1O2ZA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2zA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2zA02
3SU3A 5EXMA 4VGCC 1NRQH 2CF9H 3BTTE 1LPGB 3GCHC 3SGBE 8KME2 4X6OA 2R0LA 4VGCB 2HNTC 1THRH 2C90B 5A0BA 1D4PB 1NFWA 3SNAA 3GCHB 2WPKS 1TNIA 2HPQH 1O2XA 1EPTC 2ZHWH 1GJ7B 1SSXA 1C2LA 1CHOG 1BTHH 1GL1A 5I46H 3MI4A 3NZIA 2BYAX 4A1XA 3V7TA 3RU4D 3ZVAA 2AMPA 2OC7A 1EPTB 1KXDA 2ZFQH 1O3DA 3MYWA 3QLPH 3RXDA 1OP0A 1LHFH 1M9UA 1GJBB 2ZQ1A 1O36A 4BTIB 1MKWH 1P2QA 1ZLRA 2OQUA 6ESTA 5HM2A 2ZGJA 1OXGA 5C3NA 1ZTJA 1RTKA 4HTCH 1BRCE 4B1TA 4AOQA 3CS7A 2LNCA 3P6ZB 3SI4H 4AX9H 2SNWA 2WUCA 2VWNA 2ZDNA 2C8YB 4K1SA 3UR9A 1L2EA 2D1JA 1IOEA 3GCNA 2BD3A 1C2MA 4UFEH 1BCUH 4GPGA 3LH1A 4D7FA 3OY5U 1T31A 4AN7A 2FI5E 1G9IE 3GCTF 2BD5A 1NT1A 1H4WA 2BD2A 3SUGA 1P3EA 2PR3A 2Y7XA 2UWPA 1SVPA 4MNXA 3STJA 2OTVA 4MG3A 4FUBA 1O3BA 1ZYOA 4AZ2B 5H4IB 3T26A 1MQ6A 2QN5T 6GCHF 2VVUA 3RMOH 2FDAA 1C2FA 3JZ2B 1BRAA 4D9QA 1K2I1 1NROH 3E1XB 4INHA 4MLFB 5JB9S 2FTMA 2Q1JA 3O8BA 3CENA 1PJPA 1ZMLA 3T62A 1PQAA 3LGUA 4I8LA 2RA0A 3MWIU 4FUDA 1V2KT 1TONA 3I77A 1C5SA 5FPSA 1K28D 1V2QT 2ZZUH 3GY2A 3TH4H 1WTGH 5ESBA 4ABJA 1N1LA 1GVZA 4OS6A 1AMHA 5GDSH 2DE8A 4WMDA 1AVGH 1NS3A 2P8OC 2B0FA 2W3KA 1WBGB 4AG2A 1SFIA 4ABGA 2TGAA 1CGHA 4A7IB 3TK5A 1YPKH 1D9IA 1W7XH 2P8OB 1BMLA 2WYGA 4R0IA 1XUJA 2QA9E 3RMNH 2NU4E 1P05A 2G8TA 2V6NA 5DP4A 1UK3A 1EZSC 4ISLA 4JCNA 2WUBA 2FOBA 4JK5A 1BHXF 1LCYA 5DP7A 1EAXA 1L1NA 1X7AC 4MVNA 1FPHH 4RKJB 4B73A 1TRYA 1F0TA 4ZHAA 1J9CH 1Q2WA 2GV6A 5HGGA 4TY6A 4LXBH 3KL6A 5GPIB 4WJG2 3A81A 3ZZ4A 1QGFA 1AY6H 3RMLH 1GHAF 4ZROA 2OC8A 1W11U 1YLDA 3LGYA 5F8XA 1ZRBA 1FY5A 1HPGA 2W26A 2OP9A 1F5RA 1NPMA 2YNAA 3H7TA 3Q00A 2ZG0H 2WPMS 3SV8A 2FOEA 3PROA 1IQIA 5HMAA 1B5GH 2UUYA 3M7TA 5JB8S 2FMJA 3QZRA 1GHBF 2TGPZ 4U2WA 4NSVA 1V2NT 3ZYEA 4YZUA 3LU9B 2FOMB 2ZU3A 4ZHMU 1EZQA 4M7GA 2DUCA 3ZVDA 1ABJH 3CP7A 3JZ1B 3TPIZ 1ETSH 1TNLA 4MPXA 2BLQA 2GDDA 1SG8B 1UJ1A 3Q3XA 2BX4A 3FAOA 4BXSA 5FPTA 3UQVA 3SU4A 4WH8A 2CF8H 1LHDH 1ELVA 2BTCE 1GG6C 1L1GA 1GPZA 1O2UA 1EKBB 3K65B 4DIIH 5DGJA 2EI6A 1GMHF 3VPKA 1E36B 1SC8U 2P94A 1O2QA 2Y82A 2ZU5A 4K5ZA 1BDAA 3A82A 1NRPH 1PQ5A 1TPAE 3AASA 3RMMH 1C5NH 2ZFPH 1PPHE 1DUAA 1S0RA 1CE5A 1SGFG 1O30A 1P09A 2GCHF 1SFQB 1OP8A 4CR5A 5C67A 1ELGA 1C5ZB 1GJ8B 3SI3H 2W7SA 1O3OA 1SHHB 1T8MA 1O5BB 2UWLA 3A8BA 1VR1H 2Y81A 4GAWA 1KTTB 2YOLA 3DA9B 1O32A 1GBKA 1O5FH 1O2YA 1YPMH 1SL3A 1K1NA 3MNBA 1EX3A 2BVXH 1V2WT 1YCPK 2FM2A 5I25A 4GUXA 3VXEH 1AO5A 2ZTYA 2HNTF 1TOMH 1QL7A 5FPYA 2Z3CA 1NRRH 1AZZA 1S5SA 3MNCA 3M5LA 1SBWA 1MTSA 2CMYA 5F8ZA 2FODA 1F5LA 2ZEBA 5TCCA 3EA8A 4MDSA 3UTUH 4YM9A 2GCTC 3RXVA 1LO6A 1A46H 2GT8A 2HVXA 2RG3A 1XXFA 5L30H 1SGDE 1JWTA 1PPZA 2PUQH 3BSQA 3ATKA 1AWFH 3SGAE 2NU3E 1BTYA 1TBRH 4ISNA 3KF2A 1O2GH 5DG6A 1OP2A 5E2PA 4ZKSU 2A1DB 3PTNA 3M35A 1GHWH 3RU4E 4CBNA 5AF9H 3FANA 1W13U 2FX6A 1MBQA 2VNTA 2NWNA 2VGCC 1PPGE 3FP6E 1G3BA 1E37B 3ATIA 3MNSA 1RD3B 3LDXH 1VCWA 5JPMH 3F9EA 2VIWA 3SN8A 2VGCB 1ZPCA 2C8WB 2J34A 3ENSB 1THSH 2FOFA 1O34A 3O8RA 1EZXC 2A45B 1TGTA 3MHWU 2D8WA 4U30A 4YTAA 1T32A 4I33A 3GDVA 1HXFH 2FI3E 2G5VA 1YPLH 1EZUC 1O3GA 1QR3E 1CGJE 3RXMA 3VFEA 1FNIA 1HNEE 3SU2A 2R2WU 4X1NU 2RA3A 3BG4C 3SUEA 3LIWA 1ACBE 4XBBA 4AFSA 4JZEH 3F9FA 3MO6A 3DFLA 3BTEE 2H9HA 1BRBE 5JYIA 3BG4B 1FMGA 2PKAA 2J38A 4KTUA 1YKTA 1GI7B 1P02A 1UTPA 2ZTZA 2R9PA 3PO1C 1O35A 1BJUA 3SHAH 4NWKA 3B9FH 2ZCHP 5LPEA 1JIMA 1O3PB 2WINI 1FQ3A 1YBWA 4X1RU 1V2VT 2FPZA 3BTFE 3PO1B 1IQHA 3UPEA 1QTFA 2O8MA 4FXGH 1DANH 3MMGA 1DY9A 5DP3A 2ZGCA 1HIAA 3OSYA 1SQTA 1OS8A 4AGJA 1A7SA 4CRCA 4A1VA 2F9PA 1ZPZA 3BTGE 4NA7A 4I32A 1O39A 1GBMA 2J2UA 3AAUA 3SGQE 3TU7H 4Y8ZA 3RLYH 4B76A 2HLCA 3RXPA 4Z0KA 4KTCA 2CN0H 1QNJA 2OINA 1V2PT 1N6YA 1QRZA 2ANYA 1TNHA 3MU4A 1C5OH 1NRSH 1CSOE 4GSOA 2BXTH 4NG9H 3KQBA 3RDZA 2JKHA 1A2CH 5ESTE 5TCAA 3GY7A 4ABIA 1Z1JA 1UTQA 1EUFA 3QK1A 1UTOA 2A4QA 2HPPH 3UFAA 5FHTA 1OWIA 4BAOB 1SOZA 3ODDA 1HAPH 2Q6GA 1LHCH 5FBEA 1MH0A 1NY22 1V2OT 2C8ZB 3K2UA 1XVMA 4DJZB 3RXLA 4Q7YA 8GCHF 3QX5H 1F92A 4CHAC 2FYRA 1GI2A 4D7GA 2HOBA 4FUFA 1Z8JB 2UUJB 1JOUB 1KLTA 3NUMA 3M5MA 1FN8A 1O2LA 1BTUA 2A7CA 1WQSA 1Z8GA 4Z6AH 3V0XA 3D62A 3SOSA 4NIXA 1Z71A 5GIBA 2ZDAH 5A8ZA 2JH6D 3RC4A 1AGJA 3P8FA 2B8OH 8ESTE 4F49A 3PMJA 3NPSA 1NFUA 2W7UA 2SNVA 1MTUA 3ZYDA 2SGQE 4KELA 1G36A 1GVKB 3V3MA 2PTCE 2ZP0H 1AVWA 2THFB 3RU4T 3U98H 1QIXB 1GMCG 2FS9A 1MQ5A 3SQHE 3A7TA 1ZGVA 4GHQA 4WF8A 1FXYA 2ZPRA 3BTME 4I8JA 3QDZB 1DICA 3K6ZA 4GCHG 1BHXB 2BD7A 5DJ7A 3O8CA 2FIRH 2WPLS 4O9VA 4TY7A 3TJUA 4JZIA 4B75A 5JBTA 1UHBA 2H9EH 3GDUA 3SNCA 3RXOA 3UY9A 2WPJS 2BDGA 3GY4A 1WOFA 1GBJA 4HGCA 2BD9A 1KXEA 1FAXA 2BB4A 4AGKA 1SLXB 2AGGX 1GI5A 3E8LA 1V2MT 3HGPA 5EXNA 1GBBA 3A86A 1GHVH 3PV4A 4TYDA 4YOIA 2CV3A 4IW4E 4KGAA 1MD7A 3SW2B 1SR5C 5A2MH 2BOHB 5JBCS 2Z6BD 1PYTC 3HKIB 4E7NA 1Z7KA 1ORFA 5BPEA 4YT7H 3KQDA 3U8RH 1JRSA 3MH4A 1O2VA 4YESB 3EGKH 1TA6A 2Z94A 2ALPA 2AH4X 4AYVB 1VITG 4BTTB 3MO9A 3BEUA 1OOKB 1F5KU 1D3PB 1SGTA 2Z3EA 5F03A 1QL8A 1YC0A 1O38A 1T7CA 1TGNA 4FVBA 1YCPM 1JRTA 1GJ4H 