2VU8E

Crystal structure of an insect inhibitor with a fungal trypsin
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
224
structure length
224
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Structure of Locusta Migratoria Protease Inhibitor 3 (Lmpi-3) in Complex with Fusarium Oxysporum Trypsin.
pubmed doi rcsb
source organism Fusarium oxysporum
molecule tags Hydrolase/inhibitor
total genus 55
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2008-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vu8E02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2vu8E01
1LTOA 2AIQA 3A8DA 2G55A 5C2ZA 1LVOA 5EOKA 1XMNB 2O8TA 1XVOA 1A0HB 2C4FH 1RGQA 4KTUA 2FYRA 1M9UA 4INLA 4Y7BA 5A0AE 4Y8YA 1GBBA 3SOSA 1P2JA 1O3LA 4NFEA 1BTHH 3ATKA 4TPIZ 2WPJS 3T62A 1T31A 1B0FA 3F9EA 2C3SA 1S0QA 1QFKH 3QN7A 4KP0A 1YPKH 1TE0A 3M3SA 3ATWA 5LH8A 3ZZ3A 2ZGXH 3T28A 3U69H 1ELDE 1DLKB 1WOFA 3GYLB 1Y3YA 4K5ZA 4BTUB 3SNDA 3FZDA 3TH3H 1QL7A 1O2VA 1AFEH 1SQAA 2K1QA 2GMTB 3S9BA 1HCGA 2W7UA 5A2MH 3OY6U 4ABDA 2JETB 1B5GH 1F0RA 4YESB 1KTSB 1HAOH 5E0HA 3SI3H 5JDUB 1P2NA 2Z6BD 1QNJA 3UWJH 1LDTT 1NRPH 2OINA 3SJIA 4Q80A 1DSTA 3RM2H 2PKSB 1PPEE 3NK8A 4YLQH 1C9TA 1NO9H 3PM3A 1LQDB 1BBRH 1P57B 4DY7B 4FVDA 1EQ9A 3NCLA 4FUJA 1F5LA 2QXIA 4IC6A 3RU4E 2KAIB 1CQQA 1TGSZ 4TYDA 1MKXK 2F9NA 1GCTB 5JB9S 1GHBF 1RD3B 1TNKA 1DS2E 3ZVCA 3FFGA 3A8CA 2DUCA 1ANBA 4CH8B 7LPRA 2J95A 5A0CA 1GI5A 1OWDA 1FMGA 2Y6TA 2BDYA 4I32A 3U8RH 1O0DH 1UVSH 3RC5A 1NN6A 3TVJB 3EGKH 5DKMA 4MNXA 1UHBA 2FXRA 1ELAA 2OUAA 1MBMA 2CHAB 3BTKE 1A61H 1GI0A 3QGJA 1DUAA 2DE8A 4WMFA 3V7TA 1GHZA 2LNCA 3TK5A 3KNXA 3QTVH 1HAYB 3GCHC 1DE7H 3BTDE 1O3IA 2AIPA 4XOJA 1V2UT 3ZVFA 1ARCA 3E1XB 1HRTH 3MH7A 5GDSH 1Y5UT 1GMCF 3ZVBA 4HTCH 4MTBA 1SFQB 4INHA 1RTFB 1S83A 3BEIB 1VITF 1FY4A 3RXFA 1XUGA 2HPQH 1EXFA 3MH4A 1TAWA 1D3QB 1FV9A 2WYGA 4XFQA 3AW1A 4K8BA 3FP6E 3P8GA 3LH1A 1Z1JA 4YT7H 4KGAA 4MQAA 2EI8A 1XXFA 3MNCA 3STJA 1KDQA 1NPMA 1O3AA 2FLRH 3E6PH 3ZVAA 5GJ4B 5HGGA 1OYTH 1O3EA 2FWWA 3FZZA 1FLEE 2FOBA 4ZKNU 3FAOA 1EZQA 2J9NA 2Z9KA 1C5XB 4HI3A 1CGHA 3RXJA 1C2FA 1K1MA 1ZMLA 4ISIH 1O3FA 2A31A 3QTOH 3LONA 1OX1A 3LC3A 4CBNA 1XKBC 1P0SH 1N6XA 3ATMA 4O3UA 2ZI2H 2ZIQH 3S9AA 3GDUA 3GY6A 1LHEH 1GJAB 1N6YA 1YP9A 2W3IA 2FOGA 1SGNE 1C2DA 4O97A 1FONA 4RKOB 4LZ1H 4RSPA 2VVVA 3EE0B 5T6FA 2EI6A 3UQVA 4X2YA 4M7GA 1H1BA 4D8NA 3RLYH 1NY22 1P11E 3EQ0H 3K2UA 1KSNA 1THPB 3MH6A 4CBOA 2PKAB 3SUGA 5AF9H 1QY6A 2XYAA 1ZTJA 2GKVE 2A45B 2J34A 3CS7A 4WVPE 1O2TA 1K1NA 1W13U 5HMAA 4DGJA 2BXUH 1MKWH 4XBDA 2QF3A 3A8AA 5CHAB 4ZKOU 4OS7A 3IG6B 1DT2A 1MZDA 1O2PA 1TPSA 3K6ZA 5CE1A 1EZXC 2Z94A 1O2IA 1EP6A 4H4FA 1G2LA 4WXIA 4MVNA 1MZAA 1GHBG 1ESBA 2GD4B 1P2IA 3PB1E 2NU4E 5BPEA 2QXJA 1C2IA 1ELTA 1UK4A 2ZGBH 3MNXA 1FIWA 1DICA 2BY9X 7KMEH 1P2MA 2ZU4A 3CP7A 1C5LH 2R2MB 1GI1A 1KXEA 1YCPH 5LPFA 1AMHA 1XUKA 2QCYA 3MHWU 1EAWA 1P06A 2C90B 2XW9A 1X7AC 5DP9A 1C1UH 2C8WB 3S7HB 1P03A 4DJZB 1K1LA 2EEKA 4F4OC 1AD8H 1DOJA 1JRSA 2Y81A 1GJ4H 3SJOA 4MPVA 5FPTA 2VGCC 1MD8A 2BHGA 2GCTB 1ETTH 1G9IE 1AZ8A 1GMCG 1ZHPA 1O39A 1O3PB 5DPAA 1EATA 1GI9B 1MQ5A 1O2WA 5DK1A 6LPRA 5H4IB 1P2OA 2BY5X 1KXCA 4FUGA 1VITG 3VGCC 3VFEA 5JPMH 1UVUH 1TMUH 4ISNA 1K1OA 4X1NU 2XC0A 2XBYA 1ANEA 2ZHFH 1S6FA 4Y7AA 1AO5A 2OCVB 1Z1IA 3SU2A 3M3VA 3SU1A 2O9QA 5DJ7A 3V3MA 1GVKB 1KTTB 1C2GA 1GL0E 2G51A 3M36A 2TRMA 2FMJA 1ZLRA 1FIZA 2R2WU 1GBCA 1QR3E 4WMDA 1GMDF 1K1IA 1GVZA 4HZHA 1H9IE 2BQ6B 1AFQB 4AB8A 2H5DA 4UE7H 1ABIH 3SNAA 1ELCA 4AFQA 2BDBA 2WINI 1A3BH 2QV1A 4NG9H 2ZKSA 3RLWH 4NWKA 4U01A 2XNIA 1GHXH 4FUCA 1MTNB 1ABJH 4JYUH 1EJMA 4ZHMU 1GI2A 4UFEH 4WH8A 2BD3A 1ZSJA 4TPYA 3UOUA 2BD4A 2AYWA 1PPZA 4FU9A 4E06H 1YGCH 2ZTZA 2W5EA 1ZOMA 1F0UA 3A7ZA 4X1PU 1E38B 2FI3E 4OS4A 3DFJA 4K1TA 1QCPA 4JYTA 1O5EH 1C4V2 4DT7B 1C5NH 1WAYB 3U8OH 3NUMA 1S82A 3AAUA 3RMMH 1TBRH 1BTWA 1FN6A 2BD8A 1HAZB 2BYAX 1CGIE 2A0QB 2Z9IA 1PPGE 4Z6AH 1CA0C 1PYTD 1QTFA 3RXUA 1UTKA 4Y6DA 1HAPH 1BITA 1F0TA 1THRH 1H9HE 3RC6A 1WTHD 4YOGA 1IQKA 4I8GA 1YM0A 4GLYA 2ZQ1A 2PLXA 1DSUA 8KME2 3QDZB 5C5NA 2OC1A 1DWCH 1V2PT 3TPIZ 1HAVB 4DG4A 3D23A 1O2RA 2AERH 2C8ZB 1ZPCA 2OC8A 3ZZ5A 1F2SE 1QJ7B 3T27A 1AZZA 1FJSA 4CRBA 4AFZA 3UIRA 2V3OH 1BTUA 1JIMA 5CMXH 1GGDB 2PUQH 5E0GA 3BG4C 1AE5A 3I78A 3RXSA 3W94A 1O3NA 5F8ZA 3SV8A 3P8FA 5AFYH 2V0BA 4FUDA 2BLQA 2F9VA 1NFYA 1VR1H 3UREA 4UFGH 5LGOA 4BNRA 5AVDA 2ZTYA 3DUXH 3KEEA 3KGPA 1KY9A 1SGEE 1C2LA 1D3PB 2QAAA 3SV9A 4NGAH 1UCYH 4BXSA 3A7YA 1AI8H 3E16B 1YPHE 4A1VA 4B1TA 1ELVA 2VIVA 1FXYA 1AIXH 3B8JA 5JBAS 5L6NH 3S7KB 2GDDA 1G3EA 4I31A 1TPPA 5TCAA 1TRYA 2ANWA 2R9PA 4YOJA 1TB6H 3TK9A 1IAUA 1C2HA 1LVMA 1P02A 4BTTB 2GGVB 1DDJA 2BZ6H 2ZHDA 4DIHH 4Q7ZA 1DXWA 1IQGA 3MNBA 3ZVGA 2AMQA 1HPGA 5BRRE 1NFWA 4RN6A 4X8UH 1ZSLA 1BMMH 4AB9A 3VB3A 2Z3CA 1XUHA 3BTWE 3U1IB 1LHDH 2XC4A 3ZVEA 1K1JA 2ODQA 2GZ9A 1TPAE 1TONA 3M7UA 2ZGHA 3P8OA 1ANDA 1ZRBA 2ZHQH 3ZZ8A 2G5VA 5AHGH 3ZZBA 2R3YA 4WXVA 1E0FD 2QC2A 3A7XA 2FYQA 4DIIH 1SL3A 1T4UH 1GBJA 2PUXB 3S9CA 2FP7B 4BAOB 1S85A 3A8BA 1Y59T 5EPYA 3RXAA 2ZCLP 3GOVB 5T6GA 3VB6A 1V2OT 2GZ7A 2PTCE 3E8LA 1P10A 1L4ZA 5F6MA 3EAJA 