1VCQA

Semliki forest virus capsid protein (crystal form ii)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
149
structure length
149
Chain Sequence
CIFEVKHEGKVTGYACLVGDKVMKPAHVKGVIDNADLAKLAFKKSSKYDLECAQIPVHMRSDASKYTHEKPEGHYNWHHGAVQYSGGRFTIPTGAGKPGDSGRPIFDNKGRVVAIVLGGANEGSRTALSVVTWNKDMVTRVTPEGSEEW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords SEMLIKI FOREST VIRUS CAPSID PROTEIN
publication title Structure of Semliki Forest virus core protein.
pubmed doi rcsb
source organism Semliki forest virus
total genus 32
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature ec 3.4.21.90: Togavirin.
pdb deposition date 1996-03-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vcqA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1vcqA01
1T8OA 1F92A 1C2GA 1FMGA 2OC1A 1GCDA 1C2MA 2R3YA 3RU4T 1DVAH 3A7VA 1V2RT 1QURH 4YO9A 3BTHE 3HK3B 1K9OE 2B0FA 2HALA 1GI0A 3SN8A 3D23A 2FOGA 2XBVA 1O30A 4FUEA 1O2YA 2EI8A 1H8DH 1P11E 4ZXYH 1UK3A 2G55A 1FY8E 1E38B 5A0AE 1XM1A 2AGGX 5C1UA 1RJXB 4I7YH 5GCHG 3E91A 3ZZ3A 2AMDA 1C5NH 2P3TB 5C1YA 4DOQA 1PQ5A 2WPHS 1SGEE 3RXIA 1OP0A 3ZZ8A 1O2MA 1CBWC 1CO7E 2ZZUH 2CHAB 1V2LT 1CHGA 3SZNA 2PSYA 1GI6A 6ESTA 1O5GH 2AGIX 3Q77A 2FI3E 3U8RH 1NROH 3UQOA 1EATA 4AFUA 4Y7AA 1QJ1B 3W94A 3I78A 3SU6A 1HCGA 1HAVB 3SV2H 3IITA 4GHQA 5CHAC 2A7HA 4B1TA 1QJ7B 4U01A 1NRPH 2J94A 1EZUC 2VIVA 3MI4A 1O31A 1O0DH 1Y3YA 2DE8A 1K28D 1O2OA 5DP7A 1O2TA 1AFQB 2XWBI 3UWIA 1W14U 3ESTA 3GYMA 3P8OA 3BTTE 1ELBA 5F6MA 1K21H 1J15A 1N8OB 1V2ST 2WUCA 1T7CA 4CRFA 3UNRA 1TGSZ 4ZAEA 1BHXB 8GCHF 4Y0ZE 1EUFA 2ZPSA 1GI3A 2BDAA 2A5KA 1ELFA 3GDUA 1P2IA 3A85A 2ZG0H 3F1SB 5A8YA 1O2SA 1UK4A 1F0RA 3KF2A 4IGDA 7LPRA 1C2JA 1EB1H 1YPLH 1AI8H 3P92A 2ZTXA 1O36A 1O32A 2GDEH 1C1PA 2OLGA 3UR9A 1TYNA 1WQVH 2CJIA 2QCYA 4Y7BA 3GDSA 3AASA 5T6GA 4YTAA 1SLWB 2UWOA 3K6YA 3LH3A 1S5SA 1C5TA 1C9PA 5F8XA 1O3MA 1UHBB 1A5IA 4BXWA 4VGCC 4ZXXH 3VB5A 1EQ9A 4JK5A 4AGJA 3OSYA 2B9LA 4JZFH 3L6PA 2F9OA 1C1MA 1QRWA 2GCHG 1GG6B 3KNXA 4MPVA 4K2YA 1HJAB 1AE8H 1LTOA 1IQEA 2VINA 2ZDLA 3BG8A 3A87A 5L2ZH 2RG3A 3MTYA 2OD3B 4INHA 2QA9E 3RMOH 2GZ7A 4XDEA 1WQSA 1O3OA 5JBTA 1TA6A 2ZEBA 4BNRA 1ZMLA 3I29A 2ZU5A 5E0HA 1MTUA 1EPTA 3NKKA 4X0WU 3K6ZA 2JH6D 2NU1E 1V2PT 3URDA 1MKXK 1ELCA 3BEUA 1GJ4H 1BITA 3SU3A 3M37A 3LPRA 1ZRBA 3UIRA 1Y5UT 4X6NA 2PUXB 1EP5A 5AFZH 1Z71A 3RMLH 1Y5BT 1CA0C 2BD2A 1G3BA 4WMEA 1GBAA 4A1TA 4Y0YE 1PQAA 1O3GA 5ABWA 1A5HA 1ANBA 4LXBH 4WH6A 3M7UA 4IS5A 1W7XH 2QXJA 3F9GA 3T2NA 3KN2A 1G3DA 1E0FD 1BJUA 1V3XA 4ABHA 4DG4A 4PROA 2CN0H 3H5CB 2F3CE 3BTWE 3A83A 1C5UA 2TBSA 5E2OA 1JMOH 3MO9A 3Q3YA 1OPHB 1CQQA 5DKMA 1LVOA 1EAUA 4A1VA 1O2ZA 3VB4A 2Z94A 9ESTA 3PO1B 1EJNA 1BTPA 3OTJE 1EOLA 1D6RA 4YLUA 3GY4A 3KGPA 2VVUA 4BAQB 1P09A 3K9XB 1GBFA 1GVLA 3ODFA 1AVWA 4AOQA 4JYTA 4K1SA 4HI3A 1GJ8B 2NU2E 4X8SH 1A1RA 1IQGA 1LQDB 1JOUB 3LC3A 3Q3KA 3QZRA 4JYUH 1RTLA 5DG6A 2KAIA 3Q00A 3SU1A 2WYJA 1C9TA 2G5VA 1O5FH 2O9QA 1RIWB 3SV9A 2GCHF 1HXFH 3F9HA 1AZ8A 2I6SA 1GPZA 1UTNA 1BTYA 1GI2A 1C5VA 1TB6H 5F8ZA 2FMJA 1SFQB 2W7SA 1K1JA 1W13U 3M5NA 3SW2B 1YGCH 3VGCC 2C3SA 5A8ZA 2OQ5A 1FY3A 2BHGA 4ISHH 4TWYA 1C5RA 1O2IA 1F0TA 3E0PB 5L6NH 4K3JA 5FHTA 1W2KH 2FLBH 3A89A 3F68H 1C2KA 1SLVB 1T4VH 1SQAA 2H5CA 1GJ9B 4O3TA 1YC0A 2Z9JA 2FYQA 1YKTA 1W11U 4ISLA 1HJ8A 3FP7E 3EA9A 2FEQH 1O3FA 2UWLA 1O3CA 3GY5A 5DPAA 1XX9A 2H5DA 3VB6A 1DLKB 3UFAA 4LZ1H 1OP8A 3SQHE 3M61U 3FVFB 2O8MA 1MBQA 4I8KA 4AGKA 2WV5A 2C4FH 3UR6A 1THSH 5HM2A 4YOGA 4TY6A 4JMYA 4O9VA 1V2JT 3AAUA 2GVFA 2Y5HA 3TU7H 3SHAH 3B9FH 3MOCA 3SJIA 1HRTH 4DIIH 3VB3A 3TGIE 3O8RA 2BLVA 2V0BA 1ETSH 3QK1A 4Y76A 1PPCE 3M7QA 2JH5D 2ZFPH 1S85A 1JIMA 1SBWA 1VGCB 4F49A 1NZQH 5JYIA 1NRNH 5C67A 1C1WH 5T3HA 3RXLA 4THNH 4FVDA 4Y11E 1MD7A 1Z8GA 2F9UA 1UO6A 1ZJDA 4HZHA 1S6FA 2ZU3A 1C2HA 1EZQA 1UTPA 5C5OA 4B2AA 3ZZ7A 2FX6A 3D65E 1TPSA 2A32A 1XVOA 4GUXA 2Y81A 2BX3A 1QGFA 3PMJA 1BMAA 1KDQA 2I6QA 4ZKOU 1BBRH 1ZR0A 2XBWA 1SGDE 2FX4A 1AKSA 1TMUH 4XBDA 3TH2H 2PTCE 2OBOA 4I8LA 7KMEH 1ZHMA 2WV4A 5BRRE 1OWHA 1EZSC 1GHVH 1BRCE 3NPSA 1Z6EA 2A4OA 3ITIA 1FNIA 1DSUA 1Z6JH 1XXDA 1ZSKA 2ZFSA 2YNBA 3RXVA 5I25A 3LJJA 3MNSA 1NTPA 1O2NA 3C27B 3BTDE 4GLYA 2H1UA 1TGTA 1EX3A 2EI7A 1EAWA 2ALVA 4TY7A 4NGAH 1UTMA 5K0HA 2ANWA 1FN8A 2F9VA 1YPMH 1EJAA 1O2XA 5DP6A 1DXWA 2BDCA 1NFUA 2AFQB 2J95A 4JZDH 3PO1C 2BQ7B 2IPHA 3MO3A 3A7WA 2P16A 1FI8A 1DWCH 3P70B 2ZP0H 3T27A 1MTWA 1GHAF 2JETB 2IN2A 4UDWH 1O2KA 2GZ9A 2AGEX 2VGCB 1UTKA 1O5EH 1AWFH 3A8BA 1Y3UA 2PKAB 1TBQH 2J34A 3PTNA 1H9IE 2FODA 1DY8A 1GBDA 3M5LA 1LVMA 2FOFA 2G4TA 5JBBS 4ISNA 3SJOA 4IMQA 1ZPBA 2SNVA 1QA0A 3SOSA 5AF9H 1OSSA 2AMQA 3LJOA 3RXQA 5A8XA 2ULLA 2O8WA 2FM2A 2DE9A 1LPGB 1C2FA 2BY8X 1L4ZA 1O2UA 4X8VH 3HGNA 2HLCA 1C5WB 2ZCKP 3NZIA 2G4UA 2BDHA 2ZU1A 1DANH 3BV9B 2HOBA 4BTTB 1EJMA 4YM9A 1C5PA 3TJVA 3UY9A 2B8OH 1GMDG 3QGNB 1UCYK 1ZMNA 2V6NA 2JKHA 1TRNA 3UPEA 2VH6A 4NA7A 2AYWA 3QDZB 3MMGA 4M7GA 1VCQA 5EPNA 1YP9A 1ZZZA 4FXGH 1YPGH 2BXTH 1OWIA 3QWCH 1GBLA 2ZTZA 4ZHLU 2STBE 2P3UB 2BM2A 5GPIB 4CREA 2C8ZB 2FOMB 3U8OH 2IOTA 1ELGA 3A86A 1NU9A 1HAVA 1TRYA 1Y3XA 2QYIA 1QB1A 2Q6DA 5A2MH 1SGTA 3C1KA 3BTKE 