA 4Y71A 5A0CA 2ZQ2A 5I25A 1ANBA 1DVAH 1GI9B 3KQBA 5GCHG 5GWZA 3GY6A 1SGFA 2FS9A 2ZI2H 2QXHA 4WH8A 4Y79A 1TPAE 2XWBI 1S5SA 2G8TA 3MYWA 1GI7B 2B9LA 1FXYA 4MPUA 1Y3WA 4ZKSU 1GCDA 1QA7A 3VXFH 2A0QB 1WV7H 1AKSB 5DJ7A 3QO6A 1ARCA 1A46H 3IG6B 3QTOH 4ZH8A 1UVSH 3LGVA 5EQRA 4HFPB 1PPFE 2OC1A 4DIHH 1O2WA 3EDXB 1AMHA 2CMYA 1AQ7A 1OP0A 4X1NU 2WV4A 4I8KA 1UHBB 2EEKA 1CE5A 5DP6A 1BHXB 2BHGA 1SGRE 2FX4A 1HFDA 2O9QA 2BM2A 1C1RA 1TBRH 2FI5E 1ZHMA 2ZHEH 4IN1A 4WY3A 1H9IE 5T3HA 2VIPA 2QGRA 2G52A 1UCYH 3NUMA 5DPAA 5HM2A 3KEEA 3RXLA 2Y5HA 4FUEA 4FUBA 1B0EA 1EATA 3EQ0H 2PGQB 7LPRA 3DA9B 1P10A 1IOEA 3GDVA 4I8JA 2A45B 2ZGCA 5T6DA 2Z94A 3RMOH 1ZGVA 4ESTE 1GCTB 1KTTB 2BDAA 2Z9KA 3M7TA 3PO1B 5JBAS 3ZZ7A 2F9NA 3K2UA 3A7WA 1LPKB 3LIWA 3HK6B 2ZZUH 4Q7ZA 2AGGX 1KTSB 4GHQA 2XBXA 3T28A 1PPBH 1HIAB 1J9CH 2TBSA 1Z71A 2Y7XA 3RXCA 1EPTA 1GBIA 1OKXA 1V2UT 3TH3H 1RFNA 1BTWA 2I6QA 1P2NA 5GPIB 3GYLB 2LPRA 5E2PA 4KELA 3BTGE 1UTQA 1XUGA 3A86A 3UR9A 1SGNE 3GY4A 1O2QA 1W13U 1TGTA 3TK6A 1P57B 2F83A 3RMMH 5EXLA 1BITA 1SPJA 5T6FA 2A4GA 3BEIB 2PTCE 1W11U 3RXJA 5F8TA 5C20A 3OYPA 1HYLA 1V2TT 1SGYE 3FVFB 2P3TB 1HJ8A 1FIZA 3FP8E 2SNVA 4FUHA 1JRTA 1WTGH 2P94A 1HAGE 4INKA 4B2AA 1KLTA 3RXKA 5ETXA 3V13A 2O8TA 1Y3YA 2FOEA 1SGIB 4A1XA 3B23B 1GJ9B 4CHAB 7GCHF 4CREA 2XBVA 1TPPA 1SMFE 2O8MA 2HRVA 1T7CA 2AGEX 3A85A 4AN7A 2GVFA 1Y5BT 4FU9A 2Y81A 2HLCA 2XBYA 1V2VT 1UO6A 3H5CB 4BTIB 1V2NT 1O3EA 1ETRH 1VCQA 1WAYB 1P3EA 2BLQA 4X1QU 1HDTH 1LVMA 2XRCA 1TOMH 2D2DA 1GBTA 5C1XA 1TNIA 5AFYH 1DLEA 1V2QT 1QR3E 4WMEA 3EAJA 1AVGH 5J4QA 1MAYA 1XUFA 1AFQB 1TABE 3BTHE 2VGCB 1IQKA 2V6NA 1SFIA 2V3OH 3VEQB 2ZU4A 3S9CA 1O2TA 1ZZZA 3E16B 1O3IA 1VCPA 4YZUA 2G5VA 4ABHA 4SGBE 3H7TA 1ESTA 1AVXA 4MPWA 5LGOA 1BBRH 4YOJA 1GL1A 1C5YB 1O2GH 2GT7A 5GJ4B 1RTKA 1MZDA 2GCHF 2ZA5A 2W7SA 4BXSA 1T4UH 3NZIA 5FPYA 1N8OB 1SC8U 4MDSA 1FAKH 1EJNA 4X2XA 4CR9A 3WY8A 2ZP0H 4Y0ZE 2C90B 4UFDH 2P3FH 2VIVA 1SGCA 1K1JA 3ZZ3A 4X2VA 3LT3A 3S9BA 1Z8RA 3UWJH 1EAWA 3BTWE 4LOYH 3P17H 2Q6GA 3UUZA 3GDSA 1EAUA 1TFXA 1UTLM 1XX9A 3PV4A 2BLWA 1ZPZA 4U2WA 1T31A 1VCWA 1FDPA 3SJ9A 2JETB 3GCNA 4GLYA 1O3JA 5GDSH 4ABIA 3MU5A 1QGFA 4FVDA 1O2ZA 3CS0A 3E3TA 4NFFA 5PTPA 1SSXA 2WPHS 3TGKE 1HRTH 3KQDA 3LU9B 1NTPA 1Y5UT 3M5LA 3F9EA 1MZAA 4E7NA 1EPTC 2ZPRA 1QCPA 2W3IA 1GI6A 1A0HB 1CVWH 2CF9H 1TX8A 3QWCH 1A1RA 1O30A 5C1UA 3LGTA 4TPIZ 1CO7E 2ZU1A 1MTUA 1TYNA 3Q3KA 2G4UA 1NC6A 1VR1H 2ZDNA 1YPLH 2FOAA 3UOPA 1V6DA 1ZR0A 1D6RA 1DT2A 4Y8ZA 3D65E 3JZ1B 1O0DH 3EGKH 4QT8C 1FAXA 2RCEA 1FMGA 4CRFA 3KQEA 1OP2A 1ZSLA 4NCYA 3PWCA 1ZRBA 1AGJA 1TGCA 1KSNA 3FZZA 1QBVH 5CMXH 2A7CA 1LPGB 1SOZA 3PMBB 1C1QA 2ANWA 3BSQA 3MHWU 4WF8A 1ESBA 2ZFTA 4ZHLU 3SW2B 3RU4E 3UNQA 3SNEA 4YLUA 1CA0C 2HNTE 1RS0A 4UFFH 3ZV9A 1NRNH 1GJCB 4FUJA 2PSYA 1EZXC 4CR5A 2B7DH 4MG3A 1Y3XA 2HPPH 2V35A 3CENA 1Y5AT 3TNTA 3UY9A 1A61H 1YPEH 2SGDE 4DCDA 3HKIB 2NU0E 1O2NA 5GCHF 1BRBE 1GG6C 2ZEBA 3ODDA 2Y5GA 2FPZA 3RXOA 2EI7A 3KL6A 2FYQA 1O3CA 1ZHRA 1C5LH 1ANCA 5DKMA 1O31A 1SVPA 2Z3CA 4X2YA 2H1UA 3TK5A 1SBWA 1XXDA 2XC0A 1BT7A 3ESTA 4IC5A 5ESBA 3OTJE 1KY9A 1BJVA 4FUFA 4X0WU 3STIA 4WH6A 3SJ8A 4CRAA 4OGXA 1YYY1 5FXLA 3A84A 2FYRA 1OP8A 1XXFA 2WV5A 1GI8B 1DWEH 2FP7B 1IAUA 1MCTA 1YGCH 4K8YA 3U8TH 1J8AA 4ZAEA 2GMTC 1O3PB 1SLVB 5IYTA 3PB1E 1GJ6A 3SGAE 1NN6A 4BNRA 1O5CB 4FXGH 4THNH 5DGJA 1SI5H 4OGYA 2J95A 1GDUA 2R0LA 5JBBS 2FTLE 3L6PA 1C5UA 1C5PA 3F9FA 2FTMA 2YNAA 2AYWA 1HXFH 3TH2H 1P02A 1O2UA 2ZFPH 2TGPZ 1INCA 1G3CA 4TY6A 5A09A 1UHBA 2AGIX 3RU4T 1EP6A 1DY9A 1XUIA 4Y7BA 2BD3A 3PROA 1ELDE 3TU7H 3S69A 1KXDA 4JYTA 4O9VA 5FX5A 5EGMA 2PTNA 5HXFA 1O2HA 3PMJA 3ZZ4A 1MTWA 2H6MA 2ODQA 4IN2A 1C5QA 2AIQA 3SOSA 4AYVB 4YTAA 1V2ST 2BY7X 2A2XH 3E90B 2BXTH 1J17T 1DFPA 4H42U 2C8ZB 4DT7B 1UVOA 2PWXA 2F3CE 1QBNA 3MH4A 1ZTJA 1GBHA 1DS2E 2VWLA 4JZ1A 1F92A 1C1VH 2OC8A 1P06A 1NFYA 2YNBA 3RC6A 4LZ1H 1QL7A 3A8BA 2PW8H 4X1SU 2FESH 1H4WA 1GJ8B 4TWYA 4WJG2 1GJDB 1QQUA 1WQSA 4A1TA 1P2IA 4ABFA 1GBDA 3SO3A 1NT1A 1QHRB 2BVRH 4Q7XA 1V2LT 1HIAA 3NWUA 4BXWA 1DITH 1XM1A 1QL9A 3ZZ6A 1PQ7A 1HJAC 2AS9A 1S82A 1EKBB 3SORA 4AB8A 2BZAA 1FV9A 2BOKA 1GJ7B 2UUKB 2ZGBH 3O8CA 1LVBA 1A5HA 4XBDA 4RN6A 4JZEH 1P2OA 3A8AA 2NU2E 2OINA 1TGSZ 4YLQH 3ZZCA 3P8GA 1Y3VA 4BAHB 2BB4A 2PR3A 4NIYA 1O2OA 4DIIH 2BLVA 2P8OB 2GCHG 1AY6H 1SL3A 3BTEE 1VZQH 2BZ6H 1MU6B 1FQ3A 3JZ2B 2ZCKP 3UPEA 5AHGH 2FOHA 2QN5T 1D9IA 1VJAU 3OSYA 2FOGA 4MNWA 4WXIA 3ZVCA 1ETSH 3SUGA 1C9TA 1C2DA 2W7UA 3A80A 4UD9H 3U8RH 1NU7B 1S85A 1AWFH 3ZVAA 2PKAB 4Y11E 2R3UA 2SNWA 1WYKA 1TNLA 1HAPH 3A8CA 2VVVA 3A87A 