1VCQA

Semliki forest virus capsid protein (crystal form ii)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
149
structure length
149
Chain Sequence
CIFEVKHEGKVTGYACLVGDKVMKPAHVKGVIDNADLAKLAFKKSSKYDLECAQIPVHMRSDASKYTHEKPEGHYNWHHGAVQYSGGRFTIPTGAGKPGDSGRPIFDNKGRVVAIVLGGANEGSRTALSVVTWNKDMVTRVTPEGSEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SEMLIKI FOREST VIRUS CAPSID PROTEIN
publication title Structure of Semliki Forest virus core protein.
pubmed doi rcsb
source organism Semliki forest virus
molecule tags Viral protein
total genus 32
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1996-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vcqA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vcqA01
1V2JT 1SGTA 1P2NA 4FUGA 4SGBE 3AW0A 5E0GA 2FOFA 4KTSA 4E06H 1UHBB 2OC7A 2TRMA 4ZKRU 1BTYA 1GJ5H 3TVJB 1C1TA 2FODA 2WINI 1YLCA 5AVDA 1DE7H 1W7GH 3K9XB 5GIBA 3ZV8A 1BQYA 1YCPM 2F83A 4AOQA 3A82A 6CHAC 2FXRA 1O38A 2ZKSA 1DT2A 1YLDA 2HGTH 1QL7A 3MU0A 4INKA 1C5MD 5T6GA 1SQAA 1S85A 5FX6A 2FP7B 1LKAA 1ELFA 2RA0A 2OCVB 1XXDA 2NU0E 2NU3E 1Z6JH 5LH8A 1GBLA 2ODQA 3NWUA 1C1NA 4Q7YA 2ZHWH 4ESTE 1KIGH 1MBQA 1SI5H 2GZ8A 1BMAA 3S9CA 1P01A 1AE5A 4INHA 1WYKA 1UCYK 2HLCA 1ABIH 3RMMH 1F92A 1UCYE 2FI4E 4JYVH 4JCNA 2CHAB 3U9AH 1B7XB 1CSOE 3RXTA 3SQHE 1GBCA 1N6YA 3T27A 2AMQA 2ZGCA 4ISHH 1ELAA 1H8DH 4OS6A 3CP7A 4I8LA 5FBEA 1QNJA 3RXDA 3W94A 1EP5A 1A5HA 4ZH8A 1GDQA 3GCOA 3RXQA 1L2EA 1SC8U 4NWLA 2G5VA 2CF8H 1HAHH 5TJXA 3A8BA 1CT4E 4K1TA 2XRCA 3UY9A 2JETC 1P06A 3BEFB 2PV9B 4DGJA 1AFQC 3SI3H 3IITA 4IC5A 1GWAA 1LKBA 4K8BA 5A8XA 1GGDB 1MZDA 1VCWA 2GDEH 1OWKA 3SNBA 2CV3A 1ZSKA 4FUCA 4X2VA 3RMNH 1K1NA 1BTPA 1HBTH 1VITF 1C5OH 3KL6A 1GBIA 2BLWA 3A7WA 1S81A 5EXMA 2SFAA 1LQEA 1P57B 4O9VA 4WF8A 3SU6A 2FDAA 3URCA 1Y8TA 4DT7B 1TYNA 3MWIU 3NCLA 4I8HA 1J16A 2V0BA 2B0FA 3SUEA 3RXAA 1E35B 2C93B 3BTGE 1EJNA 1A4WH 4DURA 1SGFA 3ZV9A 3GY6A 1O5GH 1TFXA 5JDUB 2ZFPH 3RXRA 3Q3KA 5GPIB 2PUXB 1SLXB 1ZRBA 1C9PA 1W11U 3ZZ6A 2JH5D 1P09A 2QXIA 3F9HA 1NS3A 1OOKB 5GWZA 2B8OH 5IDKA 3SHAH 3M36A 1N6XA 3A84A 4WXVA 2XYAA 3PWCA 3GDVA 3EDXB 4NSVA 3OX7U 1EX3A 2V6NA 2PKAB 1OWEA 4CHAB 3VGCC 1GG6C 1QL9A 4AG2A 1GHAF 2BQ7B 4I7YH 5GJ4B 1IQKA 1GBTA 2FOGA 4MQAA 4X8TH 1AI8H 2BY5X 4GCHF 1YCPK 4NZQA 3SGQE 7LPRA 2ZU4A 1BBRK 1ZOMA 1KXBA 4K3JA 1GMDG 1BBRE 1O2WA 2FTLE 3A89A 2XBXA 1PYTD 2VWLA 1W13U 1A3BH 4TY6A 1BT7A 1HAPH 1ELCA 1GDNA 1GHBF 1PYTC 2OC1A 2D2DA 2ZU1A 1HAZB 1NFUA 1TPPA 3P8GA 3B23B 4X1PU 3ATKA 4RKOB 2AMPA 1NRPH 1DDJA 2ZI2H 1C4Y2 2FI5E 1P2OA 1FY4A 2FPZA 4DJZB 5DJ7A 1KXFA 2ZWLH 3NUMA 4AG1A 3VPKA 3U1JB 1GMCG 4Y8YA 1AZ8A 4NFFA 1C2DA 3RXVA 1HJAC 3ZZ9A 1WTGH 2Z9KA 1Y5BT 4ZUHA 4AB8A 3V0XA 3UNQA 1XKAC 2QAAA 4WMDA 4E05H 2A32A 3RXPA 3RXFA 3TNSA 1SB1H 3M61U 2UUYA 2J38A 2XC4A 3EYDA 2ZA5A 2C4FH 4JYUH 1AO5A 3S9BA 3BEUA 3RXOA 1V2MT 1O3EA 4JZFH 2ZDMA 3MNCA 1SOZA 2F91A 4FUFA 3DFJA 3SQEE 1EAIA 1FJSA 1SPJA 2W7SA 1FIWA 3GCNA 5E0HA 1O3IA 3SUDA 2FS8A 3TH2H 1MZAA 3QDZB 1INCA 2WPHS 1TE0A 1P8VC 1SLVB 2ZGJA 3TITA 5HMAA 3V3MA 4AZ2B 1XXFA 2FWWA 1DICA 1GMHG 4A1XA 2PTNA 2ZFQH 3LDXH 1GVKB 4KKDA 1PPBH 2ZO3H 4YT7H 4GSOA 1X7AC 1YPJH 2B7DH 3AAUA 2GD4B 1TB6H 1QY6A 3GYMA 3P92A 1MAYA 3AVZA 1EZSC 4NWKA 1CGHA 4MPXA 2BX3A 2BZAA 3SV6A 2TPIZ 4FUEA 1HB0B 5PTPA 1GBJA 2FLBH 5C5OA 2BY7X 2FI3E 1DUAA 2A2QH 1KLTA 2J92A 3TJOA 5C1UA 1C1OA 2FLRH 1YPMH 1A61H 4Y7BA 4ZKSU 1OP0A 2ZIQH 4J2YB 5F8XA 4B73A 3FFGA 2A45B 1YC0A 3FP7E 1W0YH 5BPEA 2UWLA 1L0ZA 2BDCA 1F0TA 4MPVA 1GPZA 1ZTJA 1UTOA 1O2SA 2TIOA 4KTCA 3BG8A 2BB4A 3C27B 1F5RA 1ARCA 2IPHA 2BVXH 2G5NA 1AMHA 4FUBA 2Z3EA 2Z3CA 1EKBB 1FAXA 3SBKA 3UREA 2O8UA 1ELVA 4ABFA 3BIVH 4X6OA 2ZCKP 1O3FA 2QGRA 1GL0E 3PB1E 3SU5A 1IQEA 3JZ1B 1V2ST 2HWLB 2ZNKH 3OY5U 4Z6AH 1D9IA 4H4FA 1O2TA 1N1LA 3P70B 1QRZA 1FPCH 2V3HH 4B1TA 2XWBI 2HNTE 3UR9A 2AGIX 1PJPA 1ANBA 4CBOA 5J4QA 1QRWA 2R0LA 1D3DB 1MD8A 3MYWA 1PPFE 5K0HA 5IYTA 3RXUA 1DS2E 4K1SA 1TA2A 2NU2E 5GXPA 3SGAE 3RXBA 1DY8A 3E91A 4CRDA 4CR9A 3MH5A 4F4OC 3C1KA 1WQSA 5HGGA 1FN6A 1YBWA 4XE4A 2P59A 4CRCA 1Z6EA 3H7TA 3RP2A 4BTIB 5C1XA 1PQ5A 4ZXYH 2J4IA 1UCYH 4LXBH 2A2XH 4X8VH 1C5XB 2BXTH 1GBKA 4CH2B 6CHAB 2VINA 1BJVA 4YTAA 4NIXA 1OYQA 5A2MH 1HRTH 1J9CH 2PLXA 3ZVAA 1CT0E 2M5TA 4B71A 1WCZA 2ZU3A 1QBOA 1TAWA 1ZGIA 3BF6H 1PFXC 3TJUA 1OS8A 2Y82A 5JBCS 1O2XA 1C2KA 1L4DA 1RTKA 1YYY1 5J4SA 1QQ4A 2ASUB 8ESTE 1MAXA 3QUMP 1UHBA 2J94A 4SGAE 1OWHA 4E7RG 2A5KA 1TNLA 5JBAS 4LK4A 1AZZA 1T7CA 1EXFA 2Y81A 2VNTA 1O3BA 2QYIA 2ZQ1A 4M7GA 2BD7A 1V2RT 1FN8A 5EODA 5HM9A 2RDLA 3A83A 5FPSA 1OP2A 2DE9A 4JYTA 2IN2A 4AGJA 1LCYA 3ODFA 1XVMA 1GI9B 2TBSA 2P94A 3P8NA 3PM3A 1ZPBA 3STJA 1C1MA 5I25A 3VB3A 4GPGA 4GLYA 1Y3XA 2GMTC 2F9OA 3F9FA 3E0NB 3T29A 1FUJA 2FYRA 4MDSA 1NU9A 3PMJA 4BAHB 2BYAX 4UDWH 1DY9A 3KGPA 4YOIA 1TX7A 1MU6B 3RU4T 3SV8A 4Q7XA 5EOKA 1ZHRA 4KELA 3TK9A 3PYHA 3A8DA 4U2WA 2O8MA 1SQTA 1GCTC 1D6WA 3LGUA 1AU8A 2P8OB 3SI4H 3ATIA 1EJMA 4ABGA 1AKSA 2VWOA 1P9SA 1KDQB 1MQ6A 3GY4A 4BNRA 1FAKH 1V6DA 1DFPA 3K6ZA 3RXCA 2A1DB 1TBZH 2ZTXA 3R0FA 5ESTE 5EQQA 1ESAA 4KP0A 4O3TA 5DP8A 1C1PA 3DT0H 1VITG 3EQ0H 1MTNC 3P6ZB 1DLKB 2FESH 1YCPH 