1O2ZA

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2zA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o2zA02
1FV9A 2GT8A 4AZ2B 1V3XA 1UHBB 3PV4A 3T2NA 1HJ9A 3EA8A 2IPHA 4X1SU 1KXEA 1G30B 1WQVH 2ZQ2A 4FUBA 2BDBA 1A0HB 1AIXH 1MCVA 4AOQA 4UD9H 3CP7A 3A85A 3EA7A 4Z6AH 1CT4E 2F9BH 2Z3DA 3SU0A 2XC4A 2QCYA 2R9PA 3RC5A 3AAVA 3NKKA 1BZXE 4YM9A 1HLTH 2STBE 3EQ0H 1GJCB 1TIOA 2ODPA 4SGAE 3SJKA 3VXFH 4IC5A 2XCNA 1QNJA 3LOXA 5GJ4B 3RLYH 1AU8A 4K1SA 3K65B 1C1NA 3MTYA 1SGRE 1DLEA 2AERH 2ZGCA 1NFWA 3R0FA 1C1OA 1RGQA 2ZFPH 1PPHE 1DUAA 3T27A 5GWZA 3K2UA 3PO1C 3K9XB 1HAGE 2VIDA 1QGFA 2OC8A 1ZMNA 1SLXB 2WYJA 1DY8A 1ANEA 1OYQA 1MKWH 1YPHE 4ABIA 1DANH 5FBIA 1HRTH 2HPPH 1TGSZ 3FAOA 4NIWA 1DUEA 1EPTC 3H7OA 3TLOA 2VVVA 3EDXB 1SQOA 2WPHS 1DE7H 1EQ9A 1P57B 5FPSA 5EODA 3LPRA 3ENSB 1DXWA 2LNCA 1A0LA 1O5EH 1TA2A 1OS8A 4X8TH 1NO9H 1BJUA 2WINI 2AMDA 5DGJA 1ZZZA 3A86A 1AKSA 3PO1B 1A3EH 4GLYA 2BZ6H 4MQAA 4Y6DA 2Y81A 3PTNA 1GBMA 1D4PB 3ZZ6A 1UVUH 5HYOA 4Q7ZA 4E7RG 1HPGA 4XDEA 4IS5A 4MDSA 1EPTB 1T8OA 1O2XA 2ZA5A 1YPKH 4KELA 5HM2A 1ELDE 2WV5A 4DGJA 6CHAC 1OWKA 3UWJH 2G4TA 2WV4A 1GHWH 1HAVA 1V2WT 4YTAA 3MYWA 1EJAA 2PV9B 4KP0A 3RU4E 4NSYA 2ZP0H 3T25A 4H42U 7GCHG 1GMDG 1OP8A 1TONA 1IQEA 3P70B 1O3CA 5EW1H 1O3IA 1TE0A 4ISOA 1FPHH 4ZAEA 2AEIH 1SVPA 2ZC9H 1O31A 2VU8E 4OS5A 1FN6A 1TMTH 1CGHA 4XOJA 1E35B 4UEHH 1LHFH 4LZ4B 1V2PT 3SUEA 3VB7A 1A4WH 2A0QB 2VVUA 1V2LT 1N8OB 2J9NA 3UUZA 4X1PU 1CBWB 1EAUA 3M3VA 1AWFH 4UFGH 3U98H 2OQ5A 1HJ8A 2BYAX 5C3NA 1HBTH 1CT2E 1TMUH 4I8JA 1O2HA 1O38A 1O2NA 1GMHF 4WY3A 3BIUH 3PROA 1UTMA 2ASUB 2ZFQH 1CHOG 1TPPA 2G5NA 2ZFSA 1GJ4H 2VIQA 1G3CA 2BLWA 5CMXH 1P3CA 1QFKH 1V2NT 2A1DB 1MKXH 1A46H 1DITH 3P8FA 1YF4A 4ASHA 1JBUH 1KXBA 2G51A 1GJ5H 2FO9A 2A32A 4B71A 3VXEH 1ZYOA 3O8DA 1D3TB 1KXAA 1WTHD 1M9UA 3VPKA 5LPRA 2ZCKP 1TMBH 1O2ZA 1PQ5A 1T8MA 1TRNA 1EZSC 4WH6A 4WVPE 3S9AA 2ZQ1A 3RXGA 3RXOA 3VFEA 2OUAA 2H9TH 4X2YA 3CS0A 1A0JA 5DP4A 1GI5A 1O2TA 2P94A 1C1MA 1H9LB 3TK5A 3RXCA 1AVWA 4JYVH 5EXMA 1IHSH 2ZPQA 1DM4B 4I32A 4K8BA 1Y59T 1GMDF 1XXDA 3QLPH 4CRFA 1HUTH 2XBXA 1SG8B 3DFJA 3EE0B 5ETXA 1PPGE 3ZZ3A 1TNJA 1HIAA 4FUCA 3UR6A 2KAIB 1AKSB 1OSSA 2O8LA 3SUDA 1CVWH 1T32A 2ZZUH 1Y3YA 2ALPA 5GPIB 4A92A 2PW8H 1IQIA 3CS7A 1E34B 1O3FA 1NM6A 4ABHA 2HWLB 1O33A 2VVCA 4UFDH 1WUNH 1XKAC 1SL3A 1IQHA 1YKTA 4HZHA 1HDTH 1Y3UA 3BTKE 2CV3A 3SNAA 1EKBB 1DWEH 1HAVB 4JMYA 5C2ZA 1CHOF 1HAHH 1A61H 4IMQA 2FWWA 3FZDA 1SLVB 1FI8A 3PTBA 5L2YH 1O2IA 3ZV8A 1LO6A 3BV9B 1MZAA 2OINA 1PPZA 4I8HA 3LIWA 5GDSH 2SNVA 3BSQA 2QAAA 4WF8A 1YC0A 1EAXA 3PMAB 1ETRH 3C1KA 1KXFA 4A7IB 1XUJA 1FIZA 1P12E 1Q31A 4B1TA 1ID5H 4ZHLU 4ABDA 2B0FA 1DDJA 3CENA 4OGYA 3F9FA 1S84A 1ANCA 2OTVA 1TQ7B 2BTCE 1H8DH 2BY6X 1S0RA 2HNTC 4WMFA 3E0PB 2P8OC 1GVLA 1VITG 4NFFA 1EATA 3TU7H 3S9BA 1UK4A 1G36A 4M7GA 1Y8TA 1PFXC 2LPRA 2VIOA 1QB9A 2BY9X 4WJG2 4O03A 1C5UA 1K2I1 1GHVH 1E38B 1LHDH 3M36A 3ZVDA 2EA3A 3A88A 2ODQA 3VB4A 1FMGA 4WXVA 4MNXA 1O2QA 4CH8B 2GV7A 1GG6C 3MU4A 4IN1A 3SNDA 1G2LA 1G2MA 4K1TA 1IHTH 1QBOA 1NN6A 1BTWA 3LT3A 3SNCA 2PGBB 1V2UT 8KME2 1AWHB 1F5KU 1MUEB 2C4FH 2P8OB 2Q6FA 2FLRH 3SQEE 4UDWH 3KEEA 3UNRA 3ATKA 2HGTH 4YLQH 3RXDA 5F8XA 3M7QA 3GICB 1Y3WA 1KYNA 4AORA 2C8XB 1WTGH 1GBAA 3A80A 5T6DA 5A0CA 1C1PA 1NRQH 2F9NA 1EOLA 3IITA 2VH6A 2H6MA 4U2WA 5JB9S 2HOBA 1TBZH 4YLUA 3DT0H 1GG6B 5BPEA 2BB4A 2DE9A 5EXLA 5AFYH 2YOLA 4BTTB 1KLIH 4DOQA 1W2KH 2QF0A 3RU4T 1GVZA 1O2JA 1W0ZU 1EP5A 1VJAU 4DY7B 1O5BB 1HIAB 1WBGB 3A8CA 3NPSA 8ESTE 5AVDA 1ETTH 1SMFE 4VGCC 1F0SA 1O39A 1BJVA 1SBWA 1GGDB 2D8WA 3GYMA 3LJJA 3DA9B 1O3HA 1O3BA 4IN2A 1Z6EA 3GCHC 4AG1A 3KF2A 3M7UA 2TGTA 4BXWA 1E36B 3ZYEA 1C4Y2 4A1TA 4CH2B 5I46H 2BX4A 1Y3XA 3BTFE 2SGEE 1VITF 4TYDA 4U32A 3PLKA 1EOJA 1GJAB 4O9VA 3UTUH 2C8ZB 1Z6JH 4X1RU 3M61U 2BDYA 4Q7YA 1O2WA 1BRCE 4VGCB 1SHHB 3LDXH 3QZQA 4K69A 3DFLA 2SGAA 3T28A 4NCYA 4NZQA 2R2WU 3SHCH 3UY9A 2QC2A 2AH4X 2HNTE 3GCHB 3RXPA 5DKMA 3SJIA 2ZPSA 1C5VA 5E2OA 1BCUH 1FQ3A 1MZDA 1TBRH 2ZHWH 1QJ1B 3UQOA 2TRMA 4DJZB 3LC5A 1WU1A 3SO3A 3MMGA 1C1UH 1BTYA 3M5MA 1ZR0A 1NT1A 2NU1E 4JZDH 1BITA 4GHTA 2EI6A 2BD4A 2GZ8A 2XBYA 3ZZDA 1N6YA 2ZU2A 1N1LA 1GJ8B 1JWTA 1UVSH 2ZTYA 1NC6A 3FVFB 4AFUA 1SB1H 4X8VH 1B5GH 3QTVH 3LGVA 5FPTA 2OBQA 4NSVA 4QT8C 5EW2H 4MVNA 2P3TB 4H4FA 3A8BA 4CRBA 3KN2A 1KLJH 2F83A 3OYPA 3B9FH 1QB6A 2TGDA 3BTGE 1AE8H 1Q2WA 3MNSA 4ZH8A 4YOGA 1J15A 1TALA 1Z7KA 4JZFH 1BUIA 5C5NA 2C3SA 2G00A 3F68H 1OWEA 2GT7A 3TJUA 1QA7A 4ISLA 1C2GA 2JH0D 3MU1A 1ZSJA 5AF9H 2V3OH 4INLA 2GKVE 5CHAB 3KCGH 1QCPA 1L0ZA 2GZ7A 4GPGA 4WMDA 5FX6A 1ZRBA 1NRRH 4SGBE 1KTTB 1AFEH 3AW0A 2NU2E 1ZMJA 1GHXH 3UWIA 2ZU4A 1RFNA 1FIWA 3SZNA 2ZFRH 1DSUA 5LH8A 4OS7A 1O35A 2FOHA 3RMMH 2B7DH 3RXRA 1J9CH 4FUDA 2P59A 4K5ZA 5L6NH 1C2LA 4PROA 1BHXF 1LQEA 2IN2A 1GJDB 3RXLA 2GD4B 3A7WA 2ILNA 1EZQA 3QGNB 1NU7B 3JZ1B 2ZIQH 3RXQA 1P9UA 5LGOA 4BAQB 1YCPH 2BDIA 1O5AB 4ZXYH 4CBNA 2ZDVH 2BLQA 2THFB 1VITH 2D2DA 2J4IA 3RXEA 3BTTE 2VJ1A 2W3IA 1BMLA 5A8YA 4NZLA 3TH3H 4UFEH 3UNQA 3VGCB 5H4IB 1QL9A 1A5IA 3GY3A 1CHGA 1W13U 1QQUA 1W12U 3KQBA 