1Y5UT

Dianhydrosugar-based benzamidine, factor xa specific inhibitor in complex with bovine trypsin mutant
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin, cationic
publication title Understanding binding selectivity toward trypsin and factor Xa: the role of aromatic interactions
pubmed doi rcsb
source organism Bos taurus
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-12-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y5uT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y5uT02
3PO1C 3E3TA 1MQ5A 2A4RA 3EA7A 2P3TB 3MH6A 3SU2A 1ZMNA 1SMFE 2BLOA 1D6RA 1FZZA 3LH1A 4AGKA 1AHTH 4OGYA 4DGJA 1SLUB 1ZPBA 1MUEB 2JH5D 2PV9B 2WPJS 2P94A 2O9QA 2ZDMA 2Z94A 3RC6A 3ZZ3A 2OCVB 2XBYA 3PMAB 1EX3A 1ZSLA 1V2MT 2ODPA 4D9RA 6GCHF 3PLBA 3KHVA 4ASHA 1V2UT 1HUTH 1EZUC 1OPHB 1GG6C 2BY9X 5FPYA 2THFB 3A85A 3RXBA 3ZVBA 4YESB 2FI4E 1GWAA 4BAHB 4MNXA 1DX5M 2ALVA 1HAHH 4FUFA 5LPFA 4ZAEA 4KP0A 3SV8A 2ZGCA 1FV9A 1KXAA 5GWZA 1C5MD 2ZECA 2GKVE 1SGFA 3KGPA 4B74A 4NA7A 1CU1A 1GHXH 1C5LH 5EQSA 1DOJA 3TJVA 1MTNC 4ZKRU 2GCHF 1HIAA 1ANBA 1YPHE 2PFEA 4NWKA 1AWFH 3ZZDA 3LIWA 1YCPM 3BEUA 1F5LA 1L2EA 2A4OA 3SJKA 5G4BA 1PPHE 2G8TA 1CA0B 1NT1A 3RXVA 2ZTXA 1FMGA 2XYAA 2AMQA 1A7SA 3SI3H 2FOEA 8ESTE 2HALA 4ISOA 1ELBA 1FJSA 1SB1H 1LO6A 4B2AA 1EPTB 1OP8A 1SC8U 3LGUA 3TJOA 1SOZA 2ZDAH 1KXCA 2ULLA 1ELGA 4NIVA 3DT0H 5HMAA 1BBRH 2CV3A 5EQQA 1GCTB 1IQFA 3HGNA 2Y5FA 3RXLA 1C1QA 1G2MA 1FQ3A 4DVAU 2GCTC 1FI8A 1BQYA 2BX3A 3BIVH 2R2MB 3T28A 4DURA 4X1QU 2PW8H 1UO6A 1GDNA 1W7GH 4ZKOU 1P0SH 3HATH 4Y10E 4YT7H 1O32A 1JOUB 2OC1A 3ELAH 3KQEA 1GI8B 4HGCA 1THRH 1ETTH 1ARBA 3FP7E 2BDBA 1JMOH 3MI4A 2JKHA 1IHTH 1N1LA 1ORFA 3M7TA 1UVSH 4MPVA 1O3FA 1NU9A 3E8LA 1KYNA 3RU4E 4FUGA 2RA0A 3I78A 1UTJA 1O2MA 1GHYH 1W12U 3A7WA 3MNXA 3TLOA 3UNRA 3PLKA 1WAYB 3PMJA 2J4IA 2XC0A 3NCLA 1D3PB 1VITF 1BTPA 4UDWH 1XKAC 4KTSA 4WH8A 4Y0YE 1RIWB 2VIQA 5GCHG 1A0LA 1HAPH 1SGPE 1BTZA 2PGQB 3SJIA 1GJ4H 2ZIQH 1K21H 1SL3A 2BX4A 4MPXA 1TRYA 4JZDH 3VB5A 3SU4A 3PTNA 2FS9A 2BQ7B 4ZUHA 5T6FA 3L33A 3AASA 2O8WA 3SUDA 1NTPA 1KXEA 2QIQA 4NIYA 1G3BA 2JETB 1GBJA 1ZPCA 4K1TA 2Z9GA 1CVWH 1DLKB 5DP7A 4IMQA 3SGAE 3OTJE 4ABEA 5AFZH 1CGJE 3U8RH 1DY8A 1GI0A 5GDSH 3KIDU 1KLIH 1RTLA 2QY0B 3QK1A 2BVRH 1TYNA 1N8OC 1EOLA 1ELDE 4MQAA 2ZO3H 2P3FH 1C1VH 3RMMH 1K1NA 1IQLA 4HZHA 4ZHMU 1QURH 2R0LA 1A5IA 1TQ0B 1EAXA 4YLUA 2VWNA 5T6DA 1V2TT 2ZFPH 4MVNA 1V2VT 1EAIA 3M37A 4A1VA 1O34A 8GCHF 2ANKH 4BTUB 1EQ9A 1G37A 1DE7H 3M5OA 4AX9H 1O3IA 1MZDA 2ANYA 3P8NA 1Y5UT 2C8ZB 3CENA 1RGQA 1UCYK 2EI8A 9ESTA 2VIVA 1LQEA 1TA6A 2ZHQH 4AB9A 3QLPH 2GGVB 1SSXA 5JB8S 4XBCA 3KQBA 3MO9A 4ABHA 1QFKH 4YM9A 1S81A 3PLPA 1O2SA 4GHTA 1C5YB 2ZU1A 1HJ8A 5L30H 1L0ZA 4M7GA 1UMAH 2AGIX 3O8DA 1O3OA 3QO6A 3BF6H 1KLJH 2XBWA 4J1YA 1BOQA 2P8OC 3VB7A 4FVDA 1O2LA 1SHYA 2IPHA 5GIBA 4ZHLU 5IDKA 1O3MA 4UFGH 3URCA 4AG2A 4YOJA 1HJAC 3SW2B 2I6SA 3RXFA 7KMEH 6GCHG 3T2NA 3MH4A 3PWCA 1CA8B 2FOMB 1GBIA 1PPZA 4I31A 5HXFA 3KNXA 4XDEA 1GJ8B 1UK4A 1XMNB 1AO5A 3NK8A 2F9VA 1SPJA 1C5RA 2VH6A 1V2RT 1NO9H 1KDQB 1O5AB 2ODQA 3M3VA 1BJUA 1THPB 1YC0A 3HPTB 4X1RU 2WPHS 1GPZA 2OQUA 1P2JA 3UY9A 1GGDB 3BTHE 1S0QA 2V6NA 1FPHH 1MTVA 2GCHG 2NU1E 5JYIA 9LPRA 2VINA 1C2HA 1JRTA 3B23B 3SV9A 1O5DH 1Y5BT 3UNSA 2QA9E 1GBLA 5C2ZA 2BY5X 1O3GA 1UTMA 1UTNA 1AN1E 3URDA 3M5LA 3GCOA 2GT8A 1NRQH 3A8CA 1MU6B 1AE8H 1V3XA 1C5TA 2ZDVH 3VFEA 1SGDE 1A5HA 4VGCB 4E06H 3MTYA 1BMNH 4F49A 3S0NA 1UVOA 1K22H 2GZ7A 3LGWA 2QF3A 1HAYB 3RUOA 5DGJA 1ELAA 2BDGA 4IC5A 2OC7A 1YGCH 1EB2A 3A88A 1VGCB 1O37A 1GI2A 4X8VH 3E6PH 2AIPA 5F8XA 4RKOB 2B0FA 3U9AH 4TWYA 1FPCH 2PKAB 2SGAA 2W3IA 3OSYA 4R0IA 1MU8B 3RXTA 1PQ7A 4CRBA 2W3KA 1X7AC 5TJXA 1O39A 1M9UA 3MU5A 1FAXA 4IC6A 3RXDA 3LKWA 1DWCH 1HB0B 2UWOA 1SLXB 1C1TA 2GT7A 1E37B 3RLWH 2ZTZA 4Q2KA 1GBDA 3EDXB 4NSVA 1C5SA 3GY7A 3H5CB 4MNYA 1FIZA 1IAUA 1GMHF 3KQDA 1Y3VA 1C2LA 4K60A 4IS5A 2R3YA 2FI3E 4X2XA 2FOCA 1MAXA 3AW0A 1LVOA 1LMWB 1K9OE 3TGKE 1TGNA 4JZ1A 1HFDA 1DXPA 1GMCF 1UTLM 3T62A 3SN8A 3FP8E 2CMYA 3LONA 2J38A 4Q7YA 1H8IH 1JWTA 1O5EH 2PGBB 3BTTE 3SBKA 2FLBH 1RS0A 1UCYH 1AWHB 2BQ6B 4ZKNU 3ZV9A 3S9BA 1A3EH 2TGDA 2A2QH 3GY3A 3B9FH 1CSOE 3MH7A 4AZ2B 2ZWLH 1HRTH 1EZXC 5DP5A 1C1RA 1GMDF 5BRRE 2Y7XA 3SOSA 1EJAA 1O30A 3PV4A 1EJMA 4UEHH 1O2UA 5H4IB 2ODYB 2CF9H 2R9PA 5J4SA 3GDVA 1MAYA 1LHFH 4X6PA 2OBOA 1BRCE 1LPGB 3ITIA 1G3CA 4I8LA 3E91A 1C9TA 1MCTA 1IHSH 3S7HB 5AFYH 3HGPA 1AD8H 2FWWA 2ZCLP 1YYY1 3NZIA 2P59A 2Z9IA 3CP7A 2JH0D 2H6MA 4YZUA 1ZR0A 5GCHF 4BXSA 1VITH 3RXJA 8GCHG 1PPFE 3A7ZA 1EPTA 2FMJA 1NRSH 3KCGH 4TPIZ 7ESTE 2EEKA 2YNBA 1Z7KA 1TALA 1RIWC 1WUNH 3GY4A 1Y3XA 5BPEA 2OD3B 2M5TA 5ESTE 4Q7ZA 1QR3E 2H5CA 1RFNA 1UVUH 2P93A 1W0ZU 3MOCA 2ZGJA 1ELEE 1P10A 2CXVA 4FUJA 4GCHF 5T6GA 1LHCH 2C93B 1O3CA 1AUJA 3V12A 1PQ5A 1AI8H 1DLEA 2F9PA 2Y82A 4O3UA 1Q2WA 1C5ZB 1WTGH 1QBVH 3SU6A 1FN8A 1C2JA 1AB9B 2JETC 3FFGA 5I25A 2IN2A 1A4WH 2GMTC 1QJ1B 1T4VH 2ZQ1A 4KTUA 1HAOH 2PHBA 3RXOA 3P70B 4CBNA 3BTME 3BG8A 3F6UH 2R0KA 3TPIZ 3T5FH 1QRWA 2CF8H 3P6ZB 3LT3A 2AS9A 5HYOA 3NPSA 4WXVA 1J9CH 1MTWA 1F0UA 3ZZ5A 4X6MA 4AFUA 3NXPA 3Q3KA 