1N8OC 2J34A 2KAIB 3GCHC 4K1EA 1VGCB 4ZROA 2FOBA 1O2GH 1S0QA 4FUHA 4FVBA 1SSXA 2PSXA 1MU8B 3DUXH 1EOLA 1XM1A 1BTXA 3SN8A 1DM4B 2QXJA 2I6QA 5F03A 2SGEE 3O8RA 1IQMA 4ABJA 1G3EA 4FUDA 3VGCB 2OC0A 3O8BA 3UWJH 3S9AA 4BAKB 1YPKH 1ORFA 1K22H 3LH3A 3A7ZA 1QA0A 1W10U 1T8MA 3U1IB 3SNDA 3SUFA 4AFQA 2FS9A 1C5WB 1UK3A 1DOJA 5EQSA 3VFEA 2IJOB 3HPTB 1GI3A 2AGGX 4ISNA 4BAMB 3VXEH 2QY0B 1BZXE 1O3HA 2PR3A 3MO3A 1GHAG 2QC2A 1P2MA 4GCHG 1K28D 3RXMA 2FM2A 1LO6A 1OPHB 1SGYE 2PKAA 4YM9A 1O3NA 1Z8RA 2OD3B 3UNRA 5L2ZH 2ZPQA 3I29A 1Z1IA 3TK6A 3MFJA 3SJKA 3VB7A 1GHBG 2ZDAH 1ZMJA 2JKHA 4VGCB 5LPRA 1RS0A 3RU4E 4AYYB 4X0WU 1SL3A 3BTTE 2Z9GA 3F1SB 2XXLA 4THNH 1ID5H 2Z9JA 3E90B 2F3CE 4Y0ZE 5E2OA 1GBHA 3A7VA 1K1PA 1L4ZA 4ZXXH 3UNSA 1QHRB 3L33A 1QRXA 3HGNA 2WPKS 3BV9B 3MO6A 1NU7B 5DP6A 1G9IE 3RMOH 4WMEA 1G36A 1TLDA 1KXEA 4Y8ZA 2F9VA 2XC5A 4BOHA 1CA0B 4RSPA 4KGAA 1Z71A 3FANA 1P2IA 4J1YA 4WJG2 2ZG0H 4Y11E 3TJNA 2Y5FA 2XBWA 1W12U 1C1SA 4WY3A 1CT2E 1ZHPA 5AFZH 4JK6A 3A81A 1YP9A 1C5ZB 4CR5A 3SOSA 3TGKE 1NY22 5JPMH 2BLQA 1EZUC 2QF3A 1NRRH 2EA3A 1YF4A 2J95A 1V2PT 4DW2U 4NIYA 4Q7ZA 3P17H 5FPYA 2FYQA 1OSSA 1V2WT 1OX1A 1HIAB 3ENSB 5HYOA 3UIRA 1UTQA 2I6SA 1Q3XA 1CE5A 1AVWA 1O5FH 1MKWK 3EA8A 4D7FA 1MH0A 1S5SA 1TALA 2G8TA 1O2KA 3E8LA 4HI3A 4AFUA 1G32B 2ZGHA 2TGTA 4BAQB 2A4OA 3IWMA 4DOQA 3NZIA 2C90B 4BTUB 1O3LA 3KCGH 3TH4H 1W0ZU 2F9BH 2HALA 2H9TH 1F5KU 1THPB 3P95A 2SGDE 1S82A 3TLOA 5T3HA 2BM2A 1EP6A 1H9IE 3RUOA 1C5PA 2A4QA 4B75A 1C4V2 2PFEA 1CBWB 4IC6A 3Q3XA 2GGVB 3ITIA 5F6MA 3BEIB 1C1UH 1A1RA 3S7KB 1VCQA 1GI4A 3NKKA 1GI1A 3SNCA 2A7CA 1E38B 3P8FA 5DP7A 3OTJE 1ANDA 1EAXA 1JRTA 2GT8A 1AGJA 5CHAC 3BTME 1ZPCA 4Y79A 3LGWA 1BRUP 4NFEA 1NESE 2G51A 4YLQH 5C20A 3SU1A 1O2QA 3CS0A 1V2OT 9ESTA 1DSUA 1DPOA 2GKVE 1FV9A 3F9EA 3M5NA 4JZEH 2BY6X 1Z8IB 4X1NU 1ABJH 1DXPA 2VIWA 4WVPE 4MVNA 1D3QB 1EJAA 8GCHF 5F8ZA 1SLWB 3RXKA 2O8WA 1AB9C 2W7UA 4TWWA 2AYWA 2XC0A 1SGEE 3QZRA 4YT6H 5L6NH 1V2LT 3CS7A 1C1RA 2D1JA 4NZLA 4UFFH 2VGCC 1OWDA 1V2TT 2Q1JA 1A3EH 4DVAU 2D26C 5E8EH 1E0FD 1J14A 2QCYA 1MD7A 1RTFB 4DY7B 1XUIA 2PTCE 5FAHA 1XUKA 3SHCH 4OS2A 4OGYA 1SGIB 3OY6U 1EAWA 2CF9H 5E2PA 1NRQH 2UUKB 1NZQH 2FOCA 2YOLA 4KTUA 1OWJA 2H6MA 1NC6A 2PKSC 4B74A 1UK2A 2D8WA 3IG6B 1QL8A 3MI4A 3RXHA 4R0IA 1FY3A 1TA6A 3HATH 3ATWA 4NSYA 1WOFA 2UWOA 4WH6A 1FDPA 1BMLA 3PO1C 2ANWA 1O3KA 5CMXH 1QA7A 1ARBA 4R8TB 2WYGA 1O0DH 5DP4A 1TABE 1MTWA 1RTLA 1JMOH 1V2KT 2RA3A 3BN9A 2VVCA 1C2IA 3Q77A 5FCKA 4OGXA 1C2LA 5EXNA 4D7GA 4ZKNU 2GT7A 3R3GB 1L1GA 4GUXA 5CE1A 1BTHH 4ISIH 4A7IB 2CJIA 1ZMNA 1W8BH 2C8WB 3V12A 3SJOA 2GCTC 4K2YA 4GVUA 1C1VH 2ZTYA 1UVTH 2PGBB 1HAGE 4ZKOU 1XKBC 1P2QA 2XW9A 1EUFA 2HPPH 3MU4A 2UUJB 3TK5A 3BTEE 4FUIA 2BVSH 5ESBA 1BTUA 4XSKU 1RIWB 2W3IA 2G4TA 1TNJA 4ASHA 2ZU2A 2GMTB 1QIXB 1O39A 3QGNB 1Z8GA 1A2CH 2Z3DA 2F9PA 2ZPRA 2J9NA 5A09A 1ELTA 1QURH 1RFNA 2O9QA 4QT8C 5EG4A 1C5NH 2ZHDA 2PHBA 2EC9H 1IQFA 8KME2 1P0SH 1K1OA 1UTPA 1EPTB 1HAOH 4YO9A 3UQOA 4ZHMU 1GJ7B 2G55A 3CENA 3VB4A 1D3PB 4I8GA 1IAUA 3ZZDA 3A87A 1VJAU 5DGJA 3TPIZ 3LONA 1AVXA 1KSNA 2XBYA 4UEHH 2BQWB 1F0UA 3LGTA 1K1IA 3SU4A 4AB9A 2FTMA 3ZVCA 3T5FH 3MO9A 2AS9A 1UO6A 2Q6DA 3UOPA 1ZRKA 1LHGH 1GBBA 1C2HA 4NGAH 1AQ7A 1ELEE 3TIUA 2ZFSA 1QJ7B 2OC8A 1FY1A 1AWFH 1UTNA 2NWNA 2GX4A 1O3MA 1UK4A 1QB6A 1J8AA 1LVYA 4FU7A 4ISOA 2YNAA 3RC6A 6ESTA 1ZGVA 2HNTC 1XX9A 3A7TA 1DWDH 2ZC9H 3KQEA 1TGNA 1DSTA 2HOBA 2PWXA 4PROA 3U8RH 1G3CA 1UVUH 3KF2A 3UWIA 3EE0B 2BLVA 2ZU5A 1BRBE 2W26A 1GHWH 5FPTA 1TMBH 2VH0A 4X1SU 1O2YA 1TPSA 4X8SH 2BHGA 3QGJA 2CN0H 1GVZA 1AN1E 5SGAE 1QGFA 1IQGA 1WUNH 4D76A 5K7RA 1KXAA 1SLUB 5I46H 2CHAC 2TGAA 4I33A 2KAIA 2BDAA 2LPRA 1K21H 1B5GH 4AFZA 1EOJA 1EQ9A 1NRSH 1O5BB 2BD4A 1SGDE 1XUHA 3SNEA 2BD8A 3Q00A 3ZZ4A 3QZQA 2H1UA 2F9NA 3KQDA 2FMJA 1F0RA 2ILNA 1GJDB 1YPEH 1DVAH 1ZHMA 4OS1A 1NROH 5EPYA 2QIQA 1TBRH 1O35A 3M5OA 1BMMH 3B8JA 1AVGH 1Y3WA 3LPRA 4B76A 3T26A 1GHZA 4CRAA 3ZYEA 2BD9A 4X2WA 3D49H 1P02A 4RN6A 3U8OH 5BRRE 2VIPA 1GGDC 2A0QB 3UR6A 5EQRA 3DD2H 5E0JA 8LPRA 4WWYA 1LHEH 1NT1A 1A0HB 2VVVA 2STBE 2R2WU 3QWCH 1FZZA 1HUTH 1VZQH 2XTTB 3LJJA 2CGAA 2YNBA 3LU9B 3FP6E 2BXUH 2SGFE 1TNHA 3AAVA 2ZCHP 1BDAA 1XUJA 5EU8A 5LPFA 1TGSZ 1E36B 3M5LA 5JB9S 1MKWH 2SNVA 3LGYA 3HGPA 4NG9H 4CBNA 4NA7A 2CMYA 4K8YA 3ZVDA 1JOUB 3VB6A 1GI8B 4TPIZ 3M37A 1Z1JA 1BHXF 1P3EA 2RG3A 3A8AA 3G01A 5B6OA 1O3GA 1O37A 2ZDVH 1SFIA 2ZF0H 1FY5A 3EA7A 1OWIA 4XBDA 3MNBA 3K6YA 4IMZA 3F68H 2VIQA 1YPHC 3GY2A 2ZFRH 4CHAC 1QJ1B 3T62A 1NN6A 3URDA 1Y5UT 2WPMS 3JZ2B 1NFWA 1C5TA 2ZDLA 4X1RU 1BTZA 1SGNE 3UTUH 4TYDA 4LOYH 1UTMA 1DUEA 1O2PA 1NRNH 3S69A 2A5AA 1ZPZA 5GDSH 1JBUH 2VIDA 1WV7H 3MTYA 4HZHA 1O30A 4OS4A 1ZZZA 3U8TH 5JBBS 5EW2H 1D6RA 4A6LA 2GTBA 1HAIH 4Y7AA 3O8DA 1AFEH 3VEQB 2QN5T 2BDYA 3M7QA 1HIAA 4MNXA 1GJAB 2LNCA 1KY9A 1TONA 2JETB 3H7OA 1UTLM 3NXPA 1PQ7A 4Y8XA 1ZMLA 1E37B 1EZQA 2JH6D 1AFQB 5FCRA 1BMNH 1WBGB 2FOMB 2FOAA 4Y71A 4H6SB 2G00A 3N7OA 4YLUA 1L1NA 2ODYB 3BTKE 4YESB 1GI0A 2A5IA 3RXEA 3ZZAA 2Y7XA 3F9GA 3MH7A 1IQJA 1MQ5A 1S0RA 3S7HB 1RGQA 5DO4H 5EW1H 4K69A 1YPHE 1O5AB 1RJXB 4ABAA 2AH4X 1C5SA 2PUQH 1CHOF 3ZZ5A 3SV2H 3H5CB 2FZZA 3LOXA 