1C5YB

Structural basis for selectivity of a small molecule, s1-binding, sub-micromolar inhibitor of urokinase type plasminogen activator
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
248
structure length
248
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLMSPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKEASTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Blood clotting
molecule keywords PROTEIN (UROKINASE-TYPE PLASMINOGEN ACTIVATOR)
publication title Structural basis for selectivity of a small molecule, S1-binding, submicromolar inhibitor of urokinase-type plasminogen activator.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 248
sequence length 248
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 1999-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5yB02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5yB01
2KAIA 4GVUA 2JH6D 3S7KB 3TGIE 1TIOA 1AIXH 4JK6A 3MYWA 1TPSA 3RP2A 1DVAH 4LK4A 2B9LA 3L3TA 3TJOA 1Y8TA 3PLBA 3RXMA 3UR9A 1BMMH 1CT2E 1YPMH 1OWDA 3ZZCA 1GGDB 5E2OA 3SJOA 2PUQH 3V0XA 5DP6A 1O3EA 2AYWA 3SNEA 1BCUH 2A5KA 3QDZB 1L4ZA 1LPZB 5E0JA 4ZKSU 3EQ0H 4B75A 4CR5A 3S69A 2THFB 3PLKA 1C2IA 2C8ZB 2UWPA 2F91A 3HGNA 1ACBE 2VGCB 3MOCA 4DIHH 2A4QA 3FP8E 1ZJKA 1PPCE 1DX5M 1P2IA 1T4VH 1W12U 2H2ZA 1O5DH 3KQDA 4I8LA 3TGKE 1KLIH 1O31A 4Z0KA 1GL0E 4NIXA 2GTBA 1CT0E 1E37B 1G2LA 2PKAB 1IQIA 1GVKB 3STIA 1UK3A 1UTKA 1AVWA 1L1NA 1AFQB 1LVOA 2WUCA 5PTPA 4F4OC 4X2XA 4UD9H 1TOCB 2OC0A 3V7TA 2P94A 3K6YA 1AB9C 3SGQE 4Y76A 1O2GH 2R0LA 5EGMA 3PO1B 2FP7B 4ABFA 4D76A 1QL9A 1UHBB 2P59A 3TK5A 3LGWA 4MNYA 1CGHA 2I6SA 1GBAA 1OP8A 1E38B 1BQYA 3ELAH 2ZIQH 1UTNA 3PMAB 2BQ7B 2FDAA 1MBMA 1ANCA 2BXTH 2CF9H 2LNCA 2VIPA 1BMAA 1IHSH 1KXAA 4DOQA 1O3AA 2FS8A 1K1IA 3Q3YA 5JYIA 1T32A 1K1MA 1SI5H 1ZTLA 2G4UA 2BD2A 1TNJA 1SLVB 4M7GA 2GCTC 1C5LH 3M7TA 4WH8A 3MHWU 1BIOA 3IWMA 1GMHF 1P8VC 1ZHPA 1LDTT 3R0FA 3URDA 5TJXA 1QFKH 3OY5U 1TMBH 1Y5BT 1W7GH 4MDSA 1GVZA 1CA0B 3KQBA 4ZKOU 2ZG0H 1O2ZA 5C1YA 2P3TB 5C1UA 1UTOA 1Y59T 1C9PA 2ZKSA 3QTOH 3SGAE 2GT7A 1S84A 2FI3E 2BQWB 5F8XA 3EAJA 4AOQA 4JZIA 3SNBA 2BDBA 1YLCA 2BD4A 1ANDA 1GJ6A 1CHGA 4TY7A 4BAQB 3PTBA 2ZFSA 1BOQA 3BTFE 5BRRE 1YCPH 1FXYA 1P01A 3BTHE 1SGQE 1O3DA 1QA0A 1SFQB 1EB1H 2BVXH 4ISIH 2TBSA 3B8JA 3A7WA 1TX7A 3PWCA 3RXIA 2Y82A 1AQ7A 4IC6A 1BA8B 4BAHB 1GCTB 3LC3A 5T6FA 1VJAU 4BAMB 4Y8XA 3SJIA 3U8RH 5HYOA 1D3TB 3I29A 3I77A 1N1LA 3RXJA 1SBWA 4CHAC 2EI6A 3KGPA 3RXHA 1A3EH 1SC8U 1B0EA 2XW9A 4R0IA 1O2YA 5HM9A 3EE0B 1AFEH 3LH1A 1HNEE 1N8OB 1MTWA 1OOKB 1XKAC 2ZTYA 1ESAA 3A81A 1GJAB 1P2QA 1WQSA 2PTCE 1ZRKA 2ZEBA 4FUIA 3LGTA 2IN2A 1OYTH 1GBCA 1D6RA 3P70B 1C2KA 4WF8A 3PROA 5AF9H 3SN8A 5FCRA 6GCHG 3SI3H 3E1XB 3RXSA 3M3SA 1MUEB 4A1XA 1H1BA 4Y10E 2TGTA 5DP4A 3P95A 2VH0A 2GZ8A 2ZDVH 1LTOA 7GCHF 3QLPH 4X8SH 4O3TA 4ZHLU 1O2QA 4B1TA 2ESTE 1UJ1A 2Z9GA 4GCHG 4ZXXH 1Y3VA 4YLQH 5JB8S 1O37A 3P8NA 5FX6A 4A92A 1M9UA 4OS1A 3SU3A 1T4UH 1SB1H 1SOZA 1P9SA 4XBDA 3PWBA 3U69H 3TJVA 1CT4E 1SSXA 1FONA 2VVUA 3T2NA 2Z3CA 1QNJA 4ZXYH 3DUXH 1AD8H 2SGAA 4O97A 5JBBS 1BT7A 3D23A 4ZH8A 1TRMA 4MG3A 4K1TA 4YOJA 1P09A 5CHAB 1T7CA 5CMXH 1O2OA 2OTVA 1EP5A 2GV6A 3SV7A 1GJCB 1V2MT 1GHAF 1KDQA 1MKXK 1OWHA 4U32A 1LQEA 5ESTE 2G5NA 1EPTB 1Z7KA 2VWNA 2G81E 2Q6GA 3UY9A 5AFYH 3M3VA 1C2LA 4Z6AH 2WV5A 2PSXA 1KLTA 4B73A 4FUHA 1C4U2 1LKAA 3UOPA 2JH5D 1XUKA 1P57B 3LGYA 4AFQA 4KKDA 1O3OA 1BTXA 2ZFQH 1HAIH 4K8YA 1CU1A 2PTNA 1CGIE 3STJA 5IDKA 4X6OA 1C5VA 1O3LA 1PQAA 2VGCC 3LDXH 2RCEA 2A7CA 1GHVH 1FQ3A 3PTNA 1ZRBA 1KTTB 4XBBA 5EXMA 3LONA 1C5XB 2BD9A 4TWYA 1F5KU 2ZGCA 4FUBA 1DSUA 1V2WT 2O8UA 5AHGH 3SUEA 1TYNA 1AFQC 5EOKA 2B8OH 1N6YA 3K9XB 3MH4A 3M5LA 1QBVH 2ZU4A 2AIQA 1P05A 5A8YA 2NU4E 3E6PH 2OC8A 1NY22 1SGRE 1GMCG 1XUGA 2GV7A 2FOFA 1TQ7B 4ZMAH 4ABAA 2XXLA 1GBEA 1C1PA 5FBIA 1MH0A 2R3UA 2R2WU 3NKKA 1QY6A 1O3FA 1EAIA 1O5BB 1A7SA 4VGCB 2BHGA 1C2DA 1IQNA 3RXVA 1OKXA 2QXIA 1GHXH 3SW2B 3SNDA 3NXPA 2FLBH 2Z9KA 4CBNA 1ZGIA 4NA7A 3SGBE 2H9TH 4BTUB 1Y3XA 3C1KA 2ZGBH 1O2HA 1A0HB 1ZPBA 5LPEA 1NPMA 1UVTH 3PMJA 1PFXC 2GVFA 2H1UA 1ZJDA 2F9OA 1UK2A 4YOIA 3ESTA 1MU6B 3BN9A 1NRPH 1ZMLA 1TBZH 2CV3A 2WINI 1Z8IB 1X7AC 2HRVA 2WPJS 1O2TA 2J95A 1SR5C 2ANYA 1W11U 1AU8A 3FZDA 2FODA 2TRMA 4Q7ZA 2ZHWH 3TJNA 3ZZ4A 3ZYEA 3BSQA 8GCHG 1FMGA 3E16B 3MU1A 2GGVB 3OX7U 2ZHDA 4X2WA 4ZUHA 3SV8A 2QGRA 2QXHA 1TALA 2R0KA 2BY9X 3TH3H 4X1QU 1JRSA 4X6PA 2QAAA 1T8MA 3MH5A 4D7GA 3SBKA 3KHVA 1GCTC 5LH8A 2JETC 1G3BA 2VNTA 1O3HA 1AKSB 3A8BA 1S82A 3LPRA 1QTFA 1AB9B 1TAWA 5FPSA 1ZHMA 4DT7B 5CE1A 1JBUH 1FN6A 1IAUA 2NU2E 1J15A 3U98H 1ELAA 3RC4A 4IS5A 1O35A 4FUCA 3T27A 3GOVB 2SGQE 1ZGVA 5A8XA 3ZVFA 2BM2A 4X6MA 1YM0A 2OINA 1ELEE 1P10A 5C20A 1F92A 1N8OC 1DWEH 1FDPA 1NS3A 1QB1A 1SGNE 1C2EA 1XUIA 3MWIU 1OPHB 1KLJH 1XUFA 3A8AA 4Q2KA 2ZHFH 2NU3E 3M7UA 4UFEH 1G9IE 1V2VT 4DCDA 1QQ4A 1C1WH 3T29A 1GHBG 1V2ST 1O5GH 3UNQA 1SGTA 5ESBA 3A87A 1ZOMA 1HAZB 2ZGJA 2C8YB 1NU9A 3MO6A 1Z8JB 2CGAA 4NWLA 5FBEA 5A09A 1FIWA 1RRKA 5EQQA 3S9AA 3ZZ9A 5LGOA 1XXFA 2IJOB 4WH6A 2ZDKA 1DSTA 3IITA 1O2KA 3RM2H 3PMHB 4YO9A 1P2OA 1MTNB 1QL8A 3U8OH 4MTBA 4INKA 1D3PB 4FUJA 1HJAC 