1Y5UT

Dianhydrosugar-based benzamidine, factor xa specific inhibitor in complex with bovine trypsin mutant
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding binding selectivity toward trypsin and factor Xa: the role of aromatic interactions
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords Trypsin, cationic
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y5uT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y5uT02
4Y7AA 5GDSH 2P8OC 3RXJA 4Z6AH 3UPEA 1ELAA 2A7HA 2ZIQH 4JYVH 2J92A 5JBAS 3KQEA 1XX9A 4LZ1H 1G30B 1QR3E 1O2KA 1JMOH 1GHBF 4DCDA 1QY6A 2VU8E 2A7CA 2BOHB 1EZSC 5BRRE 3TNTA 1CT2E 1L0ZA 3OY6U 1NROH 5F8TA 1Z8IB 1DLEA 5IYTA 2XRCA 3JZ1B 2V35A 4NA8A 3C27B 1EKBB 2BY5X 4B1TA 4XBCA 1DWCH 1TNIA 1PPFE 2BDHA 1CA0B 4XFQA 3L33A 2XWAA 1UTOA 2XNIA 2W5EA 1V2JT 1E37B 2BZ6H 1WSSH 4RKOB 2WYGA 1GMDF 1AY6H 4MPUA 3SQHE 1O37A 1F0SA 4RN6A 4KGAA 4JYTA 3RMNH 1OYQA 4XE4A 1Z7KA 2BX4A 1D9IA 2IN2A 4ESTE 2NU0E 3LGTA 1UHBA 2ANKH 1C2EA 3U1JB 3RU4D 1DT2A 1HBTH 2NU2E 3TJVA 1ELVA 4ZKNU 3ZVDA 1IHTH 3AASA 1SGQE 5JB9S 2BD8A 5E2PA 3P8GA 4GPGA 4Y7BA 1O5AB 1C1NA 1K1NA 1J9CH 1UCYK 1KY9A 4OS1A 1PQ7A 1C2HA 1A3EH 1LQDB 2PW8H 3OYPA 1O3DA 3KN2A 2PLXA 2GGVB 1W2KH 1GHXH 1UK2A 3BN9A 4DOQA 3NXPA 3SI4H 1XXFA 4MNXA 1PQAA 2YNAA 4ZXYH 4E05H 2F3CE 2G52A 4BAHB 1Z8JB 5FCRA 1O2QA 5FAHA 1J15A 1TOMH 2FTLE 1FQ3A 1ANBA 1A4WH 3V7TA 2GDDA 1GMHF 3VPKA 2A0QB 1DY8A 2ZDVH 1OPHB 2XYAA 1D3PB 2VIDA 4M7GA 1CHGA 3PMJA 3H5CB 6LPRA 1FNIA 1DLKB 4Y79A 3RXDA 1O3PB 2QA9E 2XBWA 1FAXA 1SGRE 1TX8A 2VINA 3SJKA 2EI6A 1S5SA 3M5NA 2BLQA 3GDVA 5L2ZH 1RGQA 1Y3WA 1B5GH 1FAKH 4FUCA 4B74A 1DOJA 4VGCC 3S9CA 1GCTB 2JH0D 3UTUH 3A7TA 1Z71A 3SJ9A 1NT1A 1QJ1B 2H2ZA 2Y82A 1GBLA 2ZU2A 2FOCA 2PFEA 1AFQC 1HAIH 4X2VA 3BTHE 2VWNA 2HOBA 1F7ZA 1RTFB 2G5VA 1L4ZA 1C9TA 2SGDE 2WPKS 2Z7FE 2AEIH 5FX5A 2WV5A 1FPCH 4ISLA 2J95A 1BBRH 2Z9IA 1GBKA 1O2IA 4MPXA 1MMJN 1UTMA 1RD3B 1NFYA 1O3CA 2IOTA 5LH8A 3ZZ7A 1BCUH 1C4U2 4WMEA 1XVOA 1C1QA 4U01A 3SQEE 3ZVGA 2HNTF 1EJAA 2FOHA 1GBIA 1O3JA 2QIQA 3LH3A 2FXRA 3QWCH 2ZCHP 3ESTA 1HNEE 3F9HA 1AGJA 2JH5D 1HJAB 2OQUA 3OX7U 4YOIA 2F9NA 1ZSLA 4UE7H 4ABFA 2SGAA 5DKMA 1TGNA 3SGAE 2H9TH 3RUOA 1ETSH 3RMOH 1K2I1 4KTCA 4ABIA 1UVUH 2HALA 4MNVA 1ESTA 2ZZUH 1KXAA 1P3CA 1VCPA 2Y5GA 4AZ2B 3ZV8A 1GBDA 1GHAG 3QLPH 2ZFSA 3PWBA 3LGIA 3OY5U 1MKWH 1GCTC 1K1PA 2AIPA 1P09A 3RXMA 1THSH 1UVSH 1GHYH 3ZVAA 2GMTC 1TX6A 3BIUH 1EP5A 2BY6X 2ZO3H 3MO9A 2W26A 4ABAA 2Q6FA 4B73A 2UUJB 1P9SA 4AYYB 2VIVA 1O5CB 1AB9B 2UUYA 3RXBA 4ISNA 2HVXA 4Y0YE 1DXPA 1EAWA 3JZ2B 4K1SA 1O31A 1Y3YA 3U9AH 2FOMB 3T28A 4AYVB 2H5DA 1O3NA 1C5RA 1AIXH 1GBBA 1T4UH 3LJJA 4H6TA 4I8GA 4XBDA 1L1JA 1MKWK 4X8SH 4D8NA 3SV2H 1UVOA 1P57B 1L2EA 3M37A 3P8FA 1SOTA 5FPSA 4X6OA 2A4QA 3ZV9A 1FN6A 1KXFA 1K1IA 1G2MA 1YP9A 1HV7A 2AMQA 3C1KA 3BG4C 4Y6DA 2C8WB 2FESH 4YOJA 3TK9A 3A7WA 5GXPA 4UEHH 3BSQA 4BANB 4WWYA 4XDEA 4ISIH 1TNGA 2Z9JA 4IMZA 5EXLA 1CVWH 2G5NA 2QF0A 3VB5A 1KLJH 1O3LA 5EGMA 3TK5A 1K1LA 1OWDA 2PKSC 2Z9KA 2AMPA 3DFJA 1Y3VA 2ZFQH 1N6YA 2H1UA 1O2YA 1SR5C 1O32A 1TWXB 3LGUA 1C5PA 5EXNA 3EA9A 1GJ5H 3MNSA 4A7IB 1QB6A 1BOQA 1N6XA 3TIUA 2ZFPH 1CBWB 5J4QA 3PB1E 4JZ1A 1CO7E 3M7UA 4UFEH 1P2OA 2QY0B 1AWHB 1E38B 1PPHE 4R0IA 3SV6A 1Q31A 3LGVA 4ABBA 1QL7A 1O2ZA 2GD4B 1EXFA 1VITG 5C20A 2ESTE 4IBLH 2GX4A 1BB0B 1WQSA 1AFEH 1SPJA 2XC0A 4NSVA 5DP7A 1UJ1A 4GHQA 2B0FA 4BTIB 4D7GA 1FZZA 2ZI2H 2Y6TA 5FBIA 2HGTH 3BTDE 1VCWA 2SNVA 5EPNA 1OWIA 4ZH8A 1HB0B 3V3MA 4OGYA 1NN6A 1ZTKA 4ZHLU 1V2VT 3PV4A 4NG9H 3T62A 1LKBA 1MBQA 2XC4A 1PYTD 2ASUB 1GBCA 5C1XA 3S7HB 3GDUA 1W14U 3ZZ5A 1C5LH 8ESTE 1PPCE 2D1JA 4PROA 1TGCA 1BDAA 3SHCH 3D23A 3SU6A 1UCYE 1C2IA 1YLCA 2RDLA 1BRBE 4HTCH 1OYTH 1VJAU 2IPHA 3M5MA 1EASA 3EGKH 3UR6A 3UOUA 1A2CH 1P05A 2PSXA 2XBYA 3CENA 1C2GA 1D6WA 3LC3A 2F9OA 3SNCA 3RXAA 2B9LA 1UK3A 4ZMAH 3UWJH 1Y3UA 1BT7A 4X8VH 1WCZA 1CQQA 1TPOA 2O8UA 4I7YH 2EC9H 5T3HA 5JBCS 4TPYA 2TRMA 1ELCA 1A7SA 1QQ4A 1QURH 4HFPB 1V6DA 3VGCC 1IQNA 2K1QA 1IQEA 3D65E 2LPRA 5DP9A 4FUHA 1TPSA 2AS9A 2SGPE 3UNQA 1Y5BT 2BY7X 2Y5HA 1BJVA 1K22H 2QAAA 1SOZA 1FONA 1GJ4H 2FOEA 1V2OT 2O8MA 5GJ4B 3U1IB 1K1MA 2VIPA 3ZZ8A 3KF2A 1O5BB 4WY3A 3QX5H 1EOLA 1DPOA 1A5IA 2TGTA 4JCNA 2DE9A 4DJZB 1M9UA 2VWOA 1S83A 1UK4A 1LTOA 1TRYA 2ZCLP 3E91A 1RIWC 3MFJA 2ZDNA 2VB0A 4YO9A 2B7DH 4NZQA 2D8WA 1O5EH 1THRH 1DSUA 3EAJA 3QN7A 3U8RH 3K2UA 3LU9B 3RXLA 4Y8YA 1S84A 1GJ7B 3T2NA 3DUXH 7GCHF 3EA8A 4AFQA 1O34A 3RLYH 5JB8S 1O30A 1OWKA 3BG8A 4K3JA 2VVUA 2RA3A 3ELAH 1AZ8A 4WXVA 4YM9A 1XUHA 2PUQH 1T32A 1MU6B 1UCYH 1C1RA 3SBKA 1E35B 1SB1H 2OLGA 5DGJA 2BDCA 2VIOA 2OP9A 4B71A 2Y80A 2AYWA 4K1EA 3KIDU 3BTTE 3LONA 2TIOA 2ZFTA 1FDPA 3GY8A 1DWDH 1ZRKA 2BQ7B 5CMXH 3LT3A 4MQAA 5T6GA 1O2HA 2VGCC 4X6NA 3PM3A 1BMLA 1RTLA 1HIAB 3GY5A 3OSYA 1JRTA 1EZXC 1O3AA 3SUGA 1CE5A 5PTPA 2FX4A 1CBWC 1O2WA 2ZFFH 1O2XA 2FYQA 5JBBS 3MU1A 4Y8ZA 4XBBA 4DIHH 2ZF0H 1YCPM 1ZJDA 3A82A 4INLA 1FV9A 1CU1A 1O2RA 4IGDA 1QJ7B 4DY7B 1ACBE 4U30A 2C93B 2HPPH 1AUTC 2FOGA 1EPTB 3ZVCA 4CRGA 1OXGA 2ILNA 1Z6JH 2DE8A 4I8HA 4ABDA 2WUBA 3PTBA 1K9OE 3MH6A 3U98H 1V3XA 1QQUA 2FODA 