3G01A 1SR5C 1A46H 1DPOA 1G3DA 2BTCE 4CRAA 1TMTH 1O5DH 1TRNA 1BRBE 3OX7U 2BDAA 1BMNH 3GYMA 1YPHC 3MFJA 4MPUA 4NIWA 3GY4A 1OS8A 2SGEE 1SMFE 5J4SA 3RXLA 1HIAA 2VU8E 4THNH 1TOMH 1ZTLA 7ESTE 1CVWH 1GJ6A 1HXEH 2UUYA 1TGBA 1OSSA 1O2YA 4IBLH 3U9AH 3NWUA 3K9XB 1GVLA 4I8KA 4CREA 3NPSA 1WSSH 1UTMA 1LO6A 4H6TA 4TWWA 4A92A 1T8OA 3SN8A 3SI4H 2PGQB 2FO9A 3HKJB 1Y5BT 3IWMA 1QA7A 5HM2A 3UFAA 1GCDA 1P01A 4Y79A 4Y10E 4DCDA 1L1GA 3URDA 9ESTA 1UVPA 2FTLE 1WQVH 2EC9H 4X2XA 5DP8A 2P8OB 3RXOA 1BTXA 4YO9A 1EAIA 4CRGA 3A80A 3LGTA 1V3XA 1UTOA 1GHWH 1O3CA 3LC5A 3P70B 2ZGCA 1GJ7B 3W95A 1YPMH 1SBWA 1AY6H 1QBOA 1ZPBA 5J4QA 1QJ6B 1ACBE 1O3KA 2ZP0H 3C27B 3IITA 3PO1C 5A8YA 3ZVDA 5C20A 1O33A 2SFAA 1TGTA 3SHCH 3LPRA 3ZZ6A 1C5PA 4ZMAH 1RXPA 2SGDE 1O5FH 2VIDA 2HNTF 3E0PB 4B2CA 2D26C 1SHYA 1BHXF 1BMLA 1CU1A 3T5FH 3JZ2B 1EOLA 4ZXYH 3A88A 3UTUH 1HAHH 2Y7ZA 2GMTC 3KQBA 4X2VA 1CE5A 1IQEA 1MD7A 5DG6A 1BJUA 2H9TH 1P2KA 3BV9B 2JETC 1J17T 3FP8E 3PLBA 1Y3XA 1MTUA 1SGFG 4AYYB 2CGAA 3ENSB 4B2BA 4IMZA 1EZSC 2RA3A 1SQOA 1NC6A 2TGDA 3ZYDA 2A4QA 3RXMA 1WBGB 1CO7E 4X0WU 4ESTE 1G37A 2OTVA 1PPCE 1GBDA 3LGIA 3SV6A 3VB7A 2BDGA 3U1JB 2PKAA 2PKSC 1YYY1 4OS2A 1GI6A 4YOIA 3GCTF 1W14U 1P05A 3GISB 2ZPSA 2M5TA 4WF8A 4JZIA 1AE8H 4ISHH 2H9EH 2AMDA 1GBEA 1GG6B 2Z9JA 1L4DA 5GWZA 1XXDA 5FBEA 5ESTE 2XTTB 3A84A 1NRRH 3GDVA 4UONA 1SQTA 2OQUA 1H8DH 4AORA 3F6UH 2FESH 4I7YH 1O34A 2ZO3H 5EXMA 2F9PA 1EP5A 4UFDH 1O2KA 1KXFA 1UTPA 4DW2U 3SQEE 3TGJE 3A89A 2HNTE 1GBHA 4BXWA 1BB0B 1FPCH 4SGAE 4XE4A 5EG4A 1A7SA 4XBBA 3SQHE 3GDSA 1VJ9U 3M5LA 2XXLA 4JK5A 4RKJB 1TPOA 1O38A 1JBUH 3OTJE 1TNHA 5I46H 3CS0A 4B2AA 2ZPRA 5HYOA 2HOBA 2HVXA 1K1PA 2EA3A 3TGKE 4Q7YA 1TX7A 3KIDU 1C1MA 2R3UA 1HNEE 1E37B 3Q76A 1TABE 3P92A 1OWIA 2WPKS 2BVRH 1FZZA 2BD5A 3R3GB 2ALPA 2FLBH 1G30B 1P9SA 1JWTA 2HLCA 5EPNA 4Y76A 4LOYH 1O2HA 5B6OA 3QO6A 1HYLA 2ZFPH 2ZA5A 1TMBH 3LGUA 1FPHH 2Y5HA 2A4GA 3L3TA 3RXRA 4UDWH 2FS9A 4F49A 3OSYA 1C5TA 1O2LA 8GCHG 3BG8A 5GPIB 1SLVB 2ZU1A 2Q6FA 1HAIH 5K7RA 3PLKA 2Q6GA 1CSOE 1O5AB 1E34B 3E90B 2SGFE 1KXDA 4JYVH 1VGCB 3RXGA 3UNSA 1MTWA 4QT8C 1QB1A 1NFUA 3LGYA 1P3CA 2WPMS 4E7NA 4GUXA 2O8MA 1GI3A 4O03A 4FUBA 1IHTH 1DITH 8LPRA 3LDXH 1BJVA 2G8TA 1FY3A 4XDEA 1DUEA 2HNTC 4NIXA 2BLVA 1TGNA 5ETXA 1P04A 2JH6D 3PYHA 3SU0A 1AVXA 5DP3A 4BAHB 2H2ZA 1CBWB 3SHAH 2H1UA 3CENA 3HK3B 3PWBA 1RTKA 1O2NA 1K28D 1BOQA 3EDXB 2FODA 1RTLA 1ELBA 2I6SA 1UVTH 4E7RG 3SW2B 2CN0H 1AQ7A 2Y82A 5EGMA 3EA7A 4U30A 4A7IB 5EW2H 3A81A 4JZ1A 3OY5U 3GCTG 5CHAC 3H7OA 2ULLA 3DT0H 4AFSA 1V2JT 1NZQH 2FOHA 4AYVB 3TJVA 3SJ9A 2ZZUH 4ZAEA 3VXEH 1VCQA 1TBZH 4NCYA 2VWOA 1HAGE 1AKSA 3PMAB 4DOQA 5C1XA 2TBSA 2W3KA 3HK6B 3MOCA 2VVUA 2SGQE 3SJ8A 1ORFA 5ABWA 1P9UA 1SGYE 1TIOA 2JKHA 1LCYA 2VIPA 1V6DA 3AAVA 1XUIA 2Z9GA 4Z0KA 3UR6A 3PTNA 4ISOA 3HGPA 2ANYA 1C9PA 1WCZA 1S6HA 2A32A 2FEQH 1PFXC 2GT8A 5SGAE 4CH2B 1ZGIA 1DM4B 1LVBA 3E0NB 4MNYA 1P09A 3ZYEA 2QIQA 4X1RU 3SUEA 2ZHEH 4I8LA 1NRNH 5PTPA 2BX4A 1YLDA 4NWLA 2NWNA 2OLGA 2GCTC 3P6ZB 4X1QU 3OYPA 1O2XA 3VB4A 5JBCS 1EAUA 3SV7A 4Y71A 3R0FA 1MKWK 3VEQB 4D76A 1V2TT 2UWPA 1YPGH 4U2WA 1JIRA 2BB4A 3DHKH 1V2LT 3ATIA 3ZZ9A 3ODDA 5IYTA 1TA6A 2QY0B 5AFZH 3PV4A 2XCNA 5A8XA 3H7TA 1A0LA 4Y8ZA 1DLEA 2GDEH 2XWBI 3GY5A 2SGAA 3RU4D 2BDCA 1J16A 2C93B 1ZJDA 1TLDA 1TX8A 3RM0H 2PFEA 4IS5A 4KTSA 3DD2H 1ID5H 2V3HH 4OGXA 2TGTA 1W7XH 5JBBS 1YCPK 2P94A 1SFIA 2VGCB 1G3BA 1AFQC 1DWEH 3RXEA 5F8TA 3F9GA 1QB6A 3SGAE 3UOPA 3SGQE 3GY3A 4FXGH 1DXPA 1QQUA 4YTAA 3VGCB 1ZRKA 1YC0A 2BDIA 1YCPM 5DP6A 3SJKA 2NU1E 2IPHA 1LHCH 2BY6X 2ZECA 1MMJN 2ZDVH 4LK4A 4HGCA 3MH5A 1HJAB 2ZDMA 3I29A 1AHTH 3SU5A 3SV2H 2J92A 2ZG0H 5C1YA 1QRWA 3HGNA 2AH4X 3A7WA 4UD9H 2ASUB 2AGIX 3KQCA 4H42U 5L2YH 1BTZA 1EPTB 1GL1A 5DGJA 2P93A 1ESTA 2BZAA 2XBWA 2VH6A 2ZQ2A 3ZV8A 1P12E 3MU0A 4K8YA 3LIWA 3BTEE 1TOCB 1EUFA 3M3TA 1WU1A 3F9FA 5TJXA 2ZU5A 4D7FA 2JH5D 3GY7A 1AVWA 1FY5A 1BIOA 1S5SA 5E2PA 1ELFA 1L1JA 1C5OH 1O5GH 1FN8A 1SPJA 3BEUA 5FX5A 2D8WA 1C1OA 4WMEA 1IQLA 2B5TB 1BBRE 5EXNA 1NM6A 6CHAC 2PW8H 1OOKB 3LT3A 2FX4A 4CHAB 2BOHB 4UEHH 1Y5AT 2ZFQH 3MU1A 2WPLS 4AG2A 1GGDC 3UPEA 1DANH 2O8UA 2FM2A 1LMWB 4J1YA 2W26A 1K22H 3BTFE 2NU3E 1XUJA 2V35A 2XBVA 1GWAA 1LQEA 1QL8A 1SGDE 4NFFA 1C4U2 4FU8A 1F5KU 2FDAA 2B7DH 2WV5A 2HRVA 3RP2A 3RXTA 4CRCA 1BTYA 1GDUA 3M5MA 5FHTA 4FVBA 4TY6A 4X8VH 1PQAA 3ESTA 3K6YA 3QK1A 1QJ1B 2AGEX 3ELAH 3NKKA 2FOCA 5C3NA 1J8AA 1MTSA 1HGTH 1HB0B 2ODYB 1UTLM 1AVGH 1A4WH 3U98H 1QHRB 1T4VH 1ZHMA 1FY1A 1C5ZB 2GCHF 1HUTH 5EU8A 4IW4E 1TGCA 1OWKA 1BRAA 2Y5GA 2VINA 4AX9H 4Q7XA 1D3DB 2NU0E 4VGCB 5FX6A 2CV3A 1H9LB 3UNRA 3SBKA 2WYJA 3PMBB 3D49H 2BMGB 3M37A 1YPEH 4GHQA 4BOHA 1EB1H 4CRDA 4UFFH 1P8VC 1N8OB 3RMLH 4X6NA 4HFPB 2F9UA 2C8XB 5DO4H 2PR3A 4XSKU 2A1DB 2FZZA 2YNBA 1JRTA 1W8BH 1PQ7A 1UO6A 2ZHWH 1C1TA 2ZGJA 1BT7A 5FCRA 2PV9B 4IMQA 1MAXA 2DE9A 1V2ST 2VNTA 1HV7A 1B0EA 2F9OA 1QA0A 1GHYH 2HPPH 1GBTA 1AB9B 5HM9A 1RIWB 4IN2A 1UCYK 2LPRA 1S84A 4ABBA 3RDZA 1HJ9A 4K1EA 3A86A 3EA8A 1VITH 1O2QA 2STAE 5FPSA 2VJ1A 4NSVA 3LGVA 3S0NA 3FVFB 5EQSA 2KAIA 3L6PA 3E3TA 3QZQA 1C2EA 3DFLA 5EQRA 1GHAF 3RXVA 1TQ7B 2B9LA 1PJPA 1QURH 