3MTYA

Comparison of the character and the speed of x-ray-induced structural changes of porcine pancreatic elastase at two temperatures, 100 and 15k. the data set was collected from region a of the crystal. first step of radiation damage
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
b'VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mtyA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mtyA01
1P2MA 1Z8JB 4JZEH 1C4Y2 5BPEA 1LQEA 3PMJA 1NT1A 2ANKH 1K9OE 3E1XB 3ESTA 1O2ZA 1BHXF 3K65B 3TITA 1BOQA 3EAJA 1OSSA 3UTUH 1GMDF 5FPYA 4ZKSU 2BLOA 5H4IB 1O5BB 3ZYDA 3NCLA 2H1UA 2Z9IA 1QL9A 3NPSA 1AUJA 2QIQA 1ELDE 1GJ8B 1RTFB 3TH2H 3E90B 2CHAB 1HV7A 3GICB 3RU4D 2FOAA 3VXEH 6LPRA 3KNXA 3MU1A 4K8BA 1GHBG 4FU8A 2P95A 1ZPBA 1AVGH 1MKXH 2G51A 4AB8A 5HMAA 1LPGB 4CHAC 1FY1A 6CHAC 3GY5A 3VGCB 1H4WA 1ZSKA 3MHWU 4CRBA 1CGJE 3ODDA 3A7XA 4ZHAA 1IQGA 3U8RH 2AGIX 1O2IA 1GJDB 2QXJA 7LPRA 3URCA 4KTSA 2P8OC 4Q80A 1DM4B 1NRSH 1IQIA 4NZLA 2SGFE 2TGAA 2CF8H 1IQFA 1KXDA 2YNBA 1C5NH 1ZHMA 3AAUA 1TB6H 1AIXH 3PLKA 1C1VH 1XKAC 8LPRA 1ZGIA 1C9PA 2H9HA 1EPTC 1XM1A 2G8TA 1DWCH 5L6NH 3BSQA 2AS9A 1OXGA 1ZMNA 3H7OA 4A5TS 1L4DA 3OTJE 1XVMA 1DUEA 4CR9A 1ABIH 2GKVE 1EOLA 2PSXA 1ZMJA 5I46H 4Z6AH 2Y81A 2F9PA 2TRMA 4JK6A 5GPIB 4OS1A 2OLGA 3L3TA 3PWCA 3O8BA 1D3TB 2AYWA 4K5ZA 3SJIA 4Y8YA 1ZTJA 3GOVB 1N1LA 2SGAA 5E0GA 3RMNH 1J16A 4ZROA 1O3JA 5JBBS 1S0RA 2J34A 4KTUA 3EE0B 2XC4A 1XUKA 4Q7YA 5F8XA 1QJ1B 5DP3A 3RXDA 5DG6A 1DVAH 2BDHA 2BY7X 3M7UA 1K1LA 3RXHA 1Z8GA 1SBWA 1TPAE 5C1YA 2WYGA 3P6ZB 5DJ7A 1MMJN 1TIOA 3SJOA 4ZH8A 4SGAE 4AG1A 1BRAA 1ID5H 3MH4A 1XUJA 3A88A 4CRAA 4I31A 2WUBA 1MTWA 1AE5A 1RGQA 1HFDA 1O2VA 4CRDA 2HNTF 1D4PB 1HNEE 1C2JA 4Y8XA 4UFGH 1K28D 2Y5FA 5EGMA 1PPCE 1EZSC 1JXPA 1TWXB 2GV7A 4FU9A 1S5SA 2A5KA 3TJVA 1P2KA 5GXPA 1C1NA 1XX9A 3EA9A 3MU5A 1K2I1 5L2ZH 3A7TA 1QHRB 1UJ1A 3RC4A 1O5CB 2BD3A 2CGAA 3RU4T 3SU5A 1DSTA 4LXBH 4O3UA 1ELAA 3RU4E 3A81A 3AVZA 1ELVA 1DY8A 1TPPA 1O3CA 2ZCLP 1XVOA 1AB9B 2J9NA 2WPKS 2GMTC 2FESH 1W8BH 1ELTA 8KME2 2FI4E 1SOTA 5F6MA 1UK2A 3T29A 1Z6JH 1TA6A 1FY5A 2ZHDA 1FIZA 1Z71A 1NTPA 1VJ9U 2BQ7B 3TK6A 4ZKOU 4CREA 1GG6B 2EA3A 2HRVA 3A7WA 1Z6EA 2QAAA 1QB1A 1LVOA 3QO6A 4WH6A 1GHWH 1M9UA 1FDPA 1UVTH 2DE8A 1O5FH 2O9QA 3RXAA 1DSUA 2QA9E 1ETTH 2B7DH 3U69H 1J9CH 4NFFA 4AGJA 1GL1A 4DURA 5HYOA 1OS8A 2I6SA 2ZTYA 1FQ3A 1KY9A 1C5XB 2THFB 3AASA 3I78A 4GHQA 1O3EA 2R0KA 4HTCH 4IMZA 1O37A 1UTQA 3QGJA 3LGUA 1PYTD 2UWLA 1YPHE 3TH4H 1SVPA 1G32B 1C4V2 1W14U 4CBOA 1CT0E 3BG8A 4DGJA 4UDWH 2RA3A 1B0EA 3FVFB 4FUHA 3GY8A 1A0LA 1NU9A 2GX4A 1LHDH 1O2LA 2PKAB 1BTPA 2XC0A 3SV2H 1GI4A 1O2KA 4ZHLU 1TGBA 2GDDA 1ESAA 5JBTA 1UVUH 3UUZA 1W13U 2PV9B 2QXIA 1SGYE 1GGDC 1O32A 4AFQA 2BDGA 4D9RA 3A86A 4K8YA 1O3PB 1QRWA 2BXTH 2ODYB 3P8GA 3T28A 4X6NA 3TK5A 1CSOE 2BQWB 2PLXA 1GI1A 1BB0B 4DVAU 1XKBC 4NIVA 3RP2A 1C5SA 1W7GH 1UTLM 3R3GB 1WYKA 4ZHMU 1MZAA 2IJOB 2VU8E 4SGBE 1O2YA 2JH5D 1NC6A 1OWDA 1S82A 3VFEA 1HAPH 1TE0A 1C5MD 1SC8U 2Z9KA 5DP6A 2F3CE 5CE1A 1BT7A 2VH6A 1TFXA 4H6TA 3T2NA 1TAWA 2QGRA 4NIXA 1F0SA 3LC5A 1EKBB 3M5LA 3MH6A 5EPNA 2C4FH 1NROH 1QB9A 2ZDKA 3S9BA 1TX7A 3B23B 5F8ZA 1EZQA 4YZUA 1TQ7B 1EJNA 1TGCA 2R0LA 2ZG0H 1H9IE 1P03A 2ZHFH 4ZUHA 2XCNA 1D9IA 4ISHH 2BDYA 3QTVH 1O2WA 3LPRA 2PKSB 2FIRH 4DY7B 1A3EH 4WMDA 2FX6A 4FUGA 4FUIA 1ESTA 5I25A 1MQ6A 1G2LA 4FVDA 1CBWC 1DY9A 2OC0A 5HM9A 3GYLB 2ULLA 1VZQH 3DT0H 3MNXA 1O3KA 4JCNA 4MTBA 3VXFH 1NRQH 5GCHF 1SGPE 4ISOA 2TPIZ 1C2FA 3MNCA 5JBAS 2WPHS 1ZR0A 5AFZH 1C5QA 2OC8A 1T8MA 1J17T 3E8LA 3TGIE 1ANDA 9ESTA 2PWXA 2ZDNA 3SZNA 4DIHH 3HGNA 2HOBA 1OWEA 4PROA 1GVZA 1ELGA 3PTNA 4XSKU 3RC6A 3TPIZ 2Z9LA 1DWBH 1TX6A 3PV4A 4BTIB 3SHAH 2BDAA 3UQVA 1AFQC 3PWBA 2F83A 3ELAH 1ZOMA 3KEEA 1V2NT 2OQUA 1J14A 3A8AA 1LHGH 3H7TA 4B2AA 5F8TA 1Y3UA 3T62A 3MU8A 4ABDA 1K1NA 4WXIA 2W7SA 1Z1IA 2QV1A 1GHAF 1Q3XA 2GD4B 5C67A 4Y76A 4IGDA 2XYAA 4JZDH 2R3UA 4IN1A 2WINI 3LGVA 2W3IA 3LOXA 3VPKA 2Z3DA 1H9HE 3HK6B 4ABIA 2BVXH 3O8CA 3PMBB 1SSXA 1BUIA 2VWMA 1EX3A 1TBRH 5C1UA 1ETSH 3TLOA 2UWPA 1BRBE 2WUCA 4XOJA 4YLUA 3EYDA 1GL0E 4JMYA 1WUNH 1UMAH 1VJAU 2SGEE 3ZVBA 4INLA 4NIWA 5FBIA 1HCGA 2BD9A 3K2UA 4MPWA 1PFXC 1UCYH 1HJAC 1W0ZU 1CO7E 1HJ8A 4ABJA 2C3SA 3RXFA 1O3HA 2H5CA 3CS7A 1C5ZB 2SGQE 1MQ5A 3KQEA 4A1VA 1SFQB 2VINA 