1O2ZA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2zA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2zA02
3TNSA 5L2ZH 4UD9H 3SBKA 4X6OA 1FV9A 4ISNA 4X6PA 2YNBA 3AW0A 3RXMA 3D62A 2SGQE 2GV7A 3NUMA 3Q77A 2V6NA 1GL0E 4JK6A 3SQEE 1RTFB 2VIPA 5E0GA 2DE9A 1BMAA 3UNRA 5B6OA 2G00A 2ZGHA 1TMTH 1ETRH 2ZECA 3TNTA 3T25A 2A7CA 5JB9S 2SGDE 5GIBA 2AMQA 2AFQB 3AAUA 2ODPA 1FN8A 4JYVH 2GT7A 5HMAA 1MKWH 2EI8A 3KF2A 1J14A 1KIGH 1OWJA 3UUZA 2WPHS 5EQQA 1B7XB 1GJBB 1AZ8A 3PMAB 2A0QB 2HRVA 5DP6A 1WQVH 2WINI 2XWBI 3SV7A 2A2XH 1O3AA 5I25A 3MNXA 4TY7A 4BAHB 5FX5A 1P01A 2AH4X 1DWCH 4Z6AH 2W3KA 2ZDVH 1IQIA 4YM9A 1ZHRA 3E91A 3DHKH 5F03A 2VIOA 3QX5H 3QGNB 3A86A 1V2UT 1SQOA 2FODA 4HI3A 4XFQA 1VCWA 1XUHA 1UTQA 2R2WU 2FOFA 3BTHE 3E90B 3HPTB 5EOKA 3KHVA 3I78A 3A7YA 2BLOA 1TNGA 1GL1A 1NROH 2BD3A 1P11E 2Z3EA 2AGIX 3U1IB 1ZOMA 1QCPA 3UPEA 1TA2A 3KL6A 1TONA 2SNVA 3QTOH 1N6XA 4MPUA 4X8TH 1EJMA 3Q3XA 3LONA 2IN2A 3P8NA 4BOHA 2FWWA 5G4BA 1YM0A 1XUFA 4NIYA 4JYUH 4A6LA 4R8TB 4MPVA 3U8RH 3PTBA 4CR5A 1QB6A 1Z71A 8KME2 1GMHF 5AFZH 1Z1IA 1XM1A 3ATMA 5E2PA 1O2UA 1K1OA 2NU0E 1SQTA 3A84A 2TGPZ 2A4QA 2R3UA 1LVBA 4E7NA 2TRMA 2ZDLA 3RMMH 5C1UA 1OXGA 1LQEA 3K6ZA 3KNXA 1GBLA 4Y8ZA 4OGYA 4I8HA 1EAXA 1TNJA 4CRAA 3C1KA 4RN6A 3VPKA 3MU1A 4BTIB 1NZQH 1WYKA 1W11U 1TBRH 1Q3XA 2VWOA 1BHXF 3L3TA 1RIWB 2GZ9A 1EKBB 1XKAC 2BVRH 3ZVFA 4ASHA 1F0UA 2UWOA 2OC8A 4HTCH 2F9PA 1C5PA 2CGAA 3BEIB 1ZMNA 4O3UA 1MD8A 4ZXXH 1C1UH 1O0DH 5EW1H 3RXIA 1XVMA 5DJ7A 1CO7E 1F0TA 1TNKA 2Y5GA 1EZUC 3PV4A 3GISB 1L4ZA 3BTKE 1FN6A 4ISLA 3GCTG 4CRBA 2A32A 1WU1A 3QDZB 5HM9A 1MCTA 1C2IA 1HIAA 1AE8H 1BTYA 1S85A 3SV2H 5HGGA 3WY8A 2W26A 2ZCHP 5ETXA 1OWKA 1SLXB 1BTUA 1FIZA 3L6PA 1UK2A 2IPHA 4I32A 1O2HA 3CS0A 2ZU2A 3E8LA 5FPTA 3FP7E 1RXPA 1C2GA 1IQMA 1FY1A 4H4FA 3LDXH 4D7FA 1GI9B 2UUJB 3EYDA 3Q76A 4Y10E 3PMHB 2TGDA 1CU1A 1CHGA 1RIWC 1O37A 1WSSH 1ACBE 1O2IA 1FIWA 2O8UA 4JZIA 1HAVA 1LPZB 1O2LA 2OC7A 3GOVB 3VB4A 3LC5A 4XBCA 3SU4A 2SGPE 1SGPE 1YPLH 1UTKA 5GJ4B 4ZKRU 1MKXH 4NA7A 3M3TA 1HBTH 4HGCA 2AGGX 1G3CA 1OP0A 2AMPA 1O5EH 1UVPA 2ZHWH 2Q6GA 1F92A 2CF9H 3PMJA 1NFWA 3T28A 1AN1E 1LHCH 1GBMA 1TIOA 2ANWA 4LK4A 3PROA 2ZPSA 4F49A 1HRTH 1OP8A 4OS2A 1KXAA 3M5NA 3H5CB 4Y76A 1S6FA 2W7SA 4SGAE 2ALPA 1AIXH 1HGTH 1CA8B 1OYQA 1V2PT 1HJAB 1YLCA 4DG4A 2BDHA 3RXEA 2AEIH 3SJOA 2A31A 3EE0B 2GD4B 1XXFA 1GI6A 3Q3YA 1C5NH 2VWNA 1AVXA 4Y6DA 2W5EA 3PB1E 4BTUB 1A7SA 1QJ6B 1J9CH 3NK8A 2PGQB 5EQSA 4O3TA 2A2QH 3RXJA 3QLPH 2Y7ZA 3TJUA 4FUDA 3URCA 4K1SA 2STBE 2ZDAH 5BRRE 2NU3E 1ZRKA 2Z3DA 4AFUA 1Y59T 1O2ZA 1HJ9A 1B5GH 1C4U2 1PPFE 2WYGA 3ZYEA 4U01A 1EAIA 2KAIA 1JMOH 2QXJA 4TY6A 1K21H 4X1RU 1O3GA 1SGIB 3STIA 3GCHB 1O2VA 1KLTA 3U8OH 4ZHLU 3M3SA 3MH4A 1X7AC 1AGJA 1O3MA 3AAVA 1GJAB 1BZXE 2EC9H 4Y0YE 3S9BA 3O8CA 1UTOA 2VWMA 4Y7AA 4K60A 2QXIA 2P3FH 1CGIE 5E0HA 2D2DA 2NU2E 3TH2H 1IQEA 1HJAC 5J4QA 2JH5D 1Z6EA 5A8ZA 1P57B 1ZR0A 1SLWB 1W10U 3JZ1B 4ZHAA 5K0HA 1ZGIA 3CS7A 1TPPA 4AX9H 3TVJB 4B2CA 1INCA 1W14U 1O5BB 2QYIA 4BAOB 1O2GH 3GYMA 5JBTA 4AFSA 3SV6A 1FONA 2BLQA 1W12U 2ZGCA 1LDTT 2J2UA 1BOQA 2P8OC 2C8XB 3LPRA 2BDYA 4DURA 1DM4B 1HNEE 1ZSJA 4X2YA 1KTTB 1UO6A 2BD4A 4X1NU 5CHAB 1WQSA 5GPIB 4FU8A 2ZFTA 1JIRA 3UOUA 1RRKA 4O97A 1SGFA 3ZZ4A 3GCHC 3LT3A 4BXWA 2ZU3A 3HATH 1OWIA 2GT8A 2ZEBA 1SB1H 3RXKA 1MQ5A 1IQFA 2J38A 1FAKH 1THSH 1GMHG 4BAQB 1TOCB 2FDAA 1F7ZA 1UVOA 3GY4A 4HFPB 3BTDE 6LPRA 2H9HA 3OU0A 4AGKA 3M5MA 2WV5A 1UTNA 2XCFA 2FM2A 1P3CA 1P10A 4K5ZA 2NU4E 1TGTA 3HGNA 5T6GA 1DY8A 1O30A 3SZNA 1G3EA 5A8YA 4AORA 3P95A 1FZZA 1DS2E 2BXTH 4INKA 4NSYA 1HV7A 3VEQB 1ZTLA 1AMHA 1CT4E 7ESTE 1G2MA 1TQ0B 5C1YA 4ZKSU 1ESAA 5C3NA 1MZAA 1Z1JA 1C5MD 1C5QA 4AFZA 2HLCA 1GBKA 2XTTB 4MLFB 5CHAC 2ZC9H 3TGKE 4NWKA 1FXYA 4WMDA 4A1TA 4ABEA 3AASA 3RC4A 3T62A 3RMNH 2J4IA 4ZKNU 2G55A 3BG8A 1GJ4H 2H5DA 4X1PU 4ESTE 2FZZA 3GDUA 3V7TA 3ITIA 4I33A 1KDQA 2GTBA 3TITA 3A7TA 1P2JA 4ZUHA 1ANDA 1S0RA 1GG6B 1P2NA 1H9IE 2A7JA 3MFJA 3EDXB 4YZUA 1LPKB 3ATKA 1AY6H 4TWYA 2GKVE 3M7QA 1A46H 3E0NB 5FBEA 3U1JB 1UHBA 4KELA 2OCVB 3RM0H 1K1LA 2EI6A 4PROA 1ZTKA 2GCTB 4IMQA 1AO5A 1MTNC 2TPIZ 5DP5A 1T8OA 1HAHH 2BVXH 1L1NA 1SGNE 1EZQA 4IGDA 9LPRA 1YKTA 1GHBF 4CHAC 3DD2H 2BTCE 1CGJE 1PJPA 5DP3A 3SOSA 1VGCB 5FAHA 3UIRA 4MVNA 1WTHD 3BTWE 2SGEE 1NT1A 1AKSB 1N8OB 2P59A 1WCZA 4ABBA 4GSOA 4D7GA 2YNAA 2FYQA 5EPNA 3ZV8A 2HWLB 1H4WA 1ZRBA 2HPQH 1O3FA 4XOJA 1ETTH 2ZFPH 1GBHA 6GCHF 2OP9A 1EB2A 4NSVA 1QR3E 1L4DA 2ZWLH 3BG4B 3LGYA 1C9TA 1NRSH 1DLKB 4WXVA 1TOMH 1OP2A 4MQAA 3EA8A 4GCHF 1EOJA 1G2LA 3SI4H 1GG6C 2GZ8A 2ZGJA 3P17H 3SJIA 2ZKSA 1A5GH 4A1XA 2FEQH 3RXVA 2ZDMA 1ABIH 2GCTC 4YOIA 1THRH 2R0LA 2GDDA 3QZRA 2ZF0H 2FS9A 1O3PB 2GZ7A 1WTGH 2F3CE 7KMEH 3MOCA 3HGPA 1OSSA 1BJVA 3D65E 1L0ZA 1C1OA 1VGCC 5AFYH 3BTTE 5CMXH 3RMLH 4IW4E 1N8OC 2JKHA 1NFYA 3A7ZA 3RXUA 1GHVH 1A0HB 5FCKA 1ANCA 4UFGH 1BT7A 1TRYA 4I7YH 1YGCH 2XRCA 1T8LA 3GICB 2WUBA 1ANBA 3MH7A 2BDIA 2QXGA 2C8YB 5K7RA 3BG4C 2O8WA 4UFFH 4CH8B 3A80A 3RC5A 2PKAA 3RU4D 1BQYA 1GDNA 1XXDA 1VCPA 1C5SA 3TGIE 2FOCA 5L2YH 1BDAA 5L30H 3KQCA 2BQ6B 