2VU8E

Crystal structure of an insect inhibitor with a fungal trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
224
structure length
224
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/inhibitor
molecule keywords TRYPSIN
publication title Structure of Locusta Migratoria Protease Inhibitor 3 (Lmpi-3) in Complex with Fusarium Oxysporum Trypsin.
pubmed doi rcsb
source organism Fusarium oxysporum
total genus 55
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vu8E02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vu8E01
2D1JA 1HAOH 3MO3A 4INLA 2Q6FA 4B2AA 2BVRH 4E06H 4UE7H 5JB8S 5CE1A 5DG6A 4AFZA 1IOEA 4WMFA 2GX4A 2ZF0H 3TGJE 1GBFA 4THNH 1Y3YA 1JMOH 1SOTA 3A85A 1FUJA 1N1LA 3RXVA 1OS8A 1EAXA 1F0SA 4B2CA 1GBLA 1GL0E 1TRYA 3KIDU 1PPGE 1W12U 1DXPA 3QZRA 1DWDH 3VB3A 1P8VC 1PQ8A 3TH2H 4ZROA 3NKKA 3ZZBA 2XW9A 1TMUH 2HNTF 2VIVA 4X6MA 4B73A 1CQQA 4HGCA 1C2IA 1P04A 4BOHA 3L3TA 1O2UA 2FLBH 2BY7X 3NCLA 1SMFE 3ATMA 1C5UA 1MAXA 3BEUA 4U32A 1QQ4A 1C5LH 5T6GA 2J92A 2SGAA 3AW0A 3S0NA 3QWCH 1A1RA 1FJSA 1TNHA 1A0JA 2Q6GA 2ZHEH 1NN6A 4DOQA 2A5KA 4ZUHA 3ODDA 4Z6AH 1PYTC 4DJZB 1QIXB 2PSYA 2Z9LA 1CHOF 3PYHA 3GYMA 1GBDA 1C1UH 1SGFG 1XUJA 4ISLA 4UFDH 1YM0A 1TRMA 2CV3A 2GDDA 2FODA 2HPPH 1NTPA 4A1TA 5LPRA 1GMDG 3F1SB 1BJVA 1YBWA 3UWJH 3E1XB 3EGKH 3HK6B 1T4VH 5A2MH 1EZXC 1B0EA 5DP9A 4CHAC 2XRCA 4J1YA 1RIWC 2A45B 1O2JA 1G3BA 1T8LA 1C1PA 3LC3A 4FUBA 5A8ZA 1MTVA 1ANBA 2C8ZB 2DUCA 1LPZB 1MQ6A 3SORA 2FMJA 2A4RA 2OBOA 2FZZA 3GCHC 1HAZB 3SV6A 1NS3A 5DKMA 1O2VA 3RLYH 2A7CA 1GJ4H 1V2RT 3D49H 2BLVA 1CU1A 2WPKS 5BRRE 2BOHB 3SJ9A 1SG8B 3BTTE 3S9BA 2QV1A 3K6ZA 4CRDA 1BTPA 1Y59T 2F83A 2ZTZA 1CVWH 4ZKSU 1W13U 4O3TA 1YPHC 4AFUA 3MU8A 4X2VA 1KXBA 3A81A 1H1BA 1S83A 4JMYA 1AVXA 3UOUA 1T8NA 3QTVH 5FPYA 1BIOA 1YCPM 1AUTC 1GHVH 3SU3A 6LPRA 3TVJB 3RC5A 1F5LA 1QHRB 1GBEA 3UFAA 1F0UA 1P0SH 1UTNA 3ZZ4A 2GCHG 3VGCC 1ETTH 3GY3A 1EAWA 4MG3A 3ATKA 1O2XA 4X1PU 3OY5U 4FUJA 1GHBF 2ZDVH 1J15A 2W5EA 3UR9A 2YNAA 4AOQA 1C2HA 4ZKNU 1GBMA 5I46H 2ANWA 2CJIA 4XFQA 2QXJA 3P8OA 1C4V2 1W7GH 1O2HA 3O8BA 1HIAB 3PO1C 2W3IA 1QRZA 3KGPA 1LVMA 3TJNA 3OSYA 2PFEA 1TYNA 1KXDA 3CP7A 2OQ5A 3V7TA 4MNVA 1ZR0A 2ZA5A 3VPKA 5TCCA 1TOMH 2ZDNA 3RLWH 3U8RH 1C2LA 4H6TA 1GMCG 3UQOA 2BD8A 2WPIS 2B7DH 4E7RG 3GCOA 1TPSA 2D26C 4XOJA 3GCNA 1TWXB 1LHDH 1J9CH 1DM4B 1XKAC 1KTTB 3RXAA 4DY7B 2ZKSA 5L2YH 1AIXH 1EKBB 3SQHE 2A7JA 5HMAA 1W8BH 2P8OB 3VB6A 1VITF 1BA8B 2PTNA 4JZFH 4NSVA 1SL3A 2WV5A 1GBAA 4X8TH 1CT2E 4XDEA 1GHWH 4GHTA 1HAYB 1GHZA 4KKDA 1C1WH 3F9GA 1V2TT 3RXTA 2UWPA 4UDWH 5C1YA 4BXSA 4MQAA 4U30A 2ZCLP 2QC2A 3MFJA 4CREA 4NCYA 4YTAA 2QF0A 1EXFA 1O38A 2BVSH 4U2WA 1F0TA 2BZAA 3N7OA 1HXFH 1ELDE 3MO9A 5T6FA 3EDXB 1BRAA 3HGPA 4INHA 1BTHH 4ABEA 2GCTB 4E7NA 1GMDF 4B76A 3TLOA 1G36A 3TNTA 1LVOA 1GCTB 1UK3A 2ZGCA 1WV7H 1ARCA 4OS2A 3W95A 2ZZUH 1CGHA 1V2MT 4PROA 1XUIA 2VIPA 4A6LA 4BAHB 3K6YA 3QGNB 1MD7A 1ABJH 1C9PA 1BDAA 1LHGH 2Z9JA 3ATLA 3PV4A 2GV7A 1O3FA 4JZIA 4GUXA 3SI3H 3VEQB 1LO6A 3A8BA 2H9HA 2FTMA 4UEHH 3T25A 1SB1H 4AB9A 1UVSH 1TAWA 1BBRH 2SGEE 3TPIZ 1BJUA 1MH0A 1NRSH 3MNSA 3GICB 3GOVB 3UNRA 4WF8A 3SZNA 3OX7U 2PV9B 2SNWA 1AO5A 1IQFA 3P92A 3F9FA 4MPXA 2QXGA 3SNEA 4GPGA 1BQYA 2ANYA 2V0BA 3OYPA 1S6FA 1SGEE 1O3LA 1AZZA 3LJOA 1K1LA 4JYUH 5EQQA 4BAMB 4XE4A 3RXHA 4K2YA 3A7TA 3K65B 2ZGHA 1KSNA 1H8DH 1GMHG 1YF4A 2M5TA 3VFEA 4I7YH 1AMHA 1GJBB 1QB9A 4U01A 4TPYA 4HZHA 1XUFA 2CHAB 3BTHE 1C1QA 1P06A 1BHXB 1UTOA 4Y7AA 1QGFA 2GT8A 1SLWB 4YLQH 5DP8A 2F3CE 1TGNA 1GBKA 3L33A 2BHGA 2O8TA 1GI9B 2ODYB 2XXLA 2F91A 1GG6B 1GVZA 5AHGH 2PGBB 1A3BH 5A0AE 3ZYEA 1CO7E 1NROH 3BV9B 2BD2A 1C2KA 2BLQA 4LZ4B 1RRKA 3F6UH 3LIWA 1TGBA 1YPMH 1Y5UT 2C8XB 1JWTA 2P3FH 1ZJKA 3MNXA 1UCYH 3FP6E 2GZ7A 1O3CA 1MD8A 3MNBA 4FVBA 2ZDMA 1WYKA 4O03A 1CA0C 4OS4A 3M3TA 4ESTE 1YYY1 1K28D 1PPEE 4LZ1H 1S0QA 1P2NA 1PYTD 1FQ3A 3UOPA 2AMDA 1JIRA 4K3JA 1QL8A 2R0LA 2ZU2A 1C9TA 1BZXE 1IHSH 2CGAA 4CH2B 4X8VH 1V2ST 1SGRE 1OYTH 3NZIA 5GCHG 1T8OA 1Y5BT 3V12A 1BBRE 2AGGX 3KNXA 1SC8U 3ZVBA 1YCPK 4YO9A 1C2EA 2GD4B 1QB1A 4X8SH 3VB7A 4AG1A 1TNGA 2QYIA 1QNJA 3MH7A 3E0PB 2BZ6H 3MHWU 1D3DB 3H7TA 3BN9A 3OY6U 4MPUA 1O2SA 1NM6A 2ALVA 2NU4E 1TIOA 1LQDB 3PWBA 4YLUA 3ZZAA 4ZHMU 1MUEB 5CHAC 1HAHH 2Y7XA 5C5NA 3DD2H 3HGNA 1QL7A 3NPSA 2ZO3H 4IMQA 1RIWB 2FOCA 4X1QU 1HGTH 1FXYA 1ETSH 1FY1A 1P2JA 1ZHMA 2PTCE 1C2FA 1NT1A 1SGIB 4I33A 1QBOA 6CHAB 4XSKU 3UREA 2VH6A 1BMMH 1LKBA 5DP4A 4X1NU 2R9PA 2Y6TA 4RKJB 5J4SA 1Z8IB 3O8DA 1FY4A 2EEKA 1S5SA 1TBQH 3FP7E 2OTVA 4WH8A 2F9UA 4AX9H 1W14U 1TA6A 2BD4A 1UVUH 2AMQA 1XUHA 3SV2H 1GJ5H 1MKXH 1ZSJA 1OP8A 2G51A 4FUEA 3S9CA 1DSUA 1UCYE 3SUFA 4Q2KA 1KYNA 3A8DA 1C1SA 1J14A 1Y5AT 3LDXH 2AIQA 2G5VA 1XUGA 3AASA 1C1RA 4MDSA 1ZHPA 4AYVB 2BDAA 1P2OA 3NK8A 1D3QB 1WTGH 2QY0B 4Y6DA 1O0DH 1OOKB 1QA7A 3I77A 4X1SU 1M9UA 2JKHA 2GCTC 2Z3CA 1O2PA 2VB0A 1AI8H 2VU8E 3D23A 2OLGA 1D9IA 1TE0A 5DK1A 3S7HB 1HYLA 5FPTA 2VH0A 2A5AA 1ZGVA 1GBBA 2P94A 3SGAE 3UUZA 1O3GA 2A31A 4Y11E 2B0FA 1OXGA 4I8KA 1C2GA 4CBNA 5A8YA 3TH4H 1HPGA 1O30A 3B9FH 3I78A 1QBVH 5DP5A 2ZU4A 1FNIA 2FOBA 2HPQH 4AG2A 2B9LA 3ZYDA 