1QQUA 7GCHF 1MU8B 1Z7KA 2Q6FA 1FXYA 1O3NA 2CXVA 5C3NA 5JPMH 6GCHF 3S7HB 2NWNA 1S84A 1MTNB 2Q6DA 3BTGE 3M61U 1HAZB 1BQYA 1N8OC 2RA0A 2BY8X 5CHAC 4XBCA 4Y7AA 3BV9B 3TJOA 3SU1A 2HVXA 1H8DH 1BZXE 1P12E 1A46H 5DGJA 1BTXA 4YT6H 1VGCC 1BMLA 1RXPA 3NUMA 1SGFA 2GV6A 1GDQA 4WJG2 5FHTA 2NU3E 2BZAA 5GCHG 3KQCA 3UY9A 2BB4A 1DXWA 4MQAA 3ZZ7A 2H5DA 5A0CA 1HIAB 1C2IA 4DJZB 1AO5A 1C5WB 3P92A 5ESBA 4VGCB 3SU6A 1F7ZA 1Y3XA 5DP9A 1E0FD 8GCHF 4X6MA 1QA7A 4NA8A 5LH8A 3HKIB 2UWOA 1O36A 2FLBH 3W95A 1BBRK 2NU2E 1T8LA 2A4RA 2Z6BD 3AW1A 1K1JA 3SV9A 1LKBA 4B74A 5AFYH 1MD7A 3VEQB 1MU6B 1XUGA 1SL3A 1FMGA 5C1XA 3O8RA 3SJKA 3OYPA 4K1SA 2OP9A 4BANB 2C93B 4BNRA 1GPZA 1N6XA 3KN2A 1THRH 1A0HB 1YBWA 2V6NA 1L2EA 3FAOA 2ZDLA 1GHAG 2BVSH 4UFFH 1GJ6A 1Y5AT 1HB0B 1WAYB 2WV5A 1SG8B 3BTDE 4WF8A 3K9XB 2A2XH 3LJOA 4AORA 4FUBA 3KIDU 2ILNA 1OPHB 3TU7H 4GCHG 1O39A 3T26A 1GVKB 1P57B 2LPRA 3SNCA 2GDEH 4UFDH 3SUGA 1ANCA 1O2JA 1FIWA 1P9UA 2FYQA 1KTTB 3A7YA 4O9VA 1Z8IB 1FPHH 1D3DB 4I8HA 4X1PU 3BTKE 3FFGA 1T8NA 4TY7A 1C2EA 1WOFA 6ESTA 4AZ2B 1YPKH 3MFJA 1QR3E 1TX8A 5K0HA 1GBCA 1GVLA 3MI4A 3HK3B 1QBNA 2TBSA 3BTME 3GCHC 1DDJA 3E16B 2QYIA 1HAXB 4JYVH 2QC2A 1UTMA 1ANEA 1JBUH 2ZFQH 3FP6E 1TMBH 4NG9H 1DITH 2B0FA 1QBOA 1LCYA 3A82A 3QK1A 1K1MA 3F9GA 2BHGA 1BHXB 4DW2U 1AI8H 2VIOA 1MAYA 1OYQA 1DOJA 3BG4C 2A4GA 1ZJKA 2EI8A 3QZRA 4X8UH 2GT8A 1QY6A 1ESBA 4IN2A 3GCNA 3RXQA 1XXDA 1TRNA 4A7IB 4Y6DA 1GI5A 3S7KB 1O3FA 2PGBB 3C27B 1Z8RA 1AFEH 1HGTH 1HBTH 1SQOA 4ABEA 2P3FH 1W3CA 1BTHH 1ELBA 3UIRA 5EQRA 5E2OA 4O97A 4IC6A 1O31A 1Q2WA 2G5NA 3TK9A 3UR9A 1G36A 1FLEE 4WXVA 3U1IB 4GAWA 4THNH 3FANA 1CHOF 1A4WH 1HAIH 5EXLA 8GCHG 3QZQA 3SGQE 5DP8A 4D7FA 3CP7A 4FU7A 1MBMA 3QUMP 2HNTC 1ZTKA 3V3MA 4U2WA 1Y5BT 5EPYA 2QF3A 5E8EH 2FMJA 4U01A 4UE7H 1GDNA 4BAMB 1L0ZA 2ZTXA 1MCVA 1OX1A 4WWYA 3SHCH 4AOQA 1NU7B 3S9CA 2ZHEH 3I77A 3EDXB 3RXVA 1GI7B 2FOGA 4BOHA 1MKXK 3KF2A 3ZV8A 1H8IH 5A0AE 1O5AB 1G2MA 1B5GH 1O5GH 5DPAA 2FTMA 1AVXA 3PO1C 2C8WB 3SNEA 2CJIA 1KDQB 4KGAA 4OS2A 3NXPA 3NWUA 5ETXA 3ZZ9A 2AIPA 1FZZA 4DT7B 2ZDMA 1A0JA 2KAIA 3BIVH 3STIA 1SR5C 1RRKA 1EOJA 4BAKB 1FV9A 1LMWB 1V2MT 2FO9A 2OINA 5FCRA 3E3TA 1HAVB 2A4QA 4RSPA 3DD2H 1C5LH 4JYTA 1P06A 3MMGA 1Y8TA 1ZTLA 3MYWA 3RMLH 5HGGA 1G3EA 1MUEB 4CRCA 3ZVGA 3IITA 4CHAB 6CHAB 1YYY1 3UNSA 1V3XA 2ZGHA 4FVBA 3SNAA 3A80A 4DOQA 1TNGA 2BX3A 1O5DH 4AN7A 1EQ9A 2A5IA 1MTSA 2ZGXH 1GBLA 2FM2A 1C4U2 2FZZA 4FUFA 4CH8B 1AWHB 3F9EA 4BTUB 4X6PA 2P8OB 1AUTC 1D3PB 1GBEA 4BXSA 1HJ9A 3PLBA 2ZDAH 3NZIA 1YPHC 4ISLA 2P3UB 3Q00A 2ZF0H 8ESTE 1UK3A 5FAHA 1EPTB 4OS6A 2VIVA 1LDTT 3GYMA 4NA9H 1F5LA 2EI6A 4X2VA 2STAE 4LOYH 3MNBA 4WMEA 1XUIA 1T32A 4NWKA 2J95A 1UK4A 2OC7A 2A2QH 1UCYE 3Q3YA 1GBIA 1O2MA 1P05A 3K6ZA 4D8NA 1GMDG 4M7GA 1OP8A 1F2SE 1NESE 1B0FA 4TWYA 3VB6A 5ABWA 4ABGA 5JB8S 1GMCF 2AEIH 4GPGA 1AZZA 1FUJA 3F9HA 1P9SA 1RJXB 3BN9A 3Q76A 1G9IE 4RN6A 2FOBA 1EXFA 4MPXA 3RXIA 1A2CH 1G3CA 1CA0C 1ABJH 3MWIU 2A32A 1QJ7B 1EJMA 1MZDA 1O5EH 1SI5H 3RLWH 3UREA 4E7RG 3WY8A 1UHBB 4BAOB 1QIXB 2R3YA 4K69A 3RXJA 2FDAA 3QTOH 1BBRE 4MVNA 3LT3A 3V12A 2TGPZ 1E36B 2WYJA 1P2QA 1IQEA 1MTUA 2ODQA 3L33A 2OD3B 4AX9H 5HXFA 1AE8H 1HXEH 3QX5H 2Y7XA 1Q31A 4B2CA 2A0QB 3W94A 2A4OA 3HKJB 1V6DA 1HRTH 2GP9B 1WTGH 3LGIA 2BZ6H 1QL7A 3D62A 3IWMA 1RTKA 1X7AC 1KIGH 1V2VT 3M5OA 4ABBA 4Q7XA 3A7ZA 1V2UT 1EJAA 1LQDB 2IPHA 1YCPH 3K6YA 1PQAA 1NS3A 1BTWA 1GCDA 2FYRA 3QDZB 3A8DA 3VB4A 1EUFA 1GMHF 1HYLA 4H4FA 2QN5T 3AW0A 3ZZ8A 2ZU5A 5J4QA 1GI9B 4B73A 1KYNA 1GBHA 2BOKA 1GBAA 1AKSB 1BMMH 2EEKA 4TWWA 2GMTB 3M5MA 3SI3H 1T4VH 1WCZA 2OXSA 2RDLA 1C5TA 4OS7A 5A09A 5ESTE 3SUDA 5JB9S 2O8WA 1A5HA 3TJUA 1CT2E 2Z3CA 1XXFA 2VWNA 4Y0YE 5FX5A 1MAXA 3C1KA 2R2MB 2ZZUH 1AD8H 4FUEA 1EZUC 5LGOA 1SGRE 2BD4A 5GJ4B 2GCTC 2AGGX 3ATKA 4MDSA 4I8JA 1E35B 1GWAA 2F9BH 4ASHA 1VITF 3GY3A 1O2OA 2OCVB 4E7NA 1XUHA 2BYAX 2Q6GA 1PPEE 4I32A 2PW8H 4Y0ZE 1A1RA 1O0DH 1C1RA 3LH1A 1S81A 1P02A 2QXGA 3UFAA 3FZDA 2O8LA 7ESTE 1O30A 2PHBA 1TNJA 1AMHA 1TGTA 2ZCKP 3T25A 2RCEA 4X8VH 3M5NA 5C5NA 2F9VA 5LPRA 3QWCH 3TGJE 3RDZA 4Y10E 2W5EA 1TBZH 1ZLRA 2O8TA 5EODA 1V2PT 2YNAA 3A84A 1LVYA 1GBMA 1P10A 2ZGBH 3S69A 2VIWA 1OOKB 1SB1H 1ZSLA 1TBQH 1SGNE 1RIWC 3D49H 1EP5A 5E0JA 2VVCA 4NSYA 3BEUA 1TNLA 1HUTH 5G4BA 3GCOA 3ZV9A 3PROA 1C5OH 5FBEA 4CRGA 