1RD3B 1CT2E 3M3VA 3F9EA 2HVXA 2PWXA 1TGBA 1ETSH 3C27B 2ZGXH 1JOUB 5JBAS 4CRCA 2QC2A 1BRBE 1VITF 3SNCA 1MKWK 3TJVA 2VJ1A 2XC4A 4UE7H 1L2EA 1AFQB 2Z9IA 5E2OA 2GV6A 1JIMA 1UMAH 4MNXA 4X2VA 1W0ZU 1UTPA 3ZYDA 1CA0B 1FY5A 1QTFA 3K6YA 4MNVA 1O34A 3ZVCA 1G3BA 2G5VA 2PTCE 3M7TA 1CHOF 2P3UB 1Z7KA 1HAYB 1O2RA 1NTPA 1KLIH 1BRCE 3ODDA 1XUGA 3LJOA 5A8XA 5T3HA 7GCHG 5EXNA 4D9QA 3ZZ8A 3SU2A 2ANMH 5AHGH 1BB0B 1ELTA 1O2YA 1TABE 1GBCA 3MMGA 1O2XA 1C2MA 1ANEA 4B75A 3M35A 2QF0A 4XE4A 3TK5A 1EXFA 3SJ9A 1D3PB 3GYLB 4OS7A 1LVMA 1P3EA 4BNRA 1GBAA 5BPEA 1O2OA 1O38A 1C2JA 1A1RA 1M9UA 1HLTH 1MU8B 4ZAEA 5EXLA 1GCTC 3OY6U 5DPAA 1C5WB 2VU8E 2ZPQA 1LVOA 3JZ2B 3TK9A 3PYHA 4MPXA 1RGQA 1SSXA 3QTVH 1DFPA 1YPKH 3MTYA 2ULLA 1AFQC 2JH0D 2F9VA 4GHTA 3T5FH 2WYJA 1RTKA 1BCUH 4E06H 1CA0C 5TCCA 5ESTE 2FOGA 5EG4A 3SN8A 1SFIA 3DA9B 2J9NA 7LPRA 2BDBA 1E38B 2A5AA 3W95A 3MU4A 1JWTA 1SOTA 5C5OA 5A0AE 2ZO3H 5JPMH 1TB6H 2RG3A 1QBNA 3STJA 4B2AA 1W7GH 3UTUH 4U2WA 3HKJB 4FUCA 1EATA 2OC1A 4XBDA 1TRNA 4U32A 2BHGA 3B23B 1FAXA 1QBOA 2GCHF 2RDLA 5DP8A 2ZCKP 1LHGH 3RXTA 3CENA 1A61H 3A7VA 3KQDA 1GBEA 2XBWA 1DDJA 3NXPA 2OINA 4JZ1A 1UCYE 1A0LA 5JBCS 4JCNA 4IN1A 2PFEA 3LJJA 2PR3A 4DJZB 2C90B 1GHBG 4KP0A 5GDSH 3RXDA 5A09A 1GMDG 3IWMA 3RXHA 1FJSA 1TX7A 2H9TH 4RKOB 1TA6A 1FPHH 1P12E 4TPYA 1IQKA 4D8NA 1UCYK 4UDWH 2Z94A 4X2XA 2XC5A 3F9FA 1YP9A 1L1GA 3BTEE 1GHAF 1UTJA 1C5TA 4X6MA 1ZJDA 1DITH 1JBUH 4FUEA 1IHTH 1P05A 3SHCH 1TMBH 6GCHG 3UQOA 3U9AH 1YC0A 2FOEA 5FCRA 5FHTA 1V6DA 1MBQA 3V3MA 1PQ8A 5C20A 4FUFA 2BY8X 3A8CA 2DUCA 3KCGH 2ASUB 4GCHG 3RXBA 5LGOA 5FPYA 3MNCA 2FTLE 2G51A 1ELBA 4Q7ZA 3K2UA 1UCYH 1MAYA 3M36A 4YO9A 3MYWA 1WUNH 3ZZDA 1C1RA 2Q1JA 4U30A 1BRAA 1E34B 1C1QA 2ODYB 3HK3B 3MI4A 1FNIA 5GXPA 3H7OA 4TWWA 3RUOA 5ESBA 4DOQA 3HKIB 3MWIU 2XCNA 2K1QA 2HPPH 1MKXK 2GMTB 1GJ5H 1Z8GA 4YT7H 1ID5H 2WV4A 4RKJB 1T4VH 1ELDE 4TYDA 1DWEH 3IITA 1GJ7B 1EJNA 5TJXA 4CBNA 1LHFH 3V0XA 2A4OA 3A81A 1ABJH 2FPZA 3GDVA 1G36A 4OS6A 3DFLA 1F5LA 3T29A 1D3DB 1V2MT 4J1YA 5A0BA 2AGEX 4ZKOU 3PLKA 3PWBA 1SGCA 2P93A 2GX4A 4KTCA 2VVVA 5J4SA 2UUYA 1C5LH 1WV7H 1BIOA 3A87A 4YTAA 3A83A 2BM2A 1EP6A 2QA9E 1HJ8A 1P2IA 3ZZAA 1CGHA 2XYAA 1QFKH 4GVUA 1VITG 5IYTA 5JBBS 1VZQH 1V2OT 4X1QU 3SORA 2ZDNA 4I31A 1EZXC 1QHRB 3LU9B 4LXBH 4AYVB 2VIDA 3RMOH 2SGAA 3TJOA 2BYAX 3QUMP 3E1XB 1IAUA 1K1NA 5DP9A 5AF9H 3ZZ7A 1AD8H 1BHXB 3UFAA 2PV9B 2Y80A 2GMTC 4YESB 2OBOA 1PPHE 3LGUA 4M7GA 3RXRA 1CHOG 2J95A 5DO4H 4B1TA 4IBLH 2H6MA 1AI8H 1NFXA 3FZZA 1PFXC 4H6TA 3RDZA 2HALA 3OSYA 3R0FA 4FXGH 3SGBE 1ZPCA 3FZDA 1NO9H 1O2WA 3TGJE 2Z9JA 4JZDH 3VB3A 2O8MA 2VIQA 2O8LA 2P8OB 3N7OA 3PO1B 1GJ8B 1HIAB 4IMZA 2F9OA 1CVWH 2EI7A 1C2FA 1NM6A 1BTPA 1O2NA 3LGTA 1O33A 1D6WA 1HAIH 2Y82A 5DP4A 5L6NH 2F9UA 3MU8A 1A2CH 2VWLA 2ZIQH 2UWLA 2WPJS 1GDUA 3KGPA 3MO9A 3RXCA 4MTBA 1XUJA 2Z3CA 2GGVB 1XX9A 1G30B 4XSKU 1V2VT 2BVSH 1J8AA 1VITH 1C1PA 1IQJA 1ELGA 4J2YB 2VVCA 3PWCA 1EB1H 5H4IB 1GJ9B 4DIHH 1GBBA 3NCLA 1TMUH 1YPEH 1HAOH 1HAVB 1JRTA 2FI5E 2P3TB 2FI4E 3SU3A 3MHWU 3SU5A 3PLBA 2WUCA 1SC8U 2C8ZB 2NWNA 1V2ST 2I6SA 1HFDA 2A4GA 3Q00A 2CV3A 1PYTD 4I8KA 3CP7A 4ZMAH 1DWDH 1TNIA 1Y3XA 1H1BA 1QA0A 3PO1C 1DXWA 2BD5A 1C2KA 3BTFE 3S7HB 1O3HA 4AG1A 3BEFB 3TJNA 4ABJA 1ZLRA 1THPB 1GDQA 1ZHPA 3VFEA 2GCHG 2OLGA 1G3DA 3GCNA 3K9XB 1V2NT 1YPJH 2ODQA 4MG3A 1TALA 1MUEB 4CR9A 1O2QA 2CHAB 1QGFA 5C2ZA 1V2QT 1ELEE 2ZFSA 6CHAB 3BIVH 3F68H 1L1JA 3LGVA 1UJ1A 2ZPRA 3SU6A 3FANA 4KTSA 2FTMA 1GHWH 1AFEH 2AYWA 3QK1A 4NA8A 4AYYB 2B7DH 2FIRH 1EPTA 1MTNB 2O9QA 1TRMA 3SUDA 1V2TT 1Y3UA 1GHAG 2CJIA 2W3IA 5EPYA 3SI3H 2KAIB 1O2JA 3MO6A 1F2SE 2VB0A 1FLEE 1SQAA 3EQ0H 5AVDA 3ATIA 4CHAB 1GJDB 4ZH8A 1C5VA 1QRWA 1K1JA 1N1LA 1VR1H 1NRQH 1NN6A 3F6UH 3KQEA 3RU4E 1DSTA 2ZHFH 1AE5A 1P2KA 1GHZA 4Y0ZE 2B0FA 1D3TB 2WPMS 1Y5BT 1MQ6A 8GCHF 5JYIA 3S7KB 1GMCF 1DICA 2UUKB 1AHTH 3GDSA 4X8UH 3TIUA 4GLYA 4NZLA 3ZVEA 2CHAC 1AWFH 2ANKH 4A5TS 1RS0A 3ENSB 1Z6JH 2ZHDA 5EXMA 2D26C 4K3JA 1SGTA 6CHAC 4AN7A 4ABDA 5C5NA 4K2YA 1AQ7A 4KTUA 1OOKB 1BJUA 2OBQA 1YPHC 2VIWA 1HXFH 3GY7A 5FPSA 1K1PA 2FOAA 1FY8E 2Z9KA 2B9LA 2H1UA 1C2LA 1HAPH 3NKKA 4ABFA 4AG2A 4ABHA 1J16A 4XDEA 2CN0H 2QY0B 3A8DA 2ZA5A 5T6FA 3ZVAA 2BOKA 5FBIA 4E7RG 2QF3A 3P8FA 1GVZA 2BD7A 3MNSA 1SGEE 1N6YA 3RU4T 1W3CA 2FLRH 5C67A 3DT0H 3SU0A 1IHSH 1P03A 3UNSA 6ESTA 1B0FA 3EA7A 1ZGVA 3BF6H 1QL9A 2FX6A 1ARCA 4B74A 1Z8JB 1HCGA 1UVSH 1GVLA 1CQQA 2AMDA 1K28D 3EAJA 2Z9GA 2CF8H 3GY3A 1QY6A 3SJKA 1QRZA 1XMNB 4NG9H 3LC3A 3URDA 3BTME 3ZZ9A 3F9GA 1NRNH 2ANYA 1TFXA 1C2HA 3ODFA 1G37A 1S81A 5DKMA 1T8MA 1GJ6A 3S69A 3I77A 3DUXH 3QN7A 3SV9A 5DG6A 1OWEA 1ZZZA 1HXEH 3A85A 3SO3A 3UOPA 1ELCA 1LPGB 4MNYA 3SNAA 4DY7B 5LPFA 1QA7A 2A4RA 1PQ5A 3EGKH 1SHYA 1ZMJA 4BAKB 1KDQB 1A3BH 1MH0A 3ZZ5A 5F8TA 3B9FH 1V2WT 1PPGE 3SNBA 3UR9A 3U8TH 1YPHE 3ZVGA 1A3EH 1O3JA 1UHBB 1E0FD 4A92A 2AIQA 3TLOA 4CRDA 4Q7XA 1GI4A 1K2I1 1QBVH 1K9OE 3S0NA 1UTMA 3BIUH 3VXFH 3A89A 2BY5X 1SGQE 1GGDB 2QAAA 1HB0B 1MTUA 3I29A 1O2SA 2M5TA 2BDGA 1P02A 1AVGH 1MZDA 3FP8E 1C1NA 1C5RA 1S82A 1SHHB 1Z8RA 3EA9A 1GCTB 3LKWA 3VB7A 