1F0SA 1MTVA 2XC5A 1QBOA 2A7JA 2H6MA 1IQKA 3HKJB 3LKWA 4FVDA 1EQ9A 3NUMA 1C1RA 1E0FD 2QF0A 3AVZA 1VITH 1TGTA 1EPTC 2B7DH 5F6MA 1NROH 1O36A 1V2NT 1A61H 3P6ZB 5DK1A 1FIZA 2BMGB 4GPGA 1WU1A 4WXIA 3HK6B 4HGCA 4NZLA 1TNLA 3GDUA 4MLFB 1KIGH 2ODQA 1VCWA 1BTPA 1FNIA 2GCHG 1ELGA 1GI0A 4FUDA 2ZNKH 3ATLA 4O3UA 3SQHE 2ZECA 3MNSA 2Z9LA 4CH8B 1BTZA 2QXJA 1AI8H 3RU4T 3EGKH 1EX3A 4OS6A 2O9QA 3ZVDA 3SUFA 1VR1H 1ZSLA 1A1RA 3HPTB 1DICA 2BVSH 1TNGA 1HAVA 1C2GA 1ARCA 1U6QA 1MZDA 1Z6EA 1CA8B 3A84A 1S85A 2WYGA 1SGEE 2PLXA 2FTMA 1DFPA 1BBRH 1E35B 2Z9IA 1C1QA 1OYQA 2OCVB 5T6GA 7GCHG 1LPKB 4DIIH 3GCTG 1SQTA 2CHAC 1QJ6B 4INHA 3NZIA 2OXSA 1KY9A 1O30A 2BB4A 2O8MA 4Y8YA 3TIUA 2W7SA 1CHOF 3HATH 1SPJA 1YLDA 4UFDH 1C2FA 2XBXA 3U9AH 2ZFRH 4MPUA 1QJ7B 3ZV9A 1O3KA 2SNWA 4NG9H 1DM4B 3W94A 1D3DB 4I33A 1SGIB 2AMPA 2Q6FA 2FOAA 1W8BH 2J2UA 5FXLA 3KIDU 2O8TA 1YPGH 3V13A 1ANEA 1TABE 3LJOA 1A2CH 1DXPA 2PHBA 4J1YA 2ZTZA 1ELTA 3K2UA 4HZHA 1KTSB 1AZ8A 1EJAA 2VVCA 4H6TA 1GHAG 2AGGX 4ISHH 2HNTC 4I8JA 3M35A 5EW1H 1DOJA 3M61U 4ISOA 1YCPK 3ZVEA 2H5CA 5T6DA 2ZU1A 3NCLA 4K60A 1W0YH 1P2MA 1NRQH 3OTJE 1IQEA 1K1NA 1AMHA 2Y5HA 5DGJA 1DWCH 4Q80A 1SHHB 3FP7E 4KELA 1EZSC 1TBQH 1O2JA 3RDZA 2XC0A 1B0FA 1SLUB 1BB0B 1OXGA 2ZU2A 4GHTA 3T28A 3JZ1B 1WBGB 3UNRA 4I8GA 2BX3A 3PV4A 1WOFA 5DP3A 5TCAA 1HXEH 4UE7H 1BMNH 1J8AA 4WVPE 1O5CB 1GBIA 2HWLB 2ODPA 2Y81A 1TPAE 1TLDA 3P92A 1C5QA 2FYQA 4YESB 4NCYA 1IQHA 3QZQA 3RU4D 3QO6A 4D9QA 3ZZAA 2RDLA 1RS0A 3LT3A 4GHQA 3GY4A 3PYHA 4LZ1H 1VITF 4UDWH 1W7XH 4X1PU 1RIWC 3UNSA 2RG3A 2XCNA 3SJ8A 1EASA 3SU2A 3DFJA 3EDXB 1DPOA 3LU9B 2Z94A 3KQEA 3QK1A 4K1SA 1AO5A 4XBCA 1Y3WA 4TPYA 1FY3A 3ZVCA 2AMQA 1AUJA 2ANKH 3GCOA 4TY6A 2Y5GA 4OGYA 1SGFG 1BTHH 2ZGXH 1GVLA 1KYNA 2OC7A 2PW8H 4RKOB 3OU0A 1QB6A 5J4SA 4X1SU 1PQ8A 3A89A 1DWBH 3O8DA 5A2MH 5E0GA 2XBYA 2VWMA 1TQ0B 4CRGA 2BDYA 4THNH 2GZ7A 1AY6H 1SVPA 3BG4C 5A0BA 3SU5A 3BTEE 4X2VA 2QIQA 1O3PB 1TONA 2GZ9A 1GJBB 1C1OA 3V12A 5TCCA 4CRAA 1BMLA 1ZMNA 5T3HA 1AZZA 1MTNC 2ZU3A 1Y5AT 1HAGE 2BDHA 2H5DA 3KL6A 4KTUA 5JBAS 3TLOA 4BANB 1V2RT 1LMWB 1PPFE 2PGBB 3DT0H 9ESTA 5GXPA 1JWTA 2FEQH 1O32A 1IQFA 2FOBA 2R3YA 1OSSA 2P3UB 4I8KA 1ELBA 1RXPA 2F9BH 7KMEH 1C1VH 1O33A 2A7HA 1PYTD 2JETB 2VINA 1FZZA 3ZZ6A 2PUXB 1V6DA 2A4GA 3S7HB 2W5EA 4BTIB 1NFYA 1NRSH 4JZ1A 2I6QA 2A0QB 2VB0A 2ZPQA 3T26A 1E34B 1WYKA 4ESTE 1ZYOA 1LVYA 3F1SB 3S0NA 2HVXA 4CBOA 1F0RA 1XUHA 3RXDA 5LPRA 4UFGH 4E7NA 3SNCA 2DE8A 4JYUH 4JZEH 4H42U 1GJ5H 2C4FH 3CS0A 4FVBA 4ABBA 1HXFH 3SV2H 3MNCA 1FY1A 2TPIZ 4D7FA 4BNRA 2PKSB 1ZTKA 3SZNA 1PJPA 4B2BA 1LPGB 3RXPA 4MNWA 5AFZH 1TOMH 4GUXA 3MNXA 1WSSH 2Z6BD 2D1JA 2HPQH 3KNXA 3UUZA 3NPSA 3ZVGA 4X2YA 3PMBB 5GCHG 3RXBA 1QBNA 3PB1E 1DXWA 1TNIA 1AUTC 3D49H 1V2PT 3K6ZA 3UR6A 1YPLH 1BHXB 1YP9A 4MPWA 1D6WA 3BTKE 2SGEE 3A7ZA 1C1NA 4A1TA 4ASHA 3ZZ5A 1FV9A 1RTKA 3UWIA 4Y8ZA 3MMGA 5HM2A 4B74A 4NZQA 4MPVA 1F0UA 3TK6A 4B76A 2FMJA 1GMDG 2FX6A 2PKAA 4CRBA 1B7XB 4ZKNU 1T8LA 2ZO3H 1T8OA 2STAE 5DP7A 3SI4H 5IYTA 1HJAB 3M37A 2TGDA 3RXUA 4LZ4B 2EI7A 1UCYK 2J94A 1WTGH 1W3CA 3OY6U 1W2KH 1HAHH 1EZUC 2AERH 2A4RA 1V3XA 1UHBA 2GDDA 2OD3B 4IMQA 1C1UH 1DDJA 3BTTE 1THPB 2DE9A 1O2MA 4NSVA 3MO3A 3VFEA 1C4V2 2BOHB 2ZQ1A 2SNVA 3RXGA 2XWAA 2ZDLA 2AEIH 3BEFB 3L33A 1DUEA 2EC9H 2GT8A 1JOUB 1AGJA 3BEIB 4FUFA 3A83A 3A85A 1RTLA 5C5NA 3GCNA 1K2I1 4DGJA 3ZZBA 3TNTA 3SV6A 2ZDAH 3OYPA 3SV9A 2CMYA 3A82A 1SQOA 1HRTH 3T5FH 1DLKB 5EU8A 3VB6A 3VXEH 4IN2A 3U1JB 2R9PA 3BTME 3SOSA 1HYLA 1GJ7B 1AVXA 1C2HA 1L1JA 3AAUA 5JBTA 1YPEH 1HB0B 2A4OA 5E8EH 1S5SA 3BTDE 5GWZA 1T31A 2VIDA 5I25A 2B5TB 3Q3KA 1L0ZA 1O2WA 2CHAB 4CR9A 3IG6B 1ZLRA 2BLWA 2ZCLP 4HI3A 1HV7A 1DLEA 1HDTH 1ZMJA 1H9LB 1AN1E 1O3IA 3SJKA 5ETXA 4XFQA 3TU7H 4IMZA 1YBWA 1EB2A 1C5NH 8KME2 1O2NA 4CRFA 2ZFTA 1G2MA 1SGCA 1SGPE 4SGBE 1MQ5A 4I7YH 1C5PA 9LPRA 4AYYB 1TBRH 4CRDA 3RXLA 4WY3A 1CBWB 2A45B 1GI5A 2OBQA 2W7UA 1DUAA 3BIUH 3HKIB 2NU0E 4UONA 3F68H 3SORA 3RXFA 4KTCA 4NGAH 4AFZA 5E2PA 3T25A 1HIAB 1Z71A 3AASA 3D62A 1A3BH 4NIYA 1C5TA 3GCHB 1O5FH 3ATWA 4X8VH 1GBDA 1TWXB 3A88A 1HAOH 1LVBA 4OGXA 1F7ZA 3FP6E 3SNAA 1TX6A 1BBRE 2P93A 2V0BA 1C5SA 1HJ9A 1C5OH 5K7RA 3RMOH 1MU8B 1UCYH 2BY5X 5EPNA 3M7QA 1O39A 3GDSA 1UVOA 2F9PA 1TNKA 4AYVB 4INLA 1GJ4H 1YPHE 4JMYA 3RM0H 1E36B 5HXFA 3MU5A 3VGCB 1W13U 2TIOA 2PFEA 1BJUA 3LIWA 4BAOB 1O38A 1C2MA 2A32A 3VB3A 4ABEA 1NT1A 5JBCS 1ABIH 3MO9A 2GX4A 1GI3A 3ZVBA 1J16A 4DG4A 4XDEA 4K8BA 1G36A 2FOMB 2NWNA 1SMFE 2BD5A 2SGDE 2BDCA 5L30H 1W10U 1UTJA 3MU4A 1BBRK 1SFIA 1RIWB 2WPMS 4A7IB 2KAIB 2BX4A 1VGCB 2CXVA 3DD2H 3RU4E 2OLGA 2Y7XA 3M5MA 1C5ZB 1GMHG 3GY6A 1UVUH 1MD8A 2BXUH 4NIVA 3H5CB 2PKSC 3ODDA 1D4PB 1VCPA 1O3NA 1ABJH 1GHYH 1L4DA 4RN6A 2CF8H 2G5VA 1BRBE 1OWIA 3OSYA 1P04A 1NFUA 3SQEE 1EPTA 3I78A 1K1JA 4WMFA 3UREA 4Q7XA 1XKBC 1S0RA 5DO4H 1GJ9B 1Q2WA 3Q00A 1ZPCA 1Z8GA 2ANWA 1NFWA 1NFXA 2RA0A 3S9CA 1GJ8B 2QYIA 4Q7YA 3BG4B 5FX5A 4IC5A 1MD7A 4KP0A 1GBLA 2UUYA 1MQ6A 1SLWB 1VJ9U 2ZGHA 4AB9A 3QN7A 1NZQH 3TH4H 1QJ1B 2ANMH 4B2CA 4U30A 6GCHF 3ZVAA 1BTWA 1H4WA 3KCGH 4B2AA 1BTUA 3QWCH 2FZZA 4Y7BA 3SHAH 1GI9B 1TPOA 1EJNA 1QRXA 2XRCA 2VWOA 4MNVA 3BV9B 3QUMP 2UWLA 5A0AE 2G51A 1A0LA 3F9EA 