1DWCH 2Y7XA 2ZFTA 3BF6H 3PLBA 1TQ0B 1PQ8A 5DG6A 4B73A 3TH4H 1S85A 4Y79A 2GV6A 4ZMAH 3A7TA 1DPOA 1ZMLA 1QB1A 2A7HA 5EXNA 4DIHH 1LDTT 3VB6A 3V3MA 1XVMA 2I6SA 5TCCA 3SV2H 4Y71A 3RDZA 1C5OH 3S7HB 1V2ST 2NU4E 2ANWA 1A1RA 1LVOA 3KIDU 1GBEA 2RA3A 3DD2H 1TNGA 3A8DA 2WUBA 3L6PA 4Y0YE 2ZFFH 4RSPA 5EQRA 4A1VA 3SV6A 2A4OA 1Y3VA 2H2ZA 1GBLA 3F9HA 3T62A 9LPRA 1LVMA 4FU7A 1P06A 2PSXA 1AQ7A 3A82A 1O3KA 2Z6BD 1VGCC 4X1NU 1IAUA 2BXUH 3KQDA 5T6GA 5DP3A 3ZVEA 2WPIS 3SGBE 1QBVH 3VB3A 3OU0A 1MKXK 2HRVA 1C1SA 5L30H 3ODDA 2VIWA 3BTME 5FCRA 3ODFA 2ZHFH 2F9VA 1ZSLA 1A5HA 1C1QA 3ZZ9A 1EXFA 3B23B 1O2RA 1ELEE 1BBRK 3U8OH 1CE5A 2TIOA 1TNLA 1HCGA 2ZECA 1QURH 1V2OT 1BMNH 1FUJA 1P2NA 1HNEE 1Z8IB 3Q77A 1EZXC 5A09A 1BHXB 1C2HA 8LPRA 2SGDE 2R0LA 1UVTH 4MPWA 1DT2A 1W3CA 5HMAA 4U30A 1THSH 3E1XB 4XE4A 4I8LA 4Q80A 3M35A 3S7KB 4BAOB 3T26A 2W3KA 3M5LA 1FONA 4NIYA 1KLTA 1P9SA 3RMLH 2FOFA 3A7XA 1U6QA 1T7CA 4AX9H 3SU1A 1O3PB 4UONA 4Y8YA 1HV7A 4BNRA 1BA8B 3TK9A 3A84A 1O0DH 5EG4A 1TPOA 2FX4A 4D7FA 3SI3H 1MQ5A 1YPLH 1IQLA 5FXLA 3RXJA 5FBEA 5C1XA 5JBTA 1P8VC 2XTTB 1C9TA 3TH2H 2A5KA 3E16B 2XW9A 2FZZA 2BQ7B 4YO9A 1UK3A 2ZHQH 3AASA 3RP2A 2AGGX 2WUCA 2F9UA 2ZDMA 1SOZA 4AFQA 1ELAA 1UCYH 2PGQB 4DVAU 3MU0A 1K1OA 2OQUA 2A5AA 3MI4A 1PYTC 1KTSB 1K1MA 1ZTKA 5E0JA 3E0NB 4X2XA 7ESTE 4I7YH 1N6XA 1C4U2 1YM0A 4CRGA 3BTQE 4YT7H 2AGEX 2ZPRA 1XUFA 4D8NA 6CHAB 4Y8ZA 1OKXA 2GP9B 1C5LH 1K1JA 1RD3B 2CHAC 5C1YA 3URDA 2G8TA 4JZEH 2PWXA 2VNTA 1OPHB 1BIOA 2F91A 1TPAE 1S81A 4ABBA 1FNIA 3GCTG 4Y8XA 1LPKB 1EB2A 2GCHG 3QUMP 3STJA 1IQNA 4GHQA 1MMJN 3PMBB 1O3JA 4RKJB 2BD2A 1GWAA 1NU9A 1QL8A 2V6NA 1O34A 3E8LA 2XRCA 1Z8JB 3RU4D 1SGPE 1O2SA 5K7RA 4AGKA 1AB9C 3U69H 1O3DA 4ZKSU 3GY5A 1FY4A 2QF3A 1XVOA 3ZZBA 1C1VH 1L1NA 2CHAB 1KSNA 3D49H 2A7JA 1UJ1A 2Z7FE 4WMEA 1C1WH 4K60A 1AUTC 1UCYE 3P92A 1TOCB 3BTHE 3BTWE 3P95A 1ZTLA 1AUJA 3URCA 1GDUA 2ESTE 1G9IE 4OS2A 2FOBA 5DP7A 3HGNA 4ZUHA 2DUCA 3QTOH 2GVFA 3UPEA 4X8SH 3M5OA 1O3AA 4NIVA 1THPB 2W26A 3BG4C 5F03A 3VB5A 2Y5GA 1WOFA 2ZGBH 5ESBA 1DVAH 5FCKA 1TNKA 3RMNH 3GY4A 1T4UH 1GJ9B 2P3FH 1S6HA 1AB9B 1H4WA 3PB1E 4NFEA 1ELFA 1Y5BT 5T6FA 1KDQA 7GCHF 1TABE 1FAXA 2O8UA 3UQVA 1GBFA 1ESTA 1F5LA 4Y0ZE 5DP6A 5ABWA 2HNTF 3W95A 4KTUA 1IQMA 1K1IA 4CHAC 1A7SA 1V2TT 1EP6A 2A4GA 2BD3A 5JYIA 1RTKA 2QN5T 1ZPCA 1AO5A 1P2JA 2A2XH 2C8WB 3ATLA 1SFIA 2AMPA 2BHGA 3BG4B 2HPQH 1GBBA 1F0RA 1XUKA 4RN6A 3TVJB 1QRWA 2YNAA 4ESTE 1ZLRA 1TNIA 3AW1A 2GGVB 2H5CA 1C9PA 1QIXB 1SLWB 4R8TB 3K6ZA 1F5RA 4F49A 5FPYA 4K8YA 1P2KA 3GCTF 4BAMB 1TOMH 2BVXH 2GCHF 2J2UA 4D76A 2VWNA 1TPSA 5C5OA 1XMNB 5EPNA 1UTJA 4CHAB 2BQ6B 4CRCA 1O3MA 2FYRA 3QO6A 4AN7A 1WQSA 1VCWA 1DICA 1ZGVA 1GI3A 3EA9A 5AFZH 2PSYA 4LXBH 1LQDB 2R2MB 2FIRH 2FOEA 1QRXA 2PKSC 1AFQC 3BEUA 4HI3A 2XBWA 1VR1H 4XBDA 3NZIA 1O5CB 2XBVA 3PYHA 4OGXA 1MBQA 4I8KA 1KXCA 4ABAA 1S83A 3PMJA 1ZOMA 3TGIE 2FYQA 1EASA 3FFGA 3NK8A 2FOGA 2QXIA 3EAJA 2O8MA 3MOCA 4XSKU 3O8BA 3SU5A 3ZV9A 1EAIA 2GX4A 2R3YA 1C5SA 3BG8A 1P0SH 5J4SA 1SLUB 1LKBA 1V2RT 3UFAA 2ZTZA 4WWYA 1FY8E 2ZGHA 2O8WA 1GDNA 1HXFH 2ZCLP 8GCHG 1GI7B 3KQCA 5LPEA 2OP9A 1LKAA 1PYTD 4AGJA 2CF8H 2A31A 1P2MA 2C8YB 2CF9H 2Y7ZA 4B2CA 5E8EH 2PKSB 3A87A 4ABEA 1X7AC 4D9RA 1GI4A 1LHGH 5FX5A 1YLDA 5EQQA 1LMWB 4ABGA 1ZJDA 1GHZA 4K2YA 1TFXA 3RXBA 4FXGH 1IQGA 2BOKA 1J16A 5DJ7A 4CR9A 1LVYA 1YGCH 2G5VA 3GDSA 2EC9H 2ANKH 1O5GH 4JK6A 3RLWH 4AB8A 1D6RA 3OY6U 2UUYA 1TNHA 3GDVA 2A45B 3GISB 2ZU1A 2VWLA 1ZPBA 6GCHG 4D9QA 1J17T 1TGCA 3BN9A 4BOHA 3K6YA 3F9EA 2BM2A 1KDQB 3IWMA 2OCVB 2AIQA 1QHRB 1JRTA 4ZROA 1PQ7A 3EYDA 1ANDA 4B76A 2FOCA 3A7VA 3SW2B 3DHKH 1JXPA 3T5FH 5C1UA 1SHYA 1OWHA 4K1EA 1HAPH 1GMCG 4E06H 3TJOA 1YPGH 1OP2A 4Y7BA 1JMOH 1DS2E 4TWWA 3C27B 2TPIZ 3PM3A 3SU4A 1HJAC 2R3UA 3UOUA 1SR5C 4R0IA 2UWOA 1EZUC 2XNIA 4YZUA 1AMHA 2FODA 3I77A 2BQWB 2GCTC 1C5NH 4IGDA 1ABIH 2G52A 2RCEA 1TYNA 2CGAA 1TGBA 1C2IA 2XXLA 1L1GA 3MH4A 4DURA 1BTPA 3P17H 8GCHF 1J8AA 2UUJB 1GCDA 1TA6A 4Y76A 1A5GH 1GDQA 1HYLA 3HATH 1K1PA 3VEQB 2SGFE 2ZGXH 1F0TA 1O2UA 5DK1A 1MD7A 4J1YA 1HJAB 2STAE 2GMTC 1PPFE 2F9OA 5PTPA 1NFYA 3D23A 1Y5AT 3ATMA 1C5YB 2VGCC 5HGGA 4FUFA 5JDUB 2ZHDA 3GCNA 1WYKA 3TNTA 1SOTA 2Q6GA 2VWMA 1SGTA 4ABJA 2PUXB 4J2YB 2AYWA 2CJIA 4ZKOU 3NUMA 1GL1A 1GJ6A 1ESBA 1F7ZA 4Y10E 1YP9A 3ZYDA 4CRDA 3S69A 3M7TA 1IQJA 3S0NA 1TX7A 1HXEH 2UUKB 2ZDNA 4CRAA 5A0BA 1DWDH 1ELBA 1PPCE 1BTUA 4NWKA 2ZU5A 2QXHA 3MHWU 2ZNKH 1EB1H 4X2WA 3RXUA 2OC7A 2QXJA 3H5CB 1AZ8A 1CT0E 5EOKA 3KQEA 2PKAA 2W5EA 1QJ6B 3Q3XA 4IW4E 2GMTB 1PPBH 2H9EH 2BD5A 3SNEA 2AFQB 1GHBG 3A7ZA 3D62A 2V35A 5B6OA 1C1RA 1TBQH 2VGCB 2ZWLH 3E6PH 1Y5UT 1RXPA 4B2BA 1ZTJA 1GBDA 1D6WA 1SC8U 2FOMB 5HM9A 1GMCF 1B0FA 1QA0A 1Z1JA 1C5RA 3MNBA 1O32A 1O3NA 1OYTH 2ZDKA 2QY0B 2WPMS 2ZF0H 1D3DB 2XC5A 1AGJA 2FXRA 1GHYH 4IBLH 2QYIA 4AFZA 1MKWK 1O2KA 4A6LA 1GI8B 1O3EA 9ESTA 1DXPA 1BTHH 3ZZ5A 3SJOA 3QN7A 1W11U 3NXPA 4JYTA 1MBMA 4MPXA 3LJOA 4MTBA 1RTFB 1QQ4A 3MU5A 3LU9B 1O36A 2SGQE 3F6UH 4X8UH 3MWIU 1FZZA 5IDKA 2J95A 4O97A 1BMAA 1QY6A 1OOKB 4FUJA 3RXHA 3SV8A 4NWLA 4RKOB 2Z9JA 1C2KA 1AHTH 3RUOA 