1AB9B 2FXRA 3LH3A 4Y8XA 3RXDA 1Q31A 2GT7A 2BX4A 5CMXH 4KTSA 1Q3XA 3DA9B 1ZMLA 3MU4A 1GI5A 3E0NB 5GWZA 1F7ZA 2ASUB 3P17H 2PUQH 1SLVB 2I6QA 2BM2A 2G52A 3VB5A 4MLFB 1IAUA 1O5BB 2BQ6B 3PB1E 1TB6H 2O8WA 1CT0E 1BCUH 4VGCB 1FIWA 1D4PB 2C90B 3OTJE 2TBSA 2FX4A 2GZ9A 4IC6A 4E05H 3MH5A 1NPMA 1H8IH 1W0ZU 1A7SA 2F9OA 3KCGH 4B75A 2CHAC 1O37A 1E0FD 1H9LB 1YPLH 3GY6A 1UVTH 3RXLA 1Z6EA 2C93B 3A7XA 1LKAA 1GHBG 3LJJA 3QLPH 2IOTA 4F49A 4X0WU 2J34A 2A0QB 3QX5H 1GG6C 2A4QA 4ABAA 5AF9H 1WUNH 1SLXB 1PQ5A 3A82A 3FZDA 2CXVA 3F9EA 1P12E 3A89A 3RXOA 1HUTH 3RXCA 1O2WA 1SGQE 5EW1H 2VWOA 3Q77A 3ESTA 2NU2E 1V2LT 3T27A 1GJ9B 5EPYA 4IN1A 1O5GH 2ZQ1A 3VB4A 1ESAA 1TX8A 2BD9A 1AE8H 5DO4H 1FN6A 3IWMA 2PLXA 3MU0A 1V2UT 3JZ2B 5F03A 1DUAA 1GCDA 1NFXA 1BBRK 3M3VA 1F2SE 1OPHB 2P16A 2J38A 3BTWE 1IQEA 1UK4A 1GI6A 1JOUB 3LT3A 1VCPA 1S84A 2BD7A 1G2LA 3UPEA 2GVFA 3LU9B 1A5IA 1VITG 2F9NA 1GDQA 3MH6A 4YOJA 2Z9IA 2F9BH 3BEIB 1A61H 2OP9A 2FDAA 2TGDA 2VJ1A 1O3MA 1AFQB 4B1TA 4IN2A 2ZTYA 3M5LA 1C1MA 1QJ1B 3E16B 4FUFA 5AFYH 3RDZA 3TK5A 2WPHS 3LH1A 3ZZ6A 3P95A 4WXVA 2UUJB 3RUOA 1OP2A 1TMBH 1N8OB 2BDCA 2ZG0H 4Q80A 1MCVA 1JIMA 3T5FH 3T29A 2J4IA 3LC5A 2BY8X 2UUFB 2SGFE 5C1UA 5JDUB 1Q2WA 3TU7H 1SR5C 2Y82A 1EUFA 1W11U 3RXGA 3B23B 1MBQA 1NO9H 2ALPA 2ZDKA 2FLRH 1TX7A 5EODA 2JETB 1CSOE 3M7TA 3IITA 1BMNH 3A7ZA 1BRUP 1ZPZA 1O2MA 1K1PA 2P3TB 3SN8A 1S0RA 3UQVA 1UCYK 1FY5A 1FZZA 3Q00A 1LHEH 5EOKA 1UVPA 6CHAC 4CRCA 2OUAA 2V35A 1O3IA 2VIOA 3E6PH 2RA3A 1SFQB 1ANDA 1G3CA 1LHFH 1CA0B 2C8WB 1MTNB 2H9TH 2XCNA 1RTKA 1TNJA 1O5EH 3D62A 1P05A 3LGUA 3R0FA 1O3DA 2WPJS 1ID5H 1UTPA 4ASHA 5E2OA 1HJ9A 2A5IA 5HM9A 1OWHA 2FOAA 1V2JT 2BB4A 3E3TA 1QA0A 2Z9GA 1SQOA 2RCEA 5JB9S 1UVOA 5FBEA 1SBWA 3A86A 5EPNA 5FHTA 9LPRA 1AN1E 3K9XB 1FIZA 1MZAA 4YT7H 4OS7A 4AFQA 1P2QA 2H5CA 3RM2H 1GL1A 1O5AB 1P57B 1EB1H 2ZGXH 2SGPE 1GHAF 1TFXA 5BPEA 1MMJN 8LPRA 4ISIH 2XCFA 4MPWA 5EG4A 1A5HA 1P11E 2ANMH 5DJ7A 1ZSKA 1UTKA 2GDEH 3MMGA 3T28A 2C3SA 1V2NT 3E8LA 2RG3A 4BAKB 2ZEBA 1GPZA 1JRTA 4K60A 2ZFQH 5CHAB 4MNXA 1WSSH 1BHXF 1J8AA 1Z8RA 2SFAA 3LOXA 2OC7A 1DUEA 2YOLA 3MWIU 4H6SB 2HLCA 1P2IA 1AB9C 2UUKB 2AH4X 2YNBA 4DW2U 3QK1A 4INKA 1G30B 4HI3A 2ZI2H 3H7OA 4AFSA 4IS5A 2NU0E 4D7GA 7GCHF 1MKXK 1TPPA 1PPZA 4IC5A 4JZ1A 1V2WT 1RXPA 3TK9A 3QUMP 1EZUC 1O2IA 5IYTA 2OC1A 5E8EH 1IQGA 4VGCC 3AVZA 2ODPA 1AU8A 1SLUB 3GY7A 4NFEA 1FLEE 1AZ8A 2BVXH 3BSQA 4H42U 4IGDA 4KELA 1O2ZA 1DDJA 3ENSB 1N6XA 1UJ1A 2P59A 2Y5GA 2VIWA 5E0JA 1QY6A 1GHYH 2IPHA 4I31A 3KF2A 1OP0A 3MU1A 2UWLA 1NRNH 1NFWA 3T62A 1FV9A 3LGIA 2FO9A 4MNWA 1YP9A 4NSYA 1FONA 1KLTA 1XXFA 1ELCA 3SJ8A 3KQCA 3A7VA 8KME2 3KHVA 4K1SA 2VVCA 1DANH 2OBQA 5L30H 2ULLA 4Y79A 5JBAS 2Z3EA 1G3EA 3ZVAA 1WQSA 1EP6A 1GGDB 1T4UH 1BT7A 1AKSA 1VJ9U 2BLOA 5JBCS 1RTFB 1O3PB 1O2LA 3SHCH 3SNBA 3FANA 1QRXA 1UO6A 2AMPA 1EOLA 2VNTA 1DLKB 1PPHE 1FY8E 1SFIA 1KLJH 2AYWA 2TGTA 1DLEA 1LHCH 1WBGB 4HFPB 1EPTA 4X1RU 1KDQB 3RXPA 4Y8YA 3SNAA 1OWJA 5K0HA 1C5SA 1MTSA 2R3UA 1DICA 1CGJE 2STAE 4B74A 1MQ5A 4ZXYH 1AFQC 1O5FH 2XBYA 1ABIH 5FX5A 4UFGH 4NA9H 1O2RA 1E36B 4A5TS 2O8MA 1MAYA 3SU5A 2Q6DA 1TOCB 2FYRA 3GCTF 1MTWA 1N8OC 3UIRA 1DWEH 2ZDLA 1L4ZA 3EQ0H 1THSH 3SO3A 3ATWA 1ACBE 1GI7B 1H9HE 1U6QA 1FAXA 1GJ7B 2WYJA 1AWFH 4ISOA 2Z9KA 4NIXA 3OU0A 2Y80A 2RDLA 2FOGA 4OGXA 1IHTH 2ZECA 2FI4E 7ESTE 4FVDA 1DXWA 3U1IB 3ZVCA 1C4U2 2JETC 4YM9A 1K9OE 1J16A 3ZZ3A 1V2QT 1ZSLA 1BTYA 5JYIA 4SGAE 2NWNA 3M5MA 1CE5A 5IDKA 2FI3E 3RMLH 3TIUA 2A2XH 1Y3WA 1D3TB 2RA0A 2FOMB 4RN6A 5HXFA 3PLPA 3F9HA 4FUCA 2HALA 1O3AA 1PFXC 1BITA 1ELEE 3H5CB 2SGQE 2ZC9H 5L2ZH 3RU4E 3U98H 1MU6B 1SQAA 4JCNA 5GXPA 3WY8A 2FI5E 3SU0A 1CA8B 2PKAB 3BTFE 1MTNC 1E35B 2VIDA 3SU2A 2XTTB 4Y10E 6ESTA 1O33A 1DY8A 1VCQA 3W94A 3NUMA 1C1NA 3RP2A 3ZZCA 4HTCH 2EI8A 4TPIZ 3HKIB 3LGVA 2HRVA 3M61U 2BX3A 3SBKA 1P10A 1QR3E 1O2GH 1ESBA 2AFQB 2A4GA 3UWIA 2G55A 2PW8H 3G01A 2Z3DA 2Y81A 2FWWA 1TPOA 4X8UH 2XC0A 1IQJA 2WPMS 2VIQA 5FAHA 2UWOA 3PM3A 1OWIA 3MOCA 6GCHF 1LVBA 1ANCA 3NWUA 1ZMJA 1FI8A 1W7XH 2IJOB 2J2UA 3B8JA 3BTGE 4LXBH 2ZCKP 4OS5A 2VGCB 4I8JA 4YOGA 3RXKA 4ABFA 4CRAA 2G00A 3V3MA 1ARBA 1Z1IA 2FYQA 3QO6A 2SGDE 1ELTA 5GDSH 2R0KA 2VWLA 1AVWA 1V2PT 1OWKA 4RKOB 4NWKA 4D9RA 1A46H 1HAXB 1C1TA 1BB0B 3GISB 4WMDA 3CS0A 2TIOA 1SI5H 4X2WA 1GI3A 4NIYA 3GYLB 8ESTE 2CF9H 4JZDH 3EA7A 1QFKH 1P2KA 1THRH 3SJKA 1NZQH 5LH8A 1ELBA 1FPCH 2ESTE 1YPGH 2C8YB 4WXIA 5A0CA 4CR5A 1BRCE 2FP7B 4B71A 1IQLA 2BXTH 1O3HA 5TCAA 1VCWA 4Z0KA 2EI6A 1P3EA 4Y0YE 5DP3A 1ZLRA 1V2VT 1SGCA 1D6WA 2WYGA 1KDQA 1W3CA 3PWCA 1ZRBA 2ZHFH 2BYAX 2A32A 1TLDA 1GJCB 4GLYA 4BTUB 8GCHF 2R2MB 1GDUA 3VXFH 1G3DA 4BTTB 3RXEA 3Q76A 1T7CA 3PLKA 4ZMAH 5H4IB 5T3HA 1NESE 4ABBA 3A7WA 1UMAH 3BTME 2ZTXA 3CENA 2XC5A 4ZXXH 4AGJA 1SQTA 2AGEX 3KEEA 4WH6A 3D65E 2WV4A 3DT0H 2ZPRA 1C5YB 4YZUA 5EGMA 5A0BA 1TNLA 1HRTH 3M36A 1A5GH 1RFNA 1GI1A 5ESBA 4OS1A 3RXJA 2Y7ZA 4I32A 1GGDC 5EQRA 5FBIA 1QBNA 4D7FA 4J2YB 1O5CB 4ZKOU 1YPKH 1O32A 1NFUA 1P09A 1TQ7B 4NA7A 1BMAA 2WUBA 1GJDB 3T26A 2GMTB 3V13A 2BD3A 5DPAA 5J4QA 5FXLA 4XBBA 4WVPE 1KTSB 2D8WA 2FIRH 1QL9A 1HXEH 5DP7A 3UNSA 1T8MA 1XVOA 3M7UA 1O2OA 4D8NA 4JYVH 