4JK6A 2GT7A 3WY8A 3SV7A 1DFPA 2Q6FA 4RN6A 1ZMJA 2HRVA 1GMCF 4FUJA 1ZTLA 4TWWA 1Y3YA 2FX4A 1WU1A 3IG6B 3MOCA 4ABDA 2Q6DA 1CO7E 1O2RA 1GBEA 3M7QA 5LH8A 5FXLA 1LPKB 1AUJA 1UVTH 3RXRA 4UONA 1T8OA 2OD3B 1B7XB 3GYMA 1WTHD 1K1IA 1J16A 1Y3WA 1TPOA 3TVJB 3FZDA 2VIDA 1ZR0A 2AEIH 3S9AA 3ZZ9A 1SGYE 1LKAA 3E0NB 1J17T 5B6OA 2PKAB 2Z3DA 1C2DA 1W7GH 3SV2H 2SGAA 1NFYA 4ZHLU 1O31A 3S9CA 4ZAEA 1ESAA 2A7HA 2BQ6B 2BXUH 3ITIA 2G5NA 5J4SA 2YNBA 3L33A 3LGWA 3FFGA 1UO6A 1TQ0B 2XW9A 3E90B 2BMGB 1C5RA 5L2YH 1S85A 1CA8B 1K1MA 4BAHB 1C5MD 3ZZCA 4INLA 1Z8RA 2GV7A 1VGCC 3QGNB 3RXGA 5A8XA 1PPFE 4AYYB 2A7JA 5DK1A 1WCZA 2D2DA 3MFJA 1VGCB 5CMXH 4R8TB 3F1SB 3TIUA 3UR6A 1A5IA 2FLBH 2H6MA 1FPCH 4I7YH 3KIDU 6CHAC 1P9SA 1UTMA 1MZDA 4ASHA 1SLWB 2EC9H 4UDWH 1C2HA 3QUMP 1O2HA 1DM4B 2QXJA 3RM0H 1WV7H 1YM0A 1QJ6B 2SFAA 2SGPE 4NFFA 1DWBH 1Y5BT 3QO6A 3ZZBA 4A92A 1MTNC 3SORA 3RUOA 1AN1E 1F0UA 1KLIH 3SJIA 1OKXA 4CRAA 4YO9A 1SI5H 1MU8B 1QQUA 2BD4A 2Z9JA 4CRDA 1YCPH 3A7YA 1MTNB 3ZZAA 2I6SA 1LHEH 1ZHRA 2A4OA 4IGDA 4YT6H 5DKMA 3ZZ7A 4K8BA 2TIOA 1HAOH 1AI8H 1BTXA 4X8SH 3NKKA 1TALA 2G81E 3PWCA 4LZ4B 1C5YB 2AERH 1EP6A 4NSYA 3KNXA 2BM2A 3TJOA 1P2JA 4CREA 3T28A 4XBDA 5G4BA 2GX4A 1P06A 3S7HB 1RJXB 1SGIB 1KSNA 1S6HA 4AORA 2NU2E 1UTNA 1C1PA 1Y5AT 1CHOF 2HGTH 1HYLA 1GJAB 1C5WB 2G52A 1QB6A 1S0QA 5FCKA 1SLVB 1QBNA 1PPEE 1INCA 3RXIA 2VVCA 3MU0A 4MNVA 3FZZA 1EAUA 1O3EA 1O5CB 1TX8A 2CGAA 5C1UA 4YLUA 1O5AB 2ANKH 2R3YA 1LVYA 5C20A 5GWZA 4ZUHA 1C1QA 4JZDH 1O2SA 4NIYA 1O2TA 2FTLE 3KQCA 2GZ9A 1HJAC 1QFKH 1KXFA 4X8TH 1ELBA 4ISIH 4FU8A 3ZVCA 3NK8A 4Q7ZA 1DXWA 2QY0B 3VB6A 1H9LB 1VZQH 5AFZH 1OPHB 2EI8A 3GCOA 2O8WA 2SGDE 1UHBB 4RKOB 5EPNA 2QF0A 1HJAB 1XKAC 1P10A 2HALA 4FUCA 3P8GA 1UCYK 1GBTA 3NWUA 1ABIH 1D3DB 1RGQA 1XUIA 3FP8E 3PLBA 1D3TB 5TJXA 4DGJA 2J9NA 1GBIA 2ZFFH 2ODYB 2ZHFH 1VCPA 1DWDH 3GISB 2M5TA 2BY8X 5ETXA 1UK2A 2XC0A 2PUXB 1YF4A 2VB0A 1GDUA 1IQJA 2Z9IA 3U1JB 2ILNA 4NZLA 3SUDA 3U8TH 1FI8A 4A5TS 4Y0ZE 1TYNA 1TBZH 3P8OA 5EGMA 5K0HA 4B2AA 2XBVA 2ZQ2A 1C9TA 1BMAA 4HFPB 5EXLA 5FCRA 1C5PA 3R3GB 1ETRH 1TMTH 1SGCA 1GBDA 1IAUA 1SLUB 3KGPA 2XWBI 1W8BH 3T25A 1V2LT 1UMAH 3RXHA 1TGSZ 1MKXK 4NZQA 4TPIZ 4NWLA 4Y11E 4DY7B 1MTWA 1W10U 4DURA 4LK4A 4ZXXH 5JBAS 3PLPA 2GP9B 1G2LA 3QN7A 1HAVA 1P2OA 1SGQE 1C1WH 1GG6B 1HJ8A 2ZA5A 1P2IA 2PTNA 4B2CA 4D76A 2AFQB 2Y7ZA 1A5GH 3GY3A 3AW1A 5E0JA 1C1SA 4ABFA 1NRNH 1O5DH 3D49H 4MPUA 1P2MA 2V35A 3U1IB 1RXPA 2PKSC 2BLWA 4X8UH 3MTYA 1GBHA 2STAE 1W0ZU 2BLVA 2ZNKH 2ALVA 3A7WA 2FO9A 3UNRA 4X6MA 3FP7E 3SNBA 1YPEH 1CA0C 1C2GA 1FN6A 2H5DA 4CR9A 1GI6A 1TB6H 1ANCA 4Y7AA 2A4RA 1NO9H 1CA0B 3P92A 3STIA 3QWCH 3ODFA 1AHTH 3NXPA 1C1MA 1E0FD 1RTFB 4K1EA 4Y6DA 1MAYA 2SGFE 2AYWA 3E16B 2GGVB 2VINA 2H5CA 1C1UH 5EQRA 1A0HB 1ESBA 1EAWA 1TABE 1E35B 2BDHA 3A80A 4B2BA 1UVOA 4IMQA 5HM9A 2IJOB 4KKDA 1P12E 3G01A 3GY6A 1B0FA 4WY3A 1HAXB 1KYNA 3OU0A 2GCTB 5C2ZA 3PM3A 3LGTA 1G37A 3RXTA 3UOUA 3ATLA 1TAWA 1LQDB 1LMWB 4IMZA 3DD2H 1FY1A 4H6SB 7ESTE 1GI4A 1NZQH 3TGJE 1MMJN 2A5KA 2GZ7A 1GGDC 1S81A 2V3HH 3LONA 3TGKE 5T6DA 5BRRE 5GXPA 4KP0A 4DIHH 1GGDB 1EP5A 3MU8A 4AFUA 1KXAA 1C1VH 1P57B 4FU7A 3I78A 1GL0E 4FUIA 5LPRA 2Y5FA 4ZKRU 3M5NA 4I31A 3M61U 4Y8YA 1MBMA 2XCFA 3LOXA 1ELDE 1QL9A 3EE0B 4ABEA 2B5TB 4E06H 1TBQH 2ZECA 3B8JA 1O33A 1AWHB 1OWJA 3TJNA 2FXRA 3PTBA 5E8EH 2FYQA 3VGCC 1P03A 1DVAH 3T29A 3QTVH 1C1NA 3MNXA 2RDLA 2GVFA 2BHGA 3F6UH 3KHVA 1XUGA 2ZC9H 1DDJA 3VGCB 2BY9X 4DCDA 1Y3UA 5J4QA 1LPZB 3DHKH 4ZKOU 1G30B 1K9OE 4B71A 4FUHA 4X1PU 3RC6A 1EJNA 1BZXE 1P11E 2XBXA 4E7RG 1CBWC 1K1PA 2FS8A 2AS9A 1RRKA 1TQ7B 3N7OA 2Z9GA 3QGJA 1A0JA 2W3IA 1F0RA 1ETTH 1CBWB 1QB1A 1O2MA 2OC1A 5C5OA 2NU1E 1NM6A 1B0EA 1Z1IA 2RCEA 1FZZA 1TNJA 3PYHA 1TPSA 1V3XA 3A7ZA 1GI1A 3DT0H 1O3IA 2JETC 2R0KA 3SJKA 4OGXA 1KIGH 3GDSA 4AB9A 3UIRA 1TPPA 2JETB 5AFYH 2CHAC 5DPAA 3TH2H 1K1JA 1JIRA 3ZVFA 4X1QU 1EQ9A 3TGIE 3GY8A 2XBYA 1TIOA 3GOVB 2CHAB 2FI4E 5A0CA 1TNGA 3BIUH 2A5AA 1TGCA 3PMAB 5IDKA 1KLJH 1FIWA 1U6QA 4OGYA 5DP8A 1C1RA 1HB0B 1SGFA 1IQGA 1SGPE 1OYQA 5GCHG 1YPJH 3ATWA 1SGNE 1SQOA 3ZV8A 1MCVA 1MTVA 2G4UA 4ISHH 1ZJKA 2ZTXA 3LKWA 3RXKA 4UFFH 1O5GH 4U01A 3VB7A 2A2QH 1FAKH 2ZF0H 3D65E 1UTJA 4AG1A 1HAIH 4GHTA 3D23A 2J92A 1TOCB 1G2MA 4O3TA 1C5XB 1Y59T 4CRBA 1FONA 3VB4A 4CHAB 1KDQA 3SJ8A 1OWEA 1L4DA 2ZDLA 2ZI2H 5LGOA 1N8OC 1GDNA 1HAVB 1THPB 3OX7U 1G3CA 1KXCA 1C5VA 3BEIB 1ANBA 4I8HA 1Z6JH 1H9HE 1LVBA 2STBE 1P0SH 1N8OB 4MTBA 2VIVA 1A1RA 1F2SE 4RSPA 4CRFA 3ZZ6A 1DY8A 4OS4A 4A1TA 5EU8A 2BY7X 1XKBC 1BMMH 2Z9LA 5T3HA 5DP9A 1QHRB 2VVVA 1GMDG 3RXUA 5F8TA 1GI3A 1QCPA 1C9PA 3SO3A 1O0DH 1W3CA 4SGAE 2ZGXH 4NIVA 3RM2H 1OWDA 1RFNA 1ZHPA 3S9BA 1EJAA 2VIPA 4NGAH 2FOCA 1D6RA 1V2UT 3URCA 1IQLA 1HUTH 2XBWA 1GI0A 3MU1A 1A3EH 3RXEA 1VCQA 5GCHF 1HAGE 2ESTE 1YYY1 1GJDB 1XUFA 3LJJA 4IBLH 3A8CA 4MPWA 2IPHA 3S7KB 4JZ1A 4ABAA 4WH6A 3VB3A 4K1TA 2FWWA 2XC4A 2VU8E 2FP7B 1AFQC 2XRCA 2ZIQH 2VJ1A 5EQSA 1O2OA 1ZTKA 7KMEH 4AB8A 5EG4A 1QA7A 3TK6A 1SHYA 3PWBA 5LPFA 1H9IE 1AFQB 2OXSA 2K1QA 4AFZA 4X2XA 2KAIA 1LHGH 1V2ST 4TWYA 3L3TA 3W95A 6LPRA 1W2KH 