2UUKB 4K8YA 1YPHE 3ATMA 2ZC9H 2FOFA 3A7YA 4MG3A 1GI6A 2YOLA 3FP6E 5IDKA 2BD7A 3RXUA 1SL3A 1TGSZ 2BLVA 3CP7A 3HPTB 3RXSA 4WF8A 1OKXA 1AE5A 3GDSA 3QGNB 2VNTA 3NCLA 4DIIH 1GI2A 1C2LA 1NRSH 2FTMA 3RXCA 3QTVH 4H42U 1AE8H 1IQGA 4FU7A 2ANMH 1GI3A 4I8KA 2OINA 4O03A 2BD5A 1UTNA 1EQ9A 1DWBH 2BOKA 1V2LT 1GVKB 1LHCH 2I6SA 5L30H 2GTBA 3KL6A 3UUZA 1GJ8B 1T7CA 1YPKH 1LHDH 2ALPA 2BB4A 4UFFH 1GG6B 3R3GB 1SSXA 5DP4A 1O5GH 1WU1A 3SV9A 1HAGE 3ATWA 2UUFB 2C3SA 5CE1A 1ANDA 1UTQA 1HJAC 3S9AA 1GMCG 3D62A 2A5AA 1LKAA 1C1UH 2XTTB 3ZZAA 2VVCA 4AG1A 4Q2KA 2ANYA 3SU4A 1TRMA 1HAYB 2AGGX 4F4OC 1DUEA 1MTNB 3PO1B 1QCPA 2J2UA 3Q77A 4X2YA 2A1DB 1GMHG 4XOJA 3VB3A 1W7XH 4IN1A 2FI5E 1GI0A 5DPAA 1ZR0A 3A83A 1YM0A 3KQDA 3UREA 3RU4E 4JK5A 3PMBB 4FUGA 1G3DA 1RTKA 3AAVA 1NM6A 1BHXB 3RXVA 2OBOA 1ANCA 2GP9B 1P2JA 1C1TA 1DY9A 1TABE 1A0HB 2NU3E 3E0PB 3MYWA 3MNBA 5DO4H 8GCHF 3TJOA 5JDUB 1UTKA 1XKAC 1BA8B 1KTSB 3KQBA 1HAOH 3QGJA 1C5UA 3TK6A 3VXFH 1PPEE 4CR9A 3KQCA 2PSYA 1ZTLA 2VWLA 2PTCE 4TYDA 3MTYA 1MUEB 5J4SA 2BXTH 1SGTA 2BDBA 3O8CA 3I29A 2RG3A 3HATH 1GJAB 2GCHF 3M7TA 1C1SA 1Z1JA 1BTYA 2FDAA 1GBFA 3P6ZB 2FOBA 4GVUA 1C4V2 2G4UA 2ZPRA 1S82A 1GI8B 1T8OA 1VCQA 2CGAA 3SI3H 3A8BA 3BTEE 4IC5A 5FXLA 1TONA 3FZDA 3T25A 2OC8A 3BEFB 2R2WU 2GZ8A 1XUKA 3UFAA 3NPSA 1INCA 1P11E 2G4TA 1WTHD 4O3TA 1MTNC 4LXBH 3BG4B 1VITH 2O8WA 3RXPA 1HAHH 1YLDA 1DX5M 5B6OA 3ZVBA 1SGFA 4VGCB 3UNRA 2ANWA 2W7SA 4K60A 3E1XB 1ZYOA 3SO3A 1NESE 3A81A 5A8XA 1GI7B 1LPGB 1T8NA 2P93A 3UOPA 2G51A 2WPHS 2PGBB 1S81A 4KKDA 3T26A 1QA0A 3M35A 4K8BA 5GCHF 4ISHH 1O2NA 3H7OA 4K1TA 1C5NH 2ZDAH 1XKBC 2ZG0H 2R3YA 4X6MA 3UWIA 3S9BA 3TH4H 3ZZDA 4FUBA 5I25A 4BAQB 3FP8E 3T5FH 2ZU3A 1C2JA 1PJPA 3EQ0H 3URCA 3GCHB 3TH2H 4X8TH 1C5VA 4F49A 5C67A 3DD2H 3GY3A 1P2MA 3W95A 1SG8B 3K6YA 1IQMA 1SVPA 3SV8A 4ABEA 2FYRA 1W7GH 4X8UH 3MH7A 4OS5A 1Y59T 4CRCA 4FUIA 1ZZZA 4QT8C 3TLOA 4IW4E 4FUJA 1FUJA 3RXIA 1FY3A 5HYOA 1C1OA 4NCYA 2BDYA 2ZCKP 2GV6A 1DVAH 1GL0E 1OWHA 1NFXA 2A4GA 1KDQA 2PKSB 1P2QA 1AZZA 1WAYB 3Q3YA 2VWMA 1MAYA 1KYNA 1MU8B 1BRCE 1EB2A 1TNKA 2P3FH 2CHAB 3BIVH 1XVMA 1B7XB 4KTUA 4U2WA 5FPYA 4YOGA 3F1SB 4I8JA 5JPMH 2W3IA 1RXPA 2GT7A 1BZXE 1KXCA 4Y0ZE 2V3OH 1P8VC 1P03A 4AB8A 3DA9B 1CGJE 2H9HA 1ETTH 4WMFA 3MU0A 2HWLB 4Y8XA 1NTPA 1QFKH 2ZPQA 4Q7XA 1GBMA 1SC8U 3QK1A 1MBMA 1ZHMA 1OX1A 1ZMNA 2BXUH 3GICB 1MD7A 3RP2A 4ZHAA 1P2IA 2FOAA 2EA3A 3MU8A 1G3EA 2QN5T 1KIGH 1UTLM 4A5TS 1YC0A 3EYDA 4TY6A 1TMBH 3UNSA 3RXHA 1KLIH 5DP3A 4K2YA 2OC7A 8GCHG 3A87A 3RXTA 4WJG2 2JH6D 3F6UH 1Z6EA 1TGBA 1BBRE 1G37A 3IG6B 1UTPA 1HUTH 1MQ6A 4WMDA 2A5KA 1C5YB 1GDQA 3HGNA 1LVMA 2ZTYA 1C1MA 1E0FD 1Q3XA 1D3QB 2BQ6B 5A8ZA 1AKSA 1V2TT 1YPGH 2G81E 1GI5A 2J4IA 1RS0A 5F03A 3VB4A 1O3OA 1HLTH 3AW1A 1SLUB 2P3UB 1VGCB 2J38A 2UWPA 1MCVA 3MU4A 3Q76A 2G55A 2V6NA 3RLWH 5A09A 2GCHG 1O5FH 2VH0A 1O33A 1NO9H 3L6PA 3GOVB 4Y76A 3NK8A 3SGQE 5E0JA 4TWYA 1C2MA 1AB9C 4GCHG 3NKKA 1SLVB 3F9FA 1BTPA 2WPMS 1FLEE 3SU0A 1MQ5A 4JK6A 4CRDA 1ARBA 1KXDA 2TBSA 1BTXA 4GSOA 1ZPBA 3B23B 3I78A 1V2KT 1AO5A 2H5CA 1W12U 4NFEA 1C4Y2 1MCTA 1C5WB 2BDGA 3LOXA 1SHYA 4FVDA 1N8OB 1NRPH 4AFZA 3SW2B 1A46H 1F0UA 4B2BA 1PPZA 2KAIA 4CRFA 3P70B 1O2OA 1ELGA 3Q00A 1EAIA 1ID5H 1RJXB 2Z6BD 3UIRA 3ZZ6A 2ZHEH 2HLCA 3RDZA 4AFSA 1L1GA 2ALVA 1HCGA 5G4BA 2BLWA 2R0KA 4BTUB 3PO1C 1YBWA 4BAMB 4AN7A 4Q7YA 2Q6GA 7GCHG 3R0FA 3SUDA 2FIRH 1NZQH 2A31A 1TBZH 1V2NT 1XM1A 1O0DH 3STIA 5ABWA 1P12E 1QGFA 1GGDB 1A3BH 2ZU1A 1O3IA 2THFB 3V12A 1BTWA 2FWWA 2W7UA 4MNYA 1LQEA 1TPAE 1XMNB 1GI1A 3RU4T 4JZFH 1N1LA 3LIWA 1TA2A 1LMWB 1P2KA 1C1PA 2QV1A 1ZMLA 2OUAA 2Y5FA 1PQ8A 2ZFRH 2BD2A 2OD3B 4H6SB 2A5IA 1G36A 1OWEA 4THNH 4K5ZA 5A0AE 1HRTH 2ZQ1A 1ANEA 1B0FA 2A4RA 3IWMA 1SGPE 1V2QT 4DVAU 1IHSH 1BQYA 5GCHG 5LGOA 2BD3A 3SNAA 2BQWB 1EATA 4E7NA 1ORFA 1DSTA 4GLYA 5AFZH 1IQLA 2RA0A 3DHKH 4ZXXH 5T6DA 5A2MH 5F6MA 3M36A 1EAXA 5JBTA 2FI4E 2CV3A 3CS0A 5K7RA 1SQOA 3GCTF 1GBAA 5EU8A 3SNDA 1WV7H 1ESAA 1GDNA 1ZSJA 1THPB 2QCYA 1F5RA 2BD9A 5HGGA 1AN1E 1X7AC 3ZZ9A 2BVXH 1VGCC 1MZDA 3GYMA 5EXMA 1AQ7A 4JZIA 1F0TA 1T4VH 2FS8A 1TALA 1O2TA 1WQVH 1YPEH 1GBEA 3MH4A 1RRKA 1FN8A 3RXKA 3ATKA 3PLBA 1H1BA 1RIWB 1Y8TA 1YYY1 2PUXB 4MDSA 1LHFH 2QC2A 4NA7A 3K6ZA 2O9QA 1CHOF 4YLQH 1DDJA 1O35A 3N7OA 1D4PB 3GISB 2FLRH 1MTSA 2WUCA 1NY22 3S7KB 1AVGH 4CH8B 1GHBG 2NU4E 4U32A 1O2UA 4A1VA 1WUNH 4NWKA 4IMQA 1LO6A 1Y3XA 1GG6C 2TPIZ 2Y7ZA 4RKJB 1FY1A 1HDTH 2ZGHA 3BTFE 4WXIA 5FBEA 2A4OA 1UMAH 1EPTA 1YPJH 4D76A 4YTAA 5T6FA 1BTZA 1QNJA 1J16A 4ABJA 2ZDLA 2TGDA 3MMGA 1FPHH 4B76A 4D7FA 1ZMJA 1PPGE 3FFGA 4WVPE 2NWNA 2BY9X 1AD8H 3RMLH 2FX6A 1YPHC 3LGYA 3A8AA 7KMEH 5AVDA 2SGEE 3TH3H 1AUJA 5LPFA 4DW2U 1GI4A 1O39A 1AI8H 1HAXB 3AAUA 3NWUA 4OS4A 1GJCB 3A8DA 1BITA 3LGWA 4NGAH 1SI5H 3SNEA 2GT8A 2PKAB 1EX3A 3PWCA 3TNSA 1HXFH 1O36A 4X1NU 5DP8A 3UR9A 2CXVA 1CGHA 6CHAC 3A7XA 2O8TA 3A80A 1AKSB 4NWLA 1W13U 1O2GH 3VXEH 1E36B 4X1QU 2PWXA 2G00A 3S69A 4CREA 4Y71A 1KDQB 2FLBH 3DT0H 4OS6A 4YZUA 1O2MA 2BM2A 1G3CA 1NRRH 2P95A 1N8OC 2ZPSA 3HKJB 5GIBA 3ODDA 4NA9H 1OP8A 2GKVE 1J14A 1U6QA 2V3HH 3SGBE 3VB6A 2STAE 3FVFB 1KXBA 2BTCE 4AGJA 