1BTXA 2BDGA 1CQQA 2BVRH 4ZKRU 2FEQH 1UO6A 4DG4A 3QK1A 3RXSA 2DE8A 3V0XA 3A89A 2WPJS 4FVBA 4Q2KA 3ELAH 1NFXA 2ZDLA 4BANB 3FZZA 2VWOA 1DFPA 5BRRE 1F0UA 3SJ9A 1HAXB 1FY5A 2P93A 2QV1A 2PTNA 3PLPA 3LGIA 3MFJA 1MTSA 4YOJA 1IQKA 2UWLA 2ZEBA 4JK5A 2FTLE 1NRPH 3SGAE 1KIGH 2A4RA 4ISIH 1YPJH 4KKDA 5CE1A 3GY2A 1TRMA 2BX3A 2AS9A 1UCYK 2B5TB 1GHBF 1GBCA 3BEIB 4DW2U 3ATWA 2BY7X 5A0AE 3AAUA 4ABFA 3M3TA 1TWXB 1UTOA 3BIVH 5FAHA 1S82A 1HAIH 2C90B 1OWJA 1NS3A 4BTUB 1P2OA 2VIPA 3TNSA 4OS4A 4I8GA 2TGPZ 2HVXA 4INHA 3RXKA 3O8RA 1UVOA 4OS1A 2D26C 2OXSA 1GJ7B 1INCA 1NRSH 2RG3A 2UWPA 3A7YA 4FUHA 2BVSH 1ZPZA 1MH0A 4MG3A 2PKAB 1BDAA 2AMQA 1WAYB 2ZO3H 2PHBA 2M5TA 3RMOH 1FJSA 4GCHG 3SQHE 1D3PB 1MTUA 1QR3E 3UOPA 4BAHB 2FS8A 1TRYA 1C5PA 2SFAA 5C67A 3TGKE 1TLDA 2OC0A 1S6FA 1P03A 2PUQH 3G01A 1MTWA 1CGJE 1VZQH 1JOUB 1O3OA 3ZZAA 1BQYA 4GAWA 3FP8E 4AYYB 4K3JA 4A1XA 2AIPA 4DCDA 1W10U 1V2JT 1VGCB 2QIQA 1GMHG 2W7UA 1GI2A 4B75A 1O2OA 1ZHRA 3KNXA 3STIA 3TITA 1RIWC 2OBOA 3HK3B 4OS6A 4ZHMU 2PTCE 1TB6H 1KY9A 5GCHG 1C5ZB 1QRZA 1ELGA 1CSOE 1O5FH 2BD9A 3FANA 1QTFA 3LONA 4JCNA 3M3SA 3H7TA 5E0HA 1YBWA 1HAOH 2ANYA 3QZRA 1C2JA 1QBNA 2KAIA 1B0EA 4ZHAA 2QA9E 1FPCH 2GDEH 2VH0A 1XM1A 1ZGIA 1P2QA 5DO4H 3LKWA 2PR3A 1K21H 3L3TA 3RM0H 2CXVA 1UMAH 3KL6A 1QJ7B 1LVBA 2EI7A 1EX3A 1O3LA 1VJ9U 1DOJA 1SPJA 2FX6A 5GXPA 3LC3A 5FHTA 1RIWB 1G32B 4ISNA 1C5TA 2H5DA 2C93B 1N8OC 1T4VH 1CBWC 1DSTA 1GPZA 4H6TA 1ARBA 2FESH 2FDAA 3RXIA 1BRUP 3ZZ7A 1F2SE 1WSSH 2BLVA 3SN8A 4LOYH 1K28D 4F4OC 1ELVA 3RXAA 3SU3A 3RC4A 2Z3EA 3SV9A 1SFQB 3RXMA 2OLGA 1DWBH 2P95A 1O2MA 1H8IH 1RJXB 3KGPA 1GBTA 3RM2H 2BLOA 2IOTA 3PWBA 4GCHF 4AG2A 3GY6A 1C2MA 3MO9A 2FPZA 4X0WU 3A8AA 3LGYA 3NCLA 1W8BH 4TWYA 2SNWA 3P8OA 1K1NA 1YLCA 3TJNA 1MCTA 3DUXH 1O2YA 4MPUA 1O5DH 1V2KT 1XKBC 3ZVGA 2Y82A 1VCPA 3Q76A 1XX9A 1L4DA 1SGNE 3E90B 2ZI2H 3MU8A 3OTJE 2BDCA 3TPIZ 4A5TS 2BDHA 5DP5A 2Z9IA 3HPTB 1A3BH 3T29A 3TIUA 1SQTA 6LPRA 2BZAA 2FTMA 1ANBA 5GCHF 2GZ9A 4INKA 4JZIA 4NIXA 1HGTH 2ALVA 2ANMH 3KHVA 3HKIB 1MTNC 1ELTA 1S0QA 3SGQE 5JPMH 1HFDA 2BY5X 1GHAG 2O9QA 3SUGA 2EI8A 5L2ZH 3L33A 2JKHA 7KMEH 3P8NA 1SGYE 2P16A 4NGAH 3WY8A 1MD8A 1J14A 1BBRH 3O8CA 1LPZB 3ZVBA 4D7GA 1G37A 1AVGH 1FXYA 1JIRA 1ACBE 3D65E 2FI3E 3QX5H 1O3GA 3PWCA 4FU9A 3SU2A 1T31A 1AI8H 1OWDA 3ESTA 3MH6A 1H9HE 3EGKH 2P3UB 2RA0A 2TGAA 4JYUH 2Q6DA 1SGEE 2XWAA 1C1TA 1H9IE 1A2CH 4KGAA 1GVKB 1TGTA 3LH1A 2YNBA 1CA8B 1MTNB 1SI5H 3SORA 2B8OH 2WYGA 2JH5D 1K9OE 1MU8B 4X6MA 4XBBA 1ABJH 1P11E 4XBCA 1ESAA 2NU3E 3IG6B 1NTPA 2A2QH 3SJ8A 1C5MD 1UVPA 1T8LA 2HALA 3GY8A 2A5IA 3MH5A 5J4QA 2FS9A 3M37A 3OSYA 3GCOA 4NA7A 1ORFA 4X2VA 1DY9A 1GI1A 1V2MT 3N7OA 3SNBA 5SGAE 3F9GA 1CA0C 2UUFB 1G3BA 2ZCHP 1BBRE 5HXFA 2H1UA 5A2MH 3BTDE 1PQAA 4X1QU 3SUFA 1HAZB 4BAKB 2PLXA 1TAWA 3V12A 1OXGA 1AN1E 1UTLM 4FUEA 1P01A 1Z71A 4WXIA 5GIBA 3R3GB 1P10A 2R0KA 1ELCA 3SHAH 4NG9H 4X6OA 3RXTA 5DP9A 1C4V2 4LK4A 5DP8A 3ZZCA 5F8TA 4FU8A 1PJPA 1YPEH 5EPYA 1CGIE 1GHAF 2BXTH 1SQAA 1MQ6A 3I29A 1FY1A 1ZHMA 3JZ2B 1GI9B 1AY6H 1CA0B 1SGFG 3V13A 2PFEA 2V0BA 1FN8A 1GJBB 4BXSA 1ZHPA 1D9IA 1F92A 1NRNH 1EAWA 1NZQH 1W14U 1MAYA 4JZ1A 1T8NA 7LPRA 3TJVA 1UTKA 4FVDA 4Y11E 2AGIX 1AFQB 1IOEA 3U1IB 2H9HA 4IC6A 4AFSA 1O37A 4WH8A 3MO3A 4TPIZ 3QGJA 1L2EA 2GDDA 1O30A 5F6MA 2ZTXA 4GUXA 1AD8H 1L1JA 3A81A 1D3QB 2GTBA 4DT7B 2Z94A 1HB0B 3LGUA 2IJOB 2G55A 3GYLB 2ZDAH 1BOQA 1G3DA 1V2VT 2JH6D 4Z0KA 2Z3CA 1ZRKA 1JIMA 2CN0H 1BTZA 5C20A 4TPYA 3AVZA 4Y7AA 2J34A 3V7TA 1P09A 1RS0A 1W7XH 4B74A 3UREA 4GVUA 2J94A 3MO6A 1FDPA 5F8ZA 4ISHH 4O3TA 1ARCA 1GBHA 4FUIA 1H1BA 2XYAA 4X6NA 2ZU3A 1FAKH 4IMZA 1UTPA 6ESTA 1GGDC 4MPVA 2SGPE 1MTVA 2XCFA 3Q3YA 3MH7A 1SGFA 1P04A 2Z9KA 2VB0A 1DX5M 1PPEE 2XWBI 4THNH 4ZKNU 2RDLA 4O3UA 1YYY1 1B7XB 2BDAA 2W7SA 2J38A 2D1JA 1BRBE 3SBKA 1KXDA 1LTOA 2Z9GA 1NESE 3LGWA 1NPMA 3SOSA 1GI0A 1YPMH 1CU1A 1C2EA 2FI5E 4I31A 2O8TA 5EGMA 1V2QT 4AB9A 2FMJA 1O2VA 4MNWA 1C2DA 5E0GA 4LZ1H 3UNSA 4NA8A 1XXFA 1TX8A 3ZZ8A 1UTQA 2G4UA 4X6PA 4E7NA 3I78A 1RRKA 2Y6TA 4HTCH 2VIVA 3W94A 1K22H 2QGRA 1P05A 5EU8A 2FLBH 1O2LA 1YCPK 1NROH 1SGCA 3LH3A 2OD3B 4HFPB 3Q00A 2K1QA 5LPFA 4GSOA 2Q1JA 3OX7U 4I33A 3ZZ4A 5E2PA 1P3EA 1C5WB 3FP7E 1VCQA 1UHBA 4FUGA 4UFFH 5IYTA 3GY7A 2BD8A 2V3HH 1P2IA 3HGPA 1XUIA 1FY3A 1Z8RA 2F9PA 1EJNA 2GCTB 4UE7H 1LHCH 3SV7A 2NU0E 1TGNA 1E0FD 4YOIA 2A7CA 3SI4H 1V6DA 2VINA 4B2AA 1SSXA 5TCAA 2F3CE 1ZJKA 3ZVFA 6GCHF 1XUGA 1BT7A 3BEFB 4U01A 4KTSA 1LPGB 1SGDE 3Q3KA 5AHGH 1Z1IA 1GBKA 2WPKS 3LGTA 5K0HA 1O2GH 3P8GA 2QXGA 4HGCA 3GOVB 5G4BA 2TBSA 3TK6A 2I6QA 2BOHB 1C5QA 2FI4E 1SGQE 2A4QA 5TJXA 3ATIA 1EUFA 3GDUA 5I25A 1GCTC 5JBCS 1ETSH 2NWNA 2ZKSA 1L4ZA 1GI6A 3F1SB 2Y80A 3MNXA 2CMYA 5CHAC 2FP7B 3QDZB 3UIRA 5ESTE 2J92A 1YCPM 1S5SA 3ZVAA 1G3EA 4YESB 1P02A 4CBOA 1MU6B 2Y5HA 5JB8S 5JBAS 3MNCA 2HLCA 3B8JA 1DLKB 1AZZA 1C5XB 1UK2A 4E05H 3P6ZB 5T3HA 1AVXA 2JETC 3OY5U 5JBBS 3U8TH 1CO7E 1GBJA 5A8XA 1LHEH 2FM2A 1YPHC 2XC0A 1AE5A 1WV7H 4BTIB 1OX1A 1NFUA 2OC1A 1THRH 4MLFB 2G81E 4ZXXH 2ULLA 2B9LA 3E91A 3PMHB 2FOAA 5DPAA 1GCTB 1WCZA 3E3TA 3FP6E 3RC6A 4AYVB 3ZVCA 1JRSA 2ZG0H 4NA9H 4TY6A 4YT6H 1NY22 2BY8X 3RXFA 1W7GH 4MNYA 1GBIA 3U9AH 1UTNA 1Q3XA 4Q7XA 1XUHA 3A83A 3QWCH 1LCYA 5EQSA 3VGCC 1OWIA 3U1JB 4TY7A 1EPTA 2ODYB 1BMMH 1GL0E 3NWUA 1BRAA 2ZHEH 2JETB 1K1LA 1O2PA 3SU6A 4H6SB 5A8ZA 4KTCA 1IQFA 1BB0B 1W0YH 2BD7A 1HAYB 3TGJE 4MNVA 2ZGJA 1ZSKA 3RXVA 3BTEE 3U8RH 3M5NA 1SGIB 1RTLA 3ITIA 1QL7A 1FLEE 2EEKA 1MAXA 1EJMA 1Z8GA 2Z9LA 4CREA 3S9CA 1TX6A 4DIIH 3HKJB 1OP0A 1C2FA 2BMGB 2Y5FA 4CR5A 3HK6B 4XFQA 1E37B 2WPLS 3UR9A
