1O2ZA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2zA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2zA02
1O2YA 1BCUH 2PW8H 2CGAA 1TIOA 1GG6C 1SFQB 5FPYA 4OS1A 1KLIH 1NN6A 3CS7A 1RS0A 1CU1A 3OY5U 4MNYA 5C20A 3URDA 3D49H 5SGAE 4BNRA 3ATMA 3M36A 4CREA 1QB9A 1EZQA 1YPKH 1QJ7B 2F9UA 1NFWA 3ZVBA 1MBQA 1AE8H 2D1JA 3Q00A 1FMGA 4CR9A 2BTCE 2OC7A 3Q3KA 4MNVA 2F9BH 1VJ9U 4I33A 3RXHA 6GCHF 2ZC9H 1ZZZA 2C8YB 2ZQ2A 5GPIB 1GBBA 2Y80A 1W2KH 4TYDA 2H2ZA 1K2I1 2BDGA 4ABHA 2Z7FE 2J92A 4Y8XA 1WUNH 2TRMA 1A5IA 5HXFA 3F9FA 4NFFA 2OC0A 2ZEBA 2JETC 3FZDA 4IMZA 1AZZA 2G8TA 2QIQA 1J14A 3PLKA 3SJIA 5DP3A 4D7GA 4B76A 1Z71A 1T8NA 2AMDA 2H9TH 1E34B 3CS0A 2ZTXA 1EJAA 4A6LA 4JZEH 3TITA 1XXDA 2ZU1A 4ZAEA 1J8AA 1SGFG 2BOKA 2EI7A 1C1PA 1Q31A 2VIVA 1AUTC 1IOEA 4X1PU 4MPVA 2ZU3A 1TNJA 1C1MA 1ELVA 2PKAA 3SJ9A 1P57B 4GPGA 1E36B 2QF3A 1BTZA 1W13U 4X1NU 2TGPZ 1A0LA 1TMTH 1MTWA 1JOUB 1XX9A 2Z3CA 1BB0B 1O3DA 4CRFA 3SQHE 4NA8A 1A3BH 2HALA 2H6MA 2A4RA 1T8OA 1V2NT 3E8LA 4F49A 1MU6B 3BG4B 1Z1IA 1TA2A 4XOJA 3G01A 3PO1B 2J4IA 4YZUA 5EQSA 1IQLA 1GJBB 2ALVA 3U1IB 3RXJA 2F3CE 1O3GA 1OX1A 5DO4H 3T27A 1QCPA 1LPZB 2CV3A 3UQVA 1AUJA 1FI8A 3PO1C 4DG4A 2BD9A 3A8BA 4RSPA 2BX4A 2ZU2A 2HNTC 4YOJA 3L3TA 3JZ1B 1MUEB 2J95A 4K8YA 4K60A 2DUCA 2ZA5A 2ZNKH 3PTNA 1C2GA 1MH0A 2ZECA 2BY9X 2Z6BD 1JIMA 1YCPH 1H4WA 2AERH 2CMYA 1RFNA 2HRVA 4IBLH 4D7FA 1QRWA 2BYAX 1GHYH 1XUFA 1XXFA 3QWCH 2LNCA 1AU8A 3AW1A 3MOCA 3IITA 3LT3A 1LDTT 2VJ1A 1K1NA 3QGJA 1V2LT 1GI8B 2W3KA 3V7TA 2P8OC 1RTFB 1Y5AT 1O3MA 1ZGVA 1BTUA 2G55A 1C2LA 4H42U 3M5LA 3TVJB 3BIUH 3SUEA 1ELEE 4AN7A 5C2ZA 4AORA 2OUAA 1DT2A 1P10A 1SLWB 2A5AA 2WV4A 3DHKH 4ZROA 4NG9H 1ELBA 1P11E 4AZ2B 4E7NA 5HM9A 1AGJA 4B2BA 3EQ0H 1SQOA 4ABAA 4BAOB 1UJ1A 4JYUH 1GBHA 4A1TA 1O0DH 2Z9GA 1DY8A 3SUGA 1L0ZA 4B2AA 1DWDH 1CVWH 2ZDKA 2PSYA 3ZVCA 2I6QA 4CHAB 7GCHG 2SGPE 2ZGCA 4AB8A 1OOKB 1SMFE 2WPLS 1CQQA 3UOUA 3M7UA 2FI5E 4JZDH 1V3XA 2ZCKP 3UPEA 2FOCA 1ZHMA 3NCLA 1O2LA 5C5NA 1TNKA 4WH6A 1Y3XA 1GVLA 4ZKSU 1LHGH 3ZVEA 3ZVDA 5C5OA 1ARBA 2OD3B 1AWHB 1XUJA 5T6FA 4HTCH 5G4BA 1K22H 1RIWB 1YKTA 1O3NA 2BVRH 3AAUA 3ODDA 2ZHDA 1CE5A 1MD7A 1LPKB 3VB5A 1TPPA 1ZTLA 3HPTB 1P03A 2DE9A 2Z3EA 5CHAB 3RDZA 1DXPA 4MVNA 1JRTA 1SG8B 1Y3VA 1S5SA 1BTXA 1HXEH 3K9XB 5FBEA 4X2XA 3P6ZB 3A88A 1GMCG 3A8CA 3SZNA 4NWLA 1FV9A 4FUEA 1GBAA 1C5MD 1P8VC 1SQAA 2ODYB 3MNSA 1B0FA 1GVZA 1ZSJA 3T26A 2P3UB 3CENA 1BRBE 4X8VH 2OLGA 3PMBB 3UFAA 3SJ8A 2PFEA 5EODA 2FX6A 4MTBA 5T6GA 2ZIQH 2AYWA 5A0AE 4YTAA 4UEHH 3BTQE 2QAAA 2QY0B 4AOQA 4ABFA 2CHAB 2PWXA 1O30A 2V3HH 2R2WU 2ZFFH 3QO6A 1YYY1 4QT8C 2B0FA 1D4PB 3KGPA 1O2IA 2FOAA 2F9VA 1QURH 1DUEA 1M9UA 3PV4A 4JZ1A 3ZZ7A 3M35A 1OWDA 4X6NA 1DFPA 1IQJA 1UTMA 3U69H 1T4VH 2QN5T 4Q80A 1YLDA 4FVDA 3RXAA 1QB1A 1QL7A 2VIDA 1CBWC 3BIVH 1GJ5H 1YC0A 4YO9A 4NCYA 2TIOA 3RXBA 2HNTE 4H6SB 3E0NB 1HYLA 1LHCH 5AF9H 2FLBH 1TALA 2XXLA 2TGDA 3VFEA 1C5TA 3BSQA 1TGTA 1QTFA 3MO3A 1SGEE 3UNSA 2GCHG 2G4TA 5ESTE 3RXOA 2FYQA 5E2OA 1LVYA 1UHBA 1YBWA 1KXFA 3SNDA 4I8GA 1UK3A 1C5VA 2G5VA 4ZHMU 1MQ6A 1GJ6A 2AMQA 3GY4A 2LPRA 1HJ8A 2J9NA 2ZTYA 5AHGH 3ZZCA 1W0ZU 7LPRA 3QTOH 4Y0ZE 4GAWA 2W7SA 1EKBB 1YCPK 3BEUA 3HKIB 2R0KA 5C1YA 2VGCC 1DSUA 1G36A 2RA0A 3LJOA 3AASA 1C4Y2 1C1UH 5DP7A 1GMHG 4WJG2 1A4WH 1Y5BT 3TPIZ 1SGNE 1O35A 2A2QH 2FTLE 3UWIA 4B74A 2ILNA 2A0QB 4ABIA 1L1JA 1ZPCA 3BEIB 1F92A 1YLCA 2STBE 1SOTA 3TH3H 8KME2 2XBVA 1NTPA 1DWCH 4AB9A 5LGOA 2H9HA 3TH4H 2V6NA 1CA0B 4ZKOU 1O2RA 3MH6A 3F9EA 1FN6A 3MNCA 1EATA 1K1IA 3SORA 1O3HA 2AGIX 5I25A 3TK9A 4U2WA 3RP2A 2O9QA 3ITIA 2R9PA 5FHTA 2SFAA 3F68H 1QJ1B 4ZKNU 1H9HE 4JCNA 2VU8E 1MKXH 1O3OA 2BLQA 1P06A 1ZTJA 4KP0A 3DA9B 1SGCA 2PUXB 3GICB 5HM2A 4CRGA 1GJDB 4A1XA 2UWOA 3ENSB 1A5HA 5A0BA 1GDNA 2A32A 1TBQH 1KLTA 4U30A 2D26C 1HJAB 4U32A 3DFJA 2GVFA 3M61U 4JK6A 1A46H 1HAGE 3MWIU 2BQWB 1P2IA 5EPYA 1V2MT 2GMTC 2ZKSA 1HAXB 1N6YA 1O32A 1GHAG 5GDSH 5JBCS 3F9HA 1IQFA 1NY22 1GCTC 2FOGA 1C2KA 1IQMA 4WH8A 3B8JA 1OP2A 2WUBA 4TY7A 1NZQH 3R3GB 2Y5FA 3FAOA 3PWBA 1JWTA 4OS4A 1GL1A 1GDUA 1TYNA 1C5XB 4O97A 1O37A 2ZPRA 4DT7B 1W14U 1BMNH 4ZUHA 1W10U 3C27B 2CF8H 1FY3A 2AFQB 3KCGH 2BMGB 4YOIA 1EZUC 2PTNA 4J2YB 1HRTH 1H9LB 1ESAA 2ZU5A 2ANYA 2ULLA 1HAIH 1N1LA 1P09A 1UK4A 4A1VA 1O3BA 5DJ7A 5ETXA 4KTUA 3A83A 1EOLA 2NU0E 2QV1A 4O9VA 3VB3A 2GZ7A 5JYIA 1BIOA 1RD3B 5DP6A 3LIWA 2GCTC 3RXVA 3RC5A 1NPMA 1ZRKA 2RA3A 1HXFH 1DOJA 1EPTA 3V12A 1BDAA 4ISHH 2ZP0H 2ZGXH 2QXHA 4YT6H 4INLA 1FJSA 1GJ4H 2BVXH 3K6YA 3LGYA 1GHWH 3SBKA 1MTUA 3LKWA 1C5WB 1KXCA 1TGCA 2TPIZ 4GSOA 3PMAB 5C1UA 5IYTA 2Z3DA 3A7XA 4GCHF 1PPGE 3CP7A 3SNBA 3KQBA 5E2PA 3LPRA 5JPMH 1KDQB 1BHXB 4YLUA 1KTSB 1QA7A 2OBOA 3EYDA 4DW2U 4CH2B 3BEFB 1A0HB 2ZHFH 1HUTH 4X2YA 1C5QA 4OS2A 4XBCA 3DFLA 3LGTA 6CHAB 2AGGX 4JZIA 2ALPA 1HGTH 4WVPE 1QHRB 7KMEH 3RXRA 2BD3A 4TWYA 1S6FA 1Y3WA 2CJIA 3QGNB 4KKDA 3EDXB 4WXIA 1ELTA 4YT7H 1Y59T 2XC5A 1NFXA 2VWLA 4TY6A 1D6WA 2XC4A 1P3EA 4Y0YE 1SQTA 3NK8A 1QA0A 2Z9LA 1P04A 1WYKA 3F6UH 2PKAB 3DUXH 4K3JA 2CXVA 2Y82A 3A82A 1SHHB 2C3SA 1TPSA 4E7RG 2NU2E 4DCDA 3KHVA 1LHDH 