1MH0A 3MNSA 1PQ5A 4J2YB 1J9CH 2WPHS 3Q3KA 2UUJB 4LXBH 2IOTA 1AWHB 1IQJA 2F3CE 2HGTH 4IC5A 1E35B 1GJBB 3T2NA 4O3TA 3PLPA 3HPTB 3SZNA 3O8CA 2PHBA 1SGCA 5E8EH 1RS0A 1PQ8A 1JOUB 2OXSA 2BVXH 4A1XA 5K0HA 2CJIA 1C5VA 1J14A 1D6WA 1KLIH 5IDKA 1Y3WA 3MU8A 4WWYA 2OBOA 3NXPA 1ZMJA 4OS5A 2OC7A 2WUBA 2ZNKH 1AUJA 1A5GH 2AMPA 4ISLA 4X6PA 1GDQA 3KN2A 1Z8RA 2ESTE 1PPFE 3QZRA 3BIUH 4GSOA 4K1SA 2P95A 2VWNA 4YM9A 4AGJA 1OWJA 3RC4A 2IJOB 2ZFSA 2HWLB 1BTPA 1EB2A 1O3HA 2G52A 2C8YB 3Q3YA 3UNQA 2JH0D 2P8OC 1Y8TA 2EI7A 6ESTA 1O37A 1BMAA 4GHTA 1YPJH 1CT4E 4R8TB 4FUIA 2GZ8A 3GY2A 1JXPA 4BAKB 1CGJE 1THSH 2PSXA 2O8WA 5A09A 4GCHF 1UTNA 2OP9A 1QBNA 8GCHF 2I6QA 3GCNA 2D1JA 2BY8X 1ANCA 4I8JA 3GCOA 1T7CA 2GCHG 2ZDAH 1L2EA 4A6LA 2CXVA 4ZUHA 2FI5E 4CRFA 5EW1H 1A1RA 1DX5M 2FS8A 1V2VT 1O2UA 4WH6A 2ZTXA 1XVMA 4SGBE 1GI4A 3Q00A 4OS6A 1V2QT 1E36B 3ZZAA 1O36A 1HLTH 2GVFA 3DA9B 4GPGA 1V2KT 2Z3DA 1NROH 1EKBB 1Q31A 2XC5A 2QA9E 5L30H 1A0JA 3FANA 1O35A 5DP4A 5JB8S 1D6RA 1NESE 1HFDA 1O3MA 3QUMP 3FP7E 2PGBB 1DY8A 1ZTKA 1PPBH 3M35A 1GBLA 3E91A 1GJCB 3PO1B 5DP7A 1SGQE 1UVOA 1NU7B 1W3CA 1YLCA 1FNIA 4ABHA 2A2QH 4X6OA 1MKXH 3PTBA 1U6QA 4TWYA 2J2UA 2VVCA 1IQMA 3M61U 3TH2H 1KIGH 3NZIA 1UK2A 3UWIA 1O2JA 1MTVA 1GJ5H 3SGBE 1IQFA 1TBQH 1KLJH 1SSXA 4H6SB 1GG6C 3MO6A 5FPYA 1QGFA 3URCA 4JZFH 1A3EH 2AEIH 2BQWB 1TRMA 8ESTE 2FOEA 1ZYOA 1QBVH 2B0FA 1P2QA 1G32B 2FOFA 2BDHA 1H4WA 3RXCA 1GCTC 1CT2E 4Q2KA 2BD2A 2G5NA 2GX4A 4NSYA 5C1UA 1GHAG 2STBE 1UMAH 1FY8E 3H5CB 6GCHF 1W2KH 2A7CA 4ZKSU 4X6MA 1LHGH 4JZEH 2IN2A 1GBKA 1T32A 2RG3A 4KKDA 1AWFH 4GVUA 1LPZB 2G00A 3M5OA 5E2OA 1GJ8B 4IGDA 3A85A 4GAWA 1C1WH 2A7JA 1BZXE 3RXBA 1C4Y2 3EA9A 1Z8IB 2J4IA 2VWMA 1TNIA 4MLFB 1YBWA 2CHAC 7GCHG 4ZHLU 3LJJA 1Y3UA 3UUZA 2VWLA 3A82A 2H9HA 4NZLA 2THFB 2P59A 5LPEA 4Y0YE 1EZUC 2PTNA 4D9QA 1GBIA 1OXGA 1A2CH 3A87A 1XX9A 3AASA 4K3JA 3KL6A 5FBIA 1LHFH 1BBRK 3LH3A 5LPRA 3T26A 2ALVA 2XRCA 1TQ0B 2VIQA 5F03A 3TU7H 1G3CA 3TNSA 1XUFA 3M7TA 4PROA 4NA9H 4MPWA 1LVYA 1C5WB 1HIAB 4AFUA 2TGAA 3TLOA 4NIYA 2F91A 3RXHA 1C5UA 2SNWA 2ZDLA 3BEFB 4JMYA 2GV6A 3P95A 3GCHB 1MQ6A 4U32A 4GCHG 1KLTA 3I77A 1VGCC 2ZFTA 5HXFA 1T8LA 1RFNA 3SU3A 3U8TH 1GI7B 1AU8A 1UCYE 1B7XB 3JZ1B 1V2NT 1BRCE 1QB9A 3BIVH 4R0IA 1DY9A 3V13A 1W12U 2P3TB 4AZ2B 1L1NA 1TYNA 1C5RA 1C5QA 4BAMB 2A2XH 2BD9A 3L33A 2BX3A 2XCFA 4WJG2 4AG1A 2FOAA 1W7GH 2VIOA 3LKWA 1J15A 1ZPZA 3ZZCA 3M7QA 1CBWC 1TFXA 3OU0A 1C5MD 2G4UA 1G36A 9LPRA 5I25A 2ANMH 1QRZA 1EPTA 1WYKA 1V2RT 4FUEA 4MPXA 4BANB 4I8HA 3MYWA 3SORA 1SGIB 2GT7A 2H6MA 4ZH8A 3ODFA 1NTPA 4D9RA 2ODPA 1T8MA 1TNLA 3UY9A 1JMOH 2Y5FA 5C5OA 3P8NA 1C5SA 1C2JA 1O3JA 1F5RA 3Q77A 1MU6B 3C1KA 3V12A 1BHXB 1XM1A 1HJ8A 5G4BA 3TJNA 4K2YA 1ETSH 2AGGX 3D65E 3BTME 2Y7XA 1HAVA 4X1SU 1AUTC 3MO9A 4ASHA 3RXPA 2BXTH 4O9VA 4ABIA 2BLOA 3MU4A 3VB5A 6GCHG 3B9FH 1W0ZU 2B8OH 2UUFB 1TALA 3MO3A 5A8ZA 3UQOA 1BRUP 1OKXA 1HDTH 1N1LA 1SB1H 2BM2A 4AOQA 1EJAA 1Z6JH 1IOEA 2FI4E 1CHOF 2ANKH 2BOKA 1O2MA 4INKA 2Y80A 1LPKB 1A5IA 1BDAA 2ZWLH 2D2DA 1INCA 1V2MT 1F7ZA 4MNVA 1O31A 1ZR0A 5C67A 3AW0A 1SLXB 1A5HA 1PYTC 3BN9A 4X8SH 2ZCHP 2A4OA 1UK3A 5FXLA 4K60A 1ELGA 1MBQA 2OBQA 3TK6A 4ABGA 1MU8B 3TNTA 2TGPZ 4MDSA 2G4TA 3S69A 5GXPA 1MAYA 3ZZDA 1UJ1A 2A5IA 4I33A 2R0KA 4NA7A 3QX5H 2PSYA 4WY3A 1C1RA 4OS1A 1C1VH 4XBCA 2AS9A 2NU2E 1O3DA 3ITIA 4DURA 1IQNA 1OWEA 1UHBB 2O8LA 1C2KA 3BTQE 1CT0E 1T8NA 4MG3A 4ABFA 1ZZZA 5EXLA 4B73A 1RRKA 4YT6H 1EOJA 5EODA 2ZF0H 3HKIB 4OGYA 1OP2A 3SNCA 2ZFFH 1GBFA 4BAQB 1VZQH 2OD3B 1WQSA 2PWXA 1TX6A 3KQDA 1MTNC 1UTJA 2P3FH 2UUKB 1VCWA 4FUHA 1KXBA 2FTMA 1H8IH 3V0XA 1WUNH 2ZDKA 1HJAC 4ZXXH 1SVPA 1KDQB 3A83A 3MU5A 2TPIZ 3F1SB 2QGRA 3ZZ7A 1ARBA 1GMHF 2ZFRH 4FU7A 1EPTC 3SUDA 1W0YH 2GV7A 1PPHE 1TWXB 1KXAA 1ZGVA 1NFXA 4KELA 2UWOA 1NRQH 3VXFH 1ZMNA 2ZC9H 5FCKA 4K69A 2CF8H 3O8RA 3BF6H 1EX3A 5GIBA 1K2I1 4CR5A 1GJ9B 2CF9H 2FOMB 1GBMA 2RDLA 5TCCA 2ZPQA 1MUEB 2BLWA 2GP9B 3UR9A 3PROA 3RUOA 2G81E 2BY7X 1BA8B 3GY8A 1IQHA 1NS3A 1FAXA 1Z8JB 1YPLH 1QQ4A 2UWLA 4JK6A 1ELEE 3PMJA 4CHAC 3B23B 3RXDA 1SLWB 3MI4A 2QXGA 1OPHB 2QXHA 4DVAU 1DFPA 2WV4A 2A7HA 1GPZA 1VJAU 3BTTE 1P3EA 2RA0A 1CA0B 1OYQA 2V6NA 3F9HA 2FX6A 5T6DA 5FAHA 1CHOG 5JYIA 2W7SA 4A1TA 1O2ZA 1NT1A 4ABJA 3A7TA 3F68H 1FQ3A 4CR9A 1AKSB 1LKAA 3MMGA 3PWCA 1GI8B 1O5CB 1SHHB 6CHAB 4TY7A 4IN1A 4NZQA 1C1PA 3TJOA 4B76A 3KCGH 1ESAA 2F83A 1HAXB 1L0ZA 3QGNB 1SG8B 1D9IA 1O2SA 4Y8XA 2J94A 4VGCC 2Q1JA 2HALA 3BG4B 1AGJA 1EAXA 1SOZA 1SGPE 3P17H 2R0LA 2FIRH 5E0JA 3O8BA 2RCEA 4NIVA 1Z7KA 2XBXA 4B74A 4B75A 2H5CA 2QF0A 1K21H 5GCHF 1FDPA 1LKBA 1N8OC 1MCTA 3RU4T 1KYNA 3KF2A 2ILNA 4MNWA 2J38A 1HXFH 5JBTA 2QN5T 1F0SA 1GBAA 1GDNA 3WY8A 1FI8A 1Z71A 1OP0A 2A5KA 4Y11E 2QYIA 4YZUA 3SO3A 1FAKH 1TNJA 2TIOA 3MTYA 1MCVA 1YKTA 3ZZ4A 1S81A 3T29A 1AB9C 4FUFA 2AFQB 1XKAC 3D62A 1RIWC 3SU4A 3TITA 1G2MA 4X2WA 1TNGA 2BVSH 1CHGA 3KHVA 2YOLA 2ZU2A 5F8XA 4LZ4B 2SGPE 1ZJKA 1EASA 1WV7H 3K65B 1O3BA 4ZROA 1DWDH 1GMDG 3N7OA 4AGKA 1GMHG 1C1NA 3MWIU 4X8TH 2BD7A 2ZDNA 1QRXA 1SGFA 4YLUA 3RXIA 1W10U 3SUFA 1SI5H 5A0BA 3GICB 1V2WT 3O8DA 3LU9B 4E05H 3RXKA 4B71A 4D7GA 3LJOA 1SGRE 2Z7FE 1D3TB 3RXQA 3HATH 