1GHXH 5GWZA 2SGAA 2BQWB 4CHAB 2FTLE 4I33A 1P01A 1ZOMA 4X1NU 3RM0H 1TLDA 2FOEA 3BG4B 3MFJA 3Q76A 1IQJA 1P12E 3KHVA 1HAPH 3DUXH 1ORFA 1IQNA 2G8TA 4TYDA 1HJ9A 1LKAA 2BY7X 1LPKB 2RCEA 4SGBE 5E2PA 1ZMJA 2BX4A 3DT0H 1DPOA 4MNYA 3TJOA 1UVSH 2GMTC 5TJXA 3Q3XA 1BTZA 1ZLRA 4INLA 2ZGXH 4H42U 2ZPRA 2TPIZ 1O3BA 1H9HE 1NT1A 3GY2A 3PYHA 3SNCA 1TFXA 2BYAX 1QBNA 1GHZA 1QHRB 3TIUA 1TNJA 1P05A 1P06A 4ZKSU 1TPPA 1GI5A 1ZPZA 4KTCA 3S69A 4NWKA 2A7CA 1UHBA 2GCTB 1W7GH 3LIWA 4K8YA 2ZF0H 1O3AA 1A0HB 1GMDF 1ZTKA 6GCHG 1G36A 4DCDA 1C5OH 3URCA 1MMJN 2UUYA 1AIXH 1ELDE 1BTWA 3STIA 1GJ7B 5LH8A 1F5LA 1CGHA 2ZU2A 3RXJA 4CRAA 1C1SA 3P95A 4NZLA 1JXPA 4MDSA 1TBRH 1DS2E 1LHGH 2QF0A 2D8WA 5E8EH 2FLRH 3GDVA 1NFWA 1LHFH 1Z1JA 1QCPA 3EGKH 3MU8A 1AB9B 1ELVA 3B23B 3PLBA 4U30A 1F5RA 1GI4A 2Y5FA 1GGDC 3OY6U 2ZDKA 5HXFA 2FI5E 1A0JA 1SGQE 4O03A 3RM2H 3ATIA 3LGYA 1ANCA 1AU8A 5F03A 4Y71A 4K69A 1OWDA 1NRSH 2SGEE 2ANMH 1C5SA 1GBCA 2G00A 1TE0A 5I46H 1SLXB 1MTNC 3RXTA 4B74A 1NFYA 1BB0B 1RGQA 4I32A 1P2JA 2VIOA 1OS8A 1O3IA 4NG9H 3SU5A 1ZJKA 1BMNH 3LGWA 2M5TA 5CE1A 2WYGA 4OS4A 3SNDA 3KCGH 2XC4A 1G2LA 5FCRA 3VB7A 2QXHA 4DGJA 1AGJA 5A09A 2VIDA 2VWOA 2ZA5A 3SUGA 5E0GA 2SGDE 3ZVCA 1AQ7A 3IG6B 3MU5A 4F4OC 1K1OA 3A7XA 4NZQA 4FU8A 2BY9X 1ZRKA 1NPMA 1O39A 1SQTA 1PPHE 2Z7FE 4FUIA 2ZI2H 2XNIA 1JRSA 1VCWA 2QXIA 1Z8RA 3FP8E 1V2VT 2AH4X 3JZ1B 3RXMA 4D7GA 1CGIE 3SNAA 5FAHA 3KQBA 2GT8A 5DJ7A 6GCHF 1QRXA 4K5ZA 3M3SA 2GDDA 4E7RG 1GCTB 1L4DA 2G51A 3K65B 4ABAA 5FPYA 2GD4B 5GJ4B 3RUOA 2C93B 3ZZ9A 3HKJB 2RA3A 1NRQH 1SHYA 1ZPCA 4AG2A 1BTUA 2FDAA 1TIOA 1C4U2 4AB9A 2K1QA 1ELTA 2ZHWH 1JBUH 2XRCA 1DWDH 3PB1E 5FX5A 1SMFE 1B7XB 3BF6H 2FYRA 1ZTLA 2OUAA 2O8UA 4JCNA 1MAYA 1N1LA 3HK6B 1O5CB 4YESB 2ZFTA 1B0FA 1O3PB 2ZHEH 1DSTA 2FOHA 4MPUA 4X1PU 4YLQH 2BDYA 3V3MA 1A7SA 1J16A 4FUGA 1THPB 1HDTH 2ZDAH 3TNTA 4E06H 2BY6X 2O8TA 1F5KU 2ODQA 3T29A 5C5NA 1AD8H 4OGXA 2PGQB 3EQ0H 2SGFE 1HIAB 3P17H 1TX7A 1O37A 3ATKA 2HVXA 1LPZB 3P8GA 1OYQA 4BTIB 2A5IA 1MKWH 3M5OA 5HGGA 3U69H 2Z3EA 3PWBA 1S82A 5EG4A 2Z9IA 3JZ2B 1ZGIA 4MTBA 1QRZA 3RXFA 4FUHA 1ESBA 5EXNA 3NXPA 1DM4B 2F91A 3GY8A 4BOHA 2VIQA 1RD3B 3B8JA 4WVPE 3A8CA 3QO6A 2ZGJA 3BIVH 1A4WH 3VXFH 1RTFB 5FPSA 1CGJE 1KLTA 1AY6H 4ABJA 1KXEA 1IQHA 3VEQB 5F8TA 2P94A 4RSPA 3HPTB 1BOQA 1O2WA 3BEFB 3S9AA 2PLXA 1IQMA 2F9NA 5JBCS 1AB9C 4SGAE 2VWMA 2J2UA 1T4UH 1XKAC 2F9BH 1XUHA 4H4FA 4AB8A 2R0KA 1CSOE 5DP5A 2ZNKH 2XCNA 4MLFB 1GHWH 1WYKA 3BTQE 3ZVEA 1CHOF 3STJA 3RXPA 4DJZB 2GV7A 1YCPM 4BANB 3ZZBA 2ZQ2A 1C5QA 1F7ZA 1DUEA 4GVUA 3V13A 1LHDH 1GMHG 1NM6A 1T32A 2ZGBH 1P2QA 2NU4E 5EODA 1NN6A 5EW2H 3HKIB 1UTQA 1QBVH 2H9HA 2BD4A 1SGFG 1EXFA 2QXGA 2ZECA 3GISB 1DFPA 2R3UA 2AMPA 2OTVA 3MH6A 3PM3A 4WJG2 2A31A 7GCHF 5FBEA 1QTFA 1ZGVA 2STAE 2XW9A 2A7JA 1AWHB 2H2ZA 1HBTH 2H9TH 5LGOA 2ASUB 2BOHB 2D2DA 2HNTC 1P0SH 2HGTH 1PPFE 1YM0A 5K7RA 1AO5A 3FZDA 2ZKSA 3E90B 4FVBA 3M7TA 4B2BA 1ZHPA 1C5MD 1IQLA 1XUKA 4WMDA 4CRCA 1RTKA 2C8WB 2FWWA 1AE5A 4XE4A 4MNXA 4UFEH 2HPQH 2CHAC 3R3GB 3RC5A 4A5TS 1GBIA 3BN9A 4ZKRU 4AZ2B 2BVXH 5C20A 4ISIH 3TLOA 4FUCA 1ETTH 2Z9KA 5J4QA 1WUNH 4KELA 1LHCH 1RS0A 1WCZA 2G81E 4ABDA 1XMNB 1DT2A 1L0ZA 3PV4A 2ZCLP 1GVZA 3SU0A 1AFQC 1V2QT 4NA8A 2VJ1A 2UUFB 3A7YA 2YNAA 1N8OC 1VITG 1T8NA 2FPZA 2GX4A 2QAAA 1HUTH 4IC6A 3KQEA 3N7OA 1EASA 4D9QA 5DO4H 1ZYOA 2W3KA 2ZPQA 3AAVA 1PPGE 2BDBA 2SNWA 3SI4H 2ZGHA 1QFKH 1V6DA 2BMGB 3ZVBA 3HGPA 1P10A 1ELEE 1S84A 1GMHF 1O2GH 1MZAA 2Z3DA 3GY3A 1HPGA 1KLIH 1GHAG 1H9LB 4INKA 4MNWA 1YCPH 2ESTE 2CF9H 1HAGE 1BRAA 1O3HA 3ZVGA 5C1XA 1VITH 4MNVA 5L2YH 1EAIA 3GCHB 2A2XH 4IBLH 6CHAB 2Q6GA 4DVAU 1BTXA 1GG6C 4UFDH 1HJAC 1O3KA 4A7IB 2V3HH 2R0LA 2Y5GA 1T8MA 3LONA 1YPJH 3RMNH 3TNSA 3CENA 3E6PH 1SGCA 1SR5C 1UVUH 3ELAH 1MBMA 1MAXA 1WAYB 4UE7H 2UUJB 1UK2A 2FP7B 4GHTA 3A82A 4CBOA 4WF8A 2XBYA 5GDSH 3RXUA 4I31A 3EYDA 1PFXC 2PGBB 1SVPA 1CT2E 4AX9H 3A7ZA 1WBGB 1GJCB 1KIGH 1L1NA 5AVDA 1EPTB 2J4IA 3PTBA 3RXSA 4CR9A 2YOLA 1XUJA 1DUAA 1C5LH 2ANYA 4B2CA 1W10U 1MCTA 3MO6A 1MZDA 4Z0KA 4FUFA 3SU2A 2JH0D 8LPRA 2BXUH 3A80A 4MQAA 1SGYE 1VITF 1CU1A 1SFIA 2TGTA 3VPKA 1E36B 1EZXC 5DK1A 5T6DA 4XBCA 1KTSB 1KXDA 2ZFQH 4Z6AH 1OWEA 1GJDB 1NS3A 1A61H 1C4Y2 3LDXH 3NCLA 1GI9B 3KQDA 4FUJA 1WOFA 1PQ7A 1QL9A 1A2CH 1GDUA 1QY6A 4RKJB 3QTOH 4ZHAA 1SI5H 3SGQE 3SJ9A 4HTCH 5GXPA 4QT8C 3SHCH 2FTMA 1K1MA 1LQEA 4DURA 1UTOA 2BY5X 3DD2H 1SGNE 1SQOA 1HAZB 2HNTF 1O3JA 1Y59T 4AYVB 2ZDNA 3GCOA 3RU4D 2ODYB 1GDNA 2BZAA 1FQ3A 3SJKA 1H1BA 1RIWC 4FU9A 4X6MA 1ACBE 3E1XB 3SV8A 1KXFA 1TALA 2FS8A 3T25A 4OS1A 1KSNA 3UTUH 1C1OA 4UFGH 1D3QB 3VFEA 1GWAA 1LKBA 2XXLA 1TMTH 1VR1H 2PR3A 2W7UA 3F6UH 1K1IA 3RXAA 4D8NA 4XOJA 1YLCA 2WPJS 4NA9H 1MD8A 3DFLA 1E35B 1KY9A 1UVPA 3L3TA 1HXEH 3MH7A 1A3BH 4XFQA 2BLQA 4A92A 4BAHB 4JZ1A 1TAWA 1AN1E 1O3LA 3V12A 3E3TA 1O2RA 1BRBE 1TA2A 1BHXF 2A4QA 4IC5A 1P2OA 5PTPA 3BTFE 1QL7A 2PKSB 5C3NA 1N6XA 5EXLA 1SL3A 2GTBA 4JK6A 2NU0E 4Q80A 3QX5H 1CBWB 2A45B 1UMAH 1QIXB 5EW1H 1GBEA 2A0QB 3GCTG 1FY5A 1FY1A 1UCYE 3U1IB 4RKOB 4A6LA 2FI4E 1SGRE 2SGQE 1QB9A 1BMLA 1O2PA 4X8TH 5IYTA 2AIPA 3TPIZ 1H8IH 1QQUA 1UJ1A 5CHAB 1DXPA 2J92A 4UFFH 2FOAA 1TNHA 3TK9A 1MUEB 3M3VA 