2ZFPH 4BAQB 1QJ6B 1WQVH 2PKAA 2PUXB 1AWHB 4NZQA 4Y0ZE 3VXEH 2B8OH 3O8RA 3SJIA 1RJXB 2QCYA 1AE5A 4FUIA 1EZQA 3RMNH 3E90B 1LDTT 1K1NA 1C4Y2 4M7GA 3V0XA 1XKBC 1E37B 7KMEH 2BQWB 2EA3A 3DHKH 1E34B 5LGOA 3GDUA 1B7XB 1W0YH 1EQ9A 1YPEH 1GDNA 2FTLE 1VR1H 2LPRA 1L0ZA 3TGKE 1QTFA 1SGDE 3RXFA 4ZH8A 1TBRH 2KAIB 5F6MA 1KLIH 1ZHRA 1EJMA 2ZIQH 1GHAG 1P9SA 1DITH 3P70B 5FPSA 1SOZA 4K1EA 3LKWA 3FAOA 4A7IB 2A1DB 2NU1E 4GHQA 1KIGH 2XBWA 4JYTA 3QN7A 1GBHA 1NRRH 3EAJA 4D9QA 2G8TA 1C5QA 1E38B 1LPGB 4LOYH 3S69A 1LMWB 1DSTA 2THFB 5SGAE 3GY2A 1T32A 5LPEA 3GDSA 1UK2A 5A09A 2ZHQH 1OSSA 1EJNA 4KTCA 1TMTH 4AN7A 2C4FH 2GZ8A 2P3UB 1W10U 1CBWB 1L4DA 2ZFRH 3STJA 2ANKH 3RXSA 7GCHG 2Y5HA 7LPRA 3E91A 3P8NA 5T6DA 5AFZH 1O2QA 4FU9A 1O36A 1NC6A 3I29A 3BG4B 4O9VA 2VVUA 5ETXA 1ZTKA 1SGPE 4WWYA 4A92A 5EXMA 4ABGA 1ZRKA 1HAVB 1G2MA 1O3BA 2Z7FE 1JRSA 1C5PA 3RU4T 1QRWA 2FPZA 4Y8ZA 3RXUA 1KXEA 1NY22 3UY9A 2ZU1A 1AHTH 5TJXA 1K1OA 4GCHF 1O2KA 5HM2A 4NWLA 1C5XB 1MKWH 1P2MA 1EAIA 1BRBE 5PTPA 1CT4E 1UHBB 2BQ7B 2H9EH 2BDYA 1SHYA 2ZHWH 2FOFA 2VGCC 4AYYB 1QURH 3F68H 1FAKH 3PTNA 2OD3B 1L1NA 3A88A 2A4OA 1GVKB 1V2OT 3BIUH 1N6YA 3SI4H 3PROA 4UD9H 4IW4E 3SGQE 4BAOB 3MNCA 2OXSA 1VZQH 3A80A 1Z71A 1O39A 4KGAA 4O3UA 1HJAB 1AKSB 1A3EH 3HKJB 4DVAU 1AVGH 2GV6A 3RXRA 1YCPH 3SU4A 2BXUH 2BD5A 2F9PA 3ZVDA 2ZCHP 1G9IE 3MH4A 4K8YA 1K1MA 4FUDA 2G4TA 3MI4A 1PPCE 1C1OA 1ELFA 4MTBA 3M37A 3PTBA 2HVXA 1Y3XA 3QZQA 3IG6B 1AGJA 1EAUA 1GBCA 1HB0B 2W7SA 2VINA 3ZZ9A 1LVYA 2W3KA 4Y76A 3P8GA 1EPTB 2FOHA 4ISHH 1A0HB 4ZAEA 2OC8A 4CBOA 4KP0A 3GY8A 3O8CA 2PKSB 4F4OC 1MZDA 1P02A 1LQEA 1HV7A 4DIHH 1YPJH 3M5OA 1PJPA 3ZZDA 1SGTA 1ZOMA 1THPB 1CGIE 1TONA 3S7KB 5F8XA 2ZGJA 2HGTH 2FEQH 1ZPBA 3ZVFA 3A87A 1EASA 4TY7A 1AUJA 3GCTG 2Q1JA 2V6NA 3RXMA 4FXGH 1C1VH 2JH6D 3MYWA 1QJ7B 2B5TB 2A2QH 3ZV9A 1JBUH 1GBTA 3QDZB 2ZPSA 4NIVA 1TX6A 2KAIA 3KN2A 1JXPA 3CS7A 4BNRA 2JH0D 4WMEA 4FU7A 4K69A 1ZTLA 4Q7XA 1K1JA 3U9AH 5B6OA 2I6SA 2XBXA 4WY3A 3LONA 3UTUH 2FS8A 1DWCH 2TRMA 1INCA 4Q7ZA 3SOSA 2R3YA 1S6HA 1VGCB 1GBIA 1OX1A 3HATH 5C3NA 3RXQA 1AQ7A 2GMTC 3UNQA 4MNYA 4TWWA 1SGYE 3MTYA 4X2YA 2BDHA 4R0IA 1SVPA 1P03A 1XUKA 2QAAA 3T2NA 4I8HA 2BMGB 3KQEA 3ZZ7A 1QQUA 3SU1A 2STBE 2WINI 2IN2A 2WUCA 3RU4D 4AZ2B 1DE7H 2QIQA 5HYOA 2BY9X 2R2WU 5EW2H 1NU7B 2CN0H 1S81A 4IMZA 4A1XA 1HCGA 1Z7KA 1ZZZA 3DFJA 3SUDA 2TPIZ 1O2YA 5JBBS 4D76A 5ABWA 4NGAH 4SGBE 1P9UA 1HDTH 2OC0A 1ELGA 2ZPQA 4X2XA 3DFLA 2UUYA 1HJ8A 2OCVB 2DE8A 1TBZH 2AS9A 1HAVA 4X6OA 1DPOA 1TA2A 3GDVA 3ZZ5A 3PMAB 1PPFE 4FUHA 6GCHG 1QCPA 1FMGA 3Q3XA 1UTLM 1ANEA 1GBJA 1UHBA 1C5VA 1Z8JB 1NU9A 2ZNKH 1IQIA 1ELVA 1NFYA 2FM2A 4YT6H 3BF6H 1UTJA 1MCTA 4FU8A 3P8FA 1RD3B 1ZTJA 1O5DH 3P6ZB 4UFEH 3PMJA 2HOBA 3SV8A 1G32B 2FESH 1WAYB 1B5GH 1A4WH 1V6DA 2XWAA 1L1GA 3A83A 4H4FA 3TITA 3SV9A 1EATA 2XNIA 4JK5A 2BY6X 1GI4A 5EU8A 4ZKRU 1YGCH 2J95A 2W26A 3EA9A 1F5KU 3SUGA 1Z1JA 1HLTH 2GGVB 1CBWC 2G5NA 3A7YA 1TGCA 2EC9H 1HFDA 2BY5X 1C2JA 3M35A 3FVFB 1SHHB 3FP8E 3A84A 4BTIB 4OS6A 1HAPH 3GY5A 4AORA 1L1JA 4IBLH 1XM1A 1ZJDA 4BANB 1IQNA 1DWBH 3BG4C 2J9NA 3U1JB 3TJVA 4ISNA 2ZFSA 4DURA 1GI8B 4TWYA 2V3OH 3LGYA 4ABJA 8GCHG 2CF8H 3EYDA 3R3GB 1C5WB 4BXWA 2H6MA 1YC0A 1W2KH 2NU3E 4YOIA 1XMNB 1KXAA 3BEFB 3A8AA 1AFEH 2AIPA 1OKXA 5C20A 1Y3VA 5E0GA 4TYDA 1FDPA 3TNSA 1Y3UA 2QXHA 4FUGA 3KQDA 1AY6H 3GY4A 2BDBA 1QB6A 1YLCA 2JH5D 2Z6BD 3ELAH 2HNTE 1XVMA 3HPTB 1P01A 3SJOA 3FZZA 3U8OH 2ODQA 2O8UA 1RS0A 3QTOH 2P93A 2GTBA 2FOEA 2GCHF 1GI0A 1HJAC 2H2ZA 1BOQA 1A0LA 2A7HA 1UTQA 3M3SA 1EP5A 1BUIA 3K2UA 2XBVA 3ZVEA 4DT7B 2BDGA 3RC6A 1EZSC 2BTCE 4K8BA 5C67A 4CRBA 1EB2A 3TK6A 1BTWA 2D2DA 3EA8A 4GSOA 1O31A 1ZMNA 1O35A 1MU8B 4DG4A 1EPTC 1DVAH 3SUEA 5K7RA 1PQAA 4JK6A 1VJAU 3S9AA 2ZDAH 2VVVA 4RSPA 1ESTA 1HIAA 1GMCF 3M7QA 1MTUA 2PKSC 1VITH 1Z8GA 5FCRA 5A8XA 4Y7BA 1O3KA 2ILNA 2O9QA 1O3EA 4TY6A 3LPRA 4R8TB 2QGRA 1FY3A 1BTXA 1ZPCA 3URCA 2H1UA 1BMLA 1MKWK 3SV7A 4DGJA 1PPBH 2ZFFH 1TNIA 2EI7A 2H5DA 2XWBI 4GVUA 1WTHD 3RXIA 1Y8TA 2P95A 1KY9A 1O3JA 1EX3A 1YKTA 1EJAA 2GKVE 4ZHLU 4CRGA 1X7AC 1O2NA 3TJOA 1GWAA 1ELAA 4GAWA 1LTOA 1ORFA 3RC4A 3KQBA 1WOFA 1V2KT 1HAIH 2QXIA 3UR6A 2OINA 4NA8A 5F8ZA 5C2ZA 1J17T 1SSXA 4NFFA 2F9VA 1VGCC 5AVDA 5GPIB 2CMYA 1K2I1 5I25A 1O2TA 3SNDA 1HNEE 3AAUA 1OWDA 4X6PA 5E0HA 3RMOH 2TGAA 3JZ1B 3NXPA 5ESTE 2HWLB 1SGNE 2OQUA 5F8TA 2WPLS 3BTDE 4CHAB 1KXCA 2ZHDA 1ETRH 1AD8H 2ZGBH 1YLDA 3ITIA 4CH8B 3TJUA 5FX6A 5C1XA 4ZHAA 5EQSA 1C5OH 1RTLA 3BG8A 1C5ZB 2HNTC 4X6NA 1WCZA 2PGQB 2QF3A 2Y5FA 1TALA 3GCHB 4ABDA 3RMMH 4DCDA 1IQHA 5L6NH 1IQMA 1NRPH 2P8OC 3SW2B 3QGJA 1C5RA 2V3HH 3C1KA 3FFGA 5GJ4B 5LPFA 2PR3A 3M5NA 1K1IA 2FS9A 4GCHG 3URDA 1DX5M 3PLBA 4ABHA 1DOJA 1D3PB 4AB8A 4DIIH 4KTUA 1KXFA 3DUXH 4XBDA 1GJ8B 3Q3YA 1GMHF 3ATIA 1ZYOA 1C5NH 2VWNA 3PMHB 1OYQA 4YESB 2VWMA 1UTMA 2GP9B 3ZV8A 1XX9A 4AGKA 2PHBA 3Q3KA 2TGPZ 2J94A 4K1TA 3ZZ8A 1BTUA 3TGIE 1TQ0B 1DS2E 1F92A 1GJAB 2SNVA 2XYAA 1C2MA 3VGCB 1HAGE 4WJG2 3AAVA 1TABE 1EOJA 4OGYA 2K1QA 5DGJA 1CHOG 3BTQE 5C5OA 1MBMA 1TRNA 1XXDA 1H9IE 4CRFA 2DE9A 1GCTC 1NRQH 1GI2A 2AERH 4Q7YA 3SQEE 4B2BA 5EXNA 4JZEH 5JBTA 1D6RA 1B0FA 1TGSZ 1T31A 