1QQ4A

Crystal structure of an alpha-lytic protease mutant with accelerated folding kinetics, r102h/g134s
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCHSGRTTGYQCGTITAKNVTANYAEGAVRGLTQSNACMGRGDSGGSWITSAGQAQGVMSGGNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ALPHA-LYTIC PROTEASE
publication title A Genetic Screen That Targets Specifically the Folding Transition State of Alpha-Lytic Protease
rcsb
source organism Lysobacter enzymogenes
total genus 59
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1999-06-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qq4A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1qq4A01
3EA9A 3LU9B 1QBVH 1S0QA 1GI7B 2B5TB 4TY6A 3RMNH 1O2TA 2H9TH 4DCDA 2FS9A 2J94A 3TGJE 4XSKU 2ZDKA 2ZDMA 1W13U 4KGAA 1TPAE 1BTPA 4I8KA 3GCOA 1TNHA 3TK6A 1HFDA 4BAMB 1D3DB 1MH0A 3STJA 1DLEA 1W7GH 2ZHWH 2AH4X 1DWDH 2PTCE 1D9IA 1G37A 1WBGB 1LHGH 3LONA 4A7IB 1N6YA 1O2IA 1O35A 4K60A 4BAQB 3ZVGA 3TJNA 2BY9X 3QTVH 3GCTF 1QB1A 1Q2WA 1Y59T 5JBBS 1QTFA 3UNRA 1ELGA 3LGUA 5FX6A 3GY3A 4JZDH 4B1TA 1V2KT 1GI8B 3S0NA 1TOMH 2FS8A 1O3HA 3SV9A 5EODA 1SHHB 2W3KA 3SNBA 1FY8E 2PV9B 2ZFQH 3RXIA 2ZDNA 4ZROA 3I78A 1UTOA 2K1QA 1YCPM 2BDBA 3MU1A 2JETB 4PROA 1K22H 4X2YA 2ZI2H 5L2ZH 2AMQA 1THPB 1GHBF 1THSH 2FI3E 2PTNA 1KLJH 1UTQA 1DSTA 2J34A 1SGNE 3DD2H 1J15A 1P06A 3BTEE 7KMEH 5HM9A 2THFB 3VXEH 3SQEE 1MTUA 3FVFB 1IHSH 1KLTA 3RXKA 3A83A 1GBMA 4I8HA 4A1VA 1BRUP 4IMQA 1L4DA 2ASUB 4KKDA 1OX1A 1RTFB 3U1IB 1P2IA 1SGFG 2ZU1A 2H1UA 3LH3A 5DP4A 2DE8A 3CP7A 2FEQH 3SHCH 1CA0C 3S7KB 1HIAA 2V6NA 2F9NA 4DJZB 4NA8A 2D26C 4JYUH 3SUEA 3ZVDA 3CENA 4NIXA 3MH6A 3A7ZA 4JYTA 2V0BA 1W12U 3M36A 3BTDE 3TH4H 3AW0A 3MNXA 4BAOB 1W2KH 2ZU5A 1O3DA 2ILNA 2RA3A 1ESAA 5AHGH 3STIA 1W0YH 5DP5A 1HJ9A 1LHCH 1P04A 5FHTA 2VINA 3GDVA 2VGCB 1BIOA 1BJUA 1E37B 1VJAU 1Z1IA 2D8WA 3MH7A 1V2OT 4KP0A 2M5TA 1LCYA 3JZ2B 1LHDH 1OP2A 3SNEA 1TQ0B 1LMWB 4CRCA 1BTZA 1UHBB 3BG4B 5CMXH 1TMTH 4H6TA 2O8TA 1VITG 2BVSH 1E0FD 3BTKE 2VIDA 3FP6E 3EA8A 3A8DA 2OC1A 3UQVA 5AF9H 1TFXA 2A4RA 3GOVB 3ZZ7A 3K2UA 4Q7XA 2ZCLP 1HAIH 1FAXA 1KXEA 3URCA 1F0TA 1FDPA 3EA7A 3VGCC 1B0FA 5J4SA 2F9UA 3PLPA 5E0GA 3IG6B 1BRCE 2PUQH 4X8VH 3UIRA 4UD9H 2GZ8A 3MO6A 1T4VH 1T8LA 5FPTA 1SLWB 5C2ZA 3TK9A 1W7XH 1EAUA 1YKTA 3E91A 4J2YB 1MKWK 1QB9A 1EX3A 1V2WT 4FUEA 1T8MA 1N8OB 1UVUH 2WPMS 1T4UH 1Z1JA 2GCTB 3QGJA 4BTTB 4WXVA 2P3FH 4X1RU 1QJ1B 2F83A 1OWHA 2FYRA 4U30A 3UFAA 8KME2 3UWJH 1WAYB 2ZNKH 5DJ7A 4ZXXH 1EZXC 1QL7A 4Y71A 1KTTB 1C1SA 4A92A 1K1JA 2GTBA 1EJAA 1W3CA 3AVZA 1HAZB 3SOSA 1GL1A 2G4UA 2H9HA 3BEUA 4OS7A 4GLYA 2OP9A 1WTHD 2GT8A 1G3DA 1BBRE 2TGDA 5DP8A 1CGHA 3RXUA 1NY22 1L4ZA 4YESB 1C2EA 1OXGA 5EQSA 2ZG0H 1GJ6A 1TNIA 4DGJA 1LVBA 5F8TA 4DVAU 4OGYA 2FI5E 1KXBA 2EA3A 2ZECA 1TPOA 5DGJA 4DIIH 3U9AH 1V2NT 1N6XA 2CV3A 3SJ9A 2STAE 2A4OA 4U32A 4OS1A 1Z6EA 3F9GA 1PQAA 1P9SA 1DUEA 2GGVB 1HAYB 1HJAB 1V2MT 2CJIA 2OINA 3UY9A 3SNDA 1F5LA 3K6YA 1THRH 3RXGA 1HYLA 4MPUA 2FM2A 2FPZA 5GCHG 3RC6A 1AFQB 4NIWA 3KL6A 2WINI 3UR6A 4AFZA 3SV8A 4AYVB 2OC8A 1BOQA 1TRMA 2Z94A 5FAHA 3NCLA 3MOCA 1GMHG 2UUKB 1O3MA 2FP7B 2GT7A 3GCHB 5ETXA 4BXSA 1OKXA 1LPKB 1K1IA 2A0QB 1GJ5H 4FUCA 2A1DB 2C3SA 1BMLA 3CS7A 3GYLB 3A87A 2PR3A 1O5DH 1MBQA 4A1XA 4CRBA 1GBHA 1GJCB 4XBBA 3SU2A 4F4OC 2J38A 1V2UT 2PLXA 1SOTA 1G9IE 3AW1A 2VVUA 3MWIU 1BBRH 2P93A 2GMTC 2C8YB 3O8RA 3PO1B 2R2WU 1OPHB 4YO9A 3PMBB 2FOCA 2G00A 1P10A 4B2BA 2P59A 5EXLA 1FY4A 2W3IA 1EASA 1YPLH 3ATMA 4LK4A 2BXUH 1SGRE 4K3JA 1Q3XA 1GHXH 1MTWA 1GVZA 1TRNA 2ZPSA 1QRXA 2HVXA 2NU3E 2Z7FE 2Y5FA 1ESBA 4WMEA 3M7TA 4X8SH 1GGDB 3RXVA 4SGBE 3RXQA 2XXLA 1SGIB 2ANKH 2ZFSA 4ABHA 1YPMH 1O3NA 1TLDA 2CHAC 2A4GA 1AVWA 1WU1A 5AVDA 1NFUA 1CHOG 2WPJS 4HGCA 6LPRA 3QWCH 2H5CA 1IQLA 4MLFB 1F2SE 4TYDA 1V3XA 4OS2A 2Z3CA 1O3GA 1IQKA 5T6FA 4IMZA 1GBLA 1P0SH 4JCNA 4X6OA 5F8ZA 5A09A 2FWWA 4IBLH 3RLYH 3SQHE 2R0LA 1GI0A 3N7OA 1QJ7B 2RG3A 2PKAA 3TH2H 1AN1E 4XE4A 1ELBA 5G4BA 3FANA 1ANEA 2ZEBA 1OP8A 4NFEA 3RU4T 3ZZ3A 3ATWA 4IN2A 2R3UA 2PFEA 3VPKA 1HRTH 4FVBA 1W11U 2XCNA 2BQ6B 3EQ0H 2A7CA 2ZTZA 1OOKB 3BTHE 3KN2A 2ULLA 4NIVA 1JXPA 2QIQA 4SGAE 4ABJA 2Q6DA 2FMJA 3KHVA 2BVRH 4X1PU 4CREA 1MD7A 2XCFA 1MAYA 1OSSA 1Y8TA 3LGIA 3A7YA 1C1PA 2XC0A 1UCYH 3NK8A 5HGGA 2PW8H 3A88A 1O2WA 1GCTB 3I29A 1O3OA 2O8UA 5PTPA 4H6SB 2Z9IA 1W8BH 3TPIZ 4WMDA 4ABBA 2SGFE 2W5EA 4NCYA 1UTJA 3TJUA 4H4FA 1GI4A 1Z7KA 2ZCKP 2BB4A 2EC9H 1MU8B 1M9UA 2A5AA 1BZXE 4Y10E 9ESTA 1CT2E 2BX3A 2F9OA 3NPSA 1RFNA 2HNTF 1SPJA 1ZHMA 3QN7A 2P3TB 2JH5D 1GHZA 3SI3H 1K2I1 2ZFFH 2KAIA 2A7JA 4INKA 5A0BA 3BEIB 3FZZA 4RN6A 3LJJA 1SLUB 4CH8B 1DS2E 5T6GA 2H2ZA 4X2WA 2Z3EA 4ASHA 1HAVA 1GDUA 1HAHH 4FU9A 2GD4B 2VIWA 2B9LA 1ORFA 1SGTA 1J16A 2HOBA 1RIWC 4Q7ZA 4CH2B 1KSNA 3H7TA 2NU4E 3ZYEA 1Y3UA 1O5AB 1F7ZA 4Q2KA 1O2KA 1LQDB 2BHGA 1MU6B 1EQ9A 4DW2U 6ESTA 1AO5A 1H4WA 1K1LA 1C1TA 3IITA 1NRRH 2ZFTA 2D1JA 1V2QT 3OTJE 4FUDA 5I46H 1O3JA 3UUZA 4LXBH 2C93B 4A5TS 4VGCC 2XBWA 1EPTC 1WV7H 1GJ9B 1RRKA 4U2WA 4CBNA 2G8TA 5BRRE 5EPNA 1BDAA 4X6MA 5AFYH 3RM2H 1O39A 2P95A 1TMBH 2EI6A 3LGYA 1ARBA 1P2JA 2AFQB 2AGIX 1AHTH 1C5XB 2HRVA 3V0XA 