2V0BA 1C2JA 4HZHA 1HAYB 1ZSJA 4NCYA 2TGTA 5E0GA 1UCYH 1GBCA 3PB1E 3ZZ3A 5EQQA 4BNRA 1NC6A 1S83A 1YPHE 2OQ5A 1BTZA 1Z8IB 2BOKA 2BDYA 2QAAA 3GY5A 2FZZA 2ZHEH 1BBRH 1P01A 3VEQB 2DE9A 5DP5A 5JBBS 2J95A 2VIQA 1TA2A 4B74A 2H9TH 2QIQA 2XTTB 4ZMAH 3AW0A 3A8AA 4HI3A 2P3TB 1H8DH 1XM1A 3P95A 1TX6A 3Q3KA 1MAXA 1V2RT 2ZHQH 2BDAA 4GCHF 3GCTG 4JZFH 3L6PA 1RTLA 1SGRE 1O2KA 1UVSH 1AE5A 5ABWA 1D6WA 1HDTH 3SJ9A 1YP9A 1DPOA 4H6TA 1UTKA 1CGIE 4WMFA 4FVDA 4BAKB 1ANEA 1BJVA 1O2PA 1MKXH 1QRWA 3RLWH 1MU6B 3SU5A 1BIOA 1MCTA 2ZCKP 3F68H 6GCHG 5T6GA 1C2IA 5AHGH 2XWAA 1BTPA 1SOTA 2F9UA 4K8YA 4ZXYH 4CRGA 3BTHE 3KN2A 3Q77A 4X2WA 1HRTH 4OS1A 3TK9A 4U32A 2P95A 3AAVA 2EA3A 1AFEH 3ZZ5A 1QY6A 1HIAB 2R3UA 2ASUB 2O9QA 3MH7A 2G4TA 1HFDA 5HXFA 1T8NA 1PFXC 4WXIA 1HLTH 1VITF 1ZZZA 2OBOA 2PGBB 2Z7FE 4OS5A 2ZO3H 4XBCA 3RXQA 1RS0A 2ODPA 3A7VA 1AE8H 6CHAB 1PPBH 3U9AH 3A84A 5JDUB 1Y3XA 1FLEE 1A61H 1Q31A 2VWMA 1SB1H 1FY4A 2BQ7B 3MH6A 5L6NH 3LPRA 2P93A 3ATMA 2Y80A 1W12U 1LKBA 1C5QA 2PLXA 2HNTE 1O2NA 1PQ8A 3HPTB 1DITH 2ANWA 5AVDA 1SMFE 1ZSKA 4DG4A 3UOPA 2QC2A 4ESTE 1DOJA 2B7DH 1DE7H 2OUAA 3QTOH 4FU9A 7LPRA 1ANDA 2XCNA 3SV9A 3P8NA 3SUFA 1KDQB 4I8GA 1GHAG 2VIOA 1NN6A 4CH8B 5SGAE 3ZZ8A 1ID5H 1WQVH 2AIPA 2P3UB 4GLYA 2ZGBH 1YGCH 1ELAA 2WYJA 4IN1A 4WVPE 1BTWA 1GHBG 3SU1A 1A0LA 3K9XB 4MNYA 1GJCB 3UQOA 4LOYH 1QRXA 1GBAA 1YPGH 2TRMA 3PLKA 1QA0A 3U8OH 2WV5A 1AKSA 1BRUP 4XE4A 1GJ5H 2AIQA 4K3JA 4YOJA 1XUKA 2BDCA 5K7RA 1TE0A 2WV4A 2ZDVH 1MZAA 1K21H 4CBOA 2ZFRH 1GMHG 1W0YH 3S69A 3LC5A 2A4GA 1GHZA 2B9LA 3M7UA 1LTOA 1FUJA 1IHTH 1BA8B 4MQAA 4X1SU 2PHBA 4DW2U 3TITA 1GJ6A 5EPYA 1O5EH 4K2YA 2GCHG 1JBUH 1QQ4A 1WUNH 4JYVH 5IYTA 1BBRK 2A5IA 4QT8C 3A88A 2CJIA 2GMTC 4J2YB 1C5UA 1QBOA 3LGVA 3SBKA 1CU1A 4IC6A 1TMUH 2IN2A 5FX5A 2UUKB 3LH3A 2GMTB 2AGIX 4DOQA 2QV1A 1S6FA 3VB5A 1BOQA 1O2ZA 1OYTH 4ZKNU 4BXWA 1ESTA 4FUEA 1DWCH 1AVXA 2IOTA 2OLGA 3A7XA 3A87A 1TLDA 3TH3H 1OX1A 3IWMA 3UREA 2OC0A 3GYLB 2VH6A 3UNSA 1ELFA 1H8IH 3E0PB 3HGNA 2KAIB 1HCGA 1A4WH 1GCDA 2GKVE 3SZNA 5A8YA 4UFGH 3PMHB 4SGBE 1TRNA 2BVSH 3U69H 2BX3A 1C2KA 3B23B 2Y5HA 1C1TA 3DFJA 4YLQH 2BY6X 1V2TT 2H2ZA 5DP6A 1C4Y2 1T4VH 1C5TA 1P04A 1DWEH 3I29A 1SQAA 1DS2E 2UUFB 4Y0YE 2F83A 1YLCA 2G55A 1C1OA 1DT2A 1AUTC 1GWAA 4XFQA 1CQQA 4I8KA 3SU0A 2FEQH 3BN9A 1TFXA 1L4ZA 1IQMA 3OY6U 1S84A 5E2OA 3MO3A 5FX6A 2F9BH 3KCGH 2PKSB 4MPVA 4Q2KA 1BB0B 1G3DA 4ABHA 4ISOA 3RP2A 1NFXA 3RXSA 4JMYA 1MKWK 5E0HA 2C93B 4H42U 1EOLA 1P3CA 1GHXH 2XNIA 3A89A 2BDBA 3CS0A 2FOGA 1G3EA 1UTLM 3RXAA 2V3OH 3BTDE 1AQ7A 1ZMNA 2BZAA 1DXPA 2BZ6H 1C5LH 2JH5D 2GDEH 1F7ZA 3F9HA 2GD4B 2C8XB 3H7OA 2BQWB 4IN2A 1K1OA 2QXIA 2G00A 3IITA 4WWYA 1AZ8A 1O2IA 3HK6B 4UE7H 3SJOA 1KTSB 3Q3YA 2ZPSA 1XMNB 2ZDKA 4INKA 5EW1H 4J1YA 3EDXB 3QZQA 5HYOA 4NFEA 1OWKA 1TX7A 3W94A 4BOHA 1AB9C 2ODQA 1BITA 3OYPA 8LPRA 2I6QA 2QXGA 3TJVA 1AB9B 1P9UA 2ZU4A 1OWHA 2H1UA 2F9OA 1IHSH 2PSXA 1CVWH 1WSSH 1WAYB 3UNQA 1C4V2 4Y71A 3A85A 1PYTD 2C4FH 3E6PH 1UVPA 3EA9A 3Q76A 3RC5A 1GVLA 2F3CE 2D26C 5EOKA 1TWXB 2PW8H 3S0NA 1DSTA 4Y76A 2P16A 1UVUH 2ZGHA 2XXLA 2J4IA 2QYIA 2ZCLP 2O8LA 1ZSLA 3UWJH 4Y10E 4AFQA 4MNWA 1IQEA 2W5EA 4D9RA 1ARBA 2BY5X 2XC5A 1QJ7B 4YOGA 1EB2A 1FIZA 1O3CA 1T4UH 1TMBH 1XXDA 1HBTH 1TNKA 1ZGIA 2ZHDA 3BTQE 3K6YA 2AMDA 1NESE 3PMBB 5FAHA 5L2ZH 1BQYA 3EYDA 2A31A 3C1KA 3FVFB 3MU5A 3TNSA 5EODA 1HAZB 1P8VC 3ESTA 2GZ8A 1A3BH 4BAMB 1Y5UT 1N6XA 1V6DA 2FOAA 2SGEE 2J94A 1O3AA 7GCHG 3HKJB 1S82A 3T5FH 3P17H 2PGQB 4BTUB 8GCHG 1ELTA 5FBIA 1LDTT 2FLRH 3BIVH 1DSUA 3H5CB 2QXHA 5DO4H 4CH2B 1AKSB 4NA9H 1VJAU 5A09A 2ZU1A 2HWLB 1PPCE 4PROA 4FUGA 4IS5A 4ZH8A 2TGDA 3HK3B 1LVOA 2ZPQA 1QURH 1ZPBA 4X2VA 4NA8A 5F6MA 2AGEX 2R2MB 1ELCA 4TPYA 3MH5A 2F91A 3T2NA 1J15A 2Y6TA 1EPTA 4NIWA 4Q80A 2EI7A 1EATA 3RXCA 1A5HA 1EASA 4X6PA 2QCYA 1DX5M 4F4OC 3LGIA 4O97A 4Q7XA 1HV7A 1P2NA 1L0ZA 4X6NA 1CT2E 4ABBA 2UWOA 1NTPA 1GCTC 2ULLA 1FJSA 2XYAA 3BTKE 4X0WU 1XUHA 2QGRA 1QB9A 3M36A 1GCTB 3SU6A 4THNH 1V2JT 3LT3A 3A8DA 1GI9B 5CE1A 3SNDA 2QF3A 3AVZA 1J14A 1J8AA 1O3JA 2OBQA 4UFDH 3SHCH 1GBLA 1JXPA 2PV9B 2ZKSA 3M5OA 2O8TA 4JYUH 2PSYA 2AMQA 3ELAH 3ZVEA 3KQEA 1LVMA 1SGEE 3VXFH 2WPHS 3E91A 1NU7B 4GVUA 2NU0E 4JYTA 3ZZDA 5CHAC 1UCYE 4OS7A 7GCHF 5C1YA 1FY8E 2VWLA 1O3HA 5CHAB 1QJ1B 3SV6A 4A6LA 1BBRE 3M3TA 1FDPA 1G32B 1H1BA 3UWIA 1FV9A 2BD8A 1L1JA 2P59A 1NU9A 1O2JA 3UUZA 1MUEB 1GBFA 1TGBA 1ELEE 5T6FA 2F9NA 1HXEH 1DUEA 2CXVA 1K22H 1XVOA 5GJ4B 3EA7A 3V12A 2VH0A 3O8DA 4UEHH 1AD8H 1TRMA 1XX9A 4O03A 5C1XA 1O3LA 4K69A 2TBSA 1EAIA 2ZFTA 5C5NA 2EEKA 2LPRA 2BLOA 1JMOH 4BAQB 3TLOA 2JH0D 3T27A 5PTPA 1PQ7A 2O8UA 1IQKA 1AU8A 2ZU2A 2PFEA 1GDQA 1WYKA 1BUIA 1OSSA 4D8NA 9ESTA 1ZRKA 1O3MA 9LPRA 1Z6EA 2TPIZ 2ZDMA 3OTJE 4OS2A 1YPHC 3HATH 4UD9H 1C4U2 1QBVH 4Y8XA 1HJ9A 3V13A 1K1LA 1HAHH 3RXJA 2WPIS 4KTSA 3RXBA 4XSKU 4IC5A 1AIXH 1CT0E 3M3SA 1EB1H 1RIWC 1O37A 3A83A 1CT4E 3URDA 4O3UA 1E38B 3ZVGA 3BEFB 1MD8A 3SQEE 3LC3A 1RIWB 1HGTH 1VJ9U 2OCVB 3P70B 2GTBA 2ZWLH 1ARCA 3NCLA 1VITH 3M37A 4XOJA 3BV9B 2ANMH 4WMEA 1IQFA 1LQEA 1DLKB 3LJOA 1ZJDA 4DVAU 1C2EA 2A0QB 1KXBA 2G51A 1KY9A 2A2XH 2FOHA 1ZOMA 1D3QB 4WXVA 2BDIA 4XDEA 1CHGA 5EW2H 3TNTA 1UK4A 1SPJA 4K60A 2BVRH 2A32A 3KEEA 2PWXA 3BF6H 1DLEA 4E05H 5A0AE 2Z9KA 1O3NA 1O3KA 1Y3VA 1W14U 3BG8A 1GMDF 1EOJA 3DUXH 3ZV9A 1EJMA 1BT7A 1ZHMA 3EQ0H 3SNEA 4DT7B 4X8VH 2VWOA 2F9VA 2FESH 4H4FA 1O3FA 3ZVBA 2P3FH 1P2KA 2ZFSA 1Y8TA 1E34B 1F0SA 3C27B 4LZ1H 4BANB 1EXFA 1Q3XA 1GJ9B 1IQNA 1O2WA 3BTWE 3RXFA 3GICB 1GI8B 1T8LA 2Y5GA 4Y79A 3M3VA 4X2YA 3F9GA 3E3TA 4Y7BA 1FY3A 2C3SA 1GHYH 3EAJA 1BMNH 3R0FA