4O9VA 2BX3A 1EAUA 3MH5A 3F9EA 1WTGH 3B9FH 1MTUA 4I32A 1IQJA 1L1NA 4UFDH 4MLFB 1LVOA 2C8ZB 1HJ9A 2GDEH 1FIZA 2IJOB 2Z94A 2CHAC 1SMFE 1YCPH 3P92A 4NIWA 4ZHMU 2QGRA 3IITA 5TCCA 1GJ6A 1EB1H 4ASHA 2P94A 4BAKB 2A7JA 1A0JA 1V2RT 4CHAB 3RMMH 1CA0C 2Q6DA 3RXEA 1CSOE 5FCKA 2OXSA 1TYNA 3PYHA 4Q80A 3SU1A 1H9HE 1TA6A 3GYLB 4YT7H 1W3CA 1IQFA 2STBE 1P10A 4B75A 2NU1E 2BHGA 1GHAF 2EEKA 4AOQA 1O38A 2BDIA 1DANH 2F9BH 3VFEA 3TGKE 1H8DH 5DK1A 5EODA 2AERH 1TQ7B 1GCDA 3U69H 3UQOA 2Y7XA 1A0LA 4MVNA 3V13A 5C5OA 1HJ8A 1GPZA 2QYIA 1P02A 1QRZA 1IQIA 4J1YA 3A85A 5AF9H 1BRUP 3SU2A 1A1RA 3SU3A 4B2CA 2F9UA 3EA7A 5EQSA 1HAVB 2CF8H 4UDWH 3TGJE 1G32B 5JYIA 1TB6H 5F8XA 3ZZ4A 2BDAA 2F9VA 3O8BA 5GPIB 3SORA 3KCGH 1CHOG 3NZIA 2ODYB 2VJ1A 2H6MA 1GJDB 5C5NA 2A45B 3SJOA 3E8LA 2LNCA 1HYLA 1VITF 1H8IH 3ATIA 1ELEE 1PPBH 1GDUA 4ZKRU 4X0WU 3A89A 2D2DA 2SFAA 1WYKA 2XBXA 2ZGXH 5LPEA 3ODFA 3L3TA 1SBWA 3RXGA 3KHVA 2I6QA 2Q1JA 5BPEA 1MTWA 1TE0A 3KGPA 5AHGH 2GV7A 3PLKA 2RCEA 1MKXK 1SGCA 2R3UA 1LPKB 5E0HA 4CBNA 3LDXH 9ESTA 2ULLA 2O8LA 1ZJKA 5FHTA 2FEQH 2P59A 5HMAA 4MPVA 3BTME 2FPZA 3M3TA 1Q2WA 3D49H 5DP5A 1TBRH 2HRVA 4E06H 3Q3KA 1T8MA 4LOYH 1DICA 1RFNA 3BV9B 2XCNA 2P3TB 1AMHA 1GBJA 3URDA 1S0QA 4CRBA 5CHAB 1CGIE 2AGIX 1XUIA 5ESBA 2B8OH 2ODQA 1O3FA 1GMCF 1LVBA 3VB7A 1PFXC 3GCOA 3ZVEA 2QXGA 4AORA 6CHAB 3RM2H 3HKIB 1P9UA 1LHGH 2HPQH 4O3UA 1QL9A 1PQ5A 4NIVA 5DG6A 1DS2E 4HI3A 4FUEA 3BEUA 1LCYA 4A1XA 1HPGA 4XSKU 2FS9A 4UONA 3FZZA 2WPIS 5FX6A 2WPJS 3QDZB 1J17T 5FPTA 2Z3DA 5K0HA 2BZAA 2H9EH 4GAWA 2FO9A 3ZZCA 3O8RA 1EZUC 3PROA 1O2SA 2EI7A 3A88A 1WBGB 3MWIU 1AWFH 2GVFA 2WPLS 3BTQE 3MU5A 1IQHA 1QA7A 1FIWA 1O5DH 3BTWE 3TITA 1BMNH 1YPMH 2PKAA 1S6FA 2ZWLH 1SGFG 2ZU4A 3MOCA 3F9GA 2R9PA 1MKXH 1LPZB 3Q3XA 4JMYA 2ZDKA 3PTNA 3BTKE 1AFQB 1LDTT 5EQRA 2JKHA 1ZLRA 4X2WA 2GCTB 5EQQA 4NIXA 4JYUH 4X1RU 1DFPA 5HM9A 3B8JA 3P17H 4ABGA 3TJUA 4ZROA 6ESTA 1HXEH 3TGIE 2A2XH 4KP0A 2YNBA 1XXDA 1V2PT 2ZEBA 2ZHFH 2AMDA 1NRQH 5L6NH 1ABIH 1V2MT 1SFIA 2F83A 4K69A 1MZAA 2ZHDA 1NFWA 4Q7ZA 1C5QA 4O97A 1Z8GA 2M5TA 2QXJA 2F9PA 4WH6A 4A92A 1T8LA 4D9RA 4LZ4B 2J94A 4ABHA 1A5HA 1ZOMA 1Z8RA 3QTOH 4AGKA 1ZHPA 1TOCB 1JXPA 1S85A 1BMMH 3E90B 1QB1A 1A61H 1GBHA 1MTVA 5C3NA 1GJBB 1ZGIA 3HGPA 3E0NB 3MI4A 2SGFE 1WOFA 3RC4A 4Z0KA 4GUXA 1TX7A 2A32A 5AFYH 3P8NA 3W94A 1AVWA 1KLTA 4Y11E 3A7ZA 2A2QH 1L4DA 2VVVA 3P95A 2PR3A 4AB9A 2B5TB 1CT0E 4FU8A 3SJIA 1O3MA 3TVJB 2XWBI 1NRNH 4HGCA 4DURA 2G8TA 2AH4X 2CF9H 1K1JA 3GY6A 4NSYA 2F91A 2ZHWH 1S0RA 3SV7A 2XC5A 2CN0H 4LK4A 4YLUA 3SN8A 1EJMA 1JIRA 5SGAE 1W11U 1GHVH 1GVLA 3UY9A 7LPRA 3E16B 3LJOA 4H4FA 4ZUHA 1MH0A 3K65B 2WYJA 3P8OA 3K9XB 1DM4B 1DWEH 3RC6A 2KAIB 1EUFA 3M7QA 1O2PA 4R8TB 3T27A 4ISOA 1C5MD 3GCTG 1C5SA 1GI9B 2BY8X 1XUGA 1NS3A 1GJ9B 5I46H 1O2JA 3SZNA 4NZLA 1T31A 4BOHA 4GCHF 5C2ZA 2BD4A 2WV4A 1F5KU 3G01A 3EE0B 3V0XA 1W8BH 1FY4A 1GL1A 3ZYDA 2HNTE 1O2VA 1TAWA 2D26C 2V0BA 1MAXA 5HM2A 3S0NA 4AG2A 2Z3EA 4E7RG 1ZSKA 4DT7B 1BBRK 1TNHA 2TGPZ 1C5TA 2QXIA 2OC0A 4FU9A 2PTNA 1HFDA 1F2SE 2UWLA 1BIOA 4TPIZ 3M5OA 1G9IE 3AVZA 5EG4A 1TNLA 2BMGB 2OQ5A 1SGEE 1DE7H 1YCPK 1ZPZA 1OP2A 3PMAB 1IOEA 1IQKA 2Z3CA 1IAUA 1BHXF 1K1OA 1Y5AT 1QBNA 5ETXA 1BTUA 1W10U 3ATLA 2WINI 5GWZA 1K21H 1EOJA 1FJSA 2ZGBH 2SGQE 3RM0H 4KTSA 1TNJA 2J9NA 3STJA 3T29A 4BXWA 1HAVA 4TY7A 2Z9GA 4B2AA 3WY8A 1AU8A 3VGCB 4X1SU 3M3SA 1GWAA 4CH2B 3MO3A 5E8EH 1OWJA 4INKA 5L2YH 1QIXB 2OBQA 1P2NA 3U8OH 1SGDE 4FUDA 4JZDH 2SNWA 1UVTH 5EPYA 8KME2 1H4WA 2GZ9A 4FVBA 3ZZBA 4FUFA 2C8YB 2AFQB 1TBQH 2JETB 5C1UA 4YESB 3HK3B 1QRXA 1AHTH 3TPIZ 4X6PA 4Y10E 1D6RA 4NIYA 3GY2A 1ELBA 1G2LA 4MTBA 2ZDMA 1SGIB 2OC1A 3PMHB 3A7VA 2UWOA 1W0ZU 3PLPA 1Y5UT 2QF3A 1EP6A 1TRNA 1Z1IA 4BNRA 1QL8A 3QO6A 1J8AA 3SOSA 1TLDA 1QTFA 4A1TA 1BJUA 3CS7A 1ZTJA 4UD9H 1JRSA 3MHWU 1P04A 3NUMA 1SGNE 1NC6A 2PHBA 1E34B 4ZKOU 1V2UT 5F8ZA 3LPRA 1F5LA 4OS7A 1EJNA 1MD8A 3TJNA 1CT4E 4CBOA 1NU9A 3QZQA 1YPLH 2ZECA 4IS5A 2HNTC 2C90B 4ZAEA 3FAOA 1UVPA 4I31A 2GZ7A 2VH6A 1SLXB 1W0YH 4BTTB 3TU7H 3QUMP 1C9PA 2ZP0H 1FY8E 1TQ0B 1FI8A 3SU5A 1ZPCA 5A8YA 1PYTC 1TMTH 3E3TA 4A6LA 1HIAA 3I77A 2FI3E 2XCFA 2ZU5A 4OS2A 1JIMA 5DJ7A 3A8CA 2OTVA 2ZKSA 5TCAA 1SHHB 2XW9A 1F0RA 5CHAC 1ARCA 1FY5A 3OTJE 2OCVB 2FZZA 4YT6H 2AGEX 2JETC 2ODPA 4BAOB 1O3BA 3MNCA 3M3VA 4IC6A 1UHBB 2ZTXA 1O2LA 1A5GH 2EI8A 1NU7B 2FM2A 2ZQ2A 4CR5A 3FP7E 2VIQA 1ESBA 1O3KA 4NFFA 1C2FA 3SJ8A 1QBOA 1LVYA 1H9LB 1UTJA 5ESTE 3QZRA 1DUAA 1DXWA 2R2MB 3EDXB 1JBUH 3F68H 4GHTA 1GHWH 3SNBA 2W3KA 3GCNA 2P16A 1BTHH 6GCHG 1HAZB 4TWWA 3HK6B 2J34A 2CJIA 1YGCH 1C5XB 1P0SH 5EW2H 1EPTC 3A84A 1NFUA 5HXFA 4RSPA 1YKTA 3GCHC 1SLWB 2XBVA 1FMGA 4AX9H 1ZGVA 3LKWA 3GY4A 2ZNKH 1SQTA 5E2OA 1TFXA 1GVZA 1BMAA 3ZVFA 1GMDG 1V2ST 1HGTH 2ZGJA 3ENSB 4BXSA 1P06A 1TMUH 2VGCB 3U8TH 1QHRB 4KELA 5LPRA 4AFUA 5A0CA 1O3GA 1ELFA 2GMTB 1C1VH 2C4FH 3ZYEA 3ZZ3A 2Z9LA 1C5ZB 2R0LA 2C8XB 3KEEA 3A86A 2GCTC 1VJ9U 4FXGH 5E0GA 3BTGE 3BEIB 2FP7B 1VZQH 5TJXA 1ELTA 7ESTE 4SGAE 1KXEA 3FANA 1QB9A 2BVSH 1UO6A 1K28D 4WH8A 4CHAC 1OSSA 3DFLA 1ABJH 2ZTZA 3VEQB 9LPRA 4UFGH 2ZA5A 3O8DA 1QRWA 1D3DB 5EOKA 1C5OH 2XXLA 1FXYA 2BYAX 4J2YB 2P8OB 1QJ6B 1P01A 5DP6A 3E6PH 4MNWA 1XUJA 3RXRA 4DGJA 1OP0A 4MPWA 2BLOA 1HAPH 1B0EA 1QBVH 1O3EA 3RXQA 3SUFA 1DITH 4CRAA 3ITIA 3LH1A 4SGBE 1JWTA 1OS8A 3MNXA 3MO6A 3M5LA 4OGXA 3BF6H 3GY7A 2AIQA 1TPPA 1KTTB 4D9QA 2PGQB 3OU0A 1ZHRA 3RXOA 1C2KA 1EZQA 1GBTA 1H9IE 1ZRBA 3KNXA 1OOKB 4DG4A 1S6HA 1P3EA 1LHEH 3LC5A 1ETRH 4HZHA 1XUFA 1F92A 1AVXA 4I33A 6GCHF 1KSNA 4X1PU 5C1YA 5EW1H 2CMYA 1V2WT 4X2XA 2PV9B 1TIOA 2FMJA 3AW0A 2BVRH 4ZKSU 1GGDC 2Y81A 2TGAA 1D3TB 1G3BA 3RXFA 2DUCA 5A0BA 1SFQB 1CA8B 2ZGCA 1SQAA 4I8LA 4JZEH 1BRAA 1VR1H 2ZHQH 1TGTA 3SHAH 3UQVA 4INHA 5H4IB 3RC5A 4IN2A 3SUEA 1ELDE 2VIWA 3H7TA 8LPRA 1YF4A 1C2DA 1JOUB 1O3HA 3M61U 1SGYE 2QXHA 1NPMA 1C1WH 1BUIA 1GHZA