3PO1B 2ZU3A 2PWXA 1F0RA 3AW1A 1GHXH 1SPJA 1S85A 1RGQA 4UONA 1TNKA 3HK3B 2BDIA 3BIVH 4I8LA 1FPHH 2ZP0H 3MO6A 1A2CH 3PMBB 1HBTH 3ZVGA 3STIA 4A1VA 2ZQ2A 5DP6A 3RM0H 4MPVA 1DT2A 2PSXA 4ABIA 1PQ7A 3BTEE 5E2PA 4K5ZA 1P3CA 4LK4A 1ZGIA 3ODFA 3U8TH 1DY9A 3EE0B 3SGBE 5GIBA 1LCYA 2Z94A 3SU6A 1WU1A 2QN5T 3LGTA 3SHAH 2QA9E 1GJ6A 1Z6JH 9ESTA 3L6PA 3RXBA 3U69H 1TGTA 5JPMH 3A8CA 2W7UA 4QT8C 1BTZA 3C27B 1SGFA 1FN8A 2XC4A 3MU5A 5GCHF 3KL6A 1IQKA 4I8GA 1H4WA 4Y71A 1GVLA 4NZLA 2BOKA 1DFPA 3BTKE 2G81E 3LGWA 1F5RA 1O3NA 3TH3H 2ZU5A 5FCKA 2FX6A 4NIWA 2G4UA 4NG9H 2BLWA 2O8LA 4CR9A 1V3XA 4O97A 1K22H 4UFFH 1TPAE 1O34A 1C5MD 2LNCA 5EXLA 1OWEA 1C2DA 2ZWLH 1YPHE 1S82A 2ZFTA 2AGIX 1LPKB 1CHGA 4MVNA 4XBCA 1O3OA 3SNCA 1K21H 1G37A 5HGGA 2AEIH 1L2EA 1C5TA 5G4BA
chains in the Genus database with same CATH superfamily
2D1JA 1HAOH 3MO3A 2W6ID 2Q6FA 4INLA 2WHXA 2BVRH 4B2AA 4E06H 4UE7H 3F0PA 5JB8S 5CE1A 5DG6A 4AFZA 1IOEA 4WMFA 2GX4A 2ZF0H 3TGJE 1GBFA 4THNH 4ACBA 1Y3YA 1JMOH 1SOTA 3A85A 1FUJA 1N1LA 3RXVA 1OS8A 1EAXA 1F0SA 4B2CA 1GBLA 1GL0E 1TRYA 3KIDU 1PPGE 1W12U 1DXPA 3QZRA 1DWDH 3VB3A 1P8VC 1PQ8A 3TH2H 4ZROA 3NKKA 3ZZBA 2XW9A 1TMUH 2HNTF 2VIVA 4X6MA 4B73A 1CQQA 4HGCA 1C2IA 1P04A 4BOHA 3L3TA 1O2UA 2FLBH 2BY7X 3NCLA 1SMFE 3ATMA 1C5UA 1MAXA 3BEUA 4U32A 1QQ4A 1C5LH 5T6GA 2J92A 2SGAA 3AW0A 3S0NA 3QWCH 1A1RA 1FJSA 1TNHA 1A0JA 2Q6GA 2ZHEH 1NN6A 2L74A 4DOQA 2A5KA 4ZUHA 3ODDA 2LELA 4Z6AH 1PYTC 3UB0A 1QIXB 2PSYA 2Z9LA 4DJZB 1CHOF 3PYHA 2K8IA 3GYMA 1GBDA 1C1UH 1SGFG 1XUJA 4ISLA 4UFDH 1YM0A 1TRMA 2CV3A 2GDDA 2FODA 2HPPH 1NTPA 4A1TA 5LPRA 4ACAA 1GMDG 3F1SB 1BJVA 1YBWA 3UWJH 3E1XB 3EGKH 3HK6B 1T4VH 5A2MH 1EZXC 1B0EA 5DP9A 4CHAC 2XRCA 4J1YA 1RIWC 2A45B 1O2JA 1G3BA 1T8LA 1C1PA 3LC3A 1KMHB 4FUBA 5A8ZA 1MTVA 1ANBA 2C8ZB 2DUCA 1LPZB 1MQ6A 3SORA 2FMJA 2A4RA 2OBOA 2FZZA 3GCHC 1HAZB 3SV6A 1NS3A 5DKMA 1O2VA 3EE7A 3RLYH 3PV5A 2A7CA 1GJ4H 4F55A 1V2RT 3D49H 2BLVA 3CNRA 1CU1A 2WPKS 5BRRE 2BOHB 3SJ9A 1SG8B 3BTTE 3S9BA 2QV1A 2QF4A 4Z1MD 3K6ZA 4CRDA 1BTPA 1Y59T 3PRBA 2F83A 2ZTZA 2VBCA 1CVWH 4ZKSU 1W13U 4O3TA 1YPHC 4AFUA 3MU8A 4X2VA 1KXBA 3A81A 1H1BA 1S83A 4JMYA 1AVXA 3UOUA 1T8NA 3QTVH 5FPYA 1BIOA 1YCPM 1AUTC 1GHVH 3SU3A 6LPRA 3TVJB 3RC5A 1F5LA 1QHRB 1GBEA 1E1RD 4XRNA 3UFAA 1F0UA 1P0SH 1UTNA 3ZZ4A 2GCHG 3VGCC 1ETTH 3GY3A 1EAWA 4MG3A 3ATKA 1O2XA 4X1PU 3OY5U 4FUJA 1GHBF 2ZDVH 1J15A 2W5EA 3UR9A 2YNAA 4AOQA 1C2HA 4ZKNU 1GBMA 5I46H 2ANWA 2CJIA 4XFQA 2QXJA 3P8OA 1C4V2 1W7GH 1O2HA 3O8BA 1HIAB 3PO1C 2W3IA 1QRZA 3KGPA 3OAAD 1LVMA 3TJNA 3OSYA 2PFEA 1TYNA 1KXDA 3CP7A 2OQ5A 3V7TA 4MNVA 1ZR0A 2IPQX 2ZA5A 5TCCA 1TOMH 3VPKA 2ZDNA 3RLWH 3U8RH 1C2LA 4H6TA 1GMCG 3UQOA 2BD8A 2WPIS 2B7DH 4E7RG 3GCOA 1TPSA 2D26C 4XOJA 3GCNA 1TWXB 1LHDH 1J9CH 1DM4B 1XKAC 1KTTB 3RXAA 4DY7B 3WWBA 2ZKSA 5L2YH 1AIXH 1EKBB 3SQHE 2A7JA 5HMAA 1W8BH 2P8OB 3VB6A 1VITF 1BA8B 2PTNA 4JZFH 4NSVA 1SL3A 2WV5A 1GBAA 4X8TH 1CT2E 4XDEA 1GHWH 4GHTA 1HAYB 1GHZA 4KKDA 1C1WH 3F9GA 1V2TT 3RXTA 2UWPA 4UDWH 5C1YA 4BXSA 4MQAA 4U30A 2ZCLP 2QC2A 3MFJA 4CREA 4NCYA 1E79D 4YTAA 2QF0A 1EXFA 1O38A 2BVSH 4U2WA 1F0TA 2BZAA 3N7OA 1HXFH 1ELDE 3MO9A 5T6FA 3EDXB 5CHBA 1BRAA 3HGPA 4INHA 1BTHH 4ABEA 3H09A 2GCTB 4E7NA 1GMDF 4B76A 3TLOA 1G36A 3TNTA 1LVOA 2W6JD 1GCTB 1UK3A 3PV2A 2ZGCA 1WV7H 1ARCA 4OS2A 3W95A 2ZZUH 1CGHA 1V2MT 4PROA 1XUIA 2VIPA 4A6LA 4BAHB 3K6YA 3QGNB 1MD7A 5EIYA 1ABJH 1C9PA 1BDAA 1LHGH 2Z9JA 3ATLA 3PV4A 2GV7A 1O3FA 4JZIA 4GUXA 3SI3H 3VEQB 1LO6A 3A8BA 2H9HA 2FTMA 4UEHH 3T25A 1SB1H 4AB9A 1UVSH 1TAWA 1BBRH 2SGEE 3TPIZ 1BJUA 1MH0A 1NRSH 3MNSA 3GICB 3GOVB 3UNRA 4WF8A 3SZNA 3OX7U 2PV9B 2SNWA 1AO5A 1IQFA 3P92A 3F9FA 4MPXA 2QXGA 3SNEA 4GPGA 1BQYA 2ANYA 2V0BA 3OYPA 1S6FA 1SGEE 1O3LA 2OK5A 1AZZA 3LJOA 1K1LA 4JYUH 5EQQA 4BAMB 4XE4A 3RXHA 4K2YA 3A7TA 3K65B 2ZGHA 1KSNA 1H8DH 3OEHD 1GMHG 1YF4A 2M5TA 3VFEA 4I7YH 1AMHA 1GJBB 1QB9A 4U01A 4TPYA 4HZHA 1XUFA 2CHAB 3BTHE 4Q4LA 1C1QA 1P06A 1BHXB 1UTOA 4Y7AA 1QGFA 2GT8A 1SLWB 4YLQH 5DP8A 2F3CE 2J98B 3WW7A 1TGNA 1GBKA 3L33A 2BHGA 5C17A 2O8TA 1GI9B 2ODYB 2KZ4A 2XXLA 2F91A 1GG6B 1GVZA 5AHGH 2PGBB 1A3BH 5A0AE 3ZYEA 1CO7E 1NROH 3BV9B 1E1QD 2BD2A 1C2KA 2BLQA 4LZ4B 1RRKA 3F6UH 3LIWA 1TGBA 1YPMH 1Y5UT 2C8XB 1JWTA 2P3FH 1ZJKA 3MNXA 1UCYH 3FP6E 2GZ7A 1O3CA 3FN8A 1MD8A 5EJZA 3MNBA 4FVBA 2ZDMA 1WYKA 4O03A 3KYGA 1CA0C 4OS4A 3M3TA 4ESTE 1YYY1 1K28D 1PPEE 4LZ1H 3F2GA 1S0QA 1P2NA 1PYTD 1FQ3A 3UOPA 2AMDA 1JIRA 4K3JA 1QL8A 2R0LA 2ZU2A 1C9TA 1BZXE 1IHSH 1OHHD 2CGAA 4CH2B 4X8VH 1V2ST 1SGRE 1OYTH 3NZIA 5GCHG 1T8OA 1Y5BT 4M9FA 3V12A 1BBRE 2AGGX 3KNXA 1SC8U 1WDIA 3ZVBA 1YCPK 4YO9A 1C2EA 2GD4B 1QB1A 4X8SH 3VB7A 4AG1A 1TNGA 2QYIA 1QNJA 3MH7A 3E0PB 2WZQA 2BZ6H 3MHWU 1D3DB 3H7TA 3BN9A 3OY6U 4MPUA 5C0UA 1O2SA 1NM6A 2ALVA 2NU4E 1TIOA 1LQDB 3PWBA 2KX4A 4YLUA 3ZZAA 4ZHMU 1MUEB 5CHAC 1HAHH 2Y7XA 5C5NA 3DD2H 3HGNA 1QL7A 3NPSA 2ZO3H 4IMQA 1RIWB 2FOCA 4X1QU 1HGTH 1FXYA 4HG6A 1ETSH 1FY1A 1P2JA 1ZHMA 2PTCE 1C2FA 1NT1A 1SGIB 4I33A 1QBOA 6CHAB 4XSKU 3UREA 3VG8A 4B6FA 2VH6A 1BMMH 1LKBA 5DP4A 4X1NU 2R9PA 2Y6TA 4RKJB 5J4SA 1Z8IB 5C0TA 3O8DA 1FY4A 2EEKA 1S5SA 1TBQH 3FP7E 2OTVA 