4DY7B 4WMEA 2Y80A 3EYDA 1HBTH 5DG6A 3E91A 1KXFA 1KXBA 4R8TB 1QHRB 3EA8A 1YPJH 4GCHF 1V2UT 2XTTB 3A8DA 3T62A 3TH2H 4Y6DA 1C5YB 1K21H 5L2ZH 3BTGE 1H8IH 4HFPB 1K1OA 1HPGA 5A0CA 2AH4X 3TVJB 4RKJB 2FYRA 3AAVA 1O5AB 4ABIA 2O8LA 3DHKH 3VXFH 4FUGA 1ESTA 3RXEA 2ZDNA 2GDEH 3A7XA 3GY3A 1DE7H 1LO6A 5C3NA 4YM9A 4KGAA 3BIVH 3KQCA 1J17T 2ZPSA 2FOEA 3ZV8A 3RXOA 1C5UA 3BTWE 3ZZ7A 2Q1JA 3P17H 3SHCH 2UUJB 1HIAA 1TNHA 1ZTJA 2ZCHP 2ZF0H 1TA2A 1YKTA 5ABWA 1NM6A 1Y3UA 5JDUB 4IBLH 1FY5A 4RSPA 3F9FA 4O9VA 3H7OA 1S6FA 3EA7A 1H9IE 4CRCA 3ZZ8A 1HAXB 2QXGA 2RA3A 1TA6A 1FUJA 4H4FA 1JIRA 1WQVH 1NRRH 5H4IB 1INCA 1GDQA 1ZSKA 3MH6A 4ZROA 2UUKB 3A7VA 4YT6H 1O2UA 2Z3DA 8ESTE 4ISNA 2BY6X 1HAPH 1YYY1 1GWAA 1EUFA 3LJJA 3SU4A 1CBWC 2YNBA 4MPXA 5F8ZA 1GMCF 2C93B 4AG2A 3KN2A 1C5MD 1FY8E 3CENA 1AKSA 4YTAA 4JCNA 2VVVA 4B71A 1DY8A 3H7TA 1GBFA 2GP9B 2GKVE 1ID5H 1MCVA 3GCHC 1O3CA 1P0SH 3VEQB 3MTYA 2C90B 3A7YA 1HAYB 2SGPE 1MAXA 1XM1A 1SG8B 1OWEA 3ZZ3A 1F2SE 4AGKA 3UIRA 1Z1IA 2UUFB 2ZU5A 2AFQB 4CH2B 1SGFA 3EA9A 1SHYA 1ZZZA 2WPKS 1V2OT 3LGVA 1O3BA 1HFDA 1GDNA 3GY2A 3M3TA 1YGCH 1BITA 4A1VA 2FM2A 2EI8A 1HJ8A 4I8HA 2ZQ2A 3VGCC 3NWUA 2BY7X 2O8WA 3RC5A 5SGAE 3QGNB 1AE8H 4F49A 1ZSJA 3GY7A 2UWOA 4FXGH 2BZAA 1Z1JA 4NSYA 1G32B 2ILNA 1RJXB 1P2JA 1FN8A 2AIPA 2GMTC 2FI5E 2P8OB 2BDGA 3FANA 4FU9A 4OS4A 5DP5A 2F83A 2TGAA 1LHFH 1TGCA 2F9NA 3UOUA 1GBTA 1QB9A 1XUJA 2VIVA 3A86A 4LOYH 4BXSA 2Y5FA 2CJIA 2QA9E 1IQLA 8GCHF 3DFLA 1PPBH 4UEHH 1ZHRA 4WWYA 2Z7FE 1G3EA 2Z3EA 4Y7AA 3RUOA 2XC4A 4NA9H 1VGCC 1TRNA 4TPIZ 2ZC9H 2YOLA 2ZA5A 1GI2A 3SU0A 1KXDA 3MH7A 1PPEE 4OS7A 4Y0ZE 8LPRA 4ABJA 1L1GA 4K2YA 2G55A 1BJVA 3TJUA 5GPIB 3ITIA 1KDQB 3RC6A 5L6NH 2FOCA 3WY8A 3URCA 1OP2A 2XCFA 2SFAA 4JYTA 1O3MA 2VIQA 3Q76A 3Q77A 1LQDB 1YF4A 3GY5A 5C5OA 1OWJA 4HTCH 1AVGH 1NC6A 1S83A 3N7OA 1H9HE 4ABDA 3HGPA 5GDSH 3TPIZ 2OP9A 1EATA 2QY0B 3RXQA 1AWHB 2YNAA 4X6NA 2Y6TA 4DW2U 3PM3A 4ISLA 1WV7H 3GYLB 1O2PA 2WPHS 1GHBF 4JZFH 1QRWA 2V3OH 1Z6JH 1P2KA 1P11E 2ZI2H 1MBQA 2H9EH 1EXFA 2ALVA 1S6HA 2QF3A 1P9UA 4MQAA 1A5HA 2VH6A 3RXKA 2XYAA 3GDVA 4K3JA 3G01A 1V2QT 5E0HA 3TK9A 3FVFB 1XXDA 2G52A 2ULLA 4Y79A 1ZPZA 1GHWH 1MAYA 1YPKH 1ETTH 1O5EH 1LHEH 2VJ1A 2AGEX 3E90B 1W0ZU 3NK8A 3RLWH 2HPPH 4LXBH 3SUGA 4AORA 1ELFA 3ZZDA 2WPIS 3RXCA 3CS7A 1ESBA 1UVSH 1EOLA 4BOHA 1BHXF 1O3JA 1GBMA 1THRH 1D9IA 2EA3A 3E0NB 1EAXA 1C1TA 1ETRH 1O2VA 1FAXA 1H8DH 1UMAH 1UTPA 2FWWA 3FAOA 2PV9B 4XE4A 1P02A 3ZYDA 4YT7H 5JB9S 2A5IA 2F9VA 5EG4A 1HLTH 4OS2A 6CHAB 5I46H 1G30B 3AW0A 4AGJA 1Q3XA 1O0DH 5JPMH 1AHTH 4FU7A 1V2JT 1GCDA 1O2SA 1BRUP 1UCYE 4TWWA 5AVDA 1O2IA 2Z9JA 1B5GH 1MTSA 3F9GA 1EAUA 2ZCKP 4X1NU 4E7RG 2DUCA 2WYJA 2GCHF 2FX4A 3BEUA 3ODFA 1LHDH 1ZR0A 1GG6C 2OC1A 2WUBA 4H6SB 2AMDA 1EZXC 3P8GA 2QCYA 2JH0D 5EW2H 3LGIA 1DY9A 1SGDE 4K69A 3SU1A 1QCPA 2ZTXA 4PROA 1EJMA 4XSKU 1C2JA 1O2XA 3SU6A 1MKWK 1Q31A 1CSOE 1C1SA 4ABHA 4JK5A 2AGIX 2HALA 2FPZA 1ELDE 5F8TA 4AX9H 2C3SA 5DP8A 1C4Y2 3GCTF 1GI7B 4I32A 5GIBA 1GBJA 4U2WA 1FAKH 1FY4A 1IQMA 2BQ6B 1V2LT 2V35A 1G3DA 3B23B 4JZDH 4Y11E 4ABGA 5FCKA 1QURH 2LPRA 3CP7A 3BTQE 1PPHE 1QRZA 1Y3YA 3QX5H 1BZXE 1RTFB 1GHZA 3MI4A 4GLYA 1MMJN 2BOKA 2FI4E 2BD3A 3TITA 4NFFA 5FAHA 1THSH 2ZHEH 1UK4A 2VU8E 1CO7E 2NU1E 2WV4A 2PSYA 2JKHA 1AE5A 1F5LA 2PR3A 1V2KT 2EEKA 4E05H 1GGDC 2A2XH 2XBWA 4ZKRU 2AS9A 2QV1A 4WXVA 2HOBA 2ZZUH 1TB6H 1P3EA 3VB7A 1GBBA 1PPGE 4WMDA 3RXTA 2J92A 3VB4A 3A7TA 4AB8A 2P8OC 2HNTF 5K0HA 2A31A 1P3CA 1L2EA 4KTSA 4BAKB 1K28D 1CHOG 1XVMA 1F0TA 2ZPRA 2G8TA 1LKBA 1GJDB 3E3TA 3C27B 5DJ7A 2FIRH 7LPRA 1PPZA 3P8FA 1BRAA 1DWDH 2VWLA 1ARBA 2F3CE 2ALPA 3R3GB 4YOGA 2VIOA 1LVMA 5EODA 1IQJA 2Q6DA 1SQAA 2SGFE 2H9HA 3PO1C 3B9FH 1A5IA 1A46H 1MTUA 4IW4E 4GAWA 4NWKA 1SOTA 5L2YH 1QIXB 3MFJA 1GBKA 2PGQB 1QL7A 2BTCE 1KSNA 4AFUA 3GY8A 3MU0A 1TGNA 3BF6H 1K1PA 3KEEA 1FPHH 5HGGA 1WAYB 1EOJA 2OQ5A 4I31A 1TPPA 1OX1A 3UFAA 4AN7A 3BG8A 1MKWH 3VB5A 3SO3A 1HGTH 1QA7A 3AW1A 1RGQA 4DJZB 1OP0A 3GYMA 1O2LA 1ORFA 1CA0C 1WCZA 2FOGA 2XNIA 2A2QH 2VIWA 3GICB 1AWFH 3RMMH 3S9BA 2V3HH 3V3MA 1G3CA 5F03A 1A4WH 4BTTB 1HAVB 1C9TA 3O8RA 4QT8C 3TNSA 1Y5UT 4TYDA 1JMOH 1F5RA 2J4IA 1RFNA 3M5NA 5EQRA 4ZHMU 1JRTA 2ZDMA 1GL1A 1VCQA 3O8CA 1BTYA 2FS9A 2P95A 4K5ZA 3A80A 3E0PB 4CREA 1NTPA 2QN5T 4FU8A 1EAWA 2A5AA 1FPCH 1UO6A 2M5TA 4X0WU 4A5TS 1NO9H 3QZRA 4ZAEA 4FUEA 2GMTB 1EKBB 1GI6A 4SGAE 5EXLA 4MVNA 1IHTH 1VITG 2A1DB 1MKXH 2BDAA 5EQSA 3UPEA 5C1XA 3RMNH 1XMNB 1G37A 1JXPA 1A5GH 2R2MB 3LH3A 5GJ4B 1IOEA 5EXNA 5B6OA 1GI4A 2P16A 3LOXA 3D65E 1TX8A 3RXRA 3TGJE 1WTHD 2J34A 1BUIA 2FOHA 4OS5A 1CGJE 6CHAC 5G4BA 1LHGH 2D2DA 1DT2A 1GBHA 1K1LA 2B0FA 3DA9B 6ESTA 1BRCE 2XWBI 4YZUA 2FXRA 2TGPZ 3ENSB 1TRYA 1TFXA 2BY8X 1N6XA 2CN0H 3FZZA 1MZAA 3FFGA 5DPAA 3UQVA 1EP6A 5EPYA 4BXWA 4D8NA 4J2YB 4GSOA 3UQOA 3RXAA 4Y71A 1EZQA 1P06A 3HK3B 3PLPA 1J9CH 2BD8A 4X8TH 5C2ZA 2BLOA 5FPYA 3MU8A 1QR3E 2ZWLH 3M5OA 2IOTA 1SGYE 1YPHC 1DS2E 1KXEA 3U1IB 1UTMA 3M36A 2GCTB 1PQ7A 3ATKA 1K9OE 1QGFA 2OQUA 1XX9A 2G4TA 4DURA 3RMLH 3F6UH 1P03A 3O8BA 4X8UH 4IN1A 2K1QA 2BLVA 1GI8B 3L6PA 2ODYB 4XOJA 3LC5A 2PWXA 4IGDA 2Y7ZA 3F9HA 4NA8A 2ASUB 3UTUH 2D26C 3A8CA 1NU7B 2BD7A 2BYAX 5GCHF 1SLXB 