1OWIA 4KP0A 4DG4A 1HPGA 4I7YH 2BDCA 1XUHA 1P2QA 1C2LA 1IQHA 1OWDA 3KGPA 1F0UA 2OUAA 4MVNA 1B5GH 3F68H 1Q3XA 1FI8A 3B8JA 2UUJB 2ZU2A 3UOUA 3VB6A 1FY3A 3P8OA 3PMHB 3LH1A 2VIDA 2GTBA 1BUIA 2AH4X 4IBLH 2OQ5A 3GICB 3U9AH 3ZVFA 1HNEE 1WCZA 1Z7KA 1MD8A 4Z6AH 3BF6H 3U8OH 2FM2A 3S9AA 1C2JA 5DP5A 1O2IA 2FO9A 1NM6A 3PYHA 2QIQA 1G3EA 2ZFFH 4O03A 1IQLA 3EYDA 3ATLA 3SU1A 1SHYA 2FLBH 1LPZB 4OS6A 4OS2A 3SN8A 4I8GA 3SBKA 2BXUH 1GHWH 1C5MD 2NU1E 3QUMP 1TONA 1C2HA 4HTCH 1Z6EA 3GY3A 3Q76A 8GCHG 3U98H 3BV9B 3HKJB 4VGCB 4Q80A 3SUDA 1B7XB 1HJ9A 1BMAA 3KNXA 1P03A 2ZC9H 2BQ6B 1EZUC 1GCTC 2Y6TA 4D8NA 3PO1C 2QF3A 4NA9H 4GAWA 1BTXA 2A4OA 2GX4A 1DXPA 3DD2H 1BQYA 1AUJA 1Z8GA 1LHFH 4X8UH 1UTJA 2A7HA 1K21H 3KQCA 2STAE 1O39A 3SU2A 2HPQH 4XSKU 1S6HA 3RXSA 1LHEH 1BTPA 1F0TA 1FPHH 2WPLS 1AE5A 3SV8A 3S7HB 1C2FA 1A4WH 3MNXA 5F6MA 1IHSH 2Z3DA 2BD5A 1C5NH 2F9BH 2G4TA 2EA3A 4NFEA 1J15A 2D1JA 4RKOB 1TX6A 1ELGA 5JBCS 2A4QA 2FEQH 3SV9A 3MFJA 1KDQB 3S7KB 1T8MA 4ABEA 5AVDA 2F9VA 1P2KA 4ZKRU 1FN6A 1PPGE 1TB6H 1TGNA 2EC9H 1CBWB 4BAMB 2J4IA 1DWDH 3SU5A 2VIOA 1CT0E 4GPGA 1O3DA 1PQ5A 1SHHB 3FZDA 4CHAC 1L4ZA 1HAVA 1OYQA 2ZPQA 3A83A 1O36A 3ITIA 1EJAA 4OS1A 1V2MT 1AFEH 3RLYH 2Q6DA 1NRQH 1XVMA 1TA2A 3I78A 1AHTH 3T62A 2G55A 4OS7A 1P04A 4WWYA 4DURA 5L2YH 1O3GA 1NU9A 1SQTA 4AG1A 1YPJH 1EP5A 1BB0B 1MQ5A 1DICA 3R0FA 1F5KU 2C8XB 2Z9GA 3MNBA 4FU7A 2NWNA 1BTZA 1E37B 2F9PA 2WPIS 3U1IB 1D4PB 5C5OA 3M61U 4A1VA 1C2IA 1BRCE 4KGAA 3HK3B 3GISB 1AFQC 1GJ4H 1ZJKA 2RDLA 4IMZA 4KTCA 1ESAA 2VGCC 2F91A 2NU4E 2BVXH 5HMAA 4DGJA 3ODFA 3M3SA 3ZZBA 4AFZA 4DY7B 4TYDA 2AFQB 1EASA 4X8SH 3T26A 2V0BA 2ZPSA 1ZMJA 3SQEE 3RDZA 3C1KA 1TNGA 1UMAH 3MU8A 3SU0A 2J9NA 2PUQH 3BTTE 5LPRA 2HWLB 4CRGA 1UTNA 4K1TA 1UJ1A 3TIUA 3LOXA 4UEHH 2XNIA 3SNCA 1DANH 1RRKA 3OY5U 1UVPA 1SOTA 5FBIA 4HGCA 4TWWA 1SR5C 2WYJA 2CF8H 4B75A 1F2SE 2VWMA 3BEUA 1T32A 1TMTH 2H9TH 1IQNA 2VH6A 3VGCB 1BTYA 3EA7A 4K8BA 2BTCE 3UQVA 4ZUHA 3W95A 1MTNB 2Y82A 5JPMH 3SJIA 1LCYA 4LK4A 1DE7H 1W12U 2FOFA 4IS5A 2JKHA 3QX5H 3SI4H 3MU0A 2JETC 1T8OA 2SFAA 1UK2A 2BD4A 2P93A 3RC4A 3BTFE 1JWTA 1NFWA 2ZGHA 2ZGXH 3GCHB 1W7GH 2OCVB 3RXPA 1ETTH 2CGAA 1YP9A 1BTHH 1C4V2 4MPXA 3VB4A 4AZ2B 4BAOB 1C5SA 1K22H 1W2KH 2XC4A 5T6GA 3A88A 1QA0A 1MAXA 3Q00A 4X1RU 4X6OA 3PLKA 1C2EA 4WXVA 2Z3EA 1ZRKA 4XDEA 1YPGH 2PGBB 3RMNH 1C1TA 1ZMLA 2VIQA 1RGQA 4JYVH 1T8LA 5A8YA 3RXTA 1F5LA 1AWHB 5L6NH 2GGVB 1W8BH 1JXPA 1GHVH 2BY8X 1ANEA 1VITG 2ZTXA 4E06H 1YKTA 2PHBA 1DDJA 1UTKA 2WUCA 3ZZAA 2XCNA 4Y0YE 1GBLA 2UWOA 4DW2U 3SQHE 1YF4A 2AMQA 2OC0A 5C1YA 3BIUH 3EA8A 1EAIA 4NA8A 3UQOA 1ELEE 2VINA 1C2KA 2G51A 1N6YA 1GVKB 3RXRA 2VH0A 1Q2WA 5TJXA 1N1LA 3SI3H 1GMCF 4YT6H 5CHAB 2ZFRH 3RXMA 4K2YA 4ISLA 3LGWA 4AFSA 2GD4B 1S6FA 1CGJE 1IQIA 1W3CA 2QY0B 1AUTC 4FUDA 1QBOA 4AOQA 3TJNA 6GCHF 4E05H 1TRMA 3GY7A 3HGPA 1L2EA 4Y7AA 1O2MA 1GHYH 1PPHE 3FP6E 2PUXB 1QL8A 4K69A 1SG8B 3I29A 3OX7U 1V3XA 5GIBA 1O2VA 2SGFE 1GI4A 3Q3XA 2VVUA 3RXIA 2FS8A 1P12E 4K1SA 3RXUA 5C2ZA 1MCVA 1YLCA 1C1NA 3URCA 1E34B 3E6PH 5DP3A 2ZDKA 4BTUB 1P3CA 1UVUH 1ELCA 4AFQA 1K1NA 3BTKE 4BAKB 2C8WB 4X2WA 1JOUB 3QN7A 4BANB 5BRRE 1GI5A 1ZGIA 3LGYA 3LGIA 3A7VA 2R2MB 1HCGA 3M37A 4ZKNU 3AW0A 3RLWH 1O34A 4YESB 3EA9A 5FAHA 1VITH 1TLDA 1O3FA 8GCHF 1EOJA 4K60A 2KAIA 3BN9A 1P9SA 5B6OA 1FONA 1ZJDA 1UCYE 2CXVA 2A1DB 4K3JA 3UREA 2RG3A 5HM9A 4Y10E 3RM2H 5LH8A 1C1WH 1HBTH 1SLUB 3PLPA 3F6UH 3GY8A 1EXFA 5CE1A 1C5VA 3QDZB 1EJMA 3KIDU 1MKXK 3M7UA 5EOKA 4JK6A 3NXPA 3LJOA 4AX9H 4NG9H 1HAYB 3KHVA 1AE8H 1O2YA 1QURH 5EXNA 2TGDA 1TX7A 3CP7A 2GDDA 4XBCA 3TJOA 1YCPM 4AYYB 1ELFA 4KTUA 1Z8IB 3QGJA 1V2PT 5EG4A 1AZZA 1SGEE 2GZ7A 4JZIA 1BMLA 4MNYA 1EZQA 2ULLA 1C4U2 5A8XA 3T5FH 5EPYA 5C3NA 1V2RT 2VVCA 1CHGA 1TQ0B 2A7JA 1LQDB 2PV9B 4YO9A 3RXBA 3FANA 3HGNA 2GV6A 3B9FH 3V0XA 2SGAA 1RTLA 4NGAH 1A7SA 1GVLA 2NU3E 1AKSA 4R0IA 3A8DA 2DUCA 3FFGA 1O38A 1G9IE 4PROA 1BRAA 3SV7A 1EUFA 1TRYA 3GY2A 1EOLA 5DP9A 5EW1H 3TITA 2ZHQH 1ARBA 4GSOA 1KDQA 3RMLH 3LJJA 5LPFA 2ZDAH 4X8TH 3SJKA 1HAHH 1ZLRA 2P8OC 1GBEA 2D8WA 1KYNA 1C5XB 3V3MA 4GCHG 4ZKOU 2ODYB 2J2UA 3MU1A 1QIXB 1D6WA 2P95A 2WPKS 1EB1H 1F0SA 2ANYA 1A2CH 1KLJH 1RIWB 5A0BA 3SNAA 4ABAA 3MNCA 1H8IH 2XYAA 1TBZH 3LC5A 2SGPE 3PMAB 2A31A 2BX4A 1YM0A 2FZZA 5FPTA 1K1OA 1BRUP 1UTPA 6CHAB 1K9OE 1PJPA 1SQOA 2TRMA 4ABGA 1O5AB 2QYIA 4O3UA 2DE9A 9LPRA 4CRDA 1L1NA 5TCAA 1DWCH 3URDA 1NS3A 2ZDVH 3DT0H 1O5EH 3PTBA 1LMWB 2Z7FE 4FUGA 2R2WU 1ACBE 1O3NA 1BBRE 1GBFA 4X6NA 1JIRA 4I8HA 3D49H 1BA8B 1FPCH 1OWEA 3SU3A 3K65B 4MNXA 1HAOH 2TGTA 3P92A 3ZVGA 