1YM0A 1E0FD 1RRKA 2OP9A 1KIGH 3O8CA 2OCVB 3STIA 3STJA 1CSOE 2BD5A 3RMNH 1BMLA 3O8BA 5CMXH 1PYTC 3K2UA 1HAYB 2GV6A 1W11U 3T5FH 1GBEA 2UUFB 1PFXC 3A7WA 5DP9A 1JXPA 3SO3A 1O2ZA 2A7CA 4AFQA 3A7YA 1LO6A 4THNH 3ZV9A 1TQ0B 1C1RA 3UWJH 2O8UA 1SGYE 4WWYA 1FUJA 4SGBE 3VPKA 3A81A 2FP7B 4JZFH 1AD8H 2GX4A 1V2PT 1O2HA 2BLWA 2VH0A 1Z7KA 2WYJA 1UCYH 1NC6A 1WQSA 2ZF0H 3GCHB 1P2NA 4UDWH 1O3JA 1V2RT 1AB9C 2BY8X 4AFSA 4CBOA 4CRDA 8ESTE 1EP5A 2G52A 4DIIH 4D8NA 5EXNA 1O2JA 4AFUA 3MI4A 4KTSA 3OSYA 2PLXA 3FP7E 2ANWA 2XBXA 2AGEX 2KAIB 2B8OH 1XKAC 4Q2KA 2VWOA 4KTCA 1GBJA 1HPGA 1AN1E 1AIXH 4IMQA 3F9GA 1KXEA 2XBWA 1DPOA 1K28D 1GVKB 1MQ5A 1CHOF 3E0PB 1MBMA 1J9CH 1EQ9A 2FOBA 5FPSA 3TJOA 3BF6H 1SLXB 5FPTA 1T4UH 3EE0B 1GJ7B 3E3TA 2R2MB 1O5EH 1SGTA 4MPUA 2JH6D 1DICA 1C2JA 5K0HA 1Y3UA 1XUIA 4A7IB 3M7TA 1O2TA 1ACBE 3RMMH 4CR5A 2QA9E 4JMYA 1YPGH 2ZHEH 1E35B 1CT2E 5GCHG 4MG3A 1BMAA 3ZVGA 1BBRH 3GOVB 4RKOB 1OSSA 5JB8S 1DDJA 3RXFA 1ZMNA 1P2MA 1AVXA 1LHEH 1UTNA 1IQNA 1BTWA 1XMNB 4Y8ZA 1Z6JH 2J38A 4NA7A 1UTOA 3SV2H 4LK4A 4Q7YA 1SB1H 3TJUA 2W7UA 2OQ5A 1Z8IB 1O34A 3SHCH 1ELFA 1ELGA 2AS9A 1TBRH 3UOPA 3Q77A 3S0NA 3GY5A 1HV7A 1O2KA 2VWMA 4ABJA 5H4IB 4BAHB 5EXLA 3KF2A 2OBQA 2WPJS 1SGIB 1DY9A 1CGHA 3VB6A 1UVPA 3RLWH 1RTLA 1J17T 4NIXA 4MPXA 3OY6U 1QL8A 3JZ2B 3U8RH 3EGKH 1GBMA 5A0CA 3QX5H 3RM0H 1DS2E 4D76A 4NZLA 2A4GA 2ZWLH 4XBBA 1TQ7B 4BXSA 1V2TT 5F03A 1SL3A 1LCYA 3PWCA 3N7OA 1T32A 4CBNA 4FVBA 1ANEA 2C4FH 3DT0H 1MCVA 1WU1A 4E06H 2QC2A 1K21H 1B5GH 1PQ8A 3W94A 5C67A 4FUFA 2BY6X 3KL6A 3QLPH 1JRSA 2YOLA 1BOQA 2C8ZB 2BVSH 2FWWA 1SR5C 4ABDA 3UQOA 1BRUP 1S83A 3QK1A 3TH2H 3QN7A 1LPGB 2ZFRH 3VGCC 2PHBA 1IQKA 3P95A 2UWPA 1THSH 1GI1A 1ZMJA 4NSYA 3RXPA 4BANB 1QB6A 1SPJA 4Y71A 1O2VA 2QXJA 5DK1A 3UNRA 4K69A 5JBBS 1VZQH 1CO7E 2F9PA 1GJAB 3QDZB 1EB1H 3S7HB 3GY2A 1LVBA 1OKXA 4Y79A 1C2EA 1TGBA 3SGBE 3GDSA 1XUHA 5DGJA 4LXBH 1PYTD 4ZMAH 3RC6A 2VVUA 1KSNA 1XM1A 1GL0E 4Y8YA 2BDBA 1FAKH 3VXFH 1SFIA 4CH8B 4MPWA 1GBCA 1BTYA 1DE7H 3GCTF 4Y7AA 4GCHG 3E90B 3LH1A 1XVMA 1AMHA 2R0LA 5JDUB 1YF4A 2VINA 3SV7A 1UTLM 3RXSA 3W95A 1TX6A 4IN1A 3RXQA 3A87A 1YPHC 5TCAA 3Q3XA 3T62A 1EUFA 1TPAE 1TNHA 4ZHAA 4Y7BA 4ZXYH 2R3UA 1QFKH 1O3KA 4U01A 2Q1JA 2VVVA 1ZOMA 2ZFSA 3BTHE 1LQEA 3SU5A 3A7TA 1AVGH 1P02A 3GY8A 1FQ3A 1P01A 1UTQA 1GHZA 1HNEE 2Z9JA 4O03A 1MKWK 1QBNA 1AWFH 3UUZA 3ZZ5A 3A7ZA 1GI5A 4AFZA 1YPMH 4NZQA 4B75A 1EAIA 4OS7A 1OWKA 4ABEA 3BTKE 1MKWH 2C8XB 4ESTE 4ISIH 3KQDA 1F7ZA 1JIRA 1FN8A 2SNWA 1RIWC 4O3TA 5T6DA 1WOFA 1OP0A 2ZHWH 1EPTB 3BTGE 1A5GH 1EJMA 2FI4E 2OC8A 3PROA 3KEEA 1E38B 2FESH 1F0RA 2H5DA 4J1YA 1CT4E 1DLEA 1VGCC 1EOJA 5AVDA 3V0XA 4DJZB 4IGDA 1VCWA 3U8OH 3VGCB 5BPEA 1ESBA 3HK3B 3QTVH 2B9LA 1QQ4A 1AHTH 2C90B 4F4OC 3GCTG 2FS9A 5B6OA 2XWAA 4UONA 1J16A 1V6DA 1MU8B 3GCNA 3UIRA 4NIWA 8LPRA 1O5CB 4YESB 5DP4A 2OINA 1BZXE 3BTDE 1K1MA 3TNTA 2HGTH 4I8HA 5LPEA 4X2WA 1WTHD 4I8KA 4I7YH 1V2VT 1SSXA 1W0YH 4OS6A 3LC3A 1SGFA 4FXGH 2O8WA 1FONA 2BB4A 1C9TA 1GI4A 3SV9A 3M5OA 4NSVA 1SVPA 3KN2A 2A2XH 3R0FA 1AKSA 3MO9A 2ZPQA 4UFGH 3P8GA 4XE4A 1MD8A 5HYOA 1BJUA 1DWBH 3SV6A 1YCPM 2NU4E 1C5NH 2BZ6H 3KQCA 1T31A 1G37A 4NGAH 1F5KU 2BDIA 4PROA 3AW0A 2FPZA 2VH6A 2GZ9A 1UO6A 4VGCC 1OWIA 3VEQB 2CHAC 1GBDA 1J15A 1HAVA 2P93A 3F1SB 2PR3A 3O8DA 1NROH 4BOHA 3D23A 1EX3A 1NRPH 1GHBF 2O8MA 3GYLB 2BXUH 4X0WU 2THFB 2BX3A 2GCHF 2YNBA 2FDAA 1RGQA 4NA9H 5GJ4B 1ELDE 3RXLA 1HBTH 3IWMA 2Y6TA 1SGRE 3E91A 4Y76A 2IJOB 3RMLH 3U98H 1EJNA 1YGCH 4WMDA 4B71A 2A7JA 2TGTA 1BRCE 3ZZ4A 2EC9H 2GT7A 1UVUH 3RXMA 1ZTKA 3MH5A 3TK6A 3SGAE 4BAKB 1LVMA 5FCRA 2SGFE 1YPHE 2XNIA 1DSTA 4TPYA 2PTCE 3MNXA 1GBLA 1FPHH 2VIWA 1HAOH 3PB1E 2XC0A 3IG6B 3KIDU 1O2SA 1T7CA 3V13A 1QRXA 2ZDLA 5L2YH 1GMHF 1P2JA 1SLVB 1K1OA 2F9NA 1BITA 2SGQE 3PLPA 3BTWE 1O5GH 4DIHH 3ZYDA 6LPRA 2QXGA 1VR1H 2GDEH 4K2YA 2VGCB 3ATIA 1ORFA 1XUGA 1KLJH 1IQIA 1UTPA 1KYNA 4RN6A 2ZFPH 4BXWA 5DG6A 1GI9B 3BTFE 1FPCH 1NU7B 4X8TH 3WY8A 3M5MA 1WBGB 1GI0A 1V2QT 1ZPBA 1IQGA 2A7HA 2ZFQH 4BAMB 3SN8A 3MTYA 3PLBA 3MU4A 3TJVA 1ANDA 4TPIZ 3PYHA 1LTOA 3I78A 1ZSLA 2HNTF 1TWXB 1H1BA 4R0IA 1GHXH 1RXPA 2O8TA 2NU1E 1FLEE 1HJAC 5FX6A 5TCCA 4INKA 4MNWA 2KAIA 2BZAA 3ZZ9A 3SHAH 1SOZA 1C1VH 4B1TA 1ELAA 1Z8RA 1GI7B 1TPOA 2TBSA 4X2VA 5LPRA 1VITG 3UNQA 1JMOH 4K1SA 1Q2WA 2H1UA 5A8XA 1F0TA 5K7RA 5I46H 4I31A 1P9UA 3SU4A 1AFEH 3S69A 1EAWA 1N6XA 2ZDMA 1AFQC 1GMCF 2BDAA 1KTTB 4O3UA 5GIBA 4JYTA 1EB2A 2BHGA 9ESTA 3MNBA 1O31A 5DPAA 3MU5A 1S0RA 2FYRA 4K1TA 3SW2B 2OXSA 3FP8E 2AIQA 2GCTB 3RMOH 3SQEE 2VIQA 4NIYA 4VGCB 2XW9A 2H5CA 4XDEA 4ZXXH 1NESE 1A2CH 2F9OA 6GCHG 1ZHPA 3SOSA 3P8FA 1FY5A 1O2XA 2W5EA 3ZZ8A 1D3TB 2M5TA 1NRRH 2FOHA 5A09A 3RUOA 4B2CA 3SV8A 1HCGA 1G3EA 1EASA 4B73A 1YPEH 3BTEE 2JH5D 2OQUA 1ETTH 3LGWA 1INCA 2BLVA 3OU0A 3FANA 4H4FA 2ZO3H 3MO6A 3S9AA 2PV9B 2BOHB 2W3IA 1O39A 3QUMP 3TK5A 1FZZA 3GDVA 4X6MA 2AIPA 2ZCLP 3HATH 4AGJA 3FVFB 5JBTA 4JYVH 1ZMLA 1OWEA 4Q7XA 1KXDA 3FP6E 3UR9A 1ETRH 2AEIH 5TJXA 4DURA 1IHTH 2WPIS 4XSKU 2FODA 5J4SA 3NWUA 4DY7B 1LQDB 1K1PA 2PUQH 4BTUB 1Z6EA 4I32A 2WYGA 1O2MA 1QBOA 3SU6A 