4WH8A 2F9UA 4AX9H 1W14U 1TA6A 2BD4A 1UVUH 2AMQA 1XUHA 3SV2H 1GJ5H 1MKXH 1ZSJA 1OP8A 2G51A 4FUEA 3S9CA 1DSUA 1UCYE 3SUFA 4Q2KA 1KYNA 3A8DA 1C1SA 1J14A 1Y5AT 3LDXH 1W0JD 2AIQA 5GNDA 2G5VA 1XUGA 3AASA 1C1RA 4MDSA 1ZHPA 4AYVB 2BDAA 1K0HA 1P2OA 3NK8A 1D3QB 1WTGH 2QY0B 4Y6DA 1O0DH 1OOKB 1QA7A 3I77A 4X1SU 1M9UA 2JKHA 4B6EA 2GCTC 2Z3CA 1O2PA 2VB0A 1AI8H 2VU8E 3D23A 2J98A 2OLGA 1D9IA 1TE0A 5DK1A 3S7HB 1HYLA 5FPTA 2VH0A 2A5AA 1ZGVA 1GBBA 2P94A 3SGAE 3UUZA 1O3GA 2A31A 4Y11E 2B0FA 1OXGA 4I8KA 1C2GA 4CBNA 5A8YA 3TH4H 1HPGA 1O30A 3B9FH 3I78A 1QBVH 1H8HD 5DP5A 2ZU4A 1FNIA 2FOBA 2HPQH 4AG2A 4YXWD 2B9LA 3ZYDA 1AB9B 2FXRA 3LH3A 4Y8XA 3RXDA 1Q31A 1W0KD 2GT7A 2BX4A 5CMXH 4KTSA 1Q3XA 3DA9B 1ZMLA 3MU4A 1GI5A 3E0NB 5GWZA 1F7ZA 2ASUB 3P17H 2PUQH 1SLVB 2I6QA 2BM2A 2G52A 3VB5A 4MLFB 1IAUA 1O5BB 2BQ6B 3PB1E 1TB6H 2O8WA 1CT0E 1BCUH 4VGCB 1FIWA 1D4PB 2C90B 3OTJE 2TBSA 2L6OA 2FX4A 2GZ9A 4IC6A 5HIZA 4E05H 3MH5A 1NPMA 1H8IH 1W0ZU 1A7SA 2F9OA 3KCGH 4B75A 4P00A 2CHAC 1O37A 1E0FD 1H9LB 1YPLH 3GY6A 1UVTH 3RXLA 1Z6EA 2C93B 3A7XA 1LKAA 1GHBG 3LJJA 3QLPH 2IOTA 3WWFA 4F49A 4F48B 2QF5A 4X0WU 2J34A 2A0QB 3QX5H 1GG6C 2A4QA 4ABAA 5AF9H 1WUNH 1SLXB 1PQ5A 3A82A 3FZDA 2CXVA 2J97A 3F9EA 1P12E 3A89A 3RXOA 1HUTH 3RXCA 1O2WA 1SGQE 5EW1H 2VWOA 3Q77A 3ESTA 2NU2E 1V2LT 3T27A 1GJ9B 5EPYA 4IN1A 1O5GH 3SZEA 2ZQ1A 3VB4A 1ESAA 1TX8A 2BD9A 1AE8H 5DO4H 1FN6A 3IWMA 2PLXA 3MU0A 1V2UT 3JZ2B 5F03A 1DUAA 1GCDA 1NFXA 1BBRK 3M3VA 1F2SE 1OPHB 2P16A 2J38A 3BTWE 1IQEA 1UK4A 1GI6A 1JOUB 3LT3A 1VCPA 1S84A 2BD7A 1G2LA 3UPEA 2GVFA 3LU9B 1A5IA 1VITG 2F9NA 1GDQA 3MH6A 4YOJA 2Z9IA 2F9BH 3BEIB 2RFKC 1A61H 2OP9A 2FDAA 2TGDA 2VJ1A 1O3MA 1AFQB 4B1TA 4IN2A 2ZTYA 3M5LA 4I86A 1C1MA 1QJ1B 3E16B 4FUFA 5AFYH 3RDZA 3TK5A 2WPHS 3OEED 3LH1A 3ZZ6A 3P95A 4WXVA 2UUJB 3RUOA 1OP2A 1TMBH 1N8OB 2BDCA 2ZG0H 4Q80A 1MCVA 1JIMA 3T5FH 2JIZD 2J4IA 3T29A 3LC5A 2BY8X 2UUFB 2SGFE 5C1UA 5JDUB 2J5UA 1Q2WA 3TU7H 4FOUC 1SR5C 2Y82A 1S6LA 1EUFA 1W11U 3RXGA 3B23B 1MBQA 1NO9H 2ALPA 2ZDKA 2FLRH 1TX7A 5EODA 2JETB 1CSOE 3M7TA 3IITA 1BMNH 3A7ZA 1BRUP 1ZPZA 1O2MA 1K1PA 2P3TB 3SN8A 1S0RA 3UQVA 1UCYK 1FY5A 1FZZA 2XNDD 3Q00A 1LHEH 5EOKA 1UVPA 6CHAC 4CRCA 2OUAA 2V35A 3PRDA 1O3IA 2V3MA 2VIOA 3E6PH 2RA3A 1SFQB 1ANDA 1G3CA 2KM0A 1LHFH 1CA0B 2C8WB 1MTNB 2H9TH 2XCNA 1RTKA 1TNJA 1O5EH 3D62A 1P05A 2JJ1D 3LGUA 3R0FA 1O3DA 2WPJS 3U28C 1ID5H 1UTPA 4ASHA 5E2OA 1HJ9A 2A5IA 5HM9A 1OWHA 2FOAA 1V2JT 2BB4A 3E3TA 1QA0A 2Z9GA 3F0OA 1SQOA 2RCEA 5JB9S 1UVOA 5FBEA 1SBWA 3A86A 5EPNA 5FHTA 9LPRA 1AN1E 3K9XB 1FIZA 1MZAA 4YT7H 4TT3D 4OS7A 4AFQA 1P2QA 2H5CA 3RM2H 1GL1A 1O5AB 1P57B 1EB1H 2ZGXH 2SGPE 1GHAF 1TFXA 5BPEA 1MMJN 8LPRA 4ISIH 2XCFA 4MPWA 5EG4A 1A5HA 1P11E 1NBME 2ANMH 5DJ7A 1ZSKA 1UTKA 2GDEH 3MMGA 3T28A 2C3SA 1V2NT 3E8LA 2RG3A 4BAKB 2ZEBA 1GPZA 1JRTA 4K60A 2ZFQH 5CHAB 4MNXA 1WSSH 1BHXF 1J8AA 1Z8RA 2SFAA 4TSFD 3LOXA 2OC7A 1DUEA 2YOLA 3MWIU 4H6SB 2GJGA 2HLCA 1P2IA 1AB9C 2UUKB 2AH4X 2YNBA 4DW2U 3QK1A 4INKA 1G30B 4HI3A 4ASUD 2ZI2H 3H7OA 4AFSA 4IS5A 2NU0E 4D7GA 7GCHF 1MKXK 1TPPA 1PPZA 4IC5A 4JZ1A 1V2WT 1RXPA 3TK9A 3QUMP 4DT4A 1EZUC 1O2IA 5IYTA 2OC1A 5E8EH 1IQGA 4VGCC 3AVZA 2ODPA 1AU8A 1SLUB 3GY7A 2CK3D 3MQKC 4NFEA 1FLEE 1AZ8A 2BVXH 3BSQA 4H42U 4IGDA 4KELA 1O2ZA 1DDJA 3ENSB 1N6XA 1UJ1A 2P59A 2Y5GA 2VIWA 5E0JA 1QY6A 1GHYH 2IPHA 4I31A 3KF2A 1OP0A 3MU1A 2UWLA 1NRNH 1NFWA 3T62A 1FV9A 3LGIA 2FO9A 4MNWA 1YP9A 4NSYA 1FONA 1KLTA 1XXFA 1ELCA 3SJ8A 3KQCA 3A7VA 8KME2 4AC9A 3KHVA 4K1SA 2VVCA 2EY4C 1DANH 2OBQA 5L30H 2ULLA 4Y79A 5JBAS 2Z3EA 1G3EA 3ZVAA 1WQSA 1EP6A 1GGDB 1T4UH 1BT7A 1AKSA 1VJ9U 2BLOA 5JBCS 1RTFB 1O3PB 1O2LA 3SHCH 3SNBA 3FANA 1QRXA 1UO6A 2AMPA 1EOLA 2VNTA 1DLKB 1PPHE 1FY8E 1SFIA 1KLJH 2AYWA 2TGTA 1DLEA 1LHCH 1WBGB 4HFPB 1EPTA 4X1RU 1KDQB 3RXPA 4Y8YA 3SNAA 1OWJA 5K0HA 1C5SA 1MTSA 2R3UA 1DICA 1CGJE 2STAE 4B74A 1MQ5A 4ZXYH 1AFQC 1O5FH 2XBYA 1ABIH 5FX5A 4UFGH 4NA9H 1O2RA 1E36B 4A5TS 2O8MA 2WV9A 1MAYA 3SU5A 2Q6DA 1TOCB 2FYRA 3GCTF 1MTWA 1N8OC 3UIRA 1DWEH 2ZDLA 1L4ZA 3EQ0H 1THSH 1WXRA 3SO3A 3ATWA 1ACBE 1GI7B 1H9HE 1U6QA 1FAXA 1GJ7B 2WYJA 1AWFH 4ISOA 2Z9KA 4NIXA 3OU0A 2Y80A 2RDLA 2FOGA 4OGXA 1IHTH 2ZECA 2FI4E 7ESTE 4FVDA 1DXWA 1MABB 3U1IB 3ZVCA 1C4U2 2JETC 4YM9A 1K9OE 1J16A 3ZZ3A 1V2QT 1ZSLA 1BTYA 5JYIA 4SGAE 2NWNA 3M5MA 1CE5A 5IDKA 2FI3E 3RMLH 3TIUA 2A2XH 1Y3WA 1D3TB 2RA0A 2FOMB 4RN6A 5HXFA 3PLPA 3F9HA 4FUCA 2HALA 1O3AA 1PFXC 1BITA 1ELEE 3H5CB 2SGQE 2ZC9H 5L2ZH 3RU4E 3U98H 1MU6B 1H8ED 1SQAA 4JCNA 5GXPA 3WY8A 2FI5E 3SU0A 1CA8B 2PKAB 3BTFE 1MTNC 1E35B 2VIDA 3SU2A 2XTTB 4Y10E 6ESTA 1O33A 1DY8A 1VCQA 2HVYB 1COWD 3W94A 3NUMA 1C1NA 3RP2A 3ZZCA 4HTCH 2EI8A 4TPIZ 3HKIB 3LGVA 2HRVA 3M61U 2BX3A 3SBKA 5DN6D 1P10A 1QR3E 1O2GH 1ESBA 2AFQB 2A4GA 3UWIA 2G55A 2PW8H 3G01A 2Z3DA 2Y81A 2FWWA 1TPOA 4X8UH 2XC0A 5KEDA 2KCAA 1IQJA 2WPMS 2VIQA 5FAHA 2UWOA 3PM3A 1OWIA 3MOCA 6GCHF 1LVBA 1ANCA 3NWUA 1ZMJA 2JDID 1FI8A 1W7XH 2IJOB 2J2UA 3B8JA 3BTGE 4LXBH 2ZCKP 4OS5A 2VGCB 4I8JA 4YOGA 3RXKA 4ABFA 4CRAA 2G00A 3V3MA 1ARBA 1Z1IA 2FYQA 3QO6A 2SGDE 1ELTA 5GDSH 2R0KA 2VWLA 1AVWA 1V2PT 5CDFE 5T1VA 1OWKA 4RKOB 4NWKA 4D9RA 