1DSTA 4NIWA 4IGDA 1DSUA 2BQ7B 1O3OA 4F4OC 5DG6A 1ZSKA 2H9HA 1OYTH 3MNSA 4ZHAA 5K0HA 1Q31A 1A5GH 2GCTB 3M5MA 2QF0A 1VGCB 3SNBA 2Z9LA 1TIOA 2TIOA 3A81A 3RXQA 1H1BA 5EU8A 1G32B 1EAXA 1YPKH 5EQQA 5GXPA 2Y80A 3ATIA 1IQMA 1O2JA 1AD8H 4XFQA 2ZG0H 1ELBA 3AAUA 2PSXA 1QJ6B 2VIWA 3A7XA 1QQ4A 2P16A 3F9GA 1DLKB 3QGNB 4VGCC 1CGIE 3ELAH 3E91A 1CQQA 2ZO3H 3LH3A 1ELTA 2OBQA 3RP2A 1GBMA 4ZROA 3F9HA 4Y76A 2G00A 1GDNA 1FIWA 1UK4A 1W0ZU 3H7OA 1S81A 1WTHD 1OWJA 2QA9E 5E2OA 1GI2A 1G3BA 2ZGJA 3VFEA 1GMCG 2J38A 5DP7A 4JK5A 1J14A 5F03A 4F49A 1FJSA 1ANDA 2PFEA 1BZXE 4ISHH 2BY9X 1O35A 1FY5A 1F5RA 1OXGA 1PPCE 4WVPE 1QNJA 2VJ1A 1TGBA 5JB9S 2OLGA 3GCTF 6GCHG 4GUXA 4HI3A 4JZFH 5JB8S 1VITF 4B76A 1K1MA 3T27A 3LONA 1AVWA 2BY6X 1YBWA 3K6ZA 2BVSH 3ATKA 1GPZA 3ZYEA 2XW9A 4H4FA 2RA3A 3KN2A 4NZQA 1E0FD 3ZVBA 4KKDA 1SLXB 3LPRA 3GY5A 3ZVDA 1GBKA 2F9OA 1DUAA 1NPMA 1LKAA 5K7RA 1W10U 1PPZA 1O2XA 1HV7A 4IC6A 2R3YA 1BTUA 1FY1A 2QC2A 1NFUA 4K1EA 1VJ9U 5L2ZH 1MU8B 3OY6U 1PQAA 1D3PB 5F8ZA 4H6SB 1MKXH 1LQEA 1MH0A 1CBWC 2O8UA 2W5EA 1JMOH 5H4IB 5JDUB 1O2SA 3UNSA 1WSSH 1GGDB 1GBCA 2QAAA 1G30B 2UWLA 4Y6DA 2FX6A 4BAQB 2B5TB 3NK8A 1HLTH 2ZECA 3D23A 3A82A 1O5DH 1IQEA 3BG4B 2D26C 1GMDG 1Y3UA 1LVOA 2ZDLA 2PKSB 3V7TA 3R3GB 1ELAA 1MKWK 3NPSA 3TPIZ 8KME2 2G81E 1IQJA 4B71A 1F7ZA 3AW1A 3K6YA 2GT8A 5E0JA 1W7XH 1EZSC 3IWMA 1GHXH 1TPOA 1P05A 1TNHA 4NIVA 3LC3A 3O8DA 2O8WA 2XXLA 3CS7A 2BD9A 1UTMA 1SQAA 5EODA 1P9UA 1O2LA 1XUJA 3I77A 2FIRH 1TALA 3P8FA 1NROH 3UWIA 1CSOE 2EI6A 6ESTA 1CGHA 2PLXA 2ZTYA 1P8VC 3RXEA 4YOGA 4AORA 7ESTE 3RU4D 3QTVH 2Z9JA 1KXAA 2W3KA 3SU4A 1TNJA 2SGEE 2ZIQH 1GI0A 1NESE 3W94A 1WQVH 3SGQE 2EI8A 5C67A 4UDWH 4CRCA 2OBOA 5J4SA 4WMDA 2ZU3A 1OWKA 3QLPH 1TMBH 1H8DH 1C5WB 1MD7A 2FLRH 1NO9H 1X7AC 1C9PA 1CU1A 2HOBA 1HAXB 2ZNKH 1NZQH 3VGCC 3Q77A 1CHOG 2ZU5A 2AMDA 2C93B 1GI1A 3MO6A 4Z0KA 3SJOA 1QFKH 3ENSB 1IQGA 3BTME 3UIRA 2FOCA 4JYUH 1AB9B 1MTSA 1MTNC 1TMUH 2ZHFH 4X6PA 3DFLA 3RXFA 2Q1JA 1C5OH 3SUFA 3M3VA 2C8YB 2CHAB 2ZCLP 4CBNA 4DVAU 1C4Y2 3MO9A 4ISNA 3BEFB 3GCHC 4JMYA 3P70B 1AU8A 5G4BA 1O3BA 3QK1A 2AERH 1BMNH 5I46H 9ESTA 1A0JA 2F9UA 4AFUA 4IMQA 3QZQA 2QXIA 1HAZB 1ZOMA 1RTFB 4KTSA 1L1JA 3O8BA 3D62A 2ZTZA 3MOCA 1K1IA 1O2KA 4FU8A 1NY22 1FNIA 5DO4H 1LO6A 1C2MA 4A6LA 1DOJA 4D7FA 1IQFA 5LPEA 4D7GA 1DY8A 1ABJH 5EQSA 3PTNA 3BG8A 1G3DA 3GDUA 3MH7A 2Y5FA 2GZ8A 1C5ZB 1NRRH 1GHBF 1TE0A 5AF9H 1U6QA 1TAWA 1SFQB 4GCHF 3AAVA 1DXWA 1GJAB 2C3SA 2P3UB 1N8OC 7KMEH 1KLIH
chains in the Genus database with same CATH superfamily
3P6ZB 4ZCNA 1AI8H 1QJ7B 1L0ZA 3QZRA 3KYGA 4X1PU 4Q4LA 3RXDA 3TVJB 4ZMAH 5E0GA 4UE7H 1E36B 3F1SB 2EY4C 3SNDA 5SGAE 1MQ6A 1S84A 4M7GA 1GJ5H 5CHAC 3BIVH 4P00A 2K0QA 3RUOA 2ASUB 1KXEA 3T25A 1E1RD 1QRZA 1ZPCA 4E7RG 1YPMH 1O3MA 2G5NA 3DFJA 1THSH 3GOVB 2R9PA 3SGBE 3O8RA 1OOKB 5EPNA 1YCPK 5DP8A 3SU6A 4YOIA 8ESTE 1C5RA 1N6XA 1JBUH 4OS4A 4I31A 3M5OA 1O5FH 2ALPA 3GCOA 3ZZ5A 4R8TB 3NCLA 1OS8A 1CA8B 4BTTB 5JBTA 2FMJA 4LXBH 3AVZA 3SV2H 3MH5A 3UTUH 1DX5M 4XD7D 2ZDMA 1FLEE 1O33A 3N7OA 2OXSA 2GP9B 2B0FA 1C5TA 4HZHA 4ABJA 1KXBA 4GVUA 4JCNA 3T2NA 2AEIH 1PQ8A 2Q6FA 1S83A 4FUIA 1O3LA 4ACAA 2CK3D 3E0NB 3M35A 2HGTH 3GCTG 1RD3B 2BX3A 1HXEH 2BQWB 3U28C 1QRWA 1O3HA 4OM9A 3MH6A 2KCYA 2Z6BD 3FP7E 3F2HA 3KF2A 4LZ4B 5AFZH 1GMHF 4UFGH 4WMFA 2BD8A 1GBBA 2SGQE 3L3TA 2RA0A 1GHAF 1YPHE 1GVZA 2WYGA 3TJVA 2K1QA 1NRPH 1HB0B 1OWHA 1A3BH 1L1GA 2ZFQH 1XKBC 5JYIA 2UUFB 4TY7A 2FXRA 4AGKA 4ZXYH 1SGPE 3LGUA 3E8LA 1GBJA 1PYTD 1P2MA 4RI0A 3RXGA 1MKWH 2RDEA 5L30H 4ZXXH 2ALVA 2WHXA 6LPRA 1S0RA 4YT7H 2XCFA 3NKKA 1NRSH 4J2YB 1O2RA 2VB0A 2QCYA 3ZV8A 5FPSA 4I33A 4ISOA 1UTOA 1GHZA 3ZYDA 4B74A 1WBGB 1G2MA 1RXPA 1SGDE 3MWIU 4D9QA 4A7IB 1SB1H 1BCUH 2FI3E 4B2CA 1SGTA 3STJA 3G01A 4GHTA 1WUNH 4FVBA 3TGIE 3Q3YA 1DM4B 2BDIA 2PKAA 2JH0D 4CRBA 1G37A 3RC5A 4U01A 2I6SA 1HGTH 1T8NA 1ZMNA 3DHKH 3TJUA 2GJGA 2QXGA 5ESTE 2OD3B 1WOFA 3F0OA 4ASHA 2WPJS 2ANKH 4NWKA 4XBBA 3PV2A 1P01A 1ZYOA 4JZDH 3PLBA 1Z8JB 2A5IA 1KIGH 1LHCH 1D3DB 4RKJB 1SGQE 4FUCA 1CT4E 2YOLA 1OSSA 1Y59T 1EX3A 5FBEA 1XUKA 1EQ9A 2QV1A 2GKVE 3BTQE 2LNCA 2ZWLH 3VB3A 2CJIA 4B2BA 4MNVA 2B8OH 4OS5A 1C1PA 3VXEH 2YMSC 1ID5H 1UK3A 1GMDF 1K28D 1LHDH 1ZTLA 3VB7A 1O37A 1O5GH 1YPHC 2HNTF 4ABDA 4INLA 2FOBA 1Y8TA 3TH4H 3M3TA 2BDHA 1O2PA 2ZCHP 3ZZDA 4D76A 2STBE 2VU8E 3OFND 3U1JB 5C94A 1P0SH 1ZSJA 1QB9A 2BY5X 2OP9A 1RIWC 5BPEA 2UUYA 1HAVB 1TRNA 2BLOA 3OEHD 2QXJA 2H2ZA 3M7QA 1C2GA 4I32A 4A92A 5IDKA 1W0YH 5DK1A 4AB9A 1L4DA 1V2WT 2V3HH 6CHAC 3OU0A 1YC0A 4HG6A 4U30A 3K9XB 1E35B 3RXVA 1BJUA 