4D76A 3ZVEA 1KXFA 3UOUA 2ALPA 4MNVA 2NU3E 4B1TA 1ETRH 5EODA 1HGTH 2A2XH 3ZVDA 2H9TH 1TOMH 4WXIA 3P17H 3KQCA 4I8GA 1HNEE 4ABBA 2FOHA 5F8TA 3TH4H 2PR3A 1Z1IA 4FUEA 2XBXA 3CS7A 4GUXA 1C2EA 3UIRA 2DUCA 1QGFA 1DWEH 1IQGA 1O33A 3B8JA 4FUCA 3MHWU 1ARCA 1YPEH 4BAQB 3LJJA 6ESTA 1GI1A 1F0RA 1RTKA 2OP9A 4Z6AH 3O8RA 2Z3EA 1NROH 1TPAE 2VH0A 1ESBA 4NA8A 2B5TB 1BMMH 1T31A 4HI3A 1NRNH 2PSXA 1BBRE 5JBCS 2CN0H 1C1MA 1G36A 1LQDB 4INLA 1GJ7B 3QUMP 1TNGA 4FU7A 1MQ6A 1ELFA 1TWXB 2C8XB 1J17T 1SOTA 1GBHA 2QXHA 2XCFA 3E90B 2FOAA 2J95A 2AFQB 4TY6A 2BOHB 3QGNB 1IQNA 1J15A 4ISIH 1Z8JB 4BTTB 1TIOA 3ZZ6A 2ZU2A 2BXUH 4A6LA 1BTYA 1NU7B 5ETXA 1A1RA 3U8TH 1ANDA 1C5WB 1K2I1 4DIIH 1WQVH 3A89A 3FP6E 3ZVGA 4X2WA 1PJPA 4INKA 1QL7A 1OS8A 4I8HA 4H6SB 1XXFA 4YOIA 3PMBB 2K1QA 1BMAA 5J4QA 1FUJA 2BDCA 4K8YA 1CBWB 1DPOA 2A7HA 1AU8A 1LPZB 3G01A 1GBCA 3OYPA 3UPEA 2RDLA 3TNSA 1YKTA 1L1NA 2FTMA 3P8OA 2HNTF 2ZHWH 3GCNA 3Q77A 1GMHG 2VGCB 1K1LA 4I33A 3PM3A 4JCNA 1LVMA 1LPKB 1OWHA 1HPGA 4H6TA 3F9GA 3GOVB 1C2IA 1WSSH 3A8DA 1P01A 4BNRA 1FIWA 3SHCH 2WPMS 4H42U 2ZFRH 1LHGH 1A5GH 3EE0B 3M5NA 1GMCG 1TMBH 2B8OH 1P2NA 1P9SA 4Z0KA 4YOGA 2OLGA 4UE7H 3ENSB 1ANEA 4HTCH 4VGCC 2F9UA 2VNTA 4WY3A 1GBTA 3UR6A 5F6MA 2XW9A 1GHZA 1LTOA 1NS3A 2WYGA 2A4QA 3SU0A 1O2YA 1KDQA 4AOQA 4WVPE 5C67A 1UHBB 1UTPA 4U30A 5GJ4B 2ZDLA 1K1MA 1VGCC 6CHAB 3RP2A 5GPIB 1T4UH 2XWAA 5FPTA 3A7TA 1CGHA 3MO3A 4CR5A 1QHRB 1ZHMA 5JDUB 1GMDG 3QX5H 4O03A 2I6QA 5DP3A 4CHAB 4B73A 1RJXB 1PQ8A 4XFQA 4J2YB 4ABIA 2ZF0H 3UOPA 2BQWB 1O2TA 1HAVB 2H9EH 4ABFA 2AGEX 3GDSA 4A92A 5LH8A 3W95A 1AY6H 5B6OA 3RXQA 2BDYA 3TVJB 4WH6A 1P3EA 1YLCA 3DHKH 2FS8A 3BG4B 1DANH 1O3KA 1BMLA 1G9IE 1YPGH 2UUKB 1EUFA 2GZ8A 2ZPQA 1BTWA 3SUFA 4LZ1H 5L6NH 3M7QA 1ZMLA 1KXDA 1A61H 2FX6A 4GSOA 2PKSC 2C90B 1AVGH 3FAOA 5TCCA 2A45B 5E2OA 3P92A 4GAWA 1NFYA 1V2ST 5A8ZA 3T26A 4LZ4B 2Y6TA 1AFQB 1LKBA 2SGQE 4CRCA 2EI7A 3BTFE 1O0DH 3V3MA 2PKAA 3UTUH 5LPRA 5C5OA 2Z6BD 3F9EA 5F03A 4DY7B 1O3EA 1YPMH 3TK6A 1YP9A 1G32B 3RXKA 4GCHG 2BD4A 3RXRA 1SGCA 4Y71A 1DUAA 2AEIH 1GI6A 1P02A 1AFEH 2OINA 2BDIA 2ZTYA 1XKBC 1L1JA 1SI5H 1FONA 2Y80A 2PWXA 4I8KA 3K6YA 4AB8A 2ZU4A 2HPPH 1L4DA 2C3SA 2QXGA 4OS5A 5K7RA 2HVXA 1GBMA 3P8FA 2QF0A 1TOCB 1IOEA 5GXPA 1C4V2 3I77A 1MKXK 1ELTA 1SBWA 1C5XB 4UD9H 4Y79A 3U1IB 1BB0B 3VXFH 1YM0A 1YPHC 4ZMAH 3MU0A 1TAWA 1YLDA 1O3PB 4IMZA 4I32A 1OP2A 1A0JA 3SGQE 4IW4E 1NZQH 1EKBB 2TPIZ 1Z8RA 3GY5A 2V0BA 2QAAA 1V2NT 1SGQE 1C2KA 5E0JA 1OSSA 1TX8A 3K6ZA 1HDTH 1V2WT 2ZZUH 2A7JA 4CRAA 4D9QA 1ZHPA 5EPNA 3N7OA 3UNQA 2HRVA 1WCZA 4OS7A 1QRZA 1V2PT 2GDEH 3PTBA 5T3HA 1BUIA 3T27A 4ABAA 1U6QA 2ZC9H 2H1UA 1C1WH 2ZDKA 4X2YA 3DFJA 5FBIA 1ESAA 1ANCA 3GCHB 2ZHFH 1LVYA 1O2VA 2F9NA 3LGVA 3D65E 1W3CA 2BVSH 5DP6A 1BT7A 1FAKH 1MZAA 1BDAA 2RG3A 2BD9A 1QL9A 1YPJH 1C1PA 4B76A 1AZ8A 1P04A 2ZQ2A 1H9LB 2OTVA 1KXBA 4BAOB 5FCKA 2GD4B 2JH6D 4NZQA 1AB9C 2IOTA 1NFWA 2AMPA 4Y11E 2B9LA 5DKMA 3BV9B 1G3DA 2XTTB 3HKJB 4X6NA 1ZRKA 1ZMJA 2O8UA 1OXGA 1BRBE 2YNAA 2FI5E 1F0SA 1RTFB 1BRAA 1C9PA 3A80A 3KN2A 1HJ9A 1GG6B 3ATWA 1GJCB 1O2WA 1GHBF 2SNWA 5HGGA 1S6HA 2LPRA 3E0PB 4ABJA 2NWNA 4OS1A 4KELA 1UTOA 3TH3H 1A2CH 2IJOB 1IQKA 2ZFQH 2BVXH 2VB0A 1KSNA 1SGTA 2TIOA 2TGAA 1THSH 3RC5A 4DW2U 3FANA 4A7IB 3HK6B 2WYJA 1TGSZ 4TWWA 2F9BH 2ZEBA 1QBNA 1O31A 1GJ5H 2UUJB 1CGIE 1OWKA 1W7XH 1C4U2 5A0BA 3GYMA 1EZSC 4DT7B 1GBAA 5CHAC 4NIXA 2AERH 1V2KT 2J94A 3A81A 2Q6DA 1P05A 1DVAH 4AFSA 2BD7A 1P3CA 2FYRA 4ABDA 2O8LA 1T32A 5E2PA 2QN5T 1TNHA 5JBBS 1Y3WA 1P06A 3KL6A 2R3UA 2WINI 2CGAA 3STJA 2R2WU 2A5AA 1O2IA 1UCYE 1C2GA 1KTSB 1ZOMA 1D3QB 4R8TB 5ESBA 3GICB 3VGCB 5F8ZA 4ZH8A 2WV5A 1H1BA 1TBRH 4FUHA 4RKJB 1DS2E 1KLTA 1O3HA 4IGDA 3UFAA 4CREA 1C5UA 1H9HE 1LHEH 2PLXA 1PPCE 1TABE 3RXUA 3UQOA 2HPQH 1DWDH 1LDTT 2VWMA 1A3BH 2A4GA 5L2ZH 1DFPA 1TPPA 3AW1A 1UVTH 1A0HB 1PPGE 2GCTB 2BM2A 4OS2A 2F9OA 2FIRH 2ZCHP 3TJUA 1MKWK 1LCYA 1NN6A 4K2YA 5C1XA 2WUCA 2RCEA 1JIRA 3SV2H 1D9IA 2BDHA 3LH3A 5FCRA 4RSPA 3STIA 3ODDA 3MU4A 1INCA 1ZJKA 2BD2A 1XUJA 1SR5C 2QCYA 1WTHD 2TRMA 3FZZA 3SU1A 2PUXB 2OC8A 3M5MA 2FYQA 2FPZA 3D23A 5PTPA 1O2OA 1V2OT 4D7FA 3E1XB 4FUBA 2P16A 1O36A 4CRGA 1V6DA 1GJBB 1VCQA 1Y3UA 2ZCKP 3EA8A 4U2WA 2GP9B 5FX6A 1L1GA 1D3DB 4Y76A 1C1SA 1TBZH 5L2YH 3UREA 1UK3A 2BHGA 2Y81A 5FBEA 1HAZB 1P2IA 5EXMA 3RM0H 1CA0C 4ZKSU 2Z7FE 4KKDA 3U98H 1SQOA 1V2JT 3EA9A 2ZI2H 8KME2 1SFQB 2A32A 5AF9H 1HV7A 1BITA 1LVBA 2VVCA 1Y8TA 4BTIB 2ZKSA 1EPTC 3P8GA 4KGAA 1UTKA 5JB9S 3GISB 1TX6A 5C5NA 5EW1H 2Z3CA 2J92A 3GY2A 2BLVA 4OS4A 1K1JA 1GCTC 2VIWA 3Q00A 1KY9A 1O2KA 1TPOA 2BD5A 4AFQA 3ATLA 3KF2A 2OXSA 4AYYB 1TMTH 1Z8IB 1WBGB 3TITA 2Z3DA 3A84A 1OWDA 1FY1A 4ZROA 2ZG0H 2XBVA 2YOLA 2FODA 4TPYA 3R0FA 2PTCE 6CHAC 2J2UA 4NFEA 2VWOA 3QN7A 1JBUH 2Y7ZA 1HLTH 3RMOH 5E8EH 4ISNA 4CHAC 1BHXF 3BEIB 2NU0E 3ODFA 5DO4H 3R3GB 1JRSA 3E0NB 4NSYA 4ZXXH 4AN7A 1NRRH 1SGFG 2HWLB 3ZZ9A 3AVZA 1PPBH 3RXEA 1SLWB 4ESTE 3SO3A 1ZTLA 4INHA 4JK5A 1XXDA 3BG4C 3RMLH 5EW2H 2FDAA 1XVOA 1DICA 4X6OA 2GX4A 1NESE 2W7SA 4GPGA 4BANB 3M7UA 4Q80A 3UQVA 2PUQH 2GV6A 1G2LA 2FESH 1W8BH 3O8BA 1TGBA 1DXWA 1GDUA 1Z71A 2XXLA 1UHBA 2SGPE 