1AVWA 3ZVDA 1YPEH 2HWLB 1GHZA 2VB0A 1MCTA 2H2ZA 1AHTH 1IQHA 2W3KA 3UR6A 4GLYA 1F0TA 1HXFH 1UTJA 4E05H 1GGDB 2BD2A 4B1TA 5A2MH 1MH0A 2H9EH 3ZVCA 1ZSJA 2AMPA 3A87A 4Y79A 2P94A 2XBVA 5GDSH 1YPMH 4ZKRU 2J2UA 1EZXC 1INCA 2ZFFH 4ZXXH 3GY2A 4XBBA 4K2YA 1C1UH 2GTBA 2VNTA 3RXCA 2AIQA 4X2XA 1GBBA 1CGIE 3T5FH 3STJA 3P95A 5DP5A 1TA2A 3V0XA 4Q2KA 1O33A 4JZ1A 1C2MA 1YLDA 4ZMAH 3KHVA 4X1NU 2ZTZA 1TNKA 1P09A 3D23A 2O8MA 2ANMH 4HZHA 5LPFA 1RTLA 3M7TA 3LC3A 4OS4A 4WH8A 3SOSA 1DWDH 4A6LA 2V35A 4CR5A 3LJJA 1Z1JA 2JKHA 2ZP0H 2BLVA 2W7UA 3BTTE 1CBWB 1KXEA 1GDUA 1W12U 2G00A 4OGYA 2XXLA 4WVPE 5JBCS 2D2DA 1D6RA 1KXFA 1GI6A 2J92A 3O8DA 2ZFPH 1O34A 2K1QA 4ABHA 3BTFE 4Y7BA 2FOHA 7KMEH 5T6DA 1SOZA 2FPZA 2P16A 4IC5A 1XUFA 3LIWA 1TRYA 4FUJA 1VITG 1C9TA 1S85A 2G81E 3RXGA 2ANYA 3BTEE 2G5VA 3BTHE 1JIRA 1C1TA 2CMYA 1V2WT 2ZHWH 1F0UA 3BEIB 3UOUA 1O2XA 1W0YH 4I7YH 1O35A 3LGWA 4Y11E 2BM2A 3DFJA 2CV3A 1FONA 4U30A 1AFQB 1W11U 1SLWB 2UUJB 1W10U 1AN1E 1OP0A 1AY6H 1QTFA 2RG3A 2A7JA 4KKDA 3TVJB 1KSNA 1TMTH 1Y59T 2Y7ZA 1GCTC 1C2HA 3QGNB 3UOPA 1PPGE 2BY6X 1YF4A 4AFZA 4X0WU 4TPIZ 3RLYH 1ZHRA 1FAKH 4RKJB 4NWLA 1TGSZ 3AAVA 1G3DA 1UCYK 1P2IA 2PTCE 4A1TA 4AYYB 5AHGH 3M7QA 1JIMA 1G37A 1EASA 4ZXYH 3MNSA 1O3LA 1O3OA 2SGPE 3LKWA 2OTVA 2VJ1A 5EG4A 1J8AA 4LZ4B 1S6HA 1C2LA 1SQTA 2AMQA 1QCPA 1QNJA 1AZ8A 1LVMA 2GZ7A 5C5OA 2AH4X 2NU0E 1HJAB 2F9UA 2Z3EA 1PJPA 2AERH 4Y8ZA 1J15A 3GDVA 1GHBF 1IQNA 2XTTB 1V2TT 4XE4A 2ZU2A 3V13A 2UUFB 2BQ6B 2PKAA 1ELFA 4ZKNU 1ZPZA 3SW2B 5J4SA 2JETC 5BRRE 3LONA 1PPBH 3U98H 4AGKA 1BJUA 3PMHB 1LKAA 1T7CA 2G55A 1KLIH 4JZFH 1IQMA 2D8WA 4IBLH 3N7OA 2Z94A 2HPPH 2ZO3H 1N8OB 5L2YH 1PPZA 5CHAB 1WSSH 2FOFA 1T4UH 2F9NA 1V2LT 4IS5A 4D7GA 4X1RU 2VGCC 3OSYA 1VGCB 5LPEA 1ELEE 1G3BA 1L1NA 4RKOB 1WV7H 1O3IA 2BLWA 3SJ8A 2A31A 3DFLA 1TONA 1MKWK 2G4TA 3LH3A 1BIOA 1PQ7A 2SFAA 3SU4A 1IQJA 3I29A 1GBTA 2EC9H 2ZKSA 2A7CA 2BDIA 1O38A 4QT8C 1VITH 1ZZZA 2PUQH 2HGTH 3SUFA 3V7TA 2CHAC 3D65E 3E0PB 2BD7A 3QN7A 2FTLE 1WQVH 4LZ1H 1JRSA 4DG4A 1CT4E 1NO9H 3LGTA 1AU8A 4MLFB 4CRFA 3VB3A 4KTCA 3BIUH 1P2NA 4HGCA 3TH3H 1YCPM 3Q3XA 3VGCC 1NFUA 1K1PA 4JYUH 1RFNA 1K1IA 2BD8A 3PYHA 1KXCA 2HALA 1LPKB 1L4ZA 1JMOH 7GCHG 1FY3A 2EI7A 1W7XH 1S0QA 1NY22 6GCHG 3ODFA 1ELCA 2VWLA 2JH0D 1SLUB 5EQSA 3NKKA 2H6MA 3LDXH 4AG2A 1O3BA 5EQQA 3U9AH 1TQ0B 1QFKH 1IHTH 1FN6A 1BCUH 1A5IA 2OBOA 3ZYEA 3RXMA 4I8KA 3ATWA 3HPTB 2TIOA 2XRCA 3RXLA 4ESTE 4FUCA 1CE5A 2SNWA 3KL6A 3ZZ4A 1V2RT 2PUXB 1SLXB 4UEHH 4YOIA 4WY3A 2TGDA 1GI8B 3ZZDA 3ZZ5A 1YPJH 3UPEA 1NM6A 1F92A 2ZPSA 4MPVA 1DPOA 1EAWA 2ZGCA 1EATA 2VVVA 3HGPA 4ISNA 1LPZB 1A3BH 4YLQH 3SGBE 1UVSH 1A61H 2FS8A 4GUXA 1LHEH 1O2QA 4X8SH 1NRRH 1GBKA 3GCHB 3ATMA 4MNVA 4IMQA 2DUCA 1RS0A 1K21H 1IQKA 2C8YB 1MTVA 5FCKA 3VB5A 1NRNH 2QCYA 4FUDA 2BXUH 2R2WU 3PLPA 1A5GH 3SQHE 3MH5A 1DICA 4MNYA 3BG4B 1CVWH 2Y80A 1KXAA 3KQDA 1TRMA 2ZGJA 5C20A 1DXPA 2PR3A 1DE7H 2FOMB 1FN8A 2G52A 5GWZA 3MO6A 1ARCA 1SGEE 2ODPA 2ZFTA 4JK5A 4YOGA 5CMXH 1NRPH 4U32A 1UTKA 1YKTA 1YLCA 3B8JA 2V3OH 1E37B 4NSVA 4K1EA 1ZMLA 1HDTH 4B76A 1ETRH 1VR1H 4E06H 3SBKA 1Y3YA 4XDEA 4K1TA 3SV7A 1AGJA 5A8XA 2F91A 3P8OA 1C1WH 5EXMA 3A89A 3ZVFA 2D1JA 1P8VC 4INKA 1AB9C 4XFQA 4DIIH 4NCYA 1EP6A 2OQ5A 3RM0H 3UNQA 1SHYA 2FODA 1S6FA 3DA9B 5DP4A 2C8XB 1YGCH 1H9LB 5FPTA 3GDSA 1JWTA 1BRUP 4J2YB 3RXBA 1QA0A 1GG6C 3TNTA 2Y5HA 1GJBB 1H1BA 1O3GA 1ZYOA 3RXRA 3MH7A 3RXUA 1O2GH 1GJ5H 2ANWA 4KP0A 1HIAA 5T6FA 3E0NB 1QGFA 1DWEH 1S83A 3PO1B 2HPQH 1P2OA 3UNRA 1PQ5A 4AYVB 1Y3VA 1OWJA 4BXWA 3OU0A 3ENSB 1UTOA 3SUEA 1PPHE 1W2KH 5SGAE 1FY8E 1F0RA 1MD8A 3G01A 1FNIA 3B9FH 1P0SH 2HNTE 3UQOA 1THSH 2Q1JA 1LHFH 4GVUA 3A85A 1IAUA 2AGEX 2FOCA 1UTPA 2V0BA 2BX4A 1P3EA 5F03A 1UVOA 2XW9A 3SU2A 1O2NA 1CHOG 3P70B 1HLTH 2Y6TA 4O3TA 4UFEH 1B7XB 3RM2H 1V2QT 1DANH 3EA8A 1U6QA 3SNDA 3RXPA 3SN8A 1QRXA 1O3AA 5EW2H 2BY5X 1IOEA 3OX7U 4ZAEA 3M3TA 3A8CA 1GI3A 3PMAB 3F68H 5JDUB 1QQ4A 1BITA 3SU0A 3FZZA 2B9LA 3ZVEA 1GBFA 3BF6H 1TNIA 3F1SB 3TJNA 1O2SA 1SFIA 2Y5GA 4H42U 4MG3A 1HAGE 2ZECA 2ZU4A 4TYDA 1LO6A 3PTBA 3OY5U 1PPFE 1V2JT 1GJ9B 5C2ZA 1DFPA 1XMNB 3EGKH 1E34B 2GCHF 4I8GA 4X8TH 3ATIA 3MU4A 1EB1H 2OBQA 2SNVA 3UWIA 5A0BA 1FJSA 9LPRA 3SV8A 1NPMA 2A5AA 1NFWA 1NZQH 1SLVB 2P93A 5EOKA 4CH2B 1SGIB 2FEQH 2BY9X 1DX5M 3IG6B 2VIDA 1CA0B 3S0NA 