2HWLB 4WH8A 3K2UA 1VGCC 2J38A 1YYY1 1GJAB 2BD5A 2BDIA 1HV7A 1OYTH 4NSYA 2BLWA 1VJAU 3O8BA 1Z7KA 6CHAC 1FXYA 1ETRH 3MU0A 4MPWA 1PQ8A 3MNCA 1HIAA 2HPPH 1A46H 4XSKU 2BQ6B 3SQEE 1J14A 1C5XB 1GMCF 2NU3E 4Q7YA 1FJSA 1O35A 2WPLS 1FPCH 4WY3A 4X6OA 1O38A 1BBRK 3T26A 2F83A 4NWLA 3UREA 3EE0B 3A81A 3BTGE 1BT7A 1XVMA 3QUMP 5EOKA 1HAYB 1SPJA 3KEEA 1TQ7B 1QBOA 2OP9A 2OINA 1PPBH 5EU8A 4B71A 2QF3A 3ENSB 3T5FH 1DWEH 3LGUA 5AFYH 1UTJA 1CA8B 1AFEH 2ZC9H 1NC6A 2ZO3H 2ZCHP 1A0LA 2QIQA 1D3TB 4VGCB 1LVYA 4Q2KA 1GI1A 1P2KA 2OC7A 1F0SA 3LKWA 3U8TH 2HNTE 1QA7A 1GBBA 4MVNA 1GI7B 1BRUP 1OOKB 3SNEA 7ESTE 4DIHH 3FAOA 3TJNA 4IMZA 4X8UH 2TIOA 4I8HA 4RN6A 1FDPA 3RMMH 4D7FA 1OWKA 4TPIZ 1MKXH 5FBIA 1GL0E 3BSQA 2NWNA 2ZDMA 1O5BB 3GCTF 2FO9A 2UWPA 3SGAE 1D9IA 1BMMH 3E8LA 3D62A 1SG8B 1BQYA 1AVGH 2VU8E 3QLPH 1HB0B 1YLDA 1EB2A 2JETC 2C90B 1CA0B 2VGCC 2LNCA 1HFDA 4GAWA 1PYTC 4LOYH 4BXSA 3F9EA 1S83A 2B5TB 4K8BA 5TCAA 4E7NA 1IQIA 1ANEA 2G52A 2GP9B 3A7TA 3TJUA 2FIRH 3M3TA 1BDAA 2ZQ1A 1XUGA 1G32B 3LU9B 1GJ5H 4Y8XA 1P8VC 1FZZA 2QGRA 5DP8A 2GV6A 4KKDA 2BDGA 4AFZA 1DITH 1QQ4A 1LHEH 1LVBA 3RU4E 2R9PA 2WPMS 1CT4E 2QC2A 3R0FA 2ODPA 3UNSA 1HYLA 4AN7A 2P8OB 3E16B 4FUDA 1CVWH 3S9CA 4IN1A 4WWYA 1NRRH 2WPKS 2PWXA 1MTVA 1C1NA 3TH4H 2ZGCA 1P57B 4NFEA 2SGPE 1P04A 3RC6A 3RXBA 3SGBE 2IJOB 5E0JA 4ZROA 3GY6A 4OS2A 3RXGA 3T28A 5JDUB 3SBKA 1O5DH 2WUBA 1J8AA 2PKSC 3GICB 1TGCA 2OCVB 5JB9S 1TPOA 3FZZA 3H7TA 1SGIB 3P8FA 3LH1A 3VGCB 1TOCB 1ZHRA 1D3DB 1DX5M 3FP6E 4ZKNU 3UNQA 1GBTA 2WINI 3GCNA 2BZ6H 4ABGA 1CHOG 3M36A 1X7AC 4ABFA 2VNTA 5HMAA 4CHAC 3RXDA 2P59A 1MU6B 3ZVDA 4B76A 1HAOH 3BG4C 1Y5AT 1OP2A 1Y8TA 5LPFA 1VCPA 2BD9A 2UUKB 5LPEA 1HNEE 3RDZA 2GKVE 1IOEA 1DOJA 1KTTB 2XYAA 2R2WU 4J2YB 2TGDA 4NIXA 8ESTE 1BA8B 4D9RA 4U32A 1TBZH 1GBKA 1S0RA 1KLJH 3KIDU 1MH0A 1S0QA 1NY22 5TCCA 1GVKB 3RXHA 7GCHG 4WMFA 1P03A 1VJ9U 2ZU4A 1DDJA 3ATMA 2ZHFH 1BJVA 1GBMA 1MTSA 1K1LA 3GOVB 1C2LA 3MH5A 1DE7H 4BAKB 1PYTD 2VB0A 4DY7B 1GL1A 2EC9H 1SOZA 1WV7H 1GJ6A 3TITA 1V2OT 1FV9A 2PW8H 1Q2WA 4A1XA 1TMBH 2GCTC 2PV9B 1JWTA 1LCYA 1UVTH 2Y7ZA 1HAXB 1THRH 1TQ0B 1YBWA 4NIYA 5FX6A 4H6TA 3ZZ5A 4UEHH 1DLEA 1FAXA 5T6FA 4FU7A 4J1YA 4TWWA 4ESTE 4OS6A 1FPHH 1BUIA 4KTSA 1YPHC 3OX7U 2ZTYA 4X2VA 1IAUA 5ESBA 1GDQA 1O2VA 1O3EA 2A4GA 5DP9A 5GCHF 1VZQH 4YT7H 3ATLA 1TRMA 3S7KB 5ESTE 3PMBB 4ZHMU 3WY8A 1LMWB 5GIBA 2AEIH 1ARBA 3D49H 3RXRA 4AYYB 2FOCA 4B75A 3RXKA 1TNLA 1TONA 5BPEA 5DP3A 3RLWH 1C2EA 4ISOA 1V2WT 2CMYA 1DY9A 1E37B 2QY0B 2ZIQH 2RDLA 4Y10E 4MG3A 3SV6A 1F2SE 1S6HA 4X2WA 2QV1A 2VWNA 3CP7A 1ESAA 2VIWA 1O2JA 1G3EA 4ZUHA 3OY5U 1G37A 3QZQA 1G9IE 4B73A 5SGAE 2TGPZ 2F9PA 2VIPA 3A8DA 4K1EA 2B7DH 2VWLA 3W95A 1P3CA 4Y6DA 1YF4A 3ZV9A 2OC8A 2Q1JA 1DWBH 4Q7ZA 3T62A 1EAXA 1ELAA 1O33A 4IW4E 3TVJB 5EXMA 3UOPA 3ZV8A 4NCYA 4UD9H 3MU1A 1SC8U 2VVVA 4R8TB 2DUCA 3SUDA 3DFJA 4TPYA 2ANKH 1D6WA 3KL6A 4MPXA 1D4PB 4AFSA 1F0UA 2PKAA 4X2YA 3SUEA 2THFB 3MHWU 2OC0A 1DICA 4IN2A 2P8OC 1E34B 3PMHB 1TOMH 4D76A 4WXVA 3DHKH 1AUTC 1FY4A 2BD3A 2EEKA 1BCUH 1G2MA 1GBJA 2C8XB 1K1NA 1LO6A 4YZUA 1O3DA 1ID5H 2XBXA 1GCTC 2A4RA 4CH8B 2AS9A 3ZZ4A 3P6ZB 1M9UA 1INCA 3RLYH 2A5AA 1YPKH 1O2LA 1P9SA 1EP6A 1T8LA 2ALPA 1FAKH 1RFNA 4O3UA 1SGPE 2V3OH 1LDTT 1BZXE 4XBBA 4Q7XA 1AUJA 1AVXA 3LC5A 1HLTH 3MNXA 3AVZA 1UCYH 4CRBA 4HGCA 2BD8A 1Z1IA 1K1PA 4NFFA 4CRGA 1C2DA 3MH4A 2P93A 1W3CA 3CS0A 1G3CA 3L33A 2EA3A 1P2NA 4ZH8A 4Y8YA 1MU8B 1ABJH 1L1GA 3BIUH 3PMAB 3SO3A 2AERH 3VXEH 1C1UH 2WPIS 1V2KT 3RXCA 2O8LA 1SOTA 2A2QH 4R0IA 4ABIA 1TWXB 1WTGH 3SUFA 1T31A 1AZZA 2Y82A 5EPYA 2CV3A 3ZZ6A 1MKWK 3QGJA 3MYWA 3EA7A 3SORA 1C1RA 3RXOA 2GT7A 3IWMA 3PWCA 3ATWA 1P3EA 3TGJE 3MU4A 3LT3A 3A88A 3EA8A 1ANDA 2BLOA 3U1JB 5JPMH 5H4IB 1TPAE 3PROA 4OS5A 3PLKA 2BD7A 3TH3H 4ASHA 2VH0A 1MQ5A 1Z8IB 4JYVH 4BAOB 3BEIB 2FOBA 2GMTB 4OS7A 3M5MA 3U9AH 4GCHG 1EOJA 3S0NA 5JBAS 2HRVA 1V2UT 1FONA 1C5ZB 1Y3WA 1KYNA 2BOKA 1OXGA 3BTEE 3LOXA 3LGIA 3CS7A 4CRDA 3GY7A 3UOUA 1QNJA 1SGFA 1L2EA 3V7TA 3NK8A 1SSXA 1A5GH 1WU1A 3P8NA 1B5GH 1O5AB 2PHBA 2ZFRH 5A0CA 1K22H 2G5NA 1D3PB 1OWJA 2PFEA 1SLUB 3LGVA 4YOJA 1W0YH 3KQCA 1P9UA 1AMHA 1CE5A 1P2MA 2GZ8A 2SFAA 1Z8JB 5HYOA 4NIWA 4I8JA 1FUJA 4H6SB 1OX1A 2OQUA 1RXPA 2XC0A 9LPRA 2PUQH 3AW0A 4GSOA 1GI8B 1TGNA 1KXBA 1H4WA 3ZYDA 1GGDB 4LK4A 3ZVAA 4BTUB 4X1QU 3ZZCA 2ILNA 2Y6TA 2D26C 2Y7XA 1C4V2 5JB8S 1O34A 3ZZDA 3LGTA 2FXRA 1O2HA 1GMCG 2ZHDA 4ABEA 1K2I1 1MTNB 5FXLA 4O97A 5EQRA 5HM9A 3UQVA 3O8CA 2KAIB 1O2QA 2C8YB 3E0NB 2ZWLH 4KGAA 1C1QA 3FANA 2P3FH 2Z6BD 3GYLB 1ZTJA 1IHTH 4KP0A 3MWIU 3BTME 2R2MB 2XC5A 1V2TT 4GCHF 2FZZA 2PSXA 8KME2 1WTHD 1L1JA 4X2XA 4K60A 1HAIH 2XCFA 4WXIA 1BIOA 4NIVA 1C2IA 3S9BA 5EQQA 1GHBG 1FIWA 1IQKA 4YOIA 1NESE 2AIQA 1S81A 2Z9GA 5LPRA 1FIZA 1FN6A 4Y8ZA 1QJ6B 1UTLM 1WSSH 2FS9A 1XXFA 3MNBA 3OYPA 3ZZAA 3NUMA 3F9FA 4YT6H 2W26A 1NO9H 2Q6FA 2BB4A 2TRMA 3G01A 1Q31A 1NFXA 2ZHQH 3FFGA 1J9CH 1CT0E 1MCVA 3UWJH 5ETXA 4DW2U 5B6OA 1YPEH 1C1VH 3TGKE 1HAHH 2CXVA 4UONA 1C5YB 1IQFA 3RP2A 1YPHE 4X1RU 4FUBA 1XUFA 1U6QA 4HFPB 2P95A 2GGVB 1ESTA 3H7OA 4CR5A 4LZ4B 1KXCA 2BVSH 3RXEA 1SHHB 3O8DA 2Y80A 1A3EH 1YCPK 1AHTH 4BAMB 4U2WA 1IHSH 1TX6A 5CMXH 1MQ6A 2H6MA 