chains in the Genus database with same CATH superfamily
3SU3A 5EXMA 4VGCC 1NRQH 3DSGA 4Z1MD 2CF9H 3BTTE 1LPGB 3GCHC 3SGBE 8KME2 4X6OA 2R0LA 4VGCB 2HNTC 1THRH 2C90B 3OE7D 5A0BA 1D4PB 1NFWA 3SNAA 2HVYB 3KQ5A 3GCHB 2WPKS 3KYGA 1TNIA 2HPQH 1O2XA 1EPTC 2ZHWH 1GJ7B 1SSXA 1C2LA 1CHOG 1BTHH 1GL1A 5I46H 3MI4A 3NZIA 2BYAX 4A1XA 3V7TA 3RU4D 3ZVAA 2AMPA 2OC7A 1EPTB 1KXDA 2ZFQH 5C0TA 1O3DA 3MYWA 3QLPH 3RXDA 1OP0A 1LHFH 2OK5A 3SYJA 1M9UA 1GJBB 2ZQ1A 1O36A 4BTIB 1MKWH 1P2QA 1ZLRA 2OQUA 6ESTA 5HM2A 1YWUA 3SZEA 2ZGJA 1OXGA 5C3NA 1ZTJA 1RTKA 4HTCH 1BRCE 4B1TA 1FX0B 4AOQA 3CS7A 2LNCA 3P6ZB 1KMHB 3SI4H 2SNWA 2WUCA 2VWNA 4AX9H 2ZDNA 2C8YB 4K1SA 3UR9A 1L2EA 2D1JA 1IOEA 4B6FA 3GCNA 2BD3A 1C2MA 4UFEH 1BCUH 4GPGA 3LH1A 4D7FA 3OY5U 1T31A 4AN7A 2FI5E 1G9IE 3GCTF 2BD5A 1NT1A 1H4WA 2BD2A 3SUGA 1P3EA 5IK2D 2PR3A 2Y7XA 2UWPA 1SVPA 4MNXA 3STJA 2OTVA 4MG3A 4FUBA 1O3BA 1ZYOA 4AZ2B 5H4IB 3T26A 1MQ6A 1E1QD 2QN5T 6GCHF 2VVUA 3RMOH 2FDAA 1C2FA 3JZ2B 1BRAA 4D9QA 1K2I1 1NROH 3E1XB 4INHA 4MLFB 5JB9S 2FTMA 2Q1JA 3O8BA 3CENA 1PJPA 1ZMLA 3T62A 1PQAA 2J98B 3LGUA 4I8LA 2RA0A 3MWIU 4FUDA 1V2KT 1TONA 3I77A 2J97A 1C5SA 5FPSA 1K28D 1V2QT 2ZZUH 3GY2A 3TH4H 4F55A 1WTGH 5ESBA 4ABJA 1N1LA 1GVZA 4OS6A 1AMHA 5GDSH 2DE8A 4WMDA 1AVGH 1NS3A 2P8OC 2B0FA 2W3KA 1WBGB 4AG2A 1SFIA 4ABGA 2TGAA 3F2GA 1CGHA 4A7IB 3TK5A 1YPKH 1D9IA 1W7XH 2P8OB 1BMLA 2WYGA 4R0IA 1XUJA 2QA9E 3RMNH 2NU4E 1P05A 2G8TA 2V6NA 5DP4A 1UK3A 1EZSC 4ISLA 4JCNA 2WUBA 2FOBA 4JK5A 1BHXF 1LCYA 5DP7A 1EAXA 1L1NA 1X7AC 4MVNA 1FPHH 4RKJB 4B73A 1TRYA 2WZQA 1F0TA 4ZHAA 1J9CH 1Q2WA 2GV6A 4XD7D 5HGGA 4TY6A 4LXBH 3KL6A 5GPIB 2RDEA 4ACBA 4WJG2 3A81A 3ZZ4A 1QGFA 1AY6H 3RMLH 1GHAF 4ZROA 2OC8A 1W11U 1YY3A 1YLDA 3LGYA 5F8XA 1ZRBA 1FY5A 1HPGA 2W26A 2OP9A 1F5RA 1NPMA 2YNAA 3H7TA 3Q00A 2ZG0H 2WPMS 3SV8A 2FOEA 3PROA 1IQIA 5HMAA 1B5GH 2UUYA 3M7TA 5JB8S 2FMJA 3QZRA 1GHBF 2TGPZ 4U2WA 4NSVA 1V2NT 3ZYEA 4YZUA 3LU9B 2FOMB 2ZU3A 4ZHMU 1EZQA 4M7GA 2DUCA 3ZVDA 1ABJH 3CP7A 3JZ1B 3TPIZ 1ETSH 1TNLA 4MPXA 2BLQA 2GDDA 1SG8B 1UJ1A 3Q3XA 2BX4A 3FAOA 4BXSA 5FPTA 3UQVA 3SU4A 4WH8A 2CF8H 1LHDH 1ELVA 2BTCE 1GG6C 1L1GA 1GPZA 1O2UA 1EKBB 3K65B 4DIIH 5DGJA 2EI6A 1GMHF 3VPKA 1E36B 1SC8U 2P94A 1O2QA 2Y82A 2ZU5A 4K5ZA 1BDAA 3A82A 1NRPH 1PQ5A 1TPAE 2JJ2D 3AASA 3RMMH 1C5NH 2ZFPH 1PPHE 1DUAA 1S0RA 1CE5A 1SGFG 1O30A 1P09A 2GCHF 1SFQB 1OP8A 4CR5A 5C67A 1ELGA 1C5ZB 1GJ8B 3SI3H 2W7SA 1O3OA 1SHHB 2JIZD 1T8MA 1O5BB 2UWLA 3A8BA 1VR1H 2Y81A 4GAWA 1KTTB 2YOLA 3DA9B 3OFND 1O32A 1GBKA 1O5FH 1O2YA 1YPMH 1SL3A 1K1NA 3MNBA 1EX3A 2BVXH 1V2WT 1YCPK 2FM2A 5I25A 4GUXA 3VXEH 1AO5A 2ZTYA 2HNTF 1TOMH 1QL7A 5FPYA 2Z3CA 1NRRH 1AZZA 1S5SA 3MNCA 3M5LA 1SBWA 1MTSA 2CMYA 5F8ZA 2FODA 1F5LA 2ZEBA 5TCCA 3EA8A 4MDSA 3UTUH 4YM9A 2GCTC 3RXVA 1LO6A 1A46H 2GT8A 2HVXA 2RG3A 1XXFA 5L30H 1SGDE 1JWTA 1PPZA 2KFWA 2PUQH 3BSQA 3ATKA 1AWFH 3SGAE 2NU3E 1BTYA 2XOKD 1TBRH 2EY4C 4ISNA 2HLDD 3KF2A 1O2GH 5DG6A 1OP2A 3PV5A 5E2PA 4ZKSU 2A1DB 3PTNA 3M35A 1GHWH 3RU4E 4CBNA 5AF9H 3FANA 1W13U 2FX6A 1MBQA 2VNTA 2NWNA 2VGCC 1PPGE 3F2HA 1G3BA 3FP6E 1E37B 3ATIA 3MNSA 1RD3B 3LDXH 1VCWA 5DN6D 5JPMH 3F9EA 2VIWA 3SN8A 2VGCB 1ZPCA 2C8WB 2J34A 3ENSB 1THSH 2FOFA 1O34A 3O8RA 1EZXC 2A45B 2PP6A 1TGTA 3MHWU 2D8WA 4U30A 4YTAA 1T32A 4I33A 3GDVA 1HXFH 2FI3E 2G5VA 1YPLH 1EZUC 1O3GA 1QR3E 1CGJE 3RXMA 3VFEA 1FNIA 1HNEE 3SU2A 2R2WU 4X1NU 2RA3A 3BG4C 3SUEA 3LIWA 1ACBE 4XBBA 4AFSA 4JZEH 3F9FA 3MO6A 3DFLA 3BTEE 4B6EA 2H9HA 1BRBE 5JYIA 3BG4B 1FMGA 2PKAA 2J38A 4KTUA 1YKTA 1GI7B 1P02A 1UTPA 2ZTZA 2R9PA 3PO1C 1O35A 1BJUA 3SHAH 4NWKA 3B9FH 2ZCHP 5LPEA 1BMFD 1JIMA 1O3PB 2WINI 1FQ3A 1YBWA 4X1RU 1V2VT 2FPZA 3BTFE 3PO1B 1IQHA 3UPEA 1QTFA 2O8MA 4FXGH 1DANH 3MMGA 1DY9A 5DP3A 2ZGCA 1HIAA 3OSYA 1SQTA 1OS8A 4AGJA 1A7SA 4CRCA 4A1VA 2F9PA 1ZPZA 3BTGE 4NA7A 4I32A 1O39A 2XNDD 1GBMA 3FO8D 2J2UA 3AAUA 3SGQE 3TU7H 4Y8ZA 3RLYH 4B76A 2HLCA 3RXPA 4Z0KA 4KTCA 2CN0H 1QNJA 2OINA 2KCYA 1V2PT 1N6YA 1QRZA 2ANYA 1TNHA 3MU4A 1C5OH 1NRSH 3WW7A 1CSOE 4GSOA 2BXTH 4NG9H 3MQKC 3KQBA 3RDZA 2JKHA 1A2CH 5ESTE 5EIYA 5TCAA 3GY7A 4ABIA 1Z1JA 1UTQA 1EUFA 3QK1A 1UTOA 2A4QA 2HPPH 3UFAA 5FHTA 1OWIA 4BAOB 1SOZA 3ODDA 1HAPH 2QE7D 2Q6GA 1LHCH 5FBEA 1MH0A 1NY22 1V2OT 2C8ZB 3K2UA 2V3MA 1XVMA 4ACAA 4DJZB 3RXLA 4Q7YA 8GCHF 3QX5H 1F92A 4CHAC 2FYRA 1GI2A 2RFKC 2WPDD 4D7GA 2HOBA 4FUFA 1Z8JB 2UUJB 1JOUB 2YMSB 1KLTA 3NUMA 3M5MA 1FN8A 1O2LA 1BTUA 2A7CA 1WQSA 2LP6A 1Z8GA 4Z6AH 3V0XA 3D62A 3SOSA 4NIXA 1Z71A 5GIBA 2ZDAH 5A8ZA 2JH6D 3RC4A 1AGJA 3P8FA 3FOAA 2B8OH 8ESTE 4F49A 3PMJA 3NPSA 1NFUA 2W7UA 2SNVA 1MTUA 