3AAVA 1P2OA 1O2OA 3SI4H 1O38A 3V3MA 5ESBA 1TGSZ 2A31A 5EU8A 2EI8A 1GHBG 1V2KT 4ABBA 3ESTA 1MTNC 3TJNA 5IDKA 2SGAA 4INHA 1EPTC 2BY7X 4UFFH 2DE8A 3D65E 3P70B 3MFJA 3A85A 3KNXA 1ETSH 2VNTA 1OS8A 1C2HA 1QBVH 1VITH 1AZ8A 1MCTA 1BRAA 2JKHA 1DUAA 1GJCB 2BDCA 2WINI 1S0QA 1CA8B 1TRMA 1QIXB 1WQVH 1C5LH 2F91A 3GISB 2FIRH 1LKAA 1TB6H 3NKKA 2FMJA 4GLYA 5DP5A 1W7XH 4CRAA 3ATWA 1THRH 2IN2A 8GCHG 2EI6A 1O3AA 1MMJN 5HGGA 2H9EH 1MZAA 1ELCA 1G2MA 3BTTE 3RXEA 3A84A 2BD4A 1G3CA 1DX5M 3Q76A 1T8LA 1PPBH 1ZYOA 2UUKB 2XWBI 1XUKA 1NRQH 4Y10E 1ABJH 4X6PA 3P8OA 3H7OA 2QYIA 3RU4E 2C93B 1DITH 4MNXA 1N8OC 1V2OT 3LDXH 1GHVH 3ZV8A 1AFQB 1L2EA 3SUFA 3HK6B 1SLUB 2J34A 1CHGA 4X8SH 2HPQH 2HOBA 1C9PA 1TONA 4OGXA 1MKXK 3LU9B 2ZU4A 1GMDG 3UTUH 1TAWA 1F0SA 1Z1JA 3TGIE 1GPZA 1C5YB 1C1TA 3RM2H 4AGKA 2QXIA 1TMBH 2ANMH 1UVTH 1VJAU 1D6RA 1WSSH 2PKSB 5BRRE 2GMTB 1IHSH 2G81E 4YLQH 1NO9H 1EXFA 1SBWA 1C4V2 1KDQA 4WMFA 5A8ZA 2XRCA 2QF0A 3UY9A 3LONA 1OWJA 2B7DH 2J2UA 4R8TB 3A80A 1V2ST 3SU1A 1WAYB 1N8OB 1QGFA 4UE7H 4KGAA 5GWZA 5L2ZH 1P3CA 3GDUA 5PTPA 1ARCA 2F83A 2WV5A 2ZGJA 3A86A 3K6ZA 1V2JT 1W7GH 1QL9A 3BG8A 8GCHF 4IC6A 1TRYA 5FX5A 3LJJA 1GBIA 3P92A 2FM2A 1UCYK 1PPZA 4ISLA 1MTNB 2FOEA 1GGDB 4X1QU 2BDYA 3SI3H 1WCZA 1C5OH 1FIZA 3E6PH 1HLTH 3SGQE 5A2MH 1C5ZB 1K9OE 3SJKA 1NM6A 1ANBA 2PSXA 2Y5GA 1O3PB 1GI3A 1C5SA 2GGVB 4IN2A 4CRCA 3MU0A 1AO5A 1LHFH 1NRNH 2P94A 2ZI2H 3B9FH 4I8LA 2P8OB 4WY3A 1HB0B 5AFZH 2ZPSA 5LPFA 1S82A 2Y81A 3ATLA 5FCKA 4YM9A 2WPMS 2Y5HA 3VB7A 1T8MA 3RXDA 4LZ4B 2V3OH 3RU4T 3SNAA 5EG4A 2V35A 2OC1A 1H8DH 1ZR0A 1KY9A 3HGNA 5CHAC 4AG1A 4IW4E 3M3SA 2ESTE 1O2GH 4FUGA 2Z9KA 3PMHB 4KELA 1ZGIA 3U8TH 4I8JA 4ZH8A 1L1GA 1TA6A 5JB9S 3SU0A 1TBZH 2GTBA 4HFPB 3RXKA 1BJVA 1C2FA 1ANCA 3UREA 1GWAA 3LGIA 1GCTB 1A7SA 3RLYH 3SNCA 3M37A 3PMJA 3RXTA 4WF8A 3EA9A 2GV7A 1G32B 1UTKA 1ZJDA 3RU4D 2GDDA 1ZHRA 4FUJA 1G30B 2GP9B 2ZCHP 2BD7A 1ZLRA 3ZZDA 4AX9H 1O3EA 3TIUA 2V0BA 1FXYA 7GCHF 4GVUA 1SGPE 1Z8JB 2SNVA 3H5CB 1O3FA 2FX4A 4Q7ZA 1O3CA 1C2MA 2HPPH 2Q6FA 2ZTZA 1BHXF 2VB0A 1BQYA 1O2NA 1WV7H 1G2LA 4FU8A 1Y5UT 3FZZA 1CGIE 2ZG0H 4WXVA 1GBFA 1HAHH 2Z9IA 3EA8A 3ZYEA 1OYQA 4IC5A 1YPJH 5EXMA 1UK2A 3LGUA 4X6OA 1O3IA 1Z8GA 4NWKA 3UR6A 1O5DH 5FBIA 1UCYE 2P16A 1BTHH 3GCHC 2WPKS 4K8BA 7ESTE 1ESTA 1X7AC 5L30H 2FO9A 1C4U2 2EA3A 1C5UA 1IAUA 2FTMA 1GGDC 3S9BA 1U6QA 3M3TA 1DANH 2BQ7B 3EA7A 3BV9B 2ZQ1A 2Q6GA 1P2QA 1F2SE 1GBTA 3TLOA 1MAXA 1O5FH 1P0SH 1FY1A 5HMAA 2HVXA 1H9IE 1W8BH 5E0GA 3MU1A 2W26A 1O5AB 4FUHA 2O8LA 1TFXA 3U9AH 1HAVB 5F8TA 1VCPA 3T29A 5L6NH 3LGVA 1VCQA 4ISOA 4DVAU 1DWEH 1GMDF 2NU3E 1SI5H 4AYVB 3ZVAA 3ZZAA 1HIAA 1OWHA 2D8WA 5DKMA 1O36A 2ZHQH 4JK5A 1FIWA 3C1KA 2PGBB 2P3FH 4DGJA 1S84A 4HI3A 1GDQA 3A7VA 2ZGBH 9LPRA 1C2DA 3ZZ6A 3P17H 3T28A 3U1JB 2Z94A 1G3DA 1GG6B 4FUDA 1AY6H 4BAQB 1IQEA 2TGAA 1E37B 2G4UA 3TGJE 1C1QA 1D9IA 2AH4X 2WUCA 3BTME 4FUBA 5A8YA 4MLFB 1TGNA 2STAE 5EQRA 1L1NA 3QZQA 5C3NA 3M5NA 1CHOG 1CA0C 5EGMA 5ABWA 4AYYB 1TE0A 2BY5X 1H8IH 1F0UA 1BBRK 2VWNA 1YP9A 2FI3E 4Y11E 2YNAA 3A8DA 1C5PA 1TLDA 2A5IA 4LOYH 2G5NA 2UUJB 3ELAH 2BQ6B 3SNEA 2ASUB 1S81A 1BA8B 1TRNA 2FLRH 1RJXB 1C1WH 2Y7ZA 1TX7A 5FAHA 4CHAC 2CN0H 2HLCA 2G51A 3NZIA 1B0EA 6CHAC 1IQHA 1S85A 1D3PB 5LH8A 1A0JA 5GXPA 2B5TB 4D9QA 4BTTB 2QGRA 3D62A 1GI6A 2UWLA 1V2WT 4Z6AH 3RC4A 1W3CA 2C8WB 3RXIA 3ZZBA 1AE5A 1HFDA 1KXBA 2BLOA 3Q3YA 2EEKA 3SUDA 5E0JA 4OS5A 2ZZUH 2A4QA 2Y7XA 2CF9H 1O2QA 1QY6A 1KXAA 4BTIB 6ESTA 2JETB 2J94A 1PPFE 2SGEE 2VIOA 4WMEA 1O2WA 1O5BB 1OPHB 2NWNA 5J4QA 3L6PA 5EOKA 2FOFA 1QR3E 1D3QB 1W12U 3ZZ3A 1SHYA 1PQ7A 2RCEA 4CRBA 3NPSA 4D9RA 2BD8A 3S9CA 1SC8U 5F8ZA 1UHBB 1DXWA 5FXLA 3A8AA 4M7GA 1P2KA 3NXPA 4GUXA 5EW1H 1G3BA 1HAZB 2AMPA 1GJ9B 1UVSH 3I29A 3BN9A 1BMMH 3OTJE 1VGCB 3K65B 4K5ZA 1ZJKA 1ZRBA 5T3HA 2PKSC 4A92A 2G00A 4UFDH 1K1JA 3MU8A 1DLKB 1GI2A 1NFYA 1BTPA 4ISNA 2BXTH 1UMAH 1ABIH 1ZSKA 2JH0D 1OXGA 3LOXA 4GHTA 2VIPA 1THPB 2A1DB 1FAXA 1PQ5A 3P8NA 1F5RA 3HGPA 2GD4B 3OX7U 3TGKE 2ODQA 3MMGA 4YOGA 4AG2A 2BD2A 1MAYA 3GY6A 4IS5A 2FZZA 3E16B 4OGYA 2RDLA 2ANKH 1HIAB 1C1OA 5F8XA 1DM4B 3MH7A 1GHAF 4Z0KA 1TNGA 1DVAH 2GKVE 3URCA 1K1LA 1FY4A 3M3VA 4FU9A 1A3EH 3T2NA 1BBRE 2FXRA 5JBAS 2I6SA 1AQ7A 2P3TB 1NRSH 3SJOA 4NIVA 1O2PA 2FS8A 1EZSC 1S6HA 4FU7A 2FOMB 1FDPA 1SGDE 1JBUH 5F6MA 1C2IA 2GZ8A 3NUMA 3T25A 1QNJA 3PTBA 4MDSA 4HGCA 1TOMH 1MTSA 2P59A 2A4OA 1PPEE 4X1SU 1OP8A 1UVOA 4FUIA 1CGJE 2OTVA 3SU3A 2D2DA 5EQQA 1O33A 3H7TA 2XCNA 1V2UT 3OYPA 3VXEH 2A45B 4XFQA 1P05A 2XCFA 3GY7A 1Y8TA 3ZVFA 1L4DA 1Y3YA 4X1RU 1TNIA 2PGQB 1B7XB 3VB4A 1XKBC 1MTVA 2ZDVH 5EW2H 3RXGA 2A5KA 1QQUA 1XVOA 3GYMA 1LVOA 1C1NA 1A61H 4ZHLU 1ZPZA 1GBKA 3LH3A 2ODPA 1L4ZA 1TX8A 5C1XA 3KQEA 2VVCA 1RTKA 1SGQE 5E8EH 4Y6DA 2IOTA 1EAUA 1UTJA 1AI8H 3LC5A 1GCDA 1P12E 2R3YA 3QZRA 1QRZA 2FEQH 4XBDA 3I77A 2WPHS 4MQAA 4HZHA 2ZFTA 4ASHA 1HAPH 1LKBA 3ATKA 2BM2A 1WTGH 3BG4C 2ZDNA 3RXUA 4ABGA 3GY3A 2QCYA 5E0HA 3S7KB 1C1SA 3MHWU 4FUCA 2HWLB 2UUYA 3SU2A 1AVWA 4H6TA 4A5TS 2GT8A 3MH4A 1C5RA 4UFEH 1HDTH 1BT7A 2P95A 3O8RA 1BUIA 3GCOA 3M7QA 4GHQA 5EPNA 1F5LA 1YPLH 4ZKRU 1P9SA 1QJ6B 1TMUH 1ID5H 1GJ8B 1TNLA 3HKJB 1TOCB 1NU9A 3FFGA 2RG3A 3L33A 1PPHE 2BDHA 3DD2H 3PM3A 1Q3XA 2XBYA 1PPCE 5CE1A 2XTTB 1EP6A 2ZGHA 5GCHF 1FNIA 3MYWA 3ODFA 1CBWB 1D3DB 1EAXA 2XYAA 1OYTH 2Q6DA 3TU7H 1EZXC 2SGDE 4NFEA 4LZ1H 4DOQA 4E05H 1CT0E 4K1EA 3AVZA 4TWWA 4X8UH 1MZDA 1NT1A 5DP8A 1O3LA 1NS3A 1G9IE 5AFYH 2IPHA 2K1QA 3B23B 3EAJA 1TABE 3RXCA 4UD9H 4RKJB 1AB9B 3TNSA 1FY8E 1LMWB 1A1RA 3E1XB 1O2UA 1VITF 1PJPA 3A89A 2ZDAH 1AKSB 1NFUA 1HJ9A 1PQAA 4SGAE