1BTHH 1W0ZU 3PLPA 2EI6A 4GPGA 5FPTA 1GHYH 4CH2B 4AFQA 1QB6A 2RA0A 3GCHC 2XTTB 1QR3E 4K1TA 1KXAA 4ABBA 1O3NA 2V35A 3OU0A 4KTUA 1ZSLA 2W3IA 2Z9LA 1ARCA 1RRKA 3QTVH 3V0XA 1PJPA 1C1TA 4NSVA 1XKBC 1TNIA 4X6PA 1JRTA 3TK6A 3EAJA 1FLEE 1TABE 3SV7A 2FESH 1Q3XA 5EQSA 4E05H 3AW1A 2ZFFH 3RC4A 3NWUA 4ZMAH 6LPRA 1B0EA 3ZYEA 2A1DB 3DA9B 3SJ8A 5EGMA 1G30B 1W12U 1EKBB 4JZEH 1KDQB 1P02A 1NU7B 2LPRA 5G4BA 1JIRA 3TK5A 1EPTC 2D1JA 2PTNA 4JZIA 1XUIA 1GBHA 1AKSB 2BVRH 1OKXA 4AG1A 3SI3H 2TGAA 2VVCA 4AORA 1GHBF 1V2MT 4DT7B 3I77A 1W8BH 1J17T 1PPEE 3S7HB 1ABIH 2BTCE 5DP4A 4I8GA 3M35A 1BBRE 3UUZA 2QN5T 2ZDVH 1QL8A 1GJBB 2XWAA 2OXSA 5DGJA 3U98H 3A84A 2J9NA 3A8AA 1PPZA 1N6YA 3ODDA 1TGBA 3QN7A 1UVOA 2OBQA 3ZVFA 5J4SA 2CGAA 4CBNA 3HATH 5IDKA 2H9EH 1TX8A 5AHGH 4Y79A 1V2NT 1TNGA 2Z3CA 3SU4A 1SB1H 5A0BA 1TNKA 5FCKA 4X1SU 8GCHG 3EDXB 1Y3VA 3SNBA 5L30H 2CF8H 2W5EA 1ZSJA 4OGYA 5C2ZA 1HGTH
chains in the Genus database with same CATH superfamily
1T8OA 4Q63A 1F92A 1C2GA 1FMGA 2OC1A 1GCDA 1C2MA 2R3YA 3RU4T 1DVAH 3A7VA 1V2RT 1QURH 4YO9A 3BTHE 3HK3B 1K9OE 2B0FA 2HALA 1GI0A 3SN8A 3D23A 2FOGA 2XBVA 1O30A 4FUEA 2WZQA 1O2YA 2EI8A 1H8DH 1P11E 4ZXYH 1UK3A 2G55A 1FY8E 1E38B 5A0AE 1XM1A 2AGGX 5C1UA 1RJXB 2L6OA 4I7YH 5GCHG 3E91A 3ZZ3A 2AMDA 1C5NH 2P3TB 5C1YA 4DOQA 1PQ5A 2WPHS 1SGEE 3RXIA 1OP0A 3ZZ8A 1O2MA 1CBWC 1CO7E 2ZZUH 2CHAB 1V2LT 1CHGA 3SZNA 2PSYA 1GI6A 3F2GA 6ESTA 1O5GH 2AGIX 3Q77A 2FI3E 3U8RH 1NROH 3UQOA 1EATA 4AFUA 4Y7AA 1QJ1B 3W94A 3I78A 3SU6A 1HCGA 1HAVB 3SV2H 2WSSD 3IITA 4GHQA 5CHAC 2A7HA 4B1TA 1QJ7B 3KYGA 4U01A 1NRPH 2J94A 4F55A 1EZUC 2VIVA 3MI4A 1O31A 1O0DH 1Y3YA 2DE8A 1K28D 1O2OA 5DP7A 1O2TA 1AFQB 2XWBI 3UWIA 1W14U 3ESTA 3GYMA 3P8OA 3BTTE 1ELBA 5F6MA 1K21H 1J15A 1N8OB 1V2ST 2WUCA 5DN6D 1T7CA 4CRFA 3UNRA 1TGSZ 4ZAEA 1BHXB 2KFWA 8GCHF 4Y0ZE 1EUFA 2ZPSA 1GI3A 2BDAA 2A5KA 1ELFA 3GDUA 1P2IA 3A85A 2ZG0H 3F1SB 5A8YA 1O2SA 1UK4A 1F0RA 3KF2A 4IGDA 7LPRA 1C2JA 1EB1H 1YPLH 1AI8H 3P92A 2ZTXA 1O36A 1O32A 2GDEH 1C1PA 2OLGA 3UR9A 1TYNA 1WQVH 2CJIA 2QCYA 4Y7BA 3GDSA 3AASA 5T6GA 4YTAA 1SLWB 2UWOA 3K6YA 3LH3A 1S5SA 1C5TA 1C9PA 5F8XA 1O3MA 1UHBB 1A5IA 4BXWA 4VGCC 4ZXXH 4DT4A 3VB5A 1EQ9A 4JK5A 4RT0A 4AGJA 3OSYA 2B9LA 4TT3D 4JZFH 3L6PA 2F9OA 1C1MA 1QRWA 2GCHG 1GG6B 3KNXA 4MPVA 4K2YA 1HJAB 1AE8H 1LTOA 1IQEA 2VINA 1OHHD 2ZDLA 3BG8A 3A87A 5L2ZH 2RG3A 3MTYA 2OD3B 4INHA 2QA9E 3RMOH 2GZ7A 4XDEA 1WQSA 1O3OA 5JBTA 1TA6A 2ZEBA 4BNRA 1ZMLA 3I29A 2ZU5A 5E0HA 1MTUA 1EPTA 3NKKA 4X0WU 4XRNA 3K6ZA 2JH6D 2NU1E 1V2PT 2JJ1D 3URDA 1MKXK 1ELCA 3BEUA 1GJ4H 1BITA 3EE7A 3SU3A 3M37A 3LPRA 1ZRBA 3UIRA 1Y5UT 4X6NA 2PUXB 1EP5A 5AFZH 1Z71A 3RMLH 4ACAA 1Y5BT 1CA0C 2BD2A 1G3BA 4WMEA 3F0OA 1GBAA 4A1TA 4Y0YE 1PQAA 1O3GA 5ABWA 1A5HA 5FL7D 1ANBA 4LXBH 4WH6A 3M7UA 4IS5A 1W7XH 2QXJA 3F9GA 3T2NA 3KN2A 1G3DA 1E0FD 1BJUA 1V3XA 4ABHA 4DG4A 2K8IA 4PROA 2CN0H 3H5CB 2F3CE 3BTWE 3A83A 1C5UA 2TBSA 5E2OA 1JMOH 3MO9A 3Q3YA 1OPHB 1CQQA 5DKMA 1LVOA 1EAUA 4A1VA 1O2ZA 3VB4A 2Z94A 9ESTA 3PO1B 1EJNA 1BTPA 1FX0B 3OTJE 1EOLA 1D6RA 4YLUA 3GY4A 3KGPA 3UB0A 5EJLA 2VVUA 4BAQB 1P09A 3K9XB 1GBFA 1GVLA 3ODFA 1AVWA 1QZ8A 4AOQA 4JYTA 2AHME 4K1SA 4HI3A 1GJ8B 2NU2E 4X8SH 1A1RA 1IQGA 1LQDB 1JOUB 3LC3A 3Q3KA 3QZRA 4JYUH 1RTLA 5DG6A 2KAIA 3Q00A 3SU1A 2WYJA 1C9TA 2G5VA 1O5FH 2O9QA 4Q4LA 1RIWB 3SV9A 2GCHF 1HXFH 3F9HA 1AZ8A 4B6EA 2I6SA 1GPZA 1UTNA 1BTYA 1GI2A 1C5VA 1TB6H 5F8ZA 1W0JD 2FMJA 1SFQB 2W7SA 1K1JA 1W13U 3M5NA 3SW2B 3VG8A 1YGCH 3VGCC 2C3SA 5A8ZA 2OQ5A 1FY3A 2BHGA 4ISHH 4TWYA 1C5RA 1O2IA 1F0TA 3E0PB 5L6NH 4K3JA 5FHTA 1W2KH 2FLBH 3A89A 3F68H 1C2KA 1SLVB 1T4VH 1SQAA 2H5CA 1GJ9B 4O3TA 1YC0A 2Z9JA 2FYQA 1YKTA 1W11U 4ISLA 1HJ8A 3FP7E 3EA9A 1YWUA 1O3FA 2FEQH 2KR7A 2UWLA 1O3CA 3GY5A 5DPAA 1XX9A 2H5DA 3VB6A 1DLKB 3UFAA 4LZ1H 1OP8A 3SQHE 3M61U 3FVFB 2O8MA 1COWD 1MBQA 4I8KA 4AGKA 2WV5A 2C4FH 3UR6A 1THSH 5HM2A 4YOGA 4TY6A 4JMYA 4O9VA 1V2JT 2KCPA 3AAUA 2GVFA 2Y5HA 3TU7H 3SHAH 3B9FH 3MOCA 3SJIA 1HRTH 4DIIH 3N7DA 3VB3A 3TGIE 2BLVA 3O8RA 2V0BA 1ETSH 3QK1A 4Y76A 1PPCE 3M7QA 2JH5D 2ZFPH 3KQ5A 1S85A 1JIMA 1SBWA 1VGCB 2EY4C 4F49A 1NZQH 5JYIA 1NRNH 5C67A 1C1WH 5T3HA 3RXLA 4THNH 4FVDA 4Y11E 1MD7A 1Z8GA 2LELA 2F9UA 1UO6A 1ZJDA 4HZHA 1S6FA 2KCAA 2ZU3A 1C2HA 1EZQA 1UTPA 5C5OA 4B2AA 3PV2A 3ZZ7A 2FX6A 3D65E 1TPSA 2A32A 1XVOA 4GUXA 2Y81A 2BX3A 1QGFA 3PMJA 1BMAA 1KDQA 2I6QA 4ZKOU 1BBRH 1ZR0A 2XBWA 1SGDE 2FX4A 1AKSA 1TMUH 4XBDA 2IPQX 3TH2H 2JDID 2PTCE 2OBOA 4I8LA 7KMEH 1ZHMA 2WV4A 5BRRE 1OWHA 1EZSC 1GHVH 1BRCE 3NPSA 1Z6EA 2A4OA 2QE7D 3ITIA 1FNIA 3DCLA 1DSUA 3F0PA 5CHBA 1Z6JH 1XXDA 1ZSKA 2ZFSA 2YNBA 3RXVA 5I25A 3LJJA 3MNSA 1NTPA 1O2NA 3C27B 3BTDE 4GLYA 2H1UA 1TGTA 1EX3A 2EI7A 1EAWA 2ALVA 4TY7A 4NGAH 1UTMA 4ASUD 5K0HA 2ANWA 3NRLA 1FN8A 2F9VA 1YPMH 1EJAA 1O2XA 5DP6A 1DXWA 2BDCA 1NFUA 2AFQB 2J95A 4JZDH 3PO1C 2BQ7B 2IPHA 1WDIA 3MO3A 4P00A 3A7WA 2P16A 1FI8A 1DWCH 3P70B 2ZP0H 3T27A 1MTWA 1GHAF 2JETB 2IN2A 4UDWH 1O2KA 2GZ9A 2AGEX 2VGCB 1UTKA 1O5EH 1AWFH 2KCOA 3A8BA 1Y3UA 2PKAB 1TBQH 2J34A 1E1QD 3PTNA 1H9IE 2FODA 1KMHB 1DY8A 1GBDA 3M5LA 1LVMA 2FOFA 2G4TA 5JBBS 4ISNA 3SJOA 4IMQA 1ZPBA 2SNVA 1QA0A 3SOSA 5AF9H 1OSSA 2AMQA 