3SU3A 2HNTF 1FIZA 3SJ8A 4OS7A 4O03A 1ANEA 4IW4E 4INLA 2GZ7A 4DG4A 1GJCB 1ESBA 1O3DA 1FY8E 1BBRH 1IHTH 1HAVB 1THRH 3V7TA 4GHTA 5A0CA 3S0NA 2EI7A 2VWMA 3EAJA 1TGBA 8GCHG 5JB8S 1G37A 3A7YA 3L3TA 1SGCA 1SHHB 4ZAEA 1GG6B 1ZSJA 2V35A 3ZZ8A 2JH0D 5DPAA 3STIA 1V2UT 2FEQH 3EGKH 4X1QU 1DWEH 4AX9H 1BB0B 2XNIA 4D9QA 3LGVA 1LMWB 1QB1A 2SNWA 3LJOA 1P2JA 1TQ7B 2OP9A 1A7SA 2VIOA 3QTOH 4RKJB 1DXWA 2ZPSA 1Z8JB 3PWBA 3E16B 1MCVA 1HYLA 1G30B 3HKJB 3DFLA 4X2XA 1IHSH 1Y3UA 4NA8A 2PW8H 3VXFH 2VJ1A 1BA8B 1C2GA 4IGDA 1O5DH 2BDHA 4ZMAH 3UOUA 1O34A 2GCTB 2BOHB 1GJ4H 1DX5M 1UMAH 1QBNA 3PLPA 3GCTF 3LH1A 2OTVA 5AF9H 1EAUA 4CH8B 1O32A 4FUJA 4IN1A 4LZ1H 5L30H 1Q2WA 4BANB 1HJAB 1D4PB 2P93A 2Q6FA 2SGPE 5A0BA 1GI6A 5LGOA 4ZHLU 4MPUA 5FXLA 5ETXA 3PMHB 1SGFG 3FP8E 1NFYA 3RLWH 1P9UA 2A31A 2XCFA 4XDEA 1O2UA 2OQ5A 1PPGE 2XBVA 3SUGA 1WTHD 3BTHE 1GJBB 1Y3YA 1TMTH 1MBMA 3GOVB 4FXGH 1FXYA 1YPLH 1QBVH 2RCEA 1C5LH 1AE8H 3BTWE 3KEEA 1T4UH 2Z94A 1FLEE 3L6PA 4DCDA 1W7XH 1TIOA 2QXHA 4UD9H 1O33A 4MTBA 1F7ZA 1S83A 4Y10E 3LC3A 3ATMA 1W2KH 1A5IA 3TH3H 4UFEH 1MUEB 1FMGA 1F5LA 2ZTZA 1GHVH 3OU0A 2H5DA 3FVFB 2P3FH 7KMEH 2P3TB 1L1JA 1P05A 4A5TS 2VU8E 2FOHA 1AY6H 3ZZCA 1K9OE 1TGCA 2BD5A 2BZ6H 3GY8A 1EPTA 1OP8A 1P11E 4TPYA 1CA8B 3RXLA 3ZZBA 2WUCA 1P3CA 2NU4E 1GHYH 1ELBA 2OLGA 4U01A 3DHKH 7ESTE 2C8ZB 3MNSA 1S6HA 2ANKH 3RC5A 1IQIA 1RRKA 1V2NT 4MNWA 1O2IA 1BITA 1TNGA 4FVDA 3AASA 4I32A 4CRFA 3KQCA 1E34B 2ZHFH 1GBEA 1SG8B 2STAE 2ZHQH 4NCYA 4U30A 1JIRA 1H8IH 2ZECA 1SQOA 2CXVA 4DIIH 4A1TA 2ZFTA 4I8KA 5L2YH 3UUZA 2WV5A 1QFKH 1LQDB 3MU5A 3DA9B 1TPAE 1BUIA 1FQ3A 2BVRH 3LKWA 3V13A 4IN2A 1O2NA 1YM0A 3ELAH 2GV7A 1C2MA 1K2I1 6LPRA 1OYTH 1FNIA 3ATLA 2BD2A 3RM0H 1AWHB 1H1BA 3T28A 3Q3YA 3QK1A 2Y80A 3GDSA 1SFQB 2HVXA 1KLJH 3SJIA 1AKSB 4YOJA 2AGEX 3T2NA 1ZJKA 3UPEA 3ESTA 2AERH 2QF0A 2F9UA 4K60A 4A1VA 1TBQH 7GCHG 1O2ZA 3ZYDA 3LIWA 1C5QA 3NK8A 1BCUH 2R9PA 1V2QT 1RD3B 3BTFE 2Y7ZA 1A0JA 2Q6GA 2ODPA 1ELDE 1CGIE 2GCHF 4F49A 3E3TA 3I78A 2B5TB 2V3OH 1VR1H 1AIXH 1MKXK 3T25A 3KIDU 2ULLA 1ZTLA 4UFGH 1GCDA 2P8OC 5TCAA 3MH4A 3VB5A 3M3TA 3FZDA 1TX8A 2WYJA 4Q2KA 1KTTB 4JMYA 2ALVA 1HAYB 1O3AA 1LVOA 1ELGA 4ABDA 4UONA 1ETRH 4ABBA 2Z7FE 2BMGB 1A5GH 5C3NA 3TGIE 5AFYH 1HV7A 6GCHF 1P03A 2AMDA 2ESTE 2R3UA 1VJ9U 3GICB 1NM6A 5F8TA 5G4BA 2WUBA 5GCHF 1JIMA 2BQ6B 1VGCC 3MH6A 3MNXA 3SO3A 2R3YA 3GDUA 1GHXH 1HNEE 1Y5AT 1ZR0A 3TJVA 4B2BA 5ABWA 1GI7B 4IBLH 1MMJN 1SHYA 2R0KA 1O2LA 1ACBE 1HCGA 2O8TA 1O2HA 2BD3A 1O2OA 3KQBA 1O3CA 1O3JA 2ALPA 1WAYB 1T31A 1FI8A 1O5CB 1C5RA 3M3SA 2ANYA 1OXGA 1YPGH 3MU1A 1ZYOA 1T32A 3PROA 5T6DA 2Y5GA 1F2SE 4B2CA 3A8CA 1CVWH 2VH6A 1GBMA 2QA9E 3D65E 2P3UB 4I8JA 4AORA 3FAOA 1G3DA 2B9LA 1PQ8A 1T8OA 1JRSA 4MPWA 1TRNA 1ZJDA 3RXJA 5T6FA 1LPZB 1T4VH 1THSH 1LTOA 1TWXB 2GP9B 2P16A 2AEIH 3SNAA 4AN7A 1IQLA 4VGCC 1EATA 1ETSH 3RM2H 4Q80A 2WPJS 3BG4C 1G3BA 4YZUA 2OBQA 1KYNA 1NO9H 1EZXC 3RXSA 1GCTB 5JBTA 5JYIA 2DE8A 2EI8A 1HJ9A 1P12E 3KHVA 3KN2A 1TMUH 2A4RA 5LPEA 3I77A 5TCCA 2P95A 1GVLA 1TOCB 3A88A 1GI2A 2NU1E 3RLYH 2ZZUH 3GY5A 1QB9A 1W3CA 3GY7A 1CA0C 5DP5A 3LC5A 2VB0A 1DITH 4K5ZA 2BDBA 1MTNB 3P8OA 1C5UA 1BIOA 4CREA 3PV4A 1N8OB 2UUFB 1O2MA 3GCHB 1OKXA 2J2UA 3RXGA 1O3PB 3BSQA 1CHGA 3UQVA 1ZLRA 2ZDNA 1HAXB 3M5MA 2TGDA 1JWTA 4XBBA 1QTFA 4WH8A 1CHOG 4JZIA 1J17T 1IQNA 3FZZA 2G52A 1TNIA 3BIUH 4FU8A 3F6UH 2OUAA 5HXFA 1PQAA 2GZ9A 2VWNA 5DK1A 2WPIS 1KDQA 2Z9LA 2BDIA 2H5CA 1CGJE 2BOKA 2SGAA 1SVPA 1P10A 1C4U2 1CQQA 3PTBA 5FBIA 2XWAA 4H6TA 1H9LB 1DANH 2OXSA 4WMFA 2ANMH 7GCHF 1KXDA 4NIVA 1VITH 1WQVH 2ZGBH 3ODDA 3EA9A 4TY7A 2QXGA 5DG6A 1LPKB 1LPGB 1BTWA 3ZZ3A 1BJUA 1T8LA 3LGIA 1IQHA 3UFAA 1F0SA 1HAVA 2GDDA 4MLFB 2FX6A 3B9FH 2EEKA 2C3SA 1WU1A 1S84A 3HK6B 4Y6DA 1QQUA 1TPOA 3GY3A 1QR3E 1NTPA 1BRCE 4NA9H 1XUFA 4X8UH 1EB2A 1CBWC 2C8XB 2GVFA 1AUTC 1C5VA 2BY8X 1O3OA 4ABEA 2QV1A 1VCPA 5EXLA 3E0PB 2ZQ2A 1MCTA 1O2VA 3GISB 2G4UA 1O36A 1RXPA 3OSYA 1SGPE 3U98H 4MNYA 4U32A 1C1QA 1GJ6A 4BAOB 2AIQA 4X2YA 2A4GA 3BTQE 1SGQE 1C5YB 1DLEA 5HM2A 4I31A 3MHWU 3QTVH 2Y6TA 1XMNB 4AGKA 5C2ZA 1SGRE 3PMBB 9LPRA 4AFSA 3GCTG 1AUJA 2WV4A 3A80A 2A7HA 5EGMA 2A7JA 4JZ1A 3U69H 4CRBA 1EB1H 1LDTT 5C5NA 4XOJA 4Z0KA 3QO6A 2FO9A 4A92A 1QCPA 2K1QA 3Q76A 3K65B 1TRMA 1C2JA 3M35A 3QN7A 4O3UA 4LZ4B 3K2UA 4UE7H 1HLTH 1Y59T 2BTCE 3WY8A 3M3VA 3SJ9A 1K1MA 3TNTA 2THFB 1ZSLA 1GMDF 1C1WH 3BTDE 3ZVGA 1KXCA 1GBFA 1H4WA 1MTVA 4HTCH 1HJ8A 1Z7KA 3D62A 2HPQH 1GBAA 2IOTA 3SGBE 3A86A 3SORA 3O8CA 2AIPA 3GYLB 4IS5A 1TGTA 4ABIA 3PMAB 1K1LA 1P04A 1PPCE 5DP3A 2O8LA 4ABHA 1O2RA 1Q31A 1GMCF 1LVBA 3E1XB 2W3KA 1B0FA 2FIRH 4ISLA 4YOGA 5EPNA 3TU7H 1O31A 2PGQB 4D9RA 1H9HE 3KNXA 1HPGA 3ZZ7A 3ZVFA 1HGTH 5A8YA 1SR5C 4X6MA 4WXIA 1QJ6B 1CU1A 1PPHE 5A0AE 3QLPH 2OBOA 4ZHAA 4JZDH 2BX4A 3TGJE 2W5EA 1GDUA 3PLBA 1AD8H 1RIWC 5CHAB 3PTNA 1MKXH 5DKMA 3SW2B 1A46H 4GAWA 1O2JA 2PSYA 1NFXA 5DP9A 2VIVA 5AHGH 2Z9IA 1NPMA 1XUGA 2AFQB 1ETTH 1M9UA 1CO7E 4NIWA 4DIHH 2UWPA 1TX6A 1W14U 3ZVEA 3A85A 1TNKA 1EPTC 1YGCH 4MNVA 1AHTH 1GMHF 1AB9B 1HFDA 4D8NA 1TQ0B 1MTUA 4X6NA 4BTTB 2H2ZA 3LT3A 4HFPB 4XBCA 5FX5A 1UTKA 4FU9A 1C2FA 2VGCB 3W95A 1UVOA 2R2MB 4BXSA 1TRYA 4GHQA 3SU2A 