2ZGBH 1UTPA 1BMNH 3T2NA 1AKSA 1WTGH 3ZZBA 1A0HB 2J9NA 2VVVA 4WMFA 1BJVA 2XRCA 2ZF0H 1N1LA 1YM0A 1P57B 1AB9C 5CHAB 1Q31A 1LO6A 1ZMJA 3TGIE 3PWCA 1HIAB 3OY6U 1DICA 3BIUH 1MCTA 1D4PB 2ZGHA 5FPYA 1F0RA 5B6OA 2BMGB 5A8XA 4ISHH 1EPTA 3SW2B 3S9CA 3BSQA 4NSVA 4GCHF 2P94A 3M61U 1A5GH 2Z9LA 4WWYA 5GWZA 5JBAS 1Y3VA 1AI8H 1P3CA 3RM0H 3A7XA 3PMHB 1NM6A 2FOAA 1BTWA 2GX4A 2QXHA 3KQBA 2CF8H 3MNBA 1K1OA 3LKWA 2GV7A 4E05H 1K9OE 1ZGVA 4WVPE 5C1XA 4MDSA 5FBEA 2G51A 1SHYA 1QY6A 3MH5A 3F9FA 1LTOA 2TIOA 3OY5U 3UTUH 3SBKA 4RKJB 4GHQA 1H9HE 3LPRA 1L1GA 1YP9A 1BHXF 1BB0B 3M5MA 2Q6GA 1JIRA 4MNWA 1O3CA 2FTLE 1NRNH 2F9VA 2G5NA 3ZZ8A 1C2GA 1GJ7B 1ZZZA 1O5GH 3HGPA 5FX5A 1TGCA 3TLOA 2TGTA 3C1KA 5A0CA 1QFKH 4TWYA 2SFAA 3M3TA 1VGCC 1SLXB 3SNCA 2FLRH 4FVDA 2D2DA 1H8DH 1CVWH 5EW2H 1TMUH 1D3TB 2DE9A 1MKWH 1GMDF 1PQ5A 1JOUB 3SU6A 4XBDA 5EQQA 3SJIA 1QL8A 1Y5AT 2XC4A 1TABE 5C5OA 1ID5H 3BTWE 2PGBB 3SO3A 4DIHH 4WY3A 2AIPA 1K21H 2GDEH 3QO6A 3VXFH 4NA7A 3P6ZB 3QGNB 3U8OH 1ZPBA 2NU1E 3HGNA 1PPZA 4ISOA 1B0EA 1LQEA 1ZOMA 3LOXA 5E2PA 2FODA 3EYDA 4ZMAH 2BY7X 1C5RA 1C5ZB 5AFZH 1QIXB 2VWMA 1P12E 2PKSB 2ZQ1A 1WOFA 1XUIA 2BX4A 1TGTA 3DFLA 4UDWH 1YPHC 1QL9A 5DG6A 2XWBI 1NT1A 3URDA 2TRMA 1O2SA 3OSYA 3F68H 3ZZCA 2GDDA 4M7GA 2JKHA 3BTTE 3LH1A 1FI8A 3UREA 2QCYA 2UWPA 2UWLA 1NRPH 1XUFA 3GY8A 1GHAF 4K5ZA 3VFEA 4ABGA 3QX5H 1EOLA 1G30B 2VIPA 2JH0D 4FU7A 5DP3A 3A86A 4TPIZ 1ZRBA 1BTHH 1DY8A 4AFQA 3A85A 3M5OA 1KXFA 2SGPE 1MTNB 2NU0E 3ZVEA 1NFYA 3TITA 1A1RA 1SGYE 2ZHEH 4XFQA 1Z8GA 1H1BA 1GDQA 1GBTA 5TCAA 3RP2A 3DA9B 4UFGH 4TPYA 3GISB 3UQOA 3A84A 1H8IH 1FPHH 1BUIA 3KEEA 1ZSLA 1C1NA 4OS6A 2FOHA 1H9IE 1PPHE 1TX8A 2ZCHP 3M5NA 4NGAH 1F5KU 1F0SA 1HGTH 5F03A 1O2QA 2ZO3H 2PHBA 1ETSH 4J1YA 1EAIA 1F92A 1GMCG 1ZTKA 2A45B 4FUIA 4NFFA 3SJKA 4BNRA 3LDXH 2FZZA 8ESTE 1HAOH 5C1YA 4FUFA 3ZZ4A 5DPAA 1UJ1A 1FPCH 2ZQ2A 3BTME 2ZU3A 3T25A 1QHRB 1OWDA 1QCPA 2UWOA 2V3HH 4ISLA 4D8NA 4ZKSU 2EI7A 1AU8A 2VIVA 3SGQE 3P17H 1GI5A 3M5LA 1EATA 1UTNA 1KIGH 1C5QA 1GI1A 2FO9A 4BAKB 5JBTA 4ZXYH 1YYY1 1IQHA 4K8BA 3NZIA 1BMMH 1QJ6B 3NXPA 3V12A 2AGEX 1TNKA 1IQGA 1C5NH 1NU7B 2Y5GA 3GCTG 1P2MA 1P05A 2ZFRH 3TH3H 5A2MH 3PMJA 1HUTH 1FZZA 1ELFA 2VWLA 2P8OB 1TX7A 1FLEE 5H4IB 3SU3A 5LPRA 1RJXB 2XBVA 3P8NA 1NU9A 3A7WA 2A32A 3A82A 4O03A 3RXBA 5C5NA 5K0HA 1PQ8A 2ANMH 3TVJB 2CGAA 4AB9A 3G01A 2FOGA 3KF2A 2PKAB 5ESTE 3HPTB 1INCA 4H42U 1V2LT 1ZTJA 4U01A 3ZVBA 5J4QA 1CBWB 1GHBG 3B9FH 1C4U2 1KLIH 3QK1A 2BOHB 4BTIB 2SGQE 4B2CA 3MO3A 4Y11E 1HAGE 2BQWB 1UK3A 4KTUA 2BLOA 2EI8A 4INHA 1P2NA 6GCHF 1V6DA 2SGDE 1C1QA 2JETC 1O34A 3JZ1B 1EP6A 3W94A 4HTCH 2CMYA 1DM4B 3MU5A 3PWBA 3O8DA 1XMNB 4JMYA 2CXVA 3BIVH 2A31A 1GBAA 1SB1H 3ZZ5A 1A5IA 4YLQH 1IHTH 4K2YA 3T28A 3QZRA 3M3SA 5A8ZA 2G81E 4GHTA 4TY7A 1C2KA 3TU7H 4MPVA 2VJ1A 1FY3A 4IGDA 3AAVA 4I33A 4OS4A 4CR9A 3MYWA 3GY6A 5DP6A 4Z6AH 2I6SA 1S5SA 2Y82A 1VR1H 3MU0A 4KTSA 4D76A 3GY5A 2FX4A 4IS5A 4MPXA 2VIQA 4AX9H 3TNSA 3VB7A 3CS0A 4JK5A 3SGAE 3M7QA 3KGPA 5JYIA 1G2MA 1E38B 1BT7A 1IQMA 1C5OH 1UVOA 2YNBA 1PYTC 1KXAA 1C1UH 3LC5A 4QT8C 1IOEA 2KAIB 1O3KA 3BF6H 4GPGA 1UTKA 2R2MB 4ZHAA 3PMAB 1LPZB 3S9BA 1NRSH 2BXTH 4X8UH 5GPIB 1HDTH 1G32B 1HAVB 2J92A 3UNQA 4TWWA 1WQVH 1VITH 1OP0A 1O2NA 3D65E 3HK3B 1TBZH 4ZKRU 1KDQB 4X6PA 3ZYDA 3MU4A 3SU1A 2VGCC 1ELCA 4FUGA 1NESE 1CA8B 1L0ZA 4AB8A 4THNH 3UPEA 3MU8A 1HNEE 3RXDA 5HYOA 3ENSB 1SGFA 4GSOA 1IQIA 2BVXH 1C1MA 3BG4C 1ETTH 1O2HA 1P9UA 3SV6A 3RDZA 3RMMH 4AGKA 1UVTH 6CHAB 2W7SA 3W95A 2H9EH 1VJ9U 1DANH 1JWTA 4WF8A 1MCVA 2W7UA 1O32A 2C90B 1O2PA 2EEKA 2VVCA 1Z71A 3ZZ9A 1O2RA 1SG8B 2XNIA 5JDUB 1HV7A 2Z9KA 1MTVA 1ELTA 4FUJA 4Y7AA 3RXJA 5F8XA 1C4Y2 4IC5A 1ELAA 1FIWA 4LOYH 1TGBA 3MNSA 2VH6A 1AKSB 1C9TA 3FFGA 1SFIA 1SQOA 1UCYE 5JPMH 2HPQH 3U69H 1O5FH 4JK6A 3TJVA 1UTMA 1NFXA 4B71A 4B73A 3RXAA 5K7RA 1Y3YA 1N8OC 1O31A 3SJ8A 1OS8A 2GCTC 2BYAX 3RXFA 3FP7E 1Z8JB 4X0WU 1TX6A 1O5CB 2SGEE 1AY6H 1GBKA 4Y7BA 1C5TA 3I77A 2F9PA 1TONA 4R8TB 2P16A 4I8GA 3UR9A 1NZQH 2FOEA 1TGSZ 1Y5UT 2WPIS 1BTUA 1TPPA 2XWAA 1QGFA 1D3QB 3TIUA 4AG2A 1FN8A 1PJPA 1XXFA 2JH6D 1O2YA 4E06H 1DX5M 1GBDA 1FUJA 3P8FA 2R0KA 1P02A 4CR5A 1S82A 2FIRH 1V2RT 1SR5C 3PM3A 3QZQA 3T62A 1CHGA 2ZGXH 5GDSH 1LPGB 1HLTH 1FXYA 2TPIZ 5T3HA 1IQJA 1DWBH 2BD3A 1CU1A 2BD7A 4ZUHA 4A1TA 2BZ6H 1ZMNA 2HLCA 3O8BA 2WPLS 2C8XB 1DSUA 2Z9GA 1FJSA 2XW9A 1HJAC 4HZHA 2G52A 1ZR0A 3LIWA 1O3AA 3U8TH 1PPFE 1SFQB 4IC6A 1G3EA 1MKXK 2H6MA 1AFQC 1GBIA 1O2UA 5GJ4B 1DOJA 5EPYA 1GJDB 2BZAA 2CF9H 1ARCA 3GY2A 1T8NA 5LH8A 1GHVH 1ETRH 5T6DA 3F9HA 3GCHC 1TYNA 4I8JA 1NC6A 3QTOH 2OLGA 2OC0A 2ZTYA 1GG6B 2BD9A 3RMOH 1P2OA 2FOBA 1G3BA 1VZQH 3MFJA 1TALA 1QA0A 1TNLA 3BTQE 4ABAA 4YLUA 2BD8A 4CHAB 1GCDA 2PSYA 3PO1C 1C5UA 3MI4A 3SU0A 1GVLA 7GCHF 5HXFA 2ODYB 1TGNA 1WSSH 1CT0E 2AEIH 1DWEH 4NZLA 3SJOA 4RKOB 1PPGE 2XC5A 2QYIA 1FONA 1HCGA 1TQ7B 1VCPA 1UVSH 1DE7H 4K1EA 1UMAH 3FZDA 1C5SA 4UFDH 2FOMB 1D3PB 3B8JA 3PLKA 3HKJB 2QF3A 1K1MA 1PPCE 2R9PA 2BD5A 1GGDC 1C1OA 1MQ6A 5E2OA 1LKBA 1F5RA 3LGWA 1A5HA 4MPWA 4D7FA 2OBOA 4YT6H 5EOKA 1LDTT 3F6UH 1KXCA 3VB6A 1S81A 1SMFE 1W10U 5EW1H 1NO9H 2BDGA 2QXGA 4GAWA 3NWUA 8GCHF 1EZSC 1C5MD 