3LJOA 3RXQA 5A8XA 2ULLA 2O8WA 2FM2A 2DE9A 1LPGB 1C2FA 2BY8X 1L4ZA 1O2UA 4X8VH 3HGNA 2HLCA 1C5WB 2ZCKP 3NZIA 2G4UA 2BDHA 2ZU1A 1DANH 3BV9B 2HOBA 2YMSB 4BTTB 1EJMA 4YM9A 1C5PA 3TJVA 3UY9A 2B8OH 1GMDG 3QGNB 1UCYK 1ZMNA 2V6NA 2JKHA 1TRNA 3UPEA 2VH6A 4NA7A 2AYWA 2KZ4A 3QDZB 3MMGA 4M7GA 1VCQA 5EPNA 1YP9A 1ZZZA 4FXGH 1YPGH 2BXTH 1OWIA 3QWCH 1GBLA 2ZTZA 4ZHLU 2STBE 2P3UB 1SQRA 2BM2A 5GPIB 4CREA 2C8ZB 2FOMB 3U8OH 2IOTA 1ELGA 3A86A 1NU9A 1HAVA 1TRYA 1Y3XA 2QYIA 1QB1A 2Q6DA 5A2MH 1SGTA 5DSFA 3C1KA 3BTKE 1GHXH 5GWZA 2SGAA 2BQWB 4CHAB 2FTLE 4I33A 1P01A 1ZOMA 2L74A 4X1NU 3RM0H 1TLDA 2FOEA 3BG4B 3MFJA 3Q76A 1IQJA 1P12E 3KHVA 4TSFD 1HAPH 3DUXH 1ORFA 1IQNA 2G8TA 4TYDA 1HJ9A 1LKAA 2BY7X 1LPKB 2RCEA 4SGBE 5E2PA 1ZMJA 2BX4A 3DT0H 1DPOA 4MNYA 3TJOA 1UVSH 2GMTC 5TJXA 1E79D 3Q3XA 1BTZA 1ZLRA 4INLA 3SZEA 2ZGXH 4H42U 2ZPRA 2TPIZ 1O3BA 1H9HE 1NT1A 3GY2A 2KCYA 3PYHA 3SNCA 1TFXA 2BYAX 1UW7A 1QBNA 1GHZA 1QHRB 3TIUA 1TNJA 1P05A 1P06A 4ZKSU 1TPPA 1GI5A 1ZPZA 4KTCA 3S69A 4NWKA 1SKYE 2A7CA 1UHBA 2GCTB 1W7GH 3LIWA 4K8YA 2ZF0H 1O3AA 1A0HB 1GMDF 1ZTKA 6GCHG 1G36A 4DCDA 1C5OH 3URCA 1MMJN 2UUYA 1AIXH 1K0HA 1ELDE 1BTWA 3STIA 1GJ7B 5LH8A 1F5LA 1CGHA 2ZU2A 3RXJA 4CRAA 1C1SA 3P95A 4NZLA 1JXPA 4MDSA 1TBRH 1DS2E 1LHGH 2QF0A 2D8WA 5E8EH 2FLRH 3GDVA 1NFWA 3OAAD 1LHFH 1Z1JA 1QCPA 3EGKH 3MU8A 5C0UA 1AB9B 1ELVA 3B23B 3PLBA 4U30A 1F5RA 1GI4A 2Y5FA 1GGDC 3OY6U 2ZDKA 5HXFA 2FI5E 1A0JA 1SGQE 4O03A 3RM2H 3ATIA 3LGYA 1ANCA 1AU8A 5F03A 4Y71A 4K69A 1OWDA 4ZCNA 1NRSH 2SGEE 2ANMH 1C5SA 1GBCA 2G00A 4P02A 1TE0A 5I46H 1SLXB 1MTNC 3RXTA 4B74A 1NFYA 1BB0B 1RGQA 4I32A 1P2JA 2VIOA 1OS8A 1O3IA 4NG9H 3SU5A 1ZJKA 1BMNH 3LGWA 2M5TA 2J98B 5CE1A 2WYGA 4OS4A 3SNDA 3KCGH 2XC4A 1G2LA 5FCRA 3VB7A 2QXHA 4DGJA 1AGJA 5HIZA 5A09A 2VIDA 2VWOA 2ZA5A 3SUGA 5E0GA 2SGDE 3ZVCA 1AQ7A 3IG6B 3MU5A 3OTPA 4F4OC 1K1OA 3A7XA 4NZQA 4FU8A 2BY9X 1ZRKA 1NPMA 3FO8D 1O39A 1SQTA 1PPHE 2Z7FE 4FUIA 2ZI2H 2XNIA 1JRSA 1VCWA 2QXIA 1Z8RA 3FP8E 1V2VT 2AH4X 3JZ1B 3RXMA 4D7GA 1CGIE 3SNAA 1VKYA 5FAHA 3KQBA 2GT8A 5DJ7A 6GCHF 1QRXA 4K5ZA 3M3SA 5F53A 4RI0A 2GDDA 4E7RG 1GCTB 1L4DA 2G51A 3K65B 4ABAA 5FPYA 2GD4B 5GJ4B 3RUOA 3PRDA 2GJGA 2C93B 3ZZ9A 3HKJB 2RA3A 1NRQH 1SHYA 1ZPCA 4AG2A 1BTUA 2FDAA 1TIOA 1C4U2 4AB9A 2K1QA 1ELTA 2ZHWH 1JBUH 2XRCA 1DWDH 3PB1E 5FX5A 1SMFE 1B7XB 3BF6H 2FYRA 1EFRD 1ZTLA 2OUAA 2O8UA 4JCNA 1MAYA 1N1LA 4OM9A 3HK6B 3U28C 1O5CB 4YESB 2ZFTA 1B0FA 1O3PB 2ZHEH 1DSTA 2FOHA 2IJD1 4MPUA 4X1PU 4YLQH 2BDYA 3V3MA 1A7SA 1J16A 4FUGA 1THPB 1HDTH 2ZDAH 3TNTA 4E06H 2BY6X 2O8TA 1W0KD 1F5KU 2ODQA 3T29A 5C5NA 1AD8H 4OGXA 2PGQB 3EQ0H 2SGFE 1HIAB 3P17H 1TX7A 1O37A 3ATKA 2HVXA 1LPZB 3P8GA 1OYQA 4BTIB 2A5IA 1MKWH 5EJZA 3M5OA 3ZIAD 5HGGA 3U69H 2Z3EA 3PWBA 1S82A 5EG4A 2Z9IA 3JZ2B 1ZGIA 4MTBA 1QRZA 3RXFA 4FUHA 1ESBA 5EXNA 3NXPA 2OK5A 1DM4B 2F91A 3GY8A 4BOHA 2VIQA 1RD3B 3B8JA 4WVPE 3A8CA 3QO6A 2ZGJA 2WHXA 3BIVH 1A4WH 3VXFH 1RTFB 5FPSA 1CGJE 1KLTA 1AY6H 4ABJA 1KXEA 1IQHA 3VEQB 5F8TA 2P94A 4RSPA 3HPTB 1BOQA 1O2WA 3BEFB 3S9AA 2PLXA 1IQMA 2F9NA 3WW7A 5JBCS 1AB9C 4SGAE 2VWMA 2J2UA 1T4UH 1XKAC 2F9BH 1XUHA 4H4FA 4AB8A 2R0KA 1CSOE 5DP5A 2ZNKH 2XCNA 4MLFB 1GHWH 1WYKA 3BTQE 3ZVEA 1CHOF 3STJA 3RXPA 4DJZB 2GV7A 1YCPM 4BANB 3ZZBA 2ZQ2A 2HLDD 1C5QA 1F7ZA 1DUEA 4GVUA 3V13A 1LHDH 1GMHG 1NM6A 1T32A 2ZGBH 1P2QA 2NU4E 5EODA 1NN6A 5EW2H 3HKIB 1UTQA 1QBVH 2H9HA 2BD4A 1SGFG 1EXFA 2QXGA 2ZECA 3GISB 1DFPA 2R3UA 2AMPA 2OTVA 3CNRA 1S6LA 3MH6A 3PM3A 4WJG2 2A31A 7GCHF 5FBEA 1QTFA 1ZGVA 3DSOA 2STAE 2XW9A 2A7JA 1AWHB 2H2ZA 1HBTH 2H9TH 5LGOA 2ASUB 2BOHB 2HVYB 2D2DA 2HNTC 1P0SH 4Z1MD 2HGTH 1PPFE 1YM0A 5K7RA 1AO5A 3FZDA 2ZKSA 3E90B 4FVBA 3M7TA 4B2BA 1ZHPA 1C5MD 1IQLA 1XUKA 4WMDA 4CRCA 1RTKA 2C8WB 2FWWA 1AE5A 4XE4A 4MNXA 4UFEH 2HPQH 2CHAC 3R3GB 3RC5A 4A5TS 1GBIA 3BN9A 4ZKRU 4AZ2B 2BVXH 5C20A 4ISIH 3TLOA 4FUCA 5C17A 1ETTH 2Z9KA 5J4QA 1WUNH 4KELA 1LHCH 1RS0A 1WCZA 2G81E 4ABDA 1XMNB 1DT2A 1L0ZA 3PV4A 2ZCLP 3UAIC 1GVZA 3SU0A 1AFQC 1V2QT 4NA8A 2VJ1A 2UUFB 3A7YA 2YNAA 1N8OC 1VITG 1T8NA 2FPZA 2GX4A 2QAAA 1HUTH 4IC6A 3KQEA 3N7OA 1EASA 4D9QA 5DO4H 1ZYOA 2W3KA 2ZPQA 3AAVA 1PPGE 2BDBA 2SNWA 3SI4H 2ZGHA 1QFKH 1V6DA 2BMGB 3ZVBA 3HGPA 1P10A 1ELEE 1S84A 1GMHF 1O2GH 1MZAA 2Z3DA 3GY3A 1HPGA 1KLIH 4F48B 1GHAG 1H9LB 4INKA 4MNWA 1YCPH 2ESTE 2CF9H 1HAGE 1BRAA 1O3HA 3ZVGA 5C1XA 1VITH 4MNVA 5L2YH 1EAIA 4I86A 3GCHB 2A2XH 4IBLH 6CHAB 2Q6GA 4DVAU 1BTXA 1GG6C 4UFDH 1WXRA 1HJAC 1O3KA 3F2FA 4A7IB 2V3HH 2R0LA 2Y5GA 1YY3A 1T8MA 3LONA 1YPJH 3RMNH 3TNSA 3CENA 3E6PH 1SGCA 1SR5C 1UVUH 2WPDD 3ELAH 1MBMA 1MAXA 1WAYB 2LP6A 4UE7H 2UUJB 1UK2A 2FP7B 4GHTA 3A82A 4CBOA 4WF8A 2XBYA 5GDSH 3RXUA 4I31A 3EYDA 1PFXC 2PGBB 1SVPA 1CT2E 4AX9H 3A7ZA 1WBGB 1GJCB 1KIGH 1L1NA 5AVDA 1EPTB 2J4IA 3PTBA 3RXSA 4CR9A 2YOLA 1XUJA 1DUAA 5HKKD 1C5LH 2ANYA 4B2CA 1W10U 2QF4A 1MCTA 3MO6A 1MZDA 4Z0KA 4FUFA 3SU2A 2JH0D 8LPRA 2BXUH 3A80A 4MQAA 1SGYE 1VITF 1CU1A 1SFIA 2TGTA 2M2AA 3VPKA 1E36B 1EZXC 5DK1A 3FKSD 5T6DA 4XBCA 1KTSB 1KXDA 2ZFQH 4Z6AH 1OWEA 1GJDB 1NS3A 1A61H 1C4Y2 3F2HA 3LDXH 3NCLA 1GI9B 3KQDA 4FUJA 1WOFA 1PQ7A 1QL9A 1A2CH 1GDUA 1QY6A 4RKJB 3QTOH 4ZHAA 1SI5H 3SGQE 3SJ9A 