chains in the Genus database with same CATH superfamily
1FV9A 2GT8A 4AZ2B 3PV2A 1V3XA 1UHBB 3PV4A 3T2NA 1HJ9A 3EA8A 2IPHA 4X1SU 1KXEA 1G30B 1WQVH 2ZQ2A 4FUBA 1E1QD 2BDBA 1A0HB 1AIXH 1MCVA 4AOQA 4UD9H 3CP7A 3A85A 3EA7A 2KR7A 4Z6AH 1CT4E 2F9BH 2Z3DA 3SU0A 2XC4A 2QCYA 2R9PA 3RC5A 3AAVA 3NKKA 1BZXE 4YM9A 1HLTH 2STBE 2XNDD 3EQ0H 1GJCB 1TIOA 2ODPA 4SGAE 3SJKA 3VXFH 4IC5A 2XCNA 1QNJA 3LOXA 4F55A 5GJ4B 3RLYH 1AU8A 4K1SA 3K65B 1C1NA 3MTYA 1SGRE 1DLEA 2AERH 2ZGCA 1NFWA 3R0FA 1C1OA 1RGQA 2ZFPH 1PPHE 1DUAA 3T27A 5GWZA 3K2UA 3PO1C 3DSOA 3K9XB 1HAGE 2VIDA 1QGFA 2OC8A 1ZMNA 1SLXB 2WYJA 1DY8A 1ANEA 1OYQA 1MKWH 1YPHE 4ABIA 1DANH 5FBIA 1HRTH 2HPPH 1TGSZ 4ACAA 3FAOA 4NIWA 1DUEA 1EPTC 3H7OA 3TLOA 2VVVA 3EDXB 1SQOA 2WPHS 1DE7H 1EQ9A 1P57B 5FPSA 5EODA 3LPRA 3ENSB 2F4LA 1DXWA 2LNCA 1A0LA 1O5EH 1TA2A 1OS8A 4X8TH 1NO9H 1BJUA 2WINI 2AMDA 5DGJA 1ZZZA 3A86A 1AKSA 3PO1B 1A3EH 4GLYA 2BZ6H 4MQAA 4Y6DA 3CNRA 2Y81A 3PTNA 1GBMA 1D4PB 3ZZ6A 1UVUH 5HYOA 4Q7ZA 4E7RG 1HPGA 4XDEA 4IS5A 4MDSA 1EPTB 1T8OA 1O2XA 2ZA5A 1YPKH 4KELA 5HM2A 1ELDE 2WV5A 4DGJA 6CHAC 3UAIC 1OWKA 3UWJH 2G4TA 2WV4A 3OEED 3WWFA 1GHWH 1HAVA 1V2WT 4YTAA 3MYWA 1EJAA 2PV9B 4KP0A 3RU4E 4NSYA 2ZP0H 3T25A 4H42U 7GCHG 1GMDG 1OP8A 1TONA 1IQEA 3P70B 1O3CA 5EW1H 1O3IA 1TE0A 4ISOA 1FPHH 4ZAEA 2AEIH 1SVPA 2ZC9H 3NRLA 1O31A 2VU8E 4OS5A 1FN6A 2EY4C 1TMTH 1CGHA 4XOJA 1E35B 4UEHH 1LHFH 4LZ4B 1V2PT 3SUEA 3VB7A 2AHME 3PV5A 1A4WH 2A0QB 3UB0A 3DCLA 4ACBA 2VVUA 1V2LT 1N8OB 2J9NA 3UUZA 4X1PU 1CBWB 2W6JD 1EAUA 3M3VA 1AWFH 4UFGH 2JDID 3U98H 2OQ5A 1HJ8A 2BYAX 5C3NA 1HBTH 1CT2E 1TMUH 4I8JA 1O2HA 1O38A 1O2NA 3FOAA 1GMHF 4WY3A 3BIUH 3PROA 1UTMA 2ASUB 2ZFQH 1CHOG 1TPPA 2G5NA 2ZFSA 1GJ4H 2VIQA 1G3CA 2BLWA 5CMXH 1P3CA 1QFKH 1V2NT 2A1DB 1MKXH 1A46H 1DITH 3P8FA 1YF4A 4ASHA 1JBUH 2KX4A 1KXBA 2G51A 1GJ5H 2FO9A 2A32A 4B71A 3VXEH 1ZYOA 3O8DA 1D3TB 1KXAA 1WTHD 1M9UA 3VPKA 5LPRA 2ZCKP 1TMBH 1O2ZA 1PQ5A 1T8MA 1TRNA 1EZSC 4WH6A 4WVPE 3S9AA 2ZQ1A 3RXGA 3RXOA 3VFEA 1SQRA 2OUAA 2H9TH 4X2YA 3CS0A 1A0JA 5DP4A 1GI5A 1O2TA 2P94A 1C1MA 1H9LB 3TK5A 3RXCA 1AVWA 4JYVH 5EXMA 1EFRD 1IHSH 2ZPQA 1DM4B 4I32A 4K8BA 1Y59T 1GMDF 1XXDA 3QLPH 4CRFA 1HUTH 2XBXA 5DN6D 1SG8B 3DFJA 3EE0B 3N99A 5ETXA 2WHXA 1PPGE 3ZZ3A 1TNJA 1HIAA 4FUCA 3UR6A 4DT4A 2KAIB 1AKSB 1OSSA 2O8LA 3SUDA 1CVWH 1T32A 2ZZUH 1Y3YA 2ALPA 5GPIB 4A92A 2PW8H 1IQIA 3CS7A 1E34B 1O3FA 1NM6A 4ABHA 2HWLB 1O33A 2VVCA 4UFDH 1WUNH 5EJLA 1XKAC 1SL3A 1IQHA 1YKTA 4HZHA 1HDTH 1Y3UA 4P00A 3BTKE 2CV3A 3SNAA 1EKBB 1DWEH 1HAVB 4JMYA 5C2ZA 1CHOF 1HAHH 1A61H 4IMQA 2FWWA 3FZDA 5HIZA 1SLVB 1FI8A 3PTBA 5L2YH 1O2IA 3ZV8A 1LO6A 3BV9B 1MZAA 2OINA 1PPZA 4I8HA 3LIWA 5GDSH 2SNVA 3BSQA 2QAAA 4WF8A 1YC0A 1EAXA 3PMAB 1ETRH 3C1KA 1KXFA 4A7IB 1XUJA 1FIZA 1P12E 1Q31A 4B1TA 1ID5H 4ZHLU 4ABDA 2B0FA 1DDJA 3CENA 4OGYA 3F9FA 1S84A 1ANCA 2OTVA 1TQ7B 2BTCE 1H8DH 2BY6X 2HNTC 1S0RA 4WMFA 3E0PB 2P8OC 1GVLA 1VITG 4NFFA 1EATA 3TU7H 3S9BA 1UK4A 1G36A 4M7GA 1Y8TA 1PFXC 3F2HA 2LPRA 2VIOA 1QB9A 2BY9X 4WJG2 4O03A 1C5UA 1K2I1 1GHVH 1E38B 1LHDH 3M36A 3ZVDA 2EA3A 3A88A 2ODQA 3VB4A 1FMGA 2W6ID 4WXVA 4MNXA 1O2QA 1WXRA 4TT3D 4CH8B 3FO8D 2GV7A 1GG6C 3MU4A 4IN1A 3SNDA 1G2LA 1G2MA 4K1TA 1IHTH 1QBOA 1NN6A 1BTWA 3LT3A 3SNCA 2JJ2D 2PGBB 1V2UT 8KME2 1AWHB 1F5KU 1MUEB 2C4FH 2P8OB 2Q6FA 2FLRH 5EJ1A 3SQEE 4UDWH 3KEEA 3UNRA 3ATKA 2HGTH 4YLQH 3RXDA 5F8XA 3M7QA 4FOUC 1E79D 3GICB 2KCOA 1Y3WA 1KYNA 4AORA 2C8XB 1WTGH 2VBCA 4XD7D 1GBAA 3A80A 5T6DA 5A0CA 1C1PA 1NRQH 2F9NA 1EOLA 2RDEA 2VH6A 3IITA 2H6MA 4U2WA 5JB9S 2HOBA 1TBZH 4YLUA 3DT0H 1GG6B 5BPEA 2BB4A 2DE9A 5EXLA 5AFYH 2YOLA 4BTTB 1KLIH 4DOQA 1W2KH 2QF0A 3RU4T 1GVZA 1O2JA 1W0ZU 1EP5A 1VJAU 4DY7B 1O5BB 1HIAB 1WBGB 3A8CA 3NPSA 8ESTE 5AVDA 1ETTH 1SMFE 4VGCC 1F0SA 1O39A 1BJVA 1SBWA 1GGDB 2D8WA 3GYMA 1QZ8A 2HLDD 3LJJA 3DA9B 1O3HA 1O3BA 4IN2A 1Z6EA 3GCHC 4AG1A 3KF2A 3M7UA 2TGTA 4BXWA 1E36B 3ZYEA 1C4Y2 4A1TA 4CH2B 5I46H 2BX4A 3U28C 1Y3XA 3BTFE 2SGEE 1VITF 4TYDA 4B6FA 4U32A 3PLKA 1EOJA 1GJAB 4O9VA 3UTUH 2C8ZB 1BMFD 1Z6JH 4X1RU 3M61U 2BDYA 4Q7YA 1O2WA 1BRCE 4VGCB 1SHHB 3LDXH 3QZQA 4K69A 3DFLA 2SGAA 3T28A 4NCYA 4NZQA 2R2WU 3SHCH 3UY9A 2QC2A 2AH4X 2HNTE 3GCHB 3RXPA 5DKMA 3SJIA 2ZPSA 1C5VA 5E2OA 1BCUH 1FQ3A 1MZDA 1TBRH 2ZHWH 1QJ1B 3UQOA 2TRMA 4DJZB 3LC5A 1WU1A 3SO3A 1YLNA 3MMGA 1C1UH 1BTYA 3M5MA 1ZR0A 1NT1A 2NU1E 4JZDH 1BITA 4GHTA 2EI6A 2BD4A 2GZ8A 2XBYA 3ZZDA 1N6YA 2ZU2A 1N1LA 1GJ8B 1JWTA 1UVSH 2ZTYA 1NC6A 3FVFB 3W1EA 4AFUA 1SB1H 4X8VH 3EE7A 1B5GH 3QTVH 2WV9A 3LGVA 5FPTA 2OBQA 4NSVA 4QT8C 5EW2H 4MVNA 1W0JD 2P3TB 4H4FA 3A8BA 