chains in the Genus database with same CATH superfamily
1O2YA 1BCUH 2PW8H 2CGAA 1TIOA 1GG6C 1SFQB 5FPYA 4OS1A 1KLIH 1NN6A 3CS7A 1RS0A 1CU1A 3OY5U 4MNYA 5C20A 3URDA 3D49H 5SGAE 4BNRA 3ATMA 3M36A 4CREA 1QB9A 1EZQA 1YPKH 1QJ7B 2RDEA 2F9UA 3DSGA 1NFWA 3ZVBA 1MBQA 1AE8H 2D1JA 3Q00A 1FMGA 4CR9A 2BTCE 2OC7A 3Q3KA 4MNVA 2F9BH 1VJ9U 4I33A 3RXHA 6GCHF 2M2AA 2ZC9H 2WSSD 3WW7A 1ZZZA 4Q4LA 2C8YB 2ZQ2A 5GPIB 1GBBA 2Y80A 1YLNA 1W2KH 4TYDA 2H2ZA 1K2I1 2BDGA 4ABHA 2Z7FE 2J92A 4Y8XA 1WUNH 2TRMA 1A5IA 5HXFA 3F9FA 4NFFA 2OC0A 2ZEBA 2JETC 3FZDA 2WV9A 1AZZA 4IMZA 2G8TA 2QIQA 1J14A 3U28C 1NBMD 3PLKA 3SJIA 5DP3A 4D7GA 4B76A 5C0UA 1Z71A 1T8NA 2AMDA 4B6EA 2H9TH 1E34B 3CS0A 2ZTXA 1EJAA 4A6LA 4JZEH 3TITA 1XXDA 2ZU1A 4ZAEA 1J8AA 1SGFG 2BOKA 2EI7A 1NBME 1C1PA 1Q31A 2VIVA 1AUTC 1IOEA 4X1PU 2WHXA 4MPVA 2ZU3A 1TNJA 1C1MA 1ELVA 2PKAA 3SJ9A 1P57B 4GPGA 1E36B 2QF3A 1BTZA 1W13U 1W0JD 4X1NU 2TGPZ 4Q63A 1A0LA 1TMTH 2KFWA 1MTWA 1JOUB 1XX9A 3WWBA 2Z3CA 1BB0B 1O3DA 4CRFA 3SQHE 4NA8A 1A3BH 2HALA 2H6MA 2A4RA 1T8OA 1V2NT 3E8LA 4F49A 1MU6B 3BG4B 1Z1IA 1TA2A 4XOJA 3G01A 3PO1B 2J4IA 4YZUA 5EQSA 4XRNA 1IQLA 1GJBB 2ALVA 3OEED 3U1IB 3RXJA 2F3CE 1O3GA 1OX1A 5DO4H 3T27A 1QCPA 1LPZB 2CV3A 3UQVA 1AUJA 1FI8A 3PO1C 4DG4A 2BD9A 3A8BA 4RSPA 2BX4A 2ZU2A 2HNTC 4YOJA 3L3TA 3JZ1B 1MUEB 2J95A 4K8YA 4K60A 2GJGA 2DUCA 2ZA5A 2ZNKH 3PTNA 1C2GA 1MH0A 2ZECA 2BY9X 2Z6BD 1JIMA 1YCPH 1H4WA 2AERH 2CMYA 1RFNA 2HRVA 4IBLH 4D7FA 1QRWA 2BYAX 1GHYH 4M9FA 1XUFA 1XXFA 3QWCH 2LNCA 1AU8A 3AW1A 3MOCA 3IITA 5F53A 3LT3A 1LDTT 2VJ1A 1K1NA 3QGJA 1V2LT 1GI8B 2W3KA 3V7TA 2P8OC 1RTFB 1Y5AT 1O3MA 1ZGVA 1BTUA 2G55A 1C2LA 2YMSD 4H42U 3M5LA 3TVJB 3BIUH 3SUEA 1ELEE 4AN7A 5C2ZA 4AORA 2OUAA 1DT2A 1P10A 1SLWB 2A5AA 2WV4A 3DHKH 4ZROA 4NG9H 1ELBA 1P11E 4AZ2B 4E7NA 5HM9A 1AGJA 4B2BA 3EQ0H 1SQOA 4ABAA 2CK3D 4BAOB 1UJ1A 4JYUH 1GBHA 4A1TA 1O0DH 2Z9GA 1DY8A 3SUGA 1L0ZA 4B2AA 1DWDH 1CVWH 2ZDKA 2PSYA 3ZVCA 2I6QA 4CHAB 7GCHG 5KGOA 2SGPE 2ZGCA 4AB8A 1OOKB 1SMFE 2WPLS 1CQQA 3UOUA 3M7UA 2FI5E 4JZDH 1V3XA 2ZCKP 3UPEA 2FOCA 1ZHMA 3NCLA 1O2LA 5C5NA 1TNKA 4WH6A 1Y3XA 1GVLA 4ZKSU 1LHGH 3ZVEA 3ZVDA 5C5OA 1ARBA 2OD3B 1AWHB 1XUJA 4RI0A 5T6FA 4HTCH 5G4BA 1K22H 1RIWB 1YKTA 1O3NA 3MQKC 2BVRH 3AAUA 3ODDA 2ZHDA 1CE5A 1MD7A 1LPKB 3VB5A 1TPPA 1ZTLA 3HPTB 1P03A 2DE9A 2Z3EA 5CHAB 3RDZA 1DXPA 4MVNA 1JRTA 1SG8B 1Y3VA 1S5SA 1BTXA 1HXEH 3K9XB 5FBEA 4X2XA 3P6ZB 3A88A 1GMCG 3A8CA 3SZNA 4NWLA 1FV9A 4FUEA 1GBAA 1C5MD 1P8VC 2JJ1D 1SQAA 2ODYB 3MNSA 1B0FA 1GVZA 1ZSJA 3T26A 2P3UB 3CENA 1BRBE 4X8VH 2OLGA 3PMBB 3UFAA 3SJ8A 2PFEA 5EODA 2FX6A 4MTBA 5T6GA 2ZIQH 2AYWA 5A0AE 4YTAA 4UEHH 3BTQE 4ACAA 2QAAA 2QY0B 4AOQA 4ABFA 2CHAB 2V3MA 2PWXA 1O30A 2V3HH 2R2WU 2ZFFH 3QO6A 1YYY1 4QT8C 2B0FA 1D4PB 3KGPA 1O2IA 2FOAA 2F9VA 1QURH 1DUEA 1M9UA 3PV4A 4JZ1A 3ZZ7A 3M35A 1OWDA 4X6NA 1DFPA 1IQJA 1UTMA 3U69H 1T4VH 2QN5T 4Q80A 1YLDA 4FVDA 3RXAA 1QB1A 1QL7A 4AC9A 2VIDA 1CBWC 3BIVH 1GJ5H 1YC0A 4YO9A 4NCYA 2TIOA 3RXBA 2HNTE 4H6SB 3E0NB 1HYLA 1LHCH 3VG8A 5AF9H 2FLBH 1TALA 2XXLA 2TGDA 3VFEA 1C5TA 3BSQA 1TGTA 1QTFA 3MO3A 1SGEE 5HIYA 3UNSA 2GCHG 2G4TA 5ESTE 3RXOA 2FYQA 5E2OA 1LVYA 4YXWD 1UHBA 1YBWA 2W6JD 1KXFA 3SNDA 4I8GA 1UK3A 1C5VA 2G5VA 4ZHMU 1QZ8A 1MQ6A 1GJ6A 2AMQA 3GY4A 2LPRA 1HJ8A 2J9NA 2ZTYA 5AHGH 3ZZCA 1W0ZU 7LPRA 3QTOH 4Y0ZE 4GAWA 2W7SA 1EKBB 1YCPK 3BEUA 3HKIB 2R0KA 5C1YA 2VGCC 1DSUA 1G36A 2RA0A 3LJOA 3AASA 1C4Y2 1C1UH 5DP7A 1GMHG 4WJG2 1A4WH 1Y5BT 3TPIZ 2VBCA 1SGNE 1O35A 2A2QH 2FTLE 3UWIA 4B74A 2ILNA 2A0QB 4ABIA 1L1JA 3AK5A 1ZPCA 3BEIB 1F92A 1YLCA 2STBE 1SOTA 3TH3H 8KME2 2K8IA 2XBVA 1NTPA 1DWCH 4AB9A 5LGOA 1MABB 2H9HA 3TH4H 2V6NA 1CA0B 4ZKOU 1O2RA 3MH6A 3F9EA 1FN6A 3MNCA 1EATA 3NRLA 1K1IA 3SORA 1O3HA 2AGIX 5I25A 3TK9A 4U2WA 3RP2A 2O9QA 5C17A 3ITIA 2R9PA 5FHTA 2SFAA 3F68H 1QJ1B 4ZKNU 1H9HE 4JCNA 2VU8E 1MKXH 1O3OA 2BLQA 1P06A 1ZTJA 4KP0A 3DA9B 1SGCA 2KX4A 2QF4A 2PUXB 3GICB 5HM2A 1E1RD 1GJDB 4CRGA 4A1XA 2UWOA 3ENSB 1A5HA 5A0BA 1GDNA 2A32A 1TBQH 1KLTA 3W1EA 4U30A 2D26C 1HJAB 4U32A 3DFJA 2GVFA 3M61U 4JK6A 1A46H 1HAGE 3MWIU 2BQWB 1P2IA 5EPYA 1V2MT 2GMTC 2ZKSA 1HAXB 1N6YA 1O32A 1GHAG 5GDSH 5JBCS 3F9HA 1IQFA 1NY22 2KZ4A 1GCTC 2FOGA 1C2KA 1IQMA 4WH8A 5EJLA 3B8JA 1OP2A 2WUBA 4TY7A 1NZQH 1VKYA 3R3GB 2Y5FA 3FAOA 3PWBA 1JWTA 4OS4A 1GL1A 1GDUA 1TYNA 1C5XB 4O97A 1O37A 2ZPRA 4DT7B 1W14U 1BMNH 4ZUHA 1W10U 3C27B 2CF8H 1FY3A 2AFQB 3KCGH 2BMGB 4YOIA 1EZUC 2PTNA 4J2YB 1HRTH 1H9LB 1ESAA 2ZU5A 2ANYA 2ULLA 1HAIH 1N1LA 1P09A 3FKSD 1UK4A 4A1VA 1O3BA 5DJ7A 5ETXA 4KTUA 5GNDA 3A83A 1EOLA 2NU0E 2QV1A 4O9VA 3OEHD 