2AMDA 1ZPZA 1A2CH 3ODDA 4FUBA 1Z8RA 1H9LB 1SVPA 1EB2A 1QRWA 4ABIA 1ZLRA 1D6RA 2GP9B 1GJBB 1NROH 1AWFH 3TK5A 3SHAH 4KELA 1OYQA 4GUXA 5GXPA 3UOUA 1ZPCA 1F0UA 1FNIA 1LVMA 1O30A 1TPSA 2Y5HA 2AYWA 4ABDA 1CO7E 1OWJA 2GV6A 2FX6A 2WYJA 3GY4A 2ZTXA 1A0JA 1OYTH 1JBUH 2GCHG 1D6WA 1CGIE 1S0RA 1SGEE 1AQ7A 4X1NU 1NTPA 2GVFA 1GHWH 1XVOA 2OD3B 3RXTA 1FAKH 1J9CH 1C2JA 1HAPH 1A0LA 1V2TT 1QNJA 3V7TA 4CRGA 2QY0B 3LGTA 4CRFA 1QQUA 2TGAA 3FAOA 1O2LA 1EB1H 5GIBA 4UONA 3GYMA 2Y7XA 5JB8S 3PLBA 1YPHE 4X6NA 1TOCB 2HPPH 1SOZA 1GCTC 3B23B 2F3CE 5C1UA 3A8AA 3VB5A 1KYNA 1NFWA 1QQ4A 1O3IA 2ZDAH 4D9QA 1C2MA 1AZ8A 4YOIA 1EZQA 2OCVB 4GVUA 5HMAA 4LZ4B 4XDEA 5FXLA 1O3FA 1GDNA 2O9QA 2ZDVH 3DT0H 2BOKA 2VWOA 3S69A 1P2KA 1CA0B 3SV2H 4E7RG 2QF0A 3RU4E 1FY1A 1LHEH 1V2VT 2GZ7A 1O2XA 2BDIA 2BDHA 2NU2E 1VCQA 2GZ9A 4B75A 2ANYA 1TA2A 2F9BH 2LNCA 3GICB 3FP8E 2BM2A 4DOQA 2F91A 1HB0B 1J14A 5DP7A 2FDAA 2NWNA 2VB0A 2FXRA 3BV9B 1BITA 2Q6FA 3SUGA 1YPKH 1A7SA 1SL3A 3PV4A 4MNYA 4AZ2B 1LHFH 4MTBA 3LGVA 2BTCE 1DPOA 2G4TA 3K65B 1ZRKA 3TNTA 1EJNA 1XUKA 3ZZ6A 1CGJE 7LPRA 1T31A 3E8LA 3K6ZA 1Z8IB 5IYTA 2W26A 1GMCF 4NWKA 2STBE 4DG4A 1GI2A 2Y80A 3P70B 2G55A 4I32A 5A0AE 2FYQA 2BDAA 5C3NA 2BY8X 1G3CA 1XUGA 3RU4D 1IQEA 1GBJA 3T27A 3ELAH 1J17T 1EJMA 2YNAA 5EQRA 1SGQE 3P8GA 4JZEH 1B5GH 4NWLA 4YTAA 3A81A 1CE5A 3VGCB 4YOJA 2A4QA 1XUHA 1P11E 3ODFA 3D62A 1XXDA 1ABJH 7ESTE 1JMOH 1FY5A 1V2JT 3MH4A 4NZQA 2WPHS 4WH8A 1VITF 3GCNA 1C5PA 1C9PA 3AASA 3TGKE 1YLDA 2IN2A 1TE0A 4X1QU 1E34B 1QURH 2BY5X 4AYYB 3RXOA 5L2YH 4GCHG 1GHYH 1ZSKA 5CHAC 5E0JA 1NRQH 2IJOB 2QV1A 4ZHMU 2OBQA 1UO6A 1O3BA 1XM1A 1T8OA 2Z3DA 3M7UA 3QDZB 1S6HA 1WUNH 1SSXA 1MAXA 2CN0H 1QB6A 8LPRA 1J8AA 1S6FA 1AD8H 1YGCH 3PTBA 4R0IA 4AN7A 2ZC9H 2ZGJA 2GKVE 2SNWA 4Q7YA 5ABWA 1MTSA 1AVGH 3PROA 1Z6JH 3IWMA 1UK2A 3RXSA 2FOFA 1MUEB 3DFJA 4BOHA 4AG1A 3O8CA 2B8OH 1ANDA 1CQQA 2XYAA 1DDJA 1BHXB 2WUBA 1EAXA 1O3LA 1K28D 2HNTC 4HI3A 4D9RA 1C1WH 4ZKOU 2R3YA 3D23A 3SZNA 5E0HA 3GDUA 2ZKSA 1SGDE 1AE8H 1B7XB 3M37A 1L1NA 3EGKH 4K8YA 5I25A 1Y5BT 2HGTH 3UOPA 4BANB 4DY7B 2ZIQH 4NA9H 4OGXA 1GMDG 2FI4E 4MVNA 1TA6A 2ZU4A 1A3EH 2O8LA 2FTMA 1AVXA 2ALPA 2PUXB 3RXCA 2RCEA 4JZIA 1AFEH 3Q3XA 2BDCA 1P3EA 2B0FA 3A8CA 4Y8YA 1HJ8A 3E16B 5CE1A 5ESBA 1GJ4H 1ZJKA 1FIZA 1PPEE 5GCHF 3ZV8A 4X1SU 4YZUA 4Y8XA 4CBOA 1T32A 2GMTB 1UVPA 1ZHPA 2OQUA 4B2AA 3U98H 1GMHF 1RTKA 3ITIA 2V3OH 1YCPK 5F6MA 2IPHA 1KTSB 2ZHFH 2UUFB 3BEFB 2C4FH 2IOTA 2VIOA 2QA9E 3ZZAA 1QBNA 2O8MA 2ANWA 1P8VC 1EUFA 1O37A 3SGBE 1TNJA 2ZWLH 1GHAG 4BTUB 9LPRA 2VWNA 2PKSC 1PQ7A 1BRAA 4FXGH 1RXPA 1G36A 2CHAB 1TRYA 4YT7H 1A46H 3E1XB 2FESH 3RXLA 5DP9A 1GBCA 1O38A 4DURA 4YOGA 3PYHA 1XKBC 3EDXB 1PYTD 3V3MA 2QXJA 2Z9JA 3TJOA 1EOJA 2HWLB 4I31A 1AIXH 1C5YB 2ZPQA 1SGPE 4FUHA 4DT7B 1EKBB 1DXPA 1DWCH 1MKXH 2WUCA 2H5DA 3PTNA 1QA7A 3R3GB 1CHOF 5DO4H 1HBTH 3H7OA 3NKKA 1MTNC 4JZFH 1LKAA 4BAHB 3EAJA 3KQCA 1A4WH 1K1PA 4Y0ZE 1YPJH 4ZAEA 3A8BA 1ZMLA 1JRTA 5FBIA 2HALA 1GJAB 5DK1A 1YF4A 3ATLA 4AGJA 3P92A 4D7GA 2ZGCA 3E90B 3S9AA 1O5BB 1AUTC 3ZVCA 5TCCA 2A2QH 1A61H 4B74A 3E0NB 1QRZA 4Y8ZA 1MD8A 2BQ7B 1HXEH 1MZAA 4X2XA 2VU8E 1O36A 1TIOA 1JRSA 4B76A 3UWIA 1DITH 1RGQA 1SGCA 4ZH8A 1DUAA 1ZJDA 1IQNA 3A7TA 1XX9A 2UUYA 2WYGA 2A5KA 2B7DH 1SQAA 1X7AC 5TJXA 1YLCA 1V2PT 3OYPA 2OC7A 3A89A 3Q76A 4NSYA 5LGOA 4WXIA 4O97A 5SGAE 4X8TH 1O3EA 2BLQA 2Y7ZA 3MMGA 3MHWU 4X2VA 3ZV9A 2P8OC 2UUJB 1AE5A 4KTCA 4A6LA 2ZZUH 2QC2A 1W0ZU 1C2DA 5IDKA 4ZHLU 2RDLA 3K9XB 1GI9B 3L33A 1OWIA 1C2FA 5EU8A 6GCHG 1RIWB 1EAWA 3E0PB 1ZHRA 4Y0YE 1L2EA 1TBQH 1IQFA 3F1SB 1MQ5A 1CBWC 2A7HA 2RA0A 4FU8A 3RC5A 3SV7A 5DKMA 1VCWA 1ZGIA 4NIYA 1C4V2 4MQAA 3PB1E 5L6NH 3RC4A 4INLA 1UHBA 4JZ1A 5EXMA 1SBWA 2ZPRA 3U1JB 1RTLA 1PPBH 3HKIB 4ESTE 2BLWA 3UNSA 3RLWH 3SU5A 1QR3E 4VGCB 2OXSA 1G2LA 1EPTB 1SI5H 1RD3B 2WV5A 4MNVA 1O2MA 3RXRA 1TAWA 3SU4A 1TBRH 1ANBA 1YPEH 3VEQB 4Y6DA 1SQTA 3S7HB 4I7YH 3M35A 1DY9A 3ATIA 3P8OA 2XTTB 1ABIH 3SUDA 2A5IA 2PGQB 2ODPA 1C5LH 1C1VH 2ZDLA 3M3VA 4LZ1H 1ACBE 1AB9B 1DLKB 1O3PB 1OWKA 4O9VA 5LPEA 2BD2A 4Q80A 4WH6A 1O0DH 5FCRA 2AGGX 3LJOA 3QUMP 4K69A 4CRDA 3ZVAA 2BD4A 4XBCA 2AIQA 2ZU2A 3KIDU 3MTYA 2Q1JA 1ELVA 2ZHDA 4OS5A 1C1RA 3C27B 1LVYA 1TNGA 3BN9A 2G5VA 2GCHF 3GY7A 3KQEA 4UFFH 1MZDA 1P03A 1ZSJA 1A3BH 3LT3A 2OUAA 2TBSA 1BMAA 3T29A 1WCZA 1C2LA 3HK6B 3Q3KA 2BY6X 3GDSA 1KXDA 1RS0A 2J2UA 2QXIA 4UEHH 1XUJA 1NN6A 3U8RH 3T26A 2O8WA 3KQDA 3VB3A 1C5VA 2V35A 4O3UA 1O2ZA 2AERH 1GBFA 5EGMA 5LPFA 3SUFA 3ESTA 3RXEA 1GBEA 1Y3WA 4XOJA 1GI3A 1HAXB 4K1TA 6CHAC 1UK4A 1ZTLA 1P2QA 1BTYA 5FPSA 2C8WB 1U6QA 1TB6H 2ZFPH 3MNCA 3R0FA 4F49A 1UTLM 5HM2A 1VGCB 2SNVA 3QLPH 1C5WB 2BDYA 3SI4H 3E3TA 1PFXC 5FCKA 1NS3A 4IW4E 1KDQA 3DHKH 1EP5A 4IN1A 1SLVB 2XBXA 1BQYA 4AOQA 1ELEE 1Y3XA 3LC3A 3RXHA 4MNXA 4BXWA 1BBRK 1DFPA 4UE7H 1XKAC 4RSPA 2PWXA 1C2HA 2YOLA 1IAUA 2VH0A 3D49H 2ZHQH 1DT2A 3OX7U 2SGAA 3SORA 3Q77A 3WY8A 3RUOA 3T5FH 2BLVA 3A80A 1V2ST 1OWEA 4NG9H 1E36B 1FMGA 3Q00A 1MMJN 5E8EH 1AWHB 2DUCA 2ZA5A 4UFEH 1AMHA 2QN5T 2QGRA 2QAAA 1EXFA 1FV9A 3L3TA 4YM9A 3KCGH 1GL0E 1E35B 1JIMA 1AUJA 3BTGE 5C20A 2AMPA 1TWXB 2ESTE 3RMLH 1FQ3A 1DVAH 4ISIH 2PSXA 