3GISB 1OS8A 2W3KA 3VPKA 1CE5A 1IQGA 3QTVH 1GDUA 2HGTH 1KXCA 2WPLS 1C5RA 2BDIA 2ZP0H 1SL3A 4U01A 5C67A 3K65B 4AZ2B 1O2RA 1P12E 1TMTH 4AG1A 1RD3B 1T8NA 3UWJH 1C5WB 4E06H 4AFSA 2FO9A 4WJG2 2C8WB 5A8ZA 4O03A 1LCYA 1S0QA 1J14A 2XBVA 1TE0A 1GMDF 5CHAC 1CVWH 1C1MA 3ATIA 2BLQA 3Q3XA 3SUDA 2STBE 2D8WA 1V2TT 2OUAA 4NIWA 2C8XB 4ZHAA 1OWKA 2GD4B 1Z8RA 1S81A 1UVPA 3JZ2B 3U8TH 1PQ5A 3W95A 3SJ9A 1GI1A 5BPEA 4JYVH 1NESE 5FPTA 1O3GA 3QGJA 5HMAA 3E8LA 1HUTH 7ESTE 1HCGA 2J38A 1YC0A 4UFFH 4DVAU 1FJSA 4CHAB 2W26A 3KF2A 3P8OA 2G00A 2BVRH 1CQQA 2HNTE 4X1RU 2QC2A 2FESH 1TGSZ 5DKMA 3LGUA 1ELVA 1TMUH 2ZHQH 2HLCA 1VZQH 2FTLE 1FLEE 2V6NA 5DP9A 2OBOA 1GG6B 5J4QA 1UTQA 2FLRH 1ANBA 1JIMA 1FI8A 4NFEA 1UTLM 1D3QB 1K22H 2W3IA 1A0JA 2P3FH 6LPRA 1MCTA 1GPZA 1DITH 1ELCA 1YCPM 3MNBA 2IPHA 5LPFA 1P2NA 4VGCC 1WUNH 4D9RA 2BZ6H 4Y0YE 2ZFFH 2F9UA 1PYTC 2J9NA 1ETSH 1W14U 3ATMA 1QQUA 1DANH 4MNXA 1TGBA 3RLYH 4YLUA 2ZFPH 4A6LA 5FHTA 1O34A 1NN6A 1XVOA 1BDAA 1LHCH 1NRNH 4K1EA
chains in the Genus database with same CATH superfamily
5EJZA 2KAIA 4GVUA 2JH6D 3S7KB 3TGIE 1TIOA 1AIXH 4JK6A 3MYWA 3PRBA 1TPSA 3RP2A 1DVAH 4LK4A 2B9LA 3L3TA 3TJOA 1Y8TA 3PLBA 3RXMA 3UR9A 1BMMH 1CT2E 1YPMH 1OWDA 3ZZCA 1GGDB 5E2OA 3SJOA 2PUQH 3V0XA 5DP6A 1O3EA 2AYWA 3SNEA 1BCUH 2A5KA 3QDZB 1L4ZA 1LPZB 5E0JA 4ZKSU 3EQ0H 4B75A 4CR5A 3S69A 2THFB 3PLKA 4OM9A 1C2IA 2C8ZB 2UWPA 2F91A 3HGNA 2J98B 1ACBE 2VGCB 3MOCA 4DIHH 2A4QA 3FP8E 1ZJKA 1PPCE 1DX5M 1P2IA 1T4VH 1W12U 2H2ZA 1O5DH 3KQDA 4I8LA 4F55A 3TGKE 1KLIH 1O31A 4Z0KA 1GL0E 4NIXA 2GTBA 1CT0E 1E37B 1G2LA 2PKAB 1IQIA 1GVKB 3STIA 1UK3A 1UTKA 1AVWA 1L1NA 1AFQB 1LVOA 2WUCA 5PTPA 4F4OC 4X2XA 4UD9H 5C0TA 1TOCB 2OC0A 3V7TA 2HLDD 2P94A 3K6YA 1AB9C 3SGQE 4Y76A 1O2GH 2R0LA 5EGMA 5T1VA 3PO1B 2FP7B 4ABFA 4D76A 1QL9A 1UHBB 2P59A 3TK5A 3LGWA 4MNYA 1CGHA 2I6SA 1GBAA 1OP8A 1E38B 1BQYA 3ELAH 1UW7A 2ZIQH 1UTNA 3PMAB 2BQ7B 2FDAA 1MBMA 1ANCA 2BXTH 2CF9H 2LNCA 2VIPA 1BMAA 1IHSH 1KXAA 4DOQA 1O3AA 2FS8A 1K1IA 3Q3YA 5JYIA 1T32A 1K1MA 1SI5H 1ZTLA 2G4UA 2L74A 2BD2A 1TNJA 3FN8A 1SLVB 4M7GA 2GCTC 1C5LH 3M7TA 4WH8A 3MHWU 1BIOA 3IWMA 1GMHF 1P8VC 1ZHPA 1LDTT 3R0FA 3URDA 5TJXA 1QFKH 3OY5U 1TMBH 1Y5BT 1W7GH 4MDSA 1GVZA 1CA0B 3KQBA 4ZKOU 2ZG0H 1O2ZA 5C1YA 2P3TB 2W6JD 5C1UA 1UTOA 1Y59T 1C9PA 2ZKSA 3QTOH 3SGAE 2GT7A 1S84A 2FI3E 2BQWB 5F8XA 3EAJA 4AOQA 4JZIA 3SNBA 2BDBA 1YLCA 2BD4A 1ANDA 1GJ6A 1CHGA 4TY7A 4BAQB 3PTBA 2ZFSA 1BOQA 3BTFE 5BRRE 1YCPH 1FXYA 1P01A 3BTHE 1SGQE 1O3DA 1QA0A 1SFQB 1EB1H 2BVXH 4ISIH 2TBSA 3B8JA 1WXRA 3A7WA 1TX7A 3PWCA 3RXIA 3WWFA 2Y82A 1AQ7A 4IC6A 2YMSD 1BA8B 4BAHB 1GCTB 3LC3A 5T6FA 1VJAU 4BAMB 4Y8XA 3SJIA 3U8RH 4K1EA 5HYOA 1D3TB 3I29A 3I77A 1N1LA 3RXJA 1SBWA 4CHAC 2EI6A 3KGPA 3KYFA 3RXHA 1A3EH 1SC8U 1B0EA 2XW9A 4R0IA 1O2YA 1H8ED 5HM9A 3EE0B 1AFEH 3LH1A 2W6ID 1HNEE 1N8OB 1MTWA 1OOKB 1XKAC 2ZTYA 1ESAA 3A81A 1GJAB 1P2QA 1WQSA 2PTCE 1ZRKA 2ZEBA 4FUIA 3LGTA 2IN2A 1OYTH 1GBCA 1D6RA 3P70B 1C2KA 4WF8A 3PROA 5AF9H 3SN8A 5FCRA 6GCHG 3SI3H 3E1XB 3RXSA 3M3SA 1MUEB 4A1XA 1H1BA 2JIZD 4Y10E 2TGTA 5DP4A 3P95A 2VH0A 2GZ8A 2ZDVH 1LTOA 7GCHF 3QLPH 4X8SH 4O3TA 4ZHLU 1O2QA 4B1TA 2ESTE 1UJ1A 2Z9GA 4GCHG 4ZXXH 1Y3VA 4YLQH 5JB8S 1O37A 3P8NA 5FX6A 4A92A 1M9UA 4OS1A 3SU3A 1T4UH 1SB1H 1SOZA 1P9SA 4XBDA 3PWBA 3U69H 3TJVA 1CT4E 1SSXA 1FONA 2VVUA 3T2NA 2Z3CA 1QNJA 4ZXYH 3DUXH 1AD8H 2SGAA 4O97A 5JBBS 1BT7A 3D23A 4ZH8A 1TRMA 4MG3A 4K1TA 4YOJA 1P09A 5CHAB 1T7CA 5CMXH 1O2OA 2OTVA 1EP5A 2GV6A 3SV7A 1GJCB 1V2MT 1GHAF 1KDQA 1MKXK 1OWHA 4U32A 1LQEA 5ESTE 2G5NA 1EPTB 1Z7KA 2VWNA 2G81E 2Q6GA 3UY9A 5AFYH 3M3VA 1C2LA 4Z6AH 2WV5A 2PSXA 1KLTA 4B73A 4FUHA 1C4U2 1LKAA 3UOPA 2JH5D 1XUKA 1P57B 3LGYA 4AFQA 4KKDA 1O3OA 1BTXA 2ZFQH 1HAIH 4K8YA 4Z1MD 1CU1A 2PTNA 1CGIE 3STJA 5IDKA 4X6OA 1C5VA 1O3LA 1PQAA 2VGCC 3LDXH 2RCEA 2A7CA 1GHVH 1FQ3A 3PTNA 1ZRBA 4RT0A 1KTTB 4XBBA 5EXMA 3LONA 1C5XB 2BD9A 2WV9A 4TWYA 1F5KU 2ZGCA 4FUBA 1DSUA 1V2WT 2O8UA 5AHGH 3SUEA 1TYNA 1AFQC 5EOKA 2B8OH 1N6YA 3K9XB 5CDFE 3MH4A 3M5LA 1QBVH 2ZU4A 2AIQA 1P05A 5A8YA 3WWBA 2NU4E 3F3BA 3E6PH 2OC8A 1NY22 1SGRE 1GMCG 1XUGA 2GV7A 2FOFA 1TQ7B 4ZMAH 4ABAA 2XXLA 1GBEA 1C1PA 5FBIA 1MH0A 2R3UA 2R2WU 3NKKA 1QY6A 1O3FA 1EAIA 1O5BB 1A7SA 4VGCB 2BHGA 1C2DA 1IQNA 3RXVA 1OKXA 2QXIA 1GHXH 3SW2B 3SNDA 3NXPA 2FLBH 2Z9KA 4CBNA 1ZGIA 4NA7A 3SGBE 2H9TH 4BTUB 3W1EA 1Y3XA 3C1KA 2ZGBH 1O2HA 1A0HB 1ZPBA 1QZ8A 5LPEA 1NPMA 1UVTH 3PMJA 1PFXC 3ZIAD 2GVFA 2H1UA 1ZJDA 2F9OA 1UK2A 4YOIA 1S6LA 3ESTA 3SZEA 1MU6B 3BN9A 1NRPH 1ZMLA 1TBZH 2CV3A 2WINI 3FO8D 1Z8IB 1X7AC 2HRVA 2WPJS 1NBMD 1O2TA 2J95A 1SR5C 2ANYA 1W11U 2HVYB 1AU8A 1FX0B 3FZDA 4F48B 2FODA 2TRMA 4Q7ZA 2ZHWH 3TJNA 3ZZ4A 3ZYEA 3BSQA 8GCHG 1FMGA 3E16B 3MU1A 2GGVB 3OX7U 3KYGA 2ZHDA 4X2WA 4ZUHA 3SV8A 2QGRA 2QXHA 1TALA 2R0KA 2BY9X 3TH3H 4X1QU 1JRSA 4X6PA 2QAAA 1T8MA 3MH5A 4D7GA 3SBKA 3KHVA 1GCTC 5LH8A 2JETC 1G3BA 2VNTA 1O3HA 1AKSB 3A8BA 1S82A 3LPRA 1QTFA 1AB9B 1TAWA 5FPSA 1ZHMA 4DT7B 5CE1A 1JBUH 2WSSD 1FN6A 1IAUA 2NU2E 1J15A 3U98H 1ELAA 3RC4A 4IS5A 1O35A 4FUCA 3T27A 3GOVB 2SGQE 1ZGVA 5A8XA 3ZVFA 2BM2A 4X6MA 1YM0A 2OINA 1ELEE 1P10A 5C20A 1F92A 1N8OC 1DWEH 1FDPA 1NS3A 1QB1A 1SGNE 1C2EA 