1U6QA 1S5SA 2A5KA 3ZZCA 1FUJA 3O8DA 4MDSA 3RXAA 2R3YA 4YOJA 3ATWA 1GI5A 1QIXB 3T2NA 1Y3VA 3FFGA 2V0BA 1ELAA 4CBOA 2DE8A 3FVFB 5EW2H 4LZ4B 3MH5A 3TK6A 2Q6DA 5DP7A 4FVBA 1A5IA 3GY6A 3GY2A 1RFNA 3QZQA 1GPZA 2BD2A 1K1IA 3O8BA 3LH1A 1SGFG 2H9EH 3VB6A 4AGJA 1YYY1 3UNQA 4NFEA 2BZAA 1NRRH 3BTGE 2OTVA 1GI0A 2FXRA 4GPGA 5E8EH 1MD7A 1YCPH 2FX4A 1EAUA 1QL8A 2TIOA 1KXBA 3P8OA 4QT8C 1ZSKA 3MU5A 1O5GH 2OUAA 1NPMA 1Q31A 3ZZ6A 2ZQ1A 2FP7B 1UK3A 1OPHB 1GGDC 2JH6D 3KQBA 1EOLA 2FOBA 1GVKB 1F0RA 3LOXA 1O3IA 3A8BA 1AB9B 1ARBA 3E16B 4Q80A 1LCYA 5FX6A 4JK5A 1QQUA 1LKBA 1P8VC 1EAWA 4JZFH 2XC0A 2P16A 1V2LT 3P6ZB 2ZHEH 1P9SA 2O8TA 1DE7H 1Y5UT 2V3OH 1FMGA 4Q2KA 3SUEA 3LH3A 2XWAA 1E35B 4ZHMU 3TH3H 4BTTB 1ZPZA 1BRUP 1DX5M 4CRGA 1GI1A 1P06A 1HAGE 1O3NA 2G5NA 2PKAB 1DUEA 3RXFA 4UEHH 4I8GA 1EASA 3QGJA 2Y5HA 5TCAA 2GVFA 1NS3A 2XW9A 4B71A 8GCHG 1PYTC 1GMCG 2ZTYA 1MAXA 2QGRA 1KSNA 1SR5C 1TPSA 1FI8A 3SNEA 1EUFA 4BANB 3P8GA 3UWJH 3GY5A 1F5RA 1LKAA 2BQ7B 2V35A 1J15A 1ESBA 2NU1E 1DVAH 1DSUA 1GHXH 5GWZA 4DGJA 1FQ3A 3A88A 1D4PB 1OWHA 1AVWA 1V2KT 2STAE 4K1TA 2C4FH 2VVUA 3OYPA 4WXIA 3SV8A 4DIIH 1MTWA 1MU6B 4Q7YA 1TE0A 1AB9C 1C1TA 1C2DA 4WH8A 1Y3YA 1O3DA 4Z0KA 4IN2A 4CRFA 4BXSA 2ZU5A 3OY5U 2ZTXA 1BMLA 1MCVA 5A2MH 1AUTC 1MTVA 2TBSA 2QV1A 4I8LA 2FLBH 1QNJA 1TLDA 1ZJKA 4UFEH 1CBWB 3U98H 4NIVA 3M5LA 1NFUA 2VH0A 1QB1A 2FOMB 3RC6A 1HDTH 1W0YH 1GI8B 5SGAE 2ZG0H 4K1EA 3RXQA 1O2KA 2XBVA 4WJG2 2Q6FA 3A82A 1TX6A 1QRXA 4Y7BA 4BAMB 4FUGA 2F83A 4MNWA 2FYRA 3VB5A 1XUIA 1C9PA 1XKBC 1ZPBA 1P2OA 4O03A 1QQ4A 4XBBA 3UWIA 1DT2A 1IQNA 4GHQA 1PPEE 3BN9A 1KXEA 4ISOA 1CE5A 4INLA 1J17T 2WPLS 1YLDA 1O2TA 1G32B 5T6DA 1S84A 2FOHA 1KY9A 4FUHA 4IC6A 4K8YA 4NFFA 1JXPA 2A1DB 1GWAA 5HXFA 3M37A 1D3QB 3SW2B 4TPIZ 4YLUA 1SBWA 1EJAA 1P0SH 2A7HA 1SGYE 3OTJE 1LHDH 3F9HA 1DANH 1UK4A 1TGNA 5F8ZA 1ZMLA 1GBDA 1T32A 3VGCB 1W8BH 1CBWC 1DPOA 4FU9A 4DW2U 1AZZA 3E0PB 1EP5A 5HM2A 1E36B 1GBTA 1QJ1B 1TX8A 3PTNA 1MMJN 4R0IA 2ZI2H 2BD9A 2H5CA 1RTLA 3ZZBA 3KEEA 1GI7B 1NY22 2BLWA 1SGRE 1PPZA 2BY6X 4X8VH 4Y8XA 4WF8A 4B2BA 1S0QA 1YF4A 1PPCE 1LQDB 5C1XA 2ZFQH 2D8WA 5F6MA 1T4UH 1WOFA 2ZHQH 1LTOA 1SLVB 3SQHE 3NPSA 3SGQE 1O39A 3P92A 2Y81A 4WH6A 3V12A 1AUJA 3T27A 2PKSB 1O2PA 4X0WU 1VCQA 2A45B 1BUIA 1IQGA 2PW8H 3GY8A 3LGIA 2BZ6H 4AB8A 1C4V2 1C1SA 1O3BA 2BDCA 1O3CA 1SL3A 4F4OC 1V2RT 2LNCA 4FUJA 5JB8S 1Y3WA 3PLPA 1C5OH 4HZHA 1O3KA 2SFAA 2Z7FE 4YT6H 3L33A 2VNTA 4ISHH 4FU7A 1DWBH 5EGMA 2VIVA 2R9PA 2Y6TA 1C5XB 3W94A 2W7UA 5A0CA 1BTZA 2V3HH 1KTSB 2ZGBH 1NC6A 3VGCC 2P95A 2ZNKH 3P70B 4WY3A 1HAXB 1YPMH 5GCHF 2TGTA 4WVPE 4GUXA 1TAWA 2ZFFH 1TPAE 2RA0A 3Q3KA 4THNH 2PSXA 4ISIH 2HGTH 1GI3A 4ZXYH 3S9CA 2JETB 4CREA 1O32A 1C1WH 3BTQE 1PQAA 4E05H 4A1VA 3GCOA 1Y5AT 3SUGA 4AZ2B 1LMWB 2OQ5A 1GHYH 1NU9A 1Q2WA 1FY3A 1S83A 4FUIA 2PKSC 1TYNA 2GP9B 4Y8YA 2R0KA 8ESTE 2HNTF 1TGSZ 1W13U 1C2EA 4ZROA 4MPWA 3TH4H 1P04A 2BMGB 3RXSA 1D9IA 1KYNA 1ELVA 2VGCB 3MO3A 1BA8B 2AERH 4AFQA 1C5YB 1G9IE 3A7WA 1C1MA 1P2QA 1GBFA 2BY9X 5LPEA 3BEUA 1QL7A 2ILNA 2AS9A 1EZSC 1ZSLA 1TQ7B 1HYLA 3RXGA 4KKDA 1WAYB 4GAWA 3RXLA 2FO9A 1D6RA 1WBGB 3NZIA 4OS5A 2EA3A 1O36A 1VJAU 4X8SH 1GBJA 2BDAA 3QWCH 4ABAA 2JETC 2VINA 4INHA 2WPIS 4DCDA 4Y79A 1LO6A 1F0SA 1P09A 1TBQH 3D49H 1QJ7B 2PLXA 2BOHB 1Z8IB 1VJ9U 2ZU4A 1LVYA 1ZTJA 2G4UA 3SU1A 4AOQA 3ATLA 2AIPA 3UY9A 1SVPA 1IQHA 1DOJA 2RA3A 1IQLA 3SJ8A 1P9UA 2J34A 3RLWH 1ESTA 1H8IH 2UUFB 2FMJA 2EEKA 2XXLA 4DT7B 1OKXA 1KXDA 1SMFE 2ZP0H 8LPRA 1UVTH 5DGJA 1SFQB 1AU8A 2IJOB 2C93B 2VGCC 2ZQ2A 3RP2A 1IOEA 1UVUH 3OX7U 2ZU1A 3RLYH 4SGBE 4YOGA 5F8XA 2VH6A 1O35A 4ABIA 3ZV9A 1A4WH 1GJCB 4D76A 3H7TA 2BB4A 1Y8TA 3A7XA 2HOBA 1KXFA 4VGCB 2SNWA 7GCHF 2XBXA 2THFB 2FI3E 2SGFE 3IG6B 3ZVDA 5LH8A 2OC0A 4Y71A 1C5UA 2IOTA 4B76A 1NRPH 1AKSA 3KIDU 4NWLA 3BV9B 3O8RA 1O3OA 1KLJH 1MTSA 1O3EA 5EU8A 2ZDKA 1BTWA 1O5DH 3KN2A 1OWDA 4IS5A 1BITA 2Z6BD 3K65B 2F9BH 3M7UA 1PQ7A 2XBYA 4WMEA 4FVDA 3S9AA 1O5CB 1EX3A 2I6QA 4FUBA 1OX1A 2P94A 1YBWA 1TNLA 1SGDE 4JZEH 1NU7B 3AVZA 4IC5A 1ZYOA 3SNDA 1DXPA 3RXOA 2PTNA 3VXEH 1W2KH 2ALVA 2XNIA 2FS8A 4NA9H 3UR6A 2YOLA 5PTPA 1S6HA 1O31A 2BQWB 4DVAU 1GBIA 3M61U 2CMYA 2TGAA 4VGCC 4NZQA 2ZZUH 1BMNH 1O5AB 3HK6B 4OS4A 4CH2B 2PUQH 2H2ZA 5JDUB 1A5HA 1DY9A 2ZCLP 1HUTH 1MBMA 4YLQH 4NIWA 4OGXA 1DLEA 1H8DH 2HNTC 1LHEH 4NGAH 1CT0E 2RCEA 2PUXB 2Y7XA 4B73A 5FXLA 2BX3A 3PMBB 5EQRA 1T31A 4WMFA 4KGAA 1KXCA 3SGAE 3UQVA 1HAZB 1ORFA 1XVOA 3MU0A 4NCYA 2OD3B 3BSQA 1SOZA 3PM3A 2ZFRH 3TPIZ 3FAOA 2F91A 4I8JA 1O5FH 4X1SU 3SHAH 1K1MA 3ESTA 2J94A 1DUAA 1HPGA 2GDEH 4LOYH 1GMDF 1C4Y2 4X2WA 1FY4A 1H9HE 4JMYA 1SLUB 2QN5T 1EPTB 3MH6A 3E6PH 1NESE 4D9RA 1EQ9A 4RSPA 2FESH 2G8TA 4AB9A 2WPKS 1E37B 2PSYA 2UWPA 1XUKA 2QCYA 4LZ1H 1SPJA 3A8AA 1V3XA 5GCHG 3U69H 5CE1A 3B8JA 1C5ZB 1QB9A 2LPRA 2G81E 2BY7X 4Y11E 3D23A 1W7XH 4ABGA 1B0EA 2PGBB 1SI5H 2BXUH 1A0JA 5DK1A 3RM2H 2R2MB 1O2MA 3FP6E 1BBRE 2G52A 2QIQA 2D1JA 1GCDA 3R3GB 2J92A 2PHBA 1YPGH 1T8NA 2B5TB 2OXSA 4A7IB 5LPRA 3GCTF 2ESTE 2BLVA 4H42U 2BX4A 1K22H 3ZZ3A 2C3SA 1V2JT 3E3TA 3QO6A 3ELAH 1BBRK 2A5IA 1TNHA 1YCPM 1QURH 1PPBH 4NIXA 4UFDH 2Z9LA 2BD8A 4OS1A 1C1VH 2ZTZA 5E0JA 2QXHA 1O3LA 4O9VA 1EPTC 9ESTA 1FPCH 3TU7H 3MNBA 3V13A 1OYTH 2HNTE 1GI2A 1FDPA 1TGCA 3T26A 1JRSA 5HYOA 3SUFA 1TPOA 5ABWA 1BMMH 1UTLM 1P2MA 3UREA 4K69A 1BTHH 2G4TA 5I46H 1CSOE 2C8WB 2OQUA 4K8BA 2F9NA 1BBRH 1ELFA 3NWUA 3ZVBA 1YCPK 4H6SB 2Y5FA 1OS8A 4JYTA 5EODA 1H9LB 3AW1A 4UONA 5IDKA 3DFJA 1T7CA 1TWXB 1ZHMA 3F1SB 1RJXB 1TBZH 3G01A 3LGWA 3LIWA 1F5KU 3M5OA 1AWHB 1BTXA 4WWYA 3RXPA 1SG8B 4X6NA 2B8OH 2CXVA