5E0HA 3RXAA 4Q7YA 4NIXA 3A89A 1V2OT 1SGFG 2ZHWH 2AIPA 4ABBA 5FHTA 3L33A 1KXCA 4MPVA 3SHCH 2W26A 5ABWA 1OPHB 4MTBA 2OQUA 1E38B 3M5NA 4Y8XA 5TCCA 2P59A 2M5TA 2TGAA 1S0QA 2XOKD 3U69H 3TNSA 3SUEA 1WU1A 1A5IA 1EPTB 2A5AA 1ELVA 4CH8B 3LKWA 2BOHB 1K1LA 2QF4A 1CHOF 2GCTC 3CNRA 1VGCC 2IN2A 3TGJE 3DUXH 1A0LA 2C4FH 2A4RA 1QRXA 1O32A 2BD7A 2GZ9A 1GI3A 3SZNA 3A7TA 4X8VH 1V2JT 5A2MH 3UFAA 3FOAA 2BDGA 2HVXA 2OTVA 2TPIZ 1QTFA 1TQ7B 1FUJA 1GJBB 3ZVEA 1GHBG 1BOQA 1H9HE 1P11E 5HIZA 4Q2KA 1YCPH 2R0KA 3E1XB 3LDXH 1JIMA 3P95A 2KCOA 4ASUD 4K5ZA 4NWLA 5HKKD 2GDEH 2WPDD 1OHHD 4NSVA 3SHAH 2VWNA 3MO3A 1GL0E 1CA0B 1H9LB 4TPYA 2HALA 3M36A 2J94A 1LHGH 1B0FA 1ABIH 1DWBH 2IPQX 2ZFSA 2HNTC 4DOQA 5C5NA 2J98A 4H6TA 2Y7ZA 4UONA 4AG2A 3PWBA 4FETA 1QJ1B 1LTOA 1TA6A 1FY4A 2H5DA 1GG6B 2WUBA 4NSYA 3HPTB 3TLOA 1MBQA 1UCYK 4B6EA 4MLFB 2A5KA 4NZLA 3ATMA 7GCHG 1K2I1 1K1PA 4I86A 1BMMH 3VPKA 4SGAE 5EXMA 4Y8YA 3RM0H 2JIZD 4MQAA 1P09A 3IITA 1QB1A 1FZZA 4X6MA 5EJZA 4XOJA 1C1SA 1EB2A 1T4VH 2J92A 1TWXB 1BHXF 1O3KA 1UVTH 2WV9A 2IPHA 4NA7A 1GWAA 1LVYA 2O8LA 2ILNA 1P2JA 5DP4A 1F0RA 2GMTB 2VNTA 3C27B 5FCRA 3MTYA 1DPOA 2BDYA 2QE7D 3RXHA 4CH2B 3HATH 1FN8A 1PFXC 2BD2A 3E0PB 1GGDC 2JH6D 4AGJA 1GMHG 3MMGA 3V12A 1BIOA 3EE0B 1GHAG 4P02A 2J34A 2JH5D 1MUEB 3ZZ9A 1V2KT 2WINI 3BG4C 2ZHDA 3TK9A 2XWAA 3GYMA 1O5BB 2OC7A 2DE8A 2PKSC 3UNRA 1GDQA 1D3TB 1OX1A 2KR7A 1TOCB 1ZTKA 4ISIH 3EE7A 1GBAA 2H9EH 3AASA 2BDBA 2FWWA 5A0AE 2XBWA 4ZHMU 4RSPA 3S0NA 4J1YA 1PPEE 4I8LA 1BDAA 2YMSD 2A32A 3MI4A 3PRDA 1LKBA 5C0UA 5A8ZA 5EW2H 3MU4A 2FDAA 3KCGH 3SV6A 2ZQ1A 4B73A 8LPRA 4UFEH 1Z1IA 2XTTB 1QY6A 4INHA 3N99A 2AMPA 4DJZB 5FCKA 1ORFA 1C1UH 2H5CA 1THPB 3VB5A 2IJOB 2BYAX 2VWOA 1HUTH 3BTDE 1YLDA 5HYOA 1D3QB 1ZHPA 4IW4E 4A5TS 3P8NA 1XVOA 1TNKA 4CBOA 2WPMS 4O3TA 4XE4A 2FI4E 1HAIH 1W14U 1AN1E 4U32A 1O3AA 1C1OA 1RJXB 3ATWA 2JJ1D 3KQ5A 1FY8E 5E8EH 3ZZ8A 2Z9IA 3FN8A 2KX4A 1C1MA 1Z6JH 1MMJN 1HJAB 1J16A 5HGGA 1MTVA 2ANMH 3F2FA 2A2QH 1AB9C 2KAIB 1M9UA 3T29A 5T1VA 2ESTE 3UR6A 1G36A 2BMGB 1DUEA 2THFB 3N7DA 2CHAC 1A3EH 1AZ8A 1BBRK 2ZKSA 4O97A 1LDTT 2XC5A 3PM3A 4BOHA 2FOMB 1XKAC 3A7YA 5FX6A 1THRH 1TBQH 2KFWA 2CV3A 3A7ZA 5F8XA 1IHTH 2GV7A 4D9RA 1G2LA 3FAOA 1KXFA 1NFXA 1W0KD 2ODPA 1CT2E 1ZPBA 2UWPA 2ZF0H 3WWFA 2CN0H 1AIXH 1TPSA 2IOTA 1AO5A 1JRSA 2FODA 1QB6A 1XMNB 2F43B 1SLWB 1Z1JA 3NRLA 1PYTC 1MBMA 4B1TA 4YM9A 4Y71A 5A0CA 2ZQ2A 5I25A 1ANBA 1DVAH 1GI9B 3KQBA 5GCHG 5GWZA 3GY6A 1SGFA 2FS9A 2ZI2H 2QXHA 4WH8A 4Y79A 1TPAE 2XWBI 1S5SA 2G8TA 3MYWA 1GI7B 2B9LA 1FXYA 4MPUA 1Y3WA 4ZKSU 1GCDA 1QA7A 3VXFH 3N7EA 2A0QB 1WV7H 1AKSB 5DJ7A 3QO6A 4M9FA 1ARCA 1A46H 3IG6B 3QTOH 4ZH8A 1UVSH 4Z1MD 3LGVA 5EQRA 4HFPB 1PPFE 2OC1A 4DIHH 1O2WA 3EDXB 1AMHA 2CMYA 1AQ7A 1OP0A 4X1NU 2WV4A 4I8KA 1UHBB 2EEKA 1CE5A 5DP6A 1BHXB 2BHGA 1SGRE 2FX4A 1HFDA 2O9QA 2BM2A 1C1RA 1TBRH 4RT1A 2FI5E 1ZHMA 2ZHEH 4IN1A 4WY3A 1H9IE 5T3HA 2VIPA 2QGRA 2G52A 4TT3D 1UCYH 3NUMA 5DPAA 5HM2A 3KEEA 5DSFA 2WSSD 3RXLA 2Y5HA 4FUEA 4FUBA 1B0EA 1EATA 3EQ0H 2PGQB 7LPRA 3DA9B 4AC9A 1P10A 1IOEA 3GDVA 4I8JA 2A45B 2QF5A 2ZGCA 5T6DA 2Z94A 3RMOH 1ZGVA 4ESTE 1GCTB 1KTTB 2BDAA 2Z9KA 3M7TA 3PO1B 3DSGA 5JBAS 3ZZ7A 2F9NA 3K2UA 3A7WA 1LPKB 3LIWA 3HK6B 2ZZUH 4Q7ZA 2AGGX 1KTSB 1BMFD 4GHQA 2XBXA 3T28A 1PPBH 1HIAB 1J9CH 2TBSA 1Z71A 2Y7XA 3RXCA 1EPTA 1GBIA 1OKXA 1V2UT 3TH3H 1RFNA 1BTWA 2I6QA 1P2NA 5GPIB 3GYLB 2LPRA 5E2PA 4KELA 3BTGE 1UTQA 1XUGA 3A86A 2OK5A 1SGNE 3UR9A 3GY4A 1O2QA 1W13U 1TGTA 3TK6A 1P57B 2F83A 3RMMH 5EXLA 1BITA 1SPJA 5T6FA 2A4GA 3BEIB 2PTCE 1W11U 3RXJA 5F8TA 5C20A 3OYPA 1HYLA 1V2TT 1SGYE 3FVFB 2P3TB 1HJ8A 1FIZA 3FP8E 2SNVA 4FUHA 1JRTA 1WTGH 2P94A 1HAGE 4INKA 4B2AA 1KLTA 3RXKA 2JJ2D 5ETXA 3V13A 2O8TA 1Y3YA 2FOEA 1SGIB 4A1XA 3B23B 1GJ9B 4CHAB 7GCHF 4CREA 2XBVA 1TPPA 1SMFE 2O8MA 2HRVA 1T7CA 2AGEX 3A85A 4AN7A 2GVFA 1Y5BT 3DSOA 4FU9A 2Y81A 2HLCA 2XBYA 1V2VT 1UO6A 5EJ1A 3H5CB 4BTIB 1V2NT 1O3EA 1ETRH 1VCQA 1WAYB 1P3EA 2BLQA 4X1QU 1HDTH 1LVMA 2XRCA 1TOMH 2D2DA 1GBTA 5C1XA 1TNIA 5AFYH 1DLEA 1V2QT 5GNDA 1QR3E 5FL7D 4WMEA 2XNDD 3EAJA 1AVGH 5J4QA 1MAYA 1XUFA 1AFQB 1TABE 3BTHE 1SQRA 2VGCB 1IQKA 2V6NA 1SFIA 2V3OH 3VEQB 2ZU4A 3S9CA 4B6FA 1O2TA 1ZZZA 3E16B 1O3IA 1VCPA 4YZUA 2G5VA 4ABHA 4SGBE 2IJD1 1SKYE 3H7TA 1ESTA 2AHME 1AVXA 4MPWA 5LGOA 1WXRA 1BBRH 4YOJA 1GL1A 1C5YB 1O2GH 2GT7A 5GJ4B 1RTKA 1MZDA 2GCHF 2ZA5A 2W7SA 4BXSA 1T4UH 3NZIA 5FPYA 1N8OB 1SC8U 4MDSA 1FAKH 1EJNA 4X2XA 4CR9A 3WY8A 2ZP0H 4Y0ZE 2C90B 4UFDH 2P3FH 2VIVA 1SGCA 1K1JA 3ZZ3A 4X2VA 3LT3A 3S9BA 1Z8RA 3UWJH 1EAWA 3BTWE 4LOYH 3P17H 