1XUIA 3MWIU 1OPHB 1KLJH 1XUFA 3A8AA 4Q2KA 2ZHFH 2NU3E 3M7UA 4UFEH 1G9IE 1V2VT 4DCDA 1QQ4A 1C1WH 4Q4LA 4DT4A 3T29A 1GHBG 4RI0A 1V2ST 1O5GH 3UNQA 1SGTA 5ESBA 3A87A 1ZOMA 1HAZB 2ZGJA 2C8YB 1NU9A 3MO6A 1Z8JB 2CGAA 4NWLA 5FBEA 5A09A 1FIWA 1RRKA 5EQQA 3S9AA 4ASUD 3ZZ9A 5LGOA 1XXFA 2IJOB 4WH6A 2ZDKA 1DSTA 3IITA 1O2KA 3RM2H 3PMHB 4YO9A 1P2OA 1MTNB 1QL8A 2GJGA 4MTBA 3U8OH 4INKA 1D3PB 4FUJA 1HJAC 1F0SA 1MTVA 2XC5A 1QBOA 2A7JA 2H6MA 1IQKA 3HKJB 3LKWA 4FVDA 1EQ9A 3NUMA 1C1RA 1E0FD 2QF0A 3AVZA 1VITH 1TGTA 1EPTC 2B7DH 5F6MA 1NROH 1O36A 1V2NT 1A61H 3F0OA 2K0QA 3P6ZB 5DK1A 1WDIA 1FIZA 2BMGB 4GPGA 1WU1A 4WXIA 3HK6B 4HGCA 4NZLA 1TNLA 3GDUA 4MLFB 1KIGH 2ODQA 1VCWA 1BTPA 1FNIA 2GCHG 1ELGA 1GI0A 4FUDA 2ZNKH 3ATLA 4O3UA 2KCOA 3SQHE 2ZECA 3MNSA 2Z9LA 4CH8B 1BTZA 5HIYA 2QXJA 1AI8H 3RU4T 3EGKH 1EX3A 4OS6A 2O9QA 3ZVDA 3SUFA 1VR1H 1ZSLA 1A1RA 3HPTB 1DICA 2BVSH 1TNGA 1HAVA 1C2GA 1ARCA 1U6QA 1MZDA 1Z6EA 2KX4A 5FL7D 1CA8B 3A84A 1S85A 2WYGA 1SGEE 2PLXA 2FTMA 1DFPA 1BBRH 1E35B 2Z9IA 1C1QA 1OYQA 2OCVB 5T6GA 7GCHG 1LPKB 4DIIH 3GCTG 1SQTA 2CHAC 1QJ6B 4INHA 3NZIA 2OXSA 1KY9A 1O30A 2BB4A 2O8MA 4Y8YA 3TIUA 2W7SA 1CHOF 3HATH 1SPJA 1YLDA 4UFDH 1C2FA 2RDEA 2XBXA 3U9AH 2ZFRH 4MPUA 1QJ7B 3ZV9A 1O3KA 2SNWA 4NG9H 1DM4B 3W94A 3N7DA 1D3DB 4I33A 1SGIB 2AMPA 2Q6FA 2FOAA 2QF5A 1W8BH 2J2UA 5FXLA 3KIDU 2O8TA 1YPGH 3V13A 1ANEA 1TABE 3LJOA 1A2CH 1DXPA 2PHBA 4J1YA 2ZTZA 1ELTA 3K2UA 4HZHA 1KTSB 1AZ8A 1EJAA 2VVCA 4H6TA 1GHAG 2AGGX 4ISHH 2HNTC 4I8JA 3M35A 5EW1H 1DOJA 3M61U 4ISOA 1YCPK 3ZVEA 2H5CA 5T6DA 2ZU1A 3NCLA 4K60A 1W0YH 1P2MA 1NRQH 3OTJE 1IQEA 1K1NA 1AMHA 2Y5HA 5DGJA 1DWCH 4Q80A 1K0HA 1SHHB 3FP7E 4KELA 1EZSC 1TBQH 1YY3A 1O2JA 4ACBA 3RDZA 2XC0A 1B0FA 1SLUB 1BB0B 2AHME 1OXGA 2ZU2A 4GHTA 3T28A 3JZ1B 1WBGB 3UNRA 4I8GA 2BX3A 3PV4A 3AK5A 1WOFA 5DP3A 5B6LA 5TCAA 1HXEH 4UE7H 1BMNH 1J8AA 4WVPE 1O5CB 1GBIA 3DSPA 2HWLB 2ODPA 2Y81A 1TPAE 1TLDA 3P92A 1C5QA 2FYQA 4YESB 4NCYA 1IQHA 3QZQA 3RU4D 3QO6A 4D9QA 3ZZAA 2RDLA 1RS0A 3LT3A 4GHQA 3GY4A 3PYHA 4LZ1H 1VITF 4UDWH 1W7XH 4X1PU 1RIWC 3UNSA 2RG3A 2XCNA 3H09A 3SJ8A 1EASA 3SU2A 3DFJA 3EDXB 1DPOA 3LU9B 2Z94A 3KQEA 3QK1A 4K1SA 1AO5A 4XBCA 1Y3WA 1W0KD 4TPYA 1FY3A 3ZVCA 2AMQA 1AUJA 4FETA 4XRNA 2ANKH 3GCOA 4TY6A 2Y5GA 4OGYA 1SGFG 1BTHH 2ZGXH 1GVLA 1KYNA 2OC7A 2PW8H 4RKOB 3OU0A 1QB6A 5J4SA 4X1SU 1PQ8A 3A89A 1DWBH 3O8DA 5A2MH 5E0GA 2LP6A 2XBYA 3PRDA 2VWMA 1TQ0B 4CRGA 2BDYA 4THNH 2GZ7A 1AY6H 1SVPA 3BG4C 2OK5A 5A0BA 3SU5A 3BTEE 4X2VA 2QIQA 1O3PB 1TONA 2GZ9A 1GJBB 1C1OA 3V12A 5TCCA 4CRAA 1BMLA 1ZMNA 5T3HA 1AZZA 5DSFA 1MTNC 2ZU3A 1Y5AT 1HAGE 2BDHA 2H5DA 3KL6A 4KTUA 5JBAS 3TLOA 4BANB 1V2RT 1LMWB 1PPFE 2PGBB 3DT0H 9ESTA 5GXPA 1JWTA 2FEQH 1O32A 1IQFA 2FOBA 2R3YA 4B6EA 1OSSA 2P3UB 4I8KA 1ELBA 5GNDA 1RXPA 2F9BH 7KMEH 1C1VH 1O33A 2A7HA 1PYTD 2JETB 2VINA 1FZZA 3ZZ6A 2PUXB 1V6DA 2A4GA 3S7HB 2W5EA 4BTIB 1NFYA 1NRSH 4JZ1A 2I6QA 2A0QB 2VB0A 2ZPQA 3T26A 1E34B 1WYKA 4AC9A 4ESTE 1ZYOA 1LVYA 3F1SB 3S0NA 2HVXA 4CBOA 1F0RA 1XUHA 3RXDA 5LPRA 4UFGH 4E7NA 3SNCA 2DE8A 4JYUH 4JZEH 4H42U 5CHBA 1GJ5H 2C4FH 3CS0A 4FVBA 5HKKD 4ABBA 1HXFH 2XNDD 3MNCA 1FY1A 3SV2H 2TPIZ 4D7FA 4BNRA 2PKSB 1ZTKA 3SZNA 1PJPA 4B2BA 1LPGB 3RXPA 4MNWA 5AFZH 1TOMH 4GUXA 3MNXA 1WSSH 1EFRD 2Z6BD 2D1JA 2HPQH 3KNXA 3UUZA 3NPSA 3ZVGA 4X2YA 3PMBB 5GCHG 3RXBA 1QBNA 3PB1E 1DXWA 1TNIA 1AUTC 3D49H 1V2PT 3K6ZA 3UR6A 1YPLH 1BHXB 1YP9A 4MPWA 1D6WA 3BTKE 2SGEE 3A7ZA 2XOKD 1C1NA 2J98A 4A1TA 1KMHB 4ASHA 3ZZ5A 1FV9A 1RTKA 3UWIA 4Y8ZA 3MMGA 5HM2A 4B74A 4NZQA 2V7QD 4MPVA 1F0UA 3TK6A 4B76A 2FMJA 1GMDG 2FX6A 2PKAA 4CRBA 1B7XB 3GS9A 2JJ2D 4ZKNU 1T8LA 2ZO3H 1T8OA 2STAE 5DP7A 3SI4H 5IYTA 1HJAB 3M37A 2TGDA 3RXUA 4LZ4B 2EI7A 1UCYK 2J94A 1WTGH 1W3CA 3OY6U 1W2KH 1HAHH 1EZUC 2AERH 2A4RA 1V3XA 1UHBA 2GDDA 2OD3B 4IMQA 1C1UH 1DDJA 3BTTE 1YWUA 1THPB 2DE9A 1O2MA 4NSVA 3MO3A 3VFEA 1C4V2 2BOHB 2ZQ1A 2SNVA 3RXGA 2XWAA 2ZDLA 2AEIH 3BEFB 3L33A 1DUEA 2EC9H 2GT8A 1JOUB 1AGJA 3BEIB 4FUFA 3A83A 3A85A 1RTLA 5C5NA 3GCNA 1K2I1 4DGJA 3ZZBA 3TNTA 3SV6A 2ZDAH 3OYPA 3SV9A 2CMYA 3A82A 1SQOA 1HRTH 3T5FH 1DLKB 5EU8A 3VB6A 3VXEH 4IN2A 3U1JB 2R9PA 3BTME 3SOSA 1HYLA 1GJ7B 1AVXA 1C2HA 1L1JA 3AAUA 5JBTA 1YPEH 1HB0B 2A4OA 5E8EH 1S5SA 3BTDE 5GWZA 1T31A 2VIDA 3UB0A 2K8IA 5I25A 2B5TB 3Q3KA 1L0ZA 1O2WA 2CHAB 4CR9A 3IG6B 1ZLRA 2BLWA 2ZCLP 4HI3A 1HV7A 1DLEA 1HDTH 1ZMJA 1H9LB 1AN1E 1O3IA 3SJKA 5ETXA 4XFQA 3TU7H 4IMZA 1YBWA 1EB2A 1C5NH 8KME2 1O2NA 4CRFA 2ZFTA 1G2MA 1SGCA 1SGPE 4SGBE 1MQ5A 4I7YH 1C5PA 9LPRA 4AYYB 1TBRH 4CRDA 2KM0A 5EJLA 3RXLA 4WY3A 1CBWB 5C94A 2A45B 1GI5A 2OBQA 2W7UA 3KQ5A 1DUAA 3BIUH 3HKIB 2NU0E 4UONA 2YMSB 3F68H 3SORA 3RXFA 4KTCA 4NGAH 4AFZA 5E2PA 3T25A 1HIAB 1Z71A 3AASA 3D62A 1A3BH 4NIYA 1C5TA 3GCHB 1O5FH 3ATWA 4X8VH 1GBDA 1TWXB 3A88A 1HAOH 2LELA 1LVBA 4OGXA 1F7ZA 3FP6E 3SNAA 1TX6A 1BBRE 2P93A 2V0BA 1C5SA 1HJ9A 1C5OH 3VG8A 5K7RA 3RMOH 1MU8B 1UCYH 2BY5X 5EPNA 3M7QA 1O39A 3GDSA 1UVOA 2F9PA 4ACAA 1TNKA 4AYVB 4INLA 1GJ4H 1YPHE 4JMYA 3RM0H 1E36B 5HXFA 3MU5A 3VGCB 1W13U 2TIOA 2PFEA 1BJUA 3LIWA 4BAOB 1O38A 1C2MA 2A32A 3VB3A 4ABEA 1NT1A 5JBCS 1ABIH 3MO9A 2GX4A 1GI3A 5KEDA 3ZVBA 1J16A 4DG4A 4XDEA 4K8BA 1G36A 