3ZYDA 2SGQE 4KELA 1G36A 1GVKB 5F53A 2PTCE 3V3MA 2ZP0H 1AVWA 2THFB 3RU4T 3OEHD 3U98H 3F0OA 1QIXB 1GMCG 2FS9A 1MQ5A 3SQHE 3A7TA 1ZGVA 4GHQA 4WF8A 1FXYA 2ZPRA 1VKYA 3BTME 4I8JA 3QDZB 1DICA 3K6ZA 4GCHG 1BHXB 2BD7A 2WHXA 5DJ7A 3O8CA 2FIRH 3WWBA 2WPLS 2W6JD 4O9VA 4TY7A 3TJUA 4JZIA 4B75A 5JBTA 1UHBA 2H9EH 3GDUA 3SNCA 3RXOA 3UY9A 2WPJS 2BDGA 4DT4A 3GY4A 1WOFA 1GBJA 4HGCA 2BD9A 1KXEA 1FAXA 2BB4A 4AGKA 1SLXB 2AGGX 1GI5A 1NBMD 3E8LA 1V2MT 3HGPA 5EXNA 1GBBA 3A86A 1GHVH 3PV4A 4TYDA 4YOIA 2CV3A 4IW4E 4KGAA 1MD7A 3SW2B 1SR5C 5A2MH 2BOHB 5JBCS 2Z6BD 1E1RD 1PYTC 3HKIB 4E7NA 1Z7KA 1ORFA 5BPEA 4YT7H 3KQDA 3U8RH 1JRSA 3MH4A 1O2VA 4YESB 3EGKH 1TA6A 2Z94A 2ALPA 2AH4X 4AYVB 1VITG 4BTTB 3MO9A 3BEUA 1OOKB 1F5KU 1D3PB 1SGTA 2Z3EA 5F03A 1QL8A 1YC0A 1O38A 1T7CA 1TGNA 4FVBA 1YCPM 1JRTA 3N7EA 1GJ4H 4JK6A 2GT7A 3WY8A 3SV7A 1DFPA 2Q6FA 4RN6A 1ZMJA 2HRVA 1GMCF 4FUJA 1ZTLA 4TWWA 1Y3YA 2FX4A 1WU1A 3IG6B 3MOCA 4ABDA 2Q6DA 1CO7E 1O2RA 1GBEA 3M7QA 2KX4A 5LH8A 5FXLA 1LPKB 1AUJA 1UVTH 3RXRA 4UONA 1T8OA 2OD3B 1B7XB 3GYMA 1WTHD 1K1IA 1J16A 1Y3WA 1TPOA 3TVJB 3FZDA 2VIDA 1ZR0A 2AEIH 3S9AA 3ZZ9A 1SGYE 1LKAA 3E0NB 2KR7A 3H09A 1J17T 5B6OA 2PKAB 2WSSD 2Z3DA 1C2DA 1W7GH 3SV2H 2SGAA 1NFYA 4ZHLU 1O31A 3S9CA 4ZAEA 1ESAA 2A7HA 2BQ6B 2BXUH 3ITIA 2G5NA 5J4SA 2YNBA 3L33A 3LGWA 3FFGA 1UO6A 1TQ0B 2XW9A 3E90B 2BMGB 1C5RA 5L2YH 1S85A 1CA8B 1K1MA 4BAHB 1C5MD 5CDFE 3ZZCA 4INLA 1Z8RA 2GV7A 1VGCC 3QGNB 3RXGA 5A8XA 1PPFE 4AYYB 2A7JA 5DK1A 1WCZA 2D2DA 3MFJA 1VGCB 5CMXH 4R8TB 4YXWD 1MABB 3F1SB 3TIUA 3UR6A 1A5IA 2FLBH 2H6MA 1FPCH 4I7YH 3KIDU 6CHAC 1P9SA 1UTMA 1MZDA 4ASHA 1SLWB 2EC9H 4UDWH 1C2HA 3OEED 1O2HA 3QUMP 1DM4B 2QXJA 3RM0H 1WV7H 1YM0A 1QJ6B 2SFAA 2SGPE 4NFFA 1DWBH 1Y5BT 3QO6A 3ZZBA 4A92A 1MTNC 3SORA 3RUOA 1AN1E 1F0UA 1KLIH 3SJIA 1OKXA 4CRAA 4YO9A 1SI5H 1MU8B 1QQUA 2BD4A 2Z9JA 4CRDA 1YCPH 3A7YA 1MTNB 3ZZAA 2I6SA 1LHEH 1ZHRA 2A4OA 4IGDA 4YT6H 5DKMA 3ZZ7A 4K8BA 2TIOA 1HAOH 1AI8H 5EJLA 1BTXA 4X8SH 3NKKA 1TALA 2G81E 3PWCA 4LZ4B 1C5YB 2AERH 1EP6A 4NSYA 3KNXA 2BM2A 3TJOA 1P2JA 4CREA 3T28A 4XBDA 5G4BA 2GX4A 2M2AA 1P06A 1OHHD 3S7HB 1RJXB 1SGIB 1KSNA 1S6HA 4AORA 1S6LA 2NU2E 1EFRD 1UTNA 1C1PA 1Y5AT 1CHOF 2HGTH 1HYLA 1GJAB 1C5WB 2G52A 1QB6A 1S0QA 2V7QD 5FCKA 1SLVB 1QBNA 1PPEE 1INCA 3RXIA 2VVCA 3MU0A 4MNVA 3FZZA 1EAUA 1O3EA 1O5CB 1TX8A 2CGAA 2VBCA 5C1UA 4YLUA 1O5AB 2ANKH 2R3YA 1LVYA 5C20A 5GWZA 4ZUHA 1C1QA 4JZDH 1O2SA 4NIYA 1O2TA 2FTLE 3KQCA 2GZ9A 1HJAC 1QFKH 1KXFA 2K0QA 4X8TH 1ELBA 4ISIH 4FU8A 3ZVCA 3NK8A 4Q7ZA 1DXWA 2QY0B 3VB6A 1H9LB 1VZQH 5AFZH 1OPHB 2EI8A 3GCOA 2O8WA 2SGDE 1UHBB 4RKOB 5EPNA 2QF0A 1HJAB 1XKAC 3PRDA 1P10A 2HALA 4FUCA 3P8GA 1UCYK 1GBTA 3NWUA 1ABIH 1D3DB 1RGQA 1XUIA 3FP8E 3PLBA 1D3TB 5TJXA 4DGJA 2J9NA 1GBIA 2ZFFH 2ODYB 2ZHFH 1VCPA 1DWDH 3GISB 2M5TA 2BY8X 3F2FA 5ETXA 1UK2A 2XC0A 2PUXB 1YF4A 2VB0A 1GDUA 1IQJA 2Z9IA 3U1JB 2ILNA 4NZLA 3SUDA 3U8TH 1FI8A 4A5TS 4Y0ZE 1TYNA 1TBZH 3P8OA 5EGMA 5K0HA 4B2AA 2XBVA 2ZQ2A 1C9TA 1BMAA 4HFPB 5EXLA 5FCRA 1C5PA 3R3GB 1ETRH 1TMTH 1SGCA 1GBDA 1IAUA 1SLUB 3KGPA 2XWBI 1W8BH 3T25A 3ZIAD 1V2LT 1UMAH 3RXHA 1TGSZ 1MKXK 4I86A 4NZQA 4TPIZ 4NWLA 4Y11E 1NBME 4DY7B 1MTWA 1W10U 4DURA 4LK4A 4ZXXH 2W6ID 3PLPA 5JBAS 2GP9B 1G2LA 3QN7A 1HAVA 1P2OA 1SGQE 1C1WH 1GG6B 1HJ8A 2ZA5A 1P2IA 2PTNA 4B2CA 4D76A 2AFQB 2Y7ZA 1A5GH 3GY3A 3AW1A 5E0JA 1C1SA 4ABFA 1NRNH 1O5DH 3D49H 4MPUA 1P2MA 2V35A 3U1IB 1RXPA 2PKSC 2BLWA 4X8UH 2KZ4A 3MTYA 1GBHA 2STAE 1W0ZU 2BLVA 2ZNKH 2ALVA 3A7WA 5FL7D 2FO9A 3UNRA 4X6MA 3FP7E 3DCLA 3SNBA 1YPEH 1CA0C 1C2GA 1FN6A 2H5DA 2JDID 4CR9A 1GI6A 1TB6H 1ANCA 4Y7AA 2A4RA 1NO9H 1CA0B 3P92A 3STIA 3QWCH 3ODFA 1AHTH 3NXPA 1C1MA 1E0FD 1RTFB 4K1EA 4Y6DA 1MAYA 2SGFE 2AYWA 3E16B 2GGVB 2VINA 2H5CA 1C1UH 5EQRA 1A0HB 1ESBA 1EAWA 1TABE 1E35B 2BDHA 3A80A 4B2BA 1UVOA 4IMQA 5HM9A 2IJOB 4KKDA 3N7DA 1P12E 3G01A 1SQRA 3GY6A 1B0FA 4WY3A 1HAXB 1KYNA 3OU0A 2GCTB 5C2ZA 3PM3A 3LGTA 4Q4LA 1G37A 3RXTA 3UOUA 3ATLA 1TAWA 1LQDB 4RT0A 1LMWB 4IMZA 3DD2H 1FY1A 4H6SB 7ESTE 1GI4A 1NZQH 3TGJE 1MMJN 2A5KA 5EJZA 2GZ7A 1GGDC 1S81A 4FOUC 2V3HH 3LONA 3TGKE 5T6DA 5BRRE 5GXPA 4KP0A 4DIHH 1GGDB 1EP5A 3MU8A 4AFUA 1KXAA 1C1VH 1P57B 4FU7A 3I78A 1GL0E 4FUIA 5LPRA 2Y5FA 4ZKRU 3M5NA 3F3BA 3M61U 1W0KD 4I31A 4Y8YA 1MBMA 2XCFA 3LOXA 1ELDE 1QL9A 3EE0B 4ABEA 2B5TB 3N99A 4E06H 1TBQH 2ZECA 3B8JA 1O33A 1AWHB 1OWJA 3TJNA 2FXRA 3PTBA 5E8EH 2FYQA 3VGCC 1P03A 1DVAH 3T29A 3QTVH 1C1NA 4Q63A 4XRNA 3MNXA 2RDLA 2GVFA 2BHGA 3F6UH 3KHVA 1XUGA 2ZC9H 1DDJA 3VGCB 2BY9X 4DCDA 1Y3UA 5J4QA 1LPZB 3DHKH 4ZKOU 1G30B 1K9OE 4B71A 4FUHA 4X1PU 3RC6A 1EJNA 1BZXE 1P11E 2XBXA 4E7RG 1CBWC 1K1PA 2FS8A 2AS9A 1RRKA 1TQ7B 3N7OA 2Z9GA 3QGJA 1A0JA 2W3IA 1F0RA 1ETTH 1CBWB 1QB1A 1O2MA 2OC1A 5C5OA 2NU1E 1NM6A 1B0EA 1Z1IA 2RCEA 1FZZA 1TNJA 3PYHA 1TPSA 1V3XA 3A7ZA 1GI1A 2JJ1D 3DT0H 5C0UA 1O3IA 2JETC 2R0KA 3SJKA 4OGXA 1KIGH 3GDSA 4AB9A 3UIRA 1TPPA 2JETB 5AFYH 2CHAC 5DPAA 3TH2H 1K1JA 1JIRA 3ZVFA 4X1QU 1EQ9A 2QF5A 3TGIE 3GY8A 2XBYA 1TIOA 3GOVB 2CHAB 2FI4E 5A0CA 1TNGA 3BIUH 2A5AA 1TGCA 3PMAB 5IDKA 1KLJH 1FIWA 1U6QA 