chains in the Genus database with same CATH superfamily
3TNSA 5L2ZH 4UD9H 3SBKA 4X6OA 1FV9A 4ISNA 4X6PA 2YNBA 3AW0A 3RXMA 3D62A 2SGQE 2GV7A 3NUMA 3Q77A 2V6NA 1GL0E 4JK6A 3SQEE 1RTFB 2VIPA 5E0GA 2DE9A 1BMAA 3UNRA 3OE7D 5B6OA 2G00A 2ZGHA 1TMTH 3DSOA 1ETRH 2ZECA 3TNTA 3T25A 2A7CA 5JB9S 2SGDE 5GIBA 1E1RD 2AMQA 2AFQB 3AAUA 2ODPA 1FN8A 4JYVH 2GT7A 5HMAA 1MKWH 2EI8A 3KF2A 1J14A 1KIGH 1OWJA 3UUZA 2WPHS 5EQQA 1B7XB 1YY3A 1GJBB 1AZ8A 3PMAB 2A0QB 2HRVA 5DP6A 1WQVH 2WINI 2XWBI 3SV7A 2A2XH 1O3AA 5I25A 3MNXA 4TY7A 4BAHB 5FX5A 1P01A 2AH4X 1DWCH 4Z6AH 2W3KA 2ZDVH 1IQIA 4YM9A 1ZHRA 3E91A 3DHKH 5F03A 2VIOA 3QX5H 5C0UA 3QGNB 3A86A 1V2UT 1SQOA 3FOAA 2FODA 4HI3A 4XFQA 1VCWA 1XUHA 1OHHD 1UTQA 2R2WU 2FOFA 3BTHE 3E90B 3HPTB 5EOKA 3KHVA 3I78A 3A7YA 2BLOA 1TNGA 1GL1A 1NROH 2BD3A 1P11E 2Z3EA 2AGIX 3U1IB 1ZOMA 1QCPA 3UPEA 1TA2A 3KL6A 1TONA 2IJD1 2SNVA 3QTOH 1N6XA 4MPUA 4X8TH 1EJMA 3Q3XA 3LONA 2IN2A 3P8NA 4BOHA 2FWWA 2QE7D 1YM0A 5G4BA 1XUFA 4NIYA 4JYUH 4A6LA 4R8TB 4MPVA 3U8RH 4P02A 3PTBA 4CR5A 1QB6A 1Z71A 8KME2 1GMHF 5AFZH 1Z1IA 1XM1A 3ATMA 5E2PA 1O2UA 1K1OA 2NU0E 1SQTA 3A84A 2TGPZ 2A4QA 2R3UA 1LVBA 4E7NA 2TRMA 2ZDLA 3RMMH 5C1UA 1OXGA 3KYFA 2F4LA 3UAIC 1LQEA 3K6ZA 3KNXA 1GBLA 4Y8ZA 4OGYA 4I8HA 1EAXA 1TNJA 4CRAA 3C1KA 4RN6A 1BMFD 3VPKA 3MU1A 4BTIB 1NZQH 1WYKA 1W11U 1TBRH 1Q3XA 1WXRA 2VWOA 1BHXF 3L3TA 1RIWB 2KCAA 2GZ9A 1EKBB 1XKAC 2BVRH 3UB0A 3ZVFA 4ASHA 1F0UA 2UWOA 2OC8A 4HTCH 2F9PA 1C5PA 2CGAA 3BEIB 1ZMNA 4O3UA 5KGOA 1MD8A 4ZXXH 1C1UH 1O0DH 5EW1H 3RXIA 5EJ1A 1XVMA 5DJ7A 1CO7E 1F0TA 1TNKA 2Y5GA 1EZUC 3PV4A 3GISB 1L4ZA 3BTKE 1FN6A 4ISLA 3GCTG 4CRBA 2A32A 2J98A 1WU1A 3QDZB 5HM9A 1MCTA 1C2IA 1HIAA 1AE8H 1BTYA 1S85A 3SV2H 1NBME 3OEHD 5HGGA 3WY8A 2W26A 2ZCHP 5ETXA 1OWKA 1SLXB 1BTUA 1FIZA 3L6PA 1UK2A 2IPHA 4I32A 1O2HA 3CS0A 2ZU2A 3VG8A 3E8LA 3DSPA 5FPTA 3FP7E 1RXPA 1C2GA 1IQMA 1FY1A 4H4FA 3LDXH 4D7FA 1GI9B 1S6LA 2UUJB 3EYDA 3Q76A 4Y10E 3PMHB 2TGDA 1CU1A 1CHGA 1RIWC 1O37A 1WSSH 1ACBE 1O2IA 1FIWA 2O8UA 4JZIA 1HAVA 1LPZB 1O2LA 2OC7A 3GOVB 3VB4A 3LC5A 4XBCA 3SU4A 2SGPE 1SGPE 1YPLH 1UTKA 5GJ4B 4ZKRU 1MKXH 4NA7A 5DSFA 3M3TA 1HBTH 2V7QD 4HGCA 2AGGX 1G3CA 1OP0A 2AMPA 1O5EH 1UVPA 2ZHWH 4FOUC 1W0KD 2Q6GA 1F92A 2CF9H 3PMJA 1NFWA 3T28A 1AN1E 1LHCH 1GBMA 1TIOA 2ANWA 4LK4A 3PROA 2CK3D 2ZPSA 4F49A 1HRTH 1OP8A 4OS2A 1KXAA 3M5NA 3H5CB 4Y76A 1S6FA 2W7SA 4SGAE 2ALPA 1AIXH 1HGTH 1CA8B 1OYQA 1V2PT 1HJAB 1YLCA 4DG4A 2BDHA 3RXEA 2AEIH 3SJOA 2A31A 3EE0B 2GD4B 1XXFA 1GI6A 3Q3YA 1C5NH 1KMHB 2VWNA 1AVXA 4Y6DA 2W5EA 3PB1E 4M9FA 4BTUB 1A7SA 1QJ6B 1VKYA 1J9CH 3NK8A 2PGQB 5EQSA 4O3TA 2A2QH 3RXJA 3QLPH 3F0OA 2Y7ZA 3TJUA 4FUDA 3URCA 4K1SA 2STBE 2ZDAH 5BRRE 2NU3E 1ZRKA 2Z3DA 5CDFE 4AFUA 1Y59T 1O2ZA 1HJ9A 1B5GH 1C4U2 3CNRA 1PPFE 3F3BA 2WYGA 3ZYEA 4U01A 1EAIA 2KAIA 1JMOH 2QXJA 4TY6A 1K21H 4X1RU 1O3GA 1SGIB 3STIA 3GCHB 1O2VA 1KLTA 3U8OH 4ZHLU 3M3SA 3MH4A 1X7AC 1AGJA 1O3MA 3AAVA 1GJAB 1BZXE 2EC9H 4Y0YE 3S9BA 3O8CA 4RT0A 1UTOA 2VWMA 4Y7AA 4K60A 2QXIA 2P3FH 1CGIE 5E0HA 2D2DA 2NU2E 3TH2H 1IQEA 1HJAC 5J4QA 2JH5D 1Z6EA 5A8ZA 1P57B 1ZR0A 1SLWB 2LELA 1W10U 3JZ1B 4ZHAA 5K0HA 1ZGIA 3CS7A 1TPPA 4AX9H 3TVJB 4B2CA 1INCA 1W14U 1O5BB 2QYIA 4BAOB 1O2GH 3GYMA 5JBTA 4AFSA 3SV6A 1E79D 1FONA 2BLQA 1W12U 2ZGCA 1LDTT 2J2UA 1BOQA 2P8OC 2C8XB 3LPRA 2BDYA 4DURA 1DM4B 1HNEE 1ZSJA 4X2YA 1KTTB 1UO6A 2BD4A 4X1NU 5CHAB 1WQSA 5GPIB 4FU8A 4RI0A 4TT3D 2ZFTA 1JIRA 3UOUA 1RRKA 4O97A 1SGFA 3ZZ4A 3GCHC 3LT3A 5EJZA 4BXWA 2ZU3A 3HATH 1OWIA 2GT8A 2ZEBA 1SB1H 3RXKA 1MQ5A 1IQFA 2J38A 1FAKH 1THSH 1GMHG 4B6EA 4BAQB 1TOCB 2FDAA 1F7ZA 1UVOA 3GY4A 4HFPB 3BTDE 6LPRA 2H9HA 3OU0A 4AGKA 3M5MA 2WV5A 1UTNA 2XCFA 2FM2A 1P3CA 1P10A 4K5ZA 1YLNA 2NU4E 1TGTA 3HGNA 5T6GA 1DY8A 1O30A 3SZNA 1G3EA 5A8YA 4AORA 2OK5A 3P95A 1FZZA 1DS2E 2BXTH 4INKA 4NSYA 1HV7A 3VEQB 1ZTLA 1AMHA 1CT4E 7ESTE 1G2MA 1TQ0B 5C1YA 4ZKSU 1ESAA 5C3NA 1MZAA 1Z1JA 4DT4A 1C5MD 1C5QA 4AFZA 2HLCA 1GBKA 2XTTB 4MLFB 4F48B 4Q63A 5CHAC 2ZC9H 3TGKE 4NWKA 1FXYA 4WMDA 4A1TA 4ABEA 3AASA 4FETA 3RC4A 3T62A 3RMNH 2J4IA 4ACBA 4ZKNU 2G55A 3BG8A 1GJ4H 2H5DA 4X1PU 3FN8A 4ESTE 2FZZA 3GDUA 2EQNA 3V7TA 3ITIA 4I33A 1KDQA 2GTBA 3TITA 3A7TA 1P2JA 5B6LA 4ZUHA 1ANDA 1S0RA 1SKYE 1GG6B 1P2NA 1H9IE 2A7JA 3MFJA 3EDXB 4YZUA 1LPKB 3ATKA 1AY6H 4TWYA 2GKVE 3M7QA 1A46H 3E0NB 5FBEA 3U1JB 1UHBA 4KELA 2OCVB 3RM0H 1K1LA 2EI6A 4PROA 1ZTKA 2GCTB 4IMQA 1AO5A 1MTNC 2TPIZ 5DP5A 1T8OA 1HAHH 2BVXH 1L1NA 1SGNE 1EZQA 4IGDA 9LPRA 1YKTA 2L74A 1GHBF 1QZ8A 4CHAC 3DD2H 2BTCE 1CGJE 1PJPA 5DP3A 3SOSA 1VGCB 5FAHA 3UIRA 4MVNA 2XNDD 1WTHD 3BTWE 