1YM0A 4X1QU 3DUXH 4I8LA 2XWBI 2DE9A 3MOCA 2ZEBA 3TGKE 1BTZA 1MBQA 1YCPK 2PKSC 2ZIQH 4HFPB 3LU9B 1UO6A 4MPUA 1TLDA 3M3VA 1FI8A 1PYTC 1TOMH 1ZHPA 2XWAA 1BMNH 5AVDA 1SHHB 1GBDA 2ZU1A 3NK8A 1O3DA 1KTSB 1DUAA 1WQSA 1FPCH 3RXTA 5FXLA 3ZZCA 4R8TB 1TABE 5TJXA 1O3MA 4D9QA 2A7HA 2I6QA 1SQAA 4A92A 2NU4E 1QURH 4B71A 2STBE 1C5RA 1P01A 2ALPA 3JZ2B 2G4UA 2R9PA 3M3SA 4Q7ZA 3ZZ3A 1V2ST 1LHCH 1F5KU 1PQ8A 1YPLH 2VIQA 4LK4A 3GY6A 4MNWA 4TY6A 2P59A 3VB7A 1GJ4H 2FX4A 2XCFA 5EXNA 5FPSA 1C1MA 2VVUA 2TGTA 2GT7A 1GMCG 5DKMA 1DT2A 2J94A 4IW4E 1ZGVA 1EAIA 1JRTA 3MO3A 2WPMS 3Q77A 1SGTA 2ZCHP 2ZFRH 2GZ9A 1ORFA 2GCTB 4H6SB 3RUOA 3SJ9A 3P17H 4NIYA 2Z7FE 4ABFA 1TYNA 3R0FA 1KDQA 3GDUA 1A7SA 4J1YA 3ATLA 1E38B 2J38A 3RMOH 2FI3E 1GHYH 1KLTA 3T27A 3GCTF 1HAVA 1D3QB 4JZIA 5E2PA 2AMDA 1O2RA 4WMFA 2FLRH 1N6YA 1C5UA 3DHKH 4DCDA 2ZPRA 3PM3A 1WU1A 1F5RA 4ABAA 1GI2A 1GJ7B 2WPIS 5A8ZA 4F49A 1UVPA 3OY6U 5IDKA 2ALVA 3ZZBA 1GJCB 3L6PA 2O8UA 1G30B 1HAHH 2A1DB 2ZI2H 3E6PH 4YO9A 3A7VA 2BOHB 3UWJH 3H5CB 3BTQE 2GCHG 4OS5A 2FS9A 4NFEA 1GMHG 1OWKA 1RIWB 4TPYA 1SGQE 2HLCA 3A83A 2PFEA 3RXEA 3F6UH 4KELA 4R0IA 3SQEE 3FP7E 2UUYA 2B8OH 2BMGB 3HATH 2B5TB 3RXOA 3PB1E 1NFYA 1SGFG 1IQLA 2VH0A 3GY7A 2XNIA 3JZ1B 1MTNC 1C1OA 2VIPA 1EPTA 2C90B 3BTWE 1SGDE 5EU8A 4O03A 2ZWLH 1EAXA 1LTOA 2NU1E 4INHA 1O2TA 1RD3B 2P3TB 1C1SA 2GGVB 1TOCB 3M37A 4YTAA 3ZZ6A 2FWWA 4FXGH 4GCHF 3BEFB 3S9AA 1BTUA 1NFXA 3RXSA 5T6GA 2PSYA 1TMUH 1YPGH 2IOTA 1LVBA 2V3HH 1ARBA 3RXKA 1C2KA 2A45B 2QXHA 4A1XA 3EA7A 1C1PA 2UUKB 4Z0KA 1EB2A 2ZA5A 3M35A 2BLQA 1AQ7A 3CENA 3F9FA 1OP2A 1QBVH 4VGCC 1P3CA 1VCQA 4K60A 1ANBA 2FI5E 1SGCA 3FP8E 1EAUA 4NGAH 1K22H 2KAIB 3MU0A 1OWHA 4AFUA 5TCCA 1OYTH 1Y3WA 2BD5A 2ZQ2A 1UHBA 4B2BA 4HI3A 1TALA 3ZVAA 5HM2A 4BAQB 5PTPA 3SV6A 4CBNA 3KCGH 1GHVH 1GBJA 4Y71A 1KXBA 4X2YA 1P11E 3GISB 1QRZA 3EQ0H 2ZPQA 1V2OT 1FAXA 2QF0A 3TNSA 1BJVA 4F4OC 2WPLS 4YM9A 2XBWA 2FOEA 1DS2E 2CN0H 1QB6A 3KGPA 5K7RA 1DLKB 3SNBA 2IN2A 2XBXA 3MTYA 2F9OA 3URDA 2VWOA 2J4IA 1BRCE 3ZZAA 1BBRH 1HPGA 2ZU3A 4NZQA 1HAOH 1KLJH 2OUAA 1CHGA 1QL8A 1WBGB 3TIUA 4UD9H 1BDAA 1TPSA 4MNXA 4XBDA 4UONA 2C8ZB 2PTNA 2SGDE 3GCTG 2GVFA 1AKSA 3MO9A 1BMAA 5AF9H 1YP9A 2ZNKH 3U8TH 2Z9JA 1TNHA 1O2PA 5GIBA 1GJAB 1V2KT 1C5YB 1ZJDA 2WV4A 1K1OA 1NN6A 3CS0A 3QLPH 1UTNA 3U8OH 3U1JB 1VCPA 3GY4A 5T3HA 1L1GA 1TPOA 2Y82A 1GCTB 3SO3A 5JYIA 1OKXA 1SMFE 4OGXA 1THPB 4K3JA 1Y5UT 4ISIH 2Z9GA 2XC5A 3SU3A 4YT7H 1CQQA 4I33A 4GSOA 3SGAE 4NA7A 1P2JA 3A8BA 1FY4A 1P04A 2XBYA 3P8FA 3Q3KA 1T8OA 4GHTA 3ITIA 1BA8B 1VCWA 5TCAA 1GHXH 2BVRH 1ACBE 2LNCA 1MKWH 3KQBA 3RC5A 1C2DA 1AWFH 2GZ8A 4D76A 5A8YA 5EW1H 4X1SU 2FP7B 1ZPCA 4X6OA 3SORA 1YC0A 1IHSH 1L1JA 4X2WA 2ASUB 2PGQB 5DO4H 1TGNA 2BDCA 3P8NA 5B6OA 3E91A 4AFSA 2W26A 1O2HA 1BTYA 2WPJS 2M5TA 2QY0B 2YOLA 4YOJA 2ZHQH 2ZQ1A 2ZDVH 4BAHB 1C2GA 1C5PA 5E0HA 2ESTE 1T31A 2FXRA 1CU1A 1WTHD 1SPJA 2OC1A 1JOUB 2JETB 3M36A 4YESB 3SI4H 5DP7A 1D6WA 5DK1A 3RMMH 2D26C 1ZRBA 1QJ6B 1HAYB 1CA8B 4BTTB 1DLEA 2JH6D 5IYTA 2BDBA 1OWIA 2AFQB 2ZFSA 5FX6A 3LGYA 5L30H 1ZRKA 1GI0A 2ZC9H 2BTCE 4B75A 2CF9H 1CGHA 1O2UA 4AB9A 1C1QA 2VGCB 2H9TH 1C5VA
chains in the Genus database with same CATH superfamily
1P2MA 1Z8JB 4JZEH 1C4Y2 5BPEA 1LQEA 3PMJA 1W0JD 1NT1A 3F2GA 2ANKH 1K9OE 3E1XB 3ESTA 5HIZA 1O2ZA 1BHXF 3K65B 3TITA 1BOQA 3EAJA 1OSSA 3UTUH 1GMDF 5FPYA 4ZKSU 2BLOA 5H4IB 1O5BB 3ZYDA 3NCLA 2H1UA 2Z9IA 1QL9A 3NPSA 1AUJA 2QIQA 1ELDE 1GJ8B 1RTFB 3TH2H 3E90B 2CHAB 1HV7A 3GICB 3RU4D 2FOAA 3VXEH 6LPRA 3KNXA 3MU1A 4K8BA 1GHBG 4FU8A 2P95A 1ZPBA 1AVGH 1MKXH 2G51A 4AB8A 3KYGA 5HMAA 1LPGB 4CHAC 1FY1A 6CHAC 3GY5A 3VGCB 1H4WA 1ZSKA 3MHWU 4CRBA 1CGJE 3ODDA 3A7XA 4ZHAA 1IQGA 3U8RH 2AGIX 1O2IA 1GJDB 2QXJA 7LPRA 3URCA 4KTSA 2P8OC 4Q80A 1DM4B 1NRSH 1IQIA 4NZLA 2SGFE 2TGAA 2CF8H 1IQFA 1KXDA 2YNBA 1C5NH 1ZHMA 3AAUA 1TB6H 1AIXH 3PLKA 1C1VH 1XKAC 8LPRA 3OTPA 1ZGIA 1C9PA 2H9HA 1EPTC 1XM1A 2G8TA 1DWCH 5L6NH 3BSQA 2AS9A 1OXGA 1ZMNA 3H7OA 4A5TS 1L4DA 3OTJE 1XVMA 1DUEA 4CR9A 1ABIH 2GKVE 1EOLA 2PSXA 1ZMJA 1E1QD 5I46H 4Z6AH 2Y81A 2F9PA 2TRMA 4JK6A 5GPIB 4OS1A 2OLGA 3L3TA 3PWCA 3O8BA 1D3TB 2AYWA 4K5ZA 3SJIA 4Y8YA 4TT3D 1ZTJA 3GOVB 1N1LA 2SGAA 5E0GA 3RMNH 1J16A 4ZROA 1O3JA 5JBBS 1S0RA 2J34A 4KTUA 3EE0B 2XC4A 1XUKA 4Q7YA 5KGOA 2JDID 2KX4A 1QJ1B 5DP3A 