1A46H 1HAXB 1C1TA 1BB0B 3GISB 4WMDA 3CS0A 2TIOA 1SI5H 4X2WA 1GI3A 4NIYA 3GYLB 8ESTE 2CF9H 4JZDH 3EA7A 1QFKH 1P2KA 4RI0A 1THRH 3DCLA 3SJKA 1NZQH 5LH8A 1ELBA 1FPCH 2ESTE 1YPGH 2C8YB 4WXIA 5A0CA 4CR5A 1BRCE 2FP7B 4B71A 3FO8D 1IQLA 2BXTH 1O3HA 5TCAA 1VCWA 4Z0KA 2EI6A 1P3EA 4Y0YE 5DP3A 1ZLRA 1V2VT 1SGCA 1D6WA 2WYGA 2YMSB 1KDQA 1W3CA 3PWCA 1ZRBA 2ZHFH 2BYAX 2A32A 1TLDA 1GJCB 4GLYA 4BTUB 8GCHF 2R2MB 1GDUA 3VXFH 1G3DA 4BTTB 3RXEA 3Q76A 1T7CA 3PLKA 4ZMAH 5H4IB 5T3HA 1NESE 4ABBA 3A7WA 1UMAH 3BTME 2ZTXA 4Q63A 3CENA 3FOAA 2XC5A 4ZXXH 4AGJA 1SQTA 2AGEX 3KEEA 4WH6A 3D65E 2WV4A 3DT0H 1YLNA 2ZPRA 1C5YB 4YZUA 5EGMA 5A0BA 1TNLA 1HRTH 3M36A 1A5GH 3DSOA 1RFNA 1GI1A 5ESBA 4OS1A 3RXJA 2Y7ZA 4I32A 1GGDC 5EQRA 5FBIA 1QBNA 4D7FA 1YY3A 4J2YB 1O5CB 4ZKOU 3AK5A 1YPKH 1O32A 1NFUA 1P09A 1TQ7B 3OTPA 4NA7A 1BMAA 2WUBA 1GJDB 3T26A 2GMTB 3V13A 2BD3A 5DPAA 5J4QA 5FXLA 4XBBA 4WVPE 3OE7D 1KTSB 2D8WA 2FIRH 1QL9A 1HXEH 3KQ5A 5DP7A 3UNSA 1T8MA 3FKSD 1XVOA 3M7UA 1O2OA 2KFWA 4D8NA 4JYVH 2ZFPH 4BAQB 1QJ6B 1WQVH 2PKAA 2PUXB 1AWHB 4NZQA 4Y0ZE 3VXEH 2B8OH 3O8RA 3SJIA 1RJXB 2QCYA 1AE5A 4FUIA 1EZQA 3RMNH 3E90B 3DSGA 1LDTT 1K1NA 1C4Y2 4M7GA 3V0XA 1XKBC 1E37B 7KMEH 2BQWB 2EA3A 3DHKH 1E34B 5LGOA 3GDUA 1B7XB 1W0YH 1EQ9A 1YPEH 1GDNA 2FTLE 1VR1H 2LPRA 1L0ZA 3TGKE 3SYJA 1QTFA 1SGDE 3RXFA 4ZH8A 1TBRH 2KAIB 4OM9A 5F6MA 1KLIH 1ZHRA 5KECA 1BMFD 1EJMA 2ZIQH 1GHAG 1P9SA 1DITH 3P70B 5FPSA 1SOZA 4K1EA 3LKWA 3FAOA 4A7IB 2A1DB 2NU1E 4GHQA 1KIGH 2XBWA 4JYTA 3QN7A 1GBHA 1NRRH 3EAJA 4D9QA 2G8TA 1NBMD 1C5QA 1E38B 1LPGB 4LOYH 3S69A 1LMWB 1DSTA 2THFB 5SGAE 3GY2A 1T32A 5LPEA 3GDSA 1UK2A 5A09A 2ZHQH 1OSSA 1EJNA 4KTCA 1TMTH 4AN7A 2C4FH 2GZ8A 2P3UB 1W10U 1CBWB 1L4DA 2ZFRH 5EJ1A 3STJA 2ANKH 3RXSA 7GCHG 2Y5HA 7LPRA 3E91A 2KCYA 3P8NA 5T6DA 5AFZH 1O2QA 4FU9A 1O36A 1NC6A 3I29A 3BG4B 4O9VA 2VVUA 5ETXA 1ZTKA 1SGPE 4WWYA 4A92A 5EXMA 1FX0B 1ZRKA 4ABGA 1HAVB 1G2MA 1O3BA 2Z7FE 1JRSA 1C5PA 3RU4T 1QRWA 2FPZA 4Y8ZA 3RXUA 1KXEA 1NY22 3UY9A 2ZU1A 1AHTH 5TJXA 1K1OA 4GCHF 1O2KA 5HM2A 4NWLA 1C5XB 2KCOA 1MKWH 1P2MA 1EAIA 1BRBE 5PTPA 1CT4E 1UHBB 2BQ7B 2H9EH 2BDYA 1SHYA 2ZHWH 5EJLA 2FOFA 2VGCC 4AYYB 1QURH 3F68H 1FAKH 3PTNA 2OD3B 1L1NA 3A88A 2A4OA 3N7EA 1GVKB 1V2OT 3BIUH 1N6YA 3SI4H 3PROA 4UD9H 4IW4E 3SGQE 4BAOB 3MNCA 2OXSA 1VZQH 3A80A 2PP6A 1Z71A 1O39A 4KGAA 4O3UA 1HJAB 1AKSB 1A3EH 3HKJB 4DVAU 1AVGH 2GV6A 3RXRA 1YCPH 3SU4A 2BXUH 2BD5A 2F9PA 3ZVDA 2ZCHP 1G9IE 3MH4A 4K8YA 1K1MA 4FUDA 2G4TA 3MI4A 1PPCE 1C1OA 1ELFA 4MTBA 3M37A 3PTBA 2HVXA 5C94A 1Y3XA 3QZQA 3IG6B 1AGJA 1EAUA 1GBCA 1HB0B 2W7SA 2VINA 3ZZ9A 1LVYA 2W3KA 4Y76A 3P8GA 1EPTB 2FOHA 4ISHH 1A0HB 2F4LA 4ZAEA 2OC8A 3N7DA 5B6LA 4CBOA 4KP0A 2HLDD 3GY8A 3O8CA 2YMSC 2PKSB 4F4OC 1MZDA 1P02A 2XOKD 1LQEA 1HV7A 4DIHH 3F2FA 1YPJH 3M5OA 1PJPA 3ZZDA 1SGTA 1ZOMA 1THPB 1CGIE 1TONA 3S7KB 5F8XA 2ZGJA 2HGTH 2FEQH 1ZPBA 3ZVFA 3A87A 1EASA 3F3BA 4TY7A 1AUJA 3GCTG 2JJ2D 2Q1JA 2V6NA 3RXMA 4FXGH 1C1VH 2JH6D 3MYWA 1QJ7B 2B5TB 2A2QH 3ZV9A 1JBUH 1GBTA 3QDZB 2ZPSA 4NIVA 1TX6A 5F53A 2KAIA 3KN2A 5KGOA 1JXPA 3CS7A 4BNRA 2JH0D 4WMEA 4FU7A 4K69A 1ZTLA 4Q7XA 1K1JA 3U9AH 5B6OA 2I6SA 2XBXA 4WY3A 3LONA 3UTUH 2FS8A 1DWCH 2TRMA 1INCA 4Q7ZA 3SOSA 2R3YA 1S6HA 1VGCB 1GBIA 1OX1A 3HATH 5C3NA 3RXQA 1AQ7A 2GMTC 3UNQA 4MNYA 4TWWA 1SGYE 3MTYA 4X2YA 3F2HA 2BDHA 4R0IA 1SVPA 1P03A 1XUKA 2QAAA 3T2NA 4I8HA 2BMGB 3KQEA 3ZZ7A 1QQUA 3SU1A 2STBE 2WINI 2IN2A 2WUCA 3RU4D 4AZ2B 1DE7H 2QIQA 5HYOA 2BY9X 2R2WU 5EW2H 1NU7B 2CN0H 1S81A 4IMZA 4A1XA 1HCGA 1Z7KA 1ZZZA 3DFJA 3SUDA 2TPIZ 1O2YA 5JBBS 4D76A 4ZCNA 5ABWA 4NGAH 4SGBE 2EQNA 1P9UA 1HDTH 2OC0A 1ELGA 2ZPQA 4X2XA 3DFLA 2UUYA 1HJ8A 2OCVB 2DE8A 1TBZH 2AS9A 5FL7D 1HAVA 4X6OA 1DPOA 1TA2A 3GDVA 3ZZ5A 3PMAB 1PPFE 4FUHA 6GCHG 1QCPA 1FMGA 3Q3XA 1SQRA 1UTLM 1ANEA 1GBJA 1UHBA 1C5VA 1Z8JB 3DSPA 1NU9A 2ZNKH 3UAIC 1IQIA 1ELVA 1NFYA 2FM2A 4YT6H 3BF6H 1UTJA 1MCTA 4FU8A 3P8FA 1RD3B 1ZTJA 3OFND 1O5DH 3P6ZB 4UFEH 3PMJA 2HOBA 3SV8A 1G32B 2FESH 1WAYB 1B5GH 1A4WH 1V6DA 2RDEA 2XWAA 1L1GA 3A83A 4H4FA 3TITA 3SV9A 1EATA 2XNIA 4JK5A 2BY6X 1GI4A 5EU8A 4ZKRU 1YGCH 2J95A 2W26A 3EA9A 2LP6A 1F5KU 3SUGA 1Z1JA 1HLTH 2GGVB 1CBWC 2G5NA 3A7YA 3ZIAD 1TGCA 2EC9H 1HFDA 2BY5X 1C2JA 3M35A 1YWUA 3FVFB 1SHHB 3FP8E 3A84A 2V7QD 4BTIB 4OS6A 1HAPH 3GY5A 4AORA 1L1JA 4IBLH 1XM1A 1ZJDA 4BANB 1IQNA 1DWBH 3BG4C 2J9NA 3U1JB 3TJVA 4ISNA 2ZFSA 4DURA 1GI8B 4TWYA 2V3OH 3LGYA 4ABJA 8GCHG 2CF8H 3EYDA 3R3GB 1C5WB 4BXWA 2H6MA 1YC0A 1W2KH 2NU3E 4YOIA 1XMNB 1KXAA 3BEFB 3A8AA 1AFEH 2AIPA 1OKXA 5C20A 1Y3VA 4FETA 5E0GA 4TYDA 1FDPA 3TNSA 1Y3UA 2QXHA 4FUGA 3KQDA 1AY6H 3GY4A 2BDBA 1QB6A 1YLCA 2JH5D 2Z6BD 3ELAH 2HNTE 1XVMA 3HPTB 1P01A 3SJOA 3FZZA 2K0QA 3U8OH 4RT0A 2ODQA 2O8UA 1RS0A 3QTOH 2P93A 2GTBA 2FOEA 2GCHF 1GI0A 1HJAC 2H2ZA 1BOQA 1A0LA 2A7HA 1UTQA 3M3SA 1EP5A 1BUIA 3K2UA 2XBVA 3ZVEA 4DT7B 5HIYA 2BDGA 3RC6A 1EZSC 2BTCE 4K8BA 5C67A 4CRBA 1EB2A 3TK6A 1QZ8A 1BTWA 2D2DA 3EA8A 4GSOA 1O31A 1ZMNA 1O35A 1MU8B 4DG4A 1EPTC 1DVAH 3SUEA 5K7RA 1PQAA 4JK6A 1VJAU 3S9AA 2ZDAH 2VVVA 4RSPA 1ESTA 1HIAA 1GMCF 3M7QA 1MTUA 2PKSC 1VITH 1Z8GA 4RT1A 5FCRA 5A8XA 4Y7BA 1O3KA 2ILNA 