1YKTA 2ZHEH 4OS5A 3RU4D 2H9HA 1SMFE 3MMGA 2FOEA 4UFDH 2GCHG 1PPZA 1IOEA 1P2KA 4IMQA 2VVUA 2GV6A 1O5EH 1KLIH 1HXEH 1J15A 1G2LA 1BOQA 2PKSB 1C9TA 4H42U 2EI6A 3D23A 2XCNA 1TOMH 1DWCH 3RMLH 3HKIB 3PO1B 1JXPA 4E7NA 1D3TB 2G81E 4B2AA 1V2VT 2BY9X 2DUCA 1U6QA 1BHXB 1BRAA 4XFQA 2Y5HA 1ANCA 4MG3A 1PPEE 6GCHG 1WSSH 2BLOA 3PLKA 5GCHG 2SGQE 4Y76A 1GI5A 1Y3VA 2ZFFH 1HDTH 4JK5A 4Y0YE 4BXWA 2OINA 5C67A 1HXFH 1FONA 2HRVA 2ZGXH 1GJ9B 1A0LA 1ZTKA 3A7XA 1GL1A 3SU0A 3E6PH 3M7TA 4X6PA 3QX5H 1MTSA 5H4IB 1SOTA 1S6FA 3OYPA 3SZNA 3MOCA 1GBDA 1XVOA 1EASA 1LHCH 1KTSB 1DWBH 2WPLS 1ESTA 2TGPZ 1V3XA 1GJ8B 1UTJA 1C2EA 2BDGA 3NPSA 1G2MA 3RXIA 4AYVB 3MU8A 5A8ZA 4TWYA 3M7UA 2ZDKA 1UVSH 2Z6BD 1FPHH 4CRGA 3SV9A 1LHDH 5FHTA 3SV7A 2FX4A 4HGCA 1UJ1A 2ZP0H 3HK3B 3BG4B 4O97A 2C8YB 3AW1A 1SBWA 1LHFH 1T8NA 1LVMA 1UVPA 1K1JA 1B0EA 2ZCLP 3RDZA 2H9EH 2OQUA 5C1YA 3ZVBA 2ZEBA 3RC4A
chains in the Genus database with same CATH superfamily
1V2JT 1SGTA 1P2NA 4FUGA 4SGBE 3AW0A 5E0GA 2FOFA 2KCYA 4KTSA 4E06H 1UHBB 2OC7A 2TRMA 4ZKRU 1BTYA 1GJ5H 3TVJB 1C1TA 2FODA 2WINI 2KFWA 1YLCA 5AVDA 1DE7H 1W7GH 3K9XB 5GIBA 3ZV8A 1BQYA 1YCPM 2F83A 4AOQA 3A82A 6CHAC 2FXRA 1O38A 2ZKSA 1DT2A 1YLDA 2HGTH 1QL7A 3MU0A 4INKA 1C5MD 5T6GA 1SQAA 1S85A 5FX6A 2FP7B 1LKAA 1ELFA 2RA0A 5C17A 1W0JD 2OCVB 1XXDA 2NU0E 2NU3E 1Z6JH 5LH8A 1GBLA 2ODQA 3NWUA 1C1NA 1E79D 4Q7YA 2ZHWH 4ESTE 1KIGH 1MBQA 1SI5H 2GZ8A 1BMAA 3S9CA 1P01A 1AE5A 4INHA 1WYKA 1UCYK 2HLCA 1ABIH 3RMMH 1F92A 1UCYE 2FI4E 4JYVH 4JCNA 2CHAB 3U9AH 1B7XB 1CSOE 3RXTA 3SQHE 3PV2A 1GBCA 1N6YA 3T27A 2AMQA 2ZGCA 4ISHH 1ELAA 1H8DH 4OS6A 3CP7A 4I8LA 5FBEA 2F43B 4F48B 1QNJA 3RXDA 3W94A 1EP5A 1A5HA 4ZH8A 1GDQA 3GCOA 3RXQA 1L2EA 1SC8U 4NWLA 2G5VA 2CF8H 1HAHH 5TJXA 3A8BA 1CT4E 4K1TA 2XRCA 2KZ4A 3UY9A 2JETC 1P06A 3BEFB 2PV9B 4DGJA 1AFQC 3SI3H 3IITA 4IC5A 1GWAA 1LKBA 4K8BA 5A8XA 1GGDB 1MZDA 1VCWA 2RFKC 2GDEH 1OWKA 3SNBA 2CV3A 1ZSKA 1H8ED 4FUCA 4X2VA 3RMNH 2KCOA 1K1NA 1BTPA 1HBTH 1VITF 1C5OH 3KL6A 1GBIA 2BLWA 3A7WA 1S81A 5EXMA 1NBME 2SFAA 1LQEA 1P57B 4O9VA 4WF8A 3SU6A 2FDAA 3URCA 1Y8TA 4DT7B 1TYNA 3MWIU 3NCLA 4I8HA 1J16A 2V0BA 2B0FA 3SUEA 3RXAA 1E35B 2C93B 3BTGE 1EJNA 1A4WH 4DURA 1SGFA 3ZV9A 3GY6A 1O5GH 1TFXA 5JDUB 2ZFPH 3RXRA 3Q3KA 5GPIB 3WWBA 2PUXB 1SLXB 1ZRBA 2F4LA 1C9PA 1W11U 3ZZ6A 2JH5D 1P09A 2QXIA 3F9HA 4AC9A 1NS3A 1OOKB 5GWZA 2B8OH 5IDKA 3SHAH 3M36A 1N6XA 3A84A 4WXVA 2XYAA 3PWCA 4TT3D 3GDVA 3EDXB 4NSVA 3OX7U 1EX3A 2V6NA 2PKAB 1OWEA 4CHAB 4B6EA 3VGCC 1K0HA 1GG6C 5HKKD 1QL9A 4AG2A 1GHAF 2BQ7B 4I7YH 5GJ4B 1IQKA 1GBTA 2FOGA 4MQAA 4X8TH 1AI8H 2BY5X 4GCHF 1YCPK 4NZQA 3SGQE 7LPRA 2ZU4A 1BBRK 1ZOMA 1KXBA 4K3JA 1GMDG 1BBRE 1O2WA 2FTLE 3A89A 2XBXA 1PYTD 2VWLA 1W13U 1A3BH 4TY6A 1BT7A 1HAPH 1ELCA 1GDNA 1GHBF 1PYTC 2OC1A 2D2DA 2ZU1A 1HAZB 1NFUA 1TPPA 3P8GA 3B23B 4X1PU 3ATKA 4RKOB 2AMPA 1NRPH 1DDJA 2ZI2H 1C4Y2 2FI5E 1P2OA 1FY4A 2FPZA 4DJZB 5DJ7A 2KR7A 1KXFA 2ZWLH 3NUMA 4AG1A 3VPKA 3U1JB 1GMCG 4Y8YA 1AZ8A 4NFFA 1C2DA 1WDIA 3RXVA 1HJAC 3ZZ9A 1WTGH 2Z9KA 1Y5BT 4ZUHA 4AB8A 3V0XA 3UNQA 1XKAC 2QAAA 4WMDA 4E05H 2A32A 4ASUD 3RXPA 3RXFA 3TNSA 1SB1H 3M61U 2UUYA 2J38A 2XC4A 3EYDA 3DSGA 2ZA5A 2C4FH 4JYUH 2K0QA 1AO5A 3S9BA 2WZQA 3BEUA 2LP6A 3RXOA 1V2MT 1O3EA 4JZFH 2ZDMA 3MNCA 1SOZA 2F91A 4FUFA 3DFJA 3SQEE 1EAIA 1FJSA 1SPJA 2W7SA 1FIWA 3GCNA 5E0HA 1O3IA 3SUDA 2FS8A 3TH2H 1MZAA 3QDZB 1INCA 2WPHS 1TE0A 1P8VC 1SLVB 2ZGJA 3TITA 5HMAA 3V3MA 4AZ2B 1XXFA 2FWWA 3KYGA 1DICA 1GMHG 4A1XA 2PTNA 2ZFQH 3LDXH 1GVKB 4KKDA 1PPBH 2ZO3H 4YT7H 4GSOA 3MQKC 1X7AC 1YPJH 2B7DH 3AAUA 5EIYA 2GD4B 1TB6H 1QY6A 3GYMA 3P92A 1MAYA 3AVZA 1EZSC 4NWKA 1CGHA 4MPXA 2BX3A 2BZAA 3SV6A 2KCAA 2TPIZ 4FUEA 1HB0B 5PTPA 1GBJA 2EQNA 2FLBH 2WPDD 5C5OA 2BY7X 2FI3E 1DUAA 2A2QH 1KLTA 2J92A 3TJOA 5C1UA 1C1OA 2FLRH 1YPMH 1A61H 4Y7BA 2W6JD 4ZKSU 1OP0A 2ZIQH 4J2YB 5F8XA 4B73A 3OEED 3FFGA 2A45B 1YC0A 3FP7E 1W0YH 5BPEA 2UWLA 1L0ZA 2BDCA 1F0TA 4MPVA 1GPZA 1ZTJA 1UTOA 1O2SA 2TIOA 4KTCA 3BG8A 2BB4A 3C27B 1F5RA 5EJLA 1ARCA 2IPHA 2BVXH 2G5NA 1AMHA 4FUBA 2Z3EA 2Z3CA 1EKBB 1FAXA 3SBKA 3UREA 2O8UA 1ELVA 4ABFA 3BIVH 4X6OA 2ZCKP 1O3FA 2QGRA 1GL0E 3PB1E 3SU5A 5C94A 1IQEA 3JZ1B 1V2ST 2HWLB 2ZNKH 3OY5U 4Z6AH 1D9IA 4H4FA 1O2TA 1N1LA 3P70B 1QRZA 1FPCH 2V3HH 5KEDA 4B1TA 2XWBI 2HNTE 3UR9A 2AGIX 1PJPA 2KX4A 1ANBA 4CBOA 5J4QA 1QRWA 2R0LA 1D3DB 3CNRA 1MD8A 3MYWA 1PPFE 5K0HA 5IYTA 3RXUA 2JDID 1DS2E 4K1SA 5HIZA 1TA2A 2NU2E 3FO8D 5GXPA 2K8IA 3SGAE 3RXBA 1DY8A 3E91A 4CRDA 4CR9A 3MH5A 5DSFA 4F4OC 3C1KA 1WQSA 5HGGA 1FN6A 1YBWA 4XE4A 2P59A 4CRCA 1Z6EA 3H7TA 3RP2A 4BTIB 5C1XA 1PQ5A 4ZXYH 2J4IA 1UCYH 4LXBH 2A2XH 4X8VH 1C5XB 2BXTH 1GBKA 4CH2B 6CHAB 2VINA 1BJVA 4YTAA 4NIXA 1OYQA 5A2MH 1HRTH 1J9CH 2PLXA 3ZVAA 1CT0E 2M5TA 4B71A 1WCZA 2ZU3A 1QBOA 1TAWA 1ZGIA 3BF6H 1PFXC 3TJUA 1OS8A 2Y82A 5JBCS 1O2XA 1C2KA 1L4DA 1RTKA 1YYY1 5J4SA 1QQ4A 2ASUB 8ESTE 1MAXA 3QUMP 1UHBA 1YY3A 2J94A 4SGAE 1OWHA 4E7RG 2A5KA 1TNLA 5JBAS 4LK4A 1AZZA 1T7CA 1EXFA 2Y81A 2WHXA 2VNTA 1O3BA 2QYIA 2ZQ1A 4M7GA 2BD7A 1V2RT 1FN8A 3DSOA 5EODA 5HM9A 2RDLA 3A83A 5FPSA 1OP2A 2DE9A 4JYTA 2IN2A 4AGJA 1LCYA 3ODFA 1XVMA 1GI9B 2TBSA 2P94A 3P8NA 3PM3A 1ZPBA 