1SC8U 1GI6A 2J95A 3L6PA 2Y81A 4I8LA 5C67A 3HATH 2OTVA 4JYVH 3SNAA 1S83A 4AFUA 1L1JA 1WYKA 1O33A 1GJ8B 3H5CB 4Z0KA 1FN6A 1EZUC 2ZP0H 1DXWA 2I6QA 4WJG2 1HXFH 2AS9A 1ZYOA 4Y79A 3ZVFA 3E6PH 1GVKB 3Q3YA 1T7CA 1YPGH 1YBWA 1CT4E 5JB9S 3V13A 1P01A 4ISNA 3F9EA 2OQ5A 2P3UB 2TGPZ 3DUXH 4ABFA 4O3TA 5JBCS 4ABEA 5EG4A 2C8ZB 4E7NA 7GCHG 1O2GH 3KNXA 2XBYA 1GWAA 1ESTA 1O2VA 1S85A 2VNTA 1GBBA 1O2OA 2Y6TA 2WV4A 1GG6C 1O5EH 1C2IA 1AGJA 2WPKS 4AFSA 1QBOA 1BRBE 4Y76A 3OU0A 1AZZA 1W14U 3RXMA 4CRAA 1BA8B 1XVMA 2ODQA 3RXPA 3ATKA 1YCPH 4K1SA 4CHAC 1KY9A 2ALVA 1YC0A 2LPRA 3EE0B 4AORA 4HFPB 3VB4A 3MO9A 1K1NA 1BTXA 5EXNA 5BPEA 3BG8A 1UCYK 2A2XH 2Z6BD 1NPMA 1S84A 1HPGA 4MG3A 3AAUA 3P95A 1ELDE 3A7VA 1O2JA 1LVOA 5A8YA 1WQSA 1CSOE 1MBMA 2HNTE 5L30H 8GCHG 2J4IA 1GPZA 2FLBH 4ZKNU 1BCUH 3ZZDA 3NUMA 3SN8A 1ANCA 3BTFE 1P09A
chains in the Genus database with same CATH superfamily
3EA9A 3LU9B 1QBVH 1S0QA 2LELA 1GI7B 2B5TB 4TY6A 3RMNH 1O2TA 2H9TH 4DCDA 2FS9A 2J94A 3TGJE 4XSKU 2ZDKA 2ZDMA 1W13U 4KGAA 1TPAE 1BTPA 4I8KA 3GCOA 1TNHA 3TK6A 1HFDA 4BAMB 1D3DB 1MH0A 3STJA 1DLEA 1W7GH 2ZHWH 2AH4X 1DWDH 2PTCE 1COWD 1D9IA 1G37A 1WBGB 1LHGH 3LONA 4A7IB 1N6YA 1O2IA 1O35A 4K60A 1H8ED 4BAQB 3ZVGA 3TJNA 2BY9X 3QTVH 3GCTF 1QB1A 1Q2WA 1Y59T 5JBBS 2EQNA 1QTFA 3UNRA 1ELGA 3LGUA 5FX6A 3GY3A 4JZDH 4B1TA 1V2KT 1GI8B 3S0NA 1TOMH 2FS8A 1O3HA 3SV9A 5EODA 1SHHB 2W3KA 3SNBA 1FY8E 2PV9B 2ZFQH 3RXIA 2ZDNA 4ZROA 3I78A 1UTOA 2K1QA 1YCPM 2BDBA 3MU1A 2JETB 4PROA 1K22H 4X2YA 2ZI2H 5L2ZH 4B6FA 2AMQA 1THPB 1GHBF 1THSH 2FI3E 2PTNA 1KLJH 1UTQA 1DSTA 2J34A 1SGNE 3DD2H 1J15A 1P06A 3BTEE 7KMEH 5HM9A 2THFB 3VXEH 3SQEE 1MTUA 3FVFB 1IHSH 1KLTA 3RXKA 3A83A 1GBMA 4I8HA 4A1VA 1BRUP 4IMQA 1L4DA 2ASUB 4KKDA 1OX1A 1RTFB 3U1IB 1P2IA 4RT0A 1SGFG 5T1VA 2ZU1A 2H1UA 3LH3A 5DP4A 2DE8A 3CP7A 2FEQH 3SHCH 1CA0C 3S7KB 1HIAA 2V6NA 2F9NA 4DJZB 4NA8A 2D26C 4JYUH 3SUEA 3UB0A 3ZVDA 3CENA 2PP6A 4NIXA 3MH6A 3A7ZA 4JYTA 3F2GA 2V0BA 1W12U 3M36A 3BTDE 3TH4H 3AW0A 3MNXA 4BAOB 1W2KH 2ZU5A 1O3DA 2ILNA 2RA3A 4ACBA 1ESAA 5AHGH 3STIA 1W0YH 5DP5A 1HJ9A 1LHCH 1P04A 5FHTA 2VINA 3GDVA 2VGCB 1BIOA 1BJUA 1E37B 1VJAU 1Z1IA 5IK2D 2RFKC 2D8WA 4P00A 3MH7A 1V2OT 4KP0A 2M5TA 2WHXA 1LCYA 3JZ2B 1LHDH 1OP2A 3SNEA 1TQ0B 1LMWB 4CRCA 3NRLA 1BTZA 1UHBB 3BG4B 5CMXH 1TMTH 4H6TA 2O8TA 1VITG 2BVSH 1E0FD 3BTKE 2VIDA 3FP6E 3EA8A 2CK3D 3A8DA 2OC1A 3UQVA 5AF9H 1TFXA 2A4RA 3F0PA 3GOVB 3ZZ7A 3K2UA 4Q7XA 2ZCLP 1HAIH 1FAXA 1KXEA 3URCA 1F0TA 1FDPA 3EA7A 3VGCC 1B0FA 3U28C 5J4SA 2F9UA 3PLPA 5E0GA 3IG6B 1BRCE 2PUQH 4X8VH 3UIRA 4UD9H 2GZ8A 3MO6A 1T4VH 1T8LA 5FPTA 1SLWB 5C2ZA 3TK9A 1W7XH 1EAUA 1YKTA 3E91A 4J2YB 1MKWK 1QB9A 5HIYA 1EX3A 1V2WT 4FUEA 1T8MA 1N8OB 1UVUH 2WPMS 1T4UH 3SZEA 1Z1JA 2GCTB 3QGJA 4BTTB 4WXVA 2P3FH 4X1RU 1QJ1B 2F83A 1OWHA 2FYRA 4U30A 3UFAA 8KME2 3UWJH 1WAYB 2ZNKH 5DJ7A 5EJLA 4ZXXH 4OM9A 1EZXC 1QL7A 4Y71A 1KTTB 1C1SA 4A92A 1K1JA 2GTBA 1EJAA 3KYFA 1W3CA 3AVZA 1HAZB 3SOSA 1GL1A 2G4UA 2H9HA 3BEUA 4OS7A 4GLYA 2OP9A 1WTHD 2GT8A 1G3DA 2YMSD 1BBRE 2TGDA 5DP8A 1CGHA 3RXUA 1NY22 1L4ZA 4YESB 1C2EA 1OXGA 5EQSA 2ZG0H 1GJ6A 1TNIA 4DGJA 1LVBA 5F8TA 4DVAU 4OGYA 2FI5E 1KXBA 2EA3A 2ZECA 1TPOA 5DGJA 4DIIH 3U9AH 1V2NT 5EIYA 1N6XA 2CV3A 3SJ9A 2STAE 4YXWD 2A4OA 4U32A 4OS1A 1Z6EA 3F9GA 1PQAA 1P9SA 1DUEA 2GGVB 1HAYB 1HJAB 1V2MT 2CJIA 2KM0A 2OINA 3UY9A 3SNDA 1F5LA 2L74A 3K6YA 1THRH 3RXGA 1HYLA 4MPUA 2FM2A 2FPZA 5GCHG 3RC6A 1AFQB 4NIWA 3KL6A 2WINI 3UR6A 4AFZA 3SV8A 4AYVB 2HVYB 2OC8A 1BOQA 1TRMA 2Z94A 5FAHA 3NCLA 3MOCA 1GMHG 2UUKB 1O3MA 2FP7B 2GT7A 3GCHB 5ETXA 4BXSA 1OKXA 1LPKB 1K1IA 2A0QB 1GJ5H 4FUCA 2A1DB 2C3SA 1BMLA 3CS7A 3GYLB 3A87A 2F43B 2PR3A 1O5DH 1MBQA 4A1XA 4CRBA 1GBHA 1GJCB 4XBBA 3SU2A 4F4OC 2J38A 1V2UT 2PLXA 1SOTA 1G9IE 3AW1A 2VVUA 3MWIU 1BBRH 2P93A 2GMTC 2C8YB 3O8RA 3PO1B 2R2WU 1OPHB 4YO9A 3PMBB 2FOCA 2G00A 1P10A 4B2BA 2IJD1 2P59A 5EXLA 1FY4A 2W3IA 1EASA 1YPLH 3ATMA 4LK4A 2BXUH 1SGRE 4K3JA 1Q3XA 1GHXH 1MTWA 1GVZA 1TRNA 2ZPSA 1QRXA 5C0TA 2HVXA 2NU3E 2Z7FE 2Y5FA 1ESBA 4WMEA 3M7TA 4X8SH 1GGDB 3RXVA 4SGBE 3RXQA 2XXLA 1SGIB 2ANKH 2ZFSA 4ABHA 1YPMH 3W1EA 1O3NA 1TLDA 2CHAC 2A4GA 1AVWA 1WU1A 5AVDA 1NFUA 1CHOG 2WPJS 4HGCA 6LPRA 3QWCH 2H5CA 1IQLA 4MLFB 1F2SE 4TYDA 5FL7D 1V3XA 4OS2A 2Z3CA 1O3GA 1IQKA 2WPDD 5T6FA 4IMZA 1GBLA 1P0SH 4JCNA 4X6OA 5F8ZA 5A09A 2FWWA 4IBLH 3RLYH 3SQHE 2R0LA 1GI0A 3N7OA 1QJ7B 2RG3A 2PKAA 3TH2H 1AN1E 4XE4A 1ELBA 5G4BA 3FANA 1ANEA 2ZEBA 1OP8A 4NFEA 2XNDD 3RU4T 3ATWA 3ZZ3A 4IN2A 2R3UA 3WWFA 2PFEA 3VPKA 1HRTH 4FVBA 1W11U 2XCNA 2BQ6B 3EQ0H 2A7CA 2ZTZA 1OOKB 3BTHE 3KN2A 2ULLA 4NIVA 1JXPA 1W0KD 2QIQA 4SGAE 4ABJA 2Q6DA 2FMJA 3KHVA 2BVRH 4X1PU 4CREA 1MD7A 2XCFA 1MAYA 2KX4A 1OSSA 3FN8A 1Y8TA 2W6JD 3LGIA 3A7YA 1C1PA 2XC0A 1UCYH 1YWUA 3NK8A 5HGGA 1NBME 2PW8H 3A88A 1O2WA 1GCTB 3I29A 1O3OA 2O8UA 5PTPA 4H6SB 2F4LA 2Z9IA 3PRDA 1W8BH 3TPIZ 4WMDA 4ABBA 2SGFE 2W5EA 4NCYA 1UTJA 5CHBA 3TJUA 4H4FA 1GI4A 1Z7KA 2JDID 2BB4A 2EC9H 2ZCKP 5HIZA 1MU8B 1M9UA 1WDIA 2A5AA 1BZXE 4Y10E 9ESTA 1CT2E 2BX3A 2F9OA 3NPSA 1RFNA 2KCOA 2HNTF 1SPJA 1ZHMA 1H8HD 3QN7A 2P3TB 2JH5D 1GHZA 3SI3H 1K2I1 2ZFFH 2KAIA 2A7JA 4INKA 5A0BA 