2O9QA 1O3EA 4TY6A 3LPRA 4R8TB 2QGRA 1FY3A 4P02A 1BTXA 1ZPCA 2WPDD 3URCA 2H1UA 1BMLA 2QE7D 1MKWK 3SV7A 4DGJA 1PPBH 2ZFFH 3N99A 1TNIA 2EI7A 2H5DA 2XWBI 2F43B 4GVUA 1WTHD 3RXIA 1Y8TA 2P95A 1KY9A 1O3JA 1EX3A 1YKTA 1EJAA 2GKVE 4ZHLU 4CRGA 1X7AC 1O2NA 3TJOA 1GWAA 1ELAA 4GAWA 1LTOA 1SKYE 1ORFA 3RC4A 3KQBA 1WOFA 1V2KT 1HAIH 2QXIA 3UR6A 2OINA 4NA8A 5F8ZA 3KYFA 5C2ZA 1J17T 1SSXA 4NFFA 2F9VA 1VGCC 2YMSD 5AVDA 5GPIB 2CMYA 1K2I1 5I25A 1O2TA 3SNDA 1HNEE 2AHME 3AAUA 1OWDA 4X6PA 5E0HA 3W1EA 3RMOH 2TGAA 3JZ1B 3NXPA 5ESTE 2HWLB 1SGNE 2OQUA 5F8TA 2WPLS 3BTDE 4CHAB 1KXCA 2ZHDA 1ETRH 1AD8H 2ZGBH 1YLDA 3ITIA 4CH8B 3TJUA 5FX6A 5C1XA 4ZHAA 5EQSA 1C5OH 1RTLA 3BG8A 1C5ZB 2HNTC 4X6NA 1WCZA 2PGQB 2QF3A 2Y5FA 1TALA 3GCHB 4ABDA 3RMMH 4DCDA 1IQHA 5L6NH 1IQMA 2M2AA 5IK2D 1NRPH 2P8OC 3SW2B 3QGJA 1C5RA 2V3HH 3C1KA 3FFGA 5GJ4B 5LPFA 2PR3A 3M5NA 1K1IA 2FS9A 4GCHG 3URDA 1DX5M 3PLBA 4ABHA 1DOJA 5HKKD 1D3PB 4AB8A 2WSSD 5DSFA 4DIIH 4KTUA 1KXFA 3NRLA 3DUXH 4XBDA 1GJ8B 3Q3YA 1GMHF 3ATIA 1ZYOA 1C5NH 2VWNA 3PMHB 1OYQA 4YESB 2VWMA 1UTMA 2GP9B 3ZV8A 1XX9A 4AGKA 2PHBA 3Q3KA 2TGPZ 2J94A 4K1TA 3ZZ8A 1BTUA 3TGIE 1TQ0B 1DS2E 1F92A 1GJAB 2SNVA 2XYAA 1C2MA 3VGCB 1HAGE 4WJG2 3AAVA 1TABE 1EOJA 4OGYA 2K1QA 5DGJA 1CHOG 3BTQE 5C5OA 1MBMA 1TRNA 1XXDA 1H9IE 4CRFA 2DE9A 1GCTC 1NRQH 1GI2A 2AERH 4Q7YA 3SQEE 4B2BA 5EXNA 4JZEH 5JBTA 1D6RA 1B0FA 1TGSZ 3GS9A 1T31A 3PO1B 2ZU3A 2PWXA 1F0RA 3AW1A 1GHXH 1SPJA 1S85A 1RGQA 4UONA 1TNKA 3HK3B 2BDIA 3BIVH 4I8LA 1FPHH 2ZP0H 3MO6A 1A2CH 3PMBB 1HBTH 3ZVGA 3STIA 4A1VA 2IJD1 2ZQ2A 5DP6A 4MPVA 1DT2A 2KCPA 2PSXA 3RM0H 4ABIA 1PQ7A 2KR7A 3BTEE 1EFRD 5E2PA 4K5ZA 1P3CA 4LK4A 1ZGIA 3ODFA 3U8TH 1DY9A 3EE0B 3SGBE 5GIBA 1LCYA 2Z94A 3SU6A 1WU1A 2QN5T 3LGTA 3SHAH 2QA9E 1GJ6A 1Z6JH 9ESTA 3L6PA 3RXBA 3U69H 1TGTA 5JPMH 3A8CA 2W7UA 4QT8C 1BTZA 3C27B 1SGFA 1FN8A 2XC4A 3MU5A 5GCHF 3KL6A 1IQKA 4I8GA 1H4WA 4Y71A 1GVLA 4NZLA 2BOKA 1DFPA 3BTKE 2G81E 3LGWA 1F5RA 1O3NA 3TH3H 2ZU5A 5FCKA 2FX6A 4NIWA 2G4UA 4NG9H 2BLWA 2O8LA 4XD7D 4CR9A 1V3XA 4O97A 1K22H 4UFFH 1TPAE 1O34A 1C5MD 2LNCA 5EXLA 1OWEA 1C2DA 2ZWLH 1YPHE 1S82A 2ZFTA 2AGIX 1LPKB 1CHGA 4MVNA 4XBCA 1VKYA 1O3OA 3SNCA 1K21H 1G37A 5HGGA 2AEIH 1L2EA 1C5TA 1UW7A 5G4BA
chains in the Genus database with same CATH topology
2D1JA 1HAOH 3MO3A 4INLA 2Q6FA 4B2AA 2BVRH 4E06H 4UE7H 5JB8S 5CE1A 5DG6A 4AFZA 1IOEA 4WMFA 2GX4A 2ZF0H 3TGJE 1GBFA 4THNH 1Y3YA 1JMOH 1SOTA 3A85A 1FUJA 1N1LA 3RXVA 1OS8A 1EAXA 1F0SA 4B2CA 1GBLA 1GL0E 1TRYA 3KIDU 1PPGE 1W12U 1DXPA 3QZRA 1DWDH 3VB3A 1P8VC 1PQ8A 3TH2H 4ZROA 3NKKA 3ZZBA 2XW9A 1TMUH 2HNTF 2VIVA 4X6MA 4B73A 1CQQA 4HGCA 1C2IA 1P04A 4BOHA 3L3TA 1O2UA 2FLBH 2BY7X 3NCLA 1SMFE 3ATMA 1C5UA 1MAXA 3BEUA 4U32A 1QQ4A 1C5LH 5T6GA 2J92A 2SGAA 3AW0A 3S0NA 3QWCH 1A1RA 1FJSA 1TNHA 1A0JA 2Q6GA 2ZHEH 1NN6A 4DOQA 2A5KA 4ZUHA 3ODDA 4Z6AH 1PYTC 4DJZB 1QIXB 2PSYA 2Z9LA 1CHOF 3PYHA 3GYMA 1GBDA 1C1UH 1SGFG 1XUJA 4ISLA 4UFDH 1YM0A 1TRMA 2CV3A 2GDDA 2FODA 2HPPH 1NTPA 4A1TA 5LPRA 1GMDG 3F1SB 1BJVA 1YBWA 3UWJH 3E1XB 3EGKH 3HK6B 1T4VH 5A2MH 1EZXC 1B0EA 5DP9A 4CHAC 2XRCA 4J1YA 1RIWC 2A45B 1O2JA 1G3BA 1T8LA 1C1PA 3LC3A 4FUBA 5A8ZA 1MTVA 1ANBA 2C8ZB 2DUCA 1LPZB 1MQ6A 3SORA 2FMJA 2A4RA 2OBOA 2FZZA 3GCHC 1HAZB 3SV6A 1NS3A 5DKMA 1O2VA 3RLYH 2A7CA 1GJ4H 1V2RT 3D49H 2BLVA 1CU1A 2WPKS 5BRRE 2BOHB 3SJ9A 1SG8B 3BTTE 3S9BA 2QV1A 3K6ZA 4CRDA 1BTPA 1Y59T 2F83A 2ZTZA 1CVWH 4ZKSU 1W13U 4O3TA 1YPHC 4AFUA 3MU8A 4X2VA 1KXBA 3A81A 1H1BA 1S83A 4JMYA 1AVXA 3UOUA 1T8NA 3QTVH 5FPYA 1BIOA 1YCPM 1AUTC 1GHVH 3SU3A 6LPRA 3TVJB 3RC5A 1F5LA 1QHRB 1GBEA 3UFAA 1F0UA 1P0SH 1UTNA 3ZZ4A 2GCHG 3VGCC 1ETTH 3GY3A 1EAWA 4MG3A 3ATKA 1O2XA 4X1PU 3OY5U 4FUJA 1GHBF 2ZDVH 1J15A 2W5EA 3UR9A 2YNAA 4AOQA 1C2HA 4ZKNU 1GBMA 5I46H 2ANWA 2CJIA 4XFQA 2QXJA 3P8OA 1C4V2 1W7GH 1O2HA 3O8BA 1HIAB 3PO1C 2W3IA 1QRZA 3KGPA 1LVMA 3TJNA 3OSYA 2PFEA 1TYNA 1KXDA 3CP7A 2OQ5A 3V7TA 4MNVA 1ZR0A 2ZA5A 3VPKA 5TCCA 1TOMH 2ZDNA 3RLWH 3U8RH 1C2LA 4H6TA 1GMCG 3UQOA 2BD8A 2WPIS 2B7DH 4E7RG 3GCOA 1TPSA 2D26C 4XOJA 3GCNA 1TWXB 1LHDH 1J9CH 1DM4B 1XKAC 1KTTB 3RXAA 4DY7B 2ZKSA 5L2YH 1AIXH 1EKBB 3SQHE 2A7JA 5HMAA 1W8BH 2P8OB 3VB6A 1VITF 1BA8B 2PTNA 4JZFH 4NSVA 1SL3A 2WV5A 1GBAA 4X8TH 1CT2E 4XDEA 1GHWH 4GHTA 1HAYB 1GHZA 4KKDA 1C1WH 3F9GA 1V2TT 3RXTA 2UWPA 4UDWH 5C1YA 4BXSA 4MQAA 4U30A 2ZCLP 2QC2A 3MFJA 4CREA 4NCYA 4YTAA 2QF0A 1EXFA 1O38A 2BVSH 4U2WA 1F0TA 2BZAA 3N7OA 1HXFH 1ELDE 3MO9A 5T6FA 3EDXB 1BRAA 3HGPA 4INHA 1BTHH 4ABEA 2GCTB 4E7NA 1GMDF 4B76A 3TLOA 1G36A 3TNTA 1LVOA 1GCTB 1UK3A 2ZGCA 1WV7H 1ARCA 4OS2A 3W95A 2ZZUH 1CGHA 1V2MT 4PROA 1XUIA 2VIPA 4A6LA 4BAHB 3K6YA 3QGNB 1MD7A 1ABJH 1C9PA 1BDAA 1LHGH 2Z9JA 3ATLA 3PV4A 2GV7A 1O3FA 4JZIA 4GUXA 3SI3H 3VEQB 1LO6A 3A8BA 2H9HA 2FTMA 4UEHH 3T25A 1SB1H 4AB9A 1UVSH 1TAWA 1BBRH 2SGEE 3TPIZ 1BJUA 1MH0A 1NRSH 3MNSA 3GICB 3GOVB 3UNRA 4WF8A 3SZNA 3OX7U 2PV9B 2SNWA 1AO5A 1IQFA 3P92A 3F9FA 4MPXA 2QXGA 3SNEA 4GPGA 1BQYA 2ANYA 2V0BA 3OYPA 1S6FA 1SGEE 1O3LA 1AZZA 3LJOA 1K1LA 4JYUH 5EQQA 4BAMB 4XE4A 3RXHA 4K2YA 3A7TA 3K65B 2ZGHA 1KSNA 1H8DH 1GMHG 1YF4A 2M5TA 3VFEA 4I7YH 1AMHA 1GJBB 