4HTCH 5GXPA 4QT8C 3SHCH 2FTMA 1K1MA 1LQEA 4DURA 1UTOA 2BY5X 3DD2H 1SGNE 1SQOA 1HAZB 2HNTF 2PP6A 1O3JA 1Y59T 4AYVB 2ZDNA 3GCOA 3RU4D 2ODYB 1GDNA 2BZAA 1FQ3A 3SJKA 1H1BA 1RIWC 4FU9A 4X6MA 1ACBE 3E1XB 3SV8A 1KXFA 1TALA 2FS8A 3T25A 4OS1A 1KSNA 3UTUH 1C1OA 4UFGH 1D3QB 3VFEA 4YXWD 1GWAA 1LKBA 2XXLA 1TMTH 1VR1H 2PR3A 2W7UA 3F6UH 1K1IA 3RXAA 4D8NA 4XOJA 1YLCA 2WPJS 4NA9H 1MD8A 3DFLA 1E35B 4AC9A 1KY9A 1UVPA 3L3TA 1HXEH 3N99A 3MH7A 1A3BH 2F43B 4XFQA 2BLQA 4A92A 4BAHB 4JZ1A 1TAWA 1AN1E 1O3LA 3V12A 3E3TA 1O2RA 1BRBE 1TA2A 1BHXF 2A4QA 4RT1A 4IC5A 1P2OA 5PTPA 3BTFE 1QL7A 2PKSB 5C3NA 1N6XA 5EXLA 1SL3A 2GTBA 3N7EA 4JK6A 2NU0E 4Q80A 3QX5H 1CBWB 2A45B 1UMAH 1QIXB 5EW1H 1GBEA 2A0QB 2RDEA 3GCTG 1FY5A 3WWFA 1FY1A 1UCYE 3U1IB 3H09A 3FN8A 4RKOB 4A6LA 2FI4E 1SGRE 2SGQE 1QB9A 1BMLA 1O2PA 4X8TH 5IYTA 2AIPA 3TPIZ 1H8IH 1QQUA 1UJ1A 5CHAB 2J92A 1DXPA 3GS9A 2FOAA 4UFFH 1TNHA 3TK9A 1MUEB 3M3VA 2HWLB 4WH8A 3K2UA 1VGCC 3FOAA 2J38A 1YYY1 1GJAB 2BD5A 2BDIA 1HV7A 1OYTH 4NSYA 2BLWA 1VJAU 3O8BA 1Z7KA 6CHAC 1FXYA 1ETRH 3MU0A 4MPWA 1PQ8A 3MNCA 1HIAA 2HPPH 2K0QA 1A46H 4XSKU 2BQ6B 3SQEE 1J14A 1C5XB 1GMCF 2NU3E 4Q7YA 1FJSA 1O35A 2WPLS 1FPCH 4FOUC 4WY3A 4X6OA 1O38A 1BBRK 3T26A 2F83A 4NWLA 3UREA 3EE0B 3A81A 3BTGE 1BT7A 1XVMA 3QUMP 5EOKA 1HAYB 1SPJA 3KEEA 1TQ7B 1QBOA 2OP9A 2OINA 1PPBH 5EU8A 4B71A 2QF3A 3ENSB 3T5FH 1DWEH 3LGUA 5AFYH 1UTJA 1CA8B 2XOKD 1AFEH 2ZC9H 1NC6A 2ZO3H 2ZCHP 1A0LA 2QIQA 1D3TB 4VGCB 3F3BA 1LVYA 2VBCA 4Q2KA 1GI1A 1P2KA 2OC7A 1F0SA 3LKWA 3U8TH 2HNTE 1QA7A 1GBBA 4MVNA 1GI7B 1BRUP 1OOKB 3SNEA 7ESTE 4DIHH 3FAOA 3TJNA 4IMZA 5CDFE 4X8UH 2TIOA 4I8HA 4RN6A 1FDPA 3RMMH 4D7FA 1OWKA 4TPIZ 1MKXH 5FBIA 1GL0E 3BSQA 2NWNA 2ZDMA 1O5BB 3GCTF 2FO9A 2UWPA 3SGAE 1D9IA 1BMMH 3E8LA 3D62A 1SG8B 1BQYA 1AVGH 2VU8E 3QLPH 1HB0B 1YLDA 1EB2A 2JETC 2C90B 1CA0B 2VGCC 2LNCA 1HFDA 4GAWA 1PYTC 4LOYH 4BXSA 3F9EA 1S83A 5KECA 2B5TB 4K8BA 5TCAA 4E7NA 1IQIA 1ANEA 2G52A 2GP9B 3A7TA 3TJUA 2FIRH 3M3TA 1BDAA 2ZQ1A 1XUGA 1G32B 4HG6A 3LU9B 1GJ5H 4Y8XA 1P8VC 1FZZA 2QGRA 5DP8A 2GV6A 4KKDA 2BDGA 4AFZA 1DITH 1QQ4A 1LHEH 1LVBA 3RU4E 2R9PA 2WPMS 1CT4E 2QC2A 3R0FA 2ODPA 2YMSC 3UNSA 1HYLA 4AN7A 3DSGA 2P8OB 3E16B 4FUDA 1CVWH 3S9CA 4IN1A 4WWYA 1NRRH 2WPKS 2PWXA 1MTVA 1C1NA 3TH4H 2ZGCA 1P57B 4NFEA 2SGPE 1P04A 3RC6A 3RXBA 3SGBE 2IJOB 5E0JA 4ZROA 3GY6A 4OS2A 3RXGA 3T28A 5JDUB 3SBKA 1O5DH 2WUBA 1J8AA 2PKSC 3GICB 1TGCA 2OCVB 5JB9S 1TPOA 3FZZA 3H7TA 1SGIB 3P8FA 3LH1A 3VGCB 1TOCB 1ZHRA 1D3DB 1DX5M 3FP6E 4ZKNU 3UNQA 1GBTA 2WINI 3GCNA 2BZ6H 4ABGA 1CHOG 3M36A 1X7AC 4ABFA 2VNTA 5HMAA 4CHAC 3RXDA 2P59A 1MU6B 3ZVDA 4B76A 1HAOH 3BG4C 1Y5AT 1OP2A 1Y8TA 5LPFA 1VCPA 2BD9A 2UUKB 5LPEA 1HNEE 2W6JD 3RDZA 2GKVE 1IOEA 1DOJA 1KTTB 2XYAA 2R2WU 1NBMD 4J2YB 3OFND 2TGDA 4NIXA 1BMFD 1BA8B 8ESTE 4D9RA 4U32A 1TBZH 1GBKA 1S0RA 1KLJH 3KIDU 2J5UA 1MH0A 1S0QA 1NY22 5TCCA 2KM0A 1GVKB 3RXHA 7GCHG 4WMFA 1P03A 1VJ9U 2ZU4A 1DDJA 3ATMA 2ZHFH 1BJVA 1GBMA 1MTSA 1K1LA 3GOVB 1C2LA 3MH5A 1DE7H 4BAKB 1PYTD 2VB0A 4DY7B 1GL1A 2EC9H 1SOZA 1WV7H 1GJ6A 3TITA 1V2OT 1FV9A 2PW8H 1Q2WA 4A1XA 1TMBH 2GCTC 2PV9B 1JWTA 1LCYA 1UVTH 2Y7ZA 1HAXB 1THRH 1TQ0B 1YBWA 4NIYA 5FX6A 4H6TA 3ZZ5A 4UEHH 1DLEA 1FAXA 5T6FA 4FU7A 4J1YA 4TWWA 4ESTE 4OS6A 1FPHH 1BUIA 4KTSA 1YPHC 3OX7U 2ZTYA 4X2VA 1IAUA 5ESBA 1GDQA 1O2VA 1O3EA 2A4GA 2YMSD 5DP9A 4ACBA 3SYJA 5GCHF 1VZQH 4YT7H 5HIYA 3ATLA 1TRMA 3S7KB 5ESTE 3PMBB 4ZHMU 3WY8A 1LMWB 5GIBA 2AEIH 1ARBA 3D49H 1YLNA 3RXRA 4AYYB 2FOCA 3W1EA 3RXKA 4B75A 1TNLA 1TONA 5BPEA 5DP3A 3RLWH 1C2EA 4ISOA 1V2WT 2CMYA 1DY9A 1E37B 2QY0B 2ZIQH 2V3MA 4FETA 2RDLA 4Y10E 4MG3A 3SV6A 1F2SE 1S6HA 4X2WA 2QV1A 2VWNA 3CP7A 1ESAA 2VIWA 1O2JA 1G3EA 4ZUHA 3OY5U 1G37A 3QZQA 1MABB 1G9IE 4B73A 5T1VA 5SGAE 2TGPZ 2F9PA 2VIPA 3A8DA 4K1EA 2B7DH 2VWLA 3W95A 1P3CA 4Y6DA 1YF4A 3ZV9A 2OC8A 2Q1JA 1DWBH 4Q7ZA 3T62A 1EAXA 1ELAA 1O33A 4IW4E 3TVJB 5EXMA 3UOPA 3ZV8A 4NCYA 4UD9H 3MU1A 1SC8U 2VVVA 4R8TB 2DUCA 3SUDA 3DFJA 4TPYA 2ANKH 1D6WA 3KL6A 4MPXA 1D4PB 4AFSA 1F0UA 2PKAA 4X2YA 4XD7D 3SUEA 2THFB 3MHWU 2OC0A 1DICA 4IN2A 2P8OC 1E34B 3PMHB 1TOMH 4D76A 4WXVA 3DHKH 1AUTC 1FY4A 2BD3A 2EEKA 1BCUH 1G2MA 1GBJA 2C8XB 1K1NA 1LO6A 4YZUA 1O3DA 1ID5H 2XBXA 1GCTC 2A4RA 4CH8B 2AS9A 3ZZ4A 3P6ZB 1M9UA 1INCA 3RLYH 2A5AA 2XNDD 1YPKH 1O2LA 1P9SA 1EP6A 1T8LA 2ALPA 1FAKH 1RFNA 4O3UA 1SGPE 2V3OH 4M9FA 1LDTT 1BZXE 4XBBA 4Q7XA 1AUJA 1AVXA 3LC5A 1HLTH 3MNXA 3AVZA 1UCYH 4CRBA 4HGCA 2BD8A 1Z1IA 1K1PA 4NFFA 4CRGA 1C2DA 3MH4A 2P93A 1W3CA 3CS0A 3OEED 1G3CA 3L33A 2EA3A 1P2NA 4ZH8A 2WV9A 3PRBA 4Y8YA 1MU8B 1ABJH 4B6FA 1L1GA 3BIUH 3PMAB 3SO3A 2AERH 3VXEH 1C1UH 2WPIS 1V2KT 3RXCA 2O8LA 1SOTA 2A2QH 4R0IA 4ABIA 1TWXB 1WTGH 3WWBA 3SUFA 1T31A 1AZZA 2Y82A 3DSPA 5EPYA 2CV3A 3ZZ6A 1MKWK 1NBME 3QGJA 3MYWA 3EA7A 3SORA 1C1RA 3RXOA 2GT7A 3IWMA 3PWCA 3ATWA 1P3EA 3TGJE 3MU4A 3LT3A 3A88A 3EA8A 1ANDA 2BLOA 3U1JB 5JPMH 5H4IB 1TPAE 3PROA 4OS5A 3PLKA 2BD7A 3TH3H 4ASHA 2VH0A 2KX4A 1MQ5A 1Z8IB 4JYVH 4BAOB 3BEIB 2FOBA 2GMTB 4OS7A 3M5MA 3U9AH 4GCHG 1EOJA 3S0NA 5JBAS 2HRVA 1V2UT 1FONA 1C5ZB 1Y3WA 1H8HD 1KYNA 2BOKA 2JIZD 1OXGA 3BTEE 3LOXA 3LGIA 3CS7A 4CRDA 3GY7A 3UOUA 1QNJA 1SGFA 1L2EA 