3VB3A 2GZ7A 5JYIA 3KQ5A 1BIOA 1RD3B 5DP6A 3LIWA 2GCTC 3RXVA 3RC5A 1NPMA 1ZRKA 2RA3A 1HXFH 1DOJA 1EPTA 3V12A 1BDAA 4ISHH 2WPDD 2ZP0H 2EQNA 2ZGXH 2QXHA 4YT6H 4ACBA 4INLA 1FJSA 1GJ4H 2BVXH 3OFND 3K6YA 3LGYA 1GHWH 3SBKA 1MTUA 3LKWA 1C5WB 1KXCA 1TGCA 2TPIZ 4GSOA 3PMAB 5C1UA 5IYTA 2Z3DA 3A7XA 4GCHF 1PPGE 3CP7A 3SNBA 3KQBA 5E2PA 4F55A 3LPRA 5JPMH 1KDQB 1BHXB 4YLUA 1KTSB 1QA7A 2OBOA 3EYDA 4DW2U 4CH2B 3BEFB 1A0HB 2ZHFH 1HUTH 1SQRA 4X2YA 1C5QA 4OS2A 4XBCA 4TSFD 3DFLA 3LGTA 6CHAB 2LELA 2AGGX 4JZIA 2ALPA 1HGTH 3KYGA 4WVPE 1QHRB 7KMEH 2J98A 3RXRA 2BD3A 4TWYA 1S6FA 1Y3WA 2CJIA 3QGNB 4KKDA 3EDXB 4WXIA 1ELTA 1E1QD 4YT7H 1Y59T 2XC5A 1NFXA 2VWLA 4TY6A 1D6WA 1P3EA 2XC4A 4Y0YE 1SQTA 3NK8A 1QA0A 2Z9LA 1P04A 1WYKA 3F6UH 2PKAB 3DUXH 4K3JA 4P02A 2CXVA 2Y82A 3A82A 1SHHB 2C3SA 1TPSA 4E7RG 2NU2E 4DCDA 5DSFA 3KHVA 1LHDH 3FOAA 1YM0A 5C0TA 1E0FD 1RRKA 2OP9A 1KIGH 3O8CA 2OCVB 3STIA 3STJA 1CSOE 2BD5A 3RMNH 1BMLA 3O8BA 5CMXH 1PYTC 3K2UA 1HAYB 2GV6A 1W11U 3T5FH 1GBEA 2UUFB 1PFXC 3A7WA 5DP9A 1JXPA 3SO3A 1O2ZA 2A7CA 4AFQA 3A7YA 1LO6A 4THNH 3ZV9A 1TQ0B 1C1RA 3UWJH 2O8UA 1SGYE 3PRDA 1FUJA 4WWYA 4SGBE 3VPKA 3A81A 2FP7B 4JZFH 1AD8H 2GX4A 2L6OA 1V2PT 1O2HA 2BLWA 2VH0A 1Z7KA 2WYJA 1UCYH 3F2HA 4OM9A 1NC6A 1WQSA 2ZF0H 3GCHB 1P2NA 4UDWH 1O3JA 4RT0A 1V2RT 1AB9C 2BY8X 4AFSA 4CBOA 4CRDA 8ESTE 1EP5A 2G52A 2KCYA 4D8NA 4DIIH 4I86A 5EXNA 1O2JA 4AFUA 3MI4A 4KTSA 1E79D 3OSYA 2PLXA 3FP7E 2ANWA 2XBXA 2AGEX 2KAIB 2B8OH 1XKAC 4Q2KA 2VWOA 4KTCA 1GBJA 1HPGA 1AN1E 1AIXH 3F2FA 3N7EA 4IMQA 3F9GA 1KXEA 2XBWA 1DPOA 1K28D 1GVKB 1MQ5A 1CHOF 3E0PB 1MBMA 1J9CH 1EQ9A 2FOBA 5FPSA 2PP6A 3TJOA 3F3BA 3BF6H 1SLXB 5FPTA 1T4UH 3EE0B 1GJ7B 3E3TA 2R2MB 1O5EH 1SGTA 4MPUA 2JH6D 1DICA 1C2JA 5K0HA 1Y3UA 2F4LA 1XUIA 4A7IB 3OE7D 3M7TA 1O2TA 1ACBE 3RMMH 4CR5A 2QA9E 4JMYA 1YPGH 2ZHEH 3EE7A 3PRBA 1E35B 1CT2E 5B6LA 5GCHG 4MG3A 1BMAA 3ZVGA 1BBRH 3GOVB 4RKOB 1OSSA 5JB8S 1DDJA 3RXFA 1ZMNA 3F0PA 1P2MA 1AVXA 1LHEH 1UTNA 1IQNA 1BTWA 1XMNB 4Y8ZA 1Z6JH 2J38A 4NA7A 1UTOA 3SV2H 3N7DA 4LK4A 4Q7YA 1SB1H 3TJUA 2W7UA 2OQ5A 1Z8IB 1O34A 3SHCH 1ELFA 1ELGA 2AS9A 1TBRH 3UOPA 3Q77A 3S0NA 3GY5A 1HV7A 1O2KA 2VWMA 4ABJA 5H4IB 4BAHB 5EXLA 3KF2A 2OBQA 2WPJS 1SGIB 1DY9A 1CGHA 3VB6A 1UVPA 3RLWH 1RTLA 1J17T 4NIXA 4MPXA 3OY6U 1QL8A 3JZ2B 3U8RH 3EGKH 1GBMA 5A0CA 3QX5H 3RM0H 1DS2E 4D76A 4NZLA 2A4GA 2ZWLH 4XBBA 1FX0B 1TQ7B 1V2TT 4BXSA 1WXRA 5F03A 1SL3A 1LCYA 3PWCA 3N7OA 1T32A 4FETA 4CBNA 4FVBA 1ANEA 2C4FH 3DT0H 1MCVA 1WU1A 4E06H 2QC2A 1K21H 1B5GH 1PQ8A 3W94A 5C67A 4FUFA 2BY6X 3KL6A 3QLPH 1JRSA 2YOLA 1BOQA 1H8ED 2C8ZB 2BVSH 2FWWA 5KECA 1SR5C 4ABDA 3UQOA 1BRUP 1S83A 3QK1A 3TH2H 3QN7A 1LPGB 2ZFRH 3VGCC 2PHBA 1IQKA 3P95A 2UWPA 1THSH 1GI1A 1ZMJA 4NSYA 3RXPA 4BANB 1QB6A 1SPJA 4Y71A 1O2VA 2QXJA 5DK1A 3UNRA 4K69A 5JBBS 1VZQH 1CO7E 2EY4C 2F9PA 1GJAB 3QDZB 1EB1H 3S7HB 3GY2A 2IPQX 1LVBA 1OKXA 4Y79A 1C2EA 1TGBA 3SGBE 3GDSA 1XUHA 5DGJA 4LXBH 1PYTD 4ZMAH 3RC6A 2VVUA 1KSNA 1XM1A 1GL0E 4Y8YA 2BDBA 1FAKH 3VXFH 1SFIA 4CH8B 4MPWA 1GBCA 1BTYA 1DE7H 3GCTF 4Y7AA 4GCHG 3E90B 3LH1A 1XVMA 1AMHA 2R0LA 5JDUB 1YF4A 2VINA 3SV7A 1UTLM 3RXSA 3W95A 1TX6A 4IN1A 3RXQA 3A87A 1YPHC 5TCAA 3Q3XA 3T62A 1EUFA 1TPAE 1TNHA 4ZHAA 4Y7BA 4ZXYH 2R3UA 1QFKH 1O3KA 4U01A 2Q1JA 2VVVA 1ZOMA 2ZFSA 3BTHE 1LQEA 3SU5A 3A7TA 1AVGH 1P02A 3GY8A 1FQ3A 1P01A 1UTQA 1GHZA 1HNEE 2Z9JA 4O03A 1MKWK 1QBNA 1AWFH 3UUZA 3ZZ5A 3A7ZA 1GI5A 1EFRD 4AFZA 1YPMH 4NZQA 4B75A 1EAIA 2F43B 4OS7A 1OWKA 4ABEA 3BTKE 1MKWH 2C8XB 4ESTE 4ISIH 3KQDA 1F7ZA 1JIRA 1FN8A 2SNWA 1RIWC 4O3TA 5T6DA 3WWFA 2JDID 1WOFA 1OP0A 2ZHWH 1EPTB 3BTGE 1A5GH 1EJMA 2FI4E 2OC8A 3PROA 3KEEA 1E38B 2FESH 1F0RA 2H5DA 4J1YA 1CT4E 1DLEA 1VGCC 1EOJA 5AVDA 3V0XA 4DJZB 4IGDA 1H8HD 1VCWA 3U8OH 3VGCB 5BPEA 1ESBA 1UW7A 3HK3B 3QTVH 2B9LA 1QQ4A 1AHTH 2C90B 4F4OC 3GCTG 2FS9A 5B6OA 2XWAA 4UONA 1J16A 1V6DA 1MU8B 3GCNA 3UB0A 3UIRA 4NIWA 8LPRA 1O5CB 4YESB 5DP4A 2OINA 1BZXE 3BTDE 1K1MA 3TNTA 3UAIC 2HGTH 4I8HA 5LPEA 4X2WA 1WTHD 4I8KA 4I7YH 1V2VT 1SSXA 5CDFE 1W0YH 4OS6A 3LC3A 1SGFA 4FXGH 2O8WA 1FONA 2BB4A 1C9TA 1GI4A 3SV9A 3M5OA 4NSVA 4B6FA 1SVPA 3KN2A 2A2XH 3R0FA 1AKSA 3MO9A 3ZIAD 2ZPQA 4UFGH 3P8GA 4XE4A 1MD8A 5HYOA 3FN8A 1BJUA 1DWBH 3SV6A 1YCPM 2NU4E 1C5NH 3FO8D 2BZ6H 3KQCA 3PV5A 1T31A 1G37A 4NGAH 3OTPA 1F5KU 2BDIA 4PROA 3AW0A 2FPZA 2VH6A 2GZ9A 1UO6A 4VGCC 4XD7D 1OWIA 3VEQB 2CHAC 1GBDA 1J15A 1HAVA 3DSOA 2P93A 3F1SB 2PR3A 3O8DA 1NROH 4BOHA 3D23A 1EX3A 1NRPH 2QE7D 1GHBF 2O8MA 3GYLB 2BXUH 4X0WU 2THFB 2BX3A 2GCHF 2YNBA 2FDAA 1RGQA 4NA9H 5GJ4B 1ELDE 3RXLA 1HBTH 3IWMA 2Y6TA 1SGRE 3E91A 4Y76A 2IJOB 3RMLH 3U98H 1EJNA 1YGCH 4WMDA 4B71A 2A7JA 2TGTA 1BRCE 3ZZ4A 2EC9H 2GT7A 1UVUH 3RXMA 1ZTKA 3MH5A 3TK6A 3SGAE 4BAKB 5HIZA 1LVMA 5FCRA 2SGFE 1WDIA 1YPHE 2XNIA 1DSTA 4TPYA 2PTCE 3MNXA 1GBLA 1FPHH 2VIWA 1HAOH 3PB1E 3F2GA 2XC0A 3IG6B 3KIDU 1O2SA 1T7CA 3V13A 1QRXA 2ZDLA 5L2YH 1GMHF 1P2JA 1SLVB 1K1OA 2F9NA 1BITA 2SGQE 3PLPA 3BTWE 1O5GH 4DIHH 3ZYDA 6LPRA 2QXGA 1VR1H 2GDEH 4K2YA 2VGCB 3ATIA 1ORFA 1XUGA 1KLJH 1IQIA 2OK5A 1UTPA 1KYNA 3SYJA 4RN6A 2ZFPH 