3QTOH 1C1UH 1MTSA 2STAE 3RU4D 1AFQC 1BBRK 1GBFA 5DP8A 1Z6EA 1VCPA 2A5KA 1CT4E 1HAVA 1QBOA 2OBQA 1EAWA 3IITA 1MD7A 1O3LA 3QDZB 4ABGA 5AVDA 1GJ6A 4TY7A 4XBBA 3NWUA 3ATKA 1JXPA 1HAXB 1YPLH 3ATMA 1ELVA 4THNH 3Q3YA 1GI4A 3TH2H 3W94A 2UUYA 1XUKA 3TGJE 4UFDH 3ZZBA 4F4OC 2G4TA 4X8SH 3FVFB 2FEQH 3OX7U 1O3AA 2ZFTA 2F83A 2GDDA 4MTBA 1PFXC 5EXLA 4Y6DA 1GHBG 1ZZZA 3LGYA 1GJDB 4DCDA 4Y7BA 4U01A 2ZGBH 1TONA 3VB3A 1S6FA 2FOGA 2AYWA 2H2ZA 1GI9B 1P57B 2KAIB 2VIOA 2ZGHA 3WY8A 1MKWH 1OYTH 1ZTKA 3UWJH 3TGIE 2BMGB 1TA2A 1GCDA 3VEQB 1TFXA 3K65B 1C5OH 3P95A 3RXSA 2STBE 2QYIA 1WQSA 2A31A 1GHAF 1AZZA 1N6XA 3RXIA 3L3TA 2W7UA 3V7TA 2WPLS 1ZLRA 5A8XA 1TX7A 1SGYE 5FX5A 1EAUA 4IBLH 1TNKA 2ZU3A 5A2MH 1P2MA 1GDQA 1SLVB 1SFIA 3GCHC 1EP5A 1WOFA 3BTGE 3BTDE 4D8NA 2AH4X 4XOJA 3I29A 2A1DB 4I8JA 5JBTA 4CH2B 1TNJA 2ILNA 1WU1A 3RC4A 4OS6A 4X1SU 2BLQA 4XBDA 1FY5A 1C5NH 3A7XA 3A7YA 2BXTH 3S9AA 1AVXA 3MNCA 1C2MA 1OWIA 1AKSB 3EGKH 1GBBA 2VIPA 1YBWA 1NC6A 5EQRA 3E16B 4WWYA 2BOKA 4MNWA 1G3EA 1IQEA 3BN9A 4K1EA 2ANWA 4JMYA 4B2BA 1B5GH 1TE0A 2AMDA 1A46H 1J16A 2AIQA 3F9FA 1ELCA 2CHAB 4UFFH 3RXGA 2QGRA 1GJAB 3VB6A 2G4UA 1LHDH 3LU9B 3GYLB 1BCUH 3GY6A 1XUGA 1FY8E 1E36B 3D62A 3RU4T 2PSYA 3AAVA 1O2JA 4GLYA 1FDPA 4K69A 4NGAH 4X8TH 1C1NA 3JZ2B 1JIMA 1DWBH 1C5QA 1EXFA 1GGDC 1QQUA 4LK4A 2J9NA 3U69H 2G81E 5AHGH 3ZVAA 1GJ9B 5EG4A 1O2PA 4X8UH 5TCAA 3RXMA 1TPSA 1HAGE 1P12E 3HK3B 2G51A 3A7VA 2VIDA 3BTKE 2VVUA 1O5GH 3K2UA 4WMFA 1DSUA 1HXEH 1DSTA 1OX1A 1V2LT 4WJG2 2ZA5A 1V2QT 2FXRA 4MLFB 3MO6A 4WMEA 3SJ9A 2A0QB 1GHVH 1XUHA 4YTAA 3RDZA 1ZSKA 4JZEH 3ZZ8A 1GHWH 1P2QA 2EC9H 3VGCC 2FM2A 4MPWA 4SGAE 1O3NA 4DG4A 2VU8E 3U8OH 4YO9A 5LPEA 1DUEA 4ISLA 3IWMA 3UUZA 4OGXA 4E7RG 3ZZ4A 1J8AA 1QJ7B 4Y7AA 1WV7H 1T8LA 3K9XB 1LKAA 5C1YA 4YT6H 3BTWE 4NFFA 1H4WA 4O9VA 2C4FH 3F1SB 1ZGIA 2ZPRA 5EPYA 1BIOA 3D49H 3SV7A 3DFLA 3EYDA 1BRUP 4IN2A 3TK9A 1RXPA 2BLWA 3LPRA 3MNSA 1P2KA 3DA9B 3SU3A 4NCYA 3QZRA 3OY6U 2G5NA 4HFPB 5EOKA 1QY6A 1FLEE 7LPRA 2BY7X 1TGCA 4CR9A 1TNLA 3QTVH 3SJ8A 3ZVCA 1O2HA 1F2SE 2XC5A 1CHGA 3RXCA 3A83A 3A86A 1QRXA 1GVKB 2C8WB 4K1SA 2SFAA 4UONA 2SGDE 1P8VC 4GVUA 1MD8A 2G5VA 4QT8C 1TRMA 5FHTA 4O97A 3CS0A 5DP4A 1SGIB 2DE9A 1L4ZA 1AUTC 4WF8A 1D3TB 1O2RA 1W2KH 4BOHA 2G55A 6LPRA 4DIHH 1EP6A 3MWIU 1QNJA 1NM6A 1FY3A 1P09A 2BTCE 1XX9A 1O38A 3JZ1B 1MCVA 4A1XA 1FXYA 4CH8B 4FUDA 4JYUH 3U1JB 3MMGA 2HGTH 3RXHA 1CHOF 1K1IA 2TBSA 1FN6A 3SORA 4H4FA 4D7GA 3MU8A 5DJ7A 1O5BB 3HKIB 3PYHA 4XE4A 1D6WA 4MPUA 2GZ9A 2Z9LA 2GMTB 3LGTA 1F0TA 1AQ7A 4AG1A 1SQTA 1C5VA 5E0HA 1UJ1A 1KIGH 1TMUH 2G00A 5K0HA 1QL8A 1RD3B 4MG3A 2WV4A 2O8MA 3SNCA 5A8YA 2FOBA 1VJ9U 3GY8A 4LOYH 1QA7A 4YLQH 3TIUA 1NRPH 1SQAA 1Q3XA 2XWBI 1W11U 2BDAA 1GL0E 2P95A 1O35A 1DM4B 2WUBA 1YCPK 1UVPA 3C27B 1MBQA 1NFUA 1PYTC 1GVLA 3PB1E 8LPRA 4FU9A 2QXIA 1TB6H 5JPMH 4A1TA 3ZZ7A 2RA3A 1GHAG 1T8OA 2W5EA 5C1UA 2TGTA 3SV6A 1ABJH 1FY4A 1O3JA 5DK1A 3M61U 1GBKA 5CMXH 3SNDA 3PO1B 1NPMA 2CJIA 3VB4A 1GBEA 4AORA 3RXPA 3VPKA 1ZGVA 2GV7A 1K1OA 2A5IA 2SGFE 1O5CB 3KEEA 1HIAB 3MYWA 1FNIA 3ZV8A 2Z9KA 1EZQA 2D8WA 3S9CA 2H5DA 4Y8XA 1AIXH 2HOBA 1W10U 4ZXYH 1P9UA 1S84A 1ZRBA 3S69A 3MNBA 1HYLA 2FOFA 2H9HA 2ZFFH 1QJ6B 1WYKA 1ZPZA 4FVBA 1TLDA 4CBOA 1K1PA 4JYVH 3ZYEA 3ZYDA 1PQAA 4X1PU 3NUMA 1RRKA 1GI7B 3AAUA 2GVFA 1O2GH 3DD2H 4NG9H 3PWBA 3GCTF 1BTHH 2BZAA 2SNVA 3T29A 3TNTA 2P3UB 2HNTE 2ZNKH 5HM2A 3LDXH 3RMNH 1EASA 1OP0A 5IYTA 2V3OH 4Y0ZE 1HCGA 1EOJA 1S5SA 2F91A 3MFJA 4B75A 1E34B 1MTUA 1Z1JA 4Y8YA 2NU4E 3M35A 4AYVB 1ETSH 1MTNB 3SQHE 1J14A 1E35B 3C1KA 1C1OA 4KTCA 1EJNA 1ESTA 2ZHDA 2ZDNA 4Y8ZA 3O8CA 2ZGXH 1GVZA 2D2DA 3GDUA 3PROA 4B71A 4JYTA 1BTXA 4PROA 7GCHF 4I7YH 3MH5A 4UFEH 3H7TA 1B0FA 2LNCA 3SUEA 3ZZCA 1EATA 3RXAA 1E38B 3UR9A 3UWIA 1TRNA 1Y5AT 3ZZAA 3SQEE 1IQIA 1T8MA 3ESTA 1C5PA 1B7XB 4U32A 1ACBE 4DOQA 1HBTH 2BYAX 3LJOA 5CE1A 3SHAH 4SGBE 4NWLA 3A82A 2W26A 1ABIH 2Q6GA 1B0EA 1VR1H 2KAIA 2EA3A 1NY22 1O3BA 1TQ7B 5EU8A 4BXWA 2BD3A 1NFXA 3F9HA 3BEFB 1PPEE 4X2VA 2Y5GA 1OYQA 3SI4H 3SGBE 1F92A 2O8TA 1CT2E 2XRCA 4NA9H 1BTUA 2CHAC 4RN6A 2BY6X 3EAJA 3L6PA 4NZLA 3TU7H 1W0YH 3Q76A 1HAIH 1VCWA 2FLRH 3SNBA 3SNAA 1CBWC 1OWJA 1MKXH 3MU1A 1T7CA 2UWLA 4CRDA 1OKXA 3F68H 2UUFB 2VJ1A 3SNEA 1ZJDA 1W14U 3OU0A 1TGTA 2VGCC 1YPKH 2OQ5A 5I46H 4IN1A 2EI6A 3BIUH 2AGGX 1S85A 1H8DH 4GHQA 5A09A 1IQMA 2QV1A 1BA8B 1F7ZA 3SZNA 1C2DA 2ZHEH 1TBQH 1AKSA 1VITG 2PKSB 1S82A 2BZ6H 3T25A 1F5KU 2ZU5A 4K3JA 1P11E 2D1JA 1EB1H 2TGPZ 1YCPH 5ABWA 1OWEA 4LXBH 1BJVA 1MH0A 4FUIA 1DITH 2A7CA 1ID5H 1C4Y2 1QIXB 3BTQE 3TK5A 4BAMB 1QQ4A 5C20A 2ASUB 4FXGH 1QTFA 1AVWA 4JZFH 2BB4A 3LGIA 3ZVFA 2Q1JA 4O3TA 1CHOG 2GTBA 1UTQA 1BZXE 2HNTC 1HXFH 1Y59T 2F3CE 2XC4A 1C2FA 1K28D 4ZHAA 4CRFA 3QWCH 3M3SA 1CT0E 1N6YA 2VWLA 1SVPA 2FZZA 2C8YB 4DJZB 5JBAS 1XM1A 1AMHA 4Q7XA 1N8OB 3A87A 1PYTD 3SJOA 1DY9A 3V0XA 1ZHRA 4NIWA 2WPIS 5SGAE 3V13A 2ESTE 2OUAA 2ZP0H 1DT2A 5FPSA 1DDJA 1OOKB 2D26C 1SGRE 5DG6A 1AGJA 4AFZA 3FZDA 1ZSJA 4K5ZA 2G52A 5A0CA 1GI3A 3RLYH 1SG8B 4MDSA 1UK2A 2BD8A 5FAHA 3VXEH 2BY8X 2SGEE 2ANMH 2V3HH 3H7OA 3M3TA 3TJNA 3IG6B 4ISHH 1QA0A 1ZYOA 1QB6A 5DPAA 1GL1A 3EQ0H 4A5TS 1QCPA 1BHXB 2FX4A 2OC0A 4E05H 3SUGA 2XNIA 3A8AA 1O2XA 3A8BA 1KTTB 1VZQH 1CQQA 1O2ZA 1S0RA 2HLCA 3OY5U 1Y3YA 3S7KB 1SHHB 2NU2E 3LOXA 4FU8A 4XSKU 3LC5A 1QB9A 1H9IE 2XCNA 5DP9A 4AGJA 1QB1A 5FXLA 2P8OB 2Q6FA 5C3NA 4JZIA 1IQJA 2J34A 1Z6JH 1O2NA 3Q3XA 4X0WU 2PTNA 1G30B 4JK6A 4WMDA 1W13U 1F5RA 1YF4A 3ATIA 1HJAB 5LGOA 4K8BA 1CE5A 1TNIA 2ZPSA 2FP7B 1XUIA 1XUFA 2UWPA 3QZQA 1Q31A 2DE8A 1P03A 3GCTG 4TYDA 1VJAU 3PMHB 1O3DA 3SU5A 5EXNA 4BAKB 1T8NA 4B2CA 1Z8GA 2WPKS 5EGMA 2FTLE 1MBMA 4X1NU 5A0AE 1O2QA 1MMJN 1CO7E 2QXJA 2Z9JA 1XVMA 1O5FH 3LC3A 2VVVA 3BTEE 1IQHA 3NKKA 3DUXH 1ZTJA 1P2OA 5CHAB 1SGEE 1AE5A 2ZFSA 1SGNE 2Y5HA 3M36A 2QC2A 1GI5A 3BSQA 1D4PB 2B7DH 3QGJA 2FO9A 5HM9A 2V35A 5E0GA 4E7NA 7GCHG 3RM2H 1S83A 1E0FD