3V7TA 3NK8A 1SSXA 1A5GH 1WU1A 3P8NA 1B5GH 1O5AB 2PHBA 2ZFRH 5C94A 5A0CA 1K22H 2G5NA 1D3PB 1OWJA 2W6ID 2PFEA 1SLUB 3LGVA 4YOJA 1W0YH 3KQCA 1P9UA 1AMHA 1CE5A 1P2MA 2GZ8A 5B6LA 2V7QD 2SFAA 1Z8JB 5HYOA 4NIWA 5GNDA 4I8JA 3KYFA 1FUJA 4H6SB 1OX1A 1RXPA 2OQUA 2XC0A 9LPRA 2PUQH 3AW0A 2CK3D 4GSOA 1GI8B 1TGNA 1KXBA 1H4WA 3ZYDA 1GGDB 4LK4A 3ZVAA 4BTUB 4X1QU 3ZZCA 2ILNA 2Y6TA 2RFKC 2D26C 2Y7XA 1C4V2 5JB8S 1O34A 3ZZDA 3LGTA 2FXRA 2J98A 2F4LA 1O2HA 1GMCG 2ZHDA 4ABEA 1K2I1 1MTNB 5FXLA 4O97A 5EQRA 5HM9A 3UQVA 3O8CA 2KAIB 5C0TA 1O2QA 2C8YB 3E0NB 2ZWLH 4KGAA 1C1QA 3FANA 2P3FH 2Z6BD 3GYLB 1ZTJA 1IHTH 4KP0A 3MWIU 3BTME 2R2MB 2XC5A 1V2TT 4GCHF 2FZZA 2PSXA 8KME2 1WTHD 1L1JA 4X2XA 4K60A 1HAIH 2XCFA 4WXIA 1BIOA 5KEDA 4NIVA 1C2IA 3S9BA 5EQQA 1GHBG 1FIWA 1IQKA 4YOIA 1NESE 2AIQA 1S81A 2Z9GA 5LPRA 1FIZA 1FN6A 4Y8ZA 1QJ6B 1UTLM 1WSSH 2FS9A 1XXFA 3MNBA 3OYPA 3ZZAA 3NUMA 3F9FA 4YT6H 2W26A 1NO9H 2Q6FA 2BB4A 5EIYA 2TRMA 3G01A 1Q31A 1NFXA 2ZHQH 3FFGA 1J9CH 2J97A 1CT0E 1MCVA 3UWJH 5ETXA 4DW2U 5B6OA 1YPEH 1C1VH 3TGKE 1HAHH 2CXVA 4UONA 1C5YB 5IK2D 1IQFA 3RP2A 1YPHE 2JJ2D 4X1RU 4FUBA 1XUFA 1U6QA 4HFPB 2P95A 2GGVB 3PV5A 1ESTA 3H7OA 4CR5A 4LZ4B 1KXCA 2BVSH 3RXEA 1SHHB 3O8DA 2Y80A 1A3EH 1YCPK 1AHTH 4BAMB 4U2WA 3MQKC 1IHSH 1TX6A 5CMXH 1MQ6A 2H6MA 1BTHH 2EQNA 1W0ZU 3PLPA 2EI6A 4GPGA 5FPTA 1GHYH 4CH2B 4AFQA 1QB6A 2RA0A 3GCHC 2XTTB 1QR3E 3OEHD 4K1TA 1KXAA 4ABBA 1O3NA 2V35A 3OU0A 4KTUA 1ZSLA 2W3IA 2Z9LA 1ARCA 1RRKA 3QTVH 3V0XA 1PJPA 1C1TA 4NSVA 1XKBC 1E1RD 1TNIA 4X6PA 1JRTA 3TK6A 5EJ1A 3EAJA 1FLEE 1TABE 3SV7A 2FESH 1Q3XA 5EQSA 4E05H 3AW1A 2ZFFH 3RC4A 3NWUA 4ZMAH 6LPRA 1B0EA 3ZYEA 2A1DB 3DA9B 3SJ8A 5EGMA 1G30B 1W12U 1EKBB 4JZEH 3AK5A 1KDQB 1P02A 1NU7B 2LPRA 5G4BA 1JIRA 3TK5A 1EPTC 2D1JA 2PTNA 4JZIA 1XUIA 1GBHA 1AKSB 2BVRH 1OKXA 5KGOA 4AG1A 3SI3H 2TGAA 2VVCA 4AORA 1GHBF 1V2MT 4DT7B 3I77A 1W8BH 1J17T 1PPEE 3S7HB 1ABIH 1H8ED 2BTCE 5DP4A 4I8GA 3OE7D 3M35A 1BBRE 3UUZA 2QN5T 2ZDVH 1QL8A 1GJBB 2XWAA 2OXSA 5DGJA 3U98H 3A84A 2J9NA 3A8AA 1PPZA 1N6YA 3ODDA 1TGBA 3QN7A 1UVOA 2OBQA 3ZVFA 5J4SA 2CGAA 4CBNA 3HATH 5IDKA 2H9EH 1TX8A 5AHGH 2QF5A 4Y79A 1V2NT 1TNGA 2Z3CA 3SU4A 1SB1H 5A0BA 1TNKA 5FCKA 4X1SU 8GCHG 3EDXB 1Y3VA 3SNBA 5L30H 2CF8H 2W5EA 1ZSJA 4OGYA 5C2ZA 1HGTH
chains in the Genus database with same CATH topology
1T8OA 1F92A 1C2GA 1FMGA 2OC1A 1GCDA 1C2MA 2R3YA 3RU4T 1DVAH 3A7VA 1V2RT 1QURH 4YO9A 3BTHE 3HK3B 1K9OE 2B0FA 2HALA 1GI0A 3SN8A 3D23A 2FOGA 2XBVA 1O30A 4FUEA 1O2YA 2EI8A 1H8DH 1P11E 4ZXYH 1UK3A 2G55A 1FY8E 1E38B 5A0AE 1XM1A 2AGGX 5C1UA 1RJXB 4I7YH 5GCHG 3E91A 3ZZ3A 2AMDA 1C5NH 2P3TB 5C1YA 4DOQA 1PQ5A 2WPHS 1SGEE 3RXIA 1OP0A 3ZZ8A 1O2MA 1CBWC 1CO7E 2ZZUH 2CHAB 1V2LT 1CHGA 3SZNA 2PSYA 1GI6A 6ESTA 1O5GH 2AGIX 3Q77A 2FI3E 3U8RH 1NROH 3UQOA 1EATA 4AFUA 4Y7AA 1QJ1B 3W94A 3I78A 3SU6A 1HCGA 1HAVB 3SV2H 3IITA 4GHQA 5CHAC 2A7HA 4B1TA 1QJ7B 4U01A 1NRPH 2J94A 1EZUC 2VIVA 3MI4A 1O31A 1O0DH 1Y3YA 2DE8A 1K28D 1O2OA 5DP7A 1O2TA 1AFQB 2XWBI 3UWIA 1W14U 3ESTA 3GYMA 3P8OA 3BTTE 1ELBA 5F6MA 1K21H 1J15A 1N8OB 1V2ST 2WUCA 1T7CA 4CRFA 3UNRA 1TGSZ 4ZAEA 1BHXB 8GCHF 4Y0ZE 1EUFA 2ZPSA 1GI3A 2BDAA 2A5KA 1ELFA 3GDUA 1P2IA 3A85A 2ZG0H 3F1SB 5A8YA 1O2SA 1UK4A 1F0RA 3KF2A 4IGDA 7LPRA 1C2JA 1EB1H 1YPLH 1AI8H 3P92A 2ZTXA 1O36A 1O32A 2GDEH 1C1PA 2OLGA 3UR9A 1TYNA 1WQVH 2CJIA 2QCYA 4Y7BA 3GDSA 3AASA 5T6GA 4YTAA 1SLWB 2UWOA 3K6YA 3LH3A 1S5SA 1C5TA 1C9PA 5F8XA 1O3MA 1UHBB 1A5IA 4BXWA 4VGCC 4ZXXH 3VB5A 1EQ9A 4JK5A 4AGJA 3OSYA 2B9LA 4JZFH 3L6PA 2F9OA 1C1MA 1QRWA 2GCHG 1GG6B 3KNXA 4MPVA 4K2YA 1HJAB 1AE8H 1LTOA 1IQEA 2VINA 2ZDLA 3BG8A 3A87A 5L2ZH 2RG3A 3MTYA 2OD3B 4INHA 2QA9E 3RMOH 2GZ7A 4XDEA 1WQSA 1O3OA 5JBTA 1TA6A 2ZEBA 4BNRA 1ZMLA 3I29A 2ZU5A 5E0HA 1MTUA 1EPTA 3NKKA 4X0WU 3K6ZA 2JH6D 2NU1E 1V2PT 3URDA 1MKXK 1ELCA 3BEUA 1GJ4H 1BITA 3SU3A 3M37A 3LPRA 1ZRBA 3UIRA 1Y5UT 4X6NA 2PUXB 1EP5A 5AFZH 1Z71A 3RMLH 1Y5BT 1CA0C 2BD2A 1G3BA 4WMEA 1GBAA 4A1TA 4Y0YE 1PQAA 1O3GA 5ABWA 1A5HA 1ANBA 4LXBH 4WH6A 3M7UA 4IS5A 1W7XH 2QXJA 3F9GA 3T2NA 3KN2A 1G3DA 1E0FD 1BJUA 1V3XA 4ABHA 4DG4A 4PROA 2CN0H 3H5CB 2F3CE 3BTWE 3A83A 1C5UA 2TBSA 5E2OA 1JMOH 3MO9A 3Q3YA 1OPHB 1CQQA 5DKMA 1LVOA 1EAUA 4A1VA 1O2ZA 3VB4A 2Z94A 9ESTA 3PO1B 1EJNA 1BTPA 3OTJE 1EOLA 1D6RA 4YLUA 3GY4A 3KGPA 2VVUA 4BAQB 1P09A 3K9XB 1GBFA 1GVLA 3ODFA 1AVWA 4AOQA 4JYTA 4K1SA 4HI3A 1GJ8B 2NU2E 4X8SH 1A1RA 1IQGA 1LQDB 1JOUB 3LC3A 3Q3KA 3QZRA 4JYUH 1RTLA 5DG6A 2KAIA 3Q00A 3SU1A 2WYJA 1C9TA 2G5VA 1O5FH 2O9QA 1RIWB 3SV9A 2GCHF 1HXFH 3F9HA 1AZ8A 2I6SA 1GPZA 1UTNA 1BTYA 1GI2A 1C5VA 1TB6H 5F8ZA 2FMJA 1SFQB 2W7SA 1K1JA 1W13U 3M5NA 3SW2B 1YGCH 3VGCC 2C3SA 5A8ZA 2OQ5A 1FY3A 2BHGA 4ISHH 4TWYA 1C5RA 1O2IA 1F0TA 3E0PB 5L6NH 4K3JA 5FHTA 1W2KH 2FLBH 3A89A 3F68H 1C2KA 1SLVB 1T4VH 1SQAA 2H5CA 1GJ9B 4O3TA 1YC0A 2Z9JA 2FYQA 1YKTA 1W11U 4ISLA 1HJ8A 3FP7E 3EA9A 2FEQH 1O3FA 2UWLA 1O3CA 3GY5A 5DPAA 1XX9A 2H5DA 3VB6A 1DLKB 3UFAA 4LZ1H 1OP8A 3SQHE 3M61U 3FVFB 2O8MA 1MBQA 4I8KA 4AGKA 2WV5A 2C4FH 3UR6A 1THSH 5HM2A 4YOGA 4TY6A 4JMYA 4O9VA 1V2JT 3AAUA 2GVFA 2Y5HA 3TU7H 3SHAH 3B9FH 3MOCA 3SJIA 1HRTH 4DIIH 3VB3A 3TGIE 3O8RA 2BLVA 2V0BA 