2SGEE 1NT1A 1AKSB 1N8OB 2P59A 1WCZA 4ABBA 4GSOA 4D7GA 2YNAA 2FYQA 5EPNA 3ZV8A 1WDIA 2WHXA 2J5UA 2HWLB 1H4WA 1ZRBA 2HPQH 1O3FA 4XOJA 1ETTH 2ZFPH 1GBHA 6GCHF 2OP9A 1EB2A 4NSVA 1QR3E 1L4DA 2ZWLH 3BG4B 3LGYA 1C9TA 1NRSH 1DLKB 4WXVA 1TOMH 5EIYA 1OP2A 4MQAA 3EA8A 4GCHF 1EOJA 1G2LA 3SI4H 1GG6C 1COWD 5KECA 3NRLA 2GZ8A 2ZGJA 3P17H 3SJIA 2ZKSA 1A5GH 4A1XA 2FEQH 3RXVA 2ZDMA 1ABIH 2GCTC 4YOIA 1THRH 2R0LA 2GDDA 3QZRA 2ZF0H 2FS9A 1W0JD 1O3PB 2GZ7A 1WTGH 2F3CE 7KMEH 3MOCA 3HGPA 1OSSA 1BJVA 3D65E 1L0ZA 1C1OA 1VGCC 5AFYH 3BTTE 5CMXH 3RMLH 2XOKD 1H8ED 4IW4E 1N8OC 2KX4A 2JKHA 1NFYA 3A7ZA 3RXUA 1GHVH 1A0HB 5FCKA 1ANCA 4UFGH 1BT7A 1TRYA 4I7YH 1YGCH 2XRCA 2KZ4A 1T8LA 3GICB 2WUBA 1ANBA 3MH7A 2BDIA 2QXGA 2C8YB 5K7RA 3BG4C 2O8WA 4UFFH 4CH8B 3A80A 3RC5A 2PKAA 3RU4D 1BQYA 1GDNA 1XXDA 1VCPA 1C5SA 3TGIE 2FOCA 5L2YH 1BDAA 5L30H 3KQCA 2BQ6B 1RD3B 1CT2E 3M3VA 3F9EA 2HVXA 2PWXA 1TGBA 1ETSH 3C27B 2ZGXH 1JOUB 5JBAS 4CRCA 2QC2A 1BRBE 1VITF 2GJGA 2KCYA 3H09A 3SNCA 1MKWK 3TJVA 2VJ1A 2XC4A 4UE7H 1L2EA 1AFQB 2Z9IA 5E2OA 2GV6A 1JIMA 1UMAH 4MNXA 4X2VA 1W0ZU 1UTPA 3ZYDA 3OFND 1CA0B 1FY5A 1QTFA 3K6YA 4MNVA 1O34A 3ZVCA 1G3BA 2G5VA 2PTCE 3M7TA 1CHOF 2P3UB 1Z7KA 2VBCA 1HAYB 1O2RA 1NTPA 1KLIH 1BRCE 3ODDA 1XUGA 3LJOA 5A8XA 5T3HA 7GCHG 5EXNA 4D9QA 3ZZ8A 3SU2A 2ANMH 5AHGH 1BB0B 1ELTA 1O2YA 1TABE 1GBCA 3MMGA 1O2XA 1C2MA 1ANEA 2JJ1D 4B75A 3M35A 2QF0A 4XE4A 3TK5A 1EXFA 3SJ9A 1D3PB 3EE7A 3GYLB 2YMSD 1LVMA 1P3EA 4OS7A 4BNRA 1GBAA 5BPEA 1O2OA 1O38A 1C2JA 1A1RA 3PV2A 1M9UA 1HLTH 1MU8B 4ZAEA 5EXLA 1GCTC 3OY6U 5DPAA 1C5WB 2VU8E 2ZPQA 1LVOA 3JZ2B 3TK9A 3PYHA 4MPXA 1RGQA 1SSXA 3QTVH 1DFPA 1YPKH 3MTYA 2ULLA 1AFQC 2JH0D 2F9VA 4GHTA 3T5FH 2WYJA 1RTKA 1BCUH 5GNDA 4E06H 1CA0C 5TCCA 5ESTE 2FOGA 5EG4A 3SN8A 1SFIA 3DA9B 2J9NA 7LPRA 4OM9A 2BDBA 1E38B 2A5AA 3W95A 3MU4A 1JWTA 1SOTA 5C5OA 5A0AE 2ZO3H 5JPMH 1TB6H 2RG3A 1QBNA 3STJA 4B2AA 1W7GH 3UTUH 4U2WA 3HKJB 4FUCA 1EATA 3KQ5A 2OC1A 4XBDA 1TRNA 4U32A 2BHGA 3B23B 1FAXA 1QBOA 2GCHF 2RDLA 5DP8A 2ZCKP 1LHGH 3RXTA 3CENA 1A61H 3A7VA 3KQDA 1GBEA 2XBWA 1DDJA 3NXPA 2OINA 4JZ1A 1UCYE 1A0LA 5JBCS 4JCNA 4IN1A 2PFEA 3LJJA 2PR3A 4DJZB 2C90B 1GHBG 4KP0A 5GDSH 3RXDA 5A09A 1GMDG 3IWMA 3RXHA 1FJSA 1TX7A 2H9TH 4RKOB 1TA6A 1FPHH 1P12E 4TPYA 1IQKA 4D8NA 1UCYK 4UDWH 2Z94A 4X2XA 2XC5A 2W6ID 3F9FA 1YP9A 2RFKC 1L1GA 3BTEE 1GHAF 1UTJA 1C5TA 4X6MA 1ZJDA 1DITH 1JBUH 4FUEA 1IHTH 1P05A 3SHCH 4I86A 1TMBH 3OEED 6GCHG 3UQOA 3U9AH 1YC0A 2FOEA 5FCRA 5FHTA 1V6DA 1MBQA 3V3MA 1PQ8A 5C20A 4FUFA 2BY8X 3A8CA 2DUCA 3KCGH 2ASUB 3OAAD 4GCHG 3RXBA 5LGOA 5FPYA 3MNCA 2FTLE 2G51A 1ELBA 4Q7ZA 3K2UA 4Z1MD 1UCYH 1MAYA 3M36A 4YO9A 3MYWA 1WUNH 3ZZDA 1C1RA 2Q1JA 4U30A 1BRAA 1E34B 1C1QA 2ODYB 3HK3B 3MI4A 3OTPA 1FNIA 5GXPA 3H7OA 4TWWA 3RUOA 3PRDA 1K0HA 5ESBA 4DOQA 3HKIB 3MWIU 1EFRD 2XCNA 2K1QA 2HPPH 3W1EA 1MKXK 2GMTB 1GJ5H 1Z8GA 4YT7H 1ID5H 2WV4A 4RKJB 3N7DA 1T4VH 1ELDE 4TYDA 1DWEH 3IITA 1GJ7B 1EJNA 5TJXA 4CBNA 1LHFH 3V0XA 2A4OA 3A81A 1ABJH 2FPZA 3GDVA 1G36A 4OS6A 3DFLA 2W6JD 1F5LA 3T29A 1D3DB 1V2MT 4J1YA 5A0BA 2AGEX 4ZKOU 3PLKA 3PWBA 1SGCA 2P93A 2GX4A 3GS9A 4KTCA 2VVVA 5J4SA 2UUYA 1C5LH 1WV7H 1BIOA 3A87A 4YTAA 3A83A 2BM2A 1EP6A 2QA9E 1HJ8A 1P2IA 3ZZAA 1CGHA 2XYAA 1QFKH 4GVUA 1VITG 5IYTA 5JBBS 1VZQH 1V2OT 4X1QU 3SORA 2ZDNA 4I31A 1EZXC 1QHRB 3LU9B 4LXBH 4AYVB 2VIDA 3RMOH 2SGAA 3TJOA 2BYAX 4F55A 3QUMP 3E1XB 1IAUA 1K1NA 5DP9A 5AF9H 3ZZ7A 1AD8H 1BHXB 3UFAA 2PV9B 2Y80A 2GMTC 4YESB 2OBOA 1PPHE 3LGUA 4M7GA 3RXRA 1CHOG 2J95A 5DO4H 4B1TA 4IBLH 2H6MA 1AI8H 1NFXA 3FZZA 1PFXC 4H6TA 3RDZA 2HALA 3OSYA 3R0FA 4FXGH 3SGBE 1ZPCA 3FZDA 1NO9H 1O2WA 3TGJE 2Z9JA 4JZDH 3VB3A 2O8MA 2VIQA 2O8LA 1E1QD 2J98B 2P8OB 3N7OA 3PO1B 1GJ8B 1HIAB 4IMZA 2F9OA 1CVWH 2EI7A 1C2FA 1NM6A 1BTPA 1O2NA 2WV9A 3LGTA 1O33A 1D6WA 1HAIH 2Y82A 5DP4A 5L6NH 2F9UA 3MU8A 1A2CH 2VWLA 2ZIQH 2UWLA 3DSGA 2WPJS 1GDUA 3KGPA 3MO9A 3RXCA 3SZEA 4MTBA 1XUJA 2Z3CA 2GGVB 1XX9A 1G30B 4XSKU 1V2VT 2BVSH 1J8AA 1VITH 1C1PA 1IQJA 1ELGA 4J2YB 2VVCA 3PWCA 1EB1H 5H4IB 1GJ9B 4DIHH 1GBBA 3NCLA 2K8IA 1TMUH 1YPEH 1HAOH 1HAVB 1JRTA 2KCPA 2FI5E 2P3TB 2FI4E 3SU3A 3MHWU 3SU5A 3PLBA 2WUCA 1SC8U 2C8ZB 2NWNA 1V2ST 2I6SA 1HFDA 2A4GA 3Q00A 2CV3A 1PYTD 4I8KA 3CP7A 4ZMAH 1DWDH 1TNIA 1Y3XA 1H1BA 1QA0A 3PO1C 1DXWA 2BD5A 1C2KA 3BTFE 3S7HB 1O3HA 4AG1A 3BEFB 4Q4LA 3TJNA 2V3MA 4ABJA 1ZLRA 1THPB 1GDQA 1ZHPA 3VFEA 2GCHG 2OLGA 1G3DA 1UW7A 3GCNA 3K9XB 1V2NT 1YPJH 2ODQA 4MG3A 1TALA 1MUEB 4CR9A 1O2QA 2CHAB 1QGFA 5C2ZA 1V2QT 1ELEE 2ZFSA 6CHAB 3BIVH 3F68H 1L1JA 3LGVA 1UJ1A 2ZPRA 2YMSC 5HKKD 3SU6A 3FANA 5CHBA 4KTSA 2FTMA 1GHWH 1AFEH 2AYWA 3QK1A 4NA8A 4AYYB 2B7DH 2FIRH 1EPTA 1MTNB 2O9QA 1TRMA 3SUDA 1V2TT 1Y3UA 1GHAG 2CJIA 2W3IA 5EPYA 3SI3H 2KAIB 1O2JA 3MO6A 1F2SE 2VB0A 1FLEE 1SQAA 3EQ0H 5AVDA 3ATIA 4CHAB 1GJDB 3F2GA 4ZH8A 1C5VA 1QRWA 1K1JA 1N1LA 1VR1H 1NRQH 1NN6A 3F6UH 3KQEA 3RU4E 1DSTA 2ZHFH 1AE5A 1P2KA 1GHZA 4Y0ZE 2B0FA 1D3TB 2KCOA 2WPMS 1Y5BT 1MQ6A 8GCHF 5JYIA 3S7KB 1GMCF 4ZCNA 1DICA 2UUKB 1AHTH 3GDSA 4X8UH 3TIUA 4GLYA 4NZLA 3ZVEA 2CHAC 1AWFH 2ANKH 4A5TS 1RS0A 