3BEIB 3FZZA 4RN6A 3LJJA 1SLUB 4CH8B 1DS2E 5T6GA 2H2ZA 4X2WA 2Z3EA 4ASHA 1HAVA 1GDUA 1HAHH 4FU9A 2GD4B 2VIWA 2B9LA 1ORFA 1SGTA 1J16A 2HOBA 1RIWC 4Q7ZA 4CH2B 1NBMD 1KSNA 3H7TA 2XOKD 2NU4E 3ZYEA 1Y3UA 1O5AB 1F7ZA 4Q2KA 1O2KA 1LQDB 2BHGA 1MU6B 1EQ9A 2AHME 4DW2U 6ESTA 1AO5A 1H4WA 1K1LA 1C1TA 3IITA 3AK5A 1NRRH 2ZFTA 2D1JA 1V2QT 3OTJE 4FUDA 5I46H 1O3JA 3EE7A 4LXBH 3UUZA 2C93B 2KR7A 4A5TS 4VGCC 2XBWA 1EPTC 1WV7H 1GJ9B 1RRKA 4U2WA 4CBNA 2G8TA 1MABB 5BRRE 5EPNA 1BDAA 4X6MA 5AFYH 3RM2H 1O39A 1FX0B 2P95A 1TMBH 2EI6A 3LGYA 1ARBA 1P2JA 2AFQB 2AGIX 1AHTH 1C5XB 2HRVA 3V0XA 2ZGBH 1UTPA 1BMNH 3T2NA 1AKSA 1WTGH 3ZZBA 1A0HB 2J9NA 2VVVA 4WMFA 1BJVA 2XRCA 2ZF0H 1N1LA 1YM0A 1P57B 1AB9C 5CHAB 1Q31A 1LO6A 1ZMJA 3TGIE 3PWCA 1HIAB 3OY6U 4Q4LA 1DICA 3BIUH 1MCTA 1D4PB 3WWBA 2ZGHA 5FPYA 1F0RA 5B6OA 2BMGB 5A8XA 4ISHH 1EPTA 3SW2B 3S9CA 3BSQA 4NSVA 4GCHF 1YLNA 2P94A 3M61U 1A5GH 2Z9LA 4WWYA 5GWZA 5JBAS 3OEED 1Y3VA 1AI8H 1P3CA 3RM0H 3A7XA 3PMHB 1NM6A 2FOAA 1BTWA 2GX4A 2QXHA 3KQBA 2CF8H 3MNBA 1K1OA 3LKWA 2GV7A 4E05H 1K9OE 1ZGVA 4WVPE 5C1XA 4MDSA 5FBEA 2G51A 1SHYA 1QY6A 3MH5A 3F9FA 1LTOA 2TIOA 3OY5U 3UTUH 2KZ4A 3SBKA 4RKJB 4GHQA 1H9HE 3LPRA 5C94A 1L1GA 1YP9A 1BHXF 1BB0B 3M5MA 3OEHD 2Q6GA 1JIRA 4MNWA 1O3CA 2FTLE 2LP6A 1NRNH 2F9VA 2G5NA 4TSFD 3ZZ8A 1C2GA 1GJ7B 1ZZZA 1O5GH 3HGPA 5FX5A 1TGCA 3TLOA 2TGTA 2KCAA 3C1KA 5A0CA 1QFKH 4TWYA 2SFAA 3M3TA 1VGCC 1SLXB 3SNCA 2FLRH 4FVDA 5C17A 2D2DA 1H8DH 1CVWH 5EW2H 1TMUH 1D3TB 2DE9A 1MKWH 1GMDF 1PQ5A 1JOUB 3SU6A 4XBDA 5EQQA 3SJIA 1QL8A 1Y5AT 2XC4A 1TABE 5C5OA 1ID5H 3BTWE 2PGBB 3SO3A 4DIHH 4WY3A 2AIPA 1K21H 2GDEH 3QO6A 3VXFH 4NA7A 3P6ZB 3QGNB 4FETA 3U8OH 1ZPBA 2NU1E 1S6LA 3HGNA 1PPZA 4ISOA 1B0EA 1LQEA 1ZOMA 3LOXA 5E2PA 2FODA 3EYDA 4ZMAH 2BY7X 1C5RA 1C5ZB 5AFZH 1QIXB 2VWMA 1P12E 2PKSB 2ZQ1A 1WOFA 1XUIA 2BX4A 3N7EA 1TGTA 2J5UA 3DFLA 4UDWH 3DSPA 1YPHC 1QL9A 5DG6A 2XWBI 1NT1A 3URDA 2TRMA 1O2SA 3OSYA 3F68H 3ZZCA 2GDDA 3CNRA 4M7GA 2JKHA 3BTTE 3LH1A 1FI8A 3UREA 2QCYA 2UWPA 2UWLA 1NRPH 1XUFA 3GY8A 1GHAF 4K5ZA 3VFEA 4ABGA 3QX5H 1EOLA 1G30B 2VIPA 2JH0D 4FU7A 5DP3A 3A86A 4TPIZ 1ZRBA 1BTHH 1DY8A 4AFQA 3A85A 3M5OA 1KXFA 2SGPE 1MTNB 2NU0E 3ZVEA 1NFYA 3TITA 1A1RA 1SGYE 1KMHB 2ZHEH 2K0QA 4XFQA 1Z8GA 1H1BA 1GDQA 1GBTA 5TCAA 3RP2A 3DA9B 4UFGH 4TPYA 3GISB 3UQOA 3A84A 1H8IH 1FPHH 4HG6A 1BUIA 3KEEA 1ZSLA 1C1NA 4OS6A 2FOHA 1H9IE 1PPHE 1TX8A 2ZCHP 3M5NA 4NGAH 1F5KU 1F0SA 1HGTH 5F03A 1O2QA 3KYGA 2ZO3H 2PHBA 1ETSH 4J1YA 1EAIA 1F92A 1GMCG 1ZTKA 2A45B 2QF5A 4FUIA 4NFFA 3SJKA 4BNRA 3LDXH 2FZZA 8ESTE 1HAOH 5C1YA 2M2AA 4FUFA 4FOUC 3ZZ4A 5DPAA 1UJ1A 1FPCH 2ZQ2A 3BTME 2ZU3A 3T25A 1QHRB 1OWDA 1QCPA 2UWOA 2V3HH 4ISLA 4D8NA 4ZKSU 2EI7A 1AU8A 2VIVA 3SGQE 3P17H 1GI5A 3M5LA 2YMSB 1EATA 1UTNA 2HLDD 1KIGH 1C5QA 1GI1A 2FO9A 4BAKB 5JBTA 4ZXYH 1YYY1 1IQHA 4K8BA 3NZIA 1BMMH 1QJ6B 3NXPA 3V12A 2AGEX 1TNKA 1IQGA 1C5NH 1NU7B 2Y5GA 2EY4C 3GCTG 1P2MA 1P05A 2ZFRH 3TH3H 5A2MH 3PMJA 1HUTH 1FZZA 1ELFA 2VWLA 2P8OB 1TX7A 1FLEE 5H4IB 3SU3A 5LPRA 1RJXB 2XBVA 3P8NA 1NU9A 3A7WA 2A32A 3A82A 4O03A 3RXBA 5C5NA 5K0HA 3DCLA 1PQ8A 2ANMH 3TVJB 2CGAA 4AB9A 3G01A 2FOGA 3KF2A 2PKAB 5ESTE 3HPTB 1INCA 4H42U 1V2LT 3PV2A 1ZTJA 4U01A 3ZVBA 5J4QA 3UAIC 1CBWB 1GHBG 3B9FH 1C4U2 1KLIH 3QK1A 2BOHB 4BTIB 2SGQE 4B2CA 2RDEA 3MO3A 4Y11E 1HAGE 2BQWB 1UK3A 4KTUA 2BLOA 2EI8A 4INHA 1P2NA 6GCHF 1V6DA 2SGDE 1C1QA 2JETC 1O34A 3JZ1B 1EP6A 3W94A 4HTCH 2CMYA 1DM4B 3MU5A 3PWBA 3O8DA 1XMNB 4JMYA 2CXVA 3BIVH 2A31A 1GBAA 1SB1H 3ZZ5A 1A5IA 4YLQH 1IHTH 4K2YA 3T28A 3QZRA 3M3SA 5A8ZA 2G81E 4GHTA 4TY7A 1C2KA 3TU7H 4MPVA 2VJ1A 1FY3A 4IGDA 3AAVA 4I33A 3DSGA 4OS4A 4CR9A 3MYWA 3GY6A 5DP6A 4Z6AH 2I6SA 1S5SA 2Y82A 1VR1H 3MU0A 4KTSA 4D76A 3GY5A 2FX4A 4IS5A 4MPXA 2VIQA 4AX9H 3TNSA 3VB7A 4RT1A 3CS0A 4JK5A 3SGAE 3M7QA 3KGPA 5JYIA 1G2MA 1E38B 1BT7A 1IQMA 1C5OH 1UVOA 2YNBA 1PYTC 1KXAA 1K0HA 1C1UH 3LC5A 4QT8C 1IOEA 2KAIB 1O3KA 3BF6H 4GPGA 1UTKA 2R2MB 4ZHAA 3PMAB 1LPZB 3S9BA 1NRSH 2BXTH 4X8UH 5GPIB 1HDTH 1G32B 1HAVB 2J92A 3UNQA 4TWWA 1WQVH 1VITH 1OP0A 1O2NA 3D65E 3HK3B 1TBZH 2QE7D 4ZKRU 1KDQB 4X6PA 3ZYDA 3MU4A 3SU1A 2VGCC 1ELCA 4FUGA 1NESE 1CA8B 1L0ZA 4AB8A 4THNH 1QZ8A 3UPEA 3MU8A 1HNEE 3RXDA 5HYOA 3ENSB 1SGFA 4GSOA 1IQIA 2BVXH 1C1MA 3BG4C 1ETTH 1O2HA 1P9UA 3SV6A 3RDZA 3RMMH 4AGKA 1UVTH 6CHAB 2W7SA 3W95A 2H9EH 1VJ9U 1DANH 5KECA 1JWTA 3FOAA 4WF8A 1MCVA 2W7UA 3GS9A 1O32A 2C90B 1O2PA 2EEKA 2VVCA 1Z71A 3ZZ9A 1O2RA 1SG8B 2XNIA 5JDUB 1HV7A 2Z9KA 1MTVA 1ELTA 4FUJA 4Y7AA 3RXJA 5F8XA 1C4Y2 2KFWA 4IC5A 1ELAA 1FIWA 4LOYH 1TGBA 3MNSA 2VH6A 1AKSB 1C9TA 3FFGA 1SFIA 1SQOA 1UCYE 5JPMH 2HPQH 3U69H 1O5FH 4JK6A 3TJVA 1UTMA 1NFXA 4B71A 4B73A 3RXAA 5K7RA 1Y3YA 1N8OC 1O31A 3SJ8A 1OS8A 2GCTC 2BYAX 2WZQA 3RXFA 3FP7E 1Z8JB 4X0WU 1TX6A 1O5CB 2SGEE 1AY6H 1GBKA 4Y7BA 1C5TA 3I77A 2F9PA 1TONA 4R8TB 2P16A 4I8GA 3UR9A 1NZQH 2FOEA 1TGSZ 1Y5UT 2WPIS 1BTUA 1TPPA 2XWAA 1QGFA 1D3QB 3TIUA 4AG2A 1FN8A 1PJPA 1XXFA 2JH6D 1O2YA 4E06H 1DX5M 1GBDA 1FUJA 3P8FA 2R0KA 1P02A 4CR5A 1S82A 2FIRH 1V2RT 1SR5C 3PM3A 3QZQA 3T62A 2V7QD 1CHGA 2ZGXH 5GDSH 1LPGB 1HLTH 1FXYA 2TPIZ 5T3HA 1IQJA 1DWBH 2BD3A 1CU1A 2BD7A 4ZUHA 