2Q6GA 3UUZA 3GDSA 1EAUA 1TFXA 1UTLM 1XX9A 3PV4A 2BLWA 1ZPZA 4U2WA 1T31A 1VCWA 1FDPA 3SJ9A 2JETB 2V7QD 3GCNA 4GLYA 1O3JA 5GDSH 4ABIA 3MU5A 1QGFA 2F4LA 4FVDA 1O2ZA 3CS0A 3E3TA 4NFFA 5PTPA 1SSXA 2WPHS 3TGKE 1HRTH 3KQDA 3LU9B 1NTPA 1Y5UT 3M5LA 3F9EA 1MZAA 4E7NA 1EPTC 2ZPRA 1E79D 1QCPA 2W3IA 1GI6A 1A0HB 1CVWH 2CF9H 1TX8A 3QWCH 1A1RA 1O30A 5C1UA 3LGTA 4TPIZ 1CO7E 2ZU1A 1MTUA 1TYNA 3Q3KA 5CDFE 2G4UA 1NC6A 1VR1H 2ZDNA 1YPLH 2FOAA 3UOPA 1V6DA 1ZR0A 1D6RA 1DT2A 4Y8ZA 3D65E 3JZ1B 1O0DH 3EGKH 4QT8C 1FAXA 2RCEA 1FMGA 4CRFA 3KQEA 1OP2A 1ZSLA 4NCYA 3PWCA 1ZRBA 1AGJA 1TGCA 1KSNA 5KGOA 3FZZA 1QBVH 5CMXH 1YWUA 2A7CA 1LPGB 1SOZA 3PMBB 1C1QA 2ANWA 3BSQA 3MHWU 4WF8A 1ESBA 2ZFTA 4ZHLU 3SW2B 3RU4E 3UNQA 3SNEA 4YLUA 1CA0C 2EQNA 1RS0A 2HNTE 4UFFH 2LP6A 3ZV9A 1NRNH 1GJCB 2WZQA 4FUJA 2PSYA 1EZXC 4CR5A 2B7DH 4MG3A 1Y3XA 2HPPH 2V35A 3CENA 1Y5AT 3TNTA 3UY9A 1A61H 1YPEH 2SGDE 4DCDA 3HKIB 2NU0E 1O2NA 5GCHF 1BRBE 1GG6C 2ZEBA 3ODDA 2Y5GA 2FPZA 3RXOA 2EI7A 3KL6A 2FYQA 1O3CA 1ZHRA 1C5LH 2LELA 1ANCA 5DKMA 1O31A 1SVPA 2Z3CA 4X2YA 2H1UA 3TK5A 1SBWA 1XXDA 2XC0A 1BT7A 3ESTA 4IC5A 5ESBA 3OTJE 1KY9A 1BJVA 4FUFA 4X0WU 3STIA 4WH6A 3SJ8A 4CRAA 4OGXA 1YYY1 5FXLA 3A84A 2FYRA 1OP8A 1XXFA 2WV5A 1GI8B 1DWEH 2FP7B 1IAUA 1MCTA 1YGCH 4K8YA 3U8TH 1J8AA 4ZAEA 2GMTC 1O3PB 1SLVB 5IYTA 3PB1E 1GJ6A 3SGAE 1NN6A 4BNRA 1O5CB 1KMHB 4FXGH 4THNH 5DGJA 1SI5H 4OGYA 2J95A 1GDUA 2R0LA 5JBBS 2FTLE 3L6PA 1C5UA 1C5PA 3F9FA 3MQKC 2FTMA 2YNAA 2AYWA 1HXFH 3TH2H 5EIYA 1P02A 1O2UA 2ZFPH 2TGPZ 1INCA 1G3CA 4TY6A 5A09A 1UHBA 2AGIX 3RU4T 1EP6A 3GS9A 1DY9A 1XUIA 4Y7BA 2BD3A 3PROA 1ELDE 3TU7H 3S69A 1KXDA 4JYTA 4O9VA 5FX5A 5EGMA 2PTNA 5HXFA 1O2HA 3PMJA 3ZZ4A 1MTWA 2H6MA 2ODQA 4IN2A 1C5QA 2AIQA 3SOSA 4AYVB 4YTAA 1V2ST 2BY7X 2A2XH 3E90B 2BXTH 1J17T 1DFPA 4H42U 2C8ZB 4DT7B 5DN6D 1UVOA 2PWXA 2F3CE 1QBNA 3MH4A 1ZTJA 1GBHA 1DS2E 2VWLA 4JZ1A 1F92A 2KM0A 1C1VH 2OC8A 1P06A 1NFYA 2YNBA 3RC6A 4LZ1H 1QL7A 3A8BA 2PW8H 4X1SU 2FESH 1H4WA 1GJ8B 1WDIA 4TWYA 4WJG2 1GJDB 1QQUA 1WQSA 4A1TA 3PV5A 1P2IA 4ABFA 1GBDA 3SO3A 1NT1A 1QHRB 2BVRH 4Q7XA 1V2LT 1HIAA 3NWUA 4BXWA 1DITH 1XM1A 1QL9A 3ZZ6A 1PQ7A 1HJAC 2AS9A 1S82A 1EKBB 3SORA 4AB8A 2BZAA 1FV9A 2BOKA 1GJ7B 2UUKB 2ZGBH 3O8CA 1LVBA 2J97A 1A5HA 4XBDA 4RN6A 4JZEH 1P2OA 3A8AA 2NU2E 2OINA 1TGSZ 4YLQH 3ZZCA 3P8GA 1YLNA 1Y3VA 4BAHB 2BB4A 2PR3A 4NIYA 1O2OA 4DIIH 3SYJA 2BLVA 2P8OB 2GCHG 1AY6H 1SL3A 3BTEE 1VZQH 2BZ6H 1MU6B 1FQ3A 3JZ2B 2ZCKP 3UPEA 5AHGH 2FOHA 2QN5T 1D9IA 1VJAU 3OSYA 2FOGA 4MNWA 4WXIA 3ZVCA 1ETSH 3SUGA 5CHBA 1C9TA 1C2DA 2W7UA 3A80A 4UD9H 3U8RH 1NU7B 1S85A 1AWFH 3ZVAA 2PKAB 4Y11E 2R3UA 1QZ8A 1H8HD 2SNWA 1WYKA 4YXWD 1TNLA 1HAPH 4XRNA 3A8CA 2VVVA 3A87A 1OWIA 4KP0A 4DG4A 1HPGA 4I7YH 2BDCA 1XUHA 1P2QA 1C2LA 1IQHA 1OWDA 3KGPA 1F0UA 2OUAA 4MVNA 1B5GH 3F68H 1Q3XA 1FI8A 3B8JA 5EJLA 2UUJB 2ZU2A 3UOUA 3VB6A 3F0PA 1FY3A 3P8OA 3PMHB 3LH1A 2VIDA 2GTBA 1BUIA 2AH4X 4IBLH 2OQ5A 3GICB 3U9AH 3ZVFA 1HNEE 1WCZA 1Z7KA 1MD8A 4Z6AH 3BF6H 3U8OH 2FM2A 3S9AA 1C2JA 5DP5A 1O2IA 2FO9A 1NM6A 3PYHA 2QIQA 1G3EA 2ZFFH 4O03A 1IQLA 3EYDA 3ATLA 3SU1A 1SHYA 2FLBH 1LPZB 4OS6A 4OS2A 3SN8A 4I8GA 3SBKA 2BXUH 1GHWH 1C5MD 2NU1E 3QUMP 1TONA 1C2HA 4HTCH 1Z6EA 3GY3A 3Q76A 8GCHG 3U98H 3BV9B 3HKJB 4VGCB 4Q80A 3SUDA 1B7XB 1HJ9A 1BMAA 2L74A 3KNXA 1P03A 2ZC9H 2BQ6B 1EZUC 1GCTC 2Y6TA 3F2GA 4D8NA 3PO1C 2QF3A 4NA9H 4GAWA 1BTXA 3F3BA 2A4OA 2GX4A 1DXPA 3DD2H 1BQYA 1AUJA 1Z8GA 1LHFH 3DCLA 4X8UH 1UTJA 2A7HA 1K21H 3KQCA 2STAE 1O39A 3SU2A 2HPQH 4XSKU 1S6HA 3RXSA 1LHEH 1BTPA 1F0TA 1FPHH 2WPLS 1AE5A 3SV8A 3S7HB 1C2FA 1A4WH 3MNXA 5F6MA 1IHSH 2Z3DA 2BD5A 1C5NH 2F9BH 2G4TA 2EA3A 4NFEA 1J15A 2D1JA 4RKOB 1TX6A 1ELGA 5JBCS 2A4QA 2FEQH 3SV9A 3MFJA 1KDQB 3S7KB 1T8MA 4ABEA 3FO8D 5AVDA 2F9VA 1P2KA 4ZKRU 1FN6A 1PPGE 1TB6H 1TGNA 2EC9H 1CBWB 4BAMB 2J4IA 1DWDH 3SU5A 2VIOA 1CT0E 4GPGA 1O3DA 1PQ5A 1SHHB 3FZDA 4CHAC 1L4ZA 1HAVA 1OYQA 2ZPQA 3A83A 1O36A 3ITIA 1EJAA 4OS1A 1V2MT 1AFEH 3RLYH 2Q6DA 1NRQH 1XVMA 1TA2A 1W0JD 3I78A 4DT4A 1AHTH 3T62A 2G55A 4OS7A 1P04A 4WWYA 4DURA 5L2YH 1O3GA 1NU9A 2J98B 1SQTA 4AG1A 1YPJH 1EP5A 1BB0B 1MQ5A 1DICA 3R0FA 1F5KU 2C8XB 2Z9GA 2J5UA 3MNBA 2NWNA 4FU7A 1BTZA 1E37B 2F9PA 2WPIS 3U1IB 1D4PB 5C5OA 3M61U 4A1VA 1C2IA 1BRCE 4KGAA 3HK3B 3GISB 1AFQC 1GJ4H 1ZJKA 2RDLA 4IMZA 4KTCA 1ESAA 2VGCC 2F91A 2NU4E 2BVXH 1EFRD 5HMAA 4DGJA 3ODFA 3M3SA 3ZZBA 4AFZA 4DY7B 4TYDA 2AFQB 1EASA 4X8SH 3T26A 2V0BA 2ZPSA 1ZMJA 3SQEE 3RDZA 3C1KA 1TNGA 1UMAH 3MU8A 3SU0A 2J9NA 2PUQH 3BTTE 5LPRA 2HWLB 4CRGA 1UTNA 4K1TA 1UJ1A 3TIUA 3LOXA 4UEHH 