3DCLA 3ENSB 1Z6JH 2ZHDA 5EXMA 4HG6A 2D26C 4K3JA 1SGTA 6CHAC 4AN7A 4ABDA 5C5NA 4K2YA 1AQ7A 4KTUA 1OOKB 1BJUA 2OBQA 4B6FA 1YPHC 2VIWA 1HXFH 3SYJA 3GY7A 5FPSA 1K1PA 2FOAA 1FY8E 2Z9KA 2B9LA 2H1UA 1C2LA 1HAPH 3NKKA 3KYGA 4ABFA 4AG2A 1SQRA 4ABHA 1J16A 4XDEA 4ACAA 2CN0H 2QY0B 3A8DA 2ZA5A 5T6FA 3ZVAA 2BOKA 5FBIA 4E7RG 2QF3A 3P8FA 1GVZA 2BD7A 3MNSA 1SGEE 1N6YA 3RU4T 1W3CA 2FLRH 5C67A 3DT0H 3SU0A 1IHSH 1P03A 3UNSA 6ESTA 1B0FA 3EA7A 1ZGVA 3BF6H 1QL9A 2FX6A 1ARCA 4B74A 1Z8JB 1HCGA 1UVSH 1GVLA 1CQQA 2AMDA 1K28D 2WSSD 3EAJA 2Z9GA 2CF8H 3GY3A 1QY6A 3SJKA 3WWFA 1QRZA 1XMNB 4NG9H 3LC3A 3URDA 3BTME 3ZZ9A 3F9GA 1NRNH 2ANYA 1TFXA 1C2HA 3ODFA 1G37A 1S81A 5DKMA 1T8MA 1GJ6A 3S69A 3I77A 3DUXH 3QN7A 3SV9A 5DG6A 1OWEA 2K0QA 1ZZZA 1HXEH 3A85A 3SO3A 3UOPA 3F2HA 1ELCA 1LPGB 4MNYA 3SNAA 4DY7B 5LPFA 1QA7A 2A4RA 1PQ5A 3EGKH 1SHYA 1ZMJA 4BAKB 1KDQB 1A3BH 1MH0A 3ZZ5A 5F8TA 3B9FH 1V2WT 1PPGE 3SNBA 3UR9A 3U8TH 1YPHE 3ZVGA 1A3EH 1O3JA 1UHBB 1E0FD 4A92A 2AIQA 3TLOA 4CRDA 4Q7XA 1GI4A 1K2I1 1QBVH 1K9OE 3S0NA 1UTMA 3BIUH 3VXFH 3A89A 2BY5X 1SGQE 1GGDB 2QAAA 1HB0B 1MTUA 3I29A 1O2SA 2M5TA 2BDGA 1P02A 1AVGH 1MZDA 3FP8E 1C1NA 1C5RA 1S82A 1SHHB 1Z8RA 3EA9A 3ZIAD 1GCTB 3LKWA 3VB7A 1U6QA 1S5SA 2A5KA 3MQKC 3ZZCA 1FUJA 3O8DA 4MDSA 3RXAA 2R3YA 4YOJA 3ATWA 1GI5A 1QIXB 3T2NA 5HIYA 1Y3VA 3FFGA 2V0BA 1ELAA 5EJLA 4CBOA 2DE8A 3FVFB 5EW2H 4LZ4B 3MH5A 5F53A 5HIZA 3TK6A 2Q6DA 5DP7A 4FVBA 1A5IA 3GY6A 3GY2A 1RFNA 3QZQA 1GPZA 2BD2A 1K1IA 3O8BA 3LH1A 1SGFG 2H9EH 3VB6A 4AGJA 1YYY1 3UNQA 4NFEA 2BZAA 1NRRH 3BTGE 2HVYB 2OTVA 1GI0A 2FXRA 4GPGA 5E8EH 1MD7A 1YCPH 2FX4A 1EAUA 1QL8A 2TIOA 1KXBA 3P8OA 4QT8C 1ZSKA 3MU5A 1O5GH 4AC9A 5C17A 2OUAA 1NPMA 1Q31A 2IPQX 3ZZ6A 2ZQ1A 2FP7B 1UK3A 1OPHB 1GGDC 2JH6D 3KQBA 3WW7A 1EOLA 2FOBA 1GVKB 1F0RA 3LOXA 1O3IA 3A8BA 1AB9B 1ARBA 3E16B 4Q80A 1LCYA 5FX6A 4JK5A 1QQUA 1LKBA 1P8VC 1EAWA 4JZFH 2XC0A 2P16A 1V2LT 3P6ZB 2ZHEH 1P9SA 2O8TA 1DE7H 1Y5UT 3FO8D 2V3OH 1FMGA 4Q2KA 3SUEA 3LH3A 2XWAA 1E35B 4ZHMU 3TH3H 4BTTB 1ZPZA 1BRUP 1DX5M 4CRGA 1GI1A 1P06A 1HAGE 1O3NA 2G5NA 2PKAB 1DUEA 3RXFA 4UEHH 4I8GA 1EASA 3QGJA 2Y5HA 5TCAA 2GVFA 1NS3A 2XW9A 4B71A 2PP6A 8GCHG 1PYTC 1GMCG 2ZTYA 1MAXA 2QGRA 5KEDA 1KSNA 1SR5C 1TPSA 1FI8A 3SNEA 1EUFA 4BANB 3P8GA 3UWJH 3GY5A 1F5RA 1LKAA 2BQ7B 2V35A 1J15A 1ESBA 2NU1E 1DVAH 1DSUA 1GHXH 4RT1A 5GWZA 4DGJA 1FQ3A 3A88A 1D4PB 1OWHA 1AVWA 1V2KT 2JIZD 2STAE 4K1TA 2C4FH 2VVUA 3OYPA 4WXIA 3SV8A 4DIIH 1MTWA 1MU6B 3F0PA 4Q7YA 1TE0A 1AB9C 1C1TA 1YWUA 1C2DA 4WH8A 1Y3YA 1O3DA 4Z0KA 4IN2A 4CRFA 4BXSA 2ZU5A 3OY5U 2ZTXA 1BMLA 1MCVA 5A2MH 1AUTC 1MTVA 2TBSA 2QV1A 4I8LA 2FLBH 1QNJA 1TLDA 1ZJKA 4UFEH 1CBWB 3U98H 3PV5A 4NIVA 3M5LA 1NFUA 2VH0A 1QB1A 2FOMB 3RC6A 1HDTH 1W0YH 1GI8B 5SGAE 2ZG0H 4K1EA 3RXQA 1O2KA 2XBVA 4XD7D 4WJG2 2Q6FA 3A82A 1TX6A 1QRXA 4Y7BA 4BAMB 4FUGA 2F83A 4MNWA 2FYRA 3VB5A 1FX0B 1XUIA 1C9PA 1XKBC 1ZPBA 1P2OA 4O03A 1QQ4A 4XBBA 3UWIA 1DT2A 1IQNA 4GHQA 1PPEE 3BN9A 1KXEA 4ISOA 1CE5A 4INLA 1J17T 2WPLS 1YLDA 1O2TA 1G32B 5T6DA 1S84A 2FOHA 1KY9A 4FUHA 4IC6A 4K8YA 4NFFA 1JXPA 2A1DB 1GWAA 5HXFA 3M37A 1D3QB 3SW2B 4TPIZ 2J97A 1SBWA 4YLUA 1EJAA 1P0SH 2A7HA 1SGYE 3OTJE 2M2AA 1LHDH 3F9HA 1DANH 1UK4A 1TGNA 2KM0A 1ZMLA 5F8ZA 1GBDA 1T32A 3VGCB 1W8BH 1CBWC 1DPOA 4FU9A 4DW2U 1AZZA 2AHME 3E0PB 1EP5A 5HM2A 1E36B 1GBTA 1QJ1B 1TX8A 3PTNA 1MMJN 4R0IA 2ZI2H 2BD9A 2H5CA 1RTLA 3ZZBA 3KEEA 1GI7B 1NY22 2BLWA 1SGRE 1PPZA 2BY6X 4X8VH 4Y8XA 5C94A 4WF8A 4B2BA 1S0QA 1YF4A 1PPCE 1LQDB 5C1XA 3N7EA 2ZFQH 2D8WA 5F6MA 1T4UH 1WOFA 2ZHQH 1LTOA 1SLVB 3SQHE 3NPSA 3SGQE 1O39A 3P92A 2Y81A 4WH6A 3V12A 1AUJA 3T27A 2PKSB 1O2PA 4X0WU 1VCQA 2A45B 1BUIA 1IQGA 2PW8H 3GY8A 3LGIA 2BZ6H 4AB8A 1C4V2 1C1SA 1O3BA 2BDCA 1O3CA 1SL3A 2F43B 2QF4A 1V2RT 4F4OC 2LNCA 4FUJA 5JB8S 1Y3WA 3PLPA 1C5OH 4HZHA 1O3KA 2SFAA 2Z7FE 4YT6H 3L33A 2VNTA 4ISHH 4FU7A 1DWBH 5EGMA 2VIVA 2R9PA 2Y6TA 1C5XB 3W94A 2W7UA 5A0CA 1BTZA 2V3HH 1KTSB 2ZGBH 1NC6A 3VGCC 2P95A 2HLDD 2ZNKH 3P70B 4WY3A 1HAXB 1YPMH 5GCHF 2TGTA 4WVPE 4GUXA 1TAWA 2ZFFH 1TPAE 2RA0A 3Q3KA 4THNH 2PSXA 4ISIH 2HGTH 1GI3A 4ZXYH 3S9CA 2JETB 4CREA 2EY4C 1O32A 1C1WH 3BTQE 1PQAA 4E05H 4A1VA 3GCOA 1Y5AT 3SUGA 4AZ2B 1LMWB 2LP6A 2OQ5A 1GHYH 1NU9A 1Q2WA 3FKSD 1FY3A 1S83A 4FUIA 2PKSC 1TYNA 2GP9B 3AK5A 4Y8YA 2R0KA 8ESTE 2HNTF 1TGSZ 1W13U 1C2EA 4ZROA 4MPWA 3TH4H 1P04A 2BMGB 3RXSA 1D9IA 1KYNA 1ELVA 2VGCB 3MO3A 1BA8B 2AERH 4AFQA 1C5YB 1G9IE 3A7WA 1C1MA 1P2QA 1GBFA 2BY9X 5LPEA 3BEUA 1QL7A 2ILNA 2AS9A 1EZSC 1ZSLA 2YMSB 1TQ7B 1HYLA 3RXGA 4KKDA 1WAYB 4GAWA 5T1VA 3RXLA 2FO9A 1D6RA 1WBGB 3NZIA 4OS5A 2EA3A 1O36A 4ASUD 1VJAU 4X8SH 1GBJA 2BDAA 3QWCH 4ABAA 2JETC 2VINA 4INHA 2WPIS 3N99A 4DCDA 4Y79A 1LO6A 1F0SA 1P09A 1TBQH 2JDID 3D49H 1QJ7B 2PLXA 2BOHB 1Z8IB 1VJ9U 2ZU4A 1LVYA 1ZTJA 2G4UA 3SU1A 4AOQA 3ATLA 2AIPA 3UY9A 1SVPA 1IQHA 1DOJA 2RA3A 1IQLA 3SJ8A 1P9UA 2J34A 3RLWH 1ESTA 1H8IH 2UUFB 2FMJA 1NBMD 2EEKA 2XXLA 4DT7B 1OKXA 1KXDA 1SMFE 2ZP0H 8LPRA 1UVTH 5DGJA 1SFQB 1AU8A 2IJOB 2C93B 2VGCC 2ZQ2A 3RP2A 1IOEA 1UVUH 3OX7U 2ZU1A 3RLYH 2KR7A 4SGBE 4YOGA 5F8XA 2VH6A 