4OGYA 5DP8A 1C1RA 1HB0B 1SGFA 1IQGA 1SGPE 1OYQA 5GCHG 1YPJH 3ATWA 1SGNE 1SQOA 3ZV8A 1MCVA 1MTVA 2G4UA 4ISHH 1ZJKA 2ZTXA 3LKWA 3RXKA 4UFFH 1O5GH 4U01A 3VB7A 2A2QH 1FAKH 2ZF0H 3D65E 1UTJA 2L74A 4AG1A 1HAIH 4GHTA 3D23A 2J92A 1TOCB 1G2MA 4O3TA 1C5XB 1Y59T 4CRBA 1FONA 3VB4A 4CHAB 2QF4A 1KDQA 3SJ8A 1OWEA 1L4DA 2ZDLA 2ZI2H 5LGOA 1N8OC 1GDNA 1HAVB 1THPB 3OX7U 5EJ1A 1G3CA 1KXCA 1C5VA 3BEIB 1ANBA 4I8HA 4TSFD 1Z6JH 1H9HE 1LVBA 2STBE 1P0SH 1N8OB 3F0PA 4MTBA 2VIVA 1A1RA 1F2SE 4RSPA 4CRFA 3ZZ6A 1DY8A 4OS4A 4A1TA 5EU8A 2BY7X 1XKBC 1BMMH 2Z9LA 5T3HA 5DP9A 1QHRB 2VVVA 1GMDG 3RXUA 5F8TA 1GI3A 1QCPA 1C9PA 3SO3A 1O0DH 1W3CA 4SGAE 2ZGXH 4NIVA 3RM2H 1OWDA 1RFNA 1ZHPA 3S9BA 1EJAA 2VIPA 3EE7A 4NGAH 2FOCA 1D6RA 1V2UT 3URCA 1IQLA 1HUTH 2XBWA 1GI0A 3MU1A 1A3EH 3RXEA 1VCQA 5GCHF 1HAGE 5GNDA 2EQNA 2ESTE 1YYY1 1GJDB 1XUFA 3LJJA 4IBLH 3A8CA 4MPWA 2IPHA 3S7KB 4JZ1A 4ABAA 4WH6A 3VB3A 4K1TA 2FWWA 2XC4A 2VU8E 2FP7B 1AFQC 1H8HD 2XRCA 2VJ1A 2ZIQH 1O2OA 1ZTKA 5EQSA 7KMEH 4AB8A 5EG4A 1QA7A 3TK6A 1SHYA 3PWBA 5KEDA 5LPFA 1H9IE 1AFQB 2OXSA 2K1QA 4AFZA 4X2XA 2KAIA 1LHGH 1V2ST 4TWYA 3L3TA 3W95A 6LPRA 1W2KH 2V0BA 1C2JA 4HZHA 1HAYB 1ZSJA 4NCYA 2TGTA 5E0GA 4ZCNA 1UCYH 1GBCA 3PB1E 3ZZ3A 5EQQA 4BNRA 1NC6A 1S83A 1YPHE 2OQ5A 1BTZA 1Z8IB 2BOKA 2BDYA 2QAAA 3GY5A 2FZZA 2ZHEH 1BBRH 1P01A 5CHBA 3VEQB 2DE9A 5DP5A 5JBBS 2J95A 2VIQA 1TA2A 4B74A 2H9TH 2QIQA 2XTTB 4ZMAH 3AW0A 3A8AA 4HI3A 2P3TB 5DSFA 1H8DH 1XM1A 3P95A 1TX6A 3Q3KA 1MAXA 1V2RT 2ZHQH 2BDAA 4GCHF 3GCTG 4JZFH 3L6PA 1RTLA 1SGRE 1O2KA 5HKKD 1UVSH 1AE5A 5ABWA 1D6WA 1HDTH 3SJ9A 1YP9A 3FKSD 1DPOA 3DSPA 1UTKA 1CGIE 4H6TA 4WMFA 4FVDA 1WDIA 1ANEA 4BAKB 1BJVA 1O2PA 1MKXH 1QRWA 3RLWH 1MU6B 3SU5A 1BIOA 1MCTA 2ZCKP 3F68H 6GCHG 5T6GA 1C2IA 5AHGH 1UW7A 2XWAA 1BTPA 1SOTA 2F9UA 4K8YA 4ZXYH 4CRGA 3BTHE 3KN2A 3Q77A 4X2WA 1HRTH 4OS1A 3TK9A 4U32A 2P95A 3AAVA 2EA3A 1AFEH 3ZZ5A 1QY6A 1HIAB 2R3UA 2ASUB 2O9QA 3MH7A 2G4TA 1HFDA 5HXFA 1T8NA 1PFXC 3CNRA 1HLTH 1VITF 1ZZZA 4WXIA 2OBOA 2PGBB 1SKYE 2Z7FE 4OS5A 2ZO3H 4XBCA 3RXQA 1RS0A 2ODPA 3A7VA 1AE8H 6CHAB 1PPBH 3U9AH 3A84A 5JDUB 2CK3D 3WWFA 1Y3XA 1FLEE 1A61H 1Q31A 2VWMA 1SB1H 1FY4A 2BQ7B 3MH6A 5L6NH 3LPRA 2P93A 3ATMA 2Y80A 1W12U 1LKBA 1C5QA 2PLXA 2HNTE 1O2NA 1QZ8A 1PQ8A 3HPTB 1DITH 2ANWA 5AVDA 1SMFE 1ZSKA 4DG4A 3UOPA 2QC2A 4ESTE 1DOJA 2B7DH 1DE7H 2OUAA 3QTOH 4FU9A 7LPRA 1ANDA 2XCNA 3SV9A 3P8NA 3SUFA 1KDQB 4I8GA 1GHAG 2VIOA 1NN6A 3AK5A 4CH8B 5SGAE 3ZZ8A 1ID5H 1WQVH 2AIPA 2P3UB 4GLYA 2ZGBH 2F43B 1YGCH 1ELAA 2WYJA 4IN1A 4WVPE 4F48B 1BTWA 1GHBG 3SU1A 1A0LA 3K9XB 4MNYA 1GJCB 3UQOA 4LOYH 1QRXA 1GBAA 1YPGH 2TRMA 3PLKA 1QA0A 3U8OH 2WV5A 1AKSA 1BRUP 4XE4A 1GJ5H 2AIQA 2LELA 4K3JA 4AC9A 4YOJA 1XUKA 2BDCA 5K7RA 1TE0A 2WV4A 2ZDVH 1MZAA 1K21H 4CBOA 2ZFRH 1GMHG 1W0YH 5HIZA 3S69A 3LC5A 2KCOA 2A4GA 1GHZA 1E79D 3VG8A 2B9LA 3M7UA 1LTOA 1FUJA 1IHTH 5C17A 1BA8B 4MQAA 4X1SU 2PHBA 2AHME 4DW2U 3TITA 1GJ6A 5EPYA 1O5EH 4K2YA 2GCHG 1JBUH 1QQ4A 1WUNH 3OAAD 4JYVH 1BBRK 2A5IA 4QT8C 5IYTA 3A88A 2CJIA 2GMTC 4J2YB 1C5UA 1QBOA 3LGVA 3SBKA 1CU1A 4IC6A 1TMUH 2IN2A 5FX5A 2UUKB 3LH3A 2GMTB 2AGIX 4DOQA 2QV1A 1S6FA 3VB5A 1BOQA 1O2ZA 1OYTH 4ZKNU 4BXWA 1ESTA 4FUEA 1DWCH 1AVXA 2IOTA 2OLGA 3A7XA 3A87A 1TLDA 3TH3H 1OX1A 3IWMA 3UREA 2OC0A 3GYLB 2VH6A 3UNSA 1ELFA 1H8IH 3E0PB 3HGNA 2KAIB 1HCGA 4P00A 1A4WH 1GCDA 2GKVE 3SZNA 5A8YA 4UFGH 3PMHB 4SGBE 1TRNA 2BVSH 3U69H 2BX3A 1C2KA 3B23B 2Y5HA 1C1TA 3DFJA 4YLQH 2BY6X 1V2TT 2H2ZA 5DP6A 1C4Y2 1T4VH 2WV9A 1C5TA 1P04A 1DWEH 3I29A 1SQAA 1DS2E 2UUFB 4Y0YE 2F83A 1YLCA 2G55A 1C1OA 1DT2A 1AUTC 1GWAA 3PV2A 4XFQA 1CQQA 4I8KA 4HG6A 4RI0A 3SU0A 2FEQH 3BN9A 1TFXA 1L4ZA 2YMSD 1IQMA 3OY6U 1S84A 5E2OA 3MO3A 5FX6A 2F9BH 3KCGH 2PKSB 4MPVA 4Q2KA 1BB0B 1G3DA 4ABHA 4ISOA 3RP2A 1NFXA 3RXSA 4JMYA 1MKWK 5E0HA 2C93B 4H42U 1EOLA 1P3CA 1GHXH 2XNIA 3A89A 2BDBA 3CS0A 2FOGA 1G3EA 1UTLM 3RXAA 2V3OH 3BTDE 1AQ7A 1ZMNA 2BZAA 1DXPA 2BZ6H 1C5LH 2JH5D 2GDEH 1F7ZA 3F9HA 2GD4B 2C8XB 3H7OA 2BQWB 4IN2A 1K1OA 2QXIA 2G00A 3IITA 4WWYA 1AZ8A 1O2IA 3HK6B 4UE7H 3SJOA 1KTSB 3Q3YA 3NRLA 2ZPSA 1XMNB 2ZDKA 4INKA 5EW1H 4J1YA 3EDXB 3QZQA 5HYOA 4NFEA 1OWKA 1TX7A 3W94A 4BOHA 1AB9C 2ODQA 1BITA 3OYPA 8LPRA 2I6QA 2QXGA 3TJVA 1AB9B 1YLNA 1P9UA 3KYFA 2ZU4A 1OWHA 2H1UA 2F9OA 1IHSH 2PSXA 1CVWH 1WSSH 1WAYB 4TT3D 3UNQA 1C4V2 4Y71A 3A85A 2C4FH 1H8ED 1PYTD 3E6PH 1UVPA 3EA9A 3Q76A 3RC5A 5C94A 1GVLA 2F3CE 2L6OA 2D26C 2IPQX 5EOKA 1TWXB 2PW8H 3S0NA 1DSTA 4Y76A 2P16A 1UVUH 2ZGHA 2XXLA 2J4IA 2QYIA 2ZCLP 2O8LA 1ZSLA 3UWJH 4Y10E 4AFQA 4MNWA 1IQEA 2W5EA 4D9RA 1ARBA 2BY5X 2XC5A 1QJ7B 4YOGA 4ASUD 1EB2A 1FIZA 1O3CA 1T4UH 1TMBH 1XXDA 1HBTH 1TNKA 1ZGIA 2ZHDA 3BTQE 3K6YA 2AMDA 1NESE 3PMBB 5FAHA 1W0JD 5L2ZH 1BQYA 3EYDA 2A31A 3C1KA 3FVFB 3MU5A 3TNSA 5EODA 1HAZB 1P8VC 5KGOA 3ESTA 2GZ8A 1A3BH 4BAMB 1Y5UT 1N6XA 1V6DA 2FOAA 2SGEE 2J94A 1O3AA 7GCHG 3HKJB 2K8IA 1S82A 3T5FH 3P17H 2PGQB 4BTUB 8GCHG 1ELTA 5FBIA 1LDTT 2FLRH 3BIVH 1DSUA 3H5CB 2QXHA 5DO4H 4CH2B 1AKSB 4NA9H 1VJAU 5A09A 2ZU1A 4FETA 2HWLB 1PPCE 4PROA 4FUGA 4IS5A 3DSOA 2IJD1 4ZH8A 2TGDA 3HK3B 