2XNIA 3SNCA 1FX0B 1DANH 2KCAA 1RRKA 3OY5U 1UVPA 1SOTA 5FBIA 4HGCA 4TWWA 1SR5C 2WYJA 2CF8H 4B75A 1F2SE 2VWMA 3W1EA 2M2AA 3BEUA 1T32A 1TMTH 2H9TH 1IQNA 2VH6A 3VGCB 1BTYA 3EA7A 4K8BA 2BTCE 3UQVA 4ZUHA 3W95A 1MTNB 2Y82A 5JPMH 3SJIA 1LCYA 4LK4A 1DE7H 1W12U 2FOFA 4IS5A 2JKHA 3QX5H 3SI4H 3MU0A 2JETC 1T8OA 2SFAA 1UK2A 2BD4A 2P93A 3RC4A 3BTFE 1JWTA 1NFWA 2ZGHA 2ZGXH 3GCHB 3VG8A 1W7GH 3DSPA 2OCVB 3RXPA 1ETTH 2CGAA 1YP9A 1BTHH 1C4V2 4MPXA 3VB4A 4AZ2B 4BAOB 1C5SA 1K22H 1W2KH 2XC4A 5T6GA 3A88A 1QA0A 1MAXA 3Q00A 4X1RU 4X6OA 3PLKA 1C2EA 4WXVA 2Z3EA 1ZRKA 4XDEA 1YPGH 2PGBB 3RMNH 1C1TA 1ZMLA 2VIQA 1RGQA 4JYVH 1T8LA 5A8YA 3RXTA 1F5LA 1AWHB 5L6NH 2GGVB 1W8BH 1JXPA 1GHVH 2BY8X 2V3MA 1ANEA 1VITG 2ZTXA 4E06H 1YKTA 3OAAD 5KECA 2PHBA 1DDJA 1UTKA 2WUCA 3ZZAA 2XCNA 4Y0YE 1GBLA 2UWOA 4DW2U 3SQHE 1YF4A 2AMQA 2OC0A 5C1YA 3BIUH 3EA8A 1EAIA 4NA8A 3UQOA 1ELEE 2VINA 1C2KA 2G51A 1N6YA 4ACBA 1GVKB 3RXRA 2VH0A 1Q2WA 5TJXA 1N1LA 3SI3H 1GMCF 4YT6H 5CHAB 2ZFRH 3RXMA 3KYFA 4K2YA 4ISLA 3LGWA 4AFSA 2GD4B 1S6FA 1CGJE 1IQIA 1W3CA 2QY0B 1AUTC 4FUDA 1QBOA 4AOQA 3TJNA 6GCHF 4E05H 1TRMA 3GY7A 3HGPA 1L2EA 4Y7AA 3WW7A 1O2MA 1GHYH 1PPHE 3FP6E 2PUXB 1QL8A 4K69A 1SG8B 3I29A 3OX7U 1V3XA 5GIBA 1O2VA 2SGFE 1GI4A 3Q3XA 2VVUA 1NBMD 3RXIA 2FS8A 1P12E 4K1SA 3RXUA 5C2ZA 2PP6A 1MCVA 1YLCA 1C1NA 3URCA 1E34B 3E6PH 5DP3A 2ZDKA 4BTUB 1P3CA 1UVUH 1ELCA 4FOUC 4AFQA 1K1NA 3BTKE 4BAKB 2C8WB 4X2WA 1JOUB 3QN7A 4BANB 5BRRE 1GI5A 1ZGIA 3LGYA 3LGIA 4Q63A 3A7VA 2R2MB 1HCGA 3M37A 4ZKNU 3AW0A 3RLWH 1O34A 4YESB 2L6OA 3EA9A 4RT0A 5FAHA 2KZ4A 1VITH 1TLDA 1O3FA 2KCPA 3SZEA 8GCHF 1EOJA 4K60A 2KAIA 3BN9A 1P9SA 5B6OA 1FONA 1ZJDA 1UCYE 2CXVA 2A1DB 4K3JA 3UREA 2RG3A 5HM9A 4Y10E 3RM2H 5LH8A 1C1WH 1HBTH 1SLUB 3PLPA 3F6UH 3GY8A 1EXFA 1S6LA 5CE1A 1C5VA 3QDZB 1EJMA 3KIDU 1MKXK 3M7UA 5EOKA 4JK6A 3NXPA 3LJOA 4AX9H 4NG9H 1HAYB 3KHVA 1AE8H 1MABB 1O2YA 2VBCA 1QURH 5EXNA 2TGDA 1TX7A 3CP7A 2GDDA 4XBCA 3TJOA 1YCPM 4AYYB 1ELFA 4KTUA 1Z8IB 3QGJA 1V2PT 5EG4A 1AZZA 1SGEE 2GZ7A 4JZIA 1BMLA 4MNYA 1EZQA 2ULLA 1C4U2 5A8XA 3T5FH 5EPYA 5C3NA 1V2RT 2VVCA 1CHGA 1TQ0B 2A7JA 1LQDB 2PV9B 4YO9A 3RXBA 3FANA 3HGNA 2GV6A 3B9FH 3V0XA 2SGAA 1RTLA 4NGAH 1A7SA 1GVLA 2NU3E 1AKSA 4R0IA 3A8DA 2DUCA 3FFGA 1O38A 5KEDA 1G9IE 4PROA 1BRAA 3SV7A 1EUFA 1TRYA 3GY2A 1EOLA 2JDID 5DP9A 5EW1H 3TITA 1E1QD 2ZHQH 1ARBA 4GSOA 1KDQA 3RMLH 3LJJA 5LPFA 2ZDAH 4X8TH 2YMSB 3SJKA 1HAHH 1ZLRA 2P8OC 1GBEA 2D8WA 1KYNA 1C5XB 3V3MA 4GCHG 4ZKOU 2ODYB 2J2UA 3MU1A 1QIXB 1D6WA 2P95A 2WPKS 1EB1H 1F0SA 2ANYA 3H09A 1A2CH 1KLJH 1YY3A 1RIWB 5A0BA 3SNAA 4ABAA 3MNCA 1H8IH 2K8IA 2XYAA 1TBZH 3LC5A 2SGPE 3PMAB 2A31A 2BX4A 1YM0A 2FZZA 2RFKC 5FPTA 4TSFD 1K1OA 1BRUP 1UTPA 6CHAB 1K9OE 1PJPA 1SQOA 2TRMA 4ABGA 1O5AB 2QYIA 4O3UA 2DE9A 9LPRA 4CRDA 1L1NA 5TCAA 1DWCH 3URDA 1NS3A 2ZDVH 3DT0H 1O5EH 3PTBA 1LMWB 2Z7FE 4FUGA 2R2WU 1ACBE 1O3NA 1BBRE 1GBFA 4X6NA 1JIRA 4I8HA 3D49H 1BA8B 1FPCH 1OWEA 3SU3A 3K65B 4MNXA 1HAOH 2TGTA 3P92A 3ZVGA 1DSTA 4NIWA 4IGDA 1DSUA 2BQ7B 1O3OA 4F4OC 5DG6A 1ZSKA 2H9HA 1OYTH 3MNSA 4ZHAA 5K0HA 1Q31A 1A5GH 2GCTB 3M5MA 2QF0A 1VGCB 3SNBA 5C17A 2Z9LA 1TIOA 2TIOA 3A81A 3RXQA 1H1BA 5EU8A 1G32B 3OEED 1EAXA 1YPKH 5EQQA 5GXPA 2Y80A 3ATIA 1IQMA 1O2JA 1UW7A 1AD8H 4XFQA 2ZG0H 1ELBA 3AAUA 2PSXA 5C0TA 1QJ6B 2VIWA 3A7XA 1QQ4A 2P16A 3F9GA 1DLKB 3QGNB 4VGCC 1CGIE 3ELAH 3E91A 1CQQA 2ZO3H 3LH3A 1K0HA 1ELTA 2OBQA 3RP2A 1GBMA 4ZROA 3F9HA 4Y76A 2G00A 1GDNA 1FIWA 1UK4A 1W0ZU 3H7OA 1S81A 1WTHD 1OWJA 2QA9E 5E2OA 1GI2A 1G3BA 2ZGJA 3VFEA 1GMCG 2J38A 5DP7A 4JK5A 1J14A 5F03A 4F49A 1FJSA 1ANDA 2PFEA 1BZXE 4ISHH 2BY9X 1O35A 1FY5A 1F5RA 1OXGA 1PPCE 4WVPE 1QNJA 2VJ1A 1TGBA 5JB9S 2OLGA 3GCTF 6GCHG 4GUXA 4HI3A 4JZFH 5JB8S 2HVYB 1VITF 4B76A 1K1MA 3T27A 2W6ID 3LONA 1AVWA 2BY6X 1YBWA 3K6ZA 2BVSH 3ATKA 1GPZA 3ZYEA 2XW9A 4H4FA 2RA3A 3KN2A 4NZQA 1E0FD 3WWBA 3ZVBA 4KKDA 5IK2D 1SLXB 2W6JD 3LPRA 3GY5A 4F55A 3ZVDA 1GBKA 2F9OA 1DUAA 1NPMA 1LKAA 5K7RA 1W10U 1PPZA 1O2XA 1HV7A 4IC6A 2R3YA 1BTUA 1FY1A 2QC2A 1NFUA 4K1EA 1VJ9U 5L2ZH 1MU8B 3OY6U 1PQAA 1D3PB 5F8ZA 4H6SB 1MKXH 1LQEA 1MH0A 3FKSD 1NBME 1COWD 1CBWC 2O8UA 2W5EA 1JMOH 5H4IB 5JDUB 1O2SA 3UNSA 1WSSH 1GGDB 1GBCA 2QAAA 1G30B 2UWLA 3UAIC 4Y6DA 2FX6A 4BAQB 2B5TB 3NK8A 1HLTH 2ZECA 3D23A 3A82A 1O5DH 1IQEA 3BG4B 2D26C 1GMDG 1Y3UA 1LVOA 2ZDLA 3AK5A 2PKSB 3V7TA 3R3GB 1ELAA 2HLDD 1MKWK 3NPSA 3TPIZ 8KME2 2G81E 1IQJA 4B71A 3UB0A 1F7ZA 3AW1A 3OE7D 3K6YA 2GT8A 5E0JA 1W7XH 1EZSC 3IWMA 1GHXH 1TPOA 1H8ED 1P05A 1TNHA 4NIVA 3LC3A 3O8DA 2O8WA 2XXLA 3CS7A 2BD9A 1UTMA 1SQAA 