chains in the Genus database with same CATH superfamily
4Y7AA 5GDSH 2P8OC 3RXJA 4Z6AH 3UPEA 1ELAA 2A7HA 2ZIQH 4JYVH 2J92A 5JBAS 3KQEA 1XX9A 4LZ1H 1G30B 1QR3E 1O2KA 1JMOH 1GHBF 4DCDA 1QY6A 2VU8E 2A7CA 2BOHB 1EZSC 5BRRE 3TNTA 3N7EA 1CT2E 1L0ZA 3OY6U 1NROH 5F8TA 1Z8IB 1DLEA 5IYTA 2M2AA 2XRCA 3JZ1B 2V35A 4NA8A 5T1VA 3C27B 1EKBB 2BY5X 4B1TA 4XBCA 3GS9A 1DWCH 1TNIA 1PPFE 2BDHA 1CA0B 4XFQA 3L33A 2XWAA 1UTOA 2XNIA 2W5EA 1V2JT 1E37B 2BZ6H 1WSSH 4RKOB 2WYGA 1GMDF 1AY6H 4MPUA 3SQHE 1O37A 1F0SA 4RN6A 4KGAA 4JYTA 3RMNH 1OYQA 4XE4A 1Z7KA 2BX4A 4Q63A 1D9IA 2IN2A 2V3MA 4ASUD 4ESTE 2NU0E 3LGTA 1UHBA 2ANKH 1C2EA 3U1JB 3RU4D 1DT2A 1HBTH 2NU2E 3TJVA 1ELVA 4ZKNU 3ZVDA 1IHTH 3AASA 1SGQE 5JB9S 2BD8A 5E2PA 3P8GA 4GPGA 4Y7BA 1O5AB 1C1NA 1MABB 1K1NA 1J9CH 1UCYK 1KY9A 4OS1A 1PQ7A 1C2HA 1A3EH 1LQDB 2PW8H 3OYPA 1O3DA 2WZQA 3KN2A 2PLXA 2GGVB 1W2KH 1GHXH 1UK2A 3BN9A 4DOQA 3NXPA 3SI4H 1XXFA 4MNXA 1PQAA 2YNAA 4ZXYH 4E05H 2F3CE 2G52A 4BAHB 1Z8JB 5FCRA 1O2QA 3WWFA 5FAHA 2LELA 1J15A 1TOMH 2FTLE 1FQ3A 1ANBA 1A4WH 3V7TA 2GDDA 1GMHF 3VPKA 2A0QB 1DY8A 2ZDVH 1OPHB 1D3PB 1EFRD 2XYAA 2VIDA 4M7GA 1CHGA 3PMJA 3H5CB 6LPRA 1FNIA 1DLKB 4Y79A 3RXDA 1O3PB 2QA9E 2XBWA 1FAXA 1SGRE 1TX8A 2VINA 3SJKA 2EI6A 1S5SA 3M5NA 2BLQA 3GDVA 5L2ZH 1RGQA 1Y3WA 1B5GH 1FAKH 4FUCA 4B74A 1DOJA 4VGCC 3S9CA 1GCTB 2JH0D 3UTUH 3WWBA 3A7TA 1Z71A 3SJ9A 1NT1A 1QJ1B 2H2ZA 2Y82A 1GBLA 2ZU2A 2FOCA 2PFEA 1AFQC 1HAIH 4X2VA 3BTHE 2VWNA 2HOBA 1F7ZA 1RTFB 2G5VA 1L4ZA 1C9TA 2SGDE 2WPKS 2Z7FE 2AEIH 5FX5A 2WV5A 1FPCH 4ISLA 2J95A 1BBRH 2Z9IA 1GBKA 1O2IA 4MPXA 1MMJN 1UTMA 1RD3B 1NFYA 1O3CA 2IOTA 5LH8A 3ZZ7A 1BCUH 1C4U2 4WMEA 1XVOA 1C1QA 4U01A 3SQEE 3ZVGA 2HNTF 1EJAA 2FOHA 1GBIA 1O3JA 2QIQA 3LH3A 5KECA 2FXRA 3QWCH 2ZCHP 2JDID 3ESTA 1HNEE 3F9HA 1AGJA 2JH5D 1HJAB 2OQUA 3OX7U 4YOIA 2F9NA 1ZSLA 4UE7H 4ABFA 2SGAA 5DKMA 1TGNA 3SGAE 2H9TH 3RUOA 1ETSH 3RMOH 1K2I1 4KTCA 4ABIA 1UVUH 2HALA 4MNVA 1ESTA 2ZZUH 1KXAA 1P3CA 1VCPA 2Y5GA 4AZ2B 3ZV8A 1GBDA 1GHAG 3QLPH 2ZFSA 3PWBA 3LGIA 3OY5U 1MKWH 1GCTC 1K1PA 2AIPA 1P09A 3RXMA 2OK5A 1THSH 1UVSH 1GHYH 3ZVAA 2GMTC 1TX6A 3BIUH 1EP5A 2IPQX 3FN8A 2BY6X 2ZO3H 3MO9A 2W26A 4ABAA 2Q6FA 4B73A 2UUJB 1P9SA 4AYYB 2VIVA 1O5CB 1AB9B 2UUYA 3RXBA 4ISNA 2HVXA 4Y0YE 1DXPA 1EAWA 3JZ2B 4K1SA 1O31A 1Y3YA 3U9AH 2FOMB 3T28A 4AYVB 2H5DA 1O3NA 2WSSD 1C5RA 1AIXH 1GBBA 1T4UH 3LJJA 4H6TA 4I8GA 4XBDA 1L1JA 1MKWK 4X8SH 4D8NA 3SV2H 1UVOA 1P57B 1L2EA 3M37A 3P8FA 1SOTA 5FPSA 4X6OA 2A4QA 3ZV9A 4ZCNA 1FN6A 1KXFA 1K1IA 1G2MA 1YP9A 1HV7A 5B6LA 2AMQA 3C1KA 3BG4C 4Y6DA 2C8WB 2FESH 4YOJA 3TK9A 3A7WA 2QF4A 4UEHH 5GXPA 3BSQA 4BANB 4WWYA 4XDEA 4ISIH 1TNGA 2Z9JA 4IMZA 5EXLA 1CVWH 2G5NA 2GJGA 1NBME 2QF0A 3VB5A 1KLJH 1O3LA 5EGMA 3TK5A 1K1LA 1OWDA 2PKSC 2Z9KA 2AMPA 1OHHD 3DFJA 1Y3VA 2ZFQH 1N6YA 2H1UA 1O2YA 1SR5C 5F53A 1O32A 1TWXB 3LGUA 1C5PA 5EXNA 3EA9A 1GJ5H 3MNSA 4A7IB 1QB6A 1BOQA 1N6XA 3TIUA 3F2GA 2ZFPH 1CBWB 5J4QA 3PB1E 4JZ1A 4M9FA 1CO7E 3M7UA 4UFEH 1P2OA 2QY0B 1AWHB 1E38B 1PPHE 4R0IA 3SV6A 1Q31A 3LGVA 2KCYA 4ABBA 1QL7A 1O2ZA 2GD4B 1EXFA 1VITG 5C20A 2ESTE 4IBLH 2GX4A 1BB0B 1WQSA 1AFEH 1SPJA 2XC0A 4NSVA 5DP7A 4OM9A 1UJ1A 4GHQA 2B0FA 4BTIB 4D7GA 1FZZA 2ZI2H 2Y6TA 5FBIA 2HGTH 3BTDE 1VCWA 2SNVA 5EPNA 1OWIA 4ZH8A 1HB0B 3V3MA 4OGYA 5GNDA 2WHXA 1NN6A 1ZTKA 4ZHLU 1V2VT 3PV4A 4DT4A 4NG9H 3T62A 1LKBA 1MBQA 2XC4A 1H8HD 1PYTD 2ASUB 1GBCA 5C1XA 3S7HB 3GDUA 1W14U 3ZZ5A 1C5LH 8ESTE 1PPCE 2D1JA 4PROA 1TGCA 1BDAA 3SHCH 3D23A 3SU6A 1UCYE 1C2IA 1YLCA 2RDLA 1BRBE 4HTCH 1OYTH 1VJAU 2IPHA 3M5MA 1EASA 3EGKH 3UR6A 2F43B 3UOUA 1A2CH 3PRBA 2QE7D 1P05A 2PSXA 2XBYA 3CENA 3PRDA 1C2GA 1D6WA 3LC3A 5C17A 2F9OA 3SNCA 3RXAA 2B9LA 1UK3A 4ZMAH 3UWJH 1Y3UA 1BT7A 4X8VH 1WCZA 1CQQA 1TPOA 2O8UA 4I7YH 2EC9H 5T3HA 2YMSD 5JBCS 4TPYA 2TRMA 1ELCA 1A7SA 1QQ4A 1QURH 4HFPB 1V6DA 3VGCC 1IQNA 2K1QA 1IQEA 3D65E 2LPRA 2V7QD 5DP9A 4FUHA 1TPSA 2AS9A 2HLDD 2SGPE 3UNQA 1Y5BT 2BY7X 2Y5HA 1BJVA 1K22H 2QAAA 1SOZA 1FONA 1GJ4H 2FOEA 3VG8A 1V2OT 2O8MA 5GJ4B 3U1IB 1K1MA 2VIPA 3ZZ8A 3KF2A 1O5BB 4WY3A 3QX5H 4P02A 4TT3D 4I86A 1EOLA 1DPOA 1A5IA 2TGTA 4JCNA 2DE9A 2KCAA 4DJZB 2JJ2D 1M9UA 2VWOA 1S83A 1UK4A 1LTOA 1TRYA 2ZCLP 3E91A 1RIWC 3MFJA 2ZDNA 2VB0A 4YO9A 2B7DH 4NZQA 2D8WA 1O5EH 1THRH 1DSUA 3EAJA 3QN7A 3U8RH 3K2UA 3LU9B 3RXLA 4Y8YA 1S84A 1GJ7B 3T2NA 3DUXH 7GCHF 3EA8A 4AFQA 3F0PA 1O34A 3RLYH 3DSOA 5JB8S 1O30A 1OWKA 3BG8A 4K3JA 