5F8XA 3RXDA 5DG6A 1DVAH 2BDHA 2BY7X 3M7UA 1K1LA 3RXHA 1Z8GA 1SBWA 1TPAE 5C1YA 2WYGA 3P6ZB 5DJ7A 1MMJN 1TIOA 3SJOA 4ZH8A 4SGAE 4AG1A 3UB0A 1BRAA 1ID5H 3MH4A 1XUJA 3A88A 4CRAA 4I31A 2WUBA 1MTWA 1AE5A 1RGQA 1HFDA 1O2VA 4CRDA 2HNTF 1D4PB 1HNEE 1C2JA 4RT1A 4UFGH 1K28D 2Y5FA 4Y8XA 5EGMA 1PPCE 1EZSC 1JXPA 2K8IA 1TWXB 2GV7A 4FU9A 1S5SA 2A5KA 3TJVA 1P2KA 5GXPA 1C1NA 1XX9A 3EA9A 3MU5A 1K2I1 5L2ZH 1WXRA 3A7TA 1QHRB 1UJ1A 3RC4A 1O5CB 2BD3A 3OAAD 2CGAA 3RU4T 3SU5A 1DSTA 3KYFA 4LXBH 4O3UA 1ELAA 2W6JD 3RU4E 3A81A 3AVZA 1ELVA 1DY8A 1TPPA 1O3CA 2ZCLP 1XVOA 1AB9B 2J9NA 2WPKS 2GMTC 2FESH 1W8BH 1WDIA 1ELTA 8KME2 2HVYB 2FI4E 4YXWD 1SOTA 5F6MA 1UK2A 3T29A 1Z6JH 1TA6A 1FY5A 2ZHDA 1FIZA 3MQKC 1Z71A 3GS9A 1NTPA 1VJ9U 2BQ7B 3TK6A 4ZKOU 4CREA 1GG6B 2EA3A 2HRVA 3A7WA 1Z6EA 2QAAA 1QB1A 1LVOA 3QO6A 4WH6A 1GHWH 1M9UA 1FDPA 1UVTH 2DE8A 1O5FH 2O9QA 3RXAA 5CDFE 1DSUA 2QA9E 1ETTH 2B7DH 3U69H 4I86A 1J9CH 4NFFA 4AGJA 1GL1A 4DURA 2IJD1 5HYOA 2LP6A 1OS8A 2I6SA 2ZTYA 3F2HA 1FQ3A 1KY9A 1C5XB 2THFB 3AASA 3I78A 4GHQA 1O3EA 2R0KA 4HTCH 4IMZA 1EFRD 1O37A 1UTQA 3QGJA 3F3BA 3LGUA 1PYTD 2UWLA 1YPHE 3OE7D 3TH4H 1SVPA 1G32B 1C4V2 2OK5A 1W14U 4CBOA 1CT0E 3BG8A 4DGJA 4P00A 4UDWH 2RA3A 1B0EA 3FVFB 4FUHA 3GY8A 1A0LA 1NU9A 2GX4A 1LHDH 1O2LA 2PKAB 1BTPA 2XC0A 3SV2H 1GI4A 1O2KA 4ZHLU 1TGBA 2GDDA 1ESAA 5JBTA 1UVUH 3UUZA 1W13U 2PV9B 2QXIA 2GJGA 1SGYE 1GGDC 1O32A 4AFQA 2BDGA 4D9RA 3A86A 4K8YA 1O3PB 1QRWA 2BXTH 2ODYB 3P8GA 3T28A 4X6NA 3TK5A 1CSOE 2BQWB 2PLXA 1GI1A 1BB0B 4DVAU 1XKBC 4NIVA 3RP2A 1C5SA 1W7GH 1UTLM 3R3GB 1WYKA 4ZHMU 1MZAA 2IJOB 2VU8E 3N7EA 4SGBE 1O2YA 2JH5D 1NC6A 1OWDA 1S82A 3VFEA 3WW7A 1HAPH 1TE0A 1C5MD 1SC8U 2Z9KA 5DP6A 2F3CE 5CE1A 1BT7A 2VH6A 1TFXA 4H6TA 3T2NA 1TAWA 2QGRA 4NIXA 1F0SA 3LC5A 1EKBB 3M5LA 3MH6A 5EPNA 2C4FH 1NROH 1QB9A 2ZDKA 3S9BA 1TX7A 3B23B 5F8ZA 1EZQA 4YZUA 1TQ7B 1EJNA 1TGCA 2R0LA 2ZG0H 1H9IE 1P03A 2ZHFH 4ZUHA 2XCNA 1D9IA 4ISHH 2BDYA 3QTVH 1O2WA 3LPRA 2PKSB 2YMSD 2FIRH 4DY7B 1A3EH 4WMDA 2FX6A 4FUGA 4FUIA 1ESTA 5I25A 1MQ6A 1G2LA 4FVDA 1CBWC 1DY9A 2OC0A 5HM9A 3GYLB 3DCLA 2ULLA 1VZQH 3DT0H 3MNXA 1O3KA 4JCNA 4MTBA 3VXFH 1NRQH 5GCHF 1SGPE 4ISOA 2TPIZ 1C2FA 3MNCA 5JBAS 2WPHS 1ZR0A 2L6OA 5AFZH 1C5QA 2OC8A 1T8MA 1J17T 3E8LA 5B6LA 3TGIE 1ANDA 9ESTA 2PWXA 2ZDNA 3SZNA 4DIHH 3HGNA 2HOBA 1OWEA 4PROA 1GVZA 1ELGA 3PTNA 4XSKU 3RC6A 3TPIZ 2Z9LA 1DWBH 1TX6A 3PV4A 5CHBA 4BTIB 3SHAH 2BDAA 3UQVA 1AFQC 3PWBA 2F83A 3ELAH 1ZOMA 3KEEA 1V2NT 2OQUA 1J14A 3A8AA 1LHGH 3H7TA 1VKYA 4B2AA 5F8TA 1Y3UA 3T62A 3MU8A 4ABDA 1K1NA 4WXIA 2W7SA 1Z1IA 2QV1A 1GHAF 1Q3XA 2GD4B 5C67A 3FO8D 4Y76A 4IGDA 5KEDA 2XYAA 4JZDH 2R3UA 4IN1A 2WINI 3LGVA 2W3IA 2WHXA 3LOXA 2LELA 3VPKA 2Z3DA 1H9HE 3HK6B 4ABIA 3H09A 5C17A 4DT4A 2W6ID 2BVXH 3O8CA 3PMBB 1SSXA 2XNDD 1BUIA 2VWMA 1EX3A 1TBRH 5C1UA 1ETSH 3TLOA 2UWPA 1BRBE 2WUCA 4XOJA 4YLUA 3EYDA 1GL0E 2YMSB 4JMYA 1WUNH 1UMAH 1VJAU 2SGEE 3ZVBA 4INLA 4NIWA 5FBIA 1HCGA 2BD9A 3K2UA 4MPWA 1PFXC 1UCYH 1HJAC 1W0ZU 1CO7E 1HJ8A 4ABJA 2C3SA 3RXFA 1O3HA 2H5CA 3CS7A 1C5ZB 1H8ED 2SGQE 1MQ5A 3DSPA 3KQEA 4A1VA 1SFQB 2VINA 1QQUA 7GCHF 1MU8B 1Z7KA 2Q6FA 1FXYA 1O3NA 2CXVA 5C3NA 5JPMH 6GCHF 3S7HB 2NWNA 1S84A 1MTNB 2Q6DA 3BTGE 3M61U 1HAZB 1BQYA 1N8OC 2RA0A 2BY8X 5CHAC 4XBCA 5KECA 4Y7AA 3BV9B 3TJOA 3SU1A 2HVXA 1H8DH 1BZXE 1P12E 1A46H 5DGJA 1BTXA 4YT6H 1VGCC 2KCPA 1BMLA 1RXPA 3NUMA 1SGFA 2GV6A 1GDQA 4WJG2 5FHTA 2NU3E 2BZAA 5GCHG 3KQCA 3UY9A 2BB4A 1DXWA 4MQAA 3ZZ7A 2H5DA 5A0CA 1HIAB 1C2IA 4DJZB 1AO5A 1C5WB 3P92A 5ESBA 4VGCB 3SU6A 1F7ZA 1Y3XA 5DP9A 1E0FD 8GCHF 4X6MA 1QA7A 4NA8A 5LH8A 3HKIB 2UWOA 1O36A 2FLBH 3W95A 1BBRK 2NU2E 1T8LA 2A4RA 2Z6BD 3AW1A 1K1JA 3SV9A 3N99A 1LKBA 4B74A 5AFYH 1MD7A 3VEQB 1MU6B 1XUGA 1SL3A 1FMGA 5C1XA 3O8RA 3SJKA 4OM9A 3OYPA 4K1SA 2OP9A 4BANB 3KQ5A 2C93B 4BNRA 1GPZA 1N6XA 3KN2A 1THRH 1A0HB 1YBWA 2V6NA 1L2EA 3FAOA 2ZDLA 1GHAG 2BVSH 4UFFH 1GJ6A 1Y5AT 1HB0B 1WAYB 2WV5A 3F2FA 1SG8B 3BTDE 4WF8A 3K9XB 2A2XH 3LJOA 4AORA 4FUBA 3KIDU 2ILNA 1OPHB 3TU7H 4GCHG 1O39A 3T26A 1GVKB 1P57B 2LPRA 3SNCA 2GDEH 4UFDH 3SUGA 1ANCA 1O2JA 1FIWA 1P9UA 4B6EA 2FYQA 1KTTB 3A7YA 4O9VA 1Z8IB 1FPHH 1D3DB 4I8HA 4X1PU 3BTKE 3FFGA 1T8NA 4TY7A 1C2EA 1WOFA 6ESTA 3SYJA 4AZ2B 5IK2D 1YPKH 3MFJA 1QR3E 1TX8A 5K0HA 1GBCA 1GVLA 3MI4A 4RT0A 3HK3B 1QBNA 2TBSA 