1LVOA 2ZPQA 1QURH 1ZPBA 4X2VA 4NA8A 5F6MA 2AGEX 2R2MB 1ELCA 4TPYA 3UB0A 3MH5A 3FN8A 2F91A 1K0HA 3T2NA 1J15A 2Y6TA 1EPTA 4NIWA 4Q80A 2EI7A 1EATA 3RXCA 1A5HA 1EASA 4P02A 4X6PA 2QCYA 1DX5M 4F4OC 3LGIA 4O97A 4Q7XA 1HV7A 1P2NA 1L0ZA 4X6NA 1CT2E 4ABBA 2UWOA 1NTPA 1GCTC 5T1VA 2ULLA 1FJSA 2XYAA 3BTKE 4X0WU 1XUHA 3PRBA 2QGRA 1QB9A 3M36A 1GCTB 3SU6A 4THNH 1V2JT 3LT3A 3A8DA 1GI9B 5CE1A 3SNDA 2QF3A 3AVZA 1J14A 1J8AA 1O3JA 2OBQA 4UFDH 3SHCH 1GBLA 1JXPA 2PV9B 2ZKSA 3M5OA 2O8TA 4JYUH 5KECA 2PSYA 2AMQA 3ELAH 3ZVEA 3KQEA 1LVMA 1SGEE 3VXFH 2WPHS 3E91A 3GS9A 1NU7B 4GVUA 2NU0E 4JYTA 3ZZDA 5CHAC 1UCYE 4OS7A 7GCHF 5C1YA 1FY8E 2VWLA 1O3HA 5CHAB 2YMSC 1QJ1B 1COWD 3SV6A 4A6LA 1BBRE 3M3TA 1FDPA 1G32B 1H1BA 3UAIC 3UWIA 1FV9A 2BD8A 1L1JA 2P59A 1NU9A 1O2JA 2J98A 3UUZA 1MUEB 1GBFA 1TGBA 1ELEE 5T6FA 2F9NA 1HXEH 1DUEA 2CXVA 1K22H 1XVOA 5GJ4B 3EA7A 3V12A 2VH0A 3O8DA 4UEHH 1AD8H 1TRMA 1XX9A 4O03A 5C1XA 1O3LA 4K69A 2TBSA 1EAIA 2ZFTA 5C5NA 2EEKA 2LPRA 2BLOA 1JMOH 4BAQB 3TLOA 2JH0D 3T27A 5PTPA 1PQ7A 2O8UA 1IQKA 1AU8A 2ZU2A 2PFEA 1GDQA 3OTPA 1WYKA 1BUIA 1OSSA 4M9FA 3W1EA 4D8NA 1WXRA 9ESTA 1ZRKA 1O3MA 9LPRA 1Z6EA 2TPIZ 2ZDMA 3OTJE 4OS2A 1YPHC 3HATH 4UD9H 1C4U2 1QBVH 4Y8XA 1HJ9A 2KCAA 3V13A 1K1LA 1HAHH 3RXJA 2WPIS 4KTSA 3RXBA 4XSKU 4IC5A 1AIXH 1CT0E 3M3SA 1EB1H 1RIWC 1O37A 3A83A 1CT4E 3URDA 4O3UA 1E38B 3ZVGA 2KCPA 3BEFB 1MD8A 3SQEE 3LC3A 1RIWB 1HGTH 1VJ9U 2OCVB 3P70B 2GTBA 2ZWLH 1ARCA 3NCLA 1VITH 3M37A 4XOJA 3BV9B 2ANMH 4WMEA 1IQFA 1LQEA 1DLKB 2KM0A 2F4LA 3U28C 3LJOA 1ZJDA 4DVAU 1C2EA 2A0QB 1KXBA 2G51A 2GJGA 1KY9A 2A2XH 2FOHA 1ZOMA 5HIYA 1D3QB 4WXVA 2BDIA 4XDEA 2J5UA 1CHGA 5EW2H 3TNTA 1UK4A 1SPJA 4K60A 2BVRH 2A32A 3KEEA 2PWXA 3BF6H 1DLEA 4E05H 5A0AE 2Z9KA 1O3NA 1O3KA 1Y3VA 1W14U 3BG8A 1GMDF 1EOJA 3DUXH 3ZV9A 1EJMA 1BT7A 1ZHMA 3EQ0H 3SNEA 4DT7B 4X8VH 2VWOA 2F9VA 2FESH 4H4FA 1O3FA 3ZVBA 2P3FH 1P2KA 2ZFSA 5B6LA 1Y8TA 1E34B 4OM9A 1F0SA 3C27B 4LZ1H 4BANB 1EXFA 1Q3XA 1GJ9B 1IQNA 1O2WA 3BTWE 3RXFA 3GICB 1GI8B 1T8LA 4RT1A 2Y5GA 4Y79A 3M3VA 4X2YA 3F9GA 3E3TA 4Y7BA 1FY3A 2C3SA 1GHYH 3EAJA 1BMNH 3R0FA
chains in the Genus database with same CATH topology
3SU3A 5EXMA 4VGCC 1NRQH 2CF9H 3BTTE 1LPGB 3GCHC 3SGBE 8KME2 4X6OA 2R0LA 4VGCB 2HNTC 1THRH 2C90B 5A0BA 1D4PB 1NFWA 3SNAA 3GCHB 2WPKS 1TNIA 2HPQH 1O2XA 1EPTC 2ZHWH 1GJ7B 1SSXA 1C2LA 1CHOG 1BTHH 1GL1A 5I46H 3MI4A 3NZIA 2BYAX 4A1XA 3V7TA 3RU4D 3ZVAA 2AMPA 2OC7A 1EPTB 1KXDA 2ZFQH 1O3DA 3MYWA 3QLPH 3RXDA 1OP0A 1LHFH 1M9UA 1GJBB 2ZQ1A 1O36A 4BTIB 1MKWH 1P2QA 1ZLRA 2OQUA 6ESTA 5HM2A 2ZGJA 1OXGA 5C3NA 1ZTJA 1RTKA 4HTCH 1BRCE 4B1TA 4AOQA 3CS7A 2LNCA 3P6ZB 3SI4H 4AX9H 2SNWA 2WUCA 2VWNA 2ZDNA 2C8YB 4K1SA 3UR9A 1L2EA 2D1JA 1IOEA 3GCNA 2BD3A 1C2MA 4UFEH 1BCUH 4GPGA 3LH1A 4D7FA 3OY5U 1T31A 4AN7A 2FI5E 1G9IE 3GCTF 2BD5A 1NT1A 1H4WA 2BD2A 3SUGA 1P3EA 2PR3A 2Y7XA 2UWPA 1SVPA 4MNXA 3STJA 2OTVA 4MG3A 4FUBA 1O3BA 1ZYOA 4AZ2B 5H4IB 3T26A 1MQ6A 2QN5T 6GCHF 2VVUA 3RMOH 2FDAA 1C2FA 3JZ2B 1BRAA 4D9QA 1K2I1 1NROH 3E1XB 4INHA 4MLFB 5JB9S 2FTMA 2Q1JA 3O8BA 3CENA 1PJPA 1ZMLA 3T62A 1PQAA 3LGUA 4I8LA 2RA0A 3MWIU 4FUDA 1V2KT 1TONA 3I77A 1C5SA 5FPSA 1K28D 1V2QT 2ZZUH 3GY2A 3TH4H 1WTGH 5ESBA 4ABJA 1N1LA 1GVZA 4OS6A 1AMHA 5GDSH 2DE8A 4WMDA 1AVGH 1NS3A 2P8OC 2B0FA 2W3KA 1WBGB 4AG2A 1SFIA 4ABGA 2TGAA 1CGHA 4A7IB 3TK5A 1YPKH 1D9IA 1W7XH 2P8OB 1BMLA 2WYGA 4R0IA 1XUJA 2QA9E 3RMNH 2NU4E 1P05A 2G8TA 2V6NA 5DP4A 1UK3A 1EZSC 4ISLA 4JCNA 2WUBA 2FOBA 4JK5A 1BHXF 1LCYA 5DP7A 1EAXA 1L1NA 1X7AC 4MVNA 1FPHH 4RKJB 4B73A 1TRYA 1F0TA 4ZHAA 1J9CH 1Q2WA 2GV6A 5HGGA 4TY6A 4LXBH 3KL6A 5GPIB 4WJG2 3A81A 3ZZ4A 1QGFA 1AY6H 3RMLH 1GHAF 4ZROA 2OC8A 1W11U 1YLDA 3LGYA 5F8XA 1ZRBA 1FY5A 1HPGA 2W26A 2OP9A 1F5RA 1NPMA 2YNAA 3H7TA 3Q00A 2ZG0H 2WPMS 3SV8A 2FOEA 3PROA 1IQIA 5HMAA 1B5GH 2UUYA 3M7TA 5JB8S 2FMJA 3QZRA 1GHBF 2TGPZ 4U2WA 4NSVA 1V2NT 3ZYEA 4YZUA 3LU9B 2FOMB 2ZU3A 4ZHMU 1EZQA 4M7GA 2DUCA 3ZVDA 1ABJH 3CP7A 3JZ1B 3TPIZ 1ETSH 1TNLA 4MPXA 2BLQA 2GDDA 1SG8B 1UJ1A 3Q3XA 2BX4A 3FAOA 4BXSA 5FPTA 3UQVA 3SU4A 4WH8A 2CF8H 1LHDH 1ELVA 2BTCE 1GG6C 1L1GA 1GPZA 1O2UA 1EKBB 3K65B 4DIIH 5DGJA 2EI6A 1GMHF 3VPKA 1E36B 1SC8U 2P94A 1O2QA 2Y82A 2ZU5A 4K5ZA 1BDAA 3A82A 1NRPH 1PQ5A 1TPAE 3AASA 3RMMH 1C5NH 2ZFPH 1PPHE 1DUAA 1S0RA 1CE5A 1SGFG 1O30A 1P09A 2GCHF 1SFQB 1OP8A 4CR5A 5C67A 1ELGA 1C5ZB 1GJ8B 3SI3H 2W7SA 1O3OA 1SHHB 1T8MA 1O5BB 2UWLA 3A8BA 1VR1H 2Y81A 4GAWA 1KTTB 2YOLA 3DA9B 1O32A 1GBKA 1O5FH 1O2YA 1YPMH 1SL3A 1K1NA 3MNBA 1EX3A 2BVXH 1V2WT 1YCPK 2FM2A 5I25A 4GUXA 3VXEH 1AO5A 2ZTYA 2HNTF 1TOMH 1QL7A 5FPYA 2Z3CA 1NRRH 1AZZA 1S5SA 3MNCA 3M5LA 1SBWA 1MTSA 2CMYA 5F8ZA 2FODA 1F5LA 2ZEBA 5TCCA 3EA8A 4MDSA 3UTUH 4YM9A 2GCTC 3RXVA 1LO6A 1A46H 2GT8A 2HVXA 2RG3A 1XXFA 5L30H 1SGDE 1JWTA 1PPZA 2PUQH 3BSQA 3ATKA 1AWFH 3SGAE 2NU3E 1BTYA 1TBRH 4ISNA 3KF2A 1O2GH 5DG6A 1OP2A 5E2PA 4ZKSU 2A1DB 3PTNA 3M35A 1GHWH 3RU4E 4CBNA 5AF9H 3FANA 1W13U 2FX6A 1MBQA 2VNTA 2NWNA 2VGCC 1PPGE 3FP6E 1G3BA 1E37B 3ATIA 3MNSA 1RD3B 3LDXH 1VCWA 5JPMH 3F9EA 2VIWA 3SN8A 2VGCB 1ZPCA 2C8WB 2J34A 3ENSB 1THSH 