4BXWA 5DG6A 1GI9B 3BTFE 1FPCH 1NU7B 4X8TH 3WY8A 3M5MA 1WBGB 1GI0A 1V2QT 1ZPBA 1IQGA 2A7HA 2ZFQH 4BAMB 3SN8A 3MTYA 3PLBA 3MU4A 3TJVA 1ANDA 4TPIZ 3KYFA 1LTOA 3PYHA 3I78A 1ZSLA 4ASUD 2HNTF 1TWXB 1H1BA 4R0IA 1GHXH 1RXPA 2O8TA 2NU1E 1FLEE 1HJAC 5FX6A 5TCCA 5FL7D 4INKA 4MNWA 2KAIA 2BZAA 3ZZ9A 3SHAH 1SOZA 1C1VH 4B1TA 1ELAA 2KCOA 1Z8RA 1GI7B 1TPOA 1OHHD 2TBSA 4X2VA 5LPRA 1VITG 3UNQA 1JMOH 4K1SA 1Q2WA 2H1UA 5A8XA 1F0TA 5K7RA 5I46H 4I31A 1P9UA 3SU4A 1AFEH 3S69A 1EAWA 1N6XA 2ZDMA 1AFQC 1GMCF 2BDAA 1KTTB 4O3UA 5GIBA 4JYTA 3GS9A 1EB2A 2BHGA 9ESTA 3MNBA 1O31A 5DPAA 3MU5A 1SKYE 1S0RA 2FYRA 4K1TA 3SW2B 2OXSA 3FP8E 2AIQA 2GCTB 3RMOH 3SQEE 2VIQA 4NIYA 1BMFD 4VGCB 2XW9A 2H5CA 4XDEA 4ZXXH 1NESE 1A2CH 2F9OA 6GCHG 1ZHPA 3SOSA 3P8FA 1FY5A 1O2XA 2W5EA 3ZZ8A 1D3TB 2M5TA 1NRRH 2FOHA 5A09A 3RUOA 4B2CA 3SV8A 1HCGA 1G3EA 1EASA 4B73A 1YPEH 3BTEE 2JH5D 2OQUA 1ETTH 3LGWA 1INCA 2BLVA 3OU0A 3FANA 4H4FA 2ZO3H 3MO6A 3S9AA 2PV9B 4ZCNA 2BOHB 2W3IA 1O39A 3QUMP 3TK5A 1FZZA 3GDVA 4X6MA 2AIPA 2ZCLP 3HATH 4AGJA 3FVFB 5JBTA 4JYVH 1ZMLA 1OWEA 4Q7XA 1KXDA 3FP6E 3UR9A 1ETRH 2AEIH 5TJXA 4DURA 1IHTH 2WPIS 4XSKU 2FODA 5J4SA 3NWUA 4DY7B 1LQDB 1K1PA 2PUQH 4BTUB 1Z6EA 1YWUA 4I32A 2WYGA 1O2MA 1QBOA 3SU6A 2W6ID 3AAVA 1P2OA 1O2OA 3SI4H 1O38A 3V3MA 5ESBA 1TGSZ 2A31A 5EU8A 2EI8A 1GHBG 1V2KT 4ABBA 3ESTA 1MTNC 3TJNA 5IDKA 2SGAA 2KM0A 4INHA 1EPTC 2BY7X 4UFFH 2DE8A 3D65E 3P70B 3MFJA 3A85A 2HVYB 3KNXA 2KCPA 1ETSH 2VNTA 1OS8A 1C2HA 1QBVH 1VITH 1AZ8A 1MCTA 1BRAA 2JKHA 1DUAA 1GJCB 2BDCA 2WINI 1S0QA 1CA8B 1TRMA 1QIXB 1WQVH 1C5LH 2F91A 3GISB 2FIRH 1LKAA 1TB6H 3NKKA 2FMJA 4GLYA 5DP5A 1W7XH 4CRAA 3ATWA 1THRH 2IN2A 8GCHG 2EI6A 1O3AA 1MMJN 5HGGA 2H9EH 1MZAA 1ELCA 1G2MA 3BTTE 3RXEA 3A84A 2BD4A 1G3CA 1DX5M 2XOKD 1COWD 3Q76A 1T8LA 1PPBH 1ZYOA 2UUKB 2XWBI 4P00A 1XUKA 1NRQH 4Y10E 2LP6A 1ABJH 4X6PA 3P8OA 3H7OA 2QYIA 3RU4E 2C93B 1DITH 4MNXA 1N8OC 1V2OT 3LDXH 1GHVH 3ZV8A 1AFQB 1L2EA 3SUFA 5C94A 3HK6B 1SLUB 2J34A 1CHGA 4X8SH 2HPQH 2HOBA 4F48B 1C9PA 1TONA 4OGXA 1MKXK 3LU9B 2ZU4A 1GMDG 3UTUH 1TAWA 1F0SA 1Z1JA 3TGIE 1GPZA 1C5YB 1C1TA 3RM2H 4AGKA 2QXIA 1TMBH 2ANMH 1UVTH 1VJAU 1D6RA 1WSSH 1K0HA 2PKSB 5BRRE 2GMTB 1IHSH 2G81E 4YLQH 1NO9H 1EXFA 1SBWA 2J5UA 1C4V2 1KDQA 4WMFA 5A8ZA 2XRCA 2QF0A 3UY9A 3LONA 1OWJA 2B7DH 2J2UA 4R8TB 3A80A 1V2ST 3SU1A 1WAYB 1N8OB 1QGFA 4UE7H 4KGAA 5GWZA 5EJZA 5L2ZH 1P3CA 3GDUA 5PTPA 1ARCA 2F83A 2WV5A 2ZGJA 3A86A 3K6ZA 1V2JT 4Z1MD 1W7GH 1QL9A 3H09A 3BG8A 8GCHF 4IC6A 1TRYA 5FX5A 3LJJA 1GBIA 3P92A 2FM2A 1UCYK 1PPZA 4ISLA 1MTNB 2FOEA 1GGDB 4X1QU 2BDYA 3SI3H 1WCZA 2XNDD 1C5OH 1FIZA 3E6PH 1HLTH 3SGQE 5A2MH 1C5ZB 1K9OE 3SJKA 1NM6A 1ANBA 2PSXA 2Y5GA 1O3PB 1GI3A 1C5SA 2GGVB 4IN2A 4CRCA 1S6LA 3CNRA 3MU0A 1AO5A 1LHFH 1NRNH 2P94A 2ZI2H 2J97A 3B9FH 4I8LA 1YY3A 2P8OB 4WY3A 1HB0B 3N99A 5AFZH 2ZPSA 5LPFA 1S82A 2Y81A 3ATLA 5FCKA 4YM9A 2WPMS 2Y5HA 3VB7A 1T8MA 3RXDA 4LZ4B 2V3OH 3RU4T 3SNAA 5EG4A 2V35A 2OC1A 1H8DH 1ZR0A 1KY9A 3HGNA 5CHAC 4AG1A 4IW4E 3M3SA 2ESTE 1O2GH 4FUGA 2Z9KA 3PMHB 4KELA 1ZGIA 3U8TH 4I8JA 4ZH8A 1L1GA 1TA6A 5JB9S 3SU0A 1TBZH 2GTBA 4HFPB 3RXKA 1BJVA 1C2FA 1ANCA 3UREA 1GWAA 3LGIA 1GCTB 1A7SA 3RLYH 3SNCA 3M37A 3PMJA 3RXTA 4WF8A 3EA9A 2GV7A 1G32B 5KEDA 1UTKA 1ZJDA 3RU4D 2GDDA 1ZHRA 4FUJA 1G30B 2GP9B 2ZCHP 2BD7A 1ZLRA 3ZZDA 4AX9H 1O3EA 3TIUA 2V0BA 1FXYA 7GCHF 4GVUA 1SGPE 1Z8JB 2SNVA 3H5CB 1O3FA 2FX4A 4Q7ZA 1O3CA 1C2MA 2HPPH 2Q6FA 2ZTZA 1BHXF 2VB0A 1BQYA 1O2NA 1WV7H 1G2LA 4FU8A 1Y5UT 3FZZA 1CGIE 2ZG0H 4WXVA 1GBFA 1HAHH 2Z9IA 3EA8A 3ZYEA 1OYQA 4IC5A 1YPJH 5EXMA 1UK2A 3LGUA 4X6OA 1O3IA 1Z8GA 4NWKA 3UR6A 1O5DH 5FBIA 1UCYE 2P16A 1BTHH 3GCHC 2WPKS 4K8BA 7ESTE 1ESTA 1X7AC 5L30H 2FO9A 1C4U2 2EA3A 1C5UA 1IAUA 2FTMA 1GGDC 3S9BA 1U6QA 3M3TA 4FOUC 1DANH 2BQ7B 3EA7A 3BV9B 2ZQ1A 2Q6GA 1P2QA 1F2SE 1GBTA 3TLOA 1MAXA 1O5FH 1P0SH 1FY1A 5HMAA 2HVXA 1H9IE 1W8BH 5E0GA 3MU1A 2W26A 1O5AB 4FUHA 2O8LA 1TFXA 3U9AH 1HAVB 5F8TA 1VCPA 3T29A 5L6NH 3LGVA 1VCQA 4ISOA 4DVAU 1DWEH 1GMDF 2NU3E 1SI5H 4AYVB 3ZVAA 3ZZAA 1HIAA 2YMSC 1OWHA 2D8WA 5DKMA 1O36A 5EJ1A 2IJD1 5T1VA 2ZHQH 4JK5A 1FIWA 3C1KA 2PGBB 2WZQA 2P3FH 4DGJA 1S84A 4HI3A 1GDQA 3A7VA 2ZGBH 9LPRA 1C2DA 3ZZ6A 3P17H 3T28A 3U1JB 2Z94A 1G3DA 1GG6B 4FUDA 1AY6H 4BAQB 1IQEA 2TGAA 1E37B 2G4UA 3TGJE 1C1QA 1D9IA 2AH4X 2WUCA 3BTME 4FUBA 4TT3D 5A8YA 4MLFB 1TGNA 2STAE 5EQRA 1L1NA 3QZQA 5C3NA 3M5NA 1CHOG 1CA0C 5EGMA 5ABWA 4AYYB 1TE0A 2BY5X 1H8IH 1F0UA 1BBRK 2VWNA 1YP9A 2FI3E 4Y11E 2YNAA 3A8DA 1C5PA 1TLDA 2A5IA 4LOYH 2G5NA 2UUJB 3ELAH 2BQ6B 3SNEA 5EIYA 2ASUB 1S81A 1BA8B 1TRNA 2FLRH 1RJXB 1C1WH 2HLDD 2Y7ZA 1TX7A 5FAHA 4CHAC 2CN0H 2HLCA 2G51A 3NZIA 1B0EA 6CHAC 4HG6A 1IQHA 1S85A 1D3PB 5LH8A 1A0JA 5GXPA 2B5TB 4D9QA 4BTTB 2QGRA 3D62A 1GI6A 2UWLA 1V2WT 4Z6AH 3RC4A 1W3CA 2C8WB 3RXIA 3ZZBA 1AE5A 1HFDA 1KXBA 2BLOA 3Q3YA 2EEKA 3SUDA 2JJ2D 5E0JA 4OS5A 2ZZUH 2A4QA 2Y7XA 2CF9H 1O2QA 1QY6A 1KXAA 4BTIB 6ESTA 2JETB 2J94A 1PPFE 2SGEE 2VIOA 4WMEA 1O2WA 1O5BB 1OPHB 2NWNA 5J4QA 3L6PA 5EOKA 2FOFA 1QR3E 1D3QB 1W12U 3ZZ3A 1SHYA 1PQ7A 2RCEA 4CRBA 3NPSA 4D9RA 2BD8A 