1E1QD 2FOMB 2NWNA 1SMFE 2BD5A 2SGDE 2BDCA 5L30H 1W10U 1UTJA 3MU4A 1BBRK 1SFIA 1RIWB 2WPMS 4A7IB 2KAIB 2BX4A 1VGCB 2CXVA 3DD2H 3RU4E 3OTPA 2OLGA 2Y7XA 3M5MA 1C5ZB 1GMHG 3GY6A 1UVUH 1MD8A 2BXUH 4NIVA 3H5CB 2PKSC 2IPQX 3ODDA 1D4PB 1VCPA 2QF4A 1O3NA 1ABJH 1GHYH 1L4DA 4RN6A 2CF8H 2KCYA 2G5VA 1BRBE 1OWIA 3OSYA 1P04A 1NFUA 3SQEE 1EPTA 3I78A 1K1JA 4WMFA 3UREA 2V3MA 4Q7XA 1XKBC 1S0RA 5DO4H 1GJ9B 1Q2WA 3Q00A 3F2FA 1ZPCA 1Z8GA 2ANWA 1NFWA 1NFXA 2RA0A 3S9CA 1GJ8B 2QYIA 4Q7YA 3BG4B 5FX5A 4IC5A 1MD7A 4KP0A 1GBLA 2UUYA 1MQ6A 1SLWB 1VJ9U 2ZGHA 4AB9A 3QN7A 1NZQH 3TH4H 1QJ1B 2ANMH 4B2CA 4U30A 6GCHF 3ZVAA 1BTWA 1H4WA 3KCGH 4B2AA 1BTUA 3QWCH 2FZZA 4Y7BA 3SHAH 1GI9B 1TPOA 1EJNA 1QRXA 2XRCA 2VWOA 4MNVA 3BV9B 3QUMP 2UWLA 5A0AE 2G51A 1A0LA 3F9EA 4DY7B 4WMEA 2Y80A 3EYDA 1HBTH 5DG6A 3E91A 1KXFA 1KXBA 4R8TB 1QHRB 3DSGA 3EA8A 1YPJH 4GCHF 1V2UT 2XTTB 3A8DA 3T62A 3F2HA 3TH2H 4Y6DA 1C5YB 1K21H 2JJ1D 5L2ZH 3BTGE 1H8IH 4HFPB 1K1OA 1HPGA 5A0CA 2AH4X 3TVJB 4RKJB 2FYRA 3AAVA 1O5AB 4ABIA 2M2AA 2O8LA 3DHKH 3VXFH 4FUGA 1ESTA 3RXEA 2ZDNA 2GDEH 3A7XA 3GY3A 2L6OA 1DE7H 1LO6A 3OE7D 1YLNA 5C3NA 4YM9A 4KGAA 3BIVH 3KQCA 1J17T 2ZPSA 5C0UA 2FOEA 3ZV8A 3RXOA 5F53A 5EJ1A 1C5UA 3BTWE 3ZZ7A 2Q1JA 3P17H 3SHCH 2UUJB 1HIAA 1TNHA 1ZTJA 2ZCHP 2ZF0H 1TA2A 1YKTA 5ABWA 1NM6A 3DCLA 1Y3UA 5JDUB 4IBLH 1FY5A 4RSPA 3F9FA 4O9VA 3H7OA 1S6FA 3EA7A 1H9IE 1VKYA 4CRCA 3ZZ8A 1HAXB 2QXGA 2RA3A 1TA6A 1FUJA 4H4FA 1JIRA 1WQVH 1NRRH 5H4IB 1INCA 1GDQA 1ZSKA 3MH6A 3F2GA 4ZROA 2UUKB 4B6FA 3A7VA 4YT6H 1O2UA 2Z3DA 8ESTE 4ISNA 2BY6X 1HAPH 1YYY1 1GWAA 1EUFA 3LJJA 3SU4A 1CBWC 2YNBA 4MPXA 5F8ZA 1GMCF 2C93B 4AG2A 3KN2A 1C5MD 1FY8E 2YMSC 3CENA 1AKSA 4YTAA 4JCNA 2VVVA 2QE7D 2IJD1 4B71A 1DY8A 3H7TA 1GBFA 2GP9B 2GKVE 1ID5H 1MCVA 3GCHC 1O3CA 1P0SH 3VEQB 3DSOA 3PV2A 3MTYA 2C90B 1H8HD 1HAYB 2SGPE 3A7YA 1MAXA 1XM1A 1SG8B 1OWEA 3ZZ3A 1F2SE 4AGKA 3UIRA 1Z1IA 2UUFB 2ZU5A 2AFQB 4CH2B 1SGFA 3EA9A 1SHYA 1ZZZA 2WPKS 1V2OT 3LGVA 1O3BA 1HFDA 1GDNA 3GY2A 1E1RD 3NRLA 3M3TA 1YGCH 1BITA 4A1VA 2FM2A 2EI8A 1HJ8A 4I8HA 2ZQ2A 3VGCC 3NWUA 2BY7X 2O8WA 3RC5A 5SGAE 3QGNB 1AE8H 4F49A 1ZSJA 3GY7A 5DN6D 2UWOA 4FXGH 2BZAA 1Z1JA 4NSYA 1G32B 2KR7A 2ILNA 4FOUC 1RJXB 1P2JA 1FN8A 2AIPA 2GMTC 2FI5E 2P8OB 2BDGA 3FANA 4FU9A 4OS4A 5DP5A 2F83A 2TGAA 1LHFH 1TGCA 2F9NA 3UOUA 4RT1A 1GBTA 1QB9A 3OAAD 1XUJA 2VIVA 3A86A 4LOYH 4BXSA 2Y5FA 2CJIA 2QA9E 1IQLA 8GCHF 3DFLA 1PPBH 4UEHH 1ZHRA 4WWYA 2Z7FE 2F43B 1G3EA 2Z3EA 4Y7AA 3RUOA 2XC4A 4NA9H 1VGCC 1TRNA 4TPIZ 2ZC9H 2YOLA 2ZA5A 1GI2A 3SU0A 5IK2D 1KXDA 3MH7A 1PPEE 4OS7A 4Y0ZE 8LPRA 4ABJA 1L1GA 4K2YA 2G55A 1BJVA 3TJUA 5GPIB 3ITIA 1KDQB 3RC6A 5L6NH 2FOCA 3WY8A 3URCA 1OP2A 2XCFA 2SFAA 4JYTA 1O3MA 2VIQA 3Q76A 3Q77A 1LQDB 1YF4A 3GY5A 5C5OA 1OWJA 4HTCH 1AVGH 1NC6A 1S83A 3N7OA 1H9HE 4ABDA 3HGPA 5GDSH 3TPIZ 2OP9A 1EATA 2QY0B 3RXQA 1AWHB 2YNAA 4X6NA 2Y6TA 4DW2U 3PM3A 4ISLA 1WV7H 3GYLB 1O2PA 2WPHS 1GHBF 4JZFH 1QRWA 2V3OH 1Z6JH 1P2KA 1P11E 2ZI2H 1MBQA 2H9EH 1EXFA 2ALVA 1S6HA 2QF3A 2PP6A 1P9UA 4MQAA 1A5HA 2VH6A 3RXKA 2XYAA 1NBME 3GDVA 4K3JA 3G01A 1V2QT 5E0HA 3TK9A 3FVFB 1XXDA 2G52A 2ULLA 4Y79A 1ZPZA 1GHWH 1MAYA 1YPKH 1ETTH 1O5EH 1LHEH 2VJ1A 2AGEX 3E90B 1W0ZU 3NK8A 3RLWH 2HPPH 4LXBH 3SUGA 4AORA 1ELFA 3OEHD 3ZZDA 2WPIS 3RXCA 3CS7A 1ESBA 1UVSH 1EOLA 4BOHA 1BMFD 2KFWA 1BHXF 1O3JA 1GBMA 1THRH 1D9IA 2F4LA 2EA3A 3E0NB 5HIZA 1EAXA 1C1TA 1ETRH 1O2VA 1FAXA 1H8DH 1UMAH 1UTPA 2FWWA 3FAOA 4I86A 2PV9B 4XE4A 1P02A 4TT3D 3ZYDA 4YT7H 5JB9S 2A5IA 2F9VA 5EG4A 1HLTH 4OS2A 6CHAB 5I46H 1G30B 3AW0A 4AGJA 1Q3XA 1O0DH 5JPMH 1AHTH 4FU7A 1V2JT 4P02A 1GCDA 1O2SA 1BRUP 1UCYE 4TWWA 5AVDA 1O2IA 2Z9JA 1B5GH 1MTSA 2J5UA 1EAUA 3F9GA 2VBCA 2ZCKP 4X1NU 4E7RG 2DUCA 2WYJA 2GCHF 2FX4A 3BEUA 3ODFA 1LHDH 1ZR0A 1GG6C 2OC1A 2WUBA 4H6SB 2AMDA 1EZXC 3P8GA 2QCYA 2JH0D 5EW2H 3LGIA 1DY9A 1SGDE 4ZCNA 4K69A 3SU1A 1QCPA 2ZTXA 4PROA 1EJMA 4XSKU 1C2JA 1O2XA 3SU6A 1MKWK 1Q31A 1CSOE 1C1SA 4ABHA 4JK5A 2AGIX 2HALA 2FPZA 1ELDE 5F8TA 4AX9H 2C3SA 5DP8A 1C4Y2 3GCTF 1GI7B 4I32A 5GIBA 1GBJA 4U2WA 3SYJA 1FAKH 1FY4A 5C17A 1IQMA 2BQ6B 1V2LT 2V35A 1G3DA 3B23B 4JZDH 4Y11E 4ABGA 5FCKA 4Q63A 2RFKC 1QURH 2LPRA 3CP7A 3BTQE 1PPHE 1QRZA 1Y3YA 2WZQA 3QX5H 1BZXE 1RTFB 1GHZA 3MI4A 4GLYA 1MMJN 2BOKA 2FI4E 2BD3A 3TITA 4NFFA 5FAHA 1THSH 2ZHEH 1UK4A 2VU8E 1CO7E 2NU1E 2WV4A 2PSYA 2JKHA 1AE5A 1F5LA 2PR3A 1V2KT 1COWD 2EEKA 4E05H 1GGDC 2A2XH 2XBWA 4ZKRU 4YXWD 2AS9A 2QV1A 4WXVA 2HOBA 2ZZUH 1TB6H 1P3EA 3VB7A 1GBBA 1PPGE 1MABB 4WMDA 3RXTA 2J92A 3FOAA 2WHXA 3VB4A 3A7TA 4AB8A 2P8OC 2HNTF 5K0HA 2A31A 1P3CA 1L2EA 4KTSA 4BAKB 5KECA 1K28D 1CHOG 1XVMA 1F0TA 2ZPRA 2G8TA 4P00A 1LKBA 1GJDB 3E3TA 3C27B 5DJ7A 2FIRH 7LPRA 1PPZA 2KCAA 3P8FA 1BRAA 1DWDH 2VWLA 1ARBA 2F3CE 2ALPA 3R3GB 4YOGA 2VIOA 1LVMA 5EODA 1IQJA 2Q6DA 1SQAA 3F0PA 2SGFE 2H9HA 3PO1C 3B9FH 1A5IA 1A46H 1MTUA 4IW4E 3N7EA 4GAWA 4NWKA 1SOTA 5L2YH 1QIXB 3MFJA 1GBKA 4TSFD 2PGQB 1QL7A 2BTCE 1KSNA 4AFUA 3GY8A 3MU0A 1TGNA 3BF6H 1K1PA 3KEEA 1FPHH 5HGGA 1SKYE 1WAYB 1EOJA 2OQ5A 4I31A 1TPPA 1OX1A 3UFAA 4AN7A 3BG8A 1MKWH 3VB5A 3SO3A 1HGTH 1QA7A 3AW1A 1RGQA 4DJZB 1OP0A 3GYMA 1O2LA 1ORFA 1CA0C 3WW7A 1WCZA 2FOGA 2XNIA 2A2QH 