3SNEA 1C1QA 1Z6EA 1IQIA 1FUJA 1Z8GA 1OWHA 2XWAA 3SU6A 4NA8A 3SNBA 2WPIS 4BTIB 1YF4A 1IHSH 4A5TS 5L2ZH 3QWCH 2OQ5A 3AVZA 3BTHE 7GCHF 1O32A 2ZEBA 4ZKRU 1D4PB 1NU9A 1C5YB 2YNAA 2ZU3A 1BCUH 2Z3EA 3T25A 3BSQA 3TH4H 1O2GH 1WTGH 1O3GA 2OC0A 1ETRH 2FPZA 5DP5A 2CMYA 5EQQA 1TA2A 3LGWA 1LPGB 2VB0A 2VIWA 2WUCA 1O2OA 1Q2WA 1BQYA 2P16A 3BTGE 1GHVH 1QIXB 1ZSKA 1VCPA 3TIUA 2F9BH 3QLPH 1O5BB 3PMHB 1AN1E 4ABAA 3TJUA 1OP8A 1EJNA 2GTBA 3Q3XA 2VH0A 2Z9LA 2A4RA 1NRSH 1Y3VA 1O3OA 4ZHAA 1ZHRA 3M5NA 4KTCA 2A5AA 1RJXB 3RMOH 1SC8U 3STIA 3A7VA 1F92A 1S0RA 1DVAH 2P3UB 1SLUB 5T3HA 1QL9A 2Q6DA 3ZV9A 2BQ7B 1HBTH 3ATLA 4JZDH 3LOXA 1UTQA 3VPKA 4JCNA 1Q3XA 3KQEA 1SGTA 1CA8B 1SOTA 1C1SA 4AN7A 1C2MA 1O30A 1DWBH 1BUIA 1W11U 5GCHG 3TGIE 3EYDA 2SNVA 4Y0ZE 2ZCKP 1GJDB 5ESBA 4ABEA 1K9OE 3RMNH
chains in the Genus database with same CATH superfamily
1LTOA 2AIQA 3A8DA 2G55A 5C2ZA 1LVOA 5EOKA 1XMNB 2AHME 1XVOA 2O8TA 1A0HB 2C4FH 1RGQA 4KTUA 2FYRA 1M9UA 4INLA 4Y7BA 5A0AE 4Y8YA 1GBBA 3SOSA 1P2JA 1O3LA 4NFEA 1BTHH 3ATKA 4TPIZ 2WPJS 3T62A 1T31A 1B0FA 3F9EA 2C3SA 1S0QA 1QFKH 3QN7A 4KP0A 1YPKH 1TE0A 3M3SA 3ATWA 5LH8A 3ZZ3A 2ZGXH 3T28A 3U69H 5B6LA 1ELDE 1DLKB 1WOFA 3GYLB 1Y3YA 4K5ZA 4BTUB 3SNDA 3FZDA 3TH3H 1QL7A 1O2VA 1AFEH 5DSFA 1SQAA 2K1QA 2GMTB 3S9BA 1HCGA 2W7UA 5A2MH 3OY6U 4ABDA 2JETB 1B5GH 1F0RA 4YESB 1KTSB 3U28C 1HAOH 5E0HA 3SI3H 4OM9A 5JDUB 3PRBA 1P2NA 2Z6BD 1QNJA 3UWJH 1LDTT 1NRPH 2OINA 3SJIA 4Q80A 1DSTA 3RM2H 2PKSB 1PPEE 3NK8A 4YLQH 1C9TA 1NO9H 3PM3A 1LQDB 1BBRH 1P57B 4DY7B 4FVDA 1EQ9A 3NCLA 4FUJA 1F5LA 2QXIA 4IC6A 3RU4E 2KAIB 1CQQA 1TGSZ 4TYDA 1MKXK 2F9NA 1GCTB 5JB9S 1GHBF 1RD3B 1TNKA 1DS2E 3ZVCA 3FFGA 3A8CA 2DUCA 1ANBA 4CH8B 7LPRA 2J95A 5A0CA 1GI5A 1OWDA 1FMGA 2Y6TA 2BDYA 4I32A 3U8RH 1O0DH 1UVSH 3RC5A 1NN6A 3TVJB 3EGKH 5DKMA 4MNXA 1UHBA 2FXRA 1ELAA 2OUAA 1MBMA 2CHAB 3BTKE 1A61H 1GI0A 3QGJA 1DUAA 2DE8A 4WMFA 3V7TA 1GHZA 2LNCA 3TK5A 3KNXA 3QTVH 1HAYB 3GCHC 1DE7H 3BTDE 1O3IA 2AIPA 4XOJA 1V2UT 3ZVFA 1ARCA 3E1XB 1HRTH 3MH7A 5GDSH 1Y5UT 1GMCF 3ZVBA 4HTCH 4MTBA 1SFQB 4INHA 1RTFB 1S83A 2KR7A 3BEIB 1VITF 1FY4A 3RXFA 1XUGA 2HPQH 1EXFA 3MH4A 1TAWA 1D3QB 1FV9A 2WYGA 4XFQA 3AW1A 4K8BA 3FP6E 3P8GA 3LH1A 1Z1JA 3KYFA 4YT7H 4KGAA 4MQAA 2M2AA 2EI8A 1XXFA 3MNCA 3STJA 1KDQA 1NPMA 1O3AA 2FLRH 3E6PH 3ZVAA 5GJ4B 5HGGA 1OYTH 1O3EA 2FWWA 3FZZA 2XOKD 4AC9A 1FLEE 2FOBA 4ZKNU 3FAOA 1EZQA 2KM0A 2J9NA 2Z9KA 1C5XB 4HI3A 1CGHA 3RXJA 1C2FA 1K1MA 1ZMLA 4ISIH 3WWFA 1O3FA 2A31A 3QTOH 3LONA 1OX1A 3LC3A 4CBNA 1XKBC 1P0SH 1N6XA 3ATMA 4O3UA 2ZI2H 2J97A 2ZIQH 3S9AA 3F2GA 3GDUA 3GY6A 1LHEH 1GJAB 1N6YA 1YY3A 1YP9A 2W3IA 2FOGA 1SGNE 1C2DA 4O97A 1FONA 4RKOB 4LZ1H 4RSPA 2VVVA 5KGOA 3EE0B 5T6FA 2EI6A 2K8IA 3UQVA 4X2YA 4M7GA 1H1BA 4D8NA 3RLYH 1NY22 1P11E 3EQ0H 3K2UA 1KSNA 1THPB 3MH6A 4CBOA 2PKAB 3SUGA 5AF9H 1QY6A 2XYAA 1ZTJA 2GKVE 2A45B 2J34A 3CS7A 2QF5A 4WVPE 2LELA 1O2TA 1K1NA 1NBME 1W13U 2V7QD 5HMAA 4DGJA 2BXUH 1MKWH 4XBDA 2QF3A 3A8AA 5CHAB 4ZKOU 4OS7A 3IG6B 1DT2A 1MZDA 1O2PA 1TPSA 3K6ZA 5CE1A 1EZXC 4I86A 5KECA 2Z94A 1O2IA 1EP6A 4H4FA 1MABB 1G2LA 4WXIA 4MVNA 1MZAA 1GHBG 1ESBA 2GD4B 1P2IA 3PB1E 2NU4E 5BPEA 2QXJA 1C2IA 1ELTA 1UK4A 2ZGBH 3MNXA 1FIWA 1DICA 2BY9X 7KMEH 1P2MA 2ZU4A 3CP7A 1C5LH 2R2MB 1GI1A 1KXEA 4XD7D 1YCPH 5LPFA 1AMHA 1XUKA 2QCYA 3MHWU 1EAWA 1P06A 2C90B 2XW9A 1X7AC 5DP9A 1C1UH 2C8WB 3S7HB 1P03A 4DJZB 1K1LA 2EEKA 4F4OC 1AD8H 1DOJA 1JRSA 2Y81A 1GJ4H 3SJOA 4MPVA 5FPTA 2VGCC 1WDIA 1MD8A 2BHGA 2GCTB 1ETTH 1G9IE 1AZ8A 1GMCG 1ZHPA 1O39A 1O3PB 5DPAA 1EATA 1GI9B 1MQ5A 1O2WA 5DK1A 6LPRA 5H4IB 1P2OA 1E79D 2BY5X 1KXCA 4FUGA 1VITG 3VGCC 3VFEA 5JPMH 1UVUH 1TMUH 4ISNA 1K1OA 4X1NU 2WSSD 2XC0A 2XBYA 1ANEA 2ZHFH 1S6FA 4Y7AA 1AO5A 2OCVB 1Z1IA 3SU2A 3M3VA 3SU1A 2O9QA 3FN8A 5DJ7A 3V3MA 1E1QD 1GVKB 2J98A 1KTTB 1C2GA 1GL0E 2G51A 2VBCA 3M36A 2TRMA 2FMJA 1ZLRA 1FIZA 2KFWA 2R2WU 1GBCA 1QR3E 4WMDA 1GMDF 1K1IA 1GVZA 4HZHA 1H9IE 2BQ6B 1AFQB 4AB8A 2H5DA 4UE7H 1ABIH 3SNAA 1ELCA 4AFQA 2EQNA 2BDBA 2WINI 1A3BH 2QV1A 4NG9H 2ZKSA 3RLWH 4NWKA 4U01A 2XNIA 1GHXH 4FUCA 1MTNB 1ABJH 4JYUH 1EJMA 4ZHMU 1GI2A 4UFEH 4WH8A 2BD3A 1ZSJA 4TPYA 3UOUA 2BD4A 2AYWA 1PPZA 4FU9A 4E06H 1YGCH 2ZTZA 4Q4LA 2W5EA 1ZOMA 1F0UA 5C17A 3A7ZA 4X1PU 1E38B 2FI3E 4OS4A 3DFJA 4K1TA 1QCPA 4JYTA 1O5EH 3PRDA 1C4V2 4DT7B 1C5NH 1WAYB 3U8OH 3NUMA 1S82A 3AAUA 3RMMH 1TBRH 1BTWA 1FN6A 2BD8A 1HAZB 2BYAX 1CGIE 2A0QB 2Z9IA 1PPGE 4Z6AH 1CA0C 1PYTD 1QTFA 3RXUA 1UTKA 4Y6DA 1HAPH 1BITA 1F0TA 1THRH 1H9HE 3RC6A 1WTHD 4YOGA 1IQKA 4I8GA 1YM0A 4GLYA 2ZQ1A 2PLXA 1DSUA 8KME2 3QDZB 3OTPA 2OC1A 5C5NA 1DWCH 1V2PT 3TPIZ 2QE7D 1HAVB 4DG4A 3D23A 1O2RA 2AERH 2C8ZB 1ZPCA 2OC8A 3ZZ5A 1F2SE 1QJ7B 3T27A 1AZZA 1FJSA 4CRBA 4AFZA 3UIRA 2V3OH 3F0OA 1BTUA 1JIMA 5CMXH 1GGDB 2PUQH 5E0GA 2W6ID 3BG4C 1AE5A 3I78A 3RXSA 3W94A 1O3NA 5F8ZA 3SV8A 3P8FA 5AFYH 2V0BA 4B6EA 4FUDA 2BLQA 2F9VA 3DSPA 1NFYA 1VR1H 3UREA 4UFGH 5LGOA 4BNRA 5AVDA 2ZTYA 3DUXH 3KEEA 3KGPA 1KY9A 1SGEE 1C2LA 1D3PB 2QAAA 3SV9A 4NGAH 1UCYH 4BXSA 3A7YA 1AI8H 3E16B 1YPHE 4A1VA 4B1TA 1ELVA 2VIVA 1FXYA 1AIXH 3B8JA 5JBAS 5L6NH 3S7KB 2GDDA 1G3EA 4I31A 1TPPA 5TCAA 1TRYA 