3S9CA 1SC8U 5F8ZA 1UHBB 1DXWA 5CHBA 3A8AA 5FXLA 4M7GA 1P2KA 3NXPA 4GUXA 2YMSB 5EW1H 1G3BA 1HAZB 2AMPA 1GJ9B 1UVSH 3I29A 3BN9A 1BMMH 3OTJE 1VGCB 3OAAD 3K65B 4K5ZA 1ZJKA 1ZRBA 5T3HA 4DT4A 2PKSC 4A92A 2G00A 4UFDH 1K1JA 3MU8A 1DLKB 1GI2A 1NFYA 1BTPA 4ISNA 2BXTH 1UMAH 1ABIH 1ZSKA 2JH0D 1OXGA 3LOXA 2QF5A 4GHTA 2VIPA 1THPB 2A1DB 1FAXA 1PQ5A 3P8NA 1F5RA 3HGPA 2GD4B 3OX7U 3TGKE 2ODQA 3MMGA 4YOGA 4AG2A 2BD2A 1MAYA 3GY6A 4IS5A 2FZZA 3E16B 4OGYA 2RDLA 2ANKH 1HIAB 1C1OA 5F8XA 5HKKD 1DM4B 3MH7A 1GHAF 4Z0KA 1TNGA 1DVAH 2GKVE 3URCA 1K1LA 1FY4A 3M3VA 4FU9A 1A3EH 3T2NA 1BBRE 2FXRA 5JBAS 2I6SA 1AQ7A 2P3TB 1NRSH 3SJOA 4NIVA 1O2PA 2FS8A 1EZSC 3SZEA 1S6HA 4FU7A 2FOMB 1FDPA 1SGDE 1JBUH 5F6MA 1C2IA 2GZ8A 3NUMA 3T25A 1QNJA 3PTBA 4MDSA 4HGCA 1TOMH 1MTSA 2P59A 2A4OA 1PPEE 4X1SU 1OP8A 1UVOA 4FUIA 1CGJE 2OTVA 3SU3A 2D2DA 5EQQA 1O33A 3H7TA 2XCNA 1V2UT 3OYPA 3VXEH 2A45B 3PV2A 4XFQA 1P05A 2XCFA 2KR7A 3GY7A 1Y8TA 2KCAA 3ZVFA 1L4DA 1Y3YA 4X1RU 1TNIA 2PGQB 1B7XB 3VB4A 1XKBC 1MTVA 2ZDVH 5EW2H 3RXGA 2A5KA 1QQUA 1XVOA 3GYMA 1LVOA 1C1NA 3DSPA 2J98B 1A61H 4ZHLU 1ZPZA 1GBKA 3LH3A 2ODPA 1L4ZA 1TX8A 5C1XA 3KQEA 2VVCA 1RTKA 1SGQE 5E8EH 4RT1A 4Y6DA 2IOTA 1EAUA 1UTJA 1AI8H 3LC5A 2K0QA 2AHME 1GCDA 1P12E 2R3YA 3QZRA 1QRZA 2FEQH 4XBDA 3I77A 2WPHS 4MQAA 4HZHA 2ZFTA 4ASHA 1HAPH 1LKBA 3ATKA 2BM2A 1WTGH 3BG4C 2ZDNA 3RXUA 4ABGA 3GY3A 2QCYA 5E0HA 3S7KB 1C1SA 3MHWU 4FUCA 2HWLB 2UUYA 3SU2A 1AVWA 4H6TA 4A5TS 2GT8A 3MH4A 1C5RA 4UFEH 1HDTH 1BT7A 2JIZD 2P95A 3O8RA 1BUIA 3GCOA 3F0OA 3M7QA 4GHQA 5EPNA 5IK2D 1F5LA 1YPLH 4ZKRU 1W0KD 1P9SA 2L74A 1QJ6B 1TMUH 1ID5H 1GJ8B 1TNLA 3HKJB 5DN6D 1TOCB 1NU9A 2V7QD 3FFGA 2RG3A 3L33A 1PPHE 2BDHA 3DD2H 3PM3A 1Q3XA 2XBYA 1PPCE 5CE1A 2XTTB 1EP6A 2ZGHA 5GCHF 1FNIA 3MYWA 3ODFA 1CBWB 1D3DB 1EAXA 2XYAA 1OYTH 2Q6DA 3TU7H 1EZXC 2SGDE 4NFEA 4LZ1H 4DOQA 4E05H 1CT0E 4K1EA 2RFKC 3AVZA 4TWWA 4X8UH 1MZDA 1NT1A 5DP8A 1O3LA 1NS3A 1G9IE 5AFYH 2IPHA 2K1QA 3B23B 3DCLA 3EAJA 1TABE 3RXCA 4UD9H 4RKJB 1AB9B 3TNSA 1FY8E 1LMWB 1A1RA 3E1XB 1O2UA 1VITF 1PJPA 3A89A 2ZDAH 1AKSB 1NFUA 1HJ9A 1KMHB 1PQAA 4SGAE
chains in the Genus database with same CATH topology
1O2YA 1BCUH 2PW8H 2CGAA 1TIOA 1GG6C 1SFQB 5FPYA 4OS1A 1KLIH 1NN6A 3CS7A 1RS0A 1CU1A 3OY5U 4MNYA 5C20A 3URDA 3D49H 5SGAE 4BNRA 3ATMA 3M36A 4CREA 1QB9A 1EZQA 1YPKH 1QJ7B 2F9UA 1NFWA 3ZVBA 1MBQA 1AE8H 2D1JA 3Q00A 1FMGA 4CR9A 2BTCE 2OC7A 3Q3KA 4MNVA 2F9BH 1VJ9U 4I33A 3RXHA 6GCHF 2ZC9H 1ZZZA 2C8YB 2ZQ2A 5GPIB 1GBBA 2Y80A 1W2KH 4TYDA 2H2ZA 1K2I1 2BDGA 4ABHA 2Z7FE 2J92A 4Y8XA 1WUNH 2TRMA 1A5IA 5HXFA 3F9FA 4NFFA 2OC0A 2ZEBA 2JETC 3FZDA 4IMZA 1AZZA 2G8TA 2QIQA 1J14A 3PLKA 3SJIA 5DP3A 4D7GA 4B76A 1Z71A 1T8NA 2AMDA 2H9TH 1E34B 3CS0A 2ZTXA 1EJAA 4A6LA 4JZEH 3TITA 1XXDA 2ZU1A 4ZAEA 1J8AA 1SGFG 2BOKA 2EI7A 1C1PA 1Q31A 2VIVA 1AUTC 1IOEA 4X1PU 4MPVA 2ZU3A 1TNJA 1C1MA 1ELVA 2PKAA 3SJ9A 1P57B 4GPGA 1E36B 2QF3A 1BTZA 1W13U 4X1NU 2TGPZ 1A0LA 1TMTH 1MTWA 1JOUB 1XX9A 2Z3CA 1BB0B 1O3DA 4CRFA 3SQHE 4NA8A 1A3BH 2HALA 2H6MA 2A4RA 1T8OA 1V2NT 3E8LA 4F49A 1MU6B 3BG4B 1Z1IA 1TA2A 4XOJA 3G01A 3PO1B 2J4IA 4YZUA 5EQSA 1IQLA 1GJBB 2ALVA 3U1IB 3RXJA 2F3CE 1O3GA 1OX1A 5DO4H 3T27A 1QCPA 1LPZB 2CV3A 3UQVA 1AUJA 1FI8A 3PO1C 4DG4A 2BD9A 3A8BA 4RSPA 2BX4A 2ZU2A 2HNTC 4YOJA 3L3TA 3JZ1B 1MUEB 2J95A 4K8YA 4K60A 2DUCA 2ZA5A 2ZNKH 3PTNA 1C2GA 1MH0A 2ZECA 2BY9X 2Z6BD 1JIMA 1YCPH 1H4WA 2AERH 2CMYA 1RFNA 2HRVA 4IBLH 4D7FA 1QRWA 2BYAX 1GHYH 1XUFA 1XXFA 3QWCH 2LNCA 1AU8A 3AW1A 3MOCA 3IITA 3LT3A 1LDTT 2VJ1A 1K1NA 3QGJA 1V2LT 1GI8B 2W3KA 3V7TA 2P8OC 1RTFB 1Y5AT 1O3MA 1ZGVA 1BTUA 2G55A 1C2LA 4H42U 3M5LA 3TVJB 3BIUH 3SUEA 1ELEE 4AN7A 5C2ZA 4AORA 2OUAA 1DT2A 1P10A 1SLWB 2A5AA 2WV4A 3DHKH 4ZROA 4NG9H 1ELBA 1P11E 4AZ2B 4E7NA 5HM9A 1AGJA 4B2BA 3EQ0H 1SQOA 4ABAA 4BAOB 1UJ1A 4JYUH 1GBHA 4A1TA 1O0DH 2Z9GA 1DY8A 3SUGA 1L0ZA 4B2AA 1DWDH 1CVWH 2ZDKA 2PSYA 3ZVCA 2I6QA 4CHAB 7GCHG 2SGPE 2ZGCA 4AB8A 1OOKB 1SMFE 2WPLS 1CQQA 3UOUA 3M7UA 2FI5E 4JZDH 1V3XA 2ZCKP 3UPEA 2FOCA 1ZHMA 3NCLA 1O2LA 5C5NA 1TNKA 4WH6A 1Y3XA 1GVLA 4ZKSU 1LHGH 3ZVEA 3ZVDA 5C5OA 1ARBA 2OD3B 1AWHB 1XUJA 5T6FA 4HTCH 5G4BA 1K22H 1RIWB 1YKTA 1O3NA 2BVRH 3AAUA 3ODDA 2ZHDA 1CE5A 1MD7A 1LPKB 3VB5A 1TPPA 1ZTLA 3HPTB 1P03A 2DE9A 2Z3EA 5CHAB 3RDZA 1DXPA 4MVNA 1JRTA 1SG8B 1Y3VA 1S5SA 1BTXA 1HXEH 3K9XB 5FBEA 4X2XA 3P6ZB 3A88A 1GMCG 3A8CA 3SZNA 4NWLA 1FV9A 4FUEA 1GBAA 1C5MD 1P8VC 1SQAA 2ODYB 3MNSA 1B0FA 1GVZA 1ZSJA 3T26A 2P3UB 3CENA 1BRBE 4X8VH 2OLGA 3PMBB 3UFAA 3SJ8A 2PFEA 5EODA 2FX6A 4MTBA 5T6GA 2ZIQH 2AYWA 5A0AE 4YTAA 4UEHH 3BTQE 2QAAA 2QY0B 4AOQA 4ABFA 2CHAB 2PWXA 1O30A 2V3HH 2R2WU 2ZFFH 3QO6A 1YYY1 4QT8C 2B0FA 1D4PB 3KGPA 1O2IA 2FOAA 2F9VA 1QURH 1DUEA 1M9UA 3PV4A 4JZ1A 3ZZ7A 3M35A 1OWDA 4X6NA 1DFPA 1IQJA 1UTMA 3U69H 1T4VH 2QN5T 4Q80A 1YLDA 4FVDA 3RXAA 1QB1A 1QL7A 2VIDA 1CBWC 3BIVH 1GJ5H 1YC0A 4YO9A 4NCYA 2TIOA 3RXBA 2HNTE 4H6SB 3E0NB 1HYLA 1LHCH 5AF9H 2FLBH 1TALA 2XXLA 2TGDA 3VFEA 1C5TA 3BSQA 1TGTA 1QTFA 3MO3A 1SGEE 3UNSA 2GCHG 2G4TA 5ESTE 3RXOA 2FYQA 5E2OA 1LVYA 1UHBA 1YBWA 1KXFA 3SNDA 4I8GA 