2VIWA 3GICB 1AWFH 4XD7D 3RMMH 3S9BA 2V3HH 3V3MA 1G3CA 5F03A 1A4WH 4BTTB 1HAVB 1C9TA 3O8RA 4QT8C 3TNSA 1Y5UT 4TYDA 1JMOH 1F5RA 2J4IA 1RFNA 3M5NA 5EQRA 4ZHMU 1JRTA 2ZDMA 1GL1A 1VCQA 3O8CA 1BTYA 2FS9A 2P95A 4K5ZA 3A80A 3E0PB 4CREA 2CK3D 1NTPA 2QN5T 4FU8A 1EAWA 2A5AA 1FPCH 1UO6A 2M5TA 4X0WU 4A5TS 1E79D 1NO9H 3QZRA 4ZAEA 4FUEA 2GMTB 1EKBB 1GI6A 4SGAE 5EXLA 4MVNA 1IHTH 2JDID 1VITG 2A1DB 1MKXH 2BDAA 5EQSA 3UPEA 5C1XA 3RMNH 1XMNB 1G37A 1JXPA 1A5GH 2R2MB 3LH3A 5GJ4B 1IOEA 5EXNA 5B6OA 1GI4A 2P16A 3LOXA 3D65E 1TX8A 3RXRA 3TGJE 2KZ4A 1WTHD 2J34A 1BUIA 2FOHA 4OS5A 1CGJE 6CHAC 5G4BA 1LHGH 2D2DA 1DT2A 1GBHA 1K1LA 2B0FA 3DA9B 6ESTA 1BRCE 2XWBI 4YZUA 2FXRA 2TGPZ 3ENSB 1TRYA 1TFXA 3N99A 2BY8X 1N6XA 2CN0H 3FZZA 1MZAA 3FFGA 4M9FA 5DPAA 3UQVA 1EP6A 5EPYA 4BXWA 4D8NA 4J2YB 4GSOA 3UQOA 3RXAA 4Y71A 1EZQA 1P06A 3HK3B 3PLPA 5EIYA 1J9CH 2BD8A 4X8TH 5C2ZA 2BLOA 5FPYA 3MU8A 1QR3E 2ZWLH 3M5OA 2IOTA 1SGYE 1YPHC 1DS2E 1KXEA 3U1IB 1UTMA 3M36A 2GCTB 1PQ7A 3ATKA 1K9OE 1QGFA 2OQUA 2J97A 1XX9A 2G4TA 4DURA 3RMLH 1OHHD 3F6UH 1P03A 3O8BA 4X8UH 4IN1A 2K1QA 2BLVA 1GI8B 3L6PA 2ODYB 4XOJA 3LC5A 2PWXA 4IGDA 2Y7ZA 3F9HA 4NA8A 3CNRA 2ASUB 3UTUH 2D26C 3A8CA 1NU7B 2BD7A 2BYAX 5GCHF 1SLXB 3GISB 1OS8A 2W3KA 3VPKA 1CE5A 1IQGA 3QTVH 1GDUA 2HGTH 1KXCA 2WPLS 1C5RA 2BDIA 3FKSD 2ZP0H 1SL3A 4U01A 5C67A 3K65B 4AZ2B 1O2RA 1P12E 1TMTH 4AG1A 1RD3B 1T8NA 4HG6A 3UWJH 1C5WB 3PV5A 4E06H 4AFSA 2FO9A 4WJG2 2C8WB 5A8ZA 4O03A 1LCYA 1S0QA 1J14A 2XBVA 1TE0A 1GMDF 5CHAC 1CVWH 1C1MA 3ATIA 2BLQA 3Q3XA 3SUDA 2STBE 2D8WA 1V2TT 2OUAA 4NIWA 2C8XB 4ZHAA 1OWKA 2GD4B 1Z8RA 1S81A 1UVPA 3JZ2B 3U8TH 1PQ5A 3W95A 3SJ9A 1GI1A 5BPEA 4JYVH 1NESE 5FPTA 1O3GA 2EQNA 3QGJA 5HMAA 3E8LA 1HUTH 7ESTE 1HCGA 2J38A 1YC0A 4UFFH 5KGOA 4DVAU 1FJSA 4CHAB 2W26A 3KF2A 3P8OA 2G00A 2BVRH 1CQQA 3MQKC 2HNTE 4X1RU 2QC2A 2FESH 1TGSZ 5DKMA 3LGUA 1ELVA 1TMUH 2ZHQH 2HLCA 1VZQH 2FTLE 1FLEE 2V6NA 5DP9A 2OBOA 1GG6B 2EY4C 5J4QA 1UTQA 2FLRH 1ANBA 1JIMA 1FI8A 4NFEA 1UTLM 1D3QB 1SQRA 1K22H 2W3IA 3OEED 1A0JA 2P3FH 6LPRA 1MCTA 1GPZA 1DITH 1ELCA 1YCPM 3MNBA 2IPHA 5LPFA 1P2NA 4VGCC 2KCPA 1WUNH 4D9RA 2BZ6H 3OFND 4Y0YE 2ZFFH 2F9UA 1PYTC 2J9NA 3U28C 1W0JD 1ETSH 1W14U 3ATMA 3UAIC 1QQUA 1DANH 4MNXA 1TGBA 3RLYH 4YLUA 2ZFPH 2WPDD 4A6LA 5FHTA 1O34A 1NN6A 1XVOA 1BDAA 1LHCH 1NRNH 3EE7A
chains in the Genus database with same CATH topology
2KAIA 4GVUA 2JH6D 3S7KB 3TGIE 1TIOA 1AIXH 4JK6A 3MYWA 1TPSA 3RP2A 1DVAH 4LK4A 2B9LA 3L3TA 3TJOA 1Y8TA 3PLBA 3RXMA 3UR9A 1BMMH 1CT2E 1YPMH 1OWDA 3ZZCA 1GGDB 5E2OA 3SJOA 2PUQH 3V0XA 5DP6A 1O3EA 2AYWA 3SNEA 1BCUH 2A5KA 3QDZB 1L4ZA 1LPZB 5E0JA 4ZKSU 3EQ0H 4B75A 4CR5A 3S69A 2THFB 3PLKA 1C2IA 2C8ZB 2UWPA 2F91A 3HGNA 1ACBE 2VGCB 3MOCA 4DIHH 2A4QA 3FP8E 1ZJKA 1PPCE 1DX5M 1P2IA 1T4VH 1W12U 2H2ZA 1O5DH 3KQDA 4I8LA 3TGKE 1KLIH 1O31A 4Z0KA 1GL0E 4NIXA 2GTBA 1CT0E 1E37B 1G2LA 2PKAB 1IQIA 1GVKB 3STIA 1UK3A 1UTKA 1AVWA 1L1NA 1AFQB 1LVOA 2WUCA 5PTPA 4F4OC 4X2XA 4UD9H 1TOCB 2OC0A 3V7TA 2P94A 3K6YA 1AB9C 3SGQE 4Y76A 1O2GH 2R0LA 5EGMA 3PO1B 2FP7B 4ABFA 4D76A 1QL9A 1UHBB 2P59A 3TK5A 3LGWA 4MNYA 1CGHA 2I6SA 1GBAA 1OP8A 1E38B 1BQYA 3ELAH 2ZIQH 1UTNA 3PMAB 2BQ7B 2FDAA 1MBMA 1ANCA 2BXTH 2CF9H 2LNCA 2VIPA 1BMAA 1IHSH 1KXAA 4DOQA 1O3AA 2FS8A 1K1IA 3Q3YA 5JYIA 1T32A 1K1MA 1SI5H 1ZTLA 2G4UA 2BD2A 1TNJA 1SLVB 4M7GA 2GCTC 1C5LH 3M7TA 4WH8A 3MHWU 1BIOA 3IWMA 1GMHF 1P8VC 1ZHPA 1LDTT 3R0FA 3URDA 5TJXA 1QFKH 3OY5U 1TMBH 1Y5BT 1W7GH 4MDSA 1GVZA 1CA0B 3KQBA 4ZKOU 2ZG0H 1O2ZA 5C1YA 2P3TB 5C1UA 1UTOA 1Y59T 1C9PA 2ZKSA 3QTOH 3SGAE 2GT7A 1S84A 2FI3E 2BQWB 5F8XA 3EAJA 4AOQA 4JZIA 3SNBA 2BDBA 1YLCA 2BD4A 1ANDA 1GJ6A 1CHGA 4TY7A 4BAQB 3PTBA 2ZFSA 1BOQA 3BTFE 5BRRE 1YCPH 1FXYA 1P01A 3BTHE 1SGQE 1O3DA 1QA0A 1SFQB 1EB1H 2BVXH 4ISIH 2TBSA 3B8JA 3A7WA 1TX7A 3PWCA 3RXIA 2Y82A 1AQ7A 4IC6A 1BA8B 4BAHB 1GCTB 3LC3A 5T6FA 1VJAU 4BAMB 4Y8XA 3SJIA 3U8RH 5HYOA 1D3TB 3I29A 3I77A 1N1LA 3RXJA 1SBWA 4CHAC 2EI6A 3KGPA 3RXHA 1A3EH 1SC8U 1B0EA 2XW9A 4R0IA 1O2YA 5HM9A 3EE0B 1AFEH 3LH1A 1HNEE 1N8OB 1MTWA 1OOKB 1XKAC 2ZTYA 1ESAA 3A81A 1GJAB 1P2QA 1WQSA 2PTCE 1ZRKA 2ZEBA 4FUIA 3LGTA 2IN2A 1OYTH 1GBCA 1D6RA 3P70B 1C2KA 4WF8A 3PROA 5AF9H 3SN8A 5FCRA 6GCHG 3SI3H 3E1XB 3RXSA 3M3SA 1MUEB 4A1XA 1H1BA 4Y10E 2TGTA 5DP4A 3P95A 2VH0A 2GZ8A 2ZDVH 1LTOA 7GCHF 3QLPH 4X8SH 4O3TA 4ZHLU 1O2QA 4B1TA 2ESTE 1UJ1A 2Z9GA 4GCHG 4ZXXH 1Y3VA 4YLQH 5JB8S 1O37A 3P8NA 5FX6A 4A92A 1M9UA 4OS1A 3SU3A 1T4UH 1SB1H 1SOZA 1P9SA 4XBDA 3PWBA 3U69H 3TJVA 1CT4E 1SSXA 1FONA 2VVUA 3T2NA 2Z3CA 1QNJA 4ZXYH 3DUXH 1AD8H 2SGAA 4O97A 5JBBS 1BT7A 3D23A 4ZH8A 1TRMA 4MG3A 4K1TA 4YOJA 1P09A 5CHAB 1T7CA 5CMXH 1O2OA 2OTVA 1EP5A 2GV6A 3SV7A 1GJCB 1V2MT 1GHAF 1KDQA 1MKXK 1OWHA 4U32A 1LQEA 5ESTE 2G5NA 1EPTB 1Z7KA 2VWNA 2G81E 2Q6GA 3UY9A 5AFYH 3M3VA 1C2LA 4Z6AH 2WV5A 2PSXA 1KLTA 4B73A 4FUHA 1C4U2 1LKAA 3UOPA 2JH5D 1XUKA 1P57B 3LGYA 4AFQA 4KKDA 1O3OA 1BTXA 2ZFQH 1HAIH 4K8YA 1CU1A 2PTNA 1CGIE 3STJA 5IDKA 4X6OA 1C5VA 1O3LA 1PQAA 2VGCC 3LDXH 2RCEA 2A7CA 1GHVH 1FQ3A 3PTNA 1ZRBA 1KTTB 4XBBA 5EXMA 3LONA 1C5XB 2BD9A 4TWYA 1F5KU 2ZGCA 4FUBA 1DSUA 1V2WT 2O8UA 5AHGH 3SUEA 1TYNA 1AFQC 5EOKA 2B8OH 1N6YA 3K9XB 