2ANWA 2R9PA 4YOJA 1TB6H 3TK9A 1IAUA 1C2HA 1LVMA 1P02A 4BTTB 2GGVB 1DDJA 1BMFD 2BZ6H 2ZHDA 4DIHH 4Q7ZA 1DXWA 1IQGA 3MNBA 3ZVGA 2AMQA 1HPGA 3OE7D 5BRRE 1NFWA 4RN6A 3FO8D 4X8UH 1ZSLA 1BMMH 4AB9A 3VB3A 2Z3CA 2QF4A 1SKYE 1XUHA 3BTWE 3U1IB 1LHDH 2XC4A 3ZVEA 1K1JA 2ODQA 2GZ9A 1TPAE 1TONA 3M7UA 2ZGHA 3P8OA 1ANDA 1ZRBA 2ZHQH 3ZZ8A 2G5VA 5AHGH 3ZZBA 2R3YA 4WXVA 1E0FD 2QC2A 3A7XA 2FYQA 4DIIH 1SL3A 1T4UH 1GBJA 2PUXB 3S9CA 5EJLA 2FP7B 4BAOB 1S85A 3A8BA 1Y59T 5EPYA 3RXAA 2ZCLP 3GOVB 5T6GA 3VB6A 1V2OT 2GZ7A 2PTCE 3E8LA 1P10A 1L4ZA 5F6MA 3EAJA 3G01A 1SR5C 1A46H 1DPOA 1G3DA 2BTCE 4CRAA 3GS9A 1TMTH 1O5DH 1TRNA 1BRBE 2F4LA 3OX7U 2BDAA 1BMNH 3GYMA 1YPHC 3MFJA 4MPUA 4NIWA 3GY4A 1OS8A 2SGEE 1SMFE 5J4SA 3RXLA 1HIAA 2VU8E 4THNH 1TOMH 1ZTLA 7ESTE 1CVWH 1GJ6A 1HXEH 2UUYA 1TGBA 2K0QA 1OSSA 1O2YA 4IBLH 3U9AH 2YMSB 3NWUA 3K9XB 1GVLA 4I8KA 4CREA 3NPSA 1WSSH 1UTMA 1LO6A 4H6TA 4TWWA 4A92A 1T8OA 3SN8A 3SI4H 2PGQB 2FO9A 3HKJB 1Y5BT 3IWMA 1QA7A 5HM2A 3UFAA 1GCDA 1P01A 4Y79A 4Y10E 4DCDA 1L1GA 3URDA 9ESTA 1UVPA 2FTLE 1WQVH 2EC9H 2KCOA 4X2XA 5DP8A 2P8OB 3RXOA 1BTXA 4YO9A 1EAIA 2J5UA 4CRGA 3A80A 3LGTA 1V3XA 1UTOA 1GHWH 1O3CA 3LC5A 3P70B 5CHBA 2ZGCA 1GJ7B 3W95A 1YPMH 1SBWA 1AY6H 1QBOA 1ZPBA 5J4QA 5C0UA 1QJ6B 1ACBE 1O3KA 2ZP0H 3C27B 3IITA 3PO1C 5A8YA 3ZVDA 5C20A 1O33A 2SFAA 1TGTA 3SHCH 3LPRA 3ZZ6A 1C5PA 4ZMAH 4FETA 1RXPA 2SGDE 1O5FH 2VIDA 2HNTF 3E0PB 4B2CA 2D26C 1SHYA 1BHXF 1BMLA 1CU1A 3T5FH 3JZ2B 1EOLA 4ZXYH 3A88A 3UTUH 1HAHH 2Y7ZA 2GMTC 3KQBA 4X2VA 1CE5A 1IQEA 1MD7A 5DG6A 1BJUA 2H9TH 1P2KA 3BV9B 2JETC 1J17T 3FP8E 3PLBA 1Y3XA 1MTUA 1SGFG 1K0HA 4AYYB 2CGAA 3ENSB 4B2BA 4IMZA 1FX0B 2W6JD 1EZSC 2RA3A 1SQOA 1NC6A 2TGDA 3ZYDA 2A4QA 3RXMA 1WBGB 1CO7E 4X0WU 4ESTE 1G37A 5C94A 2OTVA 1PPCE 1GBDA 3LGIA 3SV6A 3VB7A 2BDGA 3U1JB 2PKAA 4ACAA 2PKSC 1YYY1 4OS2A 1GI6A 4YOIA 3GCTF 1W14U 2YMSD 1P05A 3GISB 2ZPSA 2M5TA 4WF8A 4JZIA 1AE8H 4ISHH 2H9EH 2AMDA 1GBEA 1GG6B 2Z9JA 1L4DA 5GWZA 1XXDA 5FBEA 5ESTE 2XTTB 3A84A 1NRRH 3GDVA 4UONA 1SQTA 2OQUA 1H8DH 4AORA 3F6UH 2FESH 4I7YH 1O34A 2ZO3H 5EXMA 2F9PA 1EP5A 4UFDH 1O2KA 1KXFA 1UTPA 4DW2U 3SQEE 3TGJE 3A89A 2HNTE 1GBHA 3OEHD 4BXWA 1BB0B 1FPCH 4SGAE 4XE4A 2RDEA 5EG4A 1A7SA 4XBBA 3SQHE 4DT4A 3GDSA 5T1VA 1VJ9U 3M5LA 2WZQA 2XXLA 4JK5A 4RKJB 1TPOA 1O38A 1JBUH 4P02A 3OTJE 1TNHA 5I46H 3CS0A 4B2AA 2ZPRA 2JIZD 5HYOA 2HOBA 2HVXA 1K1PA 2EA3A 3TGKE 4Q7YA 1TX7A 2PP6A 3KIDU 1C1MA 2R3UA 1HNEE 1E37B 3Q76A 1TABE 3P92A 4ASUD 1OWIA 2WPKS 3CNRA 2BVRH 1FZZA 2BD5A 3R3GB 2WV9A 2ALPA 2FLBH 1G30B 1P9SA 1JWTA 3FKSD 2HLCA 5EPNA 4Y76A 1SQRA 4LOYH 1O2HA 5B6OA 3QO6A 1HYLA 2ZFPH 2ZA5A 1TMBH 3LGUA 1FPHH 2Y5HA 2A4GA 3L3TA 3RXRA 4UDWH 3F0PA 2FS9A 4F49A 3OSYA 1C5TA 1O2LA 8GCHG 3BG8A 5GPIB 1SLVB 2ZU1A 2Q6FA 1HAIH 5K7RA 3PLKA 2Q6GA 1CSOE 1O5AB 1E34B 3E90B 2SGFE 1KXDA 4JYVH 1VGCB 3RXGA 2KCYA 3UNSA 1MTWA 4QT8C 1QB1A 1NFUA 3LGYA 1P3CA 2WPMS 4E7NA 4GUXA 2O8MA 1GI3A 4O03A 4FUBA 1IHTH 1DITH 8LPRA 3LDXH 1BJVA 2G8TA 5EJZA 1FY3A 4XDEA 1DUEA 2HNTC 4NIXA 2BLVA 4F48B 1TGNA 5ETXA 1P04A 2JH6D 3PYHA 3SU0A 1AVXA 5DP3A 4BAHB 2H2ZA 1CBWB 3SHAH 2H1UA 3CENA 4ACBA 3HK3B 3PWBA 1RTKA 1O2NA 1K28D 1BOQA 3EDXB 2FODA 1RTLA 1ELBA 2I6SA 1UVTH 3F3BA 4E7RG 3SW2B 2CN0H 1AQ7A 3PV2A 2Y82A 5EGMA 3EA7A 4U30A 4A7IB 5EW2H 3A81A 4JZ1A 3OY5U 3GCTG 5CHAC 3H7OA 2ULLA 3DT0H 4AFSA 1V2JT 1NZQH 2FOHA 4AYVB 3TJVA 3SJ9A 2ZZUH 4ZAEA 3VXEH 2F43B 1VCQA 1TBZH 1EFRD 4NCYA 2VWOA 1HAGE 1AKSA 3PMAB 4DOQA 5C1XA 2TBSA 2W3KA 3HK6B 3MOCA 2VVUA 2SGQE 3SJ8A 1ORFA 5ABWA 1OHHD 1P9UA 1SGYE 1TIOA 2JKHA 1LCYA 2VIPA 1V6DA 3AAVA 1XUIA 2Z9GA 4Z0KA 3UR6A 3PTNA 4ISOA 3HGPA 2ANYA 1C9PA 1WCZA 1S6HA 2A32A 2FEQH 1PFXC 2GT8A 5SGAE 4CH2B 1ZGIA 1DM4B 1LVBA 3E0NB 4MNYA 1P09A 3ZYEA 2QIQA 4X1RU 3SUEA 2ZHEH 4I8LA 1NRNH 5PTPA 2BX4A 4YXWD 1YLDA 4NWLA 2NWNA 2OLGA 2GCTC 3P6ZB 4X1QU 3OYPA 1O2XA 3VB4A 5JBCS 1EAUA 3SV7A 4Y71A 3R0FA 1MKWK 3VEQB 4D76A 1V2TT 2UWPA 1YPGH 4U2WA 1JIRA 2BB4A 3DHKH 1V2LT 3ATIA 3ZZ9A 3ODDA 5IYTA 1TA6A 2QY0B 5AFZH 2OK5A 3PV4A 2XCNA 5A8XA 3H7TA 1A0LA 4Y8ZA 1DLEA 2GDEH 2XWBI 3GY5A 2SGAA 3RU4D 2BDCA 1J16A 2C93B 1ZJDA 1TLDA 1TX8A 4P00A 3RM0H 2PFEA 4IS5A 4KTSA 3DD2H 1ID5H 2V3HH 4OGXA 2TGTA 1W7XH 5JBBS 1YCPK 2P94A 1SFIA 2VGCB 1G3BA 1AFQC 1DWEH 3RXEA 5F8TA 3OFND 3F9GA 1QB6A 3SGAE 3UOPA 3SGQE 3GY3A 4FXGH 1DXPA 1QQUA 4YTAA 3VGCB 1ZRKA 1YC0A 2BDIA 1YCPM 1H8ED 2IPQX 5DP6A 3SJKA 2NU1E 2IPHA 1LHCH 2BY6X 2ZECA 1MMJN 2ZDVH 4LK4A 4HGCA 3MH5A 1HJAB 2ZDMA 3I29A 1AHTH 3SU5A 3SV2H 2J92A 2ZG0H 5C1YA 1QRWA 3HGNA 4RI0A 2AH4X 3A7WA 4UD9H 2ASUB 2AGIX 4HG6A 3KQCA 4H42U 5L2YH 1BTZA 1EPTB 1GL1A 5DGJA 2P93A 1ESTA 2BZAA 2XBWA 2VH6A 2ZQ2A 5FL7D 3ZV8A 1P12E 3MU0A 4K8YA 3LIWA 3BTEE 1TOCB 2WPDD 1EUFA 3M3TA 1WU1A 3F9FA 5TJXA 5HIYA 2ZU5A 4D7FA 2JH5D 3GY7A 1AVWA 1FY5A 1BIOA 1S5SA 5E2PA 1ELFA 1L1JA 1C5OH 1O5GH 1FN8A 1SPJA 3BEUA 5FX5A 2D8WA 1C1OA 4WMEA 1IQLA 2B5TB 1BBRE 5EXNA 1NM6A 6CHAC 2PW8H 1OOKB 3LT3A 2FX4A 3VG8A 4CHAB 2BOHB 4UEHH 1Y5AT 2ZFQH 3MU1A 2WPLS 4AG2A 1GGDC 3UPEA 1DANH 2O8UA 2FM2A 1LMWB 4J1YA 2W26A 1K22H 3BTFE 2NU3E 1XUJA 2V35A 2XBVA 1GWAA 1LQEA 1QL8A 1SGDE 4NFFA 1VKYA 1C4U2 4FU8A 1F5KU 