2VVUA 3NRLA 2RA3A 3ELAH 1AZ8A 4WXVA 4YM9A 1XUHA 2PUQH 1T32A 1MU6B 1UCYH 1C1RA 3SBKA 1E35B 1SB1H 2OLGA 5DGJA 2BDCA 2VIOA 2OP9A 4B71A 2Y80A 2AYWA 4K1EA 3KIDU 3BTTE 3LONA 2TIOA 2ZFTA 1FDPA 3GY8A 1DWDH 1ZRKA 2BQ7B 5CMXH 3OEED 3LT3A 4MQAA 5T6GA 1O2HA 2VGCC 4X6NA 3PM3A 1BMLA 1RTLA 1HIAB 3GY5A 3OSYA 2WPDD 1JRTA 1EZXC 1O3AA 3OE7D 3SUGA 1CE5A 5PTPA 2FX4A 1CBWC 1O2WA 2ZFFH 1O2XA 2FYQA 5JBBS 3MU1A 4Y8ZA 4XBBA 4DIHH 2ZF0H 1YCPM 1ZJDA 3A82A 4INLA 1FV9A 3WW7A 2PP6A 5CHBA 1CU1A 1O2RA 4IGDA 1QJ7B 4DY7B 1ACBE 1COWD 4U30A 4RT0A 2C93B 2HPPH 1AUTC 2FOGA 1EPTB 3ZVCA 4CRGA 1OXGA 2ILNA 1Z6JH 2DE8A 4I8HA 4ABDA 2WUBA 2QF5A 3PTBA 1K9OE 3MH6A 3U98H 1V3XA 1QQUA 2FODA 2UUKB 4K8YA 1YPHE 3ATMA 2ZC9H 2L6OA 2FOFA 3A7YA 4MG3A 1GI6A 2YOLA 3FP6E 5IDKA 5IK2D 2BD7A 3RXUA 1SL3A 1TGSZ 2BLVA 3CP7A 3HPTB 3RXSA 4WF8A 1OKXA 1AE5A 3GDSA 3QGNB 2VNTA 3NCLA 4DIIH 1GI2A 1C2LA 1NRSH 5DN6D 2FTMA 3RXCA 3QTVH 4H42U 1FX0B 1AE8H 1IQGA 4FU7A 2ANMH 1GI3A 4I8KA 2OINA 4O03A 2BD5A 1UTNA 1EQ9A 1DWBH 2BOKA 1V2LT 1GVKB 1LHCH 2I6SA 5L30H 2GTBA 3KL6A 3UUZA 1GJ8B 1T7CA 1YPKH 1LHDH 2ALPA 2BB4A 4UFFH 1GG6B 2J5UA 1SSXA 3R3GB 5DP4A 1O5GH 1WU1A 3SV9A 1HAGE 3ATWA 2UUFB 2C3SA 5CE1A 1ANDA 1UTQA 1HJAC 3S9AA 1GMCG 3D62A 2A5AA 1LKAA 1C1UH 2XTTB 3ZZAA 2VVCA 4AG1A 4Q2KA 2ANYA 3SU4A 1TRMA 1HAYB 2AGGX 3UB0A 4F4OC 1DUEA 1MTNB 3PO1B 1QCPA 2J2UA 3OFND 3Q77A 4X2YA 2A1DB 1GMHG 4XOJA 2KM0A 3VB3A 1W7XH 4IN1A 2FI5E 1GI0A 5DPAA 1ZR0A 3A83A 1YM0A 3KQDA 3UREA 3RU4E 4JK5A 3PMBB 4FUGA 1G3DA 1RTKA 3AAVA 1NM6A 1BHXB 3RXVA 2OBOA 1ANCA 2GP9B 1P2JA 1C1TA 1DY9A 1TABE 1A0HB 2NU3E 3E0PB 3MYWA 3MNBA 5DO4H 8GCHF 3TJOA 5JDUB 1UTKA 1XKAC 1BA8B 1KTSB 3KQBA 1HAOH 3QGJA 1C5UA 3TK6A 3VXFH 1PPEE 4CR9A 3KQCA 2PSYA 1ZTLA 2VWLA 2PTCE 5C94A 4TYDA 3MTYA 3KQ5A 5CDFE 1MUEB 5J4SA 2BXTH 1SGTA 2BDBA 3O8CA 3I29A 2RG3A 3HATH 1GJAB 2GCHF 3M7TA 1C1SA 1Z1JA 1BTYA 2FDAA 1GBFA 3P6ZB 2FOBA 4GVUA 1C4V2 2G4UA 2ZPRA 1S82A 1GI8B 1T8OA 1VCQA 2CGAA 3SI3H 3A8BA 3BTEE 4IC5A 5FXLA 1TONA 3FZDA 3T25A 2OC8A 3BEFB 2R2WU 2GZ8A 1XUKA 3KYGA 3UFAA 3NPSA 1INCA 1P11E 2G4TA 1WTHD 4O3TA 1MTNC 4LXBH 3BG4B 1VITH 2O8WA 3RXPA 1HAHH 1YLDA 1DX5M 5B6OA 3ZVBA 1SGFA 4VGCB 3DSGA 3UNRA 2ANWA 2W7SA 4K60A 3E1XB 1ZYOA 3SO3A 4ACAA 1NESE 3A81A 5A8XA 1GI7B 1LPGB 1T8NA 2P93A 3UOPA 2W6ID 2G51A 2PGBB 2WPHS 1S81A 4KKDA 3T26A 1QA0A 3M35A 4K8BA 5GCHF 4ISHH 1O2NA 5KGOA 3H7OA 4K1TA 1C5NH 2ZDAH 1XKBC 2ZG0H 2R3YA 4X6MA 3UWIA 3S9BA 3TH4H 3ZZDA 4FUBA 5I25A 4BAQB 3FP8E 3T5FH 2ZU3A 1C2JA 1PJPA 3EQ0H 3URCA 3GCHB 3TH2H 4X8TH 1C5VA 4F49A 5C67A 3DD2H 3GY3A 1P2MA 3W95A 1SG8B 3K6YA 1IQMA 1SVPA 3SV8A 4ABEA 2FYRA 1W7GH 4X8UH 3MH7A 1E79D 1Y59T 4OS5A 4CRCA 4FUIA 1ZZZA 4QT8C 3TLOA 4IW4E 4FUJA 1FUJA 3RXIA 1FY3A 5HYOA 1C1OA 4NCYA 2WV9A 2BDYA 2ZCKP 2GV6A 1DVAH 1GL0E 2KCPA 1OWHA 1NFXA 2A4GA 1KDQA 2PKSB 1P2QA 1AZZA 1WAYB 3Q3YA 4Z1MD 1K0HA 2VWMA 1MAYA 1KYNA 1MU8B 1BRCE 1EB2A 1TNKA 2P3FH 2CHAB 3BIVH 1XVMA 1B7XB 4KTUA 4U2WA 5FPYA 4YOGA 3F1SB 4I8JA 5JPMH 2W3IA 1RXPA 2GT7A 1BZXE 1KXCA 4Y0ZE 2V3OH 1P8VC 3FO8D 1P03A 4AB8A 3DA9B 1CGJE 2H9HA 1ETTH 4WMFA 3MU0A 2HWLB 4Y8XA 1NTPA 1QFKH 2ZPQA 4Q7XA 1GBMA 1SC8U 3QK1A 3PV5A 1MBMA 1ZHMA 1OX1A 1ZMNA 2BXUH 3GICB 1MD7A 3RP2A 4ZHAA 1P2IA 2FOAA 2EA3A 3MU8A 1G3EA 2QN5T 1KIGH 1UTLM 4A5TS 4Q4LA 1YC0A 3N7DA 3EYDA 4TY6A 1TMBH 3UNSA 3RXHA 1KLIH 5DP3A 4K2YA 2OC7A 8GCHG 3A87A 3RXTA 4WJG2 2JH6D 3F6UH 1Z6EA 3FKSD 1TGBA 1BBRE 4FOUC 1G37A 3IG6B 1UTPA 2EY4C 1HUTH 1MQ6A 4WMDA 2A5KA 1C5YB 1GDQA 3HGNA 1LVMA 1YLNA 2ZTYA 1C1MA 1E0FD 1Q3XA 1D3QB 2BQ6B 5A8ZA 1AKSA 1V2TT 1YPGH 2G81E 1GI5A 2J4IA 1RS0A 5F03A 3VB4A 1O3OA 1HLTH 3AW1A 1SLUB 2P3UB 1VGCB 2J38A 4RT1A 2UWPA 1MCVA 3MU4A 3Q76A 2G55A 2V6NA 3RLWH 5A09A 2GCHG 1O5FH 2VH0A 1O33A 1NO9H 3L6PA 3GOVB 4Y76A 3NK8A 3SGQE 5E0JA 4TWYA 1NBMD 1C2MA 1AB9C 4GCHG 3NKKA 1SLVB 3F9FA 1BTPA 2WPMS 1FLEE 3SU0A 1MQ5A 4JK6A 4CRDA 1ARBA 5HIZA 1KXDA 2TBSA 1BTXA 4GSOA 1ZPBA 3B23B 3I78A 5HKKD 1V2KT 1AO5A 2H5CA 1W12U 4NFEA 1C4Y2 1MCTA 1C5WB 2BDGA 3LOXA 1SHYA 3OAAD 1N8OB 4FVDA 1NRPH 4AFZA 3SW2B 1A46H 1F0UA 4B2BA 1PPZA 2KAIA 4CRFA 3P70B 1O2OA 1ELGA 3Q00A 1EAIA 1ID5H 1RJXB 2Z6BD 3UIRA 3ZZ6A 2ZHEH 2HLCA 3RDZA 4AFSA 1L1GA 2ALVA 1HCGA 5G4BA 2BLWA 2R0KA 4BTUB 3PO1C 1YBWA 4BAMB 4AN7A 4Q7YA 2Q6GA 7GCHG 3R0FA 3SUDA 2FIRH 1NZQH 2A31A 1TBZH 1V2NT 1XM1A 1O0DH 3STIA 5ABWA 1P12E 1QGFA 1GGDB 1A3BH 5C0TA 2ZU1A 1O3IA 2THFB 3V12A 1BTWA 2FWWA 2W7UA 4F55A 4MNYA 4B6FA 1LQEA 1TPAE 1XMNB 1GI1A 3RU4T 4JZFH 1N1LA 3LIWA 1TA2A 1LMWB 5EJZA 1P2KA 1BMFD 1C1PA 2QV1A 1ZMLA 2OUAA 2Y5FA 3F2FA 1PQ8A 1SKYE 2ZFRH 2BD2A 2OD3B 4H6SB 2A5IA 1G36A 1OWEA 4THNH 4K5ZA 5A0AE 1HRTH 2ZQ1A 1ANEA 1B0FA 2A4RA 3IWMA 1SGPE 1V2QT 4DVAU 1IHSH 1BQYA 5GCHG 5LGOA 2BD3A 3SNAA 2BQWB 1EATA 4E7NA 1ORFA 1DSTA 4GLYA 5AFZH 1IQLA 2RA0A 3DHKH 4ZXXH 5T6DA 5A2MH 5F6MA 3M36A 1EAXA 5JBTA 2FI4E 2CV3A 3CS0A 5K7RA 1E1RD 1SQOA 3GCTF 1GBAA 5EU8A 3SNDA 1WV7H 1ESAA 1GDNA 1ZSJA 1YY3A 1THPB 2QCYA 1F5RA 3F0OA 2BD9A 5FL7D 5HGGA 1AN1E 1X7AC 3ZZ9A 2BVXH 1VGCC 1MZDA 3GYMA 5EXMA 1AQ7A 4JZIA 1F0TA 1T4VH 2FS8A 1TALA 1O2TA 1WQVH 1YPEH 1GBEA 3MH4A 1RRKA 1FN8A 3RXKA 3ATKA 