3MH4A 3M5LA 1QBVH 2ZU4A 2AIQA 1P05A 5A8YA 2NU4E 3E6PH 2OC8A 1NY22 1SGRE 1GMCG 1XUGA 2GV7A 2FOFA 1TQ7B 4ZMAH 4ABAA 2XXLA 1GBEA 1C1PA 5FBIA 1MH0A 2R3UA 2R2WU 3NKKA 1QY6A 1O3FA 1EAIA 1O5BB 1A7SA 4VGCB 2BHGA 1C2DA 1IQNA 3RXVA 1OKXA 2QXIA 1GHXH 3SW2B 3SNDA 3NXPA 2FLBH 2Z9KA 4CBNA 1ZGIA 4NA7A 3SGBE 2H9TH 4BTUB 1Y3XA 3C1KA 2ZGBH 1O2HA 1A0HB 1ZPBA 5LPEA 1NPMA 1UVTH 3PMJA 1PFXC 2GVFA 2H1UA 1ZJDA 2F9OA 1UK2A 4YOIA 3ESTA 1MU6B 3BN9A 1NRPH 1ZMLA 1TBZH 2CV3A 2WINI 1Z8IB 1X7AC 2HRVA 2WPJS 1O2TA 2J95A 1SR5C 2ANYA 1W11U 1AU8A 3FZDA 2FODA 2TRMA 4Q7ZA 2ZHWH 3TJNA 3ZZ4A 3ZYEA 3BSQA 8GCHG 1FMGA 3E16B 3MU1A 2GGVB 3OX7U 2ZHDA 4X2WA 4ZUHA 3SV8A 2QGRA 2QXHA 1TALA 2R0KA 2BY9X 3TH3H 4X1QU 1JRSA 4X6PA 2QAAA 1T8MA 3MH5A 4D7GA 3SBKA 3KHVA 1GCTC 5LH8A 2JETC 1G3BA 2VNTA 1O3HA 1AKSB 3A8BA 1S82A 3LPRA 1QTFA 1AB9B 1TAWA 5FPSA 1ZHMA 4DT7B 5CE1A 1JBUH 1FN6A 1IAUA 2NU2E 1J15A 3U98H 1ELAA 3RC4A 4IS5A 1O35A 4FUCA 3T27A 3GOVB 2SGQE 1ZGVA 5A8XA 3ZVFA 2BM2A 4X6MA 1YM0A 2OINA 1ELEE 1P10A 5C20A 1F92A 1N8OC 1DWEH 1FDPA 1NS3A 1QB1A 1SGNE 1C2EA 1XUIA 3MWIU 1OPHB 1KLJH 1XUFA 3A8AA 4Q2KA 2ZHFH 2NU3E 3M7UA 4UFEH 1G9IE 1V2VT 4DCDA 1QQ4A 1C1WH 3T29A 1GHBG 1V2ST 1O5GH 3UNQA 1SGTA 5ESBA 3A87A 1ZOMA 1HAZB 2ZGJA 2C8YB 1NU9A 3MO6A 1Z8JB 2CGAA 4NWLA 5FBEA 5A09A 1FIWA 1RRKA 5EQQA 3S9AA 3ZZ9A 5LGOA 1XXFA 2IJOB 4WH6A 2ZDKA 1DSTA 3IITA 1O2KA 3RM2H 3PMHB 4YO9A 1P2OA 1MTNB 1QL8A 3U8OH 4MTBA 4INKA 1D3PB 4FUJA 1HJAC 1F0SA 1MTVA 2XC5A 1QBOA 2A7JA 2H6MA 1IQKA 3HKJB 3LKWA 4FVDA 1EQ9A 3NUMA 1C1RA 1E0FD 2QF0A 3AVZA 1VITH 1TGTA 1EPTC 2B7DH 5F6MA 1NROH 1O36A 1V2NT 1A61H 3P6ZB 5DK1A 1FIZA 2BMGB 4GPGA 1WU1A 4WXIA 3HK6B 4HGCA 4NZLA 1TNLA 3GDUA 4MLFB 1KIGH 2ODQA 1VCWA 1BTPA 1FNIA 2GCHG 1ELGA 1GI0A 4FUDA 2ZNKH 3ATLA 4O3UA 3SQHE 2ZECA 3MNSA 2Z9LA 4CH8B 1BTZA 2QXJA 1AI8H 3RU4T 3EGKH 1EX3A 4OS6A 2O9QA 3ZVDA 3SUFA 1VR1H 1ZSLA 1A1RA 3HPTB 1DICA 2BVSH 1TNGA 1HAVA 1C2GA 1ARCA 1U6QA 1MZDA 1Z6EA 1CA8B 3A84A 1S85A 2WYGA 1SGEE 2PLXA 2FTMA 1DFPA 1BBRH 1E35B 2Z9IA 1C1QA 1OYQA 2OCVB 5T6GA 7GCHG 1LPKB 4DIIH 3GCTG 1SQTA 2CHAC 1QJ6B 4INHA 3NZIA 2OXSA 1KY9A 1O30A 2BB4A 2O8MA 4Y8YA 3TIUA 2W7SA 1CHOF 3HATH 1SPJA 1YLDA 4UFDH 1C2FA 2XBXA 3U9AH 2ZFRH 4MPUA 1QJ7B 3ZV9A 1O3KA 2SNWA 4NG9H 1DM4B 3W94A 1D3DB 4I33A 1SGIB 2AMPA 2Q6FA 2FOAA 1W8BH 2J2UA 5FXLA 3KIDU 2O8TA 1YPGH 3V13A 1ANEA 1TABE 3LJOA 1A2CH 1DXPA 2PHBA 4J1YA 2ZTZA 1ELTA 3K2UA 4HZHA 1KTSB 1AZ8A 1EJAA 2VVCA 4H6TA 1GHAG 2AGGX 4ISHH 2HNTC 4I8JA 3M35A 5EW1H 1DOJA 3M61U 4ISOA 1YCPK 3ZVEA 2H5CA 5T6DA 2ZU1A 3NCLA 4K60A 1W0YH 1P2MA 1NRQH 3OTJE 1IQEA 1K1NA 1AMHA 2Y5HA 5DGJA 1DWCH 4Q80A 1SHHB 3FP7E 4KELA 1EZSC 1TBQH 1O2JA 3RDZA 2XC0A 1B0FA 1SLUB 1BB0B 1OXGA 2ZU2A 4GHTA 3T28A 3JZ1B 1WBGB 3UNRA 4I8GA 2BX3A 3PV4A 1WOFA 5DP3A 5TCAA 1HXEH 4UE7H 1BMNH 1J8AA 4WVPE 1O5CB 1GBIA 2HWLB 2ODPA 2Y81A 1TPAE 1TLDA 3P92A 1C5QA 2FYQA 4YESB 4NCYA 1IQHA 3QZQA 3RU4D 3QO6A 4D9QA 3ZZAA 2RDLA 1RS0A 3LT3A 4GHQA 3GY4A 3PYHA 4LZ1H 1VITF 4UDWH 1W7XH 4X1PU 1RIWC 3UNSA 2RG3A 2XCNA 3SJ8A 1EASA 3SU2A 3DFJA 3EDXB 1DPOA 3LU9B 2Z94A 3KQEA 3QK1A 4K1SA 1AO5A 4XBCA 1Y3WA 4TPYA 1FY3A 3ZVCA 2AMQA 1AUJA 2ANKH 3GCOA 4TY6A 2Y5GA 4OGYA 1SGFG 1BTHH 2ZGXH 1GVLA 1KYNA 2OC7A 2PW8H 4RKOB 3OU0A 1QB6A 5J4SA 4X1SU 1PQ8A 3A89A 1DWBH 3O8DA 5A2MH 5E0GA 2XBYA 2VWMA 1TQ0B 4CRGA 2BDYA 4THNH 2GZ7A 1AY6H 1SVPA 3BG4C 5A0BA 3SU5A 3BTEE 4X2VA 2QIQA 1O3PB 1TONA 2GZ9A 1GJBB 1C1OA 3V12A 5TCCA 4CRAA 1BMLA 1ZMNA 5T3HA 1AZZA 1MTNC 2ZU3A 1Y5AT 1HAGE 2BDHA 2H5DA 3KL6A 4KTUA 5JBAS 3TLOA 4BANB 1V2RT 1LMWB 1PPFE 2PGBB 3DT0H 9ESTA 5GXPA 1JWTA 2FEQH 1O32A 1IQFA 2FOBA 2R3YA 1OSSA 2P3UB 4I8KA 1ELBA 1RXPA 2F9BH 7KMEH 1C1VH 1O33A 2A7HA 1PYTD 2JETB 2VINA 1FZZA 3ZZ6A 2PUXB 1V6DA 2A4GA 3S7HB 2W5EA 4BTIB 1NFYA 1NRSH 4JZ1A 2I6QA 2A0QB 2VB0A 2ZPQA 3T26A 1E34B 1WYKA 4ESTE 1ZYOA 1LVYA 3F1SB 3S0NA 2HVXA 4CBOA 1F0RA 1XUHA 3RXDA 5LPRA 4UFGH 4E7NA 3SNCA 2DE8A 4JYUH 4JZEH 4H42U 1GJ5H 2C4FH 3CS0A 4FVBA 4ABBA 1HXFH 3SV2H 3MNCA 1FY1A 2TPIZ 4D7FA 4BNRA 2PKSB 1ZTKA 3SZNA 1PJPA 4B2BA 1LPGB 3RXPA 4MNWA 5AFZH 1TOMH 4GUXA 3MNXA 1WSSH 2Z6BD 2D1JA 2HPQH 3KNXA 3UUZA 3NPSA 3ZVGA 4X2YA 3PMBB 5GCHG 3RXBA 1QBNA 3PB1E 1DXWA 1TNIA 1AUTC 3D49H 1V2PT 3K6ZA 3UR6A 1YPLH 1BHXB 1YP9A 4MPWA 1D6WA 3BTKE 2SGEE 3A7ZA 1C1NA 4A1TA 4ASHA 3ZZ5A 1FV9A 1RTKA 3UWIA 4Y8ZA 3MMGA 5HM2A 4B74A 4NZQA 4MPVA 1F0UA 3TK6A 4B76A 2FMJA 1GMDG 2FX6A 2PKAA 4CRBA 1B7XB 4ZKNU 1T8LA 2ZO3H 1T8OA 2STAE 5DP7A 3SI4H 5IYTA 1HJAB 3M37A 2TGDA 3RXUA 4LZ4B 2EI7A 1UCYK 2J94A 1WTGH 1W3CA 3OY6U 1W2KH 1HAHH 1EZUC 2AERH 2A4RA 1V3XA 1UHBA 2GDDA 2OD3B 4IMQA 1C1UH 1DDJA 3BTTE 1THPB 2DE9A 1O2MA 4NSVA 3MO3A 3VFEA 1C4V2 2BOHB 2ZQ1A 2SNVA 3RXGA 2XWAA 2ZDLA 2AEIH 3BEFB 3L33A 1DUEA 2EC9H 2GT8A 1JOUB 1AGJA 3BEIB 4FUFA 3A83A 3A85A 1RTLA 5C5NA 3GCNA 1K2I1 4DGJA 3ZZBA 3TNTA 3SV6A 2ZDAH 3OYPA 3SV9A 2CMYA 3A82A 1SQOA 1HRTH 3T5FH 1DLKB 5EU8A 3VB6A 3VXEH 4IN2A 3U1JB 2R9PA 3BTME 3SOSA 1HYLA 1GJ7B 1AVXA 1C2HA 1L1JA 3AAUA 5JBTA 1YPEH 1HB0B 2A4OA 5E8EH 1S5SA 3BTDE 5GWZA 1T31A 2VIDA 5I25A 2B5TB 3Q3KA 1L0ZA 1O2WA 2CHAB 4CR9A 3IG6B 1ZLRA 2BLWA 2ZCLP 4HI3A 1HV7A 1DLEA 1HDTH 1ZMJA 1H9LB 1AN1E 1O3IA 3SJKA