3STJA 1C1MA 5I25A 3VB3A 4GPGA 4GLYA 1Y3XA 1SKYE 2GMTC 2F9OA 3F9FA 3E0NB 3T29A 1FUJA 4DT4A 2FYRA 4MDSA 3OE7D 1NU9A 3PMJA 4BAHB 2BYAX 4UDWH 1DY9A 3KGPA 4YOIA 1TX7A 1MU6B 3RU4T 3SV8A 4Q7XA 5EOKA 1ZHRA 4KELA 3TK9A 3PYHA 3FOAA 3A8DA 4U2WA 2O8MA 1SQTA 1GCTC 1D6WA 3LGUA 1AU8A 2P8OB 3SI4H 3ATIA 1EJMA 4ABGA 1AKSA 2VWOA 1P9SA 1KDQB 1MQ6A 3GY4A 4BNRA 4YXWD 1FAKH 1E1RD 1V6DA 1DFPA 3K6ZA 3RXCA 2A1DB 1TBZH 2ZTXA 3R0FA 5ESTE 5EQQA 1ESAA 4KP0A 4O3TA 5DP8A 1C1PA 3DT0H 1VITG 3EQ0H 1MTNC 3P6ZB 1DLKB 2PP6A 2FESH 1YCPH 1N8OC 2J34A 2KAIB 3GCHC 4K1EA 1VGCB 4ZROA 2FOBA 1O2GH 1S0QA 4FUHA 4FVBA 1SSXA 2PSXA 1MU8B 3DUXH 1EOLA 1XM1A 1BTXA 3SN8A 1DM4B 2QXJA 4M9FA 2I6QA 5F03A 2SGEE 3O8RA 1IQMA 4ABJA 1G3EA 4FUDA 3VGCB 2OC0A 3O8BA 3UWJH 3S9AA 4BAKB 5T1VA 1YPKH 1ORFA 1K22H 1MABB 3LH3A 2M2AA 3A7ZA 1QA0A 1W10U 1T8MA 3U1IB 3SNDA 3SUFA 4AFQA 2FS9A 1C5WB 1UK3A 1DOJA 5EQSA 3VFEA 2IJOB 3HPTB 1GI3A 2AGGX 4ISNA 4BAMB 2WSSD 3VXEH 2QY0B 1BZXE 1O3HA 2PR3A 3MO3A 1GHAG 2QC2A 1P2MA 4GCHG 1K28D 3RXMA 3N7DA 5GNDA 2FM2A 5CHBA 1LO6A 1OPHB 2RDEA 1SGYE 2PKAA 4YM9A 1O3NA 1Z8RA 2OD3B 3UNRA 5L2ZH 2ZPQA 3I29A 1Z1IA 3TK6A 3MFJA 3SJKA 3VB7A 1GHBG 2ZDAH 1ZMJA 2JKHA 4VGCB 5LPRA 1RS0A 3RU4E 4AYYB 4X0WU 1SL3A 3BTTE 2Z9GA 3F1SB 2XXLA 4THNH 1ID5H 2Z9JA 3E90B 2F3CE 4Y0ZE 5E2OA 1GBHA 3A7VA 1K1PA 1L4ZA 4ZXXH 3UNSA 1QHRB 3L33A 1QRXA 3HGNA 4B6FA 2WPKS 3BV9B 3MO6A 1NU7B 5DP6A 1G9IE 3RMOH 4WMEA 1G36A 1TLDA 1KXEA 4Y8ZA 2F9VA 2XC5A 4BOHA 1CA0B 4RSPA 4KGAA 1Z71A 3FANA 1P2IA 4J1YA 4WJG2 2ZG0H 4Y11E 3TJNA 2Y5FA 2XBWA 1W12U 1C1SA 4WY3A 5FL7D 1CT2E 1ZHPA 5AFZH 3OAAD 4JK6A 3A81A 3SZEA 1YP9A 1C5ZB 4CR5A 3SOSA 2V3MA 3TGKE 1NY22 5JPMH 2BLQA 3F2GA 1EZUC 2QF3A 1NRRH 2EA3A 1YF4A 2J95A 1V2PT 4DW2U 4NIYA 4Q7ZA 3P17H 5FPYA 2FYQA 1OSSA 1V2WT 5F53A 1OX1A 3F2FA 1HIAB 3ENSB 5HYOA 3UIRA 1UTQA 2I6SA 1Q3XA 1CE5A 1AVWA 1O5FH 1MKWK 3EA8A 4D7FA 1MH0A 1S5SA 1TALA 2G8TA 1O2KA 3E8LA 4HI3A 4AFUA 1G32B 3PRBA 2ZGHA 2TGTA 4BAQB 2A4OA 3IWMA 4DOQA 3NZIA 2C90B 4BTUB 1O3LA 3KCGH 3TH4H 1W0ZU 2F9BH 2HALA 2H9TH 1F5KU 1THPB 3P95A 2SGDE 1S82A 3TLOA 5T3HA 2BM2A 1EP6A 1H9IE 3RUOA 2KCPA 1C5PA 2A4QA 4B75A 1C4V2 2PFEA 1CBWB 4IC6A 3Q3XA 2GGVB 3ITIA 5F6MA 3BEIB 1C1UH 1A1RA 3S7KB 1VCQA 1GI4A 4HG6A 3NKKA 1GI1A 3SNCA 2A7CA 1E38B 3P8FA 5DP7A 3OTJE 1ANDA 1EAXA 1JRTA 2GT8A 1AGJA 5CHAC 3BTME 1ZPCA 4Y79A 3LGWA 1BRUP 4NFEA 1NESE 2G51A 3FKSD 4YLQH 5C20A 3SU1A 1EFRD 1O2QA 3CS0A 1COWD 1V2OT 9ESTA 1DSUA 1DPOA 2GKVE 1FV9A 3F9EA 3M5NA 4JZEH 2BY6X 1Z8IB 4X1NU 1ABJH 1DXPA 2VIWA 4WVPE 4MVNA 1D3QB 1W0KD 1EJAA 8GCHF 5F8ZA 1SLWB 3RXKA 2O8WA 1AB9C 2W7UA 4TWWA 2AYWA 2XC0A 1SGEE 3QZRA 4YT6H 5L6NH 1V2LT 3CS7A 1C1RA 2D1JA 4NZLA 4UFFH 2VGCC 1OHHD 1OWDA 1V2TT 2Q1JA 1A3EH 4DVAU 2D26C 5E8EH 1E0FD 1J14A 2QCYA 5IK2D 1MD7A 1RTFB 4DY7B 1XUIA 2PTCE 5FAHA 1XUKA 3SHCH 4OS2A 2YMSD 4OGYA 2J98B 1SGIB 3OY6U 1EAWA 2CF9H 5E2PA 1NRQH 2UUKB 1NZQH 2FOCA 2YMSC 2YOLA 4KTUA 1OWJA 2H6MA 2W6ID 1NC6A 2PKSC 4B74A 1UK2A 2D8WA 3IG6B 1QL8A 3MI4A 3RXHA 4R0IA 1FY3A 1VKYA 1TA6A 3HATH 3ATWA 4NSYA 1WOFA 2UWOA 4WH6A 1FDPA 1BMLA 3PO1C 2ANWA 1O3KA 5CMXH 1QA7A 1ARBA 4R8TB 2WYGA 1O0DH 5DP4A 1TABE 1MTWA 1RTLA 1JMOH 1V2KT 2RA3A 3BN9A 2VVCA 1C2IA 3Q77A 5FCKA 4OGXA 1C2LA 5EXNA 4D7GA 4ZKNU 2GT7A 3R3GB 1L1GA 4GUXA 5CE1A 1BTHH 4ISIH 4A7IB 2CJIA 1ZMNA 1W8BH 2C8WB 3V12A 3SJOA 2GCTC 4K2YA 4GVUA 1C1VH 2ZTYA 1UVTH 2PGBB 1HAGE 1WXRA 4ZKOU 1XKBC 1P2QA 2XW9A 1EUFA 2HPPH 3MU4A 2UUJB 3TK5A 3BTEE 4FUIA 2BVSH 5ESBA 1BTUA 4XSKU 3VG8A 1RIWB 2W3IA 2G4TA 1TNJA 4ASHA 2ZU2A 2GMTB 1QIXB 1S6LA 1O39A 3QGNB 1Z8GA 1FX0B 1A2CH 2Z3DA 2F9PA 2ZPRA 2J9NA 5A09A 1ELTA 1QURH 1RFNA 2O9QA 4QT8C 5EG4A 1C5NH 2ZHDA 2PHBA 2EC9H 1IQFA 8KME2 1P0SH 1K1OA 2EY4C 1UTPA 1EPTB 1HAOH 4YO9A 3UQOA 4ZHMU 1GJ7B 2G55A 3CENA 3VB4A 1D3PB 4I8GA 1IAUA 3ZZDA 3A87A 1VJAU 5DGJA 3TPIZ 3LONA 1AVXA 1KSNA 2XBYA 4UEHH 2BQWB 1F0UA 3LGTA 4Q63A 1K1IA 3SU4A 4AB9A 4RI0A 2FTMA 3ZVCA 3T5FH 3MO9A 2AS9A 1UO6A 2Q6DA 3UOPA 1ZRKA 1LHGH 1GBBA 1C2HA 4NGAH 1AQ7A 1ELEE 3TIUA 2ZFSA 1QJ7B 2OC8A 1FY1A 1AWFH 1UTNA 2NWNA 2GX4A 1O3MA 1UK4A 1QB6A 1J8AA 1LVYA 4FU7A 4ISOA 2YNAA 3RC6A 6ESTA 1ZGVA 2HNTC 1XX9A 3A7TA 1DWDH 2ZC9H 3KQEA 1TGNA 2L6OA 1DSTA 2HOBA 4FETA 2PWXA 4PROA 3U8RH 1G3CA 1UVUH 3KF2A 3UWIA 3EE0B 2BLVA 2ZU5A 1BRBE 2W26A 1GHWH 5FPTA 1TMBH 2VH0A 3F0OA 4X1SU 1O2YA 1TPSA 4X8SH 2BHGA 3QGJA 2CN0H 1GVZA 1AN1E 5SGAE 1QGFA 1IQGA 1WUNH 4D76A 5K7RA 1KXAA 1SLUB 5I46H 2CHAC 2TGAA 3WW7A 4I33A 2KAIA 2BDAA 2LPRA 1K21H 1B5GH 4AFZA 1EOJA 1EQ9A 1NRSH 1O5BB 2BD4A 1SGDE 1XUHA 3SNEA 2BD8A 3Q00A 3ZZ4A 3QZQA 2H1UA 2F9NA 3KQDA 2FMJA 1F0RA 2ILNA 1GJDB 1YPEH 1DVAH 1ZHMA 4OS1A 1NROH 5EPYA 2QIQA 1TBRH 1O35A 3M5OA 1BMMH 3B8JA 1AVGH 1Y3WA 3LPRA 4B76A 3T26A 1GHZA 4CRAA 3ZYEA 2BD9A 4X2WA 3D49H 1P02A 3N7EA 4RN6A 3U8OH 5BRRE 2VIPA 1GGDC 2A0QB 3UR6A 5EQRA 3DD2H 5E0JA 8LPRA 4WWYA 1LHEH 1NT1A 1A0HB 2VVVA 3FN8A 2STBE 2R2WU 3QWCH 1FZZA 1HUTH 1VZQH 2XTTB 3LJJA 2CGAA 2YNBA 1H8HD 3LU9B 3FP6E 2BXUH 2SGFE 1TNHA 3AAVA 2ZCHP 3PRDA 1BDAA 1XUJA 3KYFA 5EU8A 5LPFA 1TGSZ 1E36B 3M5LA 5JB9S 1MKWH 2SNVA 3LGYA 3HGPA 4NG9H 4CBNA 4NA7A 2CMYA 4K8YA 3ZVDA 1JOUB 3VB6A 1GI8B 4TPIZ 