chains in the Genus database with same CATH superfamily
3PO1C 3E3TA 1MQ5A 2A4RA 3EA7A 2P3TB 3MH6A 3SU2A 1ZMNA 1SMFE 2BLOA 1D6RA 1FZZA 3LH1A 4AGKA 1AHTH 4OGYA 4DGJA 1SLUB 1ZPBA 2YMSD 1MUEB 2JH5D 2PV9B 2WPJS 2P94A 2O9QA 2ZDMA 2Z94A 3RC6A 3ZZ3A 2OCVB 2XBYA 3PMAB 1EX3A 1ZSLA 1V2MT 2ODPA 4D9RA 6GCHF 3PLBA 3KHVA 4ASHA 1V2UT 1HUTH 1EZUC 1OPHB 1GG6C 2BY9X 5FPYA 2THFB 3A85A 3RXBA 3ZVBA 4YESB 2FI4E 1GWAA 4BAHB 4MNXA 1K0HA 1DX5M 2ALVA 1HAHH 4FUFA 5LPFA 1OHHD 4ZAEA 4KP0A 3SV8A 2ZGCA 1FV9A 3DSPA 1KXAA 5GWZA 1C5MD 2ZECA 2GKVE 1SGFA 3KGPA 4B74A 4NA7A 1CU1A 1GHXH 1C5LH 2IJD1 5EQSA 1DOJA 3TJVA 1MTNC 4ZKRU 2GCHF 1HIAA 1ANBA 1YPHE 2PFEA 4NWKA 1AWFH 3ZZDA 4ASUD 3LIWA 1YCPM 3BEUA 1F5LA 1L2EA 2A4OA 3SJKA 5G4BA 1PPHE 2G8TA 1CA0B 1NT1A 3RXVA 2ZTXA 1FMGA 2XYAA 2AMQA 1A7SA 3SI3H 2FOEA 8ESTE 2HALA 4ISOA 1ELBA 1FJSA 1SB1H 1LO6A 4B2AA 1EPTB 1OP8A 1SC8U 3LGUA 3TJOA 3OEHD 1SOZA 2ZDAH 1KXCA 2ULLA 1ELGA 4NIVA 3DT0H 5HMAA 1BBRH 2CV3A 5EQQA 1GCTB 3DSGA 1IQFA 3HGNA 2Y5FA 3RXLA 1C1QA 1G2MA 1FQ3A 4DVAU 2GCTC 1FI8A 1BQYA 2BX3A 3BIVH 2R2MB 3T28A 4DURA 4X1QU 2PW8H 1UO6A 1GDNA 1W7GH 4ZKOU 1P0SH 3HATH 4Y10E 4YT7H 1O32A 1JOUB 2LELA 2OC1A 3ELAH 3KQEA 1GI8B 2QF5A 4HGCA 1THRH 1ETTH 1ARBA 3FP7E 2BDBA 1JMOH 3MI4A 2JKHA 1IHTH 1N1LA 1ORFA 3M7TA 1UVSH 4MPVA 1O3FA 1NU9A 3E8LA 1KYNA 3RU4E 4FUGA 2RA0A 3I78A 4TT3D 1UTJA 3PRDA 1O2MA 1GHYH 1W12U 3A7WA 3MNXA 3TLOA 3UNRA 3PLKA 1WAYB 3PMJA 2J4IA 2XC0A 3NCLA 1D3PB 1VITF 1BTPA 4UDWH 1XKAC 4KTSA 4WH8A 4Y0YE 1RIWB 2VIQA 5GCHG 1A0LA 1HAPH 1SGPE 1BTZA 2J5UA 2PGQB 3SJIA 1GJ4H 2ZIQH 1K21H 1SL3A 2BX4A 4MPXA 1TRYA 4JZDH 3VB5A 3SU4A 3PTNA 2FS9A 2BQ7B 4ZUHA 5T6FA 3L33A 3AASA 2O8WA 3SUDA 1NTPA 1KXEA 2QIQA 4NIYA 1G3BA 2JETB 1GBJA 1ZPCA 4K1TA 2Z9GA 1CVWH 1DLKB 5DP7A 4IMQA 3SGAE 3OTJE 4ABEA 5AFZH 1CGJE 3U8RH 3MQKC 1DY8A 1GI0A 5GDSH 3KIDU 1KLIH 1RTLA 2QY0B 3QK1A 2BVRH 1TYNA 1N8OC 1EOLA 1ELDE 4MQAA 2ZO3H 2P3FH 1C1VH 3RMMH 1K1NA 1IQLA 4HZHA 4ZHMU 1QURH 2R0LA 1A5IA 1TQ0B 1EAXA 4YLUA 2VWNA 5T6DA 1V2TT 2ZFPH 4MVNA 1YLNA 1V2VT 1EAIA 3M37A 4A1VA 1O34A 8GCHF 2ANKH 4BTUB 1EQ9A 1G37A 1DE7H 3M5OA 4AX9H 1O3IA 1MZDA 2ANYA 3P8NA 1Y5UT 2C8ZB 3WWBA 3CENA 1RGQA 1UCYK 2EI8A 9ESTA 2VIVA 1LQEA 1TA6A 2ZHQH 4AB9A 3QLPH 2GGVB 1SSXA 5JB8S 4XBCA 3KQBA 3MO9A 2F43B 4ABHA 1QFKH 5C0TA 4YM9A 1S81A 3PLPA 1O2SA 4GHTA 1C5YB 2ZU1A 1HJ8A 5L30H 1L0ZA 4XD7D 4M7GA 1UMAH 2AGIX 3O8DA 1O3OA 3QO6A 3BF6H 1KLJH 2XBWA 4J1YA 1BOQA 2P8OC 3VB7A 4FVDA 1O2LA 1SHYA 2IPHA 5GIBA 4ZHLU 5IDKA 1O3MA 4UFGH 3URCA 4AG2A 4YOJA 1HJAC 5EJ1A 3SW2B 2I6SA 3RXFA 7KMEH 6GCHG 3T2NA 3MH4A 3PWCA 1CA8B 2FOMB 1GBIA 1PPZA 4I31A 5HXFA 3KNXA 4XDEA 1GJ8B 1UK4A 1XMNB 1AO5A 3NK8A 2F9VA 1SPJA 1C5RA 2VH6A 1V2RT 1NO9H 1KDQB 1O5AB 2ODQA 3M3VA 1BJUA 1THPB 1YC0A 3HPTB 3UAIC 4X1RU 2WPHS 1GPZA 2K0QA 2OQUA 1P2JA 3UY9A 1GGDB 3BTHE 1S0QA 2V6NA 1FPHH 1MTVA 2GCHG 1W0JD 2NU1E 5JYIA 9LPRA 2VINA 1C2HA 1JRTA 3SYJA 3B23B 3SV9A 1O5DH 1Y5BT 3UNSA 2QA9E 1GBLA 5C2ZA 2BY5X 1O3GA 1UTMA 1EFRD 1UTNA 1AN1E 3URDA 3M5LA 3GCOA 2GT8A 1NRQH 3A8CA 1KMHB 1MU6B 1AE8H 1V3XA 1C5TA 2ZDVH 3VFEA 1SGDE 1A5HA 4VGCB 4E06H 3MTYA 1BMNH 4F49A 3S0NA 1UVOA 1K22H 2GZ7A 3LGWA 2QF3A 1HAYB 3RUOA 5DGJA 1ELAA 2BDGA 4IC5A 2OC7A 1YGCH 1EB2A 3A88A 1VGCB 1O37A 1GI2A 4X8VH 3E6PH 2AIPA 5F8XA 4RKOB 2B0FA 3U9AH 4FETA 1YWUA 4TWYA 1FPCH 2PKAB 2SGAA 2W3IA 3OSYA 4R0IA 1MU8B 3RXTA 1PQ7A 4CRBA 2W3KA 1X7AC 5TJXA 1O39A 1M9UA 3MU5A 5CHBA 1FAXA 4IC6A 3RXDA 3LKWA 2KFWA 1DWCH 2QF4A 3PV2A 1HB0B 2UWOA 1SLXB 1C1TA 2GT7A 4RI0A 1E37B 3RLWH 2KCOA 2ZTZA 3F3BA 4Q2KA 3PV5A 1GBDA 3EDXB 2KX4A 4NSVA 1C5SA 3GY7A 3H5CB 4MNYA 1FIZA 1IAUA 1GMHF 3KQDA 1Y3VA 1C2LA 4K60A 4IS5A 2R3YA 3N99A 2FI3E 4FOUC 4X2XA 2FOCA 1MAXA 3AW0A 1LVOA 1LMWB 1K9OE 2XOKD 3TGKE 1TGNA 4JZ1A 1HFDA 1DXPA 1GMCF 1UTLM 3N7DA 3T62A 3SN8A 3FP8E 2CMYA 3LONA 2J38A 4Q7YA 1H8IH 1JWTA 1O5EH 2PGBB 3BTTE 5EJLA 3SBKA 2FLBH 1RS0A 1UCYH 1AWHB 2BQ6B 4ZKNU 3ZV9A 3S9BA 1A3EH 2TGDA 2A2QH 3GY3A 4TSFD 3B9FH 4P02A 1CSOE 3MH7A 4AZ2B 2V3MA 2ZWLH 1HRTH 1EZXC 5DP5A 1C1RA 1GMDF 5BRRE 2Y7XA 3SOSA 2RFKC 1EJAA 1O30A 3PV4A 1EJMA 4UEHH 1O2UA 5H4IB 2ODYB 2CF9H 2R9PA 5J4SA 3GDVA 1MAYA 1LHFH 4X6PA 2OBOA 1BRCE 1LPGB 3ITIA 1G3CA 4I8LA 3E91A 1C9TA 1MCTA 1IHSH 3S7HB 5AFYH 3HGPA 1AD8H 2FWWA 2ZCLP 1YYY1 3NZIA 2P59A 2Z9IA 3CP7A 2JH0D 2H6MA 4YZUA 1ZR0A 5GCHF 4BXSA 1VITH 3RXJA 8GCHG 1PPFE 