2FDAA 2B7DH 2WV5A 2HRVA 3RP2A 3RXTA 4CRCA 1BTYA 1GDUA 3M5MA 5FHTA 4FVBA 4TY6A 4X8VH 1PQAA 3ESTA 3K6YA 3QK1A 1QJ1B 2AGEX 3ELAH 3NKKA 2FOCA 3EE7A 5C3NA 1J8AA 1MTSA 1HGTH 1HB0B 2ODYB 1UTLM 1AVGH 1A4WH 3U98H 1QHRB 1T4VH 1ZHMA 1FY1A 1C5ZB 2GCHF 1HUTH 5EU8A 4IW4E 1TGCA 1OWKA 1BRAA 2Y5GA 2VINA 4AX9H 1NBMD 4Q7XA 1D3DB 2NU0E 4VGCB 5FX6A 2CV3A 1H9LB 3UNRA 3SBKA 2WYJA 3PMBB 3D49H 2BMGB 3M37A 1YPEH 4GHQA 4BOHA 1EB1H 4CRDA 4TSFD 4UFFH 1P8VC 1N8OB 3RMLH 4X6NA 4HFPB 2F9UA 2C8XB 5DO4H 2PR3A 4XSKU 2A1DB 2FZZA 2YNBA 1JRTA 1W8BH 1PQ7A 1UO6A 2ZHWH 1C1TA 2ZGJA 1BT7A 5FCRA 2PV9B 4IMQA 1MAXA 2DE9A 1V2ST 2VNTA 1HV7A 1B0EA 2F9OA 1QA0A 1GHYH 2HPPH 1GBTA 1AB9B 5HM9A 1RIWB 4IN2A 2J98B 3ZIAD 1UCYK 3SZEA 2LPRA 1S84A 4ABBA 3RDZA 1HJ9A 4K1EA 3A86A 3EA8A 1VITH 5IK2D 1O2QA 2STAE 5FPSA 2VJ1A 4NSVA 3LGVA 3S0NA 3FVFB 5EQSA 2KAIA 3L6PA 3E3TA 3QZQA 1C2EA 3DFLA 5EQRA 1GHAF 3UAIC 3RXVA 1TQ7B 2B9LA 1PJPA 1QURH 1MH0A 3MNSA 1PQ5A 2JJ2D 4J2YB 1J9CH 2WPHS 3Q3KA 2UUJB 3OEED 2IOTA 4LXBH 1AWHB 1IQJA 2F3CE 4F55A 2HGTH 4IC5A 1E35B 1GJBB 3T2NA 4O3TA 3PLPA 3HPTB 3SZNA 3O8CA 2PHBA 1SGCA 5E8EH 1RS0A 1PQ8A 1JOUB 2OXSA 2BVXH 4A1XA 5K0HA 2CJIA 1C5VA 1J14A 1D6WA 1KLIH 5IDKA 1Y3WA 3MU8A 2HLDD 4WWYA 2OBOA 3NXPA 1ZMJA 4OS5A 2OC7A 2WUBA 2YMSC 2ZNKH 1AUJA 1A5GH 2AMPA 4ISLA 4X6PA 1GDQA 3KN2A 1Z8RA 2ESTE 1PPFE 3QZRA 3BIUH 4GSOA 4K1SA 2P95A 2VWNA 4YM9A 4AGJA 1OWJA 3RC4A 2IJOB 2ZFSA 2HWLB 1BTPA 1EB2A 5CDFE 1O3HA 2G52A 2C8YB 3Q3YA 3UNQA 3F2FA 2JH0D 2P8OC 1Y8TA 2EI7A 6ESTA 1O37A 1BMAA 4GHTA 1KMHB 1YPJH 1CT4E 3WWBA 4R8TB 4FUIA 3FOAA 2GZ8A 3GY2A 1JXPA 4BAKB 1CGJE 1THSH 2PSXA 2O8WA 5A09A 4GCHF 1UTNA 2OP9A 1QBNA 8GCHF 2I6QA 3GCNA 2D1JA 2BY8X 1ANCA 4I8JA 3GCOA 1T7CA 2GCHG 2ZDAH 1L2EA 4A6LA 2CXVA 4ZUHA 2FI5E 4CRFA 5EW1H 1A1RA 1DX5M 2FS8A 1V2VT 1O2UA 4WH6A 2ZTXA 1XVMA 4SGBE 1GI4A 3Q00A 4OS6A 1V2QT 3N99A 1E36B 3ZZAA 1O36A 1HLTH 2GVFA 3DA9B 4GPGA 1V2KT 2Z3DA 1NROH 1EKBB 1YLNA 1Q31A 2XC5A 2QA9E 5L30H 1A0JA 3FANA 1O35A 5DP4A 5JB8S 1D6RA 1NESE 1HFDA 1O3MA 3QUMP 3FP7E 2PGBB 1DY8A 1ZTKA 1PPBH 3M35A 1GBLA 4ZCNA 3E91A 1GJCB 3PO1B 5DP7A 1SGQE 1UVOA 1NU7B 1W3CA 1YLCA 1FNIA 4ABHA 2A2QH 4X6OA 1MKXH 3PTBA 1U6QA 4TWYA 2J2UA 2VVCA 1IQMA 3M61U 3TH2H 1KIGH 3NZIA 1UK2A 3UWIA 1O2JA 1MTVA 1GJ5H 3SGBE 1IQFA 1TBQH 1KLJH 1SSXA 3H09A 4H6SB 1GG6C 3MO6A 5FPYA 1QGFA 3URCA 4JZFH 1A3EH 2AEIH 2BQWB 1TRMA 8ESTE 2FOEA 1ZYOA 1QBVH 2B0FA 1P2QA 1G32B 2FOFA 2BDHA 1H4WA 3RXCA 3MQKC 1GCTC 1CT2E 4Q2KA 2BD2A 2G5NA 2GX4A 4NSYA 5C1UA 1GHAG 2STBE 1UMAH 1FY8E 4Z1MD 3H5CB 6GCHF 1W2KH 2A7CA 4ZKSU 4X6MA 1LHGH 2LP6A 4JZEH 2IN2A 1GBKA 1T32A 2RG3A 4KKDA 1AWFH 4GVUA 1LPZB 2G00A 3M5OA 5E2OA 1GJ8B 4IGDA 2RFKC 3A85A 4GAWA 1C1WH 2A7JA 1BZXE 3RXBA 1C4Y2 3EA9A 1Z8IB 2J4IA 2VWMA 1TNIA 3F2HA 4MLFB 1YBWA 2CHAC 7GCHG 4ZHLU 3LJJA 1Y3UA 3UUZA 2VWLA 3A82A 2H9HA 4NZLA 2THFB 2P59A 5LPEA 4Y0YE 1EZUC 2PTNA 4D9QA 1GBIA 1OXGA 1A2CH 3AK5A 3A87A 1XX9A 3AASA 4K3JA 3KL6A 3KYGA 5FBIA 1LHFH 1BBRK 3LH3A 5LPRA 3T26A 2ALVA 2XRCA 1TQ0B 2VIQA 5F03A 3TU7H 1G3CA 5C0TA 3TNSA 1XUFA 3M7TA 4PROA 4NA9H 4MPWA 1LVYA 1C5WB 1HIAB 2IJD1 4AFUA 2TGAA 3TLOA 1YWUA 4NIYA 2F91A 3RXHA 1C5UA 2SNWA 2ZDLA 3BEFB 4JMYA 2GV6A 3P95A 3GCHB 1MQ6A 4U32A 4GCHG 1KLTA 3I77A 1VGCC 2ZFTA 5HXFA 1T8LA 5HKKD 1RFNA 3SU3A 3U8TH 3DCLA 1GI7B 1AU8A 1UCYE 1B7XB 3JZ1B 1V2NT 1BRCE 1QB9A 3BIVH 4R0IA 1DY9A 3V13A 1W12U 2P3TB 4AZ2B 1L1NA 1WXRA 1TYNA 1C5RA 1C5QA 4BAMB 2A2XH 2BD9A 3L33A 2L6OA 2BX3A 2XCFA 4WJG2 4AG1A 2FOAA 1W7GH 2VIOA 3LKWA 1J15A 1ZPZA 3ZZCA 3M7QA 1CBWC 1TFXA 3OU0A 1C5MD 2G4UA 1G36A 9LPRA 5I25A 2ANMH 3KQ5A 1QRZA 1EPTA 1WYKA 1V2RT 4FUEA 4MPXA 4BANB 4I8HA 3MYWA 3DSOA 4XRNA 3SORA 1SGIB 2GT7A 2H6MA 4ZH8A 3ODFA 1NTPA 4D9RA 2ODPA 1T8MA 4Q63A 1TNLA 3UY9A 1JMOH 2Y5FA 5C5OA 3P8NA 1C5SA 1C2JA 1O3JA 1F5RA 3Q77A 1MU6B 3C1KA 3V12A 1BHXB 1XM1A 1HJ8A 5G4BA 3TJNA 4K2YA 1ETSH 2AGGX 3D65E 3BTME 2Y7XA 1HAVA 4X1SU 1AUTC 3MO9A 4ASHA 3RXPA 2BXTH 4O9VA 4ABIA 1S6LA 2BLOA 3MU4A 3VB5A 6GCHG 3B9FH 1W0ZU 2B8OH 3UB0A 2UUFB 1TALA 3MO3A 5A8ZA 3UQOA 1BRUP 1OKXA 1HDTH 2KCAA 5GNDA 1N1LA 1SB1H 2BM2A 4AOQA 1EJAA 1Z6JH 1IOEA 2FI4E 1CHOF 2ANKH 2BOKA 1O2MA 4INKA 2Y80A 1LPKB 1A5IA 1BDAA 2ZWLH 2D2DA 1INCA 1V2MT 1F7ZA 4MNVA 1O31A 1ZR0A 5C67A 3AW0A 1SLXB 1A5HA 1PYTC 3BN9A 2JDID 4X8SH 2ZCHP 2A4OA 1UK3A 5FXLA 4K60A 1ELGA 1MBQA 2OBQA 5HIZA 3TK6A 1MU8B 4ABGA 3TNTA 2TGPZ 4MDSA 2G4TA 3S69A 5GXPA 1MAYA 3ZZDA 1UJ1A 2A5IA 4I33A 2R0KA 4NA7A 3QX5H 2PSYA 4WY3A 1C1RA 4OS1A 1C1VH 4XBCA 2AS9A 2NU2E 1O3DA 3ITIA 4DURA 1IQNA 1OWEA 1UHBB 2O8LA 1C2KA 3NRLA 2KZ4A 3BTQE 1CT0E 2KCPA 1T8NA 4MG3A 4ABFA 1ZZZA 2CK3D 5EXLA 4B73A 1RRKA 4YT6H 1EOJA 5EODA 2ZF0H 3HKIB 4OGYA 1OP2A 3SNCA 1W0JD 2ZFFH 1GBFA 4BAQB 1VZQH 2OD3B 1WQSA 2PWXA 1TX6A 3KQDA 1MTNC 1UTJA 2P3FH 2UUKB 1VCWA 4FUHA 1KXBA 2FTMA 2HVYB 1QZ8A 1H8IH 3V0XA 1WUNH 2ZDKA 4RT1A 1HJAC 4ZXXH 1SVPA 1KDQB 2GJGA 3A83A 3MU5A 2TPIZ 3F1SB 2QGRA 3ZZ7A 1ARBA 1GMHF 2ZFRH 4FU7A 1EPTC 3SUDA 1W0YH 2GV7A 1PPHE 1TWXB 1KXAA 4FOUC 1ZGVA 1NFXA 4KELA 2UWOA 1NRQH 3VXFH 1ZMNA 2ZC9H 5FCKA 4K69A 2CF8H 3O8RA 3BF6H 1EX3A 5GIBA 1K2I1 4CR5A 5EJ1A 1GJ9B 2CF9H 2FOMB 1GBMA 