1O35A 2RDEA 4ABIA 3ZV9A 1A4WH 1GJCB 4D76A 3H7TA 2BB4A 1Y8TA 3A7XA 2HOBA 1KXFA 4VGCB 2SNWA 7GCHF 2XBXA 2THFB 2FI3E 2SGFE 3IG6B 3ZVDA 5LH8A 2OC0A 4Y71A 1C5UA 2IOTA 4B76A 1NRPH 1AKSA 3KIDU 4NWLA 3BV9B 3O8RA 1O3OA 1KLJH 1MTSA 1O3EA 5EU8A 2ZDKA 1BTWA 3WWBA 1O5DH 3F2FA 3KN2A 1OWDA 4IS5A 1BITA 2Z6BD 3K65B 2F9BH 3M7UA 1PQ7A 2XBYA 4WMEA 4FVDA 3S9AA 2JJ2D 1O5CB 1EX3A 2I6QA 4FUBA 1OX1A 2P94A 1YBWA 1TNLA 1SGDE 4JZEH 1NU7B 3AVZA 4IC5A 1ZYOA 3SNDA 1DXPA 3RXOA 2PTNA 3VXEH 1W2KH 2ALVA 2XNIA 2FS8A 4NA9H 3UR6A 2YOLA 5PTPA 1S6HA 1O31A 2BQWB 4DVAU 1GBIA 3M61U 5C0TA 2CMYA 2TGAA 4VGCC 4NZQA 2ZZUH 1BMNH 1O5AB 3HK6B 4OS4A 4CH2B 4XRNA 2PUQH 2QF5A 2H2ZA 5JDUB 1A5HA 1DY9A 2ZCLP 1HUTH 1MBMA 4YLQH 4NIWA 4OGXA 1DLEA 1H8DH 2HNTC 1LHEH 4NGAH 1CT0E 2RCEA 2PUXB 2Y7XA 4B73A 5FXLA 2BX3A 3PMBB 5EQRA 1T31A 4WMFA 4KGAA 1KXCA 3SGAE 3UQVA 1HAZB 2WZQA 1ORFA 1XVOA 3MU0A 4NCYA 2OD3B 3BSQA 1SOZA 3PM3A 2ZFRH 3TPIZ 3FAOA 2F91A 4I8JA 1O5FH 4X1SU 3SHAH 1K1MA 5DN6D 3ESTA 2J94A 1DUAA 1MABB 1HPGA 2GDEH 4LOYH 1GMDF 3U28C 5FL7D 1C4Y2 4X2WA 1FY4A 1H9HE 4JMYA 1SLUB 2QN5T 1EPTB 3MH6A 3E6PH 1NESE 4D9RA 1EQ9A 4RSPA 2FESH 2G8TA 4AB9A 2WPKS 1E37B 2PSYA 2UWPA 1XUKA 2QCYA 4LZ1H 1SPJA 3A8AA 1V3XA 4TSFD 5GCHG 3U69H 5CE1A 3B8JA 1C5ZB 1QB9A 2BY7X 2G81E 2LPRA 4Y11E 3D23A 1W7XH 4ABGA 1H8HD 1B0EA 2PGBB 1SI5H 2BXUH 1A0JA 5DK1A 3RM2H 2R2MB 1O2MA 3FP6E 1BBRE 2G52A 2QIQA 2D1JA 2KFWA 1GCDA 3R3GB 2J92A 2PHBA 1YPGH 3PRBA 1T8NA 2B5TB 2OXSA 4A7IB 5LPRA 3GCTF 2ESTE 2BLVA 4P00A 4H42U 2BX4A 1K22H 3ZZ3A 2C3SA 2WPDD 1V2JT 3E3TA 3QO6A 3ELAH 1BBRK 2A5IA 1TNHA 1YCPM 1QURH 1PPBH 4NIXA 4UFDH 2Z9LA 2BD8A 4OS1A 1C1VH 2ZTZA 5E0JA 2QXHA 1O3LA 4O9VA 1EPTC 9ESTA 1FPCH 3TU7H 3MNBA 3V13A 1OYTH 2HNTE 1GI2A 1FDPA 1TGCA 3T26A 1JRSA 5HYOA 3SUFA 1TPOA 5ABWA 1BMMH 1UTLM 1P2MA 3UREA 4K69A 1BTHH 2G4TA 5I46H 1CSOE 5IK2D 2C8WB 2OQUA 4K8BA 2F9NA 1BBRH 1ELFA 3NWUA 3ZVBA 1YCPK 4H6SB 2Y5FA 1OS8A 4JYTA 5EODA 1H9LB 3AW1A 4YXWD 4UONA 2L6OA 5IDKA 3DFJA 1T7CA 1TWXB 1ZHMA 3F1SB 1RJXB 1TBZH 3G01A 3LGWA 3LIWA 1F5KU 3M5OA 1AWHB 1BTXA 4WWYA 3RXPA 1SG8B 4X6NA 2B8OH 2CXVA
chains in the Genus database with same CATH topology
3TNSA 5L2ZH 4UD9H 3SBKA 4X6OA 1FV9A 4ISNA 4X6PA 2YNBA 3AW0A 3RXMA 3D62A 2SGQE 2GV7A 3NUMA 3Q77A 2V6NA 1GL0E 4JK6A 3SQEE 1RTFB 2VIPA 5E0GA 2DE9A 1BMAA 3UNRA 5B6OA 2G00A 2ZGHA 1TMTH 1ETRH 2ZECA 3TNTA 3T25A 2A7CA 5JB9S 2SGDE 5GIBA 2AMQA 2AFQB 3AAUA 2ODPA 1FN8A 4JYVH 2GT7A 5HMAA 1MKWH 2EI8A 3KF2A 1J14A 1KIGH 1OWJA 3UUZA 2WPHS 5EQQA 1B7XB 1GJBB 1AZ8A 3PMAB 2A0QB 2HRVA 5DP6A 1WQVH 2WINI 2XWBI 3SV7A 2A2XH 1O3AA 5I25A 3MNXA 4TY7A 4BAHB 5FX5A 1P01A 2AH4X 1DWCH 4Z6AH 2W3KA 2ZDVH 1IQIA 4YM9A 1ZHRA 3E91A 3DHKH 5F03A 2VIOA 3QX5H 3QGNB 3A86A 1V2UT 1SQOA 2FODA 4HI3A 4XFQA 1VCWA 1XUHA 1UTQA 2R2WU 2FOFA 3BTHE 3E90B 3HPTB 5EOKA 3KHVA 3I78A 3A7YA 2BLOA 1TNGA 1GL1A 1NROH 2BD3A 1P11E 2Z3EA 2AGIX 3U1IB 1ZOMA 1QCPA 3UPEA 1TA2A 3KL6A 1TONA 2SNVA 3QTOH 1N6XA 4MPUA 4X8TH 1EJMA 3Q3XA 3LONA 2IN2A 3P8NA 4BOHA 2FWWA 5G4BA 1YM0A 1XUFA 4NIYA 4JYUH 4A6LA 4R8TB 4MPVA 3U8RH 3PTBA 4CR5A 1QB6A 1Z71A 8KME2 1GMHF 5AFZH 1Z1IA 1XM1A 3ATMA 5E2PA 1O2UA 1K1OA 2NU0E 1SQTA 3A84A 2TGPZ 2A4QA 2R3UA 1LVBA 4E7NA 2TRMA 2ZDLA 3RMMH 5C1UA 1OXGA 1LQEA 3K6ZA 3KNXA 1GBLA 4Y8ZA 4OGYA 4I8HA 1EAXA 1TNJA 4CRAA 3C1KA 4RN6A 3VPKA 3MU1A 4BTIB 1NZQH 1WYKA 1W11U 1TBRH 1Q3XA 2VWOA 1BHXF 3L3TA 1RIWB 2GZ9A 1EKBB 1XKAC 2BVRH 3ZVFA 4ASHA 1F0UA 2UWOA 2OC8A 4HTCH 2F9PA 1C5PA 2CGAA 3BEIB 1ZMNA 4O3UA 1MD8A 4ZXXH 1C1UH 1O0DH 5EW1H 3RXIA 1XVMA 5DJ7A 1CO7E 1F0TA 1TNKA 2Y5GA 1EZUC 3PV4A 3GISB 1L4ZA 3BTKE 1FN6A 4ISLA 3GCTG 4CRBA 2A32A 1WU1A 3QDZB 5HM9A 1MCTA 1C2IA 1HIAA 1AE8H 1BTYA 1S85A 3SV2H 5HGGA 3WY8A 2W26A 2ZCHP 5ETXA 1OWKA 1SLXB 1BTUA 1FIZA 3L6PA 1UK2A 2IPHA 4I32A 1O2HA 3CS0A 2ZU2A 3E8LA 5FPTA 3FP7E 1RXPA 1C2GA 1IQMA 1FY1A 4H4FA 3LDXH 4D7FA 1GI9B 2UUJB 3EYDA 3Q76A 4Y10E 3PMHB 2TGDA 1CU1A 1CHGA 1RIWC 1O37A 1WSSH 1ACBE 1O2IA 1FIWA 2O8UA 4JZIA 1HAVA 1LPZB 1O2LA 2OC7A 3GOVB 3VB4A 3LC5A 4XBCA 3SU4A 2SGPE 1SGPE 1YPLH 1UTKA 5GJ4B 4ZKRU 1MKXH 4NA7A 3M3TA 1HBTH 4HGCA 2AGGX 1G3CA 1OP0A 2AMPA 1O5EH 1UVPA 2ZHWH 2Q6GA 1F92A 2CF9H 3PMJA 1NFWA 3T28A 1AN1E 1LHCH 1GBMA 1TIOA 2ANWA 4LK4A 3PROA 2ZPSA 4F49A 1HRTH 1OP8A 4OS2A 1KXAA 3M5NA 3H5CB 4Y76A 1S6FA 2W7SA 4SGAE 2ALPA 1AIXH 1HGTH 1CA8B 1OYQA 1V2PT 1HJAB 1YLCA 4DG4A 2BDHA 3RXEA 2AEIH 3SJOA 2A31A 3EE0B 2GD4B 1XXFA 1GI6A 3Q3YA 1C5NH 2VWNA 1AVXA 4Y6DA 2W5EA 3PB1E 4BTUB 1A7SA 1QJ6B 1J9CH 3NK8A 2PGQB 5EQSA 4O3TA 2A2QH 3RXJA 3QLPH 2Y7ZA 3TJUA 4FUDA 3URCA 4K1SA 2STBE 2ZDAH 5BRRE 2NU3E 1ZRKA 2Z3DA 4AFUA 1Y59T 1O2ZA 1HJ9A 1B5GH 1C4U2 1PPFE 2WYGA 3ZYEA 4U01A 1EAIA 2KAIA 1JMOH 2QXJA 4TY6A 1K21H 4X1RU 1O3GA 1SGIB 3STIA 3GCHB 1O2VA 1KLTA 3U8OH 4ZHLU 3M3SA 3MH4A 1X7AC 1AGJA 1O3MA 3AAVA 1GJAB 1BZXE 2EC9H 4Y0YE 3S9BA 3O8CA 1UTOA 2VWMA 4Y7AA 4K60A 2QXIA 2P3FH 1CGIE 5E0HA 2D2DA 2NU2E 3TH2H 1IQEA 1HJAC 5J4QA 2JH5D 1Z6EA 5A8ZA 1P57B 1ZR0A 1SLWB 1W10U 3JZ1B 4ZHAA 5K0HA 1ZGIA 3CS7A 1TPPA 4AX9H 3TVJB 4B2CA 1INCA 1W14U 1O5BB 2QYIA 4BAOB 1O2GH 3GYMA 