3M37A 1Z1JA 1BHXF 1P3EA 2RG3A 3A8AA 3G01A 5B6OA 1O3GA 3EE7A 1O37A 2ZDVH 1SFIA 2ZF0H 1FY5A 3EA7A 1OWIA 4XBDA 3MNBA 3K6YA 4IMZA 3F68H 2VIQA 1YPHC 3GY2A 2ZFRH 4CHAC 1QJ1B 3T62A 1NN6A 3URDA 1Y5UT 2WPMS 3JZ2B 1NFWA 1C5TA 2ZDLA 4F55A 4X1RU 1BTZA 1SGNE 3UTUH 3W1EA 4TYDA 4LOYH 1UTMA 3UB0A 1DUEA 1O2PA 5CDFE 1NRNH 3S69A 2A5AA 1ZPZA 5GDSH 1JBUH 2VIDA 1WV7H 5HIYA 3MTYA 4HZHA 1O30A 4OS4A 1ZZZA 3U8TH 5JBBS 5EW2H 1D6RA 4A6LA 2GTBA 1HAIH 4Y7AA 3O8DA 1AFEH 3VEQB 1SQRA 2QN5T 2BDYA 3M7QA 1HIAA 4MNXA 1GJAB 2LNCA 1KY9A 5KECA 1TONA 2JETB 3H7OA 1UTLM 3NXPA 1PQ7A 4Y8XA 1ZMLA 1E37B 1EZQA 2JH6D 1AFQB 5FCRA 1BMNH 1WBGB 2FOMB 2FOAA 4Y71A 4H6SB 2G00A 3N7OA 4YLUA 1L1NA 2ODYB 3BTKE 4YESB 1GI0A 2A5IA 3RXEA 3ZZAA 2Y7XA 3F9GA 3MH7A 1IQJA 1MQ5A 1S0RA 3S7HB 1RGQA 5DO4H 5EW1H 4K69A 1YPHE 1O5AB 1RJXB 4ABAA 2AH4X 4RT1A 1C5SA 2PUQH 1CHOF 3ZZ5A 3SV2H 3H5CB 2FZZA 3LOXA 3SU3A 2HNTF 1FIZA 3SJ8A 4OS7A 4O03A 1ANEA 4IW4E 4INLA 2GZ7A 3F3BA 4DG4A 1GJCB 1ESBA 1O3DA 1FY8E 1BBRH 1IHTH 1HAVB 1THRH 3V7TA 4GHTA 5A0CA 3S0NA 2EI7A 2VWMA 3EAJA 1TGBA 8GCHG 5JB8S 1G37A 3A7YA 3L3TA 1YWUA 4OM9A 1SGCA 1SHHB 4ZAEA 1GG6B 1ZSJA 2CK3D 2V35A 3ZZ8A 2JH0D 5DPAA 1UW7A 3STIA 1V2UT 2FEQH 3EGKH 4X1QU 1DWEH 4AX9H 1BB0B 2XNIA 4D9QA 3LGVA 1LMWB 1QB1A 2SNWA 3LJOA 1P2JA 1TQ7B 2OP9A 1A7SA 2VIOA 3QTOH 4RKJB 4XD7D 2ZPSA 1DXWA 1Z8JB 2JIZD 3PWBA 3E16B 1MCVA 1HYLA 1G30B 3HKJB 3DFLA 4X2XA 1IHSH 1Y3UA 4NA8A 2PW8H 3VXFH 2VJ1A 1BA8B 2J98A 1C2GA 4IGDA 1O5DH 2BDHA 4ZMAH 3UOUA 1O34A 2GCTB 2BOHB 1GJ4H 1DX5M 1UMAH 1QBNA 2J5UA 3PLPA 3GCTF 3LH1A 2OTVA 5AF9H 1EAUA 4CH8B 1O32A 4FUJA 3N99A 4IN1A 4LZ1H 5L30H 1Q2WA 4BANB 1HJAB 1D4PB 2P93A 2Q6FA 2SGPE 5A0BA 1GI6A 5LGOA 4ZHLU 4MPUA 5FXLA 5ETXA 3PMHB 1SGFG 3FP8E 1NFYA 3RLWH 1P9UA 2A31A 2XCFA 5DN6D 3SYJA 4XDEA 1O2UA 2OQ5A 1PPGE 2XBVA 3SUGA 1WTHD 3BTHE 1GJBB 1Y3YA 1TMTH 1MBMA 3GOVB 4FXGH 1FXYA 1YPLH 1QBVH 2RCEA 1C5LH 1AE8H 3BTWE 3KEEA 1T4UH 2Z94A 1FLEE 4XRNA 3L6PA 4DCDA 1W7XH 1TIOA 2QXHA 4UD9H 1O33A 4MTBA 1F7ZA 1S83A 4Y10E 2KM0A 3LC3A 3ATMA 1W2KH 1A5IA 3TH3H 4UFEH 1MUEB 1FMGA 1F5LA 2ZTZA 1GHVH 3OU0A 2H5DA 3FVFB 2P3FH 7KMEH 2P3TB 1L1JA 1P05A 4A5TS 2VU8E 2FOHA 1AY6H 2IJD1 3ZZCA 1NBMD 1K9OE 2QF4A 1TGCA 2BD5A 2BZ6H 3GY8A 1EPTA 1OP8A 1P11E 4TPYA 1CA8B 3RXLA 3ZZBA 2WUCA 1P3CA 2NU4E 1GHYH 1ELBA 2OLGA 4U01A 3DHKH 7ESTE 2C8ZB 3MNSA 1S6HA 2ANKH 3RC5A 1IQIA 1RRKA 1V2NT 4MNWA 1O2IA 1BITA 1TNGA 4FVDA 3AASA 1E1QD 4I32A 4CRFA 3KQCA 1E34B 2ZHFH 1GBEA 1SG8B 2STAE 2ZHQH 4NCYA 4U30A 1JIRA 1H8IH 2ZECA 2HLDD 1SQOA 2CXVA 4DIIH 4A1TA 2ZFTA 4I8KA 5L2YH 3UUZA 2WV5A 1QFKH 1LQDB 3MU5A 3DA9B 1TPAE 1BUIA 1FQ3A 2BVRH 3LKWA 3V13A 4IN2A 1O2NA 1YM0A 3ELAH 2GV7A 1C2MA 1K2I1 6LPRA 1OYTH 1FNIA 3ATLA 2BD2A 3RM0H 5EJZA 1AWHB 1H1BA 3T28A 3Q3YA 2LELA 3QK1A 2Y80A 3GDSA 1SFQB 2HVXA 1KLJH 3SJIA 1AKSB 4YOJA 2AGEX 3DCLA 3T2NA 1ZJKA 3UPEA 3ESTA 2AERH 2QF0A 2F9UA 4K60A 4A1VA 1TBQH 7GCHG 1O2ZA 3ZYDA 3LIWA 1C5QA 3NK8A 1BCUH 2R9PA 1V2QT 1RD3B 3BTFE 2Y7ZA 1A0JA 2Q6GA 2ODPA 1ELDE 1CGIE 2GCHF 4F49A 3E3TA 3I78A 2B5TB 2V3OH 1VR1H 1AIXH 1MKXK 3T25A 3KIDU 2ULLA 1ZTLA 4UFGH 1GCDA 2P8OC 5KGOA 5TCAA 3MH4A 3VB5A 3M3TA 3FZDA 1TX8A 2WYJA 4Q2KA 1KTTB 4JMYA 4RT0A 2ALVA 1HAYB 1O3AA 1LVOA 1ELGA 4ABDA 4UONA 1ETRH 4ABBA 2Z7FE 2BMGB 1A5GH 5C3NA 3TGIE 5AFYH 1HV7A 6GCHF 1P03A 2AMDA 2ESTE 2R3UA 1VJ9U 3GICB 1NM6A 5F8TA 5G4BA 2WUBA 5GCHF 1JIMA 2BQ6B 1VGCC 4ACBA 3MH6A 3MNXA 3SO3A 2R3YA 3GDUA 1GHXH 1HNEE 1Y5AT 1ZR0A 3TJVA 4B2BA 5ABWA 1GI7B 4IBLH 4P00A 1MMJN 1SHYA 2R0KA 1O2LA 1ACBE 1HCGA 2O8TA 1O2HA 4P02A 2BD3A 1O2OA 3KQBA 1O3CA 1O3JA 3GS9A 2ALPA 1WAYB 1T31A 1FI8A 1O5CB 1C5RA 3OTPA 3M3SA 2ANYA 1OXGA 1YPGH 3MU1A 1ZYOA 1T32A 3PROA 5T6DA 2Y5GA 1F2SE 4B2CA 3A8CA 1CVWH 3UAIC 2VH6A 2JJ2D 1GBMA 2QA9E 3D65E 2P3UB 4I8JA 4AORA 3FAOA 1G3DA 2B9LA 1PQ8A 1T8OA 1JRSA 4MPWA 1TRNA 1ZJDA 3RXJA 5T6FA 1LPZB 1T4VH 1THSH 1LTOA 1TWXB 2GP9B 2P16A 2AEIH 3SNAA 3F0PA 4AN7A 1IQLA 3NRLA 4VGCC 1EATA 1ETSH 3RM2H 4Q80A 2WPJS 3BG4C 1G3BA 4YZUA 2OBQA 1KYNA 1NO9H 1EZXC 3RXSA 1GCTB 5JBTA 5JYIA 2DE8A 2EI8A 1HJ9A 1P12E 3KQ5A 3KHVA 3KN2A 1TMUH 2A4RA 5LPEA 3I77A 5TCCA 2P95A 1GVLA 1TOCB 5C0UA 3A88A 1GI2A 2NU1E 3RLYH 1YLNA 2ZZUH 3GY5A 1QB9A 1W3CA 3GY7A 5C0TA 1CA0C 5DP5A 3LC5A 2VB0A 1DITH 4K5ZA 2BDBA 1MTNB 3P8OA 1C5UA 1BIOA 4CREA 3PV4A 1N8OB 2UUFB 1O2MA 3GCHB 1OKXA 2J2UA 3RXGA 1O3PB 3BSQA 1CHGA 3UQVA 1ZLRA 2ZDNA 1HAXB 3M5MA 2TGDA 1JWTA 4XBBA 1QTFA 4WH8A 1CHOG 4JZIA 1J17T 5EJ1A 1IQNA 3FZZA 2G52A 1TNIA 3BIUH 4FU8A 3F6UH 2OUAA 5HXFA 1PQAA 2GZ9A 2VWNA 5DK1A 2WPIS 1KDQA 2Z9LA 2HVYB 2BDIA 2H5CA 1CGJE 2BOKA 2QE7D 2SGAA 1SVPA 1P10A 1C4U2 1CQQA 3PTBA 5FBIA 2XWAA 4H6TA 1H9LB 1DANH 2OXSA 4WMFA 2ANMH 7GCHF 3OFND 5B6LA 1KXDA 4NIVA 1VITH 1WQVH 4ACAA 2ZGBH 3ODDA 3EA9A 4TY7A 2QXGA 5DG6A 1LPKB 1LPGB 1BTWA 3ZZ3A 1BJUA 1T8LA 3LGIA 1IQHA 3UFAA 1F0SA 1HAVA 2GDDA 4MLFB 2FX6A 3B9FH 2EEKA 2C3SA 1WU1A 1S84A 3HK6B 4Y6DA 1QQUA 1TPOA 3GY3A 1QR3E 1NTPA 1BRCE 4NA9H 3F2HA 1XUFA 4X8UH 1EB2A 1CBWC 2C8XB 2GVFA 1AUTC 1C5VA 2BY8X 1O3OA 4ABEA 2QV1A 1VCPA 5EXLA 3E0PB 2ZQ2A 1MCTA 1O2VA 3GISB 2G4UA 1O36A 1RXPA 3OSYA 1SGPE 3U98H 4MNYA 4U32A 1C1QA 1GJ6A 4BAOB 4ZCNA 2AIQA 