2RDLA 5TCCA 2ZPQA 1MUEB 2BLWA 2GP9B 2KX4A 3UR9A 3PROA 3RUOA 3PV5A 2G81E 2BY7X 1BA8B 3GY8A 1IQHA 1NS3A 1FAXA 1Z8JB 1YPLH 1QQ4A 2UWLA 4JK6A 5DN6D 3WW7A 1ELEE 3PMJA 4CHAC 2L74A 3B23B 3RXDA 1SLWB 1UW7A 3MI4A 2QXGA 1OPHB 2QXHA 4DVAU 1DFPA 2WV4A 2A7HA 1GPZA 1VJAU 3BTTE 1P3EA 2RA0A 1CA0B 1OYQA 2V6NA 3F9HA 2FX6A 5T6DA 5FAHA 1CHOG 5JYIA 2W7SA 4A1TA 5KEDA 1O2ZA 1NT1A 4ABJA 3A7TA 2XNDD 3F68H 1FQ3A 4CR9A 1AKSB 1LKAA 3MMGA 3PWCA 1GI8B 1O5CB 1SHHB 6CHAB 4TY7A 4IN1A 4NZQA 1C1PA 3TJOA 4B76A 3KCGH 1ESAA 2F83A 1HAXB 1L0ZA 3QGNB 1SG8B 1D9IA 5F53A 1O2SA 4Y8XA 2J94A 4VGCC 2Q1JA 2HALA 3BG4B 1AGJA 1EAXA 1SOZA 1SGPE 3P17H 2R0LA 2FIRH 5E0JA 3O8BA 2RCEA 4NIVA 1Z7KA 2XBXA 4B74A 4B75A 2H5CA 2QF0A 1K21H 5GCHF 1FDPA 1E1RD 1LKBA 4RT0A 1N8OC 1MCTA 3RU4T 1KYNA 3KF2A 2ILNA 4MNWA 2J38A 1HXFH 5JBTA 2QN5T 1F0SA 1GBAA 1GDNA 3WY8A 1FI8A 1Z71A 1OP0A 2A5KA 4Y11E 2QYIA 4YZUA 3SO3A 1FAKH 1TNJA 2TIOA 3MTYA 1MCVA 1YKTA 3ZZ4A 4B6FA 1S81A 3T29A 1AB9C 4FUFA 2AFQB 1XKAC 3D62A 1RIWC 3SU4A 3TITA 1G2MA 4X2WA 1TNGA 2BVSH 1CHGA 3KHVA 2YOLA 2ZU2A 5F8XA 4LZ4B 2SGPE 4M9FA 1ZJKA 1EASA 1WV7H 3K65B 1O3BA 4ZROA 1DWDH 3N7DA 1COWD 1GMDG 3N7OA 4AGKA 1GMHG 1C1NA 2JJ1D 3MWIU 4X8TH 2BD7A 2ZDNA 1QRXA 1SGFA 4YLUA 3RXIA 1W10U 3SUFA 1SI5H 5A0BA 3GICB 1V2WT 3O8DA 3LU9B 4E05H 2WHXA 3RXKA 4B71A 4D7GA 3LJOA 1SGRE 2Z7FE 1D3TB 3RXQA 3HATH 3SNEA 1C1QA 1Z6EA 1IQIA 1FUJA 1Z8GA 1W0KD 1OWHA 2XWAA 3SU6A 4NA8A 3SNBA 5EIYA 2WPIS 4BTIB 1YF4A 1IHSH 4A5TS 5L2ZH 3QWCH 2OQ5A 4TT3D 3AVZA 3BTHE 7GCHF 1O32A 2ZEBA 4ZKRU 1D4PB 1NU9A 1C5YB 2YNAA 2ZU3A 1BCUH 2Z3EA 3T25A 3BSQA 3TH4H 1O2GH 1WTGH 3OAAD 1O3GA 2OC0A 1ETRH 2FPZA 5DP5A 2CMYA 5EQQA 1TA2A 3LGWA 1LPGB 2VB0A 2VIWA 2WUCA 1O2OA 3SYJA 1Q2WA 1BQYA 2P16A 3BTGE 1GHVH 1QIXB 1ZSKA 1VCPA 3TIUA 2F9BH 3QLPH 2V3MA 1O5BB 3PMHB 1AN1E 4ABAA 3TJUA 1OP8A 1EJNA 2GTBA 3Q3XA 2VH0A 2Z9LA 2A4RA 1NRSH 1Y3VA 1O3OA 4ZHAA 3N7EA 1ZHRA 2EY4C 3M5NA 4KTCA 2A5AA 3W1EA 1RJXB 3RMOH 1SC8U 3STIA 3A7VA 1F92A 3DSGA 1S0RA 1DVAH 2P3UB 1SLUB 5T3HA 1QL9A 2Q6DA 3ZV9A 2BQ7B 1HBTH 3ATLA 4JZDH 3LOXA 1UTQA 3VPKA 4JCNA 1Q3XA 3KQEA 1SGTA 1CA8B 1SOTA 1C1SA 4AN7A 1C2MA 1O30A 1H8HD 1DWBH 1BUIA 1W11U 5GCHG 3TGIE 3EYDA 2SNVA 4Y0ZE 2ZCKP 1GJDB 5ESBA 4ABEA 1K9OE 3RMNH
chains in the Genus database with same CATH topology
1LTOA 2AIQA 3A8DA 2G55A 5C2ZA 1LVOA 5EOKA 1XMNB 2O8TA 1XVOA 1A0HB 2C4FH 1RGQA 4KTUA 2FYRA 1M9UA 4INLA 4Y7BA 5A0AE 4Y8YA 1GBBA 3SOSA 1P2JA 1O3LA 4NFEA 1BTHH 3ATKA 4TPIZ 2WPJS 3T62A 1T31A 1B0FA 3F9EA 2C3SA 1S0QA 1QFKH 3QN7A 4KP0A 1YPKH 1TE0A 3M3SA 3ATWA 5LH8A 3ZZ3A 2ZGXH 3T28A 3U69H 1ELDE 1DLKB 1WOFA 3GYLB 1Y3YA 4K5ZA 4BTUB 3SNDA 3FZDA 3TH3H 1QL7A 1O2VA 1AFEH 1SQAA 2K1QA 2GMTB 3S9BA 1HCGA 2W7UA 5A2MH 3OY6U 4ABDA 2JETB 1B5GH 1F0RA 4YESB 1KTSB 1HAOH 5E0HA 3SI3H 5JDUB 1P2NA 2Z6BD 1QNJA 3UWJH 1LDTT 1NRPH 2OINA 3SJIA 4Q80A 1DSTA 3RM2H 2PKSB 1PPEE 3NK8A 4YLQH 1C9TA 1NO9H 3PM3A 1LQDB 1BBRH 1P57B 4DY7B 4FVDA 1EQ9A 3NCLA 4FUJA 1F5LA 2QXIA 4IC6A 3RU4E 2KAIB 1CQQA 1TGSZ 4TYDA 1MKXK 2F9NA 1GCTB 5JB9S 1GHBF 1RD3B 1TNKA 1DS2E 3ZVCA 3FFGA 3A8CA 2DUCA 1ANBA 4CH8B 7LPRA 2J95A 5A0CA 1GI5A 1OWDA 1FMGA 2Y6TA 2BDYA 4I32A 3U8RH 1O0DH 1UVSH 3RC5A 1NN6A 3TVJB 3EGKH 5DKMA 4MNXA 1UHBA 2FXRA 1ELAA 2OUAA 1MBMA 2CHAB 3BTKE 1A61H 1GI0A 3QGJA 1DUAA 2DE8A 4WMFA 3V7TA 1GHZA 2LNCA 3TK5A 3KNXA 3QTVH 1HAYB 3GCHC 1DE7H 3BTDE 1O3IA 2AIPA 4XOJA 1V2UT 3ZVFA 1ARCA 3E1XB 1HRTH 3MH7A 5GDSH 1Y5UT 1GMCF 3ZVBA 4HTCH 4MTBA 1SFQB 4INHA 1RTFB 1S83A 3BEIB 1VITF 1FY4A 3RXFA 1XUGA 2HPQH 1EXFA 3MH4A 1TAWA 1D3QB 1FV9A 2WYGA 4XFQA 3AW1A 4K8BA 3FP6E 3P8GA 3LH1A 1Z1JA 4YT7H 4KGAA 4MQAA 2EI8A 1XXFA 3MNCA 3STJA 1KDQA 1NPMA 1O3AA 2FLRH 3E6PH 3ZVAA 5GJ4B 5HGGA 1OYTH 1O3EA 2FWWA 3FZZA 1FLEE 2FOBA 4ZKNU 3FAOA 1EZQA 2J9NA 2Z9KA 1C5XB 4HI3A 1CGHA 3RXJA 1C2FA 1K1MA 1ZMLA 4ISIH 1O3FA 2A31A 3QTOH 3LONA 1OX1A 3LC3A 4CBNA 1XKBC 1P0SH 1N6XA 3ATMA 4O3UA 2ZI2H 2ZIQH 3S9AA 3GDUA 3GY6A 1LHEH 1GJAB 1N6YA 1YP9A 2W3IA 2FOGA 1SGNE 1C2DA 4O97A 1FONA 4RKOB 4LZ1H 4RSPA 2VVVA 3EE0B 5T6FA 2EI6A 3UQVA 4X2YA 4M7GA 1H1BA 4D8NA 3RLYH 1NY22 1P11E 3EQ0H 3K2UA 1KSNA 1THPB 3MH6A 4CBOA 2PKAB 3SUGA 5AF9H 1QY6A 2XYAA 1ZTJA 2GKVE 2A45B 2J34A 3CS7A 4WVPE 1O2TA 1K1NA 1W13U 5HMAA 4DGJA 2BXUH 1MKWH 4XBDA 2QF3A 3A8AA 5CHAB 4ZKOU 4OS7A 3IG6B 1DT2A 1MZDA 1O2PA 1TPSA 3K6ZA 5CE1A 1EZXC 2Z94A 1O2IA 1EP6A 4H4FA 1G2LA 4WXIA 4MVNA 1MZAA 1GHBG 1ESBA 2GD4B 1P2IA 3PB1E 2NU4E 5BPEA 2QXJA 1C2IA 1ELTA 1UK4A 2ZGBH 3MNXA 1FIWA 1DICA 2BY9X 7KMEH 1P2MA 2ZU4A 3CP7A 1C5LH 2R2MB 1GI1A 1KXEA 1YCPH 5LPFA 1AMHA 1XUKA 2QCYA 3MHWU 1EAWA 1P06A 2C90B 2XW9A 1X7AC 5DP9A 1C1UH 2C8WB 3S7HB 1P03A 4DJZB 1K1LA 2EEKA 4F4OC 1AD8H 1DOJA 1JRSA 2Y81A 1GJ4H 3SJOA 4MPVA 5FPTA 2VGCC 1MD8A 2BHGA 2GCTB 1ETTH 1G9IE 1AZ8A 1GMCG 1ZHPA 1O39A 1O3PB 5DPAA 1EATA 1GI9B 1MQ5A 1O2WA 5DK1A 6LPRA 5H4IB 1P2OA 2BY5X 1KXCA 4FUGA 1VITG 3VGCC 3VFEA 5JPMH 1UVUH 1TMUH 4ISNA 1K1OA 4X1NU 2XC0A 2XBYA 1ANEA 2ZHFH 1S6FA 4Y7AA 1AO5A 2OCVB 1Z1IA 3SU2A 3M3VA 3SU1A 2O9QA 5DJ7A 3V3MA 1GVKB 1KTTB 1C2GA 1GL0E 2G51A 3M36A 2TRMA 2FMJA 1ZLRA 1FIZA 2R2WU 1GBCA 1QR3E 4WMDA 1GMDF 1K1IA 1GVZA 4HZHA 