4A1TA 2BZ6H 1ZMNA 2HLCA 3O8BA 2WPLS 2C8XB 1DSUA 2Z9GA 1FJSA 2XW9A 1HJAC 4HZHA 2G52A 1ZR0A 3LIWA 1O3AA 3U8TH 1PPFE 1SFQB 4IC6A 1G3EA 1MKXK 2H6MA 1AFQC 1GBIA 1O2UA 5GJ4B 1DOJA 5EPYA 1GJDB 1SQRA 2BZAA 2CF9H 1ARCA 3GY2A 1T8NA 5LH8A 1GHVH 1ETRH 5T6DA 3F9HA 3GCHC 3OE7D 1TYNA 4I8JA 1NC6A 3QTOH 2OLGA 2OC0A 2ZTYA 1GG6B 2BD9A 3RMOH 1P2OA 2WSSD 2FOBA 1G3BA 1VZQH 3MFJA 3F0OA 1TALA 1QA0A 1TNLA 3BTQE 4ABAA 4YLUA 2JJ2D 2BD8A 4CHAB 1GCDA 2PSYA 3PO1C 1C5UA 3MI4A 3SU0A 1GVLA 7GCHF 5HXFA 2ODYB 1TGNA 1WSSH 1CT0E 2AEIH 1DWEH 4NZLA 3SJOA 4RKOB 1PPGE 2XC5A 2QYIA 1FONA 1HCGA 1TQ7B 1VCPA 1UVSH 1DE7H 4K1EA 1UMAH 5EJZA 3FZDA 1C5SA 4UFDH 2FOMB 2J98A 1D3PB 3B8JA 3PLKA 3HKJB 2QF3A 1K1MA 1PPCE 2R9PA 2BD5A 1GGDC 1C1OA 1MQ6A 5E2OA 1LKBA 1F5RA 3LGWA 1A5HA 4MPWA 4D7FA 2OBOA 4YT6H 5EOKA 1LDTT 3F6UH 1KXCA 3VB6A 1S81A 1SMFE 1W10U 5EW1H 1NO9H 2BDGA 2QXGA 4F55A 4GAWA 3NWUA 8GCHF 4Z1MD 1EZSC 4TT3D 1C5MD 5HKKD 2AMDA 1ZPZA 1A2CH 3ODDA 4FUBA 1Z8RA 3F3BA 1H9LB 1SVPA 1EB2A 1QRWA 4ABIA 1ZLRA 1D6RA 2GP9B 1GJBB 1NROH 1AWFH 3TK5A 3SHAH 4KELA 1OYQA 4GUXA 5GXPA 3UOUA 1ZPCA 1F0UA 1FNIA 1LVMA 1O30A 1TPSA 2Y5HA 2AYWA 4ABDA 1CO7E 1OWJA 2GV6A 2FX6A 2WYJA 3GY4A 2ZTXA 1A0JA 1OYTH 1JBUH 2GCHG 1D6WA 1CGIE 1S0RA 1SGEE 1AQ7A 4X1NU 1NTPA 2GVFA 1GHWH 1XVOA 2OD3B 3RXTA 1FAKH 1J9CH 1C2JA 1HAPH 1A0LA 1V2TT 1QNJA 3V7TA 4CRGA 2QY0B 3LGTA 4CRFA 1QQUA 2TGAA 3FAOA 1O2LA 1EB1H 5GIBA 4UONA 3GYMA 2Y7XA 5JB8S 3PLBA 1YPHE 4X6NA 1TOCB 2HPPH 1SOZA 1GCTC 3B23B 2F3CE 5C1UA 3A8AA 3VB5A 1KYNA 1NFWA 1QQ4A 1O3IA 2ZDAH 4D9QA 1C2MA 1AZ8A 4YOIA 1EZQA 2OCVB 4GVUA 5HMAA 4LZ4B 4XDEA 5FXLA 1O3FA 1GDNA 2O9QA 2ZDVH 3DT0H 2BOKA 2VWOA 3S69A 1P2KA 1CA0B 3SV2H 4E7RG 2QF0A 3RU4E 1FY1A 1LHEH 1V2VT 2GZ7A 1O2XA 2BDIA 2BDHA 2NU2E 1VCQA 2GZ9A 4B75A 2ANYA 1TA2A 5DSFA 2F9BH 2LNCA 3GICB 3FP8E 2JJ1D 2BM2A 4DOQA 2F91A 1HB0B 1J14A 5DP7A 2FDAA 2NWNA 2VB0A 2FXRA 3F2HA 3BV9B 1E79D 1BITA 2Q6FA 3SUGA 1YPKH 1A7SA 1SL3A 3PV4A 4MNYA 4AZ2B 1LHFH 4MTBA 3LGVA 2BTCE 1DPOA 2G4TA 3K65B 1ZRKA 3TNTA 1EJNA 1XUKA 3ZZ6A 1CGJE 7LPRA 1T31A 3E8LA 3K6ZA 1Z8IB 5IYTA 2W26A 1GMCF 4NWKA 2STBE 4DG4A 1GI2A 2Y80A 3P70B 2G55A 4I32A 5A0AE 2FYQA 2BDAA 5C3NA 2BY8X 1G3CA 1XUGA 3RU4D 1IQEA 1GBJA 3T27A 3ELAH 1J17T 1EJMA 1YY3A 2YNAA 5EQRA 1SGQE 3P8GA 4JZEH 1B5GH 4NWLA 4YTAA 3A81A 1CE5A 3VGCB 4YOJA 2A4QA 1XUHA 1P11E 3ODFA 3D62A 1XXDA 1ABJH 7ESTE 1JMOH 1FY5A 1V2JT 3MH4A 4NZQA 2WPHS 4WH8A 1VITF 3GCNA 1C5PA 1C9PA 3AASA 3TGKE 1YLDA 2IN2A 1TE0A 4X1QU 1E34B 1QURH 2BY5X 4AYYB 3RXOA 5L2YH 4GCHG 1GHYH 1ZSKA 5CHAC 5E0JA 1NRQH 2IJOB 2QV1A 4ZHMU 2OBQA 1UO6A 1O3BA 2K8IA 1XM1A 1T8OA 2Z3DA 3M7UA 3QDZB 1S6HA 1WUNH 1SSXA 1UW7A 1OHHD 1MAXA 2CN0H 1QB6A 3DSOA 3H09A 5GNDA 8LPRA 1J8AA 1S6FA 1AD8H 1YGCH 3FKSD 3PTBA 4R0IA 4AN7A 2ZC9H 2ZGJA 2GKVE 2SNWA 4Q7YA 3WW7A 5ABWA 1MTSA 1AVGH 3PROA 1Z6JH 3IWMA 1UK2A 3RXSA 2FOFA 1MUEB 3DFJA 4BOHA 4AG1A 3O8CA 2B8OH 1ANDA 1CQQA 2XYAA 1DDJA 1BHXB 2WUBA 1EAXA 1O3LA 1K28D 2HNTC 4XD7D 4HI3A 4D9RA 1C1WH 4ZKOU 2R3YA 3D23A 3SZNA 5E0HA 3GDUA 2ZKSA 1SGDE 1AE8H 3MQKC 1B7XB 3M37A 1L1NA 3EGKH 4K8YA 5I25A 1Y5BT 2HGTH 3UOPA 4BANB 4DY7B 2ZIQH 4NA9H 4OGXA 1GMDG 2KCYA 3OFND 2FI4E 4MVNA 1TA6A 2ZU4A 1A3EH 2O8LA 2FTMA 1AVXA 2ALPA 2PUXB 3RXCA 2RCEA 4JZIA 1AFEH 3Q3XA 2BDCA 1P3EA 3KQ5A 2B0FA 4B6EA 3A8CA 2L6OA 4Y8YA 1HJ8A 3E16B 5F53A 5CE1A 5ESBA 2V3MA 1GJ4H 1ZJKA 1FIZA 1PPEE 5GCHF 3ZV8A 4X1SU 4YZUA 4Y8XA 4CBOA 1T32A 2GMTB 1UVPA 1ZHPA 2OQUA 4ZCNA 4B2AA 3U98H 1GMHF 1RTKA 3ITIA 2V3OH 1YCPK 5F6MA 2IPHA 1KTSB 2ZHFH 2UUFB 3BEFB 4ACAA 2C4FH 2IOTA 2VIOA 2QA9E 3ZZAA 1QBNA 2O8MA 2ANWA 1P8VC 1EUFA 1O37A 3SGBE 1TNJA 2ZWLH 1GHAG 4BTUB 9LPRA 2VBCA 2VWNA 2PKSC 1PQ7A 1BRAA 4FXGH 1RXPA 1G36A 2CHAB 1TRYA 4YT7H 1A46H 3E1XB 2FESH 3RXLA 5DP9A 4P02A 1GBCA 1O38A 4DURA 4YOGA 3PYHA 1XKBC 1W0JD 3EDXB 1PYTD 3V3MA 2QXJA 2Z9JA 3TJOA 1EOJA 2HWLB 4I31A 1AIXH 1C5YB 2ZPQA 1SGPE 4FUHA 4DT7B 1EKBB 1DXPA 1DWCH 1MKXH 2WUCA 2H5DA 4M9FA 3PTNA 1QA7A 3R3GB 1CHOF 5B6LA 5DO4H 1HBTH 3H7OA 3NKKA 1MTNC 3SYJA 4JZFH 1LKAA 4BAHB 3EAJA 2GJGA 3KQCA 1A4WH 1K1PA 4Y0ZE 1YPJH 4ZAEA 3A8BA 1ZMLA 1JRTA 5FBIA 2HALA 1GJAB 5DK1A 1YF4A 3ATLA 4AGJA 3P92A 4D7GA 2ZGCA 3E90B 3S9AA 1O5BB 1AUTC 3ZVCA 5TCCA 2A2QH 1A61H 3FO8D 4B74A 2WV9A 3E0NB 1QRZA 4ASUD 4Y8ZA 1MD8A 2BQ7B 1VKYA 1E1RD 1HXEH 1MZAA 4X2XA 2VU8E 1O36A 1TIOA 1JRSA 4B76A 3F2FA 3UWIA 1DITH 1RGQA 1SGCA 4ZH8A 1DUAA 1ZJDA 1IQNA 3A7TA 1XX9A 2UUYA 2WYGA 4DT4A 2J98B 2A5KA 2B7DH 1SQAA 1X7AC 5TJXA 1YLCA 1V2PT 3OYPA 2OC7A 2YMSC 3A89A 3Q76A 4NSYA 5LGOA 4WXIA 5KGOA 4O97A 5SGAE 4X8TH 1O3EA 2BLQA 2Y7ZA 3MMGA 3MHWU 4X2VA 3ZV9A 2P8OC 2UUJB 2QF4A 1AE5A 4KTCA 4A6LA 1WXRA 2ZZUH 2QC2A 1W0ZU 1C2DA 5IDKA 4ZHLU 2RDLA 3K9XB 1GI9B 3L33A 1OWIA 1C2FA 5EU8A 6GCHG 1RIWB 1EAWA 3E0PB 1ZHRA 4Y0YE 1L2EA 1TBQH 1IQFA 3F1SB 1MQ5A 1CBWC 4RI0A 2A7HA 5DN6D 2RA0A 4I86A 4FU8A 3RC5A 3SV7A 5DKMA 1VCWA 1ZGIA 4NIYA 1C4V2 4MQAA 3PB1E 5L6NH 3RC4A 4INLA 1UHBA 4JZ1A 5EXMA 5EJ1A 1SBWA 2ZPRA 3U1JB 1RTLA 1PPBH 3HKIB 4ESTE 2BLWA 3UNSA 3RLWH 3SU5A 1QR3E 4VGCB 2OXSA 1G2LA 1EPTB 1SI5H 1RD3B 2WV5A 3VG8A 4MNVA 1O2MA 3RXRA 1TAWA 3SU4A 1TBRH 1ANBA 1YPEH 3VEQB 4Y6DA 1SQTA 