5EODA 1P9UA 1O2LA 1XUJA 3I77A 2FIRH 1TALA 3P8FA 1NROH 3UWIA 1CSOE 2EI6A 6ESTA 1CGHA 2PLXA 2ZTYA 1P8VC 3RXEA 4YOGA 4AORA 7ESTE 3RU4D 3PRBA 2Z9JA 3QTVH 1KXAA 2W3KA 3SU4A 1TNJA 2SGEE 2ZIQH 1GI0A 1NESE 3W94A 1WQVH 3SGQE 2EI8A 5C67A 4UDWH 4CRCA 2OBOA 5J4SA 4WMDA 2ZU3A 1OWKA 3QLPH 1TMBH 1H8DH 1C5WB 1MD7A 3ZIAD 2FLRH 1NO9H 1X7AC 1C9PA 1CU1A 2HOBA 1HAXB 2ZNKH 1NZQH 3VGCC 3Q77A 1CHOG 2ZU5A 2AMDA 2C93B 1GI1A 3MO6A 5HIYA 4Z0KA 3SJOA 1QFKH 3ENSB 1IQGA 3BTME 3UIRA 3OTPA 2FOCA 1VKYA 4JYUH 5B6LA 1AB9B 1MTSA 1MTNC 1TMUH 2ZHFH 4X6PA 3DFLA 3RXFA 2Q1JA 1C5OH 3SUFA 3M3VA 2C8YB 2CHAB 2ZCLP 4CBNA 4DVAU 1C4Y2 3MO9A 4ISNA 3BEFB 3GCHC 4JMYA 3P70B 1AU8A 5G4BA 1O3BA 3QK1A 2AERH 1BMNH 5I46H 9ESTA 1A0JA 2F9UA 4AFUA 4IMQA 3QZQA 2QXIA 1HAZB 1ZOMA 1RTFB 4KTSA 1L1JA 3O8BA 3D62A 2ZTZA 3MOCA 1K1IA 1O2KA 4FU8A 5F53A 1NY22 1FNIA 4F48B 5DO4H 1LO6A 1C2MA 4A6LA 1DOJA 4D7FA 1IQFA 5LPEA 4D7GA 1DY8A 1ABJH 5EQSA 3PTNA 3BG8A 1G3DA 3GDUA 3MH7A 2Y5FA 2GZ8A 1C5ZB 1NRRH 1GHBF 1TE0A 5AF9H 1U6QA 1TAWA 1SFQB 4GCHF 3AAVA 1DXWA 1GJAB 2C3SA 2P3UB 1N8OC 7KMEH 1KLIH
chains in the Genus database with same CATH topology
3P6ZB 1AI8H 1QJ7B 1L0ZA 3QZRA 4X1PU 3RXDA 3TVJB 4ZMAH 5E0GA 4UE7H 1E36B 3F1SB 3SNDA 5SGAE 1MQ6A 1S84A 4M7GA 1GJ5H 5CHAC 3BIVH 3RUOA 2ASUB 1KXEA 3T25A 1QRZA 1ZPCA 4E7RG 1YPMH 1O3MA 2G5NA 3DFJA 1THSH 3GOVB 2R9PA 3SGBE 3O8RA 1OOKB 5EPNA 1YCPK 5DP8A 3SU6A 4YOIA 8ESTE 1C5RA 1N6XA 1JBUH 4OS4A 4I31A 3M5OA 1O5FH 2ALPA 3GCOA 3ZZ5A 4R8TB 3NCLA 1OS8A 1CA8B 4BTTB 5JBTA 2FMJA 4LXBH 3AVZA 3SV2H 3MH5A 3UTUH 1DX5M 2ZDMA 1FLEE 1O33A 3N7OA 2OXSA 2GP9B 2B0FA 1C5TA 4HZHA 4ABJA 1KXBA 4GVUA 4JCNA 3T2NA 2AEIH 1PQ8A 2Q6FA 1S83A 4FUIA 1O3LA 3E0NB 3M35A 2HGTH 3GCTG 1RD3B 2BX3A 1HXEH 2BQWB 1QRWA 1O3HA 3MH6A 2Z6BD 3FP7E 3KF2A 4LZ4B 5AFZH 1GMHF 4UFGH 4WMFA 2BD8A 1GBBA 2SGQE 3L3TA 2RA0A 1GHAF 1YPHE 1GVZA 2WYGA 3TJVA 2K1QA 1NRPH 1HB0B 1OWHA 1A3BH 1L1GA 2ZFQH 1XKBC 5JYIA 2UUFB 4TY7A 2FXRA 4AGKA 4ZXYH 1SGPE 3LGUA 3E8LA 1GBJA 1PYTD 1P2MA 3RXGA 1MKWH 5L30H 4ZXXH 2ALVA 6LPRA 1S0RA 4YT7H 2XCFA 3NKKA 1NRSH 4J2YB 1O2RA 2VB0A 2QCYA 3ZV8A 5FPSA 4I33A 4ISOA 1UTOA 1GHZA 3ZYDA 4B74A 1WBGB 1G2MA 1RXPA 1SGDE 3MWIU 4D9QA 4A7IB 1SB1H 1BCUH 2FI3E 4B2CA 1SGTA 3STJA 3G01A 4GHTA 1WUNH 4FVBA 3TGIE 3Q3YA 1DM4B 2BDIA 2PKAA 2JH0D 4CRBA 1G37A 3RC5A 4U01A 2I6SA 1HGTH 1T8NA 1ZMNA 3DHKH 3TJUA 2QXGA 5ESTE 2OD3B 1WOFA 4ASHA 2WPJS 2ANKH 4NWKA 4XBBA 1P01A 1ZYOA 4JZDH 3PLBA 1Z8JB 2A5IA 1KIGH 1LHCH 1D3DB 4RKJB 1SGQE 4FUCA 1CT4E 2YOLA 1OSSA 1Y59T 1EX3A 5FBEA 1XUKA 1EQ9A 2QV1A 2GKVE 3BTQE 2LNCA 2ZWLH 3VB3A 2CJIA 4B2BA 4MNVA 2B8OH 4OS5A 1C1PA 3VXEH 1ID5H 1UK3A 1GMDF 1K28D 1LHDH 1ZTLA 3VB7A 1O37A 1O5GH 1YPHC 2HNTF 4ABDA 4INLA 2FOBA 1Y8TA 3TH4H 3M3TA 2BDHA 1O2PA 2ZCHP 3ZZDA 4D76A 2STBE 2VU8E 3U1JB 1P0SH 1ZSJA 1QB9A 2BY5X 2OP9A 1RIWC 5BPEA 2UUYA 1HAVB 1TRNA 2BLOA 2QXJA 2H2ZA 3M7QA 1C2GA 4I32A 4A92A 5IDKA 1W0YH 5DK1A 4AB9A 1L4DA 1V2WT 2V3HH 6CHAC 3OU0A 1YC0A 4U30A 3K9XB 1E35B 3RXVA 1BJUA 5E0HA 3RXAA 4Q7YA 4NIXA 3A89A 1V2OT 1SGFG 2ZHWH 2AIPA 4ABBA 5FHTA 3L33A 1KXCA 4MPVA 3SHCH 2W26A 5ABWA 1OPHB 4MTBA 2OQUA 1E38B 3M5NA 4Y8XA 5TCCA 2P59A 2M5TA 2TGAA 1S0QA 3U69H 3TNSA 3SUEA 1WU1A 1A5IA 1EPTB 2A5AA 1ELVA 4CH8B 3LKWA 2BOHB 1K1LA 1CHOF 2GCTC 1VGCC 2IN2A 3TGJE 3DUXH 1A0LA 2C4FH 2A4RA 1QRXA 1O32A 2BD7A 2GZ9A 1GI3A 3SZNA 3A7TA 4X8VH 1V2JT 5A2MH 3UFAA 2BDGA 2HVXA 2OTVA 2TPIZ 1QTFA 1TQ7B 1FUJA 1GJBB 3ZVEA 1GHBG 1BOQA 1H9HE 1P11E 4Q2KA 1YCPH 2R0KA 3E1XB 3LDXH 1JIMA 3P95A 4K5ZA 4NWLA 2GDEH 4NSVA 3SHAH 2VWNA 3MO3A 1GL0E 1CA0B 1H9LB 4TPYA 2HALA 3M36A 2J94A 1LHGH 1B0FA 1ABIH 1DWBH 2ZFSA 2HNTC 4DOQA 5C5NA 4H6TA 2Y7ZA 4UONA 4AG2A 3PWBA 1QJ1B 1LTOA 1TA6A 1FY4A 2H5DA 1GG6B 2WUBA 4NSYA 3HPTB 3TLOA 1MBQA 1UCYK 4MLFB 2A5KA 4NZLA 3ATMA 7GCHG 1K2I1 1K1PA 1BMMH 3VPKA 4SGAE 5EXMA 4Y8YA 3RM0H 4MQAA 1P09A 3IITA 1QB1A 1FZZA 4X6MA 4XOJA 1C1SA 1EB2A 1T4VH 2J92A 1TWXB 1BHXF 1O3KA 1UVTH 2IPHA 4NA7A 1GWAA 1LVYA 2O8LA 2ILNA 1P2JA 5DP4A 1F0RA 2GMTB 2VNTA 3C27B 5FCRA 3MTYA 1DPOA 2BDYA 4CH2B 3RXHA 3HATH 1FN8A 1PFXC 2BD2A 3E0PB 1GGDC 2JH6D 4AGJA 1GMHG 3MMGA 3V12A 1BIOA 3EE0B 1GHAG 2J34A 2JH5D 1MUEB 3ZZ9A 1V2KT 2WINI 3BG4C 2ZHDA 3TK9A 2XWAA 3GYMA 1O5BB 2OC7A 2DE8A 2PKSC 3UNRA 1GDQA 1D3TB 1OX1A 1TOCB 1ZTKA 4ISIH 1GBAA 2H9EH 3AASA 2BDBA 2FWWA 5A0AE 2XBWA 4ZHMU 4RSPA 3S0NA 4J1YA 1PPEE 4I8LA 1BDAA 2A32A 3MI4A 1LKBA 5A8ZA 5EW2H 3MU4A 2FDAA 3KCGH 3SV6A 2ZQ1A 4B73A 8LPRA 4UFEH 1Z1IA 2XTTB 1QY6A 4INHA 2AMPA 4DJZB 5FCKA 1ORFA 1C1UH 2H5CA 1THPB 3VB5A 2IJOB 2BYAX 2VWOA 