3BTME 3GCHC 1DDJA 3E16B 2QYIA 1HAXB 4JYVH 2QC2A 1UTMA 1ANEA 1JBUH 2ZFQH 3FP6E 1TMBH 4NG9H 1DITH 2B0FA 1QBOA 1LCYA 3A82A 3QK1A 1K1MA 3F9GA 2BHGA 1BHXB 4DW2U 1AI8H 2VIOA 1MAYA 1OYQA 1K0HA 1DOJA 3BG4C 2A4GA 1ZJKA 2EI8A 3QZRA 4X8UH 2GT8A 1QY6A 1ESBA 2KCYA 4IN2A 5T1VA 3GCNA 3RXQA 1XXDA 1TRNA 4A7IB 4Y6DA 1GI5A 3S7KB 1O3FA 2PGBB 3C27B 1Z8RA 1AFEH 1HGTH 1HBTH 1SQOA 4ABEA 2P3FH 1W3CA 1BTHH 4HG6A 1ELBA 3UIRA 5EQRA 5E2OA 4O97A 4IC6A 1O31A 1Q2WA 2G5NA 3TK9A 3UR9A 1G36A 1FLEE 1NBMD 4WXVA 3U1IB 3DSGA 4GAWA 3FANA 4THNH 1CHOF 1A4WH 1E79D 1HAIH 4XRNA 5EXLA 8GCHG 3QZQA 3SGQE 5DP8A 4D7FA 3CP7A 4FU7A 1MBMA 3QUMP 2HNTC 1ZTKA 2EY4C 3V3MA 4U2WA 1Y5BT 5EPYA 2QF3A 4FOUC 5E8EH 2FMJA 4U01A 4UE7H 1GDNA 4BAMB 1L0ZA 2ZTXA 3AK5A 1MCVA 1OX1A 4WWYA 3SHCH 4AOQA 1NU7B 3S9CA 2ZHEH 3I77A 3EDXB 3RXVA 1GI7B 2FOGA 4BOHA 1MKXK 3KF2A 3WWBA 3ZV8A 1H8IH 5A0AE 1O5AB 1G2MA 1B5GH 1O5GH 5DPAA 2FTMA 1AVXA 3PO1C 5DN6D 2C8WB 3SNEA 2CJIA 1KDQB 4KGAA 4OS2A 3NXPA 3NWUA 5ETXA 3ZZ9A 2AIPA 1FZZA 4DT7B 2ZDMA 1A0JA 2KAIA 3BIVH 3STIA 1SR5C 1RRKA 1EOJA 4BAKB 1FV9A 1LMWB 1V2MT 2FO9A 2OINA 5FCRA 3E3TA 1HAVB 2A4QA 4RSPA 3DD2H 1C5LH 4JYTA 1P06A 3MMGA 1SQRA 1Y8TA 1ZTLA 3MYWA 3RMLH 5HGGA 1G3EA 1MUEB 4CRCA 4ZCNA 3ZVGA 5EJZA 3IITA 4CHAB 6CHAB 1YYY1 3UNSA 1V3XA 2ZGHA 4FVBA 3SNAA 3A80A 4DOQA 1TNGA 2BX3A 1O5DH 4AN7A 1EQ9A 2A5IA 1MTSA 2ZGXH 1GBLA 2FM2A 1C4U2 2FZZA 4FUFA 4CH8B 1AWHB 3F9EA 1KMHB 4BTUB 4X6PA 5EIYA 2P8OB 2V3MA 1AUTC 1FX0B 1D3PB 1GBEA 4BXSA 3PV2A 1HJ9A 3PLBA 2ZDAH 3NZIA 1YPHC 4ISLA 2P3UB 3Q00A 2ZF0H 4FETA 8ESTE 1UK3A 5FAHA 2QE7D 1EPTB 4OS6A 2VIVA 1LDTT 3GYMA 4NA9H 5EJ1A 1F5LA 2EI6A 4X2VA 2STAE 4LOYH 3MNBA 4WMEA 1XUIA 1T32A 4NWKA 2J95A 1UK4A 2OC7A 2A2QH 1UCYE 3Q3YA 2JJ2D 1GBIA 1O2MA 1P05A 3K6ZA 5EJLA 4D8NA 1GMDG 4M7GA 1OP8A 1F2SE 1NESE 1B0FA 4TWYA 3VB6A 5ABWA 4ABGA 5JB8S 1GMCF 2AEIH 4GPGA 1AZZA 1FUJA 3F9HA 1P9SA 1NBME 1RJXB 3BN9A 3Q76A 1G9IE 4RN6A 2FOBA 1EXFA 4MPXA 3RXIA 1A2CH 1G3CA 1CA0C 1ABJH 3MWIU 2A32A 1QJ7B 1EJMA 1MZDA 1O5EH 1SI5H 3RLWH 3UREA 4E7RG 3WY8A 1UHBB 4BAOB 1YY3A 1QIXB 2QF5A 2R3YA 4P02A 4K69A 3RXJA 2FDAA 3QTOH 1BBRE 4MVNA 4ACAA 3LT3A 3V12A 2TGPZ 1E36B 2WYJA 1P2QA 1IQEA 1MTUA 2ODQA 3L33A 2OD3B 2AHME 4AX9H 5HXFA 1AE8H 1HXEH 3QX5H 2Y7XA 1Q31A 4B2CA 2A0QB 3W94A 2A4OA 3HKJB 1V6DA 1HRTH 2GP9B 1WTGH 3LGIA 2BZ6H 1QL7A 3D62A 3IWMA 1RTKA 1X7AC 2WPDD 1KIGH 1V2VT 3M5OA 4ABBA 4Q7XA 3A7ZA 1V2UT 1EJAA 1LQDB 2IPHA 1YCPH 3K6YA 1PQAA 1NS3A 1BTWA 1GCDA 3CNRA 2FYRA 3QDZB 3A8DA 3VB4A 1EUFA 1GMHF 1HYLA 4H4FA 2QN5T 3AW0A 2EQNA 3ZZ8A 2ZU5A 5J4QA 1GI9B 4B73A 1KYNA 2F43B 1GBHA 2BOKA 1GBAA 1AKSB 1BMMH 2EEKA 4TWWA 2GMTB 3M5MA 3SI3H 1T4VH 1WCZA 2OXSA 2RDLA 1C5TA 4OS7A 5A09A 5ESTE 3SUDA 5JB9S 2O8WA 1A5HA 3TJUA 3U28C 1CT2E 2Z3CA 1XXFA 2VWNA 4Y0YE 5FX5A 1MAXA 2J5UA 3C1KA 2R2MB 2ZZUH 1AD8H 4FUEA 1EZUC 5LGOA 1SGRE 2BD4A 5GJ4B 2V7QD 2GCTC 2AGGX 3ATKA 4MDSA 4I8JA 1E35B 1GWAA 2F9BH 2J98B 4ASHA 1VITF 3GY3A 1UW7A 1O2OA 2OCVB 4E7NA 1XUHA 2BYAX 2Q6GA 1PPEE 2JIZD 4I32A 2PW8H 4Y0ZE 1A1RA 1O0DH 4F55A 1C1RA 3LH1A 1S81A 1P02A 2QXGA 3UFAA 3FZDA 2O8LA 7ESTE 1O30A 2PHBA 1TNJA 4Z1MD 1AMHA 1TGTA 2ZCKP 3T25A 2RCEA 4X8VH 2WSSD 3M5NA 5C5NA 2F9VA 5LPRA 3QWCH 3TGJE 3RDZA 4Y10E 2W5EA 1TBZH 1ZLRA 2O8TA 5EODA 1V2PT 2YNAA 3A84A 1LVYA 1GBMA 1P10A 2ZGBH 3S69A 2VIWA 1OOKB 1SB1H 1ZSLA 1TBQH 1SGNE 1RIWC 3D49H 1EP5A 5E0JA 2VVCA 4NSYA 3BEUA 1TNLA 1HUTH 5G4BA 3GCOA 3ZV9A 3PROA 1C5OH 5FBEA 4CRGA 1AVWA 3ZVDA 1YPEH 2HWLB 1GHZA 2VB0A 1MCTA 2H2ZA 1AHTH 1IQHA 2W3KA 3UR6A 4GLYA 1F0TA 1HXFH 1UTJA 4E05H 1GGDB 3PRBA 2BD2A 4B1TA 5A2MH 1MH0A 2H9EH 3ZVCA 1ZSJA 2AMPA 3A87A 4Y79A 2P94A 2XBVA 5GDSH 1YPMH 4ZKRU 1YWUA 2J2UA 1EZXC 1INCA 2ZFFH 4ZXXH 3GY2A 4XBBA 4K2YA 1C1UH 2GTBA 2VNTA 3RXCA 2AIQA 4X2XA 1GBBA 1CGIE 3T5FH 3STJA 3P95A 5DP5A 1TA2A 1COWD 3V0XA 4Q2KA 1O33A 4JZ1A 1C2MA 1YLDA 4ZMAH 3KHVA 4X1NU 2ZTZA 1TNKA 1P09A 3D23A 2O8MA 4TSFD 2ANMH 4HZHA 5LPFA 2KZ4A 1RTLA 3M7TA 3LC3A 4OS4A 4WH8A 3SOSA 1DWDH 4A6LA 2V35A 4CR5A 3LJJA 1Z1JA 2JKHA 2ZP0H 2BLVA 2W7UA 3BTTE 4ACBA 1CBWB 1KXEA 2KCOA 1GDUA 1W12U 2G00A 4OGYA 2XXLA 4WVPE 5JBCS 5F53A 2D2DA 1D6RA 1KXFA 1GI6A 2CK3D 2J92A 3O8DA 2ZFPH 1O34A 2K1QA 4ABHA 3BTFE 4Y7BA 2FOHA 7KMEH 5T6DA 1SOZA 2FPZA 2P16A 4IC5A 1XUFA 3LIWA 1TRYA 4FUJA 1VITG 1C9TA 1S85A 2G81E 