3A7ZA 1EPTA 3DSOA 4ACBA 2FMJA 1NRSH 3KCGH 4TPIZ 7ESTE 2EEKA 2YNBA 1Z7KA 1TALA 1RIWC 1WUNH 3GY4A 1Y3XA 5BPEA 2OD3B 2M5TA 5ESTE 4Q7ZA 1QR3E 2H5CA 1RFNA 2KCPA 1UVUH 2P93A 1W0ZU 3MOCA 2ZGJA 1ELEE 1P10A 2CXVA 3NRLA 4FUJA 4GCHF 5T6GA 1LHCH 2C93B 1O3CA 1AUJA 3V12A 1PQ5A 1AI8H 1DLEA 2F9PA 2Y82A 4O3UA 1Q2WA 1C5ZB 1WTGH 1QBVH 4B6FA 3SU6A 1FN8A 1C2JA 1WXRA 1AB9B 2JETC 3FFGA 5I25A 2IN2A 5C94A 1A4WH 2GMTC 1QJ1B 1T4VH 2ZQ1A 4KTUA 1HAOH 2PHBA 3RXOA 3P70B 4CBNA 3BTME 3BG8A 3F6UH 2R0KA 3TPIZ 3T5FH 1QRWA 2CF8H 3P6ZB 3LT3A 2AS9A 5HYOA 3NPSA 4WXVA 1J9CH 1MTWA 1F0UA 3ZZ5A 4X6MA 4AFUA 3NXPA 3Q3KA 4D76A 3ZVEA 1KXFA 3UOUA 2ALPA 4MNVA 2NU3E 4B1TA 1ETRH 5EODA 1HGTH 2A2XH 3N7EA 3ZVDA 2H9TH 1TOMH 4WXIA 2KCAA 3P17H 3KQCA 4I8GA 1HNEE 4ABBA 2FOHA 5F8TA 3TH4H 2PR3A 1Z1IA 4FUEA 2XBXA 3CS7A 4GUXA 1C2EA 3UIRA 2DUCA 1QGFA 1DWEH 2WPDD 1IQGA 1O33A 3B8JA 4FUCA 3MHWU 1ARCA 1YPEH 4BAQB 3LJJA 6ESTA 1GI1A 1F0RA 1RTKA 2OP9A 4Z6AH 2JJ1D 1E1RD 3O8RA 2Z3EA 1NROH 1TPAE 2VH0A 1ESBA 4NA8A 2B5TB 1BMMH 1T31A 4HI3A 1NRNH 2PSXA 1BBRE 5JBCS 2CN0H 1C1MA 1G36A 1LQDB 4INLA 1GJ7B 3QUMP 1TNGA 4FU7A 1MQ6A 1ELFA 1TWXB 2C8XB 1J17T 1SOTA 1GBHA 2QXHA 1BMFD 2XCFA 3E90B 2FOAA 4OM9A 2J95A 2AFQB 4TY6A 2BOHB 3QGNB 1IQNA 1J15A 4ISIH 1Z8JB 4BTTB 1TIOA 3ZZ6A 2ZU2A 2BXUH 4A6LA 1BTYA 1NU7B 5ETXA 1A1RA 3U8TH 1ANDA 1C5WB 1K2I1 4DIIH 1WQVH 3A89A 3FP6E 3ZVGA 4X2WA 1PJPA 4INKA 1QL7A 1OS8A 4I8HA 2YMSB 4H6SB 1XXFA 4YOIA 3PMBB 2K1QA 1BMAA 5J4QA 1FUJA 2BDCA 4K8YA 1CBWB 1DPOA 2KM0A 2A7HA 1AU8A 1LPZB 3G01A 1GBCA 3OYPA 3UPEA 2RDLA 3TNSA 1YKTA 1L1NA 2FTMA 3P8OA 2HNTF 2ZHWH 3GCNA 3Q77A 1GMHG 2VGCB 1K1LA 4I33A 3PM3A 4JCNA 1LVMA 1LPKB 1OWHA 3AK5A 1HPGA 4H6TA 3F9GA 3GOVB 1C2IA 1WSSH 3A8DA 1P01A 4BNRA 1FIWA 3SHCH 2WPMS 5FL7D 4H42U 2ZFRH 1LHGH 1A5GH 3EE0B 3M5NA 1GMCG 1TMBH 2B8OH 2F4LA 1P2NA 1P9SA 4Z0KA 4YOGA 2OLGA 4UE7H 3ENSB 1ANEA 4HTCH 4VGCC 2F9UA 2VNTA 4WY3A 1GBTA 3UR6A 5F6MA 2XW9A 1GHZA 1LTOA 1NS3A 2WYGA 2A4QA 3SU0A 1O2YA 1KDQA 1S6LA 4AOQA 4WVPE 5C67A 1UHBB 1UTPA 4U30A 5GJ4B 2ZDLA 1K1MA 1VGCC 1WDIA 6CHAB 3VG8A 3RP2A 5GPIB 1T4UH 2XWAA 5FPTA 3A7TA 1CGHA 3MO3A 4CR5A 1QHRB 1ZHMA 5JDUB 1GMDG 3QX5H 4O03A 2I6QA 5DP3A 4CHAB 4B73A 1RJXB 1PQ8A 4XFQA 4J2YB 4ABIA 2ZF0H 3UOPA 2BQWB 1O2TA 1HAVB 2H9EH 1NBMD 4ABFA 2AGEX 3GDSA 4A92A 5LH8A 3W95A 1AY6H 5B6OA 3RXQA 2BDYA 3TVJB 4WH6A 1P3EA 1YLCA 3DHKH 2FS8A 3BG4B 1DANH 1O3KA 1BMLA 1G9IE 1YPGH 2UUKB 1EUFA 2GZ8A 2ZPQA 1BTWA 3SUFA 4LZ1H 5L6NH 3M7QA 1ZMLA 2LP6A 1KXDA 1A61H 2FX6A 4GSOA 2PKSC 2C90B 1AVGH 3FAOA 5TCCA 2A45B 3F2HA 5E2OA 3P92A 4GAWA 1NFYA 2CK3D 1V2ST 5A8ZA 3T26A 4LZ4B 2Y6TA 1AFQB 1LKBA 2SGQE 4CRCA 2EI7A 3BTFE 1O0DH 3V3MA 2PKAA 5T1VA 3UTUH 5LPRA 5C5OA 2Z6BD 3F9EA 5F03A 4DY7B 1O3EA 1YPMH 3TK6A 1YP9A 1G32B 3RXKA 4GCHG 2BD4A 3RXRA 1SGCA 4Y71A 1DUAA 2AEIH 1GI6A 1P02A 1AFEH 2OINA 2BDIA 2ZTYA 1XKBC 1L1JA 1SI5H 1FONA 2Y80A 5KECA 2PWXA 4I8KA 3K6YA 4AB8A 2ZU4A 2HPPH 1L4DA 2C3SA 2QXGA 4OS5A 5K7RA 2HVXA 1GBMA 3P8FA 2QF0A 1TOCB 1IOEA 5GXPA 1C4V2 3I77A 1MKXK 1ELTA 1SBWA 1C5XB 4UD9H 4Y79A 3U1IB 1BB0B 3VXFH 1YM0A 1YPHC 4ZMAH 3MU0A 4RT1A 1TAWA 1YLDA 1O3PB 4IMZA 4I32A 1OP2A 1A0JA 3SGQE 4IW4E 1NZQH 1EKBB 2TPIZ 1Z8RA 1SKYE 3GY5A 2V0BA 2QAAA 1V2NT 1SGQE 1C2KA 5E0JA 1OSSA 1TX8A 3K6ZA 1HDTH 1V2WT 2ZZUH 2A7JA 4CRAA 4D9QA 1ZHPA 5EPNA 3N7OA 3UNQA 2HRVA 1WCZA 1YY3A 4OS7A 1QRZA 1V2PT 2GDEH 3PTBA 5T3HA 1BUIA 3T27A 4ABAA 1U6QA 2ZC9H 2H1UA 2XNDD 1C1WH 2ZDKA 4X2YA 3DFJA 5FBIA 1ESAA 1ANCA 3DCLA 3GCHB 2ZHFH 1LVYA 1O2VA 2F9NA 3LGVA 1UW7A 3D65E 1W3CA 2BVSH 3F0OA 5DP6A 1BT7A 1FAKH 1MZAA 1BDAA 2HLDD 2RG3A 2BD9A 1QL9A 1YPJH 1C1PA 4B76A 1AZ8A 1P04A 2ZQ2A 1H9LB 2OTVA 1KXBA 4BAOB 5FCKA 2GD4B 2JH6D 4NZQA 1AB9C 2IOTA 1NFWA 2AMPA 4Y11E 2B9LA 5DKMA 3BV9B 2WV9A 1G3DA 2XTTB 3HKJB 4X6NA 1ZRKA 1ZMJA 2O8UA 1OXGA 1BRBE 2YNAA 2FI5E 1F0SA 1RTFB 1BRAA 1C9PA 3A80A 3KN2A 4XRNA 1E1QD 1HJ9A 1GG6B 3ATWA 1GJCB 1O2WA 1GHBF 2SNWA 5HGGA 1S6HA 2LPRA 3E0PB 4ABJA 2NWNA 4OS1A 4KELA 5B6LA 1UTOA 3TH3H 1A2CH 2IJOB 1IQKA 3F2FA 2ZFQH 2BVXH 2VB0A 1KSNA 1SGTA 2TIOA 2TGAA 1THSH 3RC5A 4DW2U 3FANA 4A7IB 3HK6B 2WYJA 1TGSZ 4TWWA 2F9BH 2ZEBA 1QBNA 1O31A 1GJ5H 2UUJB 1CGIE 1OWKA 1COWD 1C4U2 1W7XH 5A0BA 2WZQA 3GYMA 1EZSC 4DT7B 1GBAA 5CHAC 4NIXA 2AERH 1V2KT 2J94A 3A81A 2Q6DA 1P05A 1DVAH 4AFSA 2BD7A 1P3CA 2FYRA 3OAAD 4ABDA 2O8LA 1T32A 5E2PA 2QN5T 2WHXA 1TNHA 5JBBS 1Y3WA 1P06A 3KL6A 2R3UA 2WINI 2CGAA 3STJA 2R2WU 2A5AA 1O2IA 1UCYE 1C2GA 1KTSB 2JJ2D 1ZOMA 1D3QB 4R8TB 5ESBA 3GICB 3VGCB 5F8ZA 4ZH8A 2WV5A 1H1BA 1TBRH 4FUHA 4RKJB 1DS2E 1KLTA 1O3HA 4IGDA 3UFAA 4CREA 1C5UA 1H9HE 1LHEH 2PLXA 1PPCE 1TABE 3RXUA 3UQOA 1FX0B 2HPQH 1DWDH 1LDTT 2L74A 2VWMA 1A3BH 2A4GA 5L2ZH 1DFPA 1TPPA 3AW1A 1UVTH 1A0HB 1PPGE 2GCTB 2BM2A 3KYFA 2OK5A 4OS2A 2F9OA 2FIRH 2ZCHP 3TJUA 1MKWK 1LCYA 3W1EA 1NN6A 4K2YA 5C1XA 2WUCA 2RCEA 1JIRA 4AC9A 3SV2H 1D9IA 2BDHA 3LH3A 5FCRA 4RSPA 3STIA 3ODDA 3MU4A 1INCA 1ZJKA 2BD2A 1XUJA 1SR5C 2QCYA 1WTHD 2TRMA 3FZZA 3SU1A 2PUXB 2OC8A 3M5MA 2FYQA 4Q63A 2FPZA 3D23A 5PTPA 5KEDA 1O2OA 1V2OT 4D7FA 3E1XB 4FUBA 2P16A 1O36A 4CRGA 1V6DA 1GJBB 1VCQA 1Y3UA 2ZCKP 3EA8A 4U2WA 3SZEA 