1QB9A 4U01A 4TPYA 4HZHA 1XUFA 2CHAB 3BTHE 1C1QA 1P06A 1BHXB 1UTOA 4Y7AA 1QGFA 2GT8A 1SLWB 4YLQH 5DP8A 2F3CE 1TGNA 1GBKA 3L33A 2BHGA 2O8TA 1GI9B 2ODYB 2XXLA 2F91A 1GG6B 1GVZA 5AHGH 2PGBB 1A3BH 5A0AE 3ZYEA 1CO7E 1NROH 3BV9B 2BD2A 1C2KA 2BLQA 4LZ4B 1RRKA 3F6UH 3LIWA 1TGBA 1YPMH 1Y5UT 2C8XB 1JWTA 2P3FH 1ZJKA 3MNXA 1UCYH 3FP6E 2GZ7A 1O3CA 1MD8A 3MNBA 4FVBA 2ZDMA 1WYKA 4O03A 1CA0C 4OS4A 3M3TA 4ESTE 1YYY1 1K28D 1PPEE 4LZ1H 1S0QA 1P2NA 1PYTD 1FQ3A 3UOPA 2AMDA 1JIRA 4K3JA 1QL8A 2R0LA 2ZU2A 1C9TA 1BZXE 1IHSH 2CGAA 4CH2B 4X8VH 1V2ST 1SGRE 1OYTH 3NZIA 5GCHG 1T8OA 1Y5BT 3V12A 1BBRE 2AGGX 3KNXA 1SC8U 3ZVBA 1YCPK 4YO9A 1C2EA 2GD4B 1QB1A 4X8SH 3VB7A 4AG1A 1TNGA 2QYIA 1QNJA 3MH7A 3E0PB 2BZ6H 3MHWU 1D3DB 3H7TA 3BN9A 3OY6U 4MPUA 1O2SA 1NM6A 2ALVA 2NU4E 1TIOA 1LQDB 3PWBA 4YLUA 3ZZAA 4ZHMU 1MUEB 5CHAC 1HAHH 2Y7XA 5C5NA 3DD2H 3HGNA 1QL7A 3NPSA 2ZO3H 4IMQA 1RIWB 2FOCA 4X1QU 1HGTH 1FXYA 1ETSH 1FY1A 1P2JA 1ZHMA 2PTCE 1C2FA 1NT1A 1SGIB 4I33A 1QBOA 6CHAB 4XSKU 3UREA 2VH6A 1BMMH 1LKBA 5DP4A 4X1NU 2R9PA 2Y6TA 4RKJB 5J4SA 1Z8IB 3O8DA 1FY4A 2EEKA 1S5SA 1TBQH 3FP7E 2OTVA 4WH8A 2F9UA 4AX9H 1W14U 1TA6A 2BD4A 1UVUH 2AMQA 1XUHA 3SV2H 1GJ5H 1MKXH 1ZSJA 1OP8A 2G51A 4FUEA 3S9CA 1DSUA 1UCYE 3SUFA 4Q2KA 1KYNA 3A8DA 1C1SA 1J14A 1Y5AT 3LDXH 2AIQA 2G5VA 1XUGA 3AASA 1C1RA 4MDSA 1ZHPA 4AYVB 2BDAA 1P2OA 3NK8A 1D3QB 1WTGH 2QY0B 4Y6DA 1O0DH 1OOKB 1QA7A 3I77A 4X1SU 1M9UA 2JKHA 2GCTC 2Z3CA 1O2PA 2VB0A 1AI8H 2VU8E 3D23A 2OLGA 1D9IA 1TE0A 5DK1A 3S7HB 1HYLA 5FPTA 2VH0A 2A5AA 1ZGVA 1GBBA 2P94A 3SGAE 3UUZA 1O3GA 2A31A 4Y11E 2B0FA 1OXGA 4I8KA 1C2GA 4CBNA 5A8YA 3TH4H 1HPGA 1O30A 3B9FH 3I78A 1QBVH 5DP5A 2ZU4A 1FNIA 2FOBA 2HPQH 4AG2A 2B9LA 3ZYDA 1AB9B 2FXRA 3LH3A 4Y8XA 3RXDA 1Q31A 2GT7A 2BX4A 5CMXH 4KTSA 1Q3XA 3DA9B 1ZMLA 3MU4A 1GI5A 3E0NB 5GWZA 1F7ZA 2ASUB 3P17H 2PUQH 1SLVB 2I6QA 2BM2A 2G52A 3VB5A 4MLFB 1IAUA 1O5BB 2BQ6B 3PB1E 1TB6H 2O8WA 1CT0E 1BCUH 4VGCB 1FIWA 1D4PB 2C90B 3OTJE 2TBSA 2FX4A 2GZ9A 4IC6A 4E05H 3MH5A 1NPMA 1H8IH 1W0ZU 1A7SA 2F9OA 3KCGH 4B75A 2CHAC 1O37A 1E0FD 1H9LB 1YPLH 3GY6A 1UVTH 3RXLA 1Z6EA 2C93B 3A7XA 1LKAA 1GHBG 3LJJA 3QLPH 2IOTA 4F49A 4X0WU 2J34A 2A0QB 3QX5H 1GG6C 2A4QA 4ABAA 5AF9H 1WUNH 1SLXB 1PQ5A 3A82A 3FZDA 2CXVA 3F9EA 1P12E 3A89A 3RXOA 1HUTH 3RXCA 1O2WA 1SGQE 5EW1H 2VWOA 3Q77A 3ESTA 2NU2E 1V2LT 3T27A 1GJ9B 5EPYA 4IN1A 1O5GH 2ZQ1A 3VB4A 1ESAA 1TX8A 2BD9A 1AE8H 5DO4H 1FN6A 3IWMA 2PLXA 3MU0A 1V2UT 3JZ2B 5F03A 1DUAA 1GCDA 1NFXA 1BBRK 3M3VA 1F2SE 1OPHB 2P16A 2J38A 3BTWE 1IQEA 1UK4A 1GI6A 1JOUB 3LT3A 1VCPA 1S84A 2BD7A 1G2LA 3UPEA 2GVFA 3LU9B 1A5IA 1VITG 2F9NA 1GDQA 3MH6A 4YOJA 2Z9IA 2F9BH 3BEIB 1A61H 2OP9A 2FDAA 2TGDA 2VJ1A 1O3MA 1AFQB 4B1TA 4IN2A 2ZTYA 3M5LA 1C1MA 1QJ1B 3E16B 4FUFA 5AFYH 3RDZA 3TK5A 2WPHS 3LH1A 3ZZ6A 3P95A 4WXVA 2UUJB 3RUOA 1OP2A 1TMBH 1N8OB 2BDCA 2ZG0H 4Q80A 1MCVA 1JIMA 3T5FH 3T29A 2J4IA 3LC5A 2BY8X 2UUFB 2SGFE 5C1UA 5JDUB 1Q2WA 3TU7H 1SR5C 2Y82A 1EUFA 1W11U 3RXGA 3B23B 1MBQA 1NO9H 2ALPA 2ZDKA 2FLRH 1TX7A 5EODA 2JETB 1CSOE 3M7TA 3IITA 1BMNH 3A7ZA 1BRUP 1ZPZA 1O2MA 1K1PA 2P3TB 3SN8A 1S0RA 3UQVA 1UCYK 1FY5A 1FZZA 3Q00A 1LHEH 5EOKA 1UVPA 6CHAC 4CRCA 2OUAA 2V35A 1O3IA 2VIOA 3E6PH 2RA3A 1SFQB 1ANDA 1G3CA 1LHFH 1CA0B 2C8WB 1MTNB 2H9TH 2XCNA 1RTKA 1TNJA 1O5EH 3D62A 1P05A 3LGUA 3R0FA 1O3DA 2WPJS 1ID5H 1UTPA 4ASHA 5E2OA 1HJ9A 2A5IA 5HM9A 1OWHA 2FOAA 1V2JT 2BB4A 3E3TA 1QA0A 2Z9GA 1SQOA 2RCEA 5JB9S 1UVOA 5FBEA 1SBWA 3A86A 5EPNA 5FHTA 9LPRA 1AN1E 3K9XB 1FIZA 1MZAA 4YT7H 4OS7A 4AFQA 1P2QA 2H5CA 3RM2H 1GL1A 1O5AB 1P57B 1EB1H 2ZGXH 2SGPE 1GHAF 1TFXA 5BPEA 1MMJN 8LPRA 4ISIH 2XCFA 4MPWA 5EG4A 1A5HA 1P11E 2ANMH 5DJ7A 1ZSKA 1UTKA 2GDEH 3MMGA 3T28A 2C3SA 1V2NT 3E8LA 2RG3A 4BAKB 2ZEBA 1GPZA 1JRTA 4K60A 2ZFQH 5CHAB 4MNXA 1WSSH 1BHXF 1J8AA 1Z8RA 2SFAA 3LOXA 2OC7A 1DUEA 2YOLA 3MWIU 4H6SB 2HLCA 1P2IA 1AB9C 2UUKB 2AH4X 2YNBA 4DW2U 3QK1A 4INKA 1G30B 4HI3A 2ZI2H 3H7OA 4AFSA 4IS5A 2NU0E 4D7GA 7GCHF 1MKXK 1TPPA 1PPZA 4IC5A 4JZ1A 1V2WT 1RXPA 3TK9A 3QUMP 1EZUC 1O2IA 5IYTA 2OC1A 5E8EH 1IQGA 4VGCC 3AVZA 2ODPA 1AU8A 1SLUB 3GY7A 4NFEA 1FLEE 1AZ8A 2BVXH 3BSQA 4H42U 4IGDA 4KELA 1O2ZA 1DDJA 3ENSB 1N6XA 1UJ1A 2P59A 2Y5GA 2VIWA 5E0JA 1QY6A 1GHYH 2IPHA 4I31A 3KF2A 1OP0A 3MU1A 2UWLA 1NRNH 1NFWA 3T62A 1FV9A 3LGIA 2FO9A 4MNWA 1YP9A 4NSYA 1FONA 1KLTA 1XXFA 1ELCA 3SJ8A 3KQCA 3A7VA 8KME2 3KHVA 4K1SA 2VVCA 1DANH 2OBQA 5L30H 2ULLA 4Y79A 5JBAS 2Z3EA 1G3EA 3ZVAA 1WQSA 1EP6A 1GGDB 1T4UH 1BT7A 1AKSA 1VJ9U 2BLOA 5JBCS 1RTFB 1O3PB 1O2LA 3SHCH 3SNBA 3FANA 1QRXA 1UO6A 2AMPA 1EOLA 2VNTA 1DLKB 1PPHE 1FY8E 1SFIA 1KLJH 2AYWA 2TGTA 1DLEA 1LHCH 1WBGB 4HFPB 1EPTA 4X1RU 1KDQB 3RXPA 4Y8YA 3SNAA 1OWJA 5K0HA 1C5SA 1MTSA 2R3UA 1DICA 1CGJE 2STAE 4B74A 1MQ5A 4ZXYH 1AFQC 1O5FH 2XBYA 1ABIH 5FX5A 4UFGH 4NA9H 1O2RA 1E36B 4A5TS 2O8MA 1MAYA 3SU5A 2Q6DA 1TOCB 2FYRA 3GCTF 1MTWA 1N8OC 3UIRA 1DWEH 2ZDLA 1L4ZA 3EQ0H 1THSH 3SO3A 3ATWA 1ACBE 1GI7B 1H9HE 1U6QA 1FAXA 1GJ7B 2WYJA 1AWFH 4ISOA 2Z9KA 4NIXA 3OU0A 2Y80A 2RDLA 2FOGA 4OGXA 1IHTH 2ZECA 2FI4E 7ESTE 4FVDA 1DXWA 3U1IB 3ZVCA 1C4U2 2JETC 4YM9A 1K9OE 1J16A 3ZZ3A 1V2QT 1ZSLA 1BTYA 5JYIA