1H9IE 2BQ6B 1AFQB 4AB8A 2H5DA 4UE7H 1ABIH 3SNAA 1ELCA 4AFQA 2BDBA 2WINI 1A3BH 2QV1A 4NG9H 2ZKSA 3RLWH 4NWKA 4U01A 2XNIA 1GHXH 4FUCA 1MTNB 1ABJH 4JYUH 1EJMA 4ZHMU 1GI2A 4UFEH 4WH8A 2BD3A 1ZSJA 4TPYA 3UOUA 2BD4A 2AYWA 1PPZA 4FU9A 4E06H 1YGCH 2ZTZA 2W5EA 1ZOMA 1F0UA 3A7ZA 4X1PU 1E38B 2FI3E 4OS4A 3DFJA 4K1TA 1QCPA 4JYTA 1O5EH 1C4V2 4DT7B 1C5NH 1WAYB 3U8OH 3NUMA 1S82A 3AAUA 3RMMH 1TBRH 1BTWA 1FN6A 2BD8A 1HAZB 2BYAX 1CGIE 2A0QB 2Z9IA 1PPGE 4Z6AH 1CA0C 1PYTD 1QTFA 3RXUA 1UTKA 4Y6DA 1HAPH 1BITA 1F0TA 1THRH 1H9HE 3RC6A 1WTHD 4YOGA 1IQKA 4I8GA 1YM0A 4GLYA 2ZQ1A 2PLXA 1DSUA 8KME2 3QDZB 5C5NA 2OC1A 1DWCH 1V2PT 3TPIZ 1HAVB 4DG4A 3D23A 1O2RA 2AERH 2C8ZB 1ZPCA 2OC8A 3ZZ5A 1F2SE 1QJ7B 3T27A 1AZZA 1FJSA 4CRBA 4AFZA 3UIRA 2V3OH 1BTUA 1JIMA 5CMXH 1GGDB 2PUQH 5E0GA 3BG4C 1AE5A 3I78A 3RXSA 3W94A 1O3NA 5F8ZA 3SV8A 3P8FA 5AFYH 2V0BA 4FUDA 2BLQA 2F9VA 1NFYA 1VR1H 3UREA 4UFGH 5LGOA 4BNRA 5AVDA 2ZTYA 3DUXH 3KEEA 3KGPA 1KY9A 1SGEE 1C2LA 1D3PB 2QAAA 3SV9A 4NGAH 1UCYH 4BXSA 3A7YA 1AI8H 3E16B 1YPHE 4A1VA 4B1TA 1ELVA 2VIVA 1FXYA 1AIXH 3B8JA 5JBAS 5L6NH 3S7KB 2GDDA 1G3EA 4I31A 1TPPA 5TCAA 1TRYA 2ANWA 2R9PA 4YOJA 1TB6H 3TK9A 1IAUA 1C2HA 1LVMA 1P02A 4BTTB 2GGVB 1DDJA 2BZ6H 2ZHDA 4DIHH 4Q7ZA 1DXWA 1IQGA 3MNBA 3ZVGA 2AMQA 1HPGA 5BRRE 1NFWA 4RN6A 4X8UH 1ZSLA 1BMMH 4AB9A 3VB3A 2Z3CA 1XUHA 3BTWE 3U1IB 1LHDH 2XC4A 3ZVEA 1K1JA 2ODQA 2GZ9A 1TPAE 1TONA 3M7UA 2ZGHA 3P8OA 1ANDA 1ZRBA 2ZHQH 3ZZ8A 2G5VA 5AHGH 3ZZBA 2R3YA 4WXVA 1E0FD 2QC2A 3A7XA 2FYQA 4DIIH 1SL3A 1T4UH 1GBJA 2PUXB 3S9CA 2FP7B 4BAOB 1S85A 3A8BA 1Y59T 5EPYA 3RXAA 2ZCLP 3GOVB 5T6GA 3VB6A 1V2OT 2GZ7A 2PTCE 3E8LA 1P10A 1L4ZA 5F6MA 3EAJA 3G01A 1SR5C 1A46H 1DPOA 1G3DA 2BTCE 4CRAA 1TMTH 1O5DH 1TRNA 1BRBE 3OX7U 2BDAA 1BMNH 3GYMA 1YPHC 3MFJA 4MPUA 4NIWA 3GY4A 1OS8A 2SGEE 1SMFE 5J4SA 3RXLA 1HIAA 2VU8E 4THNH 1TOMH 1ZTLA 7ESTE 1CVWH 1GJ6A 1HXEH 2UUYA 1TGBA 1OSSA 1O2YA 4IBLH 3U9AH 3NWUA 3K9XB 1GVLA 4I8KA 4CREA 3NPSA 1WSSH 1UTMA 1LO6A 4H6TA 4TWWA 4A92A 1T8OA 3SN8A 3SI4H 2PGQB 2FO9A 3HKJB 1Y5BT 3IWMA 1QA7A 5HM2A 3UFAA 1GCDA 1P01A 4Y79A 4Y10E 4DCDA 1L1GA 3URDA 9ESTA 1UVPA 2FTLE 1WQVH 2EC9H 4X2XA 5DP8A 2P8OB 3RXOA 1BTXA 4YO9A 1EAIA 4CRGA 3A80A 3LGTA 1V3XA 1UTOA 1GHWH 1O3CA 3LC5A 3P70B 2ZGCA 1GJ7B 3W95A 1YPMH 1SBWA 1AY6H 1QBOA 1ZPBA 5J4QA 1QJ6B 1ACBE 1O3KA 2ZP0H 3C27B 3IITA 3PO1C 5A8YA 3ZVDA 5C20A 1O33A 2SFAA 1TGTA 3SHCH 3LPRA 3ZZ6A 1C5PA 4ZMAH 1RXPA 2SGDE 1O5FH 2VIDA 2HNTF 3E0PB 4B2CA 2D26C 1SHYA 1BHXF 1BMLA 1CU1A 3T5FH 3JZ2B 1EOLA 4ZXYH 3A88A 3UTUH 1HAHH 2Y7ZA 2GMTC 3KQBA 4X2VA 1CE5A 1IQEA 1MD7A 5DG6A 1BJUA 2H9TH 1P2KA 3BV9B 2JETC 1J17T 3FP8E 3PLBA 1Y3XA 1MTUA 1SGFG 4AYYB 2CGAA 3ENSB 4B2BA 4IMZA 1EZSC 2RA3A 1SQOA 1NC6A 2TGDA 3ZYDA 2A4QA 3RXMA 1WBGB 1CO7E 4X0WU 4ESTE 1G37A 2OTVA 1PPCE 1GBDA 3LGIA 3SV6A 3VB7A 2BDGA 3U1JB 2PKAA 2PKSC 1YYY1 4OS2A 1GI6A 4YOIA 3GCTF 1W14U 1P05A 3GISB 2ZPSA 2M5TA 4WF8A 4JZIA 1AE8H 4ISHH 2H9EH 2AMDA 1GBEA 1GG6B 2Z9JA 1L4DA 5GWZA 1XXDA 5FBEA 5ESTE 2XTTB 3A84A 1NRRH 3GDVA 4UONA 1SQTA 2OQUA 1H8DH 4AORA 3F6UH 2FESH 4I7YH 1O34A 2ZO3H 5EXMA 2F9PA 1EP5A 4UFDH 1O2KA 1KXFA 1UTPA 4DW2U 3SQEE 3TGJE 3A89A 2HNTE 1GBHA 4BXWA 1BB0B 1FPCH 4SGAE 4XE4A 5EG4A 1A7SA 4XBBA 3SQHE 3GDSA 1VJ9U 3M5LA 2XXLA 4JK5A 4RKJB 1TPOA 1O38A 1JBUH 3OTJE 1TNHA 5I46H 3CS0A 4B2AA 2ZPRA 5HYOA 2HOBA 2HVXA 1K1PA 2EA3A 3TGKE 4Q7YA 1TX7A 3KIDU 1C1MA 2R3UA 1HNEE 1E37B 3Q76A 1TABE 3P92A 1OWIA 2WPKS 2BVRH 1FZZA 2BD5A 3R3GB 2ALPA 2FLBH 1G30B 1P9SA 1JWTA 2HLCA 5EPNA 4Y76A 4LOYH 1O2HA 5B6OA 3QO6A 1HYLA 2ZFPH 2ZA5A 1TMBH 3LGUA 1FPHH 2Y5HA 2A4GA 3L3TA 3RXRA 4UDWH 2FS9A 4F49A 3OSYA 1C5TA 1O2LA 8GCHG 3BG8A 5GPIB 1SLVB 2ZU1A 2Q6FA 1HAIH 5K7RA 3PLKA 2Q6GA 1CSOE 1O5AB 1E34B 3E90B 2SGFE 1KXDA 4JYVH 1VGCB 3RXGA 3UNSA 1MTWA 4QT8C 1QB1A 1NFUA 3LGYA 1P3CA 2WPMS 4E7NA 4GUXA 2O8MA 1GI3A 4O03A 4FUBA 1IHTH 1DITH 8LPRA 3LDXH 1BJVA 2G8TA 1FY3A 4XDEA 1DUEA 2HNTC 4NIXA 2BLVA 1TGNA 5ETXA 1P04A 2JH6D 3PYHA 3SU0A 1AVXA 5DP3A 4BAHB 2H2ZA 1CBWB 3SHAH 2H1UA 3CENA 3HK3B 3PWBA 1RTKA 1O2NA 1K28D 1BOQA 3EDXB 2FODA 1RTLA 1ELBA 2I6SA 1UVTH 4E7RG 3SW2B 2CN0H 1AQ7A 2Y82A 5EGMA 3EA7A 4U30A 4A7IB 5EW2H 3A81A 4JZ1A 3OY5U 3GCTG 5CHAC 3H7OA 2ULLA 3DT0H 4AFSA 1V2JT 1NZQH 2FOHA 4AYVB 3TJVA 3SJ9A 2ZZUH 4ZAEA 3VXEH 1VCQA 1TBZH 4NCYA 2VWOA 1HAGE 1AKSA 3PMAB 4DOQA 5C1XA 2TBSA 2W3KA 3HK6B 3MOCA 2VVUA 2SGQE 3SJ8A 1ORFA 5ABWA 1P9UA 1SGYE 1TIOA 2JKHA 1LCYA 2VIPA 1V6DA 3AAVA 1XUIA 2Z9GA 4Z0KA 3UR6A 3PTNA 4ISOA 3HGPA 2ANYA 1C9PA 1WCZA 1S6HA 2A32A 2FEQH 1PFXC 2GT8A 5SGAE 4CH2B 1ZGIA 1DM4B 1LVBA 3E0NB 4MNYA 1P09A 3ZYEA 2QIQA 4X1RU 3SUEA 2ZHEH 4I8LA 1NRNH 5PTPA 2BX4A 1YLDA 4NWLA 2NWNA 2OLGA 2GCTC 3P6ZB 4X1QU 3OYPA 1O2XA 3VB4A 5JBCS 1EAUA 3SV7A 4Y71A 3R0FA 1MKWK 3VEQB 4D76A 1V2TT 2UWPA 1YPGH 4U2WA 1JIRA 2BB4A 3DHKH 1V2LT 3ATIA 3ZZ9A 3ODDA 5IYTA 1TA6A 2QY0B 5AFZH 3PV4A 2XCNA 5A8XA 3H7TA 1A0LA 4Y8ZA 1DLEA 2GDEH 2XWBI 3GY5A 2SGAA 3RU4D 2BDCA 1J16A 2C93B 1ZJDA 1TLDA 1TX8A 3RM0H 2PFEA 4IS5A 4KTSA 3DD2H 1ID5H 2V3HH 4OGXA 2TGTA 1W7XH 5JBBS 1YCPK 2P94A 1SFIA 2VGCB 1G3BA 1AFQC 1DWEH 3RXEA 5F8TA 3F9GA 1QB6A 3SGAE 3UOPA 3SGQ<