4X2YA 2A4GA 3BTQE 1SGQE 1C5YB 1DLEA 5HM2A 4I31A 3MHWU 3AK5A 3QTVH 2Y6TA 1XMNB 4AGKA 5C2ZA 1SGRE 3PMBB 9LPRA 4AFSA 3GCTG 1AUJA 2WV4A 3H09A 3A80A 4Q4LA 2A7HA 5EGMA 2A7JA 4JZ1A 3U69H 4CRBA 1EB1H 1LDTT 5C5NA 4XOJA 4Z0KA 3QO6A 2FO9A 4A92A 1QCPA 2K1QA 3Q76A 3K65B 1TRMA 1C2JA 3M35A 3QN7A 4O3UA 4LZ4B 3K2UA 4UE7H 1HLTH 1Y59T 2BTCE 3WY8A 3M3VA 3SJ9A 1K1MA 3TNTA 2THFB 1KMHB 1ZSLA 1GMDF 1C1WH 3BTDE 3ZVGA 1KXCA 1GBFA 1H4WA 2QF5A 1MTVA 4HTCH 1HJ8A 1Z7KA 3D62A 2HPQH 1GBAA 2IOTA 3SGBE 3A86A 3SORA 3O8CA 2AIPA 3GYLB 4IS5A 1TGTA 4ABIA 3PMAB 1K1LA 1P04A 1PPCE 2AHME 5DP3A 2O8LA 4ABHA 1O2RA 1Q31A 1GMCF 1LVBA 3E1XB 2W3KA 1B0FA 2FIRH 4ISLA 4YOGA 5EPNA 3TU7H 1O31A 2PGQB 4D9RA 1H9HE 3KNXA 1HPGA 3ZZ7A 3ZVFA 4Z1MD 1HGTH 5A8YA 1SR5C 4X6MA 4WXIA 1QZ8A 1QJ6B 1CU1A 1PPHE 5A0AE 3QLPH 2OBOA 4ZHAA 2IPQX 4JZDH 2BX4A 3TGJE 2W5EA 1GDUA 3PLBA 1AD8H 2J97A 3U28C 1RIWC 5CHAB 3PTNA 1MKXH 5DKMA 3SW2B 1A46H 4GAWA 1O2JA 2PSYA 1NFXA 5DP9A 2VIVA 5AHGH 2Z9IA 1NPMA 1XUGA 2AFQB 1ETTH 2V7QD 1M9UA 1CO7E 4NIWA 4DIHH 2UWPA 1TX6A 1W14U 3ZVEA 3A85A 1TNKA 1EPTC 1YGCH 4MNVA 1AHTH 1GMHF 1AB9B 1HFDA 4D8NA 1TQ0B 1MTUA 4X6NA 4BTTB 2H2ZA 3LT3A 4HFPB 4XBCA 3DSPA 2GJGA 5FX5A 1UTKA 3ZIAD 4FU9A 1C2FA 2VGCB 3W95A 1UVOA 2R2MB 4BXSA 1TRYA 4GHQA 3SU2A 1YKTA 2ZHEH 4OS5A 3RU4D 2H9HA 1SMFE 3MMGA 2FOEA 2XNDD 2L74A 4UFDH 2VBCA 2GCHG 1PPZA 1IOEA 1P2KA 4IMQA 2VVUA 2YMSB 2GV6A 1O5EH 1KLIH 1HXEH 1J15A 1G2LA 1BOQA 2PKSB 1C9TA 4H42U 2EI6A 3D23A 2XCNA 1TOMH 1DWCH 3RMLH 3HKIB 3PO1B 1JXPA 4FOUC 3PV5A 4E7NA 1D3TB 2G81E 4B2AA 1V2VT 2BY9X 2DUCA 1U6QA 1BHXB 1BRAA 4XFQA 2Y5HA 1ANCA 4MG3A 1PPEE 6GCHG 2WV9A 1WSSH 2BLOA 3PLKA 5GCHG 2SGQE 4Y76A 1GI5A 1Y3VA 2ZFFH 1HDTH 4JK5A 4Y0YE 4BXWA 2OINA 5C67A 1HXFH 1FONA 2HRVA 2ZGXH 1GJ9B 2JJ1D 1A0LA 1ZTKA 3A7XA 1GL1A 3SU0A 3E6PH 3M7TA 4X6PA 3QX5H 1MTSA 2OK5A 5H4IB 1SOTA 1S6FA 3OYPA 3SZNA 3MOCA 1GBDA 1XVOA 1EASA 1LHCH 1KTSB 1DWBH 2WPLS 1ESTA 2TGPZ 1V3XA 1GJ8B 1UTJA 1C2EA 2BDGA 3NPSA 1G2MA 3RXIA 4AYVB 3MU8A 5A8ZA 4TWYA 3M7UA 2ZDKA 1UVSH 2Z6BD 1FPHH 4CRGA 3SV9A 3OEHD 1LHDH 5FHTA 3SV7A 3WWFA 4I86A 2FX4A 4HGCA 1UJ1A 2ZP0H 3HK3B 3BG4B 4O97A 1BMFD 2C8YB 3AW1A 2XOKD 1SBWA 1LHFH 1T8NA 1LVMA 1UVPA 1K1JA 1B0EA 2ZCLP 4TSFD 3RDZA 2H9EH 2OQUA 5C1YA 3ZVBA 2ZEBA 3RC4A
chains in the Genus database with same CATH topology
1V2JT 1SGTA 1P2NA 4FUGA 4SGBE 3AW0A 5E0GA 2FOFA 4KTSA 4E06H 1UHBB 2OC7A 2TRMA 4ZKRU 1BTYA 1GJ5H 3TVJB 1C1TA 2FODA 2WINI 1YLCA 5AVDA 1DE7H 1W7GH 3K9XB 5GIBA 3ZV8A 1BQYA 1YCPM 2F83A 4AOQA 3A82A 6CHAC 2FXRA 1O38A 2ZKSA 1DT2A 1YLDA 2HGTH 1QL7A 3MU0A 4INKA 1C5MD 5T6GA 1SQAA 1S85A 5FX6A 2FP7B 1LKAA 1ELFA 2RA0A 2OCVB 1XXDA 2NU0E 2NU3E 1Z6JH 5LH8A 1GBLA 2ODQA 3NWUA 1C1NA 4Q7YA 2ZHWH 4ESTE 1KIGH 1MBQA 1SI5H 2GZ8A 1BMAA 3S9CA 1P01A 1AE5A 4INHA 1WYKA 1UCYK 2HLCA 1ABIH 3RMMH 1F92A 1UCYE 2FI4E 4JYVH 4JCNA 2CHAB 3U9AH 1B7XB 1CSOE 3RXTA 3SQHE 1GBCA 1N6YA 3T27A 2AMQA 2ZGCA 4ISHH 1ELAA 1H8DH 4OS6A 3CP7A 4I8LA 5FBEA 1QNJA 3RXDA 3W94A 1EP5A 1A5HA 4ZH8A 1GDQA 3GCOA 3RXQA 1L2EA 1SC8U 4NWLA 2G5VA 2CF8H 1HAHH 5TJXA 3A8BA 1CT4E 4K1TA 2XRCA 3UY9A 2JETC 1P06A 3BEFB 2PV9B 4DGJA 1AFQC 3SI3H 3IITA 4IC5A 1GWAA 1LKBA 4K8BA 5A8XA 1GGDB 1MZDA 1VCWA 2GDEH 1OWKA 3SNBA 2CV3A 1ZSKA 4FUCA 4X2VA 3RMNH 1K1NA 1BTPA 1HBTH 1VITF 1C5OH 3KL6A 1GBIA 2BLWA 3A7WA 1S81A 5EXMA 2SFAA 1LQEA 1P57B 4O9VA 4WF8A 3SU6A 2FDAA 3URCA 1Y8TA 4DT7B 1TYNA 3MWIU 3NCLA 4I8HA 1J16A 2V0BA 2B0FA 3SUEA 3RXAA 1E35B 2C93B 3BTGE 1EJNA 1A4WH 4DURA 1SGFA 3ZV9A 3GY6A 1O5GH 1TFXA 5JDUB 2ZFPH 3RXRA 3Q3KA 5GPIB 2PUXB 1SLXB 1ZRBA 1C9PA 1W11U 3ZZ6A 2JH5D 1P09A 2QXIA 3F9HA 1NS3A 1OOKB 5GWZA 2B8OH 5IDKA 3SHAH 3M36A 1N6XA 3A84A 4WXVA 2XYAA 3PWCA 3GDVA 3EDXB 4NSVA 3OX7U 1EX3A 2V6NA 2PKAB 1OWEA 4CHAB 3VGCC 1GG6C 1QL9A 4AG2A 1GHAF 2BQ7B 4I7YH 5GJ4B 1IQKA 1GBTA 2FOGA 4MQAA 4X8TH 1AI8H 2BY5X 4GCHF 1YCPK 4NZQA 3SGQE 7LPRA 2ZU4A 1BBRK 1ZOMA 1KXBA 4K3JA 1GMDG 1BBRE 1O2WA 2FTLE 3A89A 2XBXA 1PYTD 2VWLA 1W13U 1A3BH 4TY6A 1BT7A 1HAPH 1ELCA 1GDNA 1GHBF 1PYTC 2OC1A 2D2DA 2ZU1A 1HAZB 1NFUA 1TPPA 3P8GA 3B23B 4X1PU 3ATKA 4RKOB 2AMPA 1NRPH 1DDJA 2ZI2H 1C4Y2 2FI5E 1P2OA 1FY4A 2FPZA 4DJZB 5DJ7A 1KXFA 2ZWLH 3NUMA 4AG1A 3VPKA 3U1JB 1GMCG 4Y8YA 1AZ8A 4NFFA 1C2DA 3RXVA 1HJAC 3ZZ9A 1WTGH 2Z9KA 1Y5BT 4ZUHA 4AB8A 3V0XA 3UNQA 1XKAC 2QAAA 4WMDA 4E05H 2A32A 3RXPA 3RXFA 3TNSA 1SB1H 3M61U 2UUYA 2J38A 2XC4A 3EYDA 2ZA5A 2C4FH 4JYUH 1AO5A 3S9BA 3BEUA 3RXOA 1V2MT 1O3EA 4JZFH 2ZDMA 3MNCA 1SOZA 2F91A 4FUFA 3DFJA 3SQEE 1EAIA 1FJSA 1SPJA 2W7SA 1FIWA 3GCNA 5E0HA 1O3IA 3SUDA 2FS8A 3TH2H 1MZAA 3QDZB 1INCA 2WPHS 1TE0A 1P8VC 1SLVB 2ZGJA 3TITA 5HMAA 3V3MA 4AZ2B 1XXFA 2FWWA 1DICA 1GMHG 4A1XA 2PTNA 2ZFQH 3LDXH 1GVKB 4KKDA 1PPBH 2ZO3H 4YT7H 4GSOA 1X7AC 1YPJH 2B7DH 3AAUA 2GD4B 1TB6H 1QY6A 3GYMA 3P92A 1MAYA 3AVZA 1EZSC 4NWKA 1CGHA 4MPXA 2BX3A 2BZAA 3SV6A 2TPIZ 4FUEA 1HB0B 5PTPA 1GBJA 2FLBH 5C5OA 2BY7X 2FI3E 1DUAA 2A2QH 1KLTA 2J92A 3TJOA 5C1UA 1C1OA 2FLRH 1YPMH 1A61H 4Y7BA 4ZKSU 1OP0A 2ZIQH 4J2YB 5F8XA 4B73A 3FFGA 2A45B 1YC0A 3FP7E 1W0YH 5BPEA 2UWLA 1L0ZA 2BDCA 1F0TA 4MPVA 1GPZA 1ZTJA 1UTOA 1O2SA 2TIOA 4KTCA 3BG8A 2BB4A 3C27B 1F5RA 1ARCA 2IPHA 