4CRBA 3KN2A 1KLJH 2F83A 3OYPA 3B9FH 1QB6A 2TGDA 3BTGE 1AE8H 1Q2WA 1VKYA 3MNSA 4ZH8A 4YOGA 1YY3A 1J15A 1TALA 1Z7KA 4JZFH 1BUIA 4RI0A 5C5NA 2C3SA 2G00A 3F68H 1OWEA 2GT7A 3TJUA 1QA7A 1FX0B 4ISLA 1C2GA 2JH0D 3MU1A 1ZSJA 5AF9H 2V3OH 4INLA 2GKVE 5CHAB 3SYJA 3KCGH 1QCPA 1L0ZA 2GZ7A 4GPGA 4WMDA 5FX6A 1ZRBA 1NRRH 4SGBE 1KTTB 1AFEH 3AW0A 2NU2E 5KECA 1ZMJA 1GHXH 3UWIA 2ZU4A 1RFNA 1FIWA 3SZNA 2ZFRH 1DSUA 5LH8A 4OS7A 1O35A 2FOHA 3RMMH 2B7DH 3RXRA 1J9CH 4FUDA 2P59A 4K5ZA 5L6NH 1C2LA 4RT1A 4PROA 1BHXF 1LQEA 2IN2A 1GJDB 3RXLA 2GD4B 3A7WA 2ILNA 1EZQA 3QGNB 1NU7B 3JZ1B 2ZIQH 1WDIA 3RXQA 1P9UA 5LGOA 4BAQB 1YCPH 2BDIA 1O5AB 4ZXYH 4CBNA 2ZDVH 2BLQA 2THFB 1VITH 2D2DA 2J4IA 3RXEA 3BTTE 2VJ1A 2W3IA 1BMLA 5A8YA 3N7DA 4NZLA 3TH3H 4UFEH 3UNQA 3VGCB 5H4IB 1QL9A 1A5IA 3GY3A 1CHGA 1W13U 1QQUA 1W12U 3KQBA 2JJ1D 1DWCH 2Y7XA 2ZFTA 3BF6H 3PLBA 1TQ0B 1PQ8A 5DG6A 4B73A 3TH4H 1S85A 4Y79A 2GV6A 4ZMAH 2K8IA 3A7TA 1DPOA 1ZMLA 1QB1A 2A7HA 5EXNA 4DIHH 1LDTT 3VB6A 3V3MA 1XVMA 2I6SA 5TCCA 3SV2H 4Y71A 3DSPA 3RDZA 1C5OH 3S7HB 1V2ST 2NU4E 5EJZA 5CDFE 2ANWA 1A1RA 1LVOA 3KIDU 1GBEA 3KYFA 2RA3A 4I86A 3DD2H 2KCPA 1TNGA 3A8DA 2WUBA 3L6PA 4Y0YE 2ZFFH 4RSPA 5EQRA 4A1VA 3SV6A 2A4OA 1Y3VA 2H2ZA 1GBLA 3F9HA 3T62A 5T1VA 9LPRA 1LVMA 4FU7A 1P06A 2PSXA 1AQ7A 3A82A 1O3KA 2Z6BD 1VGCC 4X1NU 1IAUA 2BXUH 3KQDA 5T6GA 5DP3A 3ZVEA 2WPIS 3SGBE 1QBVH 3VB3A 3AK5A 3OU0A 1MKXK 2HRVA 1C1SA 5L30H 3ODDA 2VIWA 3BTME 5FCRA 5CHBA 3ODFA 2ZHFH 2F9VA 1ZSLA 1A5HA 1C1QA 3ZZ9A 1EXFA 3B23B 1O2RA 1ELEE 1BBRK 3U8OH 1CE5A 2TIOA 1TNLA 1HCGA 2ZECA 1QURH 1V2OT 1BMNH 1FUJA 1P2NA 1HNEE 1Z8IB 3Q77A 1EZXC 5A09A 1BHXB 1C2HA 4ASUD 8LPRA 2SGDE 2R0LA 4HG6A 1UVTH 4MPWA 1DT2A 1W3CA 5HMAA 4U30A 1THSH 3E1XB 4XE4A 4I8LA 4Q80A 3M35A 3GS9A 3S7KB 4BAOB 3T26A 2W3KA 3M5LA 1FONA 4NIYA 1KLTA 1P9SA 3RMLH 2FOFA 3A7XA 1U6QA 1T7CA 4AX9H 3SU1A 1O3PB 4UONA 4Y8YA 1HV7A 4BNRA 1BA8B 3TK9A 3A84A 1O0DH 5EG4A 1TPOA 2FX4A 4D7FA 3SI3H 1MQ5A 1YPLH 1IQLA 5FXLA 3RXJA 5FBEA 5C1XA 5JBTA 1P8VC 2XTTB 1C9TA 3TH2H 2A5KA 3E16B 2WPDD 2XW9A 2FZZA 2BQ7B 4YO9A 1UK3A 2ZHQH 3AASA 3RP2A 2AGGX 2WUCA 2F9UA 2ZDMA 1SOZA 4AFQA 1ELAA 1UCYH 2PGQB 4DVAU 3MU0A 1K1OA 2OQUA 4YXWD 2A5AA 2IJD1 3MI4A 1PYTC 2J98A 1KTSB 1K1MA 1ZTKA 5E0JA 3E0NB 4X2XA 2CK3D 7ESTE 4I7YH 1N6XA 1C4U2 1YM0A 4CRGA 3BTQE 4YT7H 2AGEX 2ZPRA 1XUFA 4D8NA 6CHAB 4Y8ZA 1OKXA 2GP9B 1C5LH 1K1JA 1RD3B 2CHAC 5C1YA 3URDA 2G8TA 4JZEH 2PWXA 2VNTA 1OPHB 1BIOA 2F91A 1TPAE 3OFND 1S81A 4ABBA 1FNIA 3GCTG 4Y8XA 1LPKB 1EB2A 2GCHG 3QUMP 3STJA 1IQNA 4GHQA 1MMJN 2F43B 3PMBB 1O3JA 4RKJB 2BD2A 1GWAA 1NU9A 1QL8A 2V6NA 1O34A 3E8LA 2XRCA 1Z8JB 3RU4D 1SGPE 1O2SA 5K7RA 4AGKA 1AB9C 3U69H 1O3DA 4ZKSU 3GY5A 1FY4A 2QF3A 1XVOA 3ZZBA 1C1VH 1L1NA 2CHAB 1KSNA 3D49H 2A7JA 1UJ1A 2Z7FE 4WMEA 1C1WH 4K60A 1AUTC 1UCYE 1E1RD 3P92A 1TOCB 3BTHE 3BTWE 3P95A 1ZTLA 1AUJA 3URCA 1GDUA 2ESTE 1G9IE 4OS2A 2FOBA 5DP7A 3HGNA 4ZUHA 3WWBA 2DUCA 3QTOH 2GVFA 3UPEA 1KMHB 4X8SH 3M5OA 1O3AA 4NIVA 1THPB 2W26A 3BG4C 5F03A 3VB5A 2Y5GA 1WOFA 2ZGBH 5ESBA 1DVAH 5FCKA 1TNKA 3RMNH 3GY4A 1T4UH 1GJ9B 2P3FH 1S6HA 1AB9B 1H4WA 3PB1E 4NFEA 1ELFA 1Y5BT 5T6FA 1KDQA 7GCHF 1TABE 1FAXA 2O8UA 3UQVA 1GBFA 1ESTA 1F5LA 4Y0ZE 5DP6A 5ABWA 2HNTF 3W95A 3F2GA 4KTUA 1IQMA 1K1IA 4CHAC 1UW7A 1A7SA 1V2TT 1EP6A 2A4GA 2BD3A 5JYIA 1RTKA 2QN5T 1ZPCA 1AO5A 1P2JA 2A2XH 2C8WB 3ATLA 1SFIA 2AMPA 2BHGA 3BG4B 2HPQH 1GBBA 1F0RA 1XUKA 4RN6A 3TVJB 1QRWA 2YNAA 4ESTE 1ZLRA 1TNIA 3AW1A 2GGVB 2H5CA 1C9PA 1QIXB 1SLWB 4R8TB 3K6ZA 1F5RA 2V3MA 4F49A 5FPYA 4K8YA 1P2KA 3GCTF 5C0UA 4BAMB 1TOMH 2BVXH 2GCHF 2J2UA 4D76A 2VWNA 1TPSA 5C5OA 1XMNB 5EPNA 1UTJA 4CHAB 3KQ5A 2BQ6B 4CRCA 1O3MA 2FYRA 3QO6A 4AN7A 3MQKC 1WQSA 1SKYE 1VCWA 1DICA 1ZGVA 1GI3A 3EA9A 2J98B 5AFZH 2PSYA 4LXBH 1LQDB 2R2MB 2FIRH 2FOEA 1QRXA 2WZQA 2PKSC 1AFQC 3BEUA 4HI3A 2XBWA 5C17A 1VR1H 4XBDA 3NZIA 1O5CB 2XBVA 3PYHA 4OGXA 1MBQA 3PRBA 4I8KA 1KXCA 4ABAA 1S83A 3PMJA 1ZOMA 3TGIE 2FYQA 1EASA 3FFGA 3NK8A 2FOGA 2QXIA 3EAJA 2O8MA 3MOCA 4XSKU 3O8BA 3SU5A 3ZV9A 1EAIA 2GX4A 2R3YA 1C5SA 2JIZD 3BG8A 1P0SH 5J4SA 1SLUB 1LKBA 1V2RT 3UFAA 2ZTZA 4WWYA 1FY8E 2ZGHA 2O8WA 1GDNA 1HXFH 2ZCLP 8GCHG 1GI7B 3KQCA 5LPEA 2OP9A 1LKAA 3OE7D 4OM9A 1PYTD 4AGJA 2CF8H 2A31A 1P2MA 2C8YB 2CF9H 2Y7ZA 2YMSC 4B2CA 5E8EH 2PKSB 3A87A 2KM0A 4ABEA 1X7AC 4D9RA 1GI4A 1LHGH 5FX5A 1YLDA 5EQQA 1LMWB 4ABGA 1ZJDA 1GHZA 4K2YA 2L6OA 1TFXA 3RXBA 4FXGH 1IQGA 2BOKA 1J16A 5DJ7A 4CR9A 1LVYA 1YGCH 2G5VA 3GDSA 2EC9H 2ANKH 1O5GH 4JK6A 3RLWH 4AB8A 1D6RA 3OY6U 2UUYA 1TNHA 3GDVA 2A45B 3GISB 2ZU1A 2VWLA 1ZPBA 6GCHG 4D9QA 1J17T 1TGCA 2YMSB 3BN9A 4BOHA 3K6YA 3F9EA 2BM2A 1KDQB 3IWMA 2OCVB 2AIQA 1QHRB 1JRTA 4ZROA 1PQ7A 3EYDA 1ANDA 4B76A 2FOCA 1MABB 3A7VA 3SW2B 3DHKH 1JXPA 3T5FH 5C1UA 1SHYA 1OWHA 4K1EA 4ZCNA 1HAPH 1GMCG 4E06H 3TJOA 1YPGH 1OP2A 4Y7BA 1JMOH 1DS2E 4TWWA 3C27B 2TPIZ 3PM3A 2LP6A 3SU4A 1HJAC 2R3UA 3UOUA 1SR5C 4R0IA 2UWOA 1EZUC 2EQNA 2XNIA 4YZUA 1AMHA 2FODA 3I77A 2BQWB 2GCTC 1C5NH 4IGDA 1ABIH 2G52A 2RCEA 1TYNA 2CGAA 1TGBA 1C2IA 2PP6A 2XXLA 1L1GA 3MH4A 4DURA 1BTPA 3P17H 8GCHF 1J8AA 