2GP9B 5FX6A 1L1GA 1D3DB 4Y76A 1C1SA 1TBZH 5L2YH 3UREA 1UK3A 2BHGA 2Y81A 5FBEA 1HAZB 1P2IA 5EXMA 3RM0H 1CA0C 4ZKSU 2Z7FE 2J98B 4KKDA 3U98H 1SQOA 1V2JT 3EA9A 2ZI2H 8KME2 1SFQB 4ACAA 2A32A 5AF9H 5DSFA 1HV7A 1BITA 1LVBA 2VVCA 1Y8TA 4BTIB 2ZKSA 1EPTC 3P8GA 4KGAA 1UTKA 5JB9S 3GISB 1TX6A 5C5NA 5EW1H 2Z3CA 2V7QD 2J92A 3GY2A 2BLVA 4OS4A 1K1JA 1GCTC 2VIWA 3Q00A 1KY9A 1O2KA 2W6ID 1TPOA 2BD5A 4AFQA 3ATLA 3KF2A 2OXSA 4AYYB 1TMTH 1Z8IB 1WBGB 3TITA 2Z3DA 3A84A 1OWDA 1FY1A 4ZROA 2ZG0H 2XBVA 2YOLA 2FODA 4TPYA 3R0FA 2PTCE 6CHAC 2J2UA 4NFEA 2VWOA 3QN7A 1JBUH 2Y7ZA 1HLTH 3RMOH 5E8EH 4ISNA 4CHAC 1BHXF 3BEIB 2NU0E 3ODFA 5DO4H 3R3GB 1JRSA 3E0NB 4NSYA 4ZXXH 4AN7A 1NRRH 1SGFG 2HWLB 3ZZ9A 3AVZA 1PPBH 3RXEA 1SLWB 4ESTE 3SO3A 1ZTLA 4INHA 4JK5A 1XXDA 3BG4C 3RMLH 5EW2H 2FDAA 1XVOA 1DICA 4X6OA 2GX4A 1NESE 2W7SA 4GPGA 4BANB 3M7UA 4Q80A 3UQVA 2K8IA 2PUQH 2GV6A 1G2LA 2FESH 1W8BH 3O8BA 1TGBA 1DXWA 1GDUA 1Z71A 2XXLA 1UHBA 2SGPE 3QTOH 1C1UH 1MTSA 2STAE 2HVYB 2KZ4A 3RU4D 3FN8A 1AFQC 1BBRK 1GBFA 2QE7D 5DP8A 1Z6EA 1VCPA 4Q4LA 2A5KA 1CT4E 1HAVA 1QBOA 2OBQA 4M9FA 1EAWA 3IITA 1MD7A 1O3LA 3QDZB 4ABGA 5AVDA 1GJ6A 5C0UA 4TY7A 4XBBA 3NWUA 3ATKA 1JXPA 2GJGA 1HAXB 1YPLH 3ATMA 1ELVA 4THNH 3Q3YA 1GI4A 3TH2H 1H8ED 3W94A 2UUYA 1XUKA 3TGJE 4UFDH 3ZZBA 4F4OC 2G4TA 4X8SH 3FVFB 2FEQH 3OX7U 1O3AA 2ZFTA 2F83A 2GDDA 4MTBA 1PFXC 3WW7A 2IPQX 5EXLA 4Y6DA 1GHBG 1ZZZA 3LGYA 1GJDB 4DCDA 4Y7BA 4U01A 2ZGBH 1TONA 3VB3A 1S6FA 4B6EA 5HIZA 2FOGA 2AYWA 2H2ZA 1GI9B 1P57B 2KAIB 2VIOA 2W6JD 2ZGHA 3WY8A 1MKWH 1OYTH 1ZTKA 3UWJH 3TGIE 2BMGB 1TA2A 1GCDA 3VEQB 1TFXA 1QZ8A 3K65B 1C5OH 3P95A 3RXSA 2STBE 2QYIA 1WQSA 2A31A 1GHAF 1AZZA 1N6XA 3RXIA 4DT4A 3L3TA 2W7UA 3V7TA 2WPLS 1ZLRA 2KR7A 5A8XA 1TX7A 1SGYE 5FX5A 1EAUA 4IBLH 1TNKA 2ZU3A 5A2MH 1P2MA 1GDQA 1SLVB 1SFIA 3GCHC 1EP5A 1WOFA 3BTGE 3BTDE 4D8NA 2AH4X 4XOJA 3I29A 2A1DB 4I8JA 5JBTA 4CH2B 1TNJA 2ILNA 1WU1A 3RC4A 4OS6A 4X1SU 2BLQA 4XBDA 1FY5A 1C5NH 3A7XA 3A7YA 2BXTH 3S9AA 1AVXA 3FO8D 3MNCA 1C2MA 1OWIA 1AKSB 3EGKH 1GBBA 2VIPA 1YBWA 1NC6A 5EQRA 3E16B 4WWYA 2BOKA 4MNWA 1G3EA 1IQEA 3BN9A 4K1EA 2ANWA 4JMYA 4B2BA 1B5GH 1TE0A 1VKYA 2AMDA 1A46H 1J16A 2AIQA 3F9FA 3ZIAD 1ELCA 2CHAB 4UFFH 3RXGA 2QGRA 1GJAB 1E79D 3VB6A 2G4UA 1LHDH 3F2GA 3LU9B 3GYLB 1BCUH 3GY6A 1XUGA 1FY8E 1E36B 3D62A 3RU4T 2PSYA 3AAVA 1O2JA 4GLYA 3OTPA 1FDPA 4K69A 4NGAH 4X8TH 1C1NA 3JZ2B 1JIMA 1DWBH 1C5QA 1EXFA 1GGDC 1QQUA 4LK4A 2J9NA 3U69H 2G81E 5AHGH 3ZVAA 1GJ9B 2AHME 5EG4A 1O2PA 4X8UH 5TCAA 3RXMA 1TPSA 1HAGE 1P12E 3HK3B 2G51A 3A7VA 2VIDA 3BTKE 2VVUA 1O5GH 2JIZD 3K2UA 4WMFA 1DSUA 1HXEH 1DSTA 1OX1A 1V2LT 4WJG2 3FOAA 2ZA5A 1V2QT 2FXRA 4MLFB 3MO6A 4WMEA 3SJ9A 2A0QB 1GHVH 1XUHA 4YTAA 3RDZA 1ZSKA 4JZEH 3ZZ8A 1GHWH 1P2QA 2EC9H 3VGCC 2FM2A 4MPWA 4SGAE 1O3NA 4I86A 4DG4A 2VU8E 3U8OH 4YO9A 4P00A 5LPEA 1DUEA 4ISLA 3IWMA 3UUZA 4OGXA 4E7RG 3ZZ4A 1J8AA 1QJ7B 4Y7AA 1WV7H 1T8LA 3K9XB 1LKAA 5KGOA 5C1YA 4YT6H 3BTWE 4NFFA 1H4WA 4O9VA 2C4FH 3F1SB 1ZGIA 2ZPRA 5EPYA 1BIOA 3D49H 3SV7A 3DFLA 3EYDA 1BRUP 4IN2A 3TK9A 1W0KD 1RXPA 2BLWA 3WWFA 3LPRA 3MNSA 1P2KA 3DA9B 3SU3A 2M2AA 2VBCA 4NCYA 3QZRA 3OY6U 2G5NA 4HFPB 5EOKA 1QY6A 1FLEE 7LPRA 2BY7X 3EE7A 1TGCA 4CR9A 1TNLA 3QTVH 3SJ8A 3ZVCA 1O2HA 1F2SE 2XC5A 1CHGA 3RXCA 3A83A 3A86A 1QRXA 1GVKB 2C8WB 4K1SA 5GNDA 2SFAA 4UONA 2SGDE 1P8VC 4GVUA 3OEED 1MD8A 2G5VA 4QT8C 1TRMA 5FHTA 4O97A 3CS0A 5DP4A 1SGIB 2DE9A 1L4ZA 1AUTC 4WF8A 4Z1MD 1D3TB 1O2RA 1W2KH 4BOHA 2G55A 6LPRA 4DIHH 1EP6A 3MWIU 1QNJA 1NM6A 1FY3A 1P09A 2BTCE 1XX9A 1O38A 3JZ1B 1MCVA 4A1XA 1FXYA 4CH8B 4FUDA 4JYUH 3U1JB 3MMGA 2HGTH 3RXHA 4YXWD 1CHOF 1K1IA 2TBSA 1FN6A 3SORA 4H4FA 4D7GA 3MU8A 5DJ7A 1O5BB 3HKIB 3PYHA 4XE4A 1D6WA 4MPUA 2GZ9A 2Z9LA 2GMTB 3LGTA 1F0TA 1AQ7A 4AG1A 1SQTA 1C5VA 5E0HA 1UJ1A 1KIGH 1TMUH 2G00A 5K0HA 1QL8A 1RD3B 4MG3A 3UB0A 2WV4A 2O8MA 3SNCA 5A8YA 2FOBA 1VJ9U 3GY8A 4LOYH 2JDID 1QA7A 4YLQH 3TIUA 2J98A 1NRPH 1SQAA 1Q3XA 2XWBI 2EQNA 1W11U 2BDAA 1GL0E 2P95A 1O35A 1DM4B 2WUBA 5C17A 1YCPK 1UVPA 3C27B 1MBQA 1NFUA 1PYTC 1GVLA 3PB1E 8LPRA 4FU9A 2QXIA 1TB6H 5JPMH 4A1TA 3ZZ7A 2RA3A 1GHAG 1T8OA 2W5EA 5C1UA 2TGTA 3SV6A 2EY4C 1ABJH 1FY4A 1O3JA 5DK1A 3M61U 1GBKA 5CMXH 5IK2D 3SNDA 3PO1B 1NPMA 2CJIA 3VB4A 1GBEA 4ZCNA 4AORA 3RXPA 3VPKA 1ZGVA 2GV7A 1SQRA 1K1OA 2A5IA 2SGFE 1O5CB 3KEEA 1HIAB 3MYWA 1FNIA 3CNRA 2Z9KA 3ZV8A 1EZQA 2D8WA 3S9CA 2H5DA 4Y8XA 3U28C 1AIXH 2HOBA 1W10U 4ZXYH 1P9UA 1S84A 1ZRBA 3S69A 3MNBA 1HYLA 2FOFA 2H9HA 2ZFFH 1QJ6B 1WYKA 1ZPZA 3FKSD 4FVBA 2RDEA 1TLDA 4CBOA 1K1PA 4JYVH 3ZYEA 3ZYDA 1PQAA 4X1PU 3NUMA 1RRKA 1GI7B 5HKKD 3AAUA 2GVFA 1H8HD 1O2GH 3DD2H 4NG9H 3PWBA 3GCTF 1BTHH 2BZAA 2SNVA 3OE7D 3T29A 3TNTA 2P3UB 2HNTE 2ZNKH 5HM2A 3LDXH 3RMNH 1EASA 1OP0A 5F53A 5IYTA 2V3OH 4Y0ZE 1HCGA 2J97A 1EOJA 1S5SA 2F91A 3MFJA 4B75A 1E34B 1MTUA 1Z1JA 4Y8YA 2NU4E 3M35A 4AYVB 1ETSH 1MTNB 3SQHE 1J14A 1E35B 3C1KA 3GS9A 1C1OA 4KTCA 4F48B 1EJNA 1ESTA 2ZHDA 2ZDNA 4Y8ZA 3O8CA 2ZGXH 1GVZA 2D2DA 3GDUA 3PROA 4B71A 4JYTA 1BTXA 4PROA 7GCHF 4I7YH 3MH5A 4UFEH 3H7TA 1B0FA 2LNCA 3SUEA 3ZZCA 1EATA 3RXAA 1E38B 3UR9A 3UWIA 1TRNA 1Y5AT 3ZZAA 3SQEE 1IQIA 1T8MA 