2BVXH 2G5NA 1AMHA 4FUBA 2Z3EA 2Z3CA 1EKBB 1FAXA 3SBKA 3UREA 2O8UA 1ELVA 4ABFA 3BIVH 4X6OA 2ZCKP 1O3FA 2QGRA 1GL0E 3PB1E 3SU5A 1IQEA 3JZ1B 1V2ST 2HWLB 2ZNKH 3OY5U 4Z6AH 1D9IA 4H4FA 1O2TA 1N1LA 3P70B 1QRZA 1FPCH 2V3HH 4B1TA 2XWBI 2HNTE 3UR9A 2AGIX 1PJPA 1ANBA 4CBOA 5J4QA 1QRWA 2R0LA 1D3DB 1MD8A 3MYWA 1PPFE 5K0HA 5IYTA 3RXUA 1DS2E 4K1SA 1TA2A 2NU2E 5GXPA 3SGAE 3RXBA 1DY8A 3E91A 4CRDA 4CR9A 3MH5A 4F4OC 3C1KA 1WQSA 5HGGA 1FN6A 1YBWA 4XE4A 2P59A 4CRCA 1Z6EA 3H7TA 3RP2A 4BTIB 5C1XA 1PQ5A 4ZXYH 2J4IA 1UCYH 4LXBH 2A2XH 4X8VH 1C5XB 2BXTH 1GBKA 4CH2B 6CHAB 2VINA 1BJVA 4YTAA 4NIXA 1OYQA 5A2MH 1HRTH 1J9CH 2PLXA 3ZVAA 1CT0E 2M5TA 4B71A 1WCZA 2ZU3A 1QBOA 1TAWA 1ZGIA 3BF6H 1PFXC 3TJUA 1OS8A 2Y82A 5JBCS 1O2XA 1C2KA 1L4DA 1RTKA 1YYY1 5J4SA 1QQ4A 2ASUB 8ESTE 1MAXA 3QUMP 1UHBA 2J94A 4SGAE 1OWHA 4E7RG 2A5KA 1TNLA 5JBAS 4LK4A 1AZZA 1T7CA 1EXFA 2Y81A 2VNTA 1O3BA 2QYIA 2ZQ1A 4M7GA 2BD7A 1V2RT 1FN8A 5EODA 5HM9A 2RDLA 3A83A 5FPSA 1OP2A 2DE9A 4JYTA 2IN2A 4AGJA 1LCYA 3ODFA 1XVMA 1GI9B 2TBSA 2P94A 3P8NA 3PM3A 1ZPBA 3STJA 1C1MA 5I25A 3VB3A 4GPGA 4GLYA 1Y3XA 2GMTC 2F9OA 3F9FA 3E0NB 3T29A 1FUJA 2FYRA 4MDSA 1NU9A 3PMJA 4BAHB 2BYAX 4UDWH 1DY9A 3KGPA 4YOIA 1TX7A 1MU6B 3RU4T 3SV8A 4Q7XA 5EOKA 1ZHRA 4KELA 3TK9A 3PYHA 3A8DA 4U2WA 2O8MA 1SQTA 1GCTC 1D6WA 3LGUA 1AU8A 2P8OB 3SI4H 3ATIA 1EJMA 4ABGA 1AKSA 2VWOA 1P9SA 1KDQB 1MQ6A 3GY4A 4BNRA 1FAKH 1V6DA 1DFPA 3K6ZA 3RXCA 2A1DB 1TBZH 2ZTXA 3R0FA 5ESTE 5EQQA 1ESAA 4KP0A 4O3TA 5DP8A 1C1PA 3DT0H 1VITG 3EQ0H 1MTNC 3P6ZB 1DLKB 2FESH 1YCPH 1N8OC 2J34A 2KAIB 3GCHC 4K1EA 1VGCB 4ZROA 2FOBA 1O2GH 1S0QA 4FUHA 4FVBA 1SSXA 2PSXA 1MU8B 3DUXH 1EOLA 1XM1A 1BTXA 3SN8A 1DM4B 2QXJA 2I6QA 5F03A 2SGEE 3O8RA 1IQMA 4ABJA 1G3EA 4FUDA 3VGCB 2OC0A 3O8BA 3UWJH 3S9AA 4BAKB 1YPKH 1ORFA 1K22H 3LH3A 3A7ZA 1QA0A 1W10U 1T8MA 3U1IB 3SNDA 3SUFA 4AFQA 2FS9A 1C5WB 1UK3A 1DOJA 5EQSA 3VFEA 2IJOB 3HPTB 1GI3A 2AGGX 4ISNA 4BAMB 3VXEH 2QY0B 1BZXE 1O3HA 2PR3A 3MO3A 1GHAG 2QC2A 1P2MA 4GCHG 1K28D 3RXMA 2FM2A 1LO6A 1OPHB 1SGYE 2PKAA 4YM9A 1O3NA 1Z8RA 2OD3B 3UNRA 5L2ZH 2ZPQA 3I29A 1Z1IA 3TK6A 3MFJA 3SJKA 3VB7A 1GHBG 2ZDAH 1ZMJA 2JKHA 4VGCB 5LPRA 1RS0A 3RU4E 4AYYB 4X0WU 1SL3A 3BTTE 2Z9GA 3F1SB 2XXLA 4THNH 1ID5H 2Z9JA 3E90B 2F3CE 4Y0ZE 5E2OA 1GBHA 3A7VA 1K1PA 1L4ZA 4ZXXH 3UNSA 1QHRB 3L33A 1QRXA 3HGNA 2WPKS 3BV9B 3MO6A 1NU7B 5DP6A 1G9IE 3RMOH 4WMEA 1G36A 1TLDA 1KXEA 4Y8ZA 2F9VA 2XC5A 4BOHA 1CA0B 4RSPA 4KGAA 1Z71A 3FANA 1P2IA 4J1YA 4WJG2 2ZG0H 4Y11E 3TJNA 2Y5FA 2XBWA 1W12U 1C1SA 4WY3A 1CT2E 1ZHPA 5AFZH 4JK6A 3A81A 1YP9A 1C5ZB 4CR5A 3SOSA 3TGKE 1NY22 5JPMH 2BLQA 1EZUC 2QF3A 1NRRH 2EA3A 1YF4A 2J95A 1V2PT 4DW2U 4NIYA 4Q7ZA 3P17H 5FPYA 2FYQA 1OSSA 1V2WT 1OX1A 1HIAB 3ENSB 5HYOA 3UIRA 1UTQA 2I6SA 1Q3XA 1CE5A 1AVWA 1O5FH 1MKWK 3EA8A 4D7FA 1MH0A 1S5SA 1TALA 2G8TA 1O2KA 3E8LA 4HI3A 4AFUA 1G32B 2ZGHA 2TGTA 4BAQB 2A4OA 3IWMA 4DOQA 3NZIA 2C90B 4BTUB 1O3LA 3KCGH 3TH4H 1W0ZU 2F9BH 2HALA 2H9TH 1F5KU 1THPB 3P95A 2SGDE 1S82A 3TLOA 5T3HA 2BM2A 1EP6A 1H9IE 3RUOA 1C5PA 2A4QA 4B75A 1C4V2 2PFEA 1CBWB 4IC6A 3Q3XA 2GGVB 3ITIA 5F6MA 3BEIB 1C1UH 1A1RA 3S7KB 1VCQA 1GI4A 3NKKA 1GI1A 3SNCA 2A7CA 1E38B 3P8FA 5DP7A 3OTJE 1ANDA 1EAXA 1JRTA 2GT8A 1AGJA 5CHAC 3BTME 1ZPCA 4Y79A 3LGWA 1BRUP 4NFEA 1NESE 2G51A 4YLQH 5C20A 3SU1A 1O2QA 3CS0A 1V2OT 9ESTA 1DSUA 1DPOA 2GKVE 1FV9A 3F9EA 3M5NA 4JZEH 2BY6X 1Z8IB 4X1NU 1ABJH 1DXPA 2VIWA 4WVPE 4MVNA 1D3QB 1EJAA 8GCHF 5F8ZA 1SLWB 3RXKA 2O8WA 1AB9C 2W7UA 4TWWA 2AYWA 2XC0A 1SGEE 3QZRA 4YT6H 5L6NH 1V2LT 3CS7A 1C1RA 2D1JA 4NZLA 4UFFH 2VGCC 1OWDA 1V2TT 2Q1JA 1A3EH 4DVAU 2D26C 5E8EH 1E0FD 1J14A 2QCYA 1MD7A 1RTFB 4DY7B 1XUIA 2PTCE 5FAHA 1XUKA 3SHCH 4OS2A 4OGYA 1SGIB 3OY6U 1EAWA 2CF9H 5E2PA 1NRQH 2UUKB 1NZQH 2FOCA 2YOLA 4KTUA 1OWJA 2H6MA 1NC6A 2PKSC 4B74A 1UK2A 2D8WA 3IG6B 1QL8A 3MI4A 3RXHA 4R0IA 1FY3A 1TA6A 3HATH 3ATWA 4NSYA 1WOFA 2UWOA 4WH6A 1FDPA 1BMLA 3PO1C 2ANWA 1O3KA 5CMXH 1QA7A 1ARBA 4R8TB 2WYGA 1O0DH 5DP4A 1TABE 1MTWA 1RTLA 1JMOH 1V2KT 2RA3A 3BN9A 2VVCA 1C2IA 3Q77A 5FCKA 4OGXA 1C2LA 5EXNA 4D7GA 4ZKNU 2GT7A 3R3GB 1L1GA 4GUXA 5CE1A 1BTHH 4ISIH 4A7IB 2CJIA 1ZMNA 1W8BH 2C8WB 3V12A 3SJOA 2GCTC 4K2YA 4GVUA 1C1VH 2ZTYA 1UVTH 2PGBB 1HAGE 4ZKOU 1XKBC 1P2QA 2XW9A 1EUFA 2HPPH 3MU4A 2UUJB 3TK5A 3BTEE 4FUIA 2BVSH 5ESBA 1BTUA 4XSKU 1RIWB 2W3IA 2G4TA 1TNJA 4ASHA 2ZU2A 2GMTB 1QIXB 1O39A 3QGNB 1Z8GA 1A2CH 2Z3DA 2F9PA 2ZPRA 2J9NA 5A09A 1ELTA 1QURH 1RFNA 2O9QA 4QT8C 5EG4A 1C5NH 2ZHDA 2PHBA 2EC9H 1IQFA 8KME2 1P0SH 1K1OA 1UTPA 1EPTB 1HAOH 4YO9A 3UQOA 4ZHMU 1GJ7B 2G55A 3CENA 3VB4A 1D3PB 4I8GA 1IAUA 3ZZDA 3A87A 1VJAU 5DGJA 3TPIZ 3LONA 1AVXA 1KSNA 2XBYA 4UEHH 2BQWB 1F0UA 3LGTA 1K1IA 3SU4A 4AB9A 2FTMA 3ZVCA 3T5FH 3MO9A 2AS9A 1UO6A 2Q6DA 3UOPA 1ZRKA 1LHGH 1GBBA 1C2HA 4NGAH 1AQ7A 1ELEE 3TIUA 2ZFSA 1QJ7B 2OC8A 1FY1A 1AWFH 1UTNA 2NWNA 2GX4A 1O3MA 1UK4A 1QB6A 1J8AA 1LVYA 4FU7A 4ISOA 2YNAA 3RC6A 6ESTA 1ZGVA 2HNTC 1XX9A 3A7TA 1DWDH 2ZC9H 3KQEA 1TGNA 1DSTA 2HOBA 2PWXA 4PROA 3U8RH 1G3CA 1UVUH 3KF2A 3UWIA 3EE0B 2BLVA 2ZU5A 1BRBE 2W26A 1GHWH 5FPTA 1TMBH 2VH0A 4X1SU 1O2YA 1TPSA 4X8SH 2BHGA 3QGJA 2CN0H 1GVZA 1AN1E 5SGAE 1QGFA 1IQGA 1WUNH