2UUJB 1GCDA 1TA6A 4Y76A 1A5GH 1GDQA 1HYLA 3HATH 1K1PA 3VEQB 2SGFE 2ZGXH 1F0TA 1O2UA 5DK1A 1MD7A 4J1YA 1HJAB 2STAE 2GMTC 1PPFE 2F9OA 5PTPA 1NFYA 2QE7D 3D23A 1Y5AT 3ATMA 1C5YB 2VGCC 5HGGA 4FUFA 5JDUB 2ZHDA 3GCNA 1WYKA 3TNTA 1SOTA 2Q6GA 2VWMA 1SGTA 4ABJA 2PUXB 4J2YB 2AYWA 2CJIA 4ZKOU 3NUMA 1GL1A 1GJ6A 1ESBA 1F7ZA 4Y10E 1YP9A 3ZYDA 4CRDA 3S69A 3M7TA 1IQJA 3S0NA 1TX7A 1HXEH 2UUKB 2ZDNA 4CRAA 5A0BA 1DWDH 5HKKD 3PRDA 1ELBA 1PPCE 1BTUA 4NWKA 2ZU5A 2QXHA 3MHWU 2ZNKH 1EB1H 4X2WA 3RXUA 2OC7A 2QXJA 3H5CB 1AZ8A 1CT0E 5EOKA 3KQEA 2PKAA 2W5EA 1QJ6B 3Q3XA 4IW4E 2GMTB 1PPBH 2H9EH 2BD5A 3SNEA 2M2AA 2AFQB 1GHBG 3A7ZA 3D62A 2V35A 5B6OA 1C1RA 1TBQH 2VGCB 2ZWLH 3E6PH 1Y5UT 1RXPA 4B2BA 1ZTJA 1GBDA 1D6WA 1SC8U 2FOMB 5HM9A 1GMCF 1B0FA 1QA0A 1Z1JA 1C5RA 3MNBA 1O32A 1O3NA 1OYTH 2ZDKA 2QY0B 2WPMS 2ZF0H 1D3DB 2XC5A 1AGJA 2FXRA 1GHYH 4IBLH 2QYIA 4AFZA 1MKWK 1O2KA 4A6LA 1GI8B 1O3EA 9ESTA 1DXPA 1BTHH 3ZZ5A 3SJOA 3QN7A 1W11U 3NXPA 4JYTA 2YMSD 1MBMA 4MPXA 3LJOA 4MTBA 1RTFB 1QQ4A 3MU5A 3LU9B 1O36A 2SGQE 3F6UH 4X8UH 3MWIU 1FZZA 5IDKA 2J95A 4O97A 1BMAA 1QY6A 1OOKB 4FUJA 3RXHA 3SV8A 4NWLA 4RKOB 2Z9JA 1C2KA 1AHTH 3OEHD 4TSFD 3RUOA 1BTXA 2BDGA 1CQQA 2BVRH 1COWD 4ZKRU 2FEQH 1UO6A 4DG4A 3QK1A 3RXSA 2DE8A 3V0XA 3A89A 2WPJS 4FVBA 4Q2KA 3ELAH 1NFXA 2ZDLA 4BANB 3FZZA 3N7EA 2WSSD 2VWOA 1DFPA 5BRRE 1F0UA 3SJ9A 1HAXB 1FY5A 2P93A 2QV1A 2PTNA 3PLPA 1K0HA 3LGIA 3MFJA 1H8HD 1MTSA 5DSFA 4YOJA 1IQKA 2UWLA 2ZEBA 4JK5A 4P02A 2FTLE 1NRPH 3SGAE 1KIGH 2A4RA 4ISIH 1YPJH 4KKDA 5CE1A 3GY2A 1TRMA 2BX3A 2AS9A 1UCYK 2B5TB 1GHBF 1GBCA 3BEIB 4DW2U 3ATWA 2BY7X 2KCAA 5A0AE 3AAUA 4ABFA 3M3TA 1TWXB 1UTOA 3BIVH 5FAHA 1S82A 1HAIH 2C90B 1OWJA 1NS3A 4BTUB 1P2OA 2VIPA 3TNSA 4OS4A 4I8GA 2TGPZ 2HVXA 4INHA 3RXKA 3O8RA 1UVOA 4OS1A 2D26C 2OXSA 1GJ7B 1INCA 1NRSH 2RG3A 2UWPA 3A7YA 4FUHA 2OK5A 2BVSH 1ZPZA 1MH0A 4MG3A 2PKAB 1BDAA 2AMQA 1WAYB 2ZO3H 2PHBA 2M5TA 3RMOH 1FJSA 1NBME 4GCHG 3SQHE 1D3PB 1MTUA 1QR3E 3UOPA 4BAHB 2FS8A 1TRYA 1C5PA 2SFAA 5C67A 3TGKE 1TLDA 2GJGA 2OC0A 1S6FA 1P03A 2PUQH 2KFWA 3G01A 1MTWA 1CGJE 1VZQH 1JOUB 1O3OA 3ZZAA 1BQYA 4GAWA 3FP8E 4AYYB 4K3JA 4A1XA 2AIPA 4DCDA 1W10U 1V2JT 1VGCB 2QIQA 1GMHG 2W7UA 1GI2A 4B75A 1O2OA 1ZHRA 3KNXA 3STIA 3TITA 1RIWC 2OBOA 3HK3B 4OS6A 4ZHMU 2PTCE 1OHHD 1TB6H 1KY9A 5GCHG 1C5ZB 1QRZA 1ELGA 1CSOE 1O5FH 1YWUA 2BD9A 3FANA 1QTFA 3LONA 4JCNA 3M3SA 3H7TA 5E0HA 1YBWA 1HAOH 2ANYA 3QZRA 5FL7D 1C2JA 1QBNA 2KAIA 1B0EA 4ZHAA 2QA9E 1FPCH 2GDEH 2VH0A 1XM1A 1ZGIA 1P2QA 5DO4H 3LKWA 2PR3A 1NBMD 1K21H 1S6LA 3L3TA 3RM0H 2CXVA 1UMAH 3KL6A 1QJ7B 1LVBA 2EI7A 1EX3A 1O3LA 1VJ9U 1DOJA 3FKSD 1SPJA 2FX6A 5GXPA 3LC3A 5FHTA 1RIWB 1G32B 4ISNA 1C5TA 2H5DA 2C93B 1N8OC 1T4VH 1CBWC 1DSTA 3OAAD 1GPZA 4H6TA 1ARBA 2FESH 2FDAA 3RXIA 1BRUP 3ZZ7A 1F2SE 1WSSH 2BLVA 3SN8A 4LOYH 1K28D 4F4OC 2QF4A 1ELVA 3RXAA 3SU3A 3RC4A 3ZIAD 2Z3EA 3SV9A 1SFQB 3RXMA 2OLGA 1DWBH 2P95A 1O2MA 1H8IH 1RJXB 3KGPA 1GBTA 3RM2H 2BLOA 2IOTA 3PWBA 4GCHF 4AG2A 3GY6A 1C2MA 3MO9A 2FPZA 4X0WU 3A8AA 3LGYA 3NCLA 1W8BH 4TWYA 2SNWA 3P8OA 1K1NA 1YLCA 3TJNA 1MCTA 3DUXH 1O2YA 4MPUA 1O5DH 1V2KT 1XKBC 5KGOA 2Y82A 3ZVGA 1VCPA 3Q76A 1XX9A 1L4DA 1SGNE 3E90B 2ZI2H 3MU8A 3OTJE 2BDCA 3TPIZ 4A5TS 2BDHA 5DP5A 2Z9IA 3HPTB 1A3BH 3T29A 4RT0A 3TIUA 1SQTA 6LPRA 2BZAA 2FTMA 1ANBA 5GCHF 2GZ9A 4INKA 4JZIA 4NIXA 1HGTH 2ALVA 2ANMH 3KHVA 3HKIB 1MTNC 1ELTA 1S0QA 3KYGA 3SGQE 5JPMH 1HFDA 2BY5X 1GHAG 2O9QA 3SUGA 2EI8A 5L2ZH 3L33A 2JKHA 7KMEH 3P8NA 1SGYE 2P16A 4NGAH 3WY8A 1MD8A 1J14A 1BBRH 3O8CA 1LPZB 3ZVBA 4D7GA 1G37A 1AVGH 1FXYA 1JIRA 1ACBE 3D65E 2FI3E 3QX5H 1O3GA 3PWCA 4FU9A 3SU2A 1T31A 1AI8H 1OWDA 5IK2D 3ESTA 3MH6A 1H9HE 3EGKH 2P3UB 2RA0A 2TGAA 4JYUH 2Q6DA 1SGEE 2XWAA 1C1TA 1H9IE 5HIYA 1A2CH 4KGAA 2IPQX 1GVKB 1TGTA 3LH1A 2YNBA 1CA8B 1MTNB 2LELA 1SI5H 3SORA 2B8OH 2WYGA 3VG8A 2JH5D 1K9OE 5KEDA 1MU8B 4X6MA 4XBBA 1ABJH 1P11E 4XBCA 1ESAA 5GNDA 2NU3E 3IG6B 1NTPA 2A2QH 3SJ8A 1C5MD 1UVPA 1T8LA 2HALA 3GY8A 2A5IA 3MH5A 5J4QA 2FS9A 3M37A 3OSYA 3GCOA 2XOKD 4NA7A 1ORFA 4X2VA 3FN8A 1DY9A 1GI1A 1V2MT 3N7OA 3SNBA 5SGAE 3F9GA 1CA0C 2UUFB 1G3BA 2K0QA 1BBRE 2ZCHP 2H1UA 5A2MH 5HXFA 3BTDE 1PQAA 4X1QU 3SUFA 1HAZB 4BAKB 2PLXA 1TAWA 3V12A 1OXGA 1AN1E 1UTLM 4FUEA 1P01A 1Z71A 4Q4LA 4WXIA 5GIBA 3R3GB 1P10A 2R0KA 1ELCA 3SHAH 4NG9H 4X6OA 3RXTA 5DP9A 1C4V2 2J97A 4LK4A 5DP8A 3ZZCA 5F8TA 4FU8A 1PJPA 4FETA 1YPEH 5EPYA 1CGIE 1GHAF 2BXTH 1SQAA 1MQ6A 3DSGA 3I29A 1FY1A 1ZHMA 3JZ2B 1GI9B 1AY6H 1CA0B 1SGFG 3V13A 2PFEA 4F48B 2V0BA 1FN8A 1GJBB 4BXSA 1ZHPA 1D9IA 1F92A 1NRNH 1EAWA 1NZQH 1W14U 1MAYA 4JZ1A 1T8NA 1H8ED 7LPRA 3TJVA 1UTKA 4FVDA 4Y11E 2AGIX 1AFQB 1IOEA 3U1IB 2H9HA 4IC6A 4AFSA 1O37A 4WH8A 3MO3A 4Q63A 4TPIZ 3QGJA 1L2EA 2GDDA 1O30A 5F6MA 2ZTXA 4GUXA 1AD8H 1L1JA 3A81A 1D3QB 2GTBA 4DT7B 2Z94A 2HVYB 1HB0B 3LGUA 2IJOB 2G55A 3GYLB 2ZDAH 1BOQA 1G3DA 1V2VT 2JH6D 4Z0KA 3SZEA 2Z3CA 1ZRKA 1JIMA 2CN0H 1BTZA 5C20A 4TPYA 3AVZA 5C0TA 3F2FA 4Y7AA 2J34A 3V7TA 1P09A 1RS0A 1W7XH 4B74A 3UREA 4GVUA 2J94A 3MO6A 4M9FA 1FDPA 5F8ZA 4ISHH 4O3TA 1ARCA 1GBHA 4FUIA 1H1BA 2XYAA 4X6NA 