3S7HB 2J97A 4I7YH 3M35A 1DY9A 3ATIA 3P8OA 2XTTB 5KEDA 1ABIH 5CDFE 3SUDA 2A5IA 2PGQB 2ODPA 1C5LH 1C1VH 2ZDLA 3M3VA 4LZ1H 1ACBE 1AB9B 1DLKB 1O3PB 1OWKA 4O9VA 5LPEA 2BD2A 4Q80A 4WH6A 1O0DH 1BMFD 5FCRA 2AGGX 3LJOA 3QUMP 4K69A 4CRDA 3ZVAA 2BD4A 4XBCA 2AIQA 2ZU2A 3KIDU 3MTYA 2Q1JA 1ELVA 2ZHDA 4OS5A 1C1RA 3C27B 1LVYA 1TNGA 3BN9A 2G5VA 4XRNA 2GCHF 3GY7A 3PV5A 3KQEA 4UFFH 1MZDA 1P03A 1ZSJA 1A3BH 3LT3A 2OUAA 2TBSA 1BMAA 3T29A 1WCZA 5C0UA 1C2LA 3HK6B 3Q3KA 4F48B 2BY6X 3GDSA 3OTPA 1KXDA 1RS0A 2J2UA 2QXIA 4UEHH 1XUJA 1NN6A 3U8RH 3T26A 2O8WA 3KQDA 3VB3A 2OK5A 1C5VA 2V35A 4O3UA 1O2ZA 2AERH 1GBFA 3OAAD 5EGMA 5LPFA 3SUFA 3ESTA 3RXEA 1GBEA 1Y3WA 4XOJA 1GI3A 1HAXB 4K1TA 6CHAC 1UK4A 1ZTLA 1P2QA 1E1QD 1BTYA 5FPSA 2C8WB 1U6QA 1TB6H 2ZFPH 3MNCA 3R0FA 4F49A 1UTLM 5HM2A 1VGCB 2SNVA 3QLPH 2KCPA 4Q63A 1C5WB 2BDYA 3SI4H 3E3TA 1PFXC 5FCKA 1NS3A 4IW4E 1KDQA 3DHKH 1EP5A 4IN1A 1SLVB 2XBXA 1BQYA 4AOQA 1ELEE 1Y3XA 3ZIAD 3LC3A 3RXHA 4MNXA 4BXWA 1BBRK 1DFPA 4UE7H 1XKAC 4RSPA 2PWXA 1C2HA 2W6ID 2YOLA 1IAUA 2VH0A 3D49H 2ZHQH 1DT2A 3N99A 2JIZD 3OX7U 2SGAA 3SORA 3Q77A 3WY8A 3RUOA 3T5FH 2BLVA 3A80A 1V2ST 1SKYE 1OWEA 4NG9H 1E36B 1FMGA 3Q00A 1MMJN 5E8EH 1AWHB 2DUCA 2ZA5A 4UFEH 1AMHA 2QN5T 2QGRA 2QAAA 1EXFA 1FV9A 3L3TA 4YM9A 3KCGH 1GL0E 1E35B 1JIMA 1AUJA 3BTGE 5C20A 2AMPA 1TWXB 2ESTE 3RMLH 1FQ3A 1DVAH 4ISIH 3N7DA 2PSXA 1SC8U 1GI6A 2J95A 3L6PA 2Y81A 4I8LA 5C67A 3HATH 2OTVA 4JYVH 3SNAA 1S83A 4AFUA 1L1JA 1WYKA 1O33A 1GJ8B 3H5CB 3PRBA 4Z0KA 1FN6A 1EZUC 2ZP0H 1DXWA 2I6QA 4WJG2 1HXFH 2AS9A 1ZYOA 4Y79A 3ZVFA 1EFRD 3E6PH 1GVKB 3Q3YA 1T7CA 1YPGH 1YBWA 1CT4E 5JB9S 3V13A 1P01A 4ISNA 3F9EA 2OQ5A 2P3UB 2TGPZ 3DUXH 4ABFA 4O3TA 5JBCS 4ABEA 5EG4A 2C8ZB 4E7NA 7GCHG 1O2GH 3KNXA 2XBYA 1GWAA 1ESTA 1O2VA 1S85A 2VNTA 1GBBA 1O2OA 2Y6TA 2WV4A 1GG6C 1O5EH 1C2IA 1AGJA 2WPKS 4AFSA 1QBOA 1BRBE 4Y76A 3OU0A 1AZZA 1W14U 3RXMA 4CRAA 1BA8B 1XVMA 2ODQA 3RXPA 3ATKA 1YCPH 4K1SA 4AC9A 4CHAC 1KY9A 2ALVA 1YC0A 2LPRA 3EE0B 4AORA 4HFPB 3VB4A 3MO9A 1K1NA 1BTXA 5EXNA 5BPEA 3BG8A 1UCYK 2A2XH 2Z6BD 2IPQX 1NPMA 1S84A 1HPGA 4MG3A 3AAUA 3P95A 1ELDE 3A7VA 1O2JA 1LVOA 5A8YA 1WQSA 1CSOE 1MBMA 2HNTE 5L30H 8GCHG 2J4IA 1GPZA 2FLBH 4ZKNU 1BCUH 3ZZDA 3NUMA 3SN8A 1ANCA 3BTFE 1P09A
chains in the Genus database with same CATH topology
3EA9A 3LU9B 1QBVH 1S0QA 1GI7B 2B5TB 4TY6A 3RMNH 1O2TA 2H9TH 4DCDA 2FS9A 2J94A 3TGJE 4XSKU 2ZDKA 2ZDMA 1W13U 4KGAA 1TPAE 1BTPA 4I8KA 3GCOA 1TNHA 3TK6A 1HFDA 4BAMB 1D3DB 1MH0A 3STJA 1DLEA 1W7GH 2ZHWH 2AH4X 1DWDH 2PTCE 1D9IA 1G37A 1WBGB 1LHGH 3LONA 4A7IB 1N6YA 1O2IA 1O35A 4K60A 4BAQB 3ZVGA 3TJNA 2BY9X 3QTVH 3GCTF 1QB1A 1Q2WA 1Y59T 5JBBS 1QTFA 3UNRA 1ELGA 3LGUA 5FX6A 3GY3A 4JZDH 4B1TA 1V2KT 1GI8B 3S0NA 1TOMH 2FS8A 1O3HA 3SV9A 5EODA 1SHHB 2W3KA 3SNBA 1FY8E 2PV9B 2ZFQH 3RXIA 2ZDNA 4ZROA 3I78A 1UTOA 2K1QA 1YCPM 2BDBA 3MU1A 2JETB 4PROA 1K22H 4X2YA 2ZI2H 5L2ZH 2AMQA 1THPB 1GHBF 1THSH 2FI3E 2PTNA 1KLJH 1UTQA 1DSTA 2J34A 1SGNE 3DD2H 1J15A 1P06A 3BTEE 7KMEH 5HM9A 2THFB 3VXEH 3SQEE 1MTUA 3FVFB 1IHSH 1KLTA 3RXKA 3A83A 1GBMA 4I8HA 4A1VA 1BRUP 4IMQA 1L4DA 2ASUB 4KKDA 1OX1A 1RTFB 3U1IB 1P2IA 1SGFG 2ZU1A 2H1UA 3LH3A 5DP4A 2DE8A 3CP7A 2FEQH 3SHCH 1CA0C 3S7KB 1HIAA 2V6NA 2F9NA 4DJZB 4NA8A 2D26C 4JYUH 3SUEA 3ZVDA 3CENA 4NIXA 3MH6A 3A7ZA 4JYTA 2V0BA 1W12U 3M36A 3BTDE 3TH4H 3AW0A 3MNXA 4BAOB 1W2KH 2ZU5A 1O3DA 2ILNA 2RA3A 1ESAA 5AHGH 3STIA 1W0YH 5DP5A 1HJ9A 1LHCH 1P04A 5FHTA 2VINA 3GDVA 2VGCB 1BIOA 1BJUA 1E37B 1VJAU 1Z1IA 2D8WA 3MH7A 1V2OT 4KP0A 2M5TA 1LCYA 3JZ2B 1LHDH 1OP2A 3SNEA 1TQ0B 1LMWB 4CRCA 1BTZA 1UHBB 3BG4B 5CMXH 1TMTH 4H6TA 2O8TA 1VITG 2BVSH 1E0FD 3BTKE 2VIDA 3FP6E 3EA8A 3A8DA 2OC1A 3UQVA 5AF9H 1TFXA 2A4RA 3GOVB 3ZZ7A 3K2UA 4Q7XA 2ZCLP 1HAIH 1FAXA 1KXEA 3URCA 1F0TA 1FDPA 3EA7A 3VGCC 1B0FA 5J4SA 2F9UA 3PLPA 5E0GA 3IG6B 1BRCE 2PUQH 4X8VH 3UIRA 4UD9H 2GZ8A 3MO6A 1T4VH 1T8LA 5FPTA 1SLWB 5C2ZA 3TK9A 1W7XH 1EAUA 1YKTA 3E91A 4J2YB 1MKWK 1QB9A 1EX3A 1V2WT 4FUEA 1T8MA 1N8OB 1UVUH 2WPMS 1T4UH 1Z1JA 2GCTB 3QGJA 4BTTB 4WXVA 2P3FH 4X1RU 1QJ1B 2F83A 1OWHA 2FYRA 4U30A 3UFAA 8KME2 3UWJH 1WAYB 2ZNKH 5DJ7A 4ZXXH 1EZXC 1QL7A 4Y71A 1KTTB 1C1SA 4A92A 1K1JA 2GTBA 1EJAA 1W3CA 3AVZA 1HAZB 3SOSA 1GL1A 2G4UA 2H9HA 3BEUA 4OS7A 4GLYA 2OP9A 1WTHD 2GT8A 1G3DA 1BBRE 2TGDA 5DP8A 1CGHA 3RXUA 1NY22 1L4ZA 4YESB 1C2EA 1OXGA 5EQSA 2ZG0H 1GJ6A 1TNIA 4DGJA 1LVBA 5F8TA 4DVAU 4OGYA 2FI5E 1KXBA 2EA3A 2ZECA 1TPOA 5DGJA 4DIIH 3U9AH 1V2NT 1N6XA 2CV3A 3SJ9A 2STAE 2A4OA 4U32A 4OS1A 1Z6EA 3F9GA 1PQAA 1P9SA 1DUEA 2GGVB 1HAYB 1HJAB 1V2MT 2CJIA 2OINA 3UY9A 3SNDA 1F5LA 3K6YA 1THRH 3RXGA 1HYLA 4MPUA 2FM2A 2FPZA 5GCHG 3RC6A 1AFQB 4NIWA 3KL6A 2WINI 3UR6A 4AFZA 3SV8A 4AYVB 2OC8A 1BOQA 1TRMA 2Z94A 5FAHA 3NCLA 3MOCA 1GMHG 2UUKB 1O3MA 2FP7B 2GT7A 3GCHB 5ETXA 4BXSA 1OKXA 1LPKB 1K1IA 2A0QB 1GJ5H 4FUCA 2A1DB 2C3SA 1BMLA 3CS7A 3GYLB 3A87A 2PR3A 1O5DH 1MBQA 4A1XA 4CRBA 1GBHA 1GJCB 4XBBA 3SU2A 4F4OC 2J38A 1V2UT 2PLXA 1SOTA 1G9IE 3AW1A 2VVUA 3MWIU 1BBRH 2P93A 2GMTC 2C8YB 3O8RA 3PO1B 2R2WU 1OPHB 4YO9A 3PMBB 2FOCA 2G00A 1P10A 4B2BA 2P59A 5EXLA 1FY4A 2W3IA 1EASA 1YPLH 3ATMA 4LK4A 2BXUH 1SGRE 4K3JA 1Q3XA 