1ETSH 3QK1A 4Y76A 1PPCE 3M7QA 2JH5D 2ZFPH 1S85A 1JIMA 1SBWA 1VGCB 4F49A 1NZQH 5JYIA 1NRNH 5C67A 1C1WH 5T3HA 3RXLA 4THNH 4FVDA 4Y11E 1MD7A 1Z8GA 2F9UA 1UO6A 1ZJDA 4HZHA 1S6FA 2ZU3A 1C2HA 1EZQA 1UTPA 5C5OA 4B2AA 3ZZ7A 2FX6A 3D65E 1TPSA 2A32A 1XVOA 4GUXA 2Y81A 2BX3A 1QGFA 3PMJA 1BMAA 1KDQA 2I6QA 4ZKOU 1BBRH 1ZR0A 2XBWA 1SGDE 2FX4A 1AKSA 1TMUH 4XBDA 3TH2H 2PTCE 2OBOA 4I8LA 7KMEH 1ZHMA 2WV4A 5BRRE 1OWHA 1EZSC 1GHVH 1BRCE 3NPSA 1Z6EA 2A4OA 3ITIA 1FNIA 1DSUA 1Z6JH 1XXDA 1ZSKA 2ZFSA 2YNBA 3RXVA 5I25A 3LJJA 3MNSA 1NTPA 1O2NA 3C27B 3BTDE 4GLYA 2H1UA 1TGTA 1EX3A 2EI7A 1EAWA 2ALVA 4TY7A 4NGAH 1UTMA 5K0HA 2ANWA 1FN8A 2F9VA 1YPMH 1EJAA 1O2XA 5DP6A 1DXWA 2BDCA 1NFUA 2AFQB 2J95A 4JZDH 3PO1C 2BQ7B 2IPHA 3MO3A 3A7WA 2P16A 1FI8A 1DWCH 3P70B 2ZP0H 3T27A 1MTWA 1GHAF 2JETB 2IN2A 4UDWH 1O2KA 2GZ9A 2AGEX 2VGCB 1UTKA 1O5EH 1AWFH 3A8BA 1Y3UA 2PKAB 1TBQH 2J34A 3PTNA 1H9IE 2FODA 1DY8A 1GBDA 3M5LA 1LVMA 2FOFA 2G4TA 5JBBS 4ISNA 3SJOA 4IMQA 1ZPBA 2SNVA 1QA0A 3SOSA 5AF9H 1OSSA 2AMQA 3LJOA 3RXQA 5A8XA 2ULLA 2O8WA 2FM2A 2DE9A 1LPGB 1C2FA 2BY8X 1L4ZA 1O2UA 4X8VH 3HGNA 2HLCA 1C5WB 2ZCKP 3NZIA 2G4UA 2BDHA 2ZU1A 1DANH 3BV9B 2HOBA 4BTTB 1EJMA 4YM9A 1C5PA 3TJVA 3UY9A 2B8OH 1GMDG 3QGNB 1UCYK 1ZMNA 2V6NA 2JKHA 1TRNA 3UPEA 2VH6A 4NA7A 2AYWA 3QDZB 3MMGA 4M7GA 1VCQA 5EPNA 1YP9A 1ZZZA 4FXGH 1YPGH 2BXTH 1OWIA 3QWCH 1GBLA 2ZTZA 4ZHLU 2STBE 2P3UB 2BM2A 5GPIB 4CREA 2C8ZB 2FOMB 3U8OH 2IOTA 1ELGA 3A86A 1NU9A 1HAVA 1TRYA 1Y3XA 2QYIA 1QB1A 2Q6DA 5A2MH 1SGTA 3C1KA 3BTKE 1GHXH 5GWZA 2SGAA 2BQWB 4CHAB 2FTLE 4I33A 1P01A 1ZOMA 4X1NU 3RM0H 1TLDA 2FOEA 3BG4B 3MFJA 3Q76A 1IQJA 1P12E 3KHVA 1HAPH 3DUXH 1ORFA 1IQNA 2G8TA 4TYDA 1HJ9A 1LKAA 2BY7X 1LPKB 2RCEA 4SGBE 5E2PA 1ZMJA 2BX4A 3DT0H 1DPOA 4MNYA 3TJOA 1UVSH 2GMTC 5TJXA 3Q3XA 1BTZA 1ZLRA 4INLA 2ZGXH 4H42U 2ZPRA 2TPIZ 1O3BA 1H9HE 1NT1A 3GY2A 3PYHA 3SNCA 1TFXA 2BYAX 1QBNA 1GHZA 1QHRB 3TIUA 1TNJA 1P05A 1P06A 4ZKSU 1TPPA 1GI5A 1ZPZA 4KTCA 3S69A 4NWKA 2A7CA 1UHBA 2GCTB 1W7GH 3LIWA 4K8YA 2ZF0H 1O3AA 1A0HB 1GMDF 1ZTKA 6GCHG 1G36A 4DCDA 1C5OH 3URCA 1MMJN 2UUYA 1AIXH 1ELDE 1BTWA 3STIA 1GJ7B 5LH8A 1F5LA 1CGHA 2ZU2A 3RXJA 4CRAA 1C1SA 3P95A 4NZLA 1JXPA 4MDSA 1TBRH 1DS2E 1LHGH 2QF0A 2D8WA 5E8EH 2FLRH 3GDVA 1NFWA 1LHFH 1Z1JA 1QCPA 3EGKH 3MU8A 1AB9B 1ELVA 3B23B 3PLBA 4U30A 1F5RA 1GI4A 2Y5FA 1GGDC 3OY6U 2ZDKA 5HXFA 2FI5E 1A0JA 1SGQE 4O03A 3RM2H 3ATIA 3LGYA 1ANCA 1AU8A 5F03A 4Y71A 4K69A 1OWDA 1NRSH 2SGEE 2ANMH 1C5SA 1GBCA 2G00A 1TE0A 5I46H 1SLXB 1MTNC 3RXTA 4B74A 1NFYA 1BB0B 1RGQA 4I32A 1P2JA 2VIOA 1OS8A 1O3IA 4NG9H 3SU5A 1ZJKA 1BMNH 3LGWA 2M5TA 5CE1A 2WYGA 4OS4A 3SNDA 3KCGH 2XC4A 1G2LA 5FCRA 3VB7A 2QXHA 4DGJA 1AGJA 5A09A 2VIDA 2VWOA 2ZA5A 3SUGA 5E0GA 2SGDE 3ZVCA 1AQ7A 3IG6B 3MU5A 4F4OC 1K1OA 3A7XA 4NZQA 4FU8A 2BY9X 1ZRKA 1NPMA 1O39A 1SQTA 1PPHE 2Z7FE 4FUIA 2ZI2H 2XNIA 1JRSA 1VCWA 2QXIA 1Z8RA 3FP8E 1V2VT 2AH4X 3JZ1B 3RXMA 4D7GA 1CGIE 3SNAA 5FAHA 3KQBA 2GT8A 5DJ7A 6GCHF 1QRXA 4K5ZA 3M3SA 2GDDA 4E7RG 1GCTB 1L4DA 2G51A 3K65B 4ABAA 5FPYA 2GD4B 5GJ4B 3RUOA 2C93B 3ZZ9A 3HKJB 2RA3A 1NRQH 1SHYA 1ZPCA 4AG2A 1BTUA 2FDAA 1TIOA 1C4U2 4AB9A 2K1QA 1ELTA 2ZHWH 1JBUH 2XRCA 1DWDH 3PB1E 5FX5A 1SMFE 1B7XB 3BF6H 2FYRA 1ZTLA 2OUAA 2O8UA 4JCNA 1MAYA 1N1LA 3HK6B 1O5CB 4YESB 2ZFTA 1B0FA 1O3PB 2ZHEH 1DSTA 2FOHA 4MPUA 4X1PU 4YLQH 2BDYA 3V3MA 1A7SA 1J16A 4FUGA 1THPB 1HDTH 2ZDAH 3TNTA 4E06H 2BY6X 2O8TA 1F5KU 2ODQA 3T29A 5C5NA 1AD8H 4OGXA 2PGQB 3EQ0H 2SGFE 1HIAB 3P17H 1TX7A 1O37A 3ATKA 2HVXA 1LPZB 3P8GA 1OYQA 4BTIB 2A5IA 1MKWH 3M5OA 5HGGA 3U69H 2Z3EA 3PWBA 1S82A 5EG4A 2Z9IA 3JZ2B 1ZGIA 4MTBA 1QRZA 3RXFA 4FUHA 1ESBA 5EXNA 3NXPA 1DM4B 2F91A 3GY8A 4BOHA 2VIQA 1RD3B 3B8JA 4WVPE 3A8CA 3QO6A 2ZGJA 3BIVH 1A4WH 3VXFH 1RTFB 5FPSA 1CGJE 1KLTA 1AY6H 4ABJA 1KXEA 1IQHA 3VEQB 5F8TA 2P94A 4RSPA 3HPTB 1BOQA 1O2WA 3BEFB 3S9AA 2PLXA 1IQMA 2F9NA 5JBCS 1AB9C 4SGAE 2VWMA 2J2UA 1T4UH 1XKAC 2F9BH 1XUHA 4H4FA 4AB8A 2R0KA 1CSOE 5DP5A 2ZNKH 2XCNA 4MLFB 1GHWH 1WYKA 3BTQE 3ZVEA 1CHOF 3STJA 3RXPA 4DJZB 2GV7A 1YCPM 4BANB 3ZZBA 2ZQ2A 1C5QA 1F7ZA 1DUEA 4GVUA 3V13A 1LHDH 1GMHG 1NM6A 1T32A 2ZGBH 1P2QA 2NU4E 5EODA 1NN6A 5EW2H 3HKIB 1UTQA 1QBVH 2H9HA 2BD4A 1SGFG 1EXFA 2QXGA 2ZECA 3GISB 1DFPA 2R3UA 2AMPA 2OTVA 3MH6A 3PM3A 4WJG2 2A31A 7GCHF 5FBEA 1QTFA 1ZGVA 2STAE 2XW9A 2A7JA 1AWHB 2H2ZA 1HBTH 2H9TH 5LGOA 2ASUB 2BOHB 2D2DA 2HNTC 1P0SH 2HGTH 1PPFE 1YM0A 5K7RA 1AO5A 3FZDA 2ZKSA 3E90B 4FVBA 3M7TA 4B2BA 1ZHPA 1C5MD 1IQLA 1XUKA 4WMDA 4CRCA 1RTKA 2C8WB 2FWWA 1AE5A 4XE4A 4MNXA 4UFEH 2HPQH 2CHAC 3R3GB 3RC5A 4A5TS 1GBIA 3BN9A 4ZKRU 4AZ2B 2BVXH 5C20A 4ISIH 3TLOA 4FUCA 1ETTH 2Z9KA 5J4QA 1WUNH 4KELA 1LHCH 1RS0A 1WCZA 2G81E 4ABDA 1XMNB 1DT2A 1L0ZA 3PV4A 2ZCLP 1GVZA 3SU0A 1AFQC 1V2QT 4NA8A 2VJ1A 2UUFB 3A7YA 2YNAA 1N8OC 1VITG 1T8NA 2FPZA 2GX4A 2QAAA 1HUTH 4IC6A 3KQEA 3N7OA 1EASA 4D9QA 5DO4H 1ZYOA 2W3KA 2ZPQA 3AAVA 1PPGE 2BDBA 2SNWA 3SI4H 2ZGHA 1QFKH 1V6DA 2BMGB 3ZVBA 3HGPA 1P10A 1ELEE 1S84A 1GMHF 1O2GH 1MZAA 2Z3DA 3GY3A 1HPGA 1KLIH 1GHAG 1H9LB 4INKA 4MNWA 1YCPH 2ESTE 2CF9H 1HAGE 1BRAA 1O3HA 3ZVGA 5C1XA 1VITH 4MNVA 5L2YH 1EAIA 3GCHB 2A2XH 4IBLH 6CHAB 2Q6GA 4DVAU 1BTXA 1GG6C