2ZU3A 1FAKH 4IMZA 1UTPA 6ESTA 1GGDC 4MPVA 2SGPE 1MTVA 2XCFA 3Q3YA 3MH7A 1SGFA 1P04A 2Z9KA 2VB0A 1DX5M 1PPEE 2XWBI 4THNH 5EIYA 4ZKNU 2RDLA 4O3UA 1YYY1 1B7XB 2BDAA 2W7SA 2J38A 2D1JA 1BRBE 3SBKA 2RFKC 1KXDA 1LTOA 2Z9GA 1NESE 4XRNA 3LGWA 1NPMA 3SOSA 1GI0A 1YPMH 1CU1A 1C2EA 2FI5E 4I31A 2O8TA 5EGMA 1V2QT 4AB9A 2FMJA 1O2VA 4MNWA 1C2DA 5E0GA 4LZ1H 3UNSA 4NA8A 1XXFA 1TX8A 3ZZ8A 1UTQA 2G4UA 4X6PA 4E7NA 3I78A 2J5UA 1RRKA 2KCYA 2Y6TA 4HTCH 2VIVA 3W94A 1K22H 2QGRA 1P05A 5EU8A 2FLBH 1O2LA 1YCPK 1NROH 1SGCA 3LH3A 2OD3B 4HFPB 3Q00A 2K1QA 5LPFA 4GSOA 2Q1JA 3OX7U 4I33A 3ZZ4A 5E2PA 1P3EA 1C5WB 3FP7E 1VCQA 1UHBA 4FUGA 4UFFH 5IYTA 3GY7A 2BD8A 2V3HH 1P2IA 3HGPA 1XUIA 1FY3A 1Z8RA 2F9PA 1EJNA 2GCTB 4UE7H 1LHCH 3SV7A 2NU0E 1TGNA 1E0FD 3F0OA 4YOIA 2A7CA 3SI4H 1V6DA 2VINA 4B2AA 1SSXA 5TCAA 2F3CE 1ZJKA 3ZVFA 6GCHF 1XUGA 1BT7A 3BEFB 4U01A 4KTSA 1LPGB 1SGDE 3Q3KA 5AHGH 1Z1IA 1GBKA 2WPKS 3LGTA 5K0HA 1O2GH 3P8GA 2KZ4A 2QXGA 4HGCA 3GOVB 5G4BA 2TBSA 3TK6A 2I6QA 2BOHB 1C5QA 2FI4E 1SGQE 5C94A 2A4QA 5TJXA 4Z1MD 3ATIA 1EUFA 3GDUA 3H09A 5I25A 1GCTC 5JBCS 1ETSH 1W0KD 2NWNA 2ZKSA 1L4ZA 1GI6A 3F1SB 2Y80A 3MNXA 2CMYA 5CHAC 2FP7B 3QDZB 3UIRA 5ESTE 2J92A 1YCPM 1S5SA 3ZVAA 1G3EA 4YESB 1P02A 4CBOA 1MU6B 2Y5HA 4AC9A 5JB8S 3MNCA 5JBAS 2HLCA 3B8JA 1DLKB 3F3BA 1AZZA 1C5XB 1UK2A 4E05H 3P6ZB 5T3HA 1AVXA 2JETC 3OY5U 5JBBS 3WW7A 3U8TH 1CO7E 1GBJA 5A8XA 1LHEH 2L74A 2FM2A 1YPHC 2XC0A 1AE5A 1WV7H 4BTIB 1OX1A 1NFUA 2OC1A 1THRH 4MLFB 2G81E 4ZXXH 2ULLA 2B9LA 3E91A 3PMHB 2FOAA 5DPAA 1GCTB 1WCZA 3E3TA 3FP6E 3RC6A 4AYVB 3ZVCA 1JRSA 2ZG0H 4NA9H 4TY6A 4YT6H 1NY22 2BY8X 3RXFA 1W7GH 4MNYA 1GBIA 3U9AH 1UTNA 1Q3XA 4Q7XA 1XUHA 3A83A 3QWCH 5F53A 1LCYA 5EQSA 3VGCC 1OWIA 4B6EA 3U1JB 4TY7A 1EPTA 2ODYB 1BMMH 1GL0E 3NWUA 1BRAA 2ZHEH 2JETB 1K1LA 1O2PA 3SU6A 2V7QD 4H6SB 5A8ZA 4KTCA 1IQFA 1BB0B 1W0YH 2BD7A 1HAYB 3F0PA 3TGJE 4MNVA 2ZGJA 1ZSKA 3RXVA 3BTEE 3U8RH 3M5NA 1SGIB 1RTLA 3ITIA 1QL7A 1FLEE 3OTPA 2EEKA 1MAXA 1EJMA 1Z8GA 2Z9LA 4CREA 5B6LA 3S9CA 1TX6A 4DIIH 3HKJB 2QF5A 1OP0A 1C2FA 2BMGB 2Y5FA 4CR5A 3HK6B 4XFQA 1E37B 2WPLS 3UR9A
chains in the Genus database with same CATH topology
1FV9A 2GT8A 4AZ2B 1V3XA 1UHBB 3PV4A 3T2NA 1HJ9A 3EA8A 2IPHA 4X1SU 1KXEA 1G30B 1WQVH 2ZQ2A 4FUBA 2BDBA 1A0HB 1AIXH 1MCVA 4AOQA 4UD9H 3CP7A 3A85A 3EA7A 4Z6AH 1CT4E 2F9BH 2Z3DA 3SU0A 2XC4A 2QCYA 2R9PA 3RC5A 3AAVA 3NKKA 1BZXE 4YM9A 1HLTH 2STBE 3EQ0H 1GJCB 1TIOA 2ODPA 4SGAE 3SJKA 3VXFH 4IC5A 2XCNA 1QNJA 3LOXA 5GJ4B 3RLYH 1AU8A 4K1SA 3K65B 1C1NA 3MTYA 1SGRE 1DLEA 2AERH 2ZGCA 1NFWA 3R0FA 1C1OA 1RGQA 2ZFPH 1PPHE 1DUAA 3T27A 5GWZA 3K2UA 3PO1C 3K9XB 1HAGE 2VIDA 1QGFA 2OC8A 1ZMNA 1SLXB 2WYJA 1DY8A 1ANEA 1OYQA 1MKWH 1YPHE 4ABIA 1DANH 5FBIA 1HRTH 2HPPH 1TGSZ 3FAOA 4NIWA 1DUEA 1EPTC 3H7OA 3TLOA 2VVVA 3EDXB 1SQOA 2WPHS 1DE7H 1EQ9A 1P57B 5FPSA 5EODA 3LPRA 3ENSB 1DXWA 2LNCA 1A0LA 1O5EH 1TA2A 1OS8A 4X8TH 1NO9H 1BJUA 2WINI 2AMDA 5DGJA 1ZZZA 3A86A 1AKSA 3PO1B 1A3EH 4GLYA 2BZ6H 4MQAA 4Y6DA 2Y81A 3PTNA 1GBMA 1D4PB 3ZZ6A 1UVUH 5HYOA 4Q7ZA 4E7RG 1HPGA 4XDEA 4IS5A 4MDSA 1EPTB 1T8OA 1O2XA 2ZA5A 1YPKH 4KELA 5HM2A 1ELDE 2WV5A 4DGJA 6CHAC 1OWKA 3UWJH 2G4TA 2WV4A 1GHWH 1HAVA 1V2WT 4YTAA 3MYWA 1EJAA 2PV9B 4KP0A 3RU4E 4NSYA 2ZP0H 3T25A 4H42U 7GCHG 1GMDG 1OP8A 1TONA 1IQEA 3P70B 1O3CA 5EW1H 1O3IA 1TE0A 4ISOA 1FPHH 4ZAEA 2AEIH 1SVPA 2ZC9H 1O31A 2VU8E 4OS5A 1FN6A 1TMTH 1CGHA 4XOJA 1E35B 4UEHH 1LHFH 4LZ4B 1V2PT 3SUEA 3VB7A 1A4WH 2A0QB 2VVUA 1V2LT 1N8OB 2J9NA 3UUZA 4X1PU 1CBWB 1EAUA 3M3VA 1AWFH 4UFGH 3U98H 2OQ5A 1HJ8A 2BYAX 5C3NA 1HBTH 1CT2E 1TMUH 4I8JA 1O2HA 1O38A 1O2NA 1GMHF 4WY3A 3BIUH 3PROA 1UTMA 2ASUB 2ZFQH 1CHOG 1TPPA 2G5NA 2ZFSA 1GJ4H 2VIQA 1G3CA 2BLWA 5CMXH 1P3CA 1QFKH 1V2NT 2A1DB 1MKXH 1A46H 1DITH 3P8FA 1YF4A 4ASHA 1JBUH 1KXBA 2G51A 1GJ5H 2FO9A 2A32A 4B71A 3VXEH 1ZYOA 3O8DA 1D3TB 1KXAA 1WTHD 1M9UA 3VPKA 5LPRA 2ZCKP 1TMBH 1O2ZA 1PQ5A 1T8MA 1TRNA 1EZSC 4WH6A 4WVPE 3S9AA 2ZQ1A 3RXGA 3RXOA 3VFEA 2OUAA 2H9TH 4X2YA 3CS0A 1A0JA 5DP4A 1GI5A 1O2TA 2P94A 1C1MA 1H9LB 3TK5A 3RXCA 1AVWA 4JYVH 5EXMA 1IHSH 2ZPQA 1DM4B 4I32A 4K8BA 1Y59T 1GMDF 1XXDA 3QLPH 4CRFA 1HUTH 2XBXA 1SG8B 3DFJA 3EE0B 5ETXA 1PPGE 3ZZ3A 1TNJA 1HIAA 4FUCA 3UR6A 2KAIB 1AKSB 1OSSA 2O8LA 3SUDA 1CVWH 1T32A 2ZZUH 1Y3YA 2ALPA 5GPIB 4A92A 2PW8H 1IQIA 3CS7A 1E34B 1O3FA 1NM6A 4ABHA 2HWLB 1O33A 2VVCA 4UFDH 1WUNH 1XKAC 1SL3A 1IQHA 1YKTA 4HZHA 1HDTH 1Y3UA 3BTKE 2CV3A 3SNAA 1EKBB 1DWEH 1HAVB 4JMYA 5C2ZA 1CHOF 1HAHH 1A61H 4IMQA 2FWWA 3FZDA 1SLVB 1FI8A 3PTBA 5L2YH 1O2IA 3ZV8A 1LO6A 3BV9B 1MZAA 2OINA 1PPZA 4I8HA 3LIWA 5GDSH 2SNVA 3BSQA 2QAAA 4WF8A 1YC0A 1EAXA 3PMAB 1ETRH 3C1KA 1KXFA 4A7IB 1XUJA 1FIZA 1P12E 1Q31A 4B1TA 1ID5H 4ZHLU 4ABDA 2B0FA 1DDJA 3CENA 4OGYA 3F9FA 1S84A 1ANCA 2OTVA 1TQ7B 2BTCE 1H8DH 2BY6X 1S0RA 2HNTC 4WMFA 3E0PB 2P8OC 1GVLA 1VITG 4NFFA 1EATA 3TU7H 3S9BA 1UK4A 1G36A 4M7GA 1Y8TA 1PFXC 2LPRA 2VIOA 1QB9A 2BY9X 4WJG2 4O03A 1C5UA 1K2I1 1GHVH 1E38B 1LHDH 3M36A 3ZVDA 2EA3A 3A88A 2ODQA 3VB4A 1FMGA 4WXVA 4MNXA 1O2QA 4CH8B 2GV7A 1GG6C 3MU4A 4IN1A 3SNDA 1G2LA 1G2MA 4K1TA 