3ESTA 1NBME 1C5PA 1B7XB 4U32A 1ACBE 4DOQA 1HBTH 2BYAX 3LJOA 5CE1A 3SHAH 2WSSD 4SGBE 4NWLA 3A82A 2W26A 1ABIH 2Q6GA 1B0EA 1VR1H 2KAIA 2EA3A 1NY22 1O3BA 1TQ7B 5EU8A 4BXWA 2BD3A 1NFXA 3F9HA 3BEFB 1PPEE 4X2VA 2Y5GA 1OYQA 3SI4H 3SGBE 1F92A 2O8TA 2YMSC 1CT2E 2XRCA 4NA9H 1BTUA 2CHAC 4RN6A 2BY6X 3EAJA 3L6PA 4NZLA 3TU7H 1W0YH 3Q76A 1HAIH 1VCWA 2FLRH 3SNBA 3SNAA 1CBWC 1OWJA 1MKXH 3MU1A 3OFND 1T7CA 2UWLA 5EJZA 4CRDA 1OKXA 3F68H 2UUFB 4RT0A 2VJ1A 3SNEA 1ZJDA 1W14U 3OU0A 1TGTA 2VGCC 1YPKH 2OQ5A 5I46H 4IN1A 2EI6A 3BIUH 2AGGX 1S85A 1H8DH 4GHQA 5A09A 1IQMA 2QV1A 1BA8B 1F7ZA 2PP6A 3KYGA 3SZNA 1C2DA 2ZHEH 1TBQH 1AKSA 1VITG 2PKSB 1S82A 2BZ6H 3T25A 1F5KU 2ZU5A 4K3JA 1P11E 2D1JA 1EB1H 2TGPZ 1YCPH 5ABWA 1OWEA 4LXBH 1MABB 1BJVA 1MH0A 4FUIA 1DITH 2A7CA 1ID5H 1C4Y2 1QIXB 3BTQE 3TK5A 3F0PA 4BAMB 3KQ5A 5CDFE 1QQ4A 5C20A 2ASUB 4FXGH 1QTFA 1AVWA 4JZFH 2BB4A 3LGIA 3ZVFA 2Q1JA 4O3TA 5EIYA 1CHOG 2GTBA 1UTQA 1BZXE 2HNTC 1HXFH 1Y59T 2F3CE 2XC4A 1C2FA 1K28D 4ZHAA 4CRFA 3QWCH 3M3SA 1CT0E 1N6YA 2VWLA 1SVPA 2FZZA 2C8YB 4DJZB 5JBAS 1XM1A 1AMHA 4Q7XA 1N8OB 3A87A 1PYTD 4F55A 3SJOA 1DY9A 3V0XA 1ZHRA 4NIWA 2WPIS 2L6OA 3H09A 5SGAE 3V13A 2ESTE 2OUAA 4HG6A 2ZP0H 1DT2A 5FPSA 1DDJA 1OOKB 2D26C 1SGRE 5DG6A 1AGJA 4AFZA 3FZDA 1ZSJA 4K5ZA 2G52A 5A0CA 1GI3A 3RLYH 1SG8B 4MDSA 1UK2A 2BD8A 5DN6D 5FAHA 3VXEH 2BY8X 2SGEE 2ANMH 2V3HH 3H7OA 3M3TA 3TJNA 3IG6B 4ISHH 1QA0A 1ZYOA 1QB6A 5DPAA 1GL1A 3EQ0H 4A5TS 1QCPA 1BHXB 2FX4A 2OC0A 4E05H 3SUGA 2XNIA 3A8AA 1O2XA 3A8BA 1KTTB 1VZQH 1CQQA 1O2ZA 1S0RA 2HLCA 3OY5U 1Y3YA 3S7KB 1SHHB 2NU2E 3LOXA 4FU8A 4XSKU 3LC5A 1QB9A 1H9IE 2XCNA 5DP9A 4AGJA 1QB1A 5FXLA 2P8OB 2Q6FA 5C3NA 4JZIA 1IQJA 2J34A 1Z6JH 1O2NA 2KCYA 3Q3XA 4X0WU 2PTNA 1G30B 4JK6A 4WMDA 1W13U 1F5RA 1YF4A 3ATIA 1HJAB 5LGOA 4K8BA 1CE5A 1TNIA 2ZPSA 2FP7B 1XUIA 1XUFA 2UWPA 3QZQA 1Q31A 2DE8A 1P03A 3GCTG 4TYDA 1VJAU 3PMHB 1O3DA 3SU5A 5EXNA 4BAKB 1T8NA 4B2CA 1Z8GA 2WPKS 5EGMA 2FTLE 1MBMA 4X1NU 5A0AE 1O2QA 3PRBA 1MMJN 1CO7E 2QXJA 2Z9JA 1XVMA 1O5FH 3LC3A 2VVVA 3BTEE 5HIYA 1IQHA 3NKKA 3DUXH 1ZTJA 1P2OA 5CHAB 1SGEE 1AE5A 2ZFSA 1SGNE 2Y5HA 3M36A 2QC2A 1GI5A 3BSQA 1D4PB 2B7DH 3QGJA 2FO9A 5HM9A 2V35A 5E0GA 4E7NA 7GCHG 3RM2H 1S83A 1E0FD
chains in the Genus database with same CATH topology
3PO1C 3E3TA 1MQ5A 2A4RA 3EA7A 2P3TB 3MH6A 3SU2A 1ZMNA 1SMFE 2BLOA 1D6RA 1FZZA 3LH1A 4AGKA 1AHTH 4OGYA 4DGJA 1SLUB 1ZPBA 1MUEB 2JH5D 2PV9B 2WPJS 2P94A 2O9QA 2ZDMA 2Z94A 3RC6A 3ZZ3A 2OCVB 2XBYA 3PMAB 1EX3A 1ZSLA 1V2MT 2ODPA 4D9RA 6GCHF 3PLBA 3KHVA 4ASHA 1V2UT 1HUTH 1EZUC 1OPHB 1GG6C 2BY9X 5FPYA 2THFB 3A85A 3RXBA 3ZVBA 4YESB 2FI4E 1GWAA 4BAHB 4MNXA 1DX5M 2ALVA 1HAHH 4FUFA 5LPFA 4ZAEA 4KP0A 3SV8A 2ZGCA 1FV9A 1KXAA 5GWZA 1C5MD 2ZECA 2GKVE 1SGFA 3KGPA 4B74A 4NA7A 1CU1A 1GHXH 1C5LH 5EQSA 1DOJA 3TJVA 1MTNC 4ZKRU 2GCHF 1HIAA 1ANBA 1YPHE 2PFEA 4NWKA 1AWFH 3ZZDA 3LIWA 1YCPM 3BEUA 1F5LA 1L2EA 2A4OA 3SJKA 5G4BA 1PPHE 2G8TA 1CA0B 1NT1A 3RXVA 2ZTXA 1FMGA 2XYAA 2AMQA 1A7SA 3SI3H 2FOEA 8ESTE 2HALA 4ISOA 1ELBA 1FJSA 1SB1H 1LO6A 4B2AA 1EPTB 1OP8A 1SC8U 3LGUA 3TJOA 1SOZA 2ZDAH 1KXCA 2ULLA 1ELGA 4NIVA 3DT0H 5HMAA 1BBRH 2CV3A 5EQQA 1GCTB 1IQFA 3HGNA 2Y5FA 3RXLA 1C1QA 1G2MA 1FQ3A 4DVAU 2GCTC 1FI8A 1BQYA 2BX3A 3BIVH 2R2MB 3T28A 4DURA 4X1QU 2PW8H 1UO6A 1GDNA 1W7GH 4ZKOU 1P0SH 3HATH 4Y10E 4YT7H 1O32A 1JOUB 2OC1A 3ELAH 3KQEA 1GI8B 4HGCA 1THRH 1ETTH 1ARBA 3FP7E 2BDBA 1JMOH 3MI4A 2JKHA 1IHTH 1N1LA 1ORFA 3M7TA 1UVSH 4MPVA 1O3FA 1NU9A 3E8LA 1KYNA 3RU4E 4FUGA 2RA0A 3I78A 1UTJA 1O2MA 1GHYH 1W12U 3A7WA 3MNXA 3TLOA 3UNRA 3PLKA 1WAYB 3PMJA 2J4IA 2XC0A 3NCLA 1D3PB 1VITF 1BTPA 4UDWH 1XKAC 4KTSA 4WH8A 4Y0YE 1RIWB 2VIQA 5GCHG 1A0LA 1HAPH 1SGPE 1BTZA 2PGQB 3SJIA 1GJ4H 2ZIQH 1K21H 1SL3A 2BX4A 4MPXA 1TRYA 4JZDH 3VB5A 3SU4A 3PTNA 2FS9A 2BQ7B 4ZUHA 5T6FA 3L33A 3AASA 2O8WA 3SUDA 1NTPA 1KXEA 2QIQA 4NIYA 1G3BA 2JETB 1GBJA 1ZPCA 4K1TA 2Z9GA 1CVWH 1DLKB 5DP7A 4IMQA 3SGAE 3OTJE 4ABEA 5AFZH 1CGJE 3U8RH 1DY8A 1GI0A 5GDSH 3KIDU 1KLIH 1RTLA 2QY0B 3QK1A 2BVRH 1TYNA 1N8OC 1EOLA 1ELDE 4MQAA 2ZO3H 2P3FH 1C1VH 3RMMH 1K1NA 1IQLA 4HZHA 4ZHMU 1QURH 2R0LA 1A5IA 1TQ0B 1EAXA 4YLUA 2VWNA 5T6DA 1V2TT 2ZFPH 4MVNA 1V2VT 1EAIA 3M37A 4A1VA 1O34A 8GCHF 2ANKH 4BTUB 1EQ9A 1G37A 1DE7H 3M5OA 4AX9H 1O3IA 1MZDA 2ANYA 3P8NA 1Y5UT 2C8ZB 3CENA 1RGQA 1UCYK 2EI8A 9ESTA 2VIVA 1LQEA 1TA6A 2ZHQH 4AB9A 3QLPH 2GGVB 1SSXA 5JB8S 4XBCA 3KQBA 3MO9A 4ABHA 1QFKH 4YM9A 1S81A 3PLPA 1O2SA 4GHTA 1C5YB 2ZU1A 1HJ8A 5L30H 1L0ZA 4M7GA 1UMAH 2AGIX 3O8DA 1O3OA 3QO6A 3BF6H 1KLJH 2XBWA 4J1YA 1BOQA 2P8OC 3VB7A 4FVDA 1O2LA 1SHYA 2IPHA 5GIBA 4ZHLU 5IDKA 1O3MA 4UFGH 3URCA 4AG2A 4YOJA 1HJAC 3SW2B 2I6SA 3RXFA 7KMEH 6GCHG 3T2NA 3MH4A 3PWCA 1CA8B 2FOMB 1GBIA 1PPZA 4I31A 5HXFA 3KNXA 4XDEA 1GJ8B 1UK4A 1XMNB 1AO5A 3NK8A 2F9VA 1SPJA 1C5RA 2VH6A 1V2RT 1NO9H 1KDQB 1O5AB 2ODQA 3M3VA 1BJUA 1THPB 1YC0A 3HPTB 4X1RU 2WPHS 1GPZA 2OQUA 1P2JA 3UY9A 1GGDB 3BTHE 1S0QA 2V6NA 1FPHH 1MTVA 2GCHG 2NU1E 5JYIA 9LPRA 2VINA 1C2HA 1JRTA 3B23B 3SV9A 1O5DH 1Y5BT 3UNSA 2QA9E 1GBLA 5C2ZA 2BY5X 1O3GA 1UTMA 1UTNA 1AN1E 3URDA 3M5LA 3GCOA 2GT8A 1NRQH 3A8CA 1MU6B 1AE8H 