2FOFA 1O34A 3O8RA 1EZXC 2A45B 1TGTA 3MHWU 2D8WA 4U30A 4YTAA 1T32A 4I33A 3GDVA 1HXFH 2FI3E 2G5VA 1YPLH 1EZUC 1O3GA 1QR3E 1CGJE 3RXMA 3VFEA 1FNIA 1HNEE 3SU2A 2R2WU 4X1NU 2RA3A 3BG4C 3SUEA 3LIWA 1ACBE 4XBBA 4AFSA 4JZEH 3F9FA 3MO6A 3DFLA 3BTEE 2H9HA 1BRBE 5JYIA 3BG4B 1FMGA 2PKAA 2J38A 4KTUA 1YKTA 1GI7B 1P02A 1UTPA 2ZTZA 2R9PA 3PO1C 1O35A 1BJUA 3SHAH 4NWKA 3B9FH 2ZCHP 5LPEA 1JIMA 1O3PB 2WINI 1FQ3A 1YBWA 4X1RU 1V2VT 2FPZA 3BTFE 3PO1B 1IQHA 3UPEA 1QTFA 2O8MA 4FXGH 1DANH 3MMGA 1DY9A 5DP3A 2ZGCA 1HIAA 3OSYA 1SQTA 1OS8A 4AGJA 1A7SA 4CRCA 4A1VA 2F9PA 1ZPZA 3BTGE 4NA7A 4I32A 1O39A 1GBMA 2J2UA 3AAUA 3SGQE 3TU7H 4Y8ZA 3RLYH 4B76A 2HLCA 3RXPA 4Z0KA 4KTCA 2CN0H 1QNJA 2OINA 1V2PT 1N6YA 1QRZA 2ANYA 1TNHA 3MU4A 1C5OH 1NRSH 1CSOE 4GSOA 2BXTH 4NG9H 3KQBA 3RDZA 2JKHA 1A2CH 5ESTE 5TCAA 3GY7A 4ABIA 1Z1JA 1UTQA 1EUFA 3QK1A 1UTOA 2A4QA 2HPPH 3UFAA 5FHTA 1OWIA 4BAOB 1SOZA 3ODDA 1HAPH 2Q6GA 1LHCH 5FBEA 1MH0A 1NY22 1V2OT 2C8ZB 3K2UA 1XVMA 4DJZB 3RXLA 4Q7YA 8GCHF 3QX5H 1F92A 4CHAC 2FYRA 1GI2A 4D7GA 2HOBA 4FUFA 1Z8JB 2UUJB 1JOUB 1KLTA 3NUMA 3M5MA 1FN8A 1O2LA 1BTUA 2A7CA 1WQSA 1Z8GA 4Z6AH 3V0XA 3D62A 3SOSA 4NIXA 1Z71A 5GIBA 2ZDAH 5A8ZA 2JH6D 3RC4A 1AGJA 3P8FA 2B8OH 8ESTE 4F49A 3PMJA 3NPSA 1NFUA 2W7UA 2SNVA 1MTUA 3ZYDA 2SGQE 4KELA 1G36A 1GVKB 3V3MA 2PTCE 2ZP0H 1AVWA 2THFB 3RU4T 3U98H 1QIXB 1GMCG 2FS9A 1MQ5A 3SQHE 3A7TA 1ZGVA 4GHQA 4WF8A 1FXYA 2ZPRA 3BTME 4I8JA 3QDZB 1DICA 3K6ZA 4GCHG 1BHXB 2BD7A 5DJ7A 3O8CA 2FIRH 2WPLS 4O9VA 4TY7A 3TJUA 4JZIA 4B75A 5JBTA 1UHBA 2H9EH 3GDUA 3SNCA 3RXOA 3UY9A 2WPJS 2BDGA 3GY4A 1WOFA 1GBJA 4HGCA 2BD9A 1KXEA 1FAXA 2BB4A 4AGKA 1SLXB 2AGGX 1GI5A 3E8LA 1V2MT 3HGPA 5EXNA 1GBBA 3A86A 1GHVH 3PV4A 4TYDA 4YOIA 2CV3A 4IW4E 4KGAA 1MD7A 3SW2B 1SR5C 5A2MH 2BOHB 5JBCS 2Z6BD 1PYTC 3HKIB 4E7NA 1Z7KA 1ORFA 5BPEA 4YT7H 3KQDA 3U8RH 1JRSA 3MH4A 1O2VA 4YESB 3EGKH 1TA6A 2Z94A 2ALPA 2AH4X 4AYVB 1VITG 4BTTB 3MO9A 3BEUA 1OOKB 1F5KU 1D3PB 1SGTA 2Z3EA 5F03A 1QL8A 1YC0A 1O38A 1T7CA 1TGNA 4FVBA 1YCPM 1JRTA 1GJ4H 4JK6A 2GT7A 3WY8A 3SV7A 1DFPA 2Q6FA 4RN6A 1ZMJA 2HRVA 1GMCF 4FUJA 1ZTLA 4TWWA 1Y3YA 2FX4A 1WU1A 3IG6B 3MOCA 4ABDA 2Q6DA 1CO7E 1O2RA 1GBEA 3M7QA 5LH8A 5FXLA 1LPKB 1AUJA 1UVTH 3RXRA 4UONA 1T8OA 2OD3B 1B7XB 3GYMA 1WTHD 1K1IA 1J16A 1Y3WA 1TPOA 3TVJB 3FZDA 2VIDA 1ZR0A 2AEIH 3S9AA 3ZZ9A 1SGYE 1LKAA 3E0NB 1J17T 5B6OA 2PKAB 2Z3DA 1C2DA 1W7GH 3SV2H 2SGAA 1NFYA 4ZHLU 1O31A 3S9CA 4ZAEA 1ESAA 2A7HA 2BQ6B 2BXUH 3ITIA 2G5NA 5J4SA 2YNBA 3L33A 3LGWA 3FFGA 1UO6A 1TQ0B 2XW9A 3E90B 2BMGB 1C5RA 5L2YH 1S85A 1CA8B 1K1MA 4BAHB 1C5MD 3ZZCA 4INLA 1Z8RA 2GV7A 1VGCC 3QGNB 3RXGA 5A8XA 1PPFE 4AYYB 2A7JA 5DK1A 1WCZA 2D2DA 3MFJA 1VGCB 5CMXH 4R8TB 3F1SB 3TIUA 3UR6A 1A5IA 2FLBH 2H6MA 1FPCH 4I7YH 3KIDU 6CHAC 1P9SA 1UTMA 1MZDA 4ASHA 1SLWB 2EC9H 4UDWH 1C2HA 3QUMP 1O2HA 1DM4B 2QXJA 3RM0H 1WV7H 1YM0A 1QJ6B 2SFAA 2SGPE 4NFFA 1DWBH 1Y5BT 3QO6A 3ZZBA 4A92A 1MTNC 3SORA 3RUOA 1AN1E 1F0UA 1KLIH 3SJIA 1OKXA 4CRAA 4YO9A 1SI5H 1MU8B 1QQUA 2BD4A 2Z9JA 4CRDA 1YCPH 3A7YA 1MTNB 3ZZAA 2I6SA 1LHEH 1ZHRA 2A4OA 4IGDA 4YT6H 5DKMA 3ZZ7A 4K8BA 2TIOA 1HAOH 1AI8H 1BTXA 4X8SH 3NKKA 1TALA 2G81E 3PWCA 4LZ4B 1C5YB 2AERH 1EP6A 4NSYA 3KNXA 2BM2A 3TJOA 1P2JA 4CREA 3T28A 4XBDA 5G4BA 2GX4A 1P06A 3S7HB 1RJXB 1SGIB 1KSNA 1S6HA 4AORA 2NU2E 1UTNA 1C1PA 1Y5AT 1CHOF 2HGTH 1HYLA 1GJAB 1C5WB 2G52A 1QB6A 1S0QA 5FCKA 1SLVB 1QBNA 1PPEE 1INCA 3RXIA 2VVCA 3MU0A 4MNVA 3FZZA 1EAUA 1O3EA 1O5CB 1TX8A 2CGAA 5C1UA 4YLUA 1O5AB 2ANKH 2R3YA 1LVYA 5C20A 5GWZA 4ZUHA 1C1QA 4JZDH 1O2SA 4NIYA 1O2TA 2FTLE 3KQCA 2GZ9A 1HJAC 1QFKH 1KXFA 4X8TH 1ELBA 4ISIH 4FU8A 3ZVCA 3NK8A 4Q7ZA 1DXWA 2QY0B 3VB6A 1H9LB 1VZQH 5AFZH 1OPHB 2EI8A 3GCOA 2O8WA 2SGDE 1UHBB 4RKOB 5EPNA 2QF0A 1HJAB 1XKAC 1P10A 2HALA 4FUCA 3P8GA 1UCYK 1GBTA 3NWUA 1ABIH 1D3DB 1RGQA 1XUIA 3FP8E 3PLBA 1D3TB 5TJXA 4DGJA 2J9NA 1GBIA 2ZFFH 2ODYB 2ZHFH 1VCPA 1DWDH 3GISB 2M5TA 2BY8X 5ETXA 1UK2A 2XC0A 2PUXB 1YF4A 2VB0A 1GDUA 1IQJA 2Z9IA 3U1JB 2ILNA 4NZLA 3SUDA 3U8TH 1FI8A 4A5TS 4Y0ZE 1TYNA 1TBZH 3P8OA 5EGMA 5K0HA 4B2AA 2XBVA 2ZQ2A 1C9TA 1BMAA 4HFPB 5EXLA 5FCRA 1C5PA 3R3GB 1ETRH 1TMTH 1SGCA 1GBDA 1IAUA 1SLUB 3KGPA 2XWBI 1W8BH 3T25A 1V2LT 1UMAH 3RXHA 1TGSZ 1MKXK 4NZQA 4TPIZ 4NWLA 4Y11E 4DY7B 1MTWA 1W10U 4DURA 4LK4A 4ZXXH 5JBAS 3PLPA 2GP9B 1G2LA 3QN7A 1HAVA 1P2OA 1SGQE 1C1WH 1GG6B 1HJ8A 2ZA5A 1P2IA 2PTNA 4B2CA 4D76A 2AFQB 2Y7ZA 1A5GH 3GY3A 3AW1A 5E0JA 1C1SA 4ABFA 1NRNH 1O5DH 3D49H 4MPUA 1P2MA 2V35A 3U1IB 1RXPA 2PKSC 2BLWA 4X8UH 3MTYA 1GBHA 2STAE 1W0ZU 2BLVA 2ZNKH 2ALVA 3A7WA 2FO9A 3UNRA 4X6MA 3FP7E 3SNBA 1YPEH 1CA0C 1C2GA 1FN6A 2H5DA 4CR9A 1GI6A 1TB6H 1ANCA 4Y7AA 2A4RA 1NO9H 1CA0B 3P92A 3STIA 3QWCH 3ODFA 1AHTH 3NXPA 1C1MA 1E0FD 1RTFB 4K1EA 4Y6DA 1MAYA 2SGFE 2AYWA 3E16B 2GGVB 2VINA 2H5CA 1C1UH 5EQRA 1A0HB 1ESBA 1EAWA 1TABE 1E35B 2BDHA 3A80A 4B2BA 1UVOA 4IMQA 5HM9A 2IJOB 4KKDA 1P12E 3G01A 3GY6A 1B0FA 4WY3A 1HAXB 1KYNA 3OU0A 2GCTB 5C2ZA 3PM3A 3LGTA 1G37A 3RXTA 3UOUA 3ATLA 1TAWA 1LQDB 1LMWB 4IMZA 3DD2H 1FY1A 4H6SB 7ESTE 1GI4A 1NZQH 3TGJE 1MMJN 2A5KA 2GZ7A 1GGDC