1HUTH 3BTDE 1YLDA 5HYOA 1D3QB 1ZHPA 4IW4E 4A5TS 3P8NA 1XVOA 1TNKA 4CBOA 2WPMS 4O3TA 4XE4A 2FI4E 1HAIH 1W14U 1AN1E 4U32A 1O3AA 1C1OA 1RJXB 3ATWA 1FY8E 5E8EH 3ZZ8A 2Z9IA 1C1MA 1Z6JH 1MMJN 1HJAB 1J16A 5HGGA 1MTVA 2ANMH 2A2QH 1AB9C 2KAIB 1M9UA 3T29A 2ESTE 3UR6A 1G36A 2BMGB 1DUEA 2THFB 2CHAC 1A3EH 1AZ8A 1BBRK 2ZKSA 4O97A 1LDTT 2XC5A 3PM3A 4BOHA 2FOMB 1XKAC 3A7YA 5FX6A 1THRH 1TBQH 2CV3A 3A7ZA 5F8XA 1IHTH 2GV7A 4D9RA 1G2LA 3FAOA 1KXFA 1NFXA 2ODPA 1CT2E 1ZPBA 2UWPA 2ZF0H 2CN0H 1AIXH 1TPSA 2IOTA 1AO5A 1JRSA 2FODA 1QB6A 1XMNB 1Z1JA 1SLWB 4B1TA 4YM9A 1PYTC 1MBMA 4Y71A 5A0CA 2ZQ2A 5I25A 1ANBA 1DVAH 1GI9B 3KQBA 5GCHG 5GWZA 3GY6A 1SGFA 2FS9A 2ZI2H 2QXHA 4WH8A 4Y79A 1TPAE 2XWBI 1S5SA 2G8TA 3MYWA 1GI7B 2B9LA 1FXYA 4MPUA 1Y3WA 4ZKSU 1GCDA 1QA7A 3VXFH 2A0QB 1WV7H 1AKSB 5DJ7A 3QO6A 1ARCA 1A46H 3IG6B 3QTOH 4ZH8A 1UVSH 3LGVA 5EQRA 4HFPB 1PPFE 2OC1A 4DIHH 1O2WA 3EDXB 1AMHA 2CMYA 1AQ7A 1OP0A 4X1NU 2WV4A 4I8KA 1UHBB 2EEKA 1CE5A 5DP6A 1BHXB 2BHGA 1SGRE 2FX4A 1HFDA 2O9QA 2BM2A 1C1RA 1TBRH 2FI5E 1ZHMA 2ZHEH 4IN1A 4WY3A 1H9IE 5T3HA 2VIPA 2QGRA 2G52A 1UCYH 3NUMA 5DPAA 5HM2A 3KEEA 3RXLA 2Y5HA 4FUEA 4FUBA 1B0EA 1EATA 3EQ0H 2PGQB 7LPRA 3DA9B 1P10A 1IOEA 3GDVA 4I8JA 2A45B 2ZGCA 5T6DA 2Z94A 3RMOH 1ZGVA 4ESTE 1GCTB 1KTTB 2BDAA 2Z9KA 3M7TA 3PO1B 5JBAS 3ZZ7A 2F9NA 3K2UA 3A7WA 1LPKB 3LIWA 3HK6B 2ZZUH 4Q7ZA 2AGGX 1KTSB 4GHQA 2XBXA 3T28A 1PPBH 1HIAB 1J9CH 2TBSA 1Z71A 2Y7XA 3RXCA 1EPTA 1GBIA 1OKXA 1V2UT 3TH3H 1RFNA 1BTWA 2I6QA 1P2NA 5GPIB 3GYLB 2LPRA 5E2PA 4KELA 3BTGE 1UTQA 1XUGA 3A86A 3UR9A 1SGNE 3GY4A 1O2QA 1W13U 1TGTA 3TK6A 1P57B 2F83A 3RMMH 5EXLA 1BITA 1SPJA 5T6FA 2A4GA 3BEIB 2PTCE 1W11U 3RXJA 5F8TA 5C20A 3OYPA 1HYLA 1V2TT 1SGYE 3FVFB 2P3TB 1HJ8A 1FIZA 3FP8E 2SNVA 4FUHA 1JRTA 1WTGH 2P94A 1HAGE 4INKA 4B2AA 1KLTA 3RXKA 5ETXA 3V13A 2O8TA 1Y3YA 2FOEA 1SGIB 4A1XA 3B23B 1GJ9B 4CHAB 7GCHF 4CREA 2XBVA 1TPPA 1SMFE 2O8MA 2HRVA 1T7CA 2AGEX 3A85A 4AN7A 2GVFA 1Y5BT 4FU9A 2Y81A 2HLCA 2XBYA 1V2VT 1UO6A 3H5CB 4BTIB 1V2NT 1O3EA 1ETRH 1VCQA 1WAYB 1P3EA 2BLQA 4X1QU 1HDTH 1LVMA 2XRCA 1TOMH 2D2DA 1GBTA 5C1XA 1TNIA 5AFYH 1DLEA 1V2QT 1QR3E 4WMEA 3EAJA 1AVGH 5J4QA 1MAYA 1XUFA 1AFQB 1TABE 3BTHE 2VGCB 1IQKA 2V6NA 1SFIA 2V3OH 3VEQB 2ZU4A 3S9CA 1O2TA 1ZZZA 3E16B 1O3IA 1VCPA 4YZUA 2G5VA 4ABHA 4SGBE 3H7TA 1ESTA 1AVXA 4MPWA 5LGOA 1BBRH 4YOJA 1GL1A 1C5YB 1O2GH 2GT7A 5GJ4B 1RTKA 1MZDA 2GCHF 2ZA5A 2W7SA 4BXSA 1T4UH 3NZIA 5FPYA 1N8OB 1SC8U 4MDSA 1FAKH 1EJNA 4X2XA 4CR9A 3WY8A 2ZP0H 4Y0ZE 2C90B 4UFDH 2P3FH 2VIVA 1SGCA 1K1JA 3ZZ3A 4X2VA 3LT3A 3S9BA 1Z8RA 3UWJH 1EAWA 3BTWE 4LOYH 3P17H 2Q6GA 3UUZA 3GDSA 1EAUA 1TFXA 1UTLM 1XX9A 3PV4A 2BLWA 1ZPZA 4U2WA 1T31A 1VCWA 1FDPA 3SJ9A 2JETB 3GCNA 4GLYA 1O3JA 5GDSH 4ABIA 3MU5A 1QGFA 4FVDA 1O2ZA 3CS0A 3E3TA 4NFFA 5PTPA 1SSXA 2WPHS 3TGKE 1HRTH 3KQDA 3LU9B 1NTPA 1Y5UT 3M5LA 3F9EA 1MZAA 4E7NA 1EPTC 2ZPRA 1QCPA 2W3IA 1GI6A 1A0HB 1CVWH 2CF9H 1TX8A 3QWCH 1A1RA 1O30A 5C1UA 3LGTA 4TPIZ 1CO7E 2ZU1A 1MTUA 1TYNA 3Q3KA 2G4UA 1NC6A 1VR1H 2ZDNA 1YPLH 2FOAA 3UOPA 1V6DA 1ZR0A 1D6RA 1DT2A 4Y8ZA 3D65E 3JZ1B 1O0DH 3EGKH 4QT8C 1FAXA 2RCEA 1FMGA 4CRFA 3KQEA 1OP2A 1ZSLA 4NCYA 3PWCA 1ZRBA 1AGJA 1TGCA 1KSNA 3FZZA 1QBVH 5CMXH 2A7CA 1LPGB 1SOZA 3PMBB 1C1QA 2ANWA 3BSQA 3MHWU 4WF8A 1ESBA 2ZFTA 4ZHLU 3SW2B 3RU4E 3UNQA 3SNEA 4YLUA 1CA0C 2HNTE 1RS0A 4UFFH 3ZV9A 1NRNH 1GJCB 4FUJA 2PSYA 1EZXC 4CR5A 2B7DH 4MG3A 1Y3XA 2HPPH 2V35A 3CENA 1Y5AT 3TNTA 3UY9A 1A61H 1YPEH 2SGDE 4DCDA 3HKIB 2NU0E 1O2NA 5GCHF 1BRBE 1GG6C 2ZEBA 3ODDA 2Y5GA 2FPZA 3RXOA 2EI7A 3KL6A 2FYQA 1O3CA 1ZHRA 1C5LH 1ANCA 5DKMA 1O31A 1SVPA 2Z3CA 4X2YA 2H1UA 3TK5A 1SBWA 1XXDA 2XC0A 1BT7A 3ESTA 4IC5A 5ESBA 3OTJE 1KY9A 1BJVA 4FUFA 4X0WU 3STIA 4WH6A 3SJ8A 4CRAA 4OGXA 1YYY1 5FXLA 3A84A 2FYRA 1OP8A 1XXFA 2WV5A 1GI8B 1DWEH 2FP7B 1IAUA 1MCTA 1YGCH 4K8YA 3U8TH 1J8AA 4ZAEA 2GMTC 1O3PB 1SLVB 5IYTA 3PB1E 1GJ6A 3SGAE 1NN6A 4BNRA 1O5CB 4FXGH 4THNH 5DGJA 1SI5H 4OGYA 2J95A 1GDUA 2R0LA 5JBBS 2FTLE 3L6PA 1C5UA 1C5PA 3F9FA 2FTMA 2YNAA 2AYWA 1HXFH 3TH2H 1P02A 1O2UA 2ZFPH 2TGPZ 1INCA 1G3CA 4TY6A 5A09A 1UHBA 2AGIX 3RU4T 1EP6A 1DY9A 1XUIA 4Y7BA 2BD3A 3PROA 1ELDE 3TU7H 3S69A 1KXDA 4JYTA 4O9VA 5FX5A 5EGMA 2PTNA 5HXFA 1O2HA 3PMJA 3ZZ4A 1MTWA 2H6MA 2ODQA 4IN2A 1C5QA 2AIQA 3SOSA 4AYVB 4YTAA 1V2ST 2BY7X 2A2XH 3E90B 2BXTH 1J17T 1DFPA 4H42U 2C8ZB 4DT7B 1UVOA 2PWXA 2F3CE 1QBNA 3MH4A 1ZTJA 1GBHA 1DS2E 2VWLA 4JZ1A 1F92A 1C1VH 2OC8A 1P06A 1NFYA 2YNBA 3RC6A 4LZ1H 1QL7A 3A8BA 2PW8H 4X1SU 2FESH 1H4WA 1GJ8B 4TWYA 4WJG2 1GJDB 1QQUA 1WQSA 4A1TA 1P2IA 4ABFA