3PLBA 1H1BA 1RIWB 1Y8TA 1YYY1 2F4LA 2PUXB 4MDSA 1LHFH 2QC2A 4NA7A 3K6ZA 2O9QA 1CHOF 4YLQH 3N99A 1DDJA 1O35A 3N7OA 1D4PB 3GISB 2FLRH 1MTSA 2WUCA 1NY22 3S7KB 1AVGH 4CH8B 1GHBG 2NU4E 3OTPA 4U32A 1O2UA 4A1VA 1WUNH 4NWKA 4IMQA 1LO6A 1Y3XA 1GG6C 2TPIZ 2Y7ZA 4RKJB 1FY1A 1HDTH 2ZGHA 3BTFE 4WXIA 5FBEA 2A4OA 1UMAH 1EPTA 1YPJH 4D76A 4YTAA 5T6FA 1BTZA 1QNJA 1J16A 4ABJA 2ZDLA 2TGDA 3MMGA 1FPHH 4B76A 4D7FA 2AHME 1ZMJA 1PPGE 3FFGA 4WVPE 2K8IA 2NWNA 2BY9X 1AD8H 3RMLH 2FX6A 1YPHC 3LGYA 3A8AA 7KMEH 3CNRA 5AVDA 2SGEE 3TH3H 1AUJA 5LPFA 4DW2U 1GI4A 1O39A 1AI8H 1HAXB 3AAUA 3NWUA 4OS4A 1GJCB 3A8DA 1BITA 3LGWA 4NGAH 1SI5H 3SNEA 2GT8A 2PKAB 4F48B 1EX3A 2K0QA 3PWCA 3TNSA 1HXFH 1O36A 4X1NU 5DP8A 3UR9A 2CXVA 1CGHA 2KCOA 6CHAC 3A7XA 2O8TA 3A80A 1AKSB 4NWLA 1W13U 1O2GH 3VXEH 1E36B 4X1QU 2PWXA 2G00A 3S69A 4CREA 4Y71A 1KDQB 2J98B 2FLBH 3DT0H 4OS6A 4YZUA 1O2MA 2BM2A 1G3CA 1NRRH 1W0KD 2P95A 1N8OC 2ZPSA 3HKJB 5GIBA 3ODDA 4NA9H 1OP8A 1WDIA 2GKVE 2JJ1D 1J14A 1U6QA 2V3HH 3SGBE 3VB6A 3F2HA 2STAE 3FVFB 1KXBA 2BTCE 4AGJA 4O9VA 2BX3A 1EAUA 3MH5A 3F9EA 1WTGH 3B9FH 1MTUA 4I32A 3U28C 1IQJA 1L1NA 4UFDH 4MLFB 1LVOA 2C8ZB 1HJ9A 2GDEH 1FIZA 3DSPA 2IJOB 2Z94A 2RFKC 2CHAC 1SMFE 1YCPH 3P92A 4NIWA 4ZHMU 2QGRA 3IITA 5TCCA 1GJ6A 1EB1H 4ASHA 2P94A 4BAKB 2A7JA 2W6JD 1A0JA 1V2RT 3H09A 4CHAB 3RMMH 1CA0C 2Q6DA 3RXEA 1CSOE 5FCKA 2OXSA 1TYNA 3PYHA 4Q80A 3SU1A 5C0UA 1H9HE 1TA6A 3GYLB 4YT7H 1W3CA 1IQFA 2STBE 1P10A 4B75A 2NU1E 2BHGA 1GHAF 2EEKA 4AOQA 1O38A 2BDIA 1DANH 2F9BH 3VFEA 4XRNA 3TGKE 1H8DH 5DK1A 5EODA 2AERH 1TQ7B 1GCDA 3U69H 3UQOA 2Y7XA 1A0LA 4MVNA 3V13A 5C5OA 1HJ8A 1GPZA 2QYIA 1P02A 1QRZA 1IQIA 4J1YA 3A85A 5AF9H 1BRUP 3SU2A 1A1RA 3SU3A 4B2CA 2F9UA 3EA7A 5EQSA 1HAVB 2CF8H 4UDWH 3TGJE 1G32B 5JYIA 1TB6H 5F8XA 3DCLA 3ZZ4A 2BDAA 2F9VA 3O8BA 5GPIB 3SORA 3KCGH 1CHOG 3NZIA 2ODYB 2VJ1A 2EQNA 2H6MA 1GJDB 5C5NA 2A45B 3SJOA 3E8LA 2LNCA 1HYLA 1VITF 1H8IH 3ATIA 1ELEE 1PPBH 1GDUA 4ZKRU 4X0WU 3A89A 2D2DA 2SFAA 1WYKA 2XBXA 2ZGXH 5LPEA 3ODFA 3L3TA 1SBWA 3RXGA 3KHVA 2I6QA 2Q1JA 5BPEA 1MTWA 1TE0A 3KGPA 5AHGH 2GV7A 3PLKA 2YMSC 2RCEA 1MKXK 1SGCA 2R3UA 1LPKB 5E0HA 4CBNA 3LDXH 9ESTA 3MQKC 2ULLA 2O8LA 1ZJKA 5FHTA 2FEQH 2P59A 5HMAA 4MPVA 3BTME 2FPZA 3M3TA 1Q2WA 3D49H 5DP5A 1TBRH 2HRVA 4E06H 3Q3KA 1T8MA 4LOYH 1DICA 1RFNA 3BV9B 2XCNA 2P3TB 1AMHA 1GBJA 3URDA 1S0QA 4CRBA 5CHAB 3SZEA 1CGIE 2AGIX 1XUIA 5ESBA 2B8OH 2ODQA 1O3FA 1GMCF 1LVBA 3VB7A 1PFXC 3GCOA 3ZVEA 2QXGA 4AORA 6CHAB 3ZIAD 3RM2H 3HKIB 1P9UA 1LHGH 2HPQH 4O3UA 1QL9A 1PQ5A 4NIVA 5DG6A 1DS2E 4HI3A 1SQRA 4FUEA 3BEUA 1LCYA 4A1XA 1HPGA 4XSKU 2FS9A 4UONA 3FZZA 2WPIS 5FX6A 2WPJS 3QDZB 1J17T 5FPTA 2Z3DA 5K0HA 2BZAA 2H9EH 4GAWA 2FO9A 3ZZCA 3O8RA 1EZUC 3PROA 1O2SA 2EI7A 3A88A 1WBGB 3MWIU 1AWFH 2GVFA 2WPLS 3BTQE 3MU5A 1IQHA 1QA7A 1FIWA 1O5DH 3BTWE 3TITA 1BMNH 1YPMH 2PKAA 1S6FA 2ZWLH 1SGFG 2ZU4A 3MOCA 3F9GA 2R9PA 1MKXH 1LPZB 3Q3XA 4JMYA 2ZDKA 3PTNA 2IJD1 4TSFD 3BTKE 1AFQB 1LDTT 5EQRA 2JKHA 1ZLRA 4X2WA 2GCTB 5EQQA 4NIXA 4JYUH 4X1RU 1DFPA 5HM9A 3B8JA 3P17H 4ABGA 3TJUA 2RDEA 4ZROA 1VKYA 6ESTA 1HXEH 3TGIE 2A2XH 4KP0A 2YNBA 2L74A 1XXDA 1V2PT 2ZEBA 2ZHFH 3KYFA 2AMDA 1NRQH 5L6NH 2HVYB 1ABIH 1V2MT 1SFIA 2F83A 4K69A 1MZAA 2ZHDA 5DSFA 1NFWA 4Q7ZA 1C5QA 4O97A 1Z8GA 2M5TA 2QXJA 2F9PA 4WH6A 5EIYA 4A92A 1T8LA 4D9RA 4LZ4B 2J94A 4ABHA 1A5HA 1ZOMA 1Z8RA 3QTOH 4AGKA 1ZHPA 1TOCB 1JXPA 1S85A 1BMMH 3E90B 1QB1A 1A61H 1GBHA 1MTVA 5C3NA 1GJBB 2LP6A 1ZGIA 3HGPA 3E0NB 3MI4A 2SGFE 1WOFA 3RC4A 4Z0KA 4GUXA 1TX7A 2A32A 5AFYH 3P8NA 3W94A 1AVWA 1KLTA 4Y11E 3A7ZA 2A2QH 1L4DA 2VVVA 3P95A 2PR3A 4XD7D 4AB9A 2B5TB 1CT0E 4FU8A 3SJIA 1O3MA 3TVJB 2XWBI 1NRNH 4HGCA 4DURA 2G8TA 2AH4X 2CF9H 1K1JA 3GY6A 4NSYA 2F91A 2ZHWH 1S0RA 3SV7A 1KMHB 2XC5A 2CN0H 4LK4A 4YLUA 3SN8A 1EJMA 1JIRA 2YMSB 5SGAE 1W11U 1GHVH 1GVLA 3UY9A 3W1EA 7LPRA 2J98A 3E16B 3LJOA 4H4FA 4ZUHA 1MH0A 3K65B 2WYJA 3P8OA 3K9XB 1DM4B 1DWEH 3RC6A 2KAIB 1EUFA 3M7QA 1O2PA 4R8TB 3T27A 4ISOA 1C5MD 3GCTG 1C5SA 1GI9B 2BY8X 1XUGA 1NS3A 1GJ9B 5I46H 1O2JA 3SZNA 4NZLA 1T31A 4BOHA 4GCHF 5C2ZA 2BD4A 2WV4A 1F5KU 3G01A 3EE0B 3V0XA 1W8BH 1FY4A 1GL1A 3ZYDA 2HNTE 1O2VA 1TAWA 1YWUA 2D26C 2V0BA 1MAXA 5HM2A 3S0NA 4AG2A 2Z3EA 4E7RG 1ZSKA 4DT7B 1BBRK 5KEDA 1TNHA 2TGPZ 1C5TA 2QXIA 2OC0A 4FU9A 2PTNA 1HFDA 1F2SE 2UWLA 1BIOA 4TPIZ 3M5OA 1G9IE 3AVZA 5EG4A 1TNLA 2BMGB 2OQ5A 1SGEE 4RI0A 1DE7H 1YCPK 1ZPZA 1OP2A 3PMAB 1IOEA 1IQKA 2Z3CA 1IAUA 3F3BA 1BHXF 1K1OA 1Y5AT 1QBNA 5ETXA 1BTUA 1W10U 3ATLA 2WINI 5GWZA 1K21H 1EOJA 1FJSA 2ZGBH 2SGQE 3RM0H 4KTSA 1TNJA 2J9NA 3STJA 3T29A 4BXWA 1HAVA 4TY7A 2Z9GA 1H8ED 4B2AA 3PV2A 3WY8A 1W0JD 1AU8A 3VGCB 4X1SU 3M3SA 1GWAA 4CH2B 3MO3A 5E8EH 1OWJA 4INKA 5L2YH 1QIXB 2OBQA 1P2NA 3U8OH 1SGDE 4FUDA 4JZDH 2SNWA 1UVTH 5EPYA 8KME2 1H4WA 2GZ9A 4FVBA 3ZZBA 4FUFA 2JETB 2C8YB 1TBQH 2AFQB 2J97A 5C1UA 4YESB 3HK3B 1QRXA 1AHTH 3UAIC 3TPIZ 4X6PA 4Y10E 1D6RA 4NIYA 3GY2A 1ELBA 1G2LA 4MTBA 2ZDMA 1SGIB 2OC1A 3PMHB 3A7VA 2UWOA 1W0ZU 3PLPA 1Y5UT 2QF3A 1EP6A 1TRNA 1Z1IA 4BNRA 1QL8A 3QO6A 1J8AA 3SOSA 1TLDA 1QTFA 4A1TA 1BJUA 3CS7A 1ZTJA 4UD9H 1JRSA 3MHWU 1P04A 3NUMA 