3RXGA 2ANYA 3BTEE 2G5VA 3BTHE 1JIRA 1C1TA 2CMYA 1V2WT 2ZHWH 1F0UA 3BEIB 3UOUA 1O2XA 1W0YH 4I7YH 1O35A 3LGWA 4Y11E 2BM2A 3DFJA 2CV3A 1FONA 4U30A 1AFQB 1W11U 1SLWB 2UUJB 1W10U 4AC9A 1AN1E 1OP0A 1AY6H 1QTFA 2RG3A 2A7JA 4KKDA 3TVJB 1KSNA 3VG8A 1TMTH 1Y59T 2Y7ZA 1GCTC 1C2HA 3QGNB 3UOPA 1PPGE 2BY6X 1YF4A 4AFZA 4X0WU 4TPIZ 3RLYH 1ZHRA 1FAKH 4RKJB 4NWLA 1TGSZ 3DSOA 3AAVA 1G3DA 1UCYK 3NRLA 1P2IA 2PTCE 4A1TA 4AYYB 2F4LA 5AHGH 3M7QA 1JIMA 1G37A 1EASA 4ZXYH 3MNSA 1O3LA 1O3OA 2SGPE 3LKWA 2OTVA 2VJ1A 3F0OA 5EG4A 1J8AA 5FL7D 4LZ4B 1S6HA 1C2LA 1SQTA 2AMQA 1QCPA 1QNJA 1AZ8A 2JJ1D 1LVMA 2GZ7A 5C5OA 2AH4X 2NU0E 1HJAB 2F9UA 2Z3EA 1PJPA 2AERH 4Y8ZA 1J15A 3GDVA 1GHBF 1IQNA 2XTTB 1V2TT 4XE4A 2ZU2A 3V13A 2UUFB 2BQ6B 2PKAA 1ELFA 4ZKNU 1ZPZA 3SW2B 5J4SA 2JETC 3EE7A 5BRRE 3LONA 1PPBH 4Q4LA 3U98H 4AGKA 1BJUA 3PMHB 1BMFD 1LKAA 1T7CA 2G55A 1KLIH 4JZFH 1IQMA 2D8WA 4IBLH 3N7OA 2Z94A 2HPPH 2ZO3H 1N8OB 5L2YH 1PPZA 5CHAB 1WSSH 2FOFA 1T4UH 2F9NA 1V2LT 4IS5A 4D7GA 4X1RU 2VGCC 3OSYA 1VGCB 5LPEA 1ELEE 1G3BA 1L1NA 4RKOB 1WV7H 1O3IA 3FOAA 2BLWA 3SJ8A 2A31A 3DFLA 1TONA 1MKWK 2G4TA 3LH3A 1BIOA 1MABB 1PQ7A 2SFAA 3SU4A 1IQJA 3I29A 1GBTA 2EC9H 2ZKSA 2A7CA 2BDIA 1O38A 4QT8C 1VITH 1ZZZA 2PUQH 2HGTH 3SUFA 3V7TA 2RDEA 3WWFA 2CHAC 3D65E 3E0PB 2BD7A 3QN7A 2FTLE 1WQVH 4LZ1H 1JRSA 4DG4A 1CT4E 1NO9H 3LGTA 3N7DA 3W1EA 1AU8A 4MLFB 4CRFA 3VB3A 4KTCA 3BIUH 1P2NA 4HGCA 3TH3H 1YCPM 3Q3XA 3VGCC 1NFUA 1K1PA 4JYUH 1RFNA 1K1IA 2BD8A 3PYHA 1KXCA 2HALA 1LPKB 1L4ZA 1JMOH 7GCHG 3OEED 1FY3A 2EI7A 1W7XH 1S0QA 1NY22 6GCHG 3ODFA 1ELCA 2VWLA 2JH0D 1SLUB 5EQSA 3NKKA 2K0QA 2H6MA 2M2AA 3LDXH 4AG2A 1O3BA 5EQQA 3U9AH 1TQ0B 1QFKH 2VBCA 1IHTH 1FN6A 1BCUH 1A5IA 2OBOA 3ZYEA 3RXMA 4I8KA 3ATWA 3HPTB 2HLDD 2TIOA 1H8HD 2XRCA 3RXLA 4ESTE 4FUCA 1CE5A 2SNWA 3KL6A 3ZZ4A 1V2RT 2PUXB 1SLXB 4UEHH 4YOIA 4WY3A 2TGDA 1GI8B 3ZZDA 3ZZ5A 1YPJH 3UPEA 1NM6A 1F92A 2ZPSA 4MPVA 1DPOA 1EAWA 2ZGCA 1EATA 2VVVA 3HGPA 4ISNA 1LPZB 1A3BH 4YLQH 3SGBE 1UVSH 1A61H 2FS8A 4GUXA 1LHEH 1O2QA 4X8SH 1NRRH 1GBKA 3GCHB 3ATMA 4MNVA 4IMQA 2DUCA 1RS0A 1K21H 1IQKA 2C8YB 1MTVA 5FCKA 3VB5A 1NRNH 2QCYA 1YLNA 2BXUH 4FUDA 2R2WU 3PLPA 1A5GH 3SQHE 3MH5A 1DICA 4MNYA 3BG4B 1CVWH 2Y80A 1KXAA 3KQDA 1TRMA 2ZGJA 5C20A 1DXPA 2PR3A 1DE7H 2FOMB 1FN8A 2G52A 5GWZA 3MO6A 1ARCA 1SGEE 2ODPA 2ZFTA 4JK5A 4YOGA 5CMXH 1NRPH 4U32A 1UTKA 1YKTA 1YLCA 3B8JA 2V3OH 1E37B 4NSVA 4K1EA 5C94A 1ZMLA 1HDTH 3UAIC 4B76A 4Q63A 1ETRH 1VR1H 4E06H 3SBKA 1Y3YA 4XDEA 3OFND 4K1TA 3SV7A 1AGJA 5A8XA 2F91A 3P8OA 1C1WH 5EXMA 3A89A 3ZVFA 2D1JA 1P8VC 4INKA 1AB9C 4XFQA 4DIIH 4NCYA 1EP6A 2OQ5A 3RM0H 3UNQA 5C0TA 1SHYA 2FODA 1S6FA 3DA9B 5DP4A 2C8XB 1YGCH 1H9LB 5FPTA 3GDSA 1JWTA 2L74A 4B6FA 1BRUP 4J2YB 3RXBA 1QA0A 1GG6C 3TNTA 2Y5HA 1GJBB 3PV5A 1H1BA 1O3GA 1ZYOA 3RXRA 3MH7A 3RXUA 1O2GH 1GJ5H 2ANWA 4KP0A 1HIAA 5T6FA 3E0NB 1QGFA 1DWEH 5C0UA 1S83A 1W0KD 2HPQH 1P2OA 3PO1B 3UNRA 1PQ5A 4AYVB 1Y3VA 1OWJA 4BXWA 3OU0A 3ENSB 1UTOA 3SUEA 2KCAA 4RI0A 1PPHE 1W2KH 5SGAE 1FY8E 1F0RA 1MD8A 3G01A 1FNIA 3B9FH 1P0SH 2HNTE 3UQOA 1THSH 2Q1JA 1LHFH 4GVUA 3A85A 1IAUA 2AGEX 2FOCA 1UTPA 2V0BA 2BX4A 1P3EA 5F03A 1UVOA 2XW9A 3SU2A 1O2NA 1CHOG 3P70B 1HLTH 2Y6TA 3ZIAD 4O3TA 4UFEH 1B7XB 5GNDA 3RM2H 1V2QT 1DANH 3EA8A 1U6QA 3OEHD 3SNDA 3RXPA 3SN8A 1QRXA 1O3AA 5EW2H 2BY5X 1IOEA 3OX7U 4ZAEA 3M3TA 3A8CA 1GI3A 3PMAB 3F68H 2IPQX 5JDUB 1QQ4A 1BITA 3SU0A 3FZZA 2B9LA 4M9FA 3ZVEA 1GBFA 3BF6H 1TNIA 3F1SB 3TJNA 1O2SA 1SFIA 2Y5GA 4H42U 4MG3A 1HAGE 2ZECA 2ZU4A 4TYDA 1LO6A 3PTBA 3OY5U 1PPFE 1V2JT 1GJ9B 5C2ZA 1DFPA 1XMNB 3EGKH 1E34B 2GCHF 4I8GA 4X8TH 3ATIA 3MU4A 1EB1H 2OBQA 2SNVA 3UWIA 5A0BA 1FJSA 9LPRA 3SV8A 1NPMA 2A5AA 1NFWA 1NZQH 1SLVB 2P93A 5EOKA 4CH2B 1SGIB 2FEQH 5HKKD 2BY9X 1DX5M 3IG6B 2XOKD 2VIDA 1CA0B 3S0NA 1YM0A 4X1QU 3DUXH 4I8LA 2XWBI 2DE9A 3MOCA 2ZEBA 3TGKE 1BTZA 1MBQA 1YCPK 2PKSC 2ZIQH 4HFPB 3LU9B 5HIYA 1UO6A 4MPUA 2WV9A 1TLDA 3M3VA 1FI8A 1PYTC 1TOMH 1ZHPA 2XWAA 1BMNH 5AVDA 1SHHB 1GBDA 2ZU1A 3NK8A 1O3DA 1KTSB 1DUAA 1WQSA 1FPCH 3RXTA 5FXLA 3ZZCA 4R8TB 1TABE 5TJXA 1O3MA 4D9QA 2A7HA 2I6QA 1SQAA 4A92A 2NU4E 1QURH 4B71A 2STBE 1C5RA 1P01A 2ALPA 2PP6A 3JZ2B 2G4UA 1SKYE 2R9PA 3M3SA 4Q7ZA 3ZZ3A 1V2ST 1LHCH 1F5KU 1PQ8A 1YPLH 2VIQA 4LK4A 3GY6A 4MNWA 4TY6A 2P59A 3VB7A 1GJ4H 2FX4A 2KM0A 2XCFA 