5JBTA 4AFSA 3SV6A 1FONA 2BLQA 1W12U 2ZGCA 1LDTT 2J2UA 1BOQA 2P8OC 2C8XB 3LPRA 2BDYA 4DURA 1DM4B 1HNEE 1ZSJA 4X2YA 1KTTB 1UO6A 2BD4A 4X1NU 5CHAB 1WQSA 5GPIB 4FU8A 2ZFTA 1JIRA 3UOUA 1RRKA 4O97A 1SGFA 3ZZ4A 3GCHC 3LT3A 4BXWA 2ZU3A 3HATH 1OWIA 2GT8A 2ZEBA 1SB1H 3RXKA 1MQ5A 1IQFA 2J38A 1FAKH 1THSH 1GMHG 4BAQB 1TOCB 2FDAA 1F7ZA 1UVOA 3GY4A 4HFPB 3BTDE 6LPRA 2H9HA 3OU0A 4AGKA 3M5MA 2WV5A 1UTNA 2XCFA 2FM2A 1P3CA 1P10A 4K5ZA 2NU4E 1TGTA 3HGNA 5T6GA 1DY8A 1O30A 3SZNA 1G3EA 5A8YA 4AORA 3P95A 1FZZA 1DS2E 2BXTH 4INKA 4NSYA 1HV7A 3VEQB 1ZTLA 1AMHA 1CT4E 7ESTE 1G2MA 1TQ0B 5C1YA 4ZKSU 1ESAA 5C3NA 1MZAA 1Z1JA 1C5MD 1C5QA 4AFZA 2HLCA 1GBKA 2XTTB 4MLFB 5CHAC 2ZC9H 3TGKE 4NWKA 1FXYA 4WMDA 4A1TA 4ABEA 3AASA 3RC4A 3T62A 3RMNH 2J4IA 4ZKNU 2G55A 3BG8A 1GJ4H 2H5DA 4X1PU 4ESTE 2FZZA 3GDUA 3V7TA 3ITIA 4I33A 1KDQA 2GTBA 3TITA 3A7TA 1P2JA 4ZUHA 1ANDA 1S0RA 1GG6B 1P2NA 1H9IE 2A7JA 3MFJA 3EDXB 4YZUA 1LPKB 3ATKA 1AY6H 4TWYA 2GKVE 3M7QA 1A46H 3E0NB 5FBEA 3U1JB 1UHBA 4KELA 2OCVB 3RM0H 1K1LA 2EI6A 4PROA 1ZTKA 2GCTB 4IMQA 1AO5A 1MTNC 2TPIZ 5DP5A 1T8OA 1HAHH 2BVXH 1L1NA 1SGNE 1EZQA 4IGDA 9LPRA 1YKTA 1GHBF 4CHAC 3DD2H 2BTCE 1CGJE 1PJPA 5DP3A 3SOSA 1VGCB 5FAHA 3UIRA 4MVNA 1WTHD 3BTWE 2SGEE 1NT1A 1AKSB 1N8OB 2P59A 1WCZA 4ABBA 4GSOA 4D7GA 2YNAA 2FYQA 5EPNA 3ZV8A 2HWLB 1H4WA 1ZRBA 2HPQH 1O3FA 4XOJA 1ETTH 2ZFPH 1GBHA 6GCHF 2OP9A 1EB2A 4NSVA 1QR3E 1L4DA 2ZWLH 3BG4B 3LGYA 1C9TA 1NRSH 1DLKB 4WXVA 1TOMH 1OP2A 4MQAA 3EA8A 4GCHF 1EOJA 1G2LA 3SI4H 1GG6C 2GZ8A 2ZGJA 3P17H 3SJIA 2ZKSA 1A5GH 4A1XA 2FEQH 3RXVA 2ZDMA 1ABIH 2GCTC 4YOIA 1THRH 2R0LA 2GDDA 3QZRA 2ZF0H 2FS9A 1O3PB 2GZ7A 1WTGH 2F3CE 7KMEH 3MOCA 3HGPA 1OSSA 1BJVA 3D65E 1L0ZA 1C1OA 1VGCC 5AFYH 3BTTE 5CMXH 3RMLH 4IW4E 1N8OC 2JKHA 1NFYA 3A7ZA 3RXUA 1GHVH 1A0HB 5FCKA 1ANCA 4UFGH 1BT7A 1TRYA 4I7YH 1YGCH 2XRCA 1T8LA 3GICB 2WUBA 1ANBA 3MH7A 2BDIA 2QXGA 2C8YB 5K7RA 3BG4C 2O8WA 4UFFH 4CH8B 3A80A 3RC5A 2PKAA 3RU4D 1BQYA 1GDNA 1XXDA 1VCPA 1C5SA 3TGIE 2FOCA 5L2YH 1BDAA 5L30H 3KQCA 2BQ6B 1RD3B 1CT2E 3M3VA 3F9EA 2HVXA 2PWXA 1TGBA 1ETSH 3C27B 2ZGXH 1JOUB 5JBAS 4CRCA 2QC2A 1BRBE 1VITF 3SNCA 1MKWK 3TJVA 2VJ1A 2XC4A 4UE7H 1L2EA 1AFQB 2Z9IA 5E2OA 2GV6A 1JIMA 1UMAH 4MNXA 4X2VA 1W0ZU 1UTPA 3ZYDA 1CA0B 1FY5A 1QTFA 3K6YA 4MNVA 1O34A 3ZVCA 1G3BA 2G5VA 2PTCE 3M7TA 1CHOF 2P3UB 1Z7KA 1HAYB 1O2RA 1NTPA 1KLIH 1BRCE 3ODDA 1XUGA 3LJOA 5A8XA 5T3HA 7GCHG 5EXNA 4D9QA 3ZZ8A 3SU2A 2ANMH 5AHGH 1BB0B 1ELTA 1O2YA 1TABE 1GBCA 3MMGA 1O2XA 1C2MA 1ANEA 4B75A 3M35A 2QF0A 4XE4A 3TK5A 1EXFA 3SJ9A 1D3PB 3GYLB 4OS7A 1LVMA 1P3EA 4BNRA 1GBAA 5BPEA 1O2OA 1O38A 1C2JA 1A1RA 1M9UA 1HLTH 1MU8B 4ZAEA 5EXLA 1GCTC 3OY6U 5DPAA 1C5WB 2VU8E 2ZPQA 1LVOA 3JZ2B 3TK9A 3PYHA 4MPXA 1RGQA 1SSXA 3QTVH 1DFPA 1YPKH 3MTYA 2ULLA 1AFQC 2JH0D 2F9VA 4GHTA 3T5FH 2WYJA 1RTKA 1BCUH 4E06H 1CA0C 5TCCA 5ESTE 2FOGA 5EG4A 3SN8A 1SFIA 3DA9B 2J9NA 7LPRA 2BDBA 1E38B 2A5AA 3W95A 3MU4A 1JWTA 1SOTA 5C5OA 5A0AE 2ZO3H 5JPMH 1TB6H 2RG3A 1QBNA 3STJA 4B2AA 1W7GH 3UTUH 4U2WA 3HKJB 4FUCA 1EATA 2OC1A 4XBDA 1TRNA 4U32A 2BHGA 3B23B 1FAXA 1QBOA 2GCHF 2RDLA 5DP8A 2ZCKP 1LHGH 3RXTA 3CENA 1A61H 3A7VA 3KQDA 1GBEA 2XBWA 1DDJA 3NXPA 2OINA 4JZ1A 1UCYE 1A0LA 5JBCS 4JCNA 4IN1A 2PFEA 3LJJA 2PR3A 4DJZB 2C90B 1GHBG 4KP0A 5GDSH 3RXDA 5A09A 1GMDG 3IWMA 3RXHA 1FJSA 1TX7A 2H9TH 4RKOB 1TA6A 1FPHH 1P12E 4TPYA 1IQKA 4D8NA 1UCYK 4UDWH 2Z94A 4X2XA 2XC5A 3F9FA 1YP9A 1L1GA 3BTEE 1GHAF 1UTJA 1C5TA 4X6MA 1ZJDA 1DITH 1JBUH 4FUEA 1IHTH 1P05A 3SHCH 1TMBH 6GCHG 3UQOA 3U9AH 1YC0A 2FOEA 5FCRA 5FHTA 1V6DA 1MBQA 3V3MA 1PQ8A 5C20A 4FUFA 2BY8X 3A8CA 2DUCA 3KCGH 2ASUB 4GCHG 3RXBA 5LGOA 5FPYA 3MNCA 2FTLE 2G51A 1ELBA 4Q7ZA 3K2UA 1UCYH 1MAYA 3M36A 4YO9A 3MYWA 1WUNH 3ZZDA 1C1RA 2Q1JA 4U30A 1BRAA 1E34B 1C1QA 2ODYB 3HK3B 3MI4A 1FNIA 5GXPA 3H7OA 4TWWA 3RUOA 5ESBA 4DOQA 3HKIB 3MWIU 2XCNA 2K1QA 2HPPH 1MKXK 2GMTB 1GJ5H 1Z8GA 4YT7H 1ID5H 2WV4A 4RKJB 1T4VH 1ELDE 4TYDA 1DWEH 3IITA 1GJ7B 1EJNA 5TJXA 4CBNA 1LHFH 3V0XA 2A4OA 3A81A 1ABJH 2FPZA 3GDVA 1G36A 4OS6A 3DFLA 1F5LA 3T29A 1D3DB 1V2MT 4J1YA 5A0BA 2AGEX 4ZKOU 3PLKA 3PWBA 1SGCA 2P93A 2GX4A 4KTCA 2VVVA 5J4SA 2UUYA 1C5LH 1WV7H 1BIOA 3A87A 4YTAA 3A83A 2BM2A 1EP6A 2QA9E 1HJ8A 1P2IA 3ZZAA 1CGHA 2XYAA 1QFKH 4GVUA 1VITG 5IYTA 5JBBS 1VZQH 1V2OT 4X1QU 3SORA 2ZDNA 4I31A 1EZXC 1QHRB 3LU9B 4LXBH 4AYVB 2VIDA 3RMOH 2SGAA 3TJOA 2BYAX 3QUMP 3E1XB 1IAUA 1K1NA 5DP9A 5AF9H 3ZZ7A 1AD8H 1BHXB 3UFAA 2PV9B 2Y80A 2GMTC 4YESB 2OBOA 1PPHE 3LGUA 4M7GA 3RXRA 1CHOG 2J95A 5DO4H 4B1TA 4IBLH 2H6MA 1AI8H 1NFXA 3FZZA 1PFXC 4H6TA 3RDZA 2HALA 3OSYA 3R0FA 4FXGH 3SGBE 1ZPCA 3FZDA 1NO9H 1O2WA 3TGJE 2Z9JA 4JZDH 3VB3A 2O8MA 2VIQA 2O8LA 2P8OB 3N7OA 3PO1B 1GJ8B 1HIAB 4IMZA 2F9OA 1CVWH 2EI7A 1C2FA 1NM6A 1BTPA 1O2NA 3LGTA 1O33A 1D6WA 1HAIH 2Y82A 5DP4A 5L6NH 2F9UA 3MU8A 1A2CH 2VWLA 2ZIQH 2UWLA 2WPJS 1GDUA 3KGPA 3MO9A 3RXCA 4MTBA 1XUJA 2Z3CA 2GGVB 1XX9A 1G30B 4XSKU 1V2VT 2BVSH 1J8AA 1VITH 1C1PA 1IQJA 1ELGA 4J2YB 2VVCA 3PWCA 1EB1H 5H4IB 1GJ9B 4DIHH 1GBBA 3NCLA 1TMUH 1YPEH 1HAOH 1HAVB 1JRTA 2FI5E 2P3TB 2FI4E 3SU3A 3MHWU