1SGNE 1NC6A 2PHBA 1E34B 1UW7A 4ZKOU 1V2UT 5F8ZA 3LPRA 1F5LA 4OS7A 1EJNA 1MD8A 3TJNA 1CT4E 4B6EA 4CBOA 1NU9A 3QZQA 1YPLH 2ZECA 4IS5A 2HNTC 2C90B 4ZAEA 3FOAA 3FAOA 1UVPA 4I31A 2GZ7A 2VH6A 1SLXB 1W0YH 4BTTB 3TU7H 3QUMP 1C9PA 2ZP0H 1FY8E 1TQ0B 1FI8A 3SU5A 1ZPCA 5A8YA 1PYTC 1TMTH 3E3TA 4A6LA 1HIAA 3I77A 2FI3E 2XCFA 2ZU5A 4OS2A 1JIMA 5DJ7A 3A8CA 2OTVA 2ZKSA 5TCAA 1SHHB 2XW9A 1F0RA 2KX4A 5CHAC 1ARCA 1FY5A 3OTJE 5EJLA 2OCVB 2FZZA 4YT6H 2AGEX 2JETC 2ODPA 4BAOB 1O3BA 4HG6A 3MNCA 3M3VA 4IC6A 1UHBB 2KFWA 2ZTXA 4ACBA 1O2LA 1A5GH 2EI8A 1NU7B 2FM2A 2ZQ2A 5EJ1A 4CR5A 3FP7E 5HIYA 2VIQA 1ESBA 1O3KA 4NFFA 1C2FA 3SJ8A 1S6LA 1QBOA 1LVYA 1H9LB 1UTJA 5ESTE 1WXRA 3QZRA 1DUAA 1DXWA 4FETA 2R2MB 3EDXB 1JBUH 3F68H 4GHTA 1GHWH 3SNBA 3EE7A 2W3KA 3GCNA 2P16A 1BTHH 6GCHG 1HAZB 4TWWA 3HK6B 2J34A 2CJIA 1YGCH 1C5XB 1P0SH 5EW2H 1EPTC 3A84A 2JIZD 1NFUA 5HXFA 4RSPA 1YKTA 3GCHC 1SLWB 2XBVA 1FMGA 4AX9H 1ZGVA 3LKWA 3GY4A 2ZNKH 1SQTA 5E2OA 1TFXA 3SYJA 1GVZA 1BMAA 3ZVFA 1GMDG 1V2ST 1HGTH 2ZGJA 1QZ8A 3ENSB 4BXSA 3AK5A 1P06A 1TMUH 2VGCB 3U8TH 1QHRB 4KELA 5LPRA 4AFUA 5A0CA 1O3GA 1ELFA 2GMTB 1C1VH 2C4FH 4AC9A 3ZYEA 3ZZ3A 2Z9LA 1C5ZB 2R0LA 2C8XB 3KEEA 3A86A 2GCTC 1VJ9U 4FXGH 5E0GA 3BTGE 3BEIB 2FP7B 1VZQH 5TJXA 1ELTA 7ESTE 4SGAE 1KXEA 3FANA 1QB9A 2BVSH 1UO6A 1K28D 2VBCA 4WH8A 2KZ4A 4CHAC 4P00A 1OSSA 3DFLA 1ABJH 2ZTZA 3VEQB 9LPRA 4UFGH 3OEHD 2ZA5A 3O8DA 1QRWA 1D3DB 5EOKA 1C5OH 2XXLA 1FXYA 2BYAX 4J2YB 2P8OB 1QJ6B 1P01A 5DP6A 3E6PH 4MNWA 1XUJA 3RXRA 4DGJA 1OP0A 4MPWA 2BLOA 1HAPH 1B0EA 1QBVH 1O3EA 2XNDD 3RXQA 3SUFA 1DITH 4CRAA 3ITIA 3LH1A 4SGBE 1JWTA 1OS8A 3MNXA 2CK3D 3MO6A 3M5LA 4OGXA 3BF6H 2KR7A 3GY7A 2AIQA 1TPPA 1KTTB 4D9QA 2PGQB 3OU0A 1ZHRA 3RXOA 1C2KA 1EZQA 1GBTA 1H9IE 1ZRBA 3KNXA 1OOKB 4DG4A 1S6HA 1P3EA 1LHEH 3LC5A 1ETRH 4HZHA 1XUFA 1F92A 1AVXA 4I33A 6GCHF 1KSNA 4X1PU 5C1YA 5EW1H 2CMYA 1V2WT 4X2XA 2PV9B 1TIOA 2FMJA 3AW0A 2BVRH 4ZKSU 1GGDC 2XOKD 2Y81A 2TGAA 1D3TB 1G3BA 3RXFA 2DUCA 5A0BA 1SFQB 1CA8B 2ZGCA 1SQAA 4I8LA 4JZEH 1BRAA 1VR1H 2ZHQH 4YXWD 1TGTA 3SHAH 3UQVA 4INHA 5H4IB 3RC5A 4IN2A 3SUEA 1ELDE 2VIWA 3H7TA 8LPRA 1YF4A 1C2DA 1JOUB 1E1QD 1O3HA 3M61U 1SGYE 2QXHA 1NPMA 1C1WH 1BUIA 1GHZA
chains in the Genus database with same CATH topology
4Y7AA 5GDSH 2P8OC 3RXJA 4Z6AH 3UPEA 1ELAA 2A7HA 2ZIQH 4JYVH 2J92A 5JBAS 3KQEA 1XX9A 4LZ1H 1G30B 1QR3E 1O2KA 1JMOH 1GHBF 4DCDA 1QY6A 2VU8E 2A7CA 2BOHB 1EZSC 5BRRE 3TNTA 1CT2E 1L0ZA 3OY6U 1NROH 5F8TA 1Z8IB 1DLEA 5IYTA 2XRCA 3JZ1B 2V35A 4NA8A 3C27B 1EKBB 2BY5X 4B1TA 4XBCA 1DWCH 1TNIA 1PPFE 2BDHA 1CA0B 4XFQA 3L33A 2XWAA 1UTOA 2XNIA 2W5EA 1V2JT 1E37B 2BZ6H 1WSSH 4RKOB 2WYGA 1GMDF 1AY6H 4MPUA 3SQHE 1O37A 1F0SA 4RN6A 4KGAA 4JYTA 3RMNH 1OYQA 4XE4A 1Z7KA 2BX4A 1D9IA 2IN2A 4ESTE 2NU0E 3LGTA 1UHBA 2ANKH 1C2EA 3U1JB 3RU4D 1DT2A 1HBTH 2NU2E 3TJVA 1ELVA 4ZKNU 3ZVDA 1IHTH 3AASA 1SGQE 5JB9S 2BD8A 5E2PA 3P8GA 4GPGA 4Y7BA 1O5AB 1C1NA 1K1NA 1J9CH 1UCYK 1KY9A 4OS1A 1PQ7A 1C2HA 1A3EH 1LQDB 2PW8H 3OYPA 1O3DA 3KN2A 2PLXA 2GGVB 1W2KH 1GHXH 1UK2A 3BN9A 4DOQA 3NXPA 3SI4H 1XXFA 4MNXA 1PQAA 2YNAA 4ZXYH 4E05H 2F3CE 2G52A 4BAHB 1Z8JB 5FCRA 1O2QA 5FAHA 1J15A 1TOMH 2FTLE 1FQ3A 1ANBA 1A4WH 3V7TA 2GDDA 1GMHF 3VPKA 2A0QB 1DY8A 2ZDVH 1OPHB 2XYAA 1D3PB 2VIDA 4M7GA 1CHGA 3PMJA 3H5CB 6LPRA 1FNIA 1DLKB 4Y79A 3RXDA 1O3PB 2QA9E 2XBWA 1FAXA 1SGRE 1TX8A 2VINA 3SJKA 2EI6A 1S5SA 3M5NA 2BLQA 3GDVA 5L2ZH 1RGQA 1Y3WA 1B5GH 1FAKH 4FUCA 4B74A 1DOJA 4VGCC 3S9CA 1GCTB 2JH0D 3UTUH 3A7TA 1Z71A 3SJ9A 1NT1A 1QJ1B 2H2ZA 2Y82A 1GBLA 2ZU2A 2FOCA 2PFEA 1AFQC 1HAIH 4X2VA 3BTHE 2VWNA 2HOBA 1F7ZA 1RTFB 2G5VA 1L4ZA 1C9TA 2SGDE 2WPKS 2Z7FE 2AEIH 5FX5A 2WV5A 1FPCH 4ISLA 2J95A 1BBRH 2Z9IA 1GBKA 1O2IA 4MPXA 1MMJN 1UTMA 1RD3B 1NFYA 1O3CA 2IOTA 5LH8A 3ZZ7A 1BCUH 1C4U2 4WMEA 1XVOA 1C1QA 4U01A 3SQEE 3ZVGA 2HNTF 1EJAA 2FOHA 1GBIA 1O3JA 2QIQA 3LH3A 2FXRA 3QWCH 2ZCHP 3ESTA 1HNEE 3F9HA 1AGJA 2JH5D 1HJAB 2OQUA 3OX7U 4YOIA 2F9NA 1ZSLA 4UE7H 4ABFA 2SGAA 5DKMA 1TGNA 3SGAE 2H9TH 3RUOA 1ETSH 3RMOH 1K2I1 4KTCA 4ABIA 1UVUH 2HALA 4MNVA 1ESTA 2ZZUH 1KXAA 1P3CA 1VCPA 2Y5GA 4AZ2B 3ZV8A 1GBDA 1GHAG 3QLPH 2ZFSA 3PWBA 3LGIA 3OY5U 1MKWH 1GCTC 1K1PA 2AIPA 1P09A 3RXMA 1THSH 1UVSH 1GHYH 3ZVAA 2GMTC 1TX6A 3BIUH 1EP5A 2BY6X 2ZO3H 3MO9A 2W26A 4ABAA 2Q6FA 4B73A 2UUJB 1P9SA 4AYYB 2VIVA 1O5CB 1AB9B 2UUYA 3RXBA 4ISNA 2HVXA 4Y0YE 1DXPA 1EAWA 3JZ2B 4K1SA 1O31A 1Y3YA 3U9AH 2FOMB 3T28A 4AYVB 2H5DA 1O3NA 1C5RA 1AIXH 1GBBA 1T4UH 3LJJA 4H6TA 4I8GA 4XBDA 1L1JA 1MKWK 4X8SH 4D8NA 3SV2H 1UVOA 1P57B 1L2EA 3M37A 3P8FA 1SOTA 5FPSA 4X6OA 2A4QA 3ZV9A 1FN6A 1KXFA 1K1IA 1G2MA 1YP9A 1HV7A 2AMQA 3C1KA 3BG4C 4Y6DA 2C8WB 2FESH 4YOJA 3TK9A 3A7WA 5GXPA 4UEHH 3BSQA 4BANB 4WWYA 4XDEA 4ISIH 1TNGA 2Z9JA 4IMZA 5EXLA 1CVWH 2G5NA 2QF0A 3VB5A 1KLJH 1O3LA 5EGMA 3TK5A 1K1LA 1OWDA 2PKSC 2Z9KA 2AMPA 3DFJA 1Y3VA 2ZFQH 1N6YA 2H1UA 1O2YA 1SR5C 1O32A 1TWXB 3LGUA 1C5PA 5EXNA 3EA9A 1GJ5H 3MNSA 4A7IB 1QB6A 1BOQA 1N6XA 3TIUA 2ZFPH 1CBWB 5J4QA 3PB1E 4JZ1A 1CO7E 3M7UA 4UFEH 1P2OA 2QY0B 1AWHB 1E38B 1PPHE 4R0IA 3SV6A 1Q31A 3LGVA 4ABBA 1QL7A 1O2ZA 2GD4B 1EXFA 1VITG 5C20A 2ESTE 4IBLH 