1GHXH 1MTWA 1GVZA 1TRNA 2ZPSA 1QRXA 2HVXA 2NU3E 2Z7FE 2Y5FA 1ESBA 4WMEA 3M7TA 4X8SH 1GGDB 3RXVA 4SGBE 3RXQA 2XXLA 1SGIB 2ANKH 2ZFSA 4ABHA 1YPMH 1O3NA 1TLDA 2CHAC 2A4GA 1AVWA 1WU1A 5AVDA 1NFUA 1CHOG 2WPJS 4HGCA 6LPRA 3QWCH 2H5CA 1IQLA 4MLFB 1F2SE 4TYDA 1V3XA 4OS2A 2Z3CA 1O3GA 1IQKA 5T6FA 4IMZA 1GBLA 1P0SH 4JCNA 4X6OA 5F8ZA 5A09A 2FWWA 4IBLH 3RLYH 3SQHE 2R0LA 1GI0A 3N7OA 1QJ7B 2RG3A 2PKAA 3TH2H 1AN1E 4XE4A 1ELBA 5G4BA 3FANA 1ANEA 2ZEBA 1OP8A 4NFEA 3RU4T 3ZZ3A 3ATWA 4IN2A 2R3UA 2PFEA 3VPKA 1HRTH 4FVBA 1W11U 2XCNA 2BQ6B 3EQ0H 2A7CA 2ZTZA 1OOKB 3BTHE 3KN2A 2ULLA 4NIVA 1JXPA 2QIQA 4SGAE 4ABJA 2Q6DA 2FMJA 3KHVA 2BVRH 4X1PU 4CREA 1MD7A 2XCFA 1MAYA 1OSSA 1Y8TA 3LGIA 3A7YA 1C1PA 2XC0A 1UCYH 3NK8A 5HGGA 2PW8H 3A88A 1O2WA 1GCTB 3I29A 1O3OA 2O8UA 5PTPA 4H6SB 2Z9IA 1W8BH 3TPIZ 4WMDA 4ABBA 2SGFE 2W5EA 4NCYA 1UTJA 3TJUA 4H4FA 1GI4A 1Z7KA 2ZCKP 2BB4A 2EC9H 1MU8B 1M9UA 2A5AA 1BZXE 4Y10E 9ESTA 1CT2E 2BX3A 2F9OA 3NPSA 1RFNA 2HNTF 1SPJA 1ZHMA 3QN7A 2P3TB 2JH5D 1GHZA 3SI3H 1K2I1 2ZFFH 2KAIA 2A7JA 4INKA 5A0BA 3BEIB 3FZZA 4RN6A 3LJJA 1SLUB 4CH8B 1DS2E 5T6GA 2H2ZA 4X2WA 2Z3EA 4ASHA 1HAVA 1GDUA 1HAHH 4FU9A 2GD4B 2VIWA 2B9LA 1ORFA 1SGTA 1J16A 2HOBA 1RIWC 4Q7ZA 4CH2B 1KSNA 3H7TA 2NU4E 3ZYEA 1Y3UA 1O5AB 1F7ZA 4Q2KA 1O2KA 1LQDB 2BHGA 1MU6B 1EQ9A 4DW2U 6ESTA 1AO5A 1H4WA 1K1LA 1C1TA 3IITA 1NRRH 2ZFTA 2D1JA 1V2QT 3OTJE 4FUDA 5I46H 1O3JA 3UUZA 4LXBH 2C93B 4A5TS 4VGCC 2XBWA 1EPTC 1WV7H 1GJ9B 1RRKA 4U2WA 4CBNA 2G8TA 5BRRE 5EPNA 1BDAA 4X6MA 5AFYH 3RM2H 1O39A 2P95A 1TMBH 2EI6A 3LGYA 1ARBA 1P2JA 2AFQB 2AGIX 1AHTH 1C5XB 2HRVA 3V0XA 2ZGBH 1UTPA 1BMNH 3T2NA 1AKSA 1WTGH 3ZZBA 1A0HB 2J9NA 2VVVA 4WMFA 1BJVA 2XRCA 2ZF0H 1N1LA 1YM0A 1P57B 1AB9C 5CHAB 1Q31A 1LO6A 1ZMJA 3TGIE 3PWCA 1HIAB 3OY6U 1DICA 3BIUH 1MCTA 1D4PB 2ZGHA 5FPYA 1F0RA 5B6OA 2BMGB 5A8XA 4ISHH 1EPTA 3SW2B 3S9CA 3BSQA 4NSVA 4GCHF 2P94A 3M61U 1A5GH 2Z9LA 4WWYA 5GWZA 5JBAS 1Y3VA 1AI8H 1P3CA 3RM0H 3A7XA 3PMHB 1NM6A 2FOAA 1BTWA 2GX4A 2QXHA 3KQBA 2CF8H 3MNBA 1K1OA 3LKWA 2GV7A 4E05H 1K9OE 1ZGVA 4WVPE 5C1XA 4MDSA 5FBEA 2G51A 1SHYA 1QY6A 3MH5A 3F9FA 1LTOA 2TIOA 3OY5U 3UTUH 3SBKA 4RKJB 4GHQA 1H9HE 3LPRA 1L1GA 1YP9A 1BHXF 1BB0B 3M5MA 2Q6GA 1JIRA 4MNWA 1O3CA 2FTLE 1NRNH 2F9VA 2G5NA 3ZZ8A 1C2GA 1GJ7B 1ZZZA 1O5GH 3HGPA 5FX5A 1TGCA 3TLOA 2TGTA 3C1KA 5A0CA 1QFKH 4TWYA 2SFAA 3M3TA 1VGCC 1SLXB 3SNCA 2FLRH 4FVDA 2D2DA 1H8DH 1CVWH 5EW2H 1TMUH 1D3TB 2DE9A 1MKWH 1GMDF 1PQ5A 1JOUB 3SU6A 4XBDA 5EQQA 3SJIA 1QL8A 1Y5AT 2XC4A 1TABE 5C5OA 1ID5H 3BTWE 2PGBB 3SO3A 4DIHH 4WY3A 2AIPA 1K21H 2GDEH 3QO6A 3VXFH 4NA7A 3P6ZB 3QGNB 3U8OH 1ZPBA 2NU1E 3HGNA 1PPZA 4ISOA 1B0EA 1LQEA 1ZOMA 3LOXA 5E2PA 2FODA 3EYDA 4ZMAH 2BY7X 1C5RA 1C5ZB 5AFZH 1QIXB 2VWMA 1P12E 2PKSB 2ZQ1A 1WOFA 1XUIA 2BX4A 1TGTA 3DFLA 4UDWH 1YPHC 1QL9A 5DG6A 2XWBI 1NT1A 3URDA 2TRMA 1O2SA 3OSYA 3F68H 3ZZCA 2GDDA 4M7GA 2JKHA 3BTTE 3LH1A 1FI8A 3UREA 2QCYA 2UWPA 2UWLA 1NRPH 1XUFA 3GY8A 1GHAF 4K5ZA 3VFEA 4ABGA 3QX5H 1EOLA 1G30B 2VIPA 2JH0D 4FU7A 5DP3A 3A86A 4TPIZ 1ZRBA 1BTHH 1DY8A 4AFQA 3A85A 3M5OA 1KXFA 2SGPE 1MTNB 2NU0E 3ZVEA 1NFYA 3TITA 1A1RA 1SGYE 2ZHEH 4XFQA 1Z8GA 1H1BA 1GDQA 1GBTA 5TCAA 3RP2A 3DA9B 4UFGH 4TPYA 3GISB 3UQOA 3A84A 1H8IH 1FPHH 1BUIA 3KEEA 1ZSLA 1C1NA 4OS6A 2FOHA 1H9IE 1PPHE 1TX8A 2ZCHP 3M5NA 4NGAH 1F5KU 1F0SA 1HGTH 5F03A 1O2QA 2ZO3H 2PHBA 1ETSH 4J1YA 1EAIA 1F92A 1GMCG 1ZTKA 2A45B 4FUIA 4NFFA 3SJKA 4BNRA 3LDXH 2FZZA 8ESTE 1HAOH 5C1YA 4FUFA 3ZZ4A 5DPAA 1UJ1A 1FPCH 2ZQ2A 3BTME 2ZU3A 3T25A 1QHRB 1OWDA 1QCPA 2UWOA 2V3HH 4ISLA 4D8NA 4ZKSU 2EI7A 1AU8A 2VIVA 3SGQE 3P17H 1GI5A 3M5LA 1EATA 1UTNA 1KIGH 1C5QA 1GI1A 2FO9A 4BAKB 5JBTA 4ZXYH 1YYY1 1IQHA 4K8BA 3NZIA 1BMMH 1QJ6B 3NXPA 3V12A 2AGEX 1TNKA 1IQGA 1C5NH 1NU7B 2Y5GA 3GCTG 1P2MA 1P05A 2ZFRH 3TH3H 5A2MH 3PMJA 1HUTH 1FZZA 1ELFA 2VWLA 2P8OB 1TX7A 1FLEE 5H4IB 3SU3A 5LPRA 1RJXB 2XBVA 3P8NA 1NU9A 3A7WA 2A32A 3A82A 4O03A 3RXBA 5C5NA 5K0HA 1PQ8A 2ANMH 3TVJB 2CGAA 4AB9A 3G01A 2FOGA 3KF2A 2PKAB 5ESTE 3HPTB 1INCA 4H42U 1V2LT 1ZTJA 4U01A 3ZVBA 5J4QA 1CBWB 1GHBG 3B9FH 1C4U2 1KLIH 3QK1A 2BOHB 4BTIB 2SGQE 4B2CA 3MO3A 4Y11E 1HAGE 2BQWB 1UK3A 4KTUA 2BLOA 2EI8A 4INHA 1P2NA 6GCHF 1V6DA 2SGDE 1C1QA 2JETC 1O34A 3JZ1B 1EP6A 3W94A 4HTCH 2CMYA 1DM4B 3MU5A 3PWBA 3O8DA 1XMNB 4JMYA 2CXVA 3BIVH 2A31A 1GBAA 1SB1H 3ZZ5A 1A5IA 4YLQH 1IHTH 4K2YA 3T28A 3QZRA 3M3SA 5A8ZA 2G81E 4GHTA 4TY7A 1C2KA 3TU7H 4MPVA 2VJ1A 1FY3A 4IGDA 3AAVA 4I33A 4OS4A 4CR9A 3MYWA 3GY6A 5DP6A 4Z6AH 2I6SA 1S5SA 2Y82A 1VR1H 3MU0A 4KTSA 4D76A 3GY5A 2FX4A 4IS5A 4MPXA 2VIQA 4AX9H 3TNSA 3VB7A 3CS0A 4JK5A 3SGAE 3M7QA 3KGPA 5JYIA 1G2MA 1E38B 1BT7A 1IQMA 1C5OH 1UVOA 2YNBA 1PYTC 1KXAA 1C1UH 3LC5A 4QT8C 1IOEA 2KAIB 1O3KA 3BF6H 4GPGA 1UTKA 2R2MB 4ZHAA 3PMAB 1LPZB 3S9BA 1NRSH 2BXTH 4X8UH 5GPIB 1HDTH 1G32B 1HAVB 2J92A 3UNQA 4TWWA 1WQVH 1VITH 1OP0A 1O2NA 3D65E 3HK3B 1TBZH 4ZKRU 1KDQB 4X6PA 3ZYDA 3MU4A 3SU1A 2VGCC 1ELCA 4FUGA 1NESE 1CA8B 1L0ZA 4AB8A 4THNH 3UPEA 3MU8A 1HNEE 3RXDA 5HYOA 3ENSB 1SGFA 4GSOA 1IQIA 2BVXH 1C1MA 3BG4C 1ETTH 1O2HA 1P9UA 3SV6A 3RDZA 3RMMH 4AGKA 1UVTH 6CHAB 2W7SA 3W95A 2H9EH 1VJ9U 1DANH 1JWTA 4WF8A 1MCVA