1IHTH 1QBOA 1NN6A 1BTWA 3LT3A 3SNCA 2PGBB 1V2UT 8KME2 1AWHB 1F5KU 1MUEB 2C4FH 2P8OB 2Q6FA 2FLRH 3SQEE 4UDWH 3KEEA 3UNRA 3ATKA 2HGTH 4YLQH 3RXDA 5F8XA 3M7QA 3GICB 1Y3WA 1KYNA 4AORA 2C8XB 1WTGH 1GBAA 3A80A 5T6DA 5A0CA 1C1PA 1NRQH 2F9NA 1EOLA 3IITA 2VH6A 2H6MA 4U2WA 5JB9S 2HOBA 1TBZH 4YLUA 3DT0H 1GG6B 5BPEA 2BB4A 2DE9A 5EXLA 5AFYH 2YOLA 4BTTB 1KLIH 4DOQA 1W2KH 2QF0A 3RU4T 1GVZA 1O2JA 1W0ZU 1EP5A 1VJAU 4DY7B 1O5BB 1HIAB 1WBGB 3A8CA 3NPSA 8ESTE 5AVDA 1ETTH 1SMFE 4VGCC 1F0SA 1O39A 1BJVA 1SBWA 1GGDB 2D8WA 3GYMA 3LJJA 3DA9B 1O3HA 1O3BA 4IN2A 1Z6EA 3GCHC 4AG1A 3KF2A 3M7UA 2TGTA 4BXWA 1E36B 3ZYEA 1C4Y2 4A1TA 4CH2B 5I46H 2BX4A 1Y3XA 3BTFE 2SGEE 1VITF 4TYDA 4U32A 3PLKA 1EOJA 1GJAB 4O9VA 3UTUH 2C8ZB 1Z6JH 4X1RU 3M61U 2BDYA 4Q7YA 1O2WA 1BRCE 4VGCB 1SHHB 3LDXH 3QZQA 4K69A 3DFLA 2SGAA 3T28A 4NCYA 4NZQA 2R2WU 3SHCH 3UY9A 2QC2A 2AH4X 2HNTE 3GCHB 3RXPA 5DKMA 3SJIA 2ZPSA 1C5VA 5E2OA 1BCUH 1FQ3A 1MZDA 1TBRH 2ZHWH 1QJ1B 3UQOA 2TRMA 4DJZB 3LC5A 1WU1A 3SO3A 3MMGA 1C1UH 1BTYA 3M5MA 1ZR0A 1NT1A 2NU1E 4JZDH 1BITA 4GHTA 2EI6A 2BD4A 2GZ8A 2XBYA 3ZZDA 1N6YA 2ZU2A 1N1LA 1GJ8B 1JWTA 1UVSH 2ZTYA 1NC6A 3FVFB 4AFUA 1SB1H 4X8VH 1B5GH 3QTVH 3LGVA 5FPTA 2OBQA 4NSVA 4QT8C 5EW2H 4MVNA 2P3TB 4H4FA 3A8BA 4CRBA 3KN2A 1KLJH 2F83A 3OYPA 3B9FH 1QB6A 2TGDA 3BTGE 1AE8H 1Q2WA 3MNSA 4ZH8A 4YOGA 1J15A 1TALA 1Z7KA 4JZFH 1BUIA 5C5NA 2C3SA 2G00A 3F68H 1OWEA 2GT7A 3TJUA 1QA7A 4ISLA 1C2GA 2JH0D 3MU1A 1ZSJA 5AF9H 2V3OH 4INLA 2GKVE 5CHAB 3KCGH 1QCPA 1L0ZA 2GZ7A 4GPGA 4WMDA 5FX6A 1ZRBA 1NRRH 4SGBE 1KTTB 1AFEH 3AW0A 2NU2E 1ZMJA 1GHXH 3UWIA 2ZU4A 1RFNA 1FIWA 3SZNA 2ZFRH 1DSUA 5LH8A 4OS7A 1O35A 2FOHA 3RMMH 2B7DH 3RXRA 1J9CH 4FUDA 2P59A 4K5ZA 5L6NH 1C2LA 4PROA 1BHXF 1LQEA 2IN2A 1GJDB 3RXLA 2GD4B 3A7WA 2ILNA 1EZQA 3QGNB 1NU7B 3JZ1B 2ZIQH 3RXQA 1P9UA 5LGOA 4BAQB 1YCPH 2BDIA 1O5AB 4ZXYH 4CBNA 2ZDVH 2BLQA 2THFB 1VITH 2D2DA 2J4IA 3RXEA 3BTTE 2VJ1A 2W3IA 1BMLA 5A8YA 4NZLA 3TH3H 4UFEH 3UNQA 3VGCB 5H4IB 1QL9A 1A5IA 3GY3A 1CHGA 1W13U 1QQUA 1W12U 3KQBA 1DWCH 2Y7XA 2ZFTA 3BF6H 3PLBA 1TQ0B 1PQ8A 5DG6A 4B73A 3TH4H 1S85A 4Y79A 2GV6A 4ZMAH 3A7TA 1DPOA 1ZMLA 1QB1A 2A7HA 5EXNA 4DIHH 1LDTT 3VB6A 3V3MA 1XVMA 2I6SA 5TCCA 3SV2H 4Y71A 3RDZA 1C5OH 3S7HB 1V2ST 2NU4E 2ANWA 1A1RA 1LVOA 3KIDU 1GBEA 2RA3A 3DD2H 1TNGA 3A8DA 2WUBA 3L6PA 4Y0YE 2ZFFH 4RSPA 5EQRA 4A1VA 3SV6A 2A4OA 1Y3VA 2H2ZA 1GBLA 3F9HA 3T62A 9LPRA 1LVMA 4FU7A 1P06A 2PSXA 1AQ7A 3A82A 1O3KA 2Z6BD 1VGCC 4X1NU 1IAUA 2BXUH 3KQDA 5T6GA 5DP3A 3ZVEA 2WPIS 3SGBE 1QBVH 3VB3A 3OU0A 1MKXK 2HRVA 1C1SA 5L30H 3ODDA 2VIWA 3BTME 5FCRA 3ODFA 2ZHFH 2F9VA 1ZSLA 1A5HA 1C1QA 3ZZ9A 1EXFA 3B23B 1O2RA 1ELEE 1BBRK 3U8OH 1CE5A 2TIOA 1TNLA 1HCGA 2ZECA 1QURH 1V2OT 1BMNH 1FUJA 1P2NA 1HNEE 1Z8IB 3Q77A 1EZXC 5A09A 1BHXB 1C2HA 8LPRA 2SGDE 2R0LA 1UVTH 4MPWA 1DT2A 1W3CA 5HMAA 4U30A 1THSH 3E1XB 4XE4A 4I8LA 4Q80A 3M35A 3S7KB 4BAOB 3T26A 2W3KA 3M5LA 1FONA 4NIYA 1KLTA 1P9SA 3RMLH 2FOFA 3A7XA 1U6QA 1T7CA 4AX9H 3SU1A 1O3PB 4UONA 4Y8YA 1HV7A 4BNRA 1BA8B 3TK9A 3A84A 1O0DH 5EG4A 1TPOA 2FX4A 4D7FA 3SI3H 1MQ5A 1YPLH 1IQLA 5FXLA 3RXJA 5FBEA 5C1XA 5JBTA 1P8VC 2XTTB 1C9TA 3TH2H 2A5KA 3E16B 2XW9A 2FZZA 2BQ7B 4YO9A 1UK3A 2ZHQH 3AASA 3RP2A 2AGGX 2WUCA 2F9UA 2ZDMA 1SOZA 4AFQA 1ELAA 1UCYH 2PGQB 4DVAU 3MU0A 1K1OA 2OQUA 2A5AA 3MI4A 1PYTC 1KTSB 1K1MA 1ZTKA 5E0JA 3E0NB 4X2XA 7ESTE 4I7YH 1N6XA 1C4U2 1YM0A 4CRGA 3BTQE 4YT7H 2AGEX 2ZPRA 1XUFA 4D8NA 6CHAB 4Y8ZA 1OKXA 2GP9B 1C5LH 1K1JA 1RD3B 2CHAC 5C1YA 3URDA 2G8TA 4JZEH 2PWXA 2VNTA 1OPHB 1BIOA 2F91A 1TPAE 1S81A 4ABBA 1FNIA 3GCTG 4Y8XA 1LPKB 1EB2A 2GCHG 3QUMP 3STJA 1IQNA 4GHQA 1MMJN 3PMBB 1O3JA 4RKJB 2BD2A 1GWAA 1NU9A 1QL8A 2V6NA 1O34A 3E8LA 2XRCA 1Z8JB 3RU4D 1SGPE 1O2SA 5K7RA 4AGKA 1AB9C 3U69H 1O3DA 4ZKSU 3GY5A 1FY4A 2QF3A 1XVOA 3ZZBA 1C1VH 1L1NA 2CHAB 1KSNA 3D49H 2A7JA 1UJ1A 2Z7FE 4WMEA 1C1WH 4K60A 1AUTC 1UCYE 3P92A 1TOCB 3BTHE 3BTWE 3P95A 1ZTLA 1AUJA 3URCA 1GDUA 2ESTE 1G9IE 4OS2A 2FOBA 5DP7A 3HGNA 4ZUHA 2DUCA 3QTOH 2GVFA 3UPEA 4X8SH 3M5OA 1O3AA 4NIVA 1THPB 2W26A 3BG4C 5F03A 3VB5A 2Y5GA 1WOFA 2ZGBH 5ESBA 1DVAH 5FCKA 1TNKA 3RMNH 3GY4A 1T4UH 1GJ9B 2P3FH 1S6HA 1AB9B 1H4WA 3PB1E 4NFEA 1ELFA 1Y5BT 5T6FA 1KDQA 7GCHF 1TABE 1FAXA 2O8UA 3UQVA 1GBFA 1ESTA 1F5LA 4Y0ZE 5DP6A 5ABWA 2HNTF 3W95A 4KTUA 1IQMA 1K1IA 4CHAC 1A7SA 1V2TT 1EP6A 2A4GA 2BD3A 5JYIA 1RTKA 2QN5T 1ZPCA 1AO5A 1P2JA 2A2XH 2C8WB 3ATLA 1SFIA 2AMPA 2BHGA 3BG4B 2HPQH 1GBBA 1F0RA 1XUKA 4RN6A 3TVJB 1QRWA 2YNAA 4ESTE 1ZLRA 1TNIA 3AW1A 2GGVB 2H5CA 1C9PA 1QIXB 1SLWB 4R8TB 3K6ZA 1F5RA 4F49A 5FPYA 4K8YA 1P2KA 3GCTF 4BAMB 1TOMH 2BVXH 2GCHF 2J2UA 4D76A 2VWNA 1TPSA 5C5OA 1XMNB 5EPNA 1UTJA 4CHAB 2BQ6B 4CRCA 1O3MA 2FYRA 3QO6A 4AN7A 1WQSA 1VCWA 1DICA 1ZGVA 1GI3A 3EA9A 5AFZH 2PSYA 4LXBH 1LQDB 2R2MB 2FIRH 2FOEA 1QRXA 2PKSC 1AFQC 3BEUA 4HI3A 2XBWA 1VR1H 4XBDA 3NZIA 1O5CB 2XBVA 3PYHA 4OGXA 1MBQA 4I8KA 1KXCA 4ABAA 1S83A 3PMJA 1ZOMA 3TGIE 2FYQA 1EASA 3FFGA 3NK8A 2FOGA 2QXIA 3EAJA 2O8MA 3MOCA 4XSKU 3O8BA 3SU5A 3ZV9A 1EAIA 2GX4A 2R3YA 1C5SA 3BG8A 1P0SH 5J4SA 1SLUB 1LKBA 1V2RT 3UFAA 2ZTZA