2GX4A 1BB0B 1WQSA 1AFEH 1SPJA 2XC0A 4NSVA 5DP7A 1UJ1A 4GHQA 2B0FA 4BTIB 4D7GA 1FZZA 2ZI2H 2Y6TA 5FBIA 2HGTH 3BTDE 1VCWA 2SNVA 5EPNA 1OWIA 4ZH8A 1HB0B 3V3MA 4OGYA 1NN6A 1ZTKA 4ZHLU 1V2VT 3PV4A 4NG9H 3T62A 1LKBA 1MBQA 2XC4A 1PYTD 2ASUB 1GBCA 5C1XA 3S7HB 3GDUA 1W14U 3ZZ5A 1C5LH 8ESTE 1PPCE 2D1JA 4PROA 1TGCA 1BDAA 3SHCH 3D23A 3SU6A 1UCYE 1C2IA 1YLCA 2RDLA 1BRBE 4HTCH 1OYTH 1VJAU 2IPHA 3M5MA 1EASA 3EGKH 3UR6A 3UOUA 1A2CH 1P05A 2PSXA 2XBYA 3CENA 1C2GA 1D6WA 3LC3A 2F9OA 3SNCA 3RXAA 2B9LA 1UK3A 4ZMAH 3UWJH 1Y3UA 1BT7A 4X8VH 1WCZA 1CQQA 1TPOA 2O8UA 4I7YH 2EC9H 5T3HA 5JBCS 4TPYA 2TRMA 1ELCA 1A7SA 1QQ4A 1QURH 4HFPB 1V6DA 3VGCC 1IQNA 2K1QA 1IQEA 3D65E 2LPRA 5DP9A 4FUHA 1TPSA 2AS9A 2SGPE 3UNQA 1Y5BT 2BY7X 2Y5HA 1BJVA 1K22H 2QAAA 1SOZA 1FONA 1GJ4H 2FOEA 1V2OT 2O8MA 5GJ4B 3U1IB 1K1MA 2VIPA 3ZZ8A 3KF2A 1O5BB 4WY3A 3QX5H 1EOLA 1DPOA 1A5IA 2TGTA 4JCNA 2DE9A 4DJZB 1M9UA 2VWOA 1S83A 1UK4A 1LTOA 1TRYA 2ZCLP 3E91A 1RIWC 3MFJA 2ZDNA 2VB0A 4YO9A 2B7DH 4NZQA 2D8WA 1O5EH 1THRH 1DSUA 3EAJA 3QN7A 3U8RH 3K2UA 3LU9B 3RXLA 4Y8YA 1S84A 1GJ7B 3T2NA 3DUXH 7GCHF 3EA8A 4AFQA 1O34A 3RLYH 5JB8S 1O30A 1OWKA 3BG8A 4K3JA 2VVUA 2RA3A 3ELAH 1AZ8A 4WXVA 4YM9A 1XUHA 2PUQH 1T32A 1MU6B 1UCYH 1C1RA 3SBKA 1E35B 1SB1H 2OLGA 5DGJA 2BDCA 2VIOA 2OP9A 4B71A 2Y80A 2AYWA 4K1EA 3KIDU 3BTTE 3LONA 2TIOA 2ZFTA 1FDPA 3GY8A 1DWDH 1ZRKA 2BQ7B 5CMXH 3LT3A 4MQAA 5T6GA 1O2HA 2VGCC 4X6NA 3PM3A 1BMLA 1RTLA 1HIAB 3GY5A 3OSYA 1JRTA 1EZXC 1O3AA 3SUGA 1CE5A 5PTPA 2FX4A 1CBWC 1O2WA 2ZFFH 1O2XA 2FYQA 5JBBS 3MU1A 4Y8ZA 4XBBA 4DIHH 2ZF0H 1YCPM 1ZJDA 3A82A 4INLA 1FV9A 1CU1A 1O2RA 4IGDA 1QJ7B 4DY7B 1ACBE 4U30A 2C93B 2HPPH 1AUTC 2FOGA 1EPTB 3ZVCA 4CRGA 1OXGA 2ILNA 1Z6JH 2DE8A 4I8HA 4ABDA 2WUBA 3PTBA 1K9OE 3MH6A 3U98H 1V3XA 1QQUA 2FODA 2UUKB 4K8YA 1YPHE 3ATMA 2ZC9H 2FOFA 3A7YA 4MG3A 1GI6A 2YOLA 3FP6E 5IDKA 2BD7A 3RXUA 1SL3A 1TGSZ 2BLVA 3CP7A 3HPTB 3RXSA 4WF8A 1OKXA 1AE5A 3GDSA 3QGNB 2VNTA 3NCLA 4DIIH 1GI2A 1C2LA 1NRSH 2FTMA 3RXCA 3QTVH 4H42U 1AE8H 1IQGA 4FU7A 2ANMH 1GI3A 4I8KA 2OINA 4O03A 2BD5A 1UTNA 1EQ9A 1DWBH 2BOKA 1V2LT 1GVKB 1LHCH 2I6SA 5L30H 2GTBA 3KL6A 3UUZA 1GJ8B 1T7CA 1YPKH 1LHDH 2ALPA 2BB4A 4UFFH 1GG6B 3R3GB 1SSXA 5DP4A 1O5GH 1WU1A 3SV9A 1HAGE 3ATWA 2UUFB 2C3SA 5CE1A 1ANDA 1UTQA 1HJAC 3S9AA 1GMCG 3D62A 2A5AA 1LKAA 1C1UH 2XTTB 3ZZAA 2VVCA 4AG1A 4Q2KA 2ANYA 3SU4A 1TRMA 1HAYB 2AGGX 4F4OC 1DUEA 1MTNB 3PO1B 1QCPA 2J2UA 3Q77A 4X2YA 2A1DB 1GMHG 4XOJA 3VB3A 1W7XH 4IN1A 2FI5E 1GI0A 5DPAA 1ZR0A 3A83A 1YM0A 3KQDA 3UREA 3RU4E 4JK5A 3PMBB 4FUGA 1G3DA 1RTKA 3AAVA 1NM6A 1BHXB 3RXVA 2OBOA 1ANCA 2GP9B 1P2JA 1C1TA 1DY9A 1TABE 1A0HB 2NU3E 3E0PB 3MYWA 3MNBA 5DO4H 8GCHF 3TJOA 5JDUB 1UTKA 1XKAC 1BA8B 1KTSB 3KQBA 1HAOH 3QGJA 1C5UA 3TK6A 3VXFH 1PPEE 4CR9A 3KQCA 2PSYA 1ZTLA 2VWLA 2PTCE 4TYDA 3MTYA 1MUEB 5J4SA 2BXTH 1SGTA 2BDBA 3O8CA 3I29A 2RG3A 3HATH 1GJAB 2GCHF 3M7TA 1C1SA 1Z1JA 1BTYA 2FDAA 1GBFA 3P6ZB 2FOBA 4GVUA 1C4V2 2G4UA 2ZPRA 1S82A 1GI8B 1T8OA 1VCQA 2CGAA 3SI3H 3A8BA 3BTEE 4IC5A 5FXLA 1TONA 3FZDA 3T25A 2OC8A 3BEFB 2R2WU 2GZ8A 1XUKA 3UFAA 3NPSA 1INCA 1P11E 2G4TA 1WTHD 4O3TA 1MTNC 4LXBH 3BG4B 1VITH 2O8WA 3RXPA 1HAHH 1YLDA 1DX5M 5B6OA 3ZVBA 1SGFA 4VGCB 3UNRA 2ANWA 2W7SA 4K60A 3E1XB 1ZYOA 3SO3A 1NESE 3A81A 5A8XA 1GI7B 1LPGB 1T8NA 2P93A 3UOPA 2G51A 2WPHS 2PGBB 1S81A 4KKDA 3T26A 1QA0A 3M35A 4K8BA 5GCHF 4ISHH 1O2NA 3H7OA 4K1TA 1C5NH 2ZDAH 1XKBC 2ZG0H 2R3YA 4X6MA 3UWIA 3S9BA 3TH4H 3ZZDA 4FUBA 5I25A 4BAQB 3FP8E 3T5FH 2ZU3A 1C2JA 1PJPA 3EQ0H 3URCA 3GCHB 3TH2H 4X8TH 1C5VA 4F49A 5C67A 3DD2H 3GY3A 1P2MA 3W95A 1SG8B 3K6YA 1IQMA 1SVPA 3SV8A 4ABEA 2FYRA 1W7GH 4X8UH 3MH7A 4OS5A 1Y59T 4CRCA 4FUIA 1ZZZA 4QT8C 3TLOA 4IW4E 4FUJA 1FUJA 3RXIA 1FY3A 5HYOA 1C1OA 4NCYA 2BDYA 2ZCKP 2GV6A 1DVAH 1GL0E 1OWHA 1NFXA 2A4GA 1KDQA 2PKSB 1P2QA 1AZZA 1WAYB 3Q3YA 2VWMA 1MAYA 1KYNA 1MU8B 1BRCE 1EB2A 1TNKA 2P3FH 2CHAB 3BIVH 1XVMA 1B7XB 4KTUA 4U2WA 5FPYA 4YOGA 3F1SB 4I8JA 5JPMH 2W3IA 1RXPA 2GT7A 1BZXE 1KXCA 4Y0ZE 2V3OH 1P8VC 1P03A 4AB8A 3DA9B 1CGJE 2H9HA 1ETTH 4WMFA 3MU0A 2HWLB 4Y8XA 1NTPA 1QFKH 2ZPQA 4Q7XA 1GBMA 1SC8U 3QK1A 1MBMA 1ZHMA 1OX1A 1ZMNA 2BXUH 3GICB 1MD7A 3RP2A 4ZHAA 1P2IA 2FOAA 2EA3A 3MU8A 1G3EA 2QN5T 1KIGH 1UTLM 4A5TS 1YC0A 3EYDA 4TY6A 1TMBH 3UNSA 3RXHA 1KLIH 5DP3A 4K2YA 2OC7A 8GCHG 3A87A 3RXTA 4WJG2 2JH6D 3F6UH 1Z6EA 1TGBA 1BBRE 1G37A 3IG6B 1UTPA 1HUTH 1MQ6A 4WMDA 2A5KA 1C5YB 1GDQA 3HGNA 1LVMA 2ZTYA 1C1MA 1E0FD 1Q3XA 1D3QB 2BQ6B 5A8ZA 1AKSA 1V2TT 1YPGH 2G81E 1GI5A 2J4IA 1RS0A 5F03A 3VB4A 1O3OA 1HLTH 3AW1A 1SLUB 2P3UB 1VGCB 2J38A 2UWPA 1MCVA 3MU4A 3Q76A 2G55A 2V6NA 3RLWH 5A09A 2GCHG 1O5FH 2VH0A 1O33A 1NO9H 3L6PA 3GOVB 4Y76A 3NK8A 3SGQE 5E0JA 4TWYA 1C2MA 1AB9C 4GCHG 3NKKA 1SLVB 3F9FA 1BTPA 2WPMS 1FLEE 3SU0A 1MQ5A 4JK6A 4CRDA 1ARBA 1KXDA 2TBSA 1BTXA 4GSOA 1ZPBA 3B23B 3I78A 1V2KT 1AO5A 2H5CA 1W12U 4NFEA 1C4Y2 1MCTA 1C5WB 2BDGA 3LOXA 1SHYA 4FVDA 1N8OB 1NRPH 4AFZA 3SW2B 1A46H 1F0UA 4B2BA 1PPZA 2KAIA 4CRFA 3P70B 1O2OA 1ELGA 3Q00A 1EAIA 1ID5H 1RJXB 2Z6BD 3UIRA 3ZZ6A 2ZHEH 2HLCA 3RDZA 4AFSA 1L1GA 2ALVA 1HCGA 5G4BA 2BLWA 2R0KA 4BTUB 3PO1C 1YBWA