1UK3A 1C5VA 2G5VA 4ZHMU 1MQ6A 1GJ6A 2AMQA 3GY4A 2LPRA 1HJ8A 2J9NA 2ZTYA 5AHGH 3ZZCA 1W0ZU 7LPRA 3QTOH 4Y0ZE 4GAWA 2W7SA 1EKBB 1YCPK 3BEUA 3HKIB 2R0KA 5C1YA 2VGCC 1DSUA 1G36A 2RA0A 3LJOA 3AASA 1C4Y2 1C1UH 5DP7A 1GMHG 4WJG2 1A4WH 1Y5BT 3TPIZ 1SGNE 1O35A 2A2QH 2FTLE 3UWIA 4B74A 2ILNA 2A0QB 4ABIA 1L1JA 1ZPCA 3BEIB 1F92A 1YLCA 2STBE 1SOTA 3TH3H 8KME2 2XBVA 1NTPA 1DWCH 4AB9A 5LGOA 2H9HA 3TH4H 2V6NA 1CA0B 4ZKOU 1O2RA 3MH6A 3F9EA 1FN6A 3MNCA 1EATA 1K1IA 3SORA 1O3HA 2AGIX 5I25A 3TK9A 4U2WA 3RP2A 2O9QA 3ITIA 2R9PA 5FHTA 2SFAA 3F68H 1QJ1B 4ZKNU 1H9HE 4JCNA 2VU8E 1MKXH 1O3OA 2BLQA 1P06A 1ZTJA 4KP0A 3DA9B 1SGCA 2PUXB 3GICB 5HM2A 4CRGA 1GJDB 4A1XA 2UWOA 3ENSB 1A5HA 5A0BA 1GDNA 2A32A 1TBQH 1KLTA 4U30A 2D26C 1HJAB 4U32A 3DFJA 2GVFA 3M61U 4JK6A 1A46H 1HAGE 3MWIU 2BQWB 1P2IA 5EPYA 1V2MT 2GMTC 2ZKSA 1HAXB 1N6YA 1O32A 1GHAG 5GDSH 5JBCS 3F9HA 1IQFA 1NY22 1GCTC 2FOGA 1C2KA 1IQMA 4WH8A 3B8JA 1OP2A 2WUBA 4TY7A 1NZQH 3R3GB 2Y5FA 3FAOA 3PWBA 1JWTA 4OS4A 1GL1A 1GDUA 1TYNA 1C5XB 4O97A 1O37A 2ZPRA 4DT7B 1W14U 1BMNH 4ZUHA 1W10U 3C27B 2CF8H 1FY3A 2AFQB 3KCGH 2BMGB 4YOIA 1EZUC 2PTNA 4J2YB 1HRTH 1H9LB 1ESAA 2ZU5A 2ANYA 2ULLA 1HAIH 1N1LA 1P09A 1UK4A 4A1VA 1O3BA 5DJ7A 5ETXA 4KTUA 3A83A 1EOLA 2NU0E 2QV1A 4O9VA 3VB3A 2GZ7A 5JYIA 1BIOA 1RD3B 5DP6A 3LIWA 2GCTC 3RXVA 3RC5A 1NPMA 1ZRKA 2RA3A 1HXFH 1DOJA 1EPTA 3V12A 1BDAA 4ISHH 2ZP0H 2ZGXH 2QXHA 4YT6H 4INLA 1FJSA 1GJ4H 2BVXH 3K6YA 3LGYA 1GHWH 3SBKA 1MTUA 3LKWA 1C5WB 1KXCA 1TGCA 2TPIZ 4GSOA 3PMAB 5C1UA 5IYTA 2Z3DA 3A7XA 4GCHF 1PPGE 3CP7A 3SNBA 3KQBA 5E2PA 3LPRA 5JPMH 1KDQB 1BHXB 4YLUA 1KTSB 1QA7A 2OBOA 3EYDA 4DW2U 4CH2B 3BEFB 1A0HB 2ZHFH 1HUTH 4X2YA 1C5QA 4OS2A 4XBCA 3DFLA 3LGTA 6CHAB 2AGGX 4JZIA 2ALPA 1HGTH 4WVPE 1QHRB 7KMEH 3RXRA 2BD3A 4TWYA 1S6FA 1Y3WA 2CJIA 3QGNB 4KKDA 3EDXB 4WXIA 1ELTA 4YT7H 1Y59T 2XC5A 1NFXA 2VWLA 4TY6A 1D6WA 2XC4A 1P3EA 4Y0YE 1SQTA 3NK8A 1QA0A 2Z9LA 1P04A 1WYKA 3F6UH 2PKAB 3DUXH 4K3JA 2CXVA 2Y82A 3A82A 1SHHB 2C3SA 1TPSA 4E7RG 2NU2E 4DCDA 3KHVA 1LHDH 1YM0A 1E0FD 1RRKA 2OP9A 1KIGH 3O8CA 2OCVB 3STIA 3STJA 1CSOE 2BD5A 3RMNH 1BMLA 3O8BA 5CMXH 1PYTC 3K2UA 1HAYB 2GV6A 1W11U 3T5FH 1GBEA 2UUFB 1PFXC 3A7WA 5DP9A 1JXPA 3SO3A 1O2ZA 2A7CA 4AFQA 3A7YA 1LO6A 4THNH 3ZV9A 1TQ0B 1C1RA 3UWJH 2O8UA 1SGYE 4WWYA 1FUJA 4SGBE 3VPKA 3A81A 2FP7B 4JZFH 1AD8H 2GX4A 1V2PT 1O2HA 2BLWA 2VH0A 1Z7KA 2WYJA 1UCYH 1NC6A 1WQSA 2ZF0H 3GCHB 1P2NA 4UDWH 1O3JA 1V2RT 1AB9C 2BY8X 4AFSA 4CBOA 4CRDA 8ESTE 1EP5A 2G52A 4DIIH 4D8NA 5EXNA 1O2JA 4AFUA 3MI4A 4KTSA 3OSYA 2PLXA 3FP7E 2ANWA 2XBXA 2AGEX 2KAIB 2B8OH 1XKAC 4Q2KA 2VWOA 4KTCA 1GBJA 1HPGA 1AN1E 1AIXH 4IMQA 3F9GA 1KXEA 2XBWA 1DPOA 1K28D 1GVKB 1MQ5A 1CHOF 3E0PB 1MBMA 1J9CH 1EQ9A 2FOBA 5FPSA 3TJOA 3BF6H 1SLXB 5FPTA 1T4UH 3EE0B 1GJ7B 3E3TA 2R2MB 1O5EH 1SGTA 4MPUA 2JH6D 1DICA 1C2JA 5K0HA 1Y3UA 1XUIA 4A7IB 3M7TA 1O2TA 1ACBE 3RMMH 4CR5A 2QA9E 4JMYA 1YPGH 2ZHEH 1E35B 1CT2E 5GCHG 4MG3A 1BMAA 3ZVGA 1BBRH 3GOVB 4RKOB 1OSSA 5JB8S 1DDJA 3RXFA 1ZMNA 1P2MA 1AVXA 1LHEH 1UTNA 1IQNA 1BTWA 1XMNB 4Y8ZA 1Z6JH 2J38A 4NA7A 1UTOA 3SV2H 4LK4A 4Q7YA 1SB1H 3TJUA 2W7UA 2OQ5A 1Z8IB 1O34A 3SHCH 1ELFA 1ELGA 2AS9A 1TBRH 3UOPA 3Q77A 3S0NA 3GY5A 1HV7A 1O2KA 2VWMA 4ABJA 5H4IB 4BAHB 5EXLA 3KF2A 2OBQA 2WPJS 1SGIB 1DY9A 1CGHA 3VB6A 1UVPA 3RLWH 1RTLA 1J17T 4NIXA 4MPXA 3OY6U 1QL8A 3JZ2B 3U8RH 3EGKH 1GBMA 5A0CA 3QX5H 3RM0H 1DS2E 4D76A 4NZLA 2A4GA 2ZWLH 4XBBA 1TQ7B 4BXSA 1V2TT 5F03A 1SL3A 1LCYA 3PWCA 3N7OA 1T32A 4CBNA 4FVBA 1ANEA 2C4FH 3DT0H 1MCVA 1WU1A 4E06H 2QC2A 1K21H 1B5GH 1PQ8A 3W94A 5C67A 4FUFA 2BY6X 3KL6A 3QLPH 1JRSA 2YOLA 1BOQA 2C8ZB 2BVSH 2FWWA 1SR5C 4ABDA 3UQOA 1BRUP 1S83A 3QK1A 3TH2H 3QN7A 1LPGB 2ZFRH 3VGCC 2PHBA 1IQKA 3P95A 2UWPA 1THSH 1GI1A 1ZMJA 4NSYA 3RXPA 4BANB 1QB6A 1SPJA 4Y71A 1O2VA 2QXJA 5DK1A 3UNRA 4K69A 5JBBS 1VZQH 1CO7E 2F9PA 1GJAB 3QDZB 1EB1H 3S7HB 3GY2A 1LVBA 1OKXA 4Y79A 1C2EA 1TGBA 3SGBE 3GDSA 1XUHA 5DGJA 4LXBH 1PYTD 4ZMAH 3RC6A 2VVUA 1KSNA 1XM1A 1GL0E 4Y8YA 2BDBA 1FAKH 3VXFH 1SFIA 4CH8B 4MPWA 1GBCA 1BTYA 1DE7H 3GCTF 4Y7AA 4GCHG 3E90B 3LH1A 1XVMA 1AMHA 2R0LA 5JDUB 1YF4A 2VINA 3SV7A 1UTLM 3RXSA 3W95A 1TX6A 4IN1A 3RXQA 3A87A 1YPHC 5TCAA 3Q3XA 3T62A 1EUFA 1TPAE 1TNHA 4ZHAA 4Y7BA 4ZXYH 2R3UA 1QFKH 1O3KA 4U01A 2Q1JA 2VVVA 1ZOMA 2ZFSA 3BTHE 1LQEA 3SU5A 3A7TA 1AVGH 1P02A 3GY8A 1FQ3A 1P01A 1UTQA 1GHZA 1HNEE 2Z9JA 4O03A 1MKWK 1QBNA 1AWFH 3UUZA 3ZZ5A 3A7ZA 1GI5A 4AFZA 1YPMH 4NZQA 4B75A 1EAIA 4OS7A 1OWKA 4ABEA 3BTKE 1MKWH 2C8XB 4ESTE 4ISIH 3KQDA 1F7ZA 1JIRA 1FN8A 2SNWA 1RIWC 4O3TA 5T6DA 1WOFA 1OP0A 2ZHWH 1EPTB 3BTGE 1A5GH 1EJMA 2FI4E 2OC8A 3PROA 3KEEA 1E38B 2FESH 1F0RA 2H5DA 4J1YA 1CT4E 1DLEA 1VGCC 1EOJA 5AVDA 3V0XA 4DJZB 4IGDA 1VCWA 3U8OH 3VGCB 5BPEA 1ESBA 3HK3B 3QTVH 2B9LA 1QQ4A 1AHTH 2C90B 4F4OC 3GCTG 2FS9A 5B6OA 2XWAA 4UONA 1J16A 1V6DA 1MU8B 3GCNA 3UIRA 4NIWA 8LPRA 1O5CB 4YESB 5DP4A 2OINA 1BZXE 3BTDE 1K1MA 3TNTA 2HGTH 4I8HA 5LPEA 4X2WA 1WTHD 4I8KA 4I7YH 1V2VT 1SSXA 1W0YH 4OS6A 3LC3A 1SGFA 4FXGH 2O8WA 1FONA 2BB4A 1C9TA 1GI4A 3SV9A 3M5OA 4NSVA 1SVPA 3KN2A 2A2XH 3R0FA