1V3XA 1C5TA 2ZDVH 3VFEA 1SGDE 1A5HA 4VGCB 4E06H 3MTYA 1BMNH 4F49A 3S0NA 1UVOA 1K22H 2GZ7A 3LGWA 2QF3A 1HAYB 3RUOA 5DGJA 1ELAA 2BDGA 4IC5A 2OC7A 1YGCH 1EB2A 3A88A 1VGCB 1O37A 1GI2A 4X8VH 3E6PH 2AIPA 5F8XA 4RKOB 2B0FA 3U9AH 4TWYA 1FPCH 2PKAB 2SGAA 2W3IA 3OSYA 4R0IA 1MU8B 3RXTA 1PQ7A 4CRBA 2W3KA 1X7AC 5TJXA 1O39A 1M9UA 3MU5A 1FAXA 4IC6A 3RXDA 3LKWA 1DWCH 1HB0B 2UWOA 1SLXB 1C1TA 2GT7A 1E37B 3RLWH 2ZTZA 4Q2KA 1GBDA 3EDXB 4NSVA 1C5SA 3GY7A 3H5CB 4MNYA 1FIZA 1IAUA 1GMHF 3KQDA 1Y3VA 1C2LA 4K60A 4IS5A 2R3YA 2FI3E 4X2XA 2FOCA 1MAXA 3AW0A 1LVOA 1LMWB 1K9OE 3TGKE 1TGNA 4JZ1A 1HFDA 1DXPA 1GMCF 1UTLM 3T62A 3SN8A 3FP8E 2CMYA 3LONA 2J38A 4Q7YA 1H8IH 1JWTA 1O5EH 2PGBB 3BTTE 3SBKA 2FLBH 1RS0A 1UCYH 1AWHB 2BQ6B 4ZKNU 3ZV9A 3S9BA 1A3EH 2TGDA 2A2QH 3GY3A 3B9FH 1CSOE 3MH7A 4AZ2B 2ZWLH 1HRTH 1EZXC 5DP5A 1C1RA 1GMDF 5BRRE 2Y7XA 3SOSA 1EJAA 1O30A 3PV4A 1EJMA 4UEHH 1O2UA 5H4IB 2ODYB 2CF9H 2R9PA 5J4SA 3GDVA 1MAYA 1LHFH 4X6PA 2OBOA 1BRCE 1LPGB 3ITIA 1G3CA 4I8LA 3E91A 1C9TA 1MCTA 1IHSH 3S7HB 5AFYH 3HGPA 1AD8H 2FWWA 2ZCLP 1YYY1 3NZIA 2P59A 2Z9IA 3CP7A 2JH0D 2H6MA 4YZUA 1ZR0A 5GCHF 4BXSA 1VITH 3RXJA 8GCHG 1PPFE 3A7ZA 1EPTA 2FMJA 1NRSH 3KCGH 4TPIZ 7ESTE 2EEKA 2YNBA 1Z7KA 1TALA 1RIWC 1WUNH 3GY4A 1Y3XA 5BPEA 2OD3B 2M5TA 5ESTE 4Q7ZA 1QR3E 2H5CA 1RFNA 1UVUH 2P93A 1W0ZU 3MOCA 2ZGJA 1ELEE 1P10A 2CXVA 4FUJA 4GCHF 5T6GA 1LHCH 2C93B 1O3CA 1AUJA 3V12A 1PQ5A 1AI8H 1DLEA 2F9PA 2Y82A 4O3UA 1Q2WA 1C5ZB 1WTGH 1QBVH 3SU6A 1FN8A 1C2JA 1AB9B 2JETC 3FFGA 5I25A 2IN2A 1A4WH 2GMTC 1QJ1B 1T4VH 2ZQ1A 4KTUA 1HAOH 2PHBA 3RXOA 3P70B 4CBNA 3BTME 3BG8A 3F6UH 2R0KA 3TPIZ 3T5FH 1QRWA 2CF8H 3P6ZB 3LT3A 2AS9A 5HYOA 3NPSA 4WXVA 1J9CH 1MTWA 1F0UA 3ZZ5A 4X6MA 4AFUA 3NXPA 3Q3KA 4D76A 3ZVEA 1KXFA 3UOUA 2ALPA 4MNVA 2NU3E 4B1TA 1ETRH 5EODA 1HGTH 2A2XH 3ZVDA 2H9TH 1TOMH 4WXIA 3P17H 3KQCA 4I8GA 1HNEE 4ABBA 2FOHA 5F8TA 3TH4H 2PR3A 1Z1IA 4FUEA 2XBXA 3CS7A 4GUXA 1C2EA 3UIRA 2DUCA 1QGFA 1DWEH 1IQGA 1O33A 3B8JA 4FUCA 3MHWU 1ARCA 1YPEH 4BAQB 3LJJA 6ESTA 1GI1A 1F0RA 1RTKA 2OP9A 4Z6AH 3O8RA 2Z3EA 1NROH 1TPAE 2VH0A 1ESBA 4NA8A 2B5TB 1BMMH 1T31A 4HI3A 1NRNH 2PSXA 1BBRE 5JBCS 2CN0H 1C1MA 1G36A 1LQDB 4INLA 1GJ7B 3QUMP 1TNGA 4FU7A 1MQ6A 1ELFA 1TWXB 2C8XB 1J17T 1SOTA 1GBHA 2QXHA 2XCFA 3E90B 2FOAA 2J95A 2AFQB 4TY6A 2BOHB 3QGNB 1IQNA 1J15A 4ISIH 1Z8JB 4BTTB 1TIOA 3ZZ6A 2ZU2A 2BXUH 4A6LA 1BTYA 1NU7B 5ETXA 1A1RA 3U8TH 1ANDA 1C5WB 1K2I1 4DIIH 1WQVH 3A89A 3FP6E 3ZVGA 4X2WA 1PJPA 4INKA 1QL7A 1OS8A 4I8HA 4H6SB 1XXFA 4YOIA 3PMBB 2K1QA 1BMAA 5J4QA 1FUJA 2BDCA 4K8YA 1CBWB 1DPOA 2A7HA 1AU8A 1LPZB 3G01A 1GBCA 3OYPA 3UPEA 2RDLA 3TNSA 1YKTA 1L1NA 2FTMA 3P8OA 2HNTF 2ZHWH 3GCNA 3Q77A 1GMHG 2VGCB 1K1LA 4I33A 3PM3A 4JCNA 1LVMA 1LPKB 1OWHA 1HPGA 4H6TA 3F9GA 3GOVB 1C2IA 1WSSH 3A8DA 1P01A 4BNRA 1FIWA 3SHCH 2WPMS 4H42U 2ZFRH 1LHGH 1A5GH 3EE0B 3M5NA 1GMCG 1TMBH 2B8OH 1P2NA 1P9SA 4Z0KA 4YOGA 2OLGA 4UE7H 3ENSB 1ANEA 4HTCH 4VGCC 2F9UA 2VNTA 4WY3A 1GBTA 3UR6A 5F6MA 2XW9A 1GHZA 1LTOA 1NS3A 2WYGA 2A4QA 3SU0A 1O2YA 1KDQA 4AOQA 4WVPE 5C67A 1UHBB 1UTPA 4U30A 5GJ4B 2ZDLA 1K1MA 1VGCC 6CHAB 3RP2A 5GPIB 1T4UH 2XWAA 5FPTA 3A7TA 1CGHA 3MO3A 4CR5A 1QHRB 1ZHMA 5JDUB 1GMDG 3QX5H 4O03A 2I6QA 5DP3A 4CHAB 4B73A 1RJXB 1PQ8A 4XFQA 4J2YB 4ABIA 2ZF0H 3UOPA 2BQWB 1O2TA 1HAVB 2H9EH 4ABFA 2AGEX 3GDSA 4A92A 5LH8A 3W95A 1AY6H 5B6OA 3RXQA 2BDYA 3TVJB 4WH6A 1P3EA 1YLCA 3DHKH 2FS8A 3BG4B 1DANH 1O3KA 1BMLA 1G9IE 1YPGH 2UUKB 1EUFA 2GZ8A 2ZPQA 1BTWA 3SUFA 4LZ1H 5L6NH 3M7QA 1ZMLA 1KXDA 1A61H 2FX6A 4GSOA 2PKSC 2C90B 1AVGH 3FAOA 5TCCA 2A45B 5E2OA 3P92A 4GAWA 1NFYA 1V2ST 5A8ZA 3T26A 4LZ4B 2Y6TA 1AFQB 1LKBA 2SGQE 4CRCA 2EI7A 3BTFE 1O0DH 3V3MA 2PKAA 3UTUH 5LPRA 5C5OA 2Z6BD 3F9EA 5F03A 4DY7B 1O3EA 1YPMH 3TK6A 1YP9A 1G32B 3RXKA 4GCHG 2BD4A 3RXRA 1SGCA 4Y71A 1DUAA 2AEIH 1GI6A 1P02A 1AFEH 2OINA 2BDIA 2ZTYA 1XKBC 1L1JA 1SI5H 1FONA 2Y80A 2PWXA 4I8KA 3K6YA 4AB8A 2ZU4A 2HPPH 1L4DA 2C3SA 2QXGA 4OS5A 5K7RA 2HVXA 1GBMA 3P8FA 2QF0A 1TOCB 1IOEA 5GXPA 1C4V2 3I77A 1MKXK 1ELTA 1SBWA 1C5XB 4UD9H 4Y79A 3U1IB 1BB0B 3VXFH 1YM0A 1YPHC 4ZMAH 3MU0A 1TAWA 1YLDA 1O3PB 4IMZA 4I32A 1OP2A 1A0JA 3SGQE 4IW4E 1NZQH 1EKBB 2TPIZ 1Z8RA 3GY5A 2V0BA 2QAAA 1V2NT 1SGQE 1C2KA 5E0JA 1OSSA 1TX8A 3K6ZA 1HDTH 1V2WT 2ZZUH 2A7JA 4CRAA 4D9QA 1ZHPA 5EPNA 3N7OA 3UNQA 2HRVA 1WCZA 4OS7A 1QRZA 1V2PT 2GDEH 3PTBA 5T3HA 1BUIA 3T27A 4ABAA 1U6QA 2ZC9H 2H1UA 1C1WH 2ZDKA 4X2YA 3DFJA 5FBIA 1ESAA 1ANCA 3GCHB 2ZHFH 1LVYA 1O2VA 2F9NA 3LGVA 3D65E 1W3CA 2BVSH 5DP6A 1BT7A 1FAKH 1MZAA 1BDAA 2RG3A 2BD9A 1QL9A 1YPJH 1C1PA 4B76A 1AZ8A 1P04A 2ZQ2A 1H9LB 2OTVA 1KXBA 4BAOB 5FCKA 2GD4B 2JH6D 4NZQA 1AB9C 2IOTA 1NFWA 2AMPA 4Y11E 2B9LA 5DKMA 3BV9B 1G3DA 2XTTB 3HKJB 4X6NA 1ZRKA 1ZMJA 2O8UA 1OXGA 1BRBE 2YNAA 2FI5E 1F0SA 1RTFB 1BRAA 1C9PA 3A80A 3KN2A 1HJ9A 1GG6B 3ATWA 1GJCB 1O2WA 1GHBF 2SNWA 5HGGA 1S6HA 2LPRA 3E0PB 4ABJA 2NWNA 4OS1A 4KELA 1UTOA 3TH3H 1A2CH 2IJOB 1IQKA 2ZFQH 2BVXH 2VB0A 1KSNA 1SGTA 2TIOA 2TGAA 1THSH 3RC5A 4DW2U 3FANA 4A7IB 3HK6B 2WYJA 1TGSZ 4TWWA 2F9BH 2ZEBA 1QBNA 1O31A 1GJ5H 2UUJB 1CGIE 1OWKA 1W7XH 1C4U2 5A0BA 3GYMA 1EZSC 4DT7B 1GBAA 5CHAC