5EXNA 5FPSA 1C1MA 2VVUA 2TGTA 2GT7A 1GMCG 5DKMA 1DT2A 2J94A 4IW4E 1ZGVA 1EAIA 1JRTA 3MO3A 2WPMS 3Q77A 1SGTA 2ZCHP 2ZFRH 2GZ9A 1ORFA 2GCTB 4H6SB 3RUOA 3SJ9A 3P17H 4NIYA 2Z7FE 4ABFA 1TYNA 3R0FA 1KDQA 3GDUA 1A7SA 4J1YA 3ATLA 1E38B 2J38A 3RMOH 2FI3E 1GHYH 1KLTA 3T27A 3GCTF 1HAVA 1D3QB 3F0PA 4JZIA 5E2PA 2AMDA 1O2RA 4WMFA 2FLRH 1N6YA 1C5UA 3DHKH 3FN8A 4DCDA 2ZPRA 2YMSC 3PM3A 1WU1A 1F5RA 4ABAA 1GI2A 1GJ7B 2WPIS 5A8ZA 4F49A 1UVPA 3OY6U 5IDKA 2ALVA 3ZZBA 1GJCB 3L6PA 2O8UA 1G30B 1HAHH 2A1DB 2ZI2H 3E6PH 4YO9A 3A7VA 2BOHB 3UWJH 3H5CB 3BTQE 5DSFA 2GCHG 4OS5A 2FS9A 4NFEA 1GMHG 1OWKA 1RIWB 4TPYA 1OHHD 1SGQE 2HLCA 3A83A 2PFEA 3RXEA 3F6UH 4KELA 4R0IA 3SQEE 3FP7E 2UUYA 2B8OH 2BMGB 3HATH 2B5TB 3RXOA 3PB1E 1NFYA 1SGFG 1IQLA 2VH0A 3GY7A 2XNIA 3JZ1B 1MTNC 1C1OA 2VIPA 1EPTA 2KR7A 2C90B 3BTWE 1SGDE 5EU8A 4O03A 2ZWLH 1EAXA 1LTOA 2NU1E 4INHA 1O2TA 1RD3B 2P3TB 1C1SA 2GGVB 1TOCB 3M37A 4YTAA 3ZZ6A 2FWWA 4FXGH 4GCHF 3BEFB 3S9AA 1BTUA 1NFXA 3RXSA 5T6GA 2PSYA 1TMUH 1YPGH 2IOTA 1LVBA 2V3HH 1ARBA 3RXKA 1C2KA 2A45B 2QXHA 3PRDA 4A1XA 3EA7A 1C1PA 2UUKB 4Z0KA 1EB2A 2ZA5A 3M35A 2BLQA 1AQ7A 3CENA 3F9FA 1OP2A 1QBVH 4VGCC 1P3CA 1VCQA 2J97A 4K60A 1ANBA 2FI5E 1SGCA 3FP8E 1EAUA 4NGAH 1K22H 2KAIB 3MU0A 1OWHA 4AFUA 5TCCA 1OYTH 1Y3WA 2BD5A 2ZQ2A 1UHBA 4B2BA 4HI3A 1TALA 3ZVAA 5HM2A 4BAQB 2RFKC 5PTPA 3SV6A 4CBNA 3KCGH 1GHVH 1GBJA 4Y71A 1KXBA 4X2YA 1P11E 3GISB 1QRZA 3EQ0H 2ZPQA 1V2OT 1FAXA 2QF0A 3TNSA 1BJVA 4F4OC 2WPLS 4YM9A 2XBWA 2FOEA 1DS2E 2CN0H 3SZEA 1QB6A 3KGPA 5K7RA 1DLKB 3SNBA 2IN2A 2XBXA 3MTYA 2F9OA 3URDA 2VWOA 2J4IA 1BRCE 3ZZAA 2WZQA 1BBRH 1HPGA 2ZU3A 4NZQA 1HAOH 1KLJH 2OUAA 1CHGA 1QL8A 1WBGB 3TIUA 4UD9H 1BDAA 1TPSA 4MNXA 4XBDA 4UONA 2C8ZB 2PTNA 2SGDE 3GCTG 2GVFA 1AKSA 3MO9A 1BMAA 5AF9H 1YP9A 2ZNKH 3U8TH 2Z9JA 1TNHA 1O2PA 3FKSD 5GIBA 1GJAB 1V2KT 1C5YB 1ZJDA 2WV4A 1K1OA 1NN6A 3CS0A 3QLPH 1UTNA 3U8OH 3U1JB 1VCPA 3GY4A 5T3HA 1L1GA 1TPOA 2Y82A 1GCTB 3SO3A 4ASUD 5JYIA 1OKXA 1SMFE 4OGXA 1THPB 4K3JA 1Y5UT 2J98A 4ISIH 2Z9GA 2XC5A 3SU3A 4YT7H 4XD7D 1CQQA 4I33A 4GSOA 3SGAE 4NA7A 1P2JA 3A8BA 1FY4A 1P04A 2XBYA 3P8FA 3Q3KA 1T8OA 4GHTA 3ITIA 1BA8B 1VCWA 5TCAA 1GHXH 2BVRH 1ACBE 2LNCA 1MKWH 3KQBA 3RC5A 1C2DA 1AWFH 2GZ8A 4D76A 5A8YA 5EW1H 4X1SU 2FP7B 1ZPCA 4X6OA 1QZ8A 3SORA 1YC0A 1IHSH 1L1JA 4X2WA 1S6LA 2ASUB 2PGQB 5DO4H 1TGNA 2BDCA 3P8NA 5B6OA 3E91A 4AFSA 2W26A 1O2HA 1BTYA 2QF4A 2WPJS 2M5TA 2QY0B 2YOLA 4YOJA 2ZHQH 2ZQ1A 2ZDVH 4BAHB 1C2GA 1C5PA 5E0HA 2ESTE 1T31A 2FXRA 1CU1A 1WTHD 1SPJA 2OC1A 4F48B 1JOUB 2JETB 3M36A 4YESB 3SI4H 5DP7A 1D6WA 1E1RD 5DK1A 3RMMH 2D26C 1ZRBA 1QJ6B 1HAYB 1CA8B 4BTTB 1DLEA 2JH6D 5IYTA 2BDBA 1OWIA 2AFQB 2KFWA 2ZFSA 5FX6A 3LGYA 5L30H 1ZRKA 1GI0A 2ZC9H 2BTCE 4B75A 2CF9H 1CGHA 1O2UA 4AB9A 1C1QA 2VGCB 2H9TH 1C5VA
chains in the Genus database with same CATH topology
1P2MA 1Z8JB 4JZEH 1C4Y2 5BPEA 1LQEA 3PMJA 1NT1A 2ANKH 1K9OE 3E1XB 3ESTA 1O2ZA 1BHXF 3K65B 3TITA 1BOQA 3EAJA 1OSSA 3UTUH 1GMDF 5FPYA 4ZKSU 2BLOA 5H4IB 1O5BB 3ZYDA 3NCLA 2H1UA 2Z9IA 1QL9A 3NPSA 1AUJA 2QIQA 1ELDE 1GJ8B 1RTFB 3TH2H 3E90B 2CHAB 1HV7A 3GICB 3RU4D 2FOAA 3VXEH 6LPRA 3KNXA 3MU1A 4K8BA 1GHBG 4FU8A 2P95A 1ZPBA 1AVGH 1MKXH 2G51A 4AB8A 5HMAA 1LPGB 4CHAC 1FY1A 6CHAC 3GY5A 3VGCB 1H4WA 1ZSKA 3MHWU 4CRBA 1CGJE 3ODDA 3A7XA 4ZHAA 1IQGA 3U8RH 2AGIX 1O2IA 1GJDB 2QXJA 7LPRA 3URCA 4KTSA 2P8OC 4Q80A 1DM4B 1NRSH 1IQIA 4NZLA 2SGFE 2TGAA 2CF8H 1IQFA 1KXDA 2YNBA 1C5NH 1ZHMA 3AAUA 1TB6H 1AIXH 3PLKA 1C1VH 1XKAC 8LPRA 1ZGIA 1C9PA 2H9HA 1EPTC 1XM1A 2G8TA 1DWCH 5L6NH 3BSQA 2AS9A 1OXGA 1ZMNA 3H7OA 4A5TS 1L4DA 3OTJE 1XVMA 1DUEA 4CR9A 1ABIH 2GKVE 1EOLA 2PSXA 1ZMJA 5I46H 4Z6AH 2Y81A 2F9PA 2TRMA 4JK6A 5GPIB 4OS1A 2OLGA 3L3TA 3PWCA 3O8BA 1D3TB 2AYWA 4K5ZA 3SJIA 4Y8YA 1ZTJA 3GOVB 1N1LA 2SGAA 5E0GA 3RMNH 1J16A 4ZROA 1O3JA 5JBBS 1S0RA 2J34A 4KTUA 3EE0B 2XC4A 1XUKA 4Q7YA 5F8XA 1QJ1B 5DP3A 3RXDA 5DG6A 1DVAH 2BDHA 2BY7X 3M7UA 1K1LA 3RXHA 1Z8GA 1SBWA 1TPAE 5C1YA 2WYGA 3P6ZB 5DJ7A 1MMJN 1TIOA 3SJOA 4ZH8A 4SGAE 4AG1A 1BRAA 1ID5H 3MH4A 1XUJA 3A88A 4CRAA 4I31A 2WUBA 1MTWA 1AE5A 1RGQA 1HFDA 1O2VA 4CRDA 2HNTF 1D4PB 1HNEE 1C2JA 4Y8XA 4UFGH 1K28D 2Y5FA 5EGMA 1PPCE 1EZSC 1JXPA 1TWXB 2GV7A 4FU9A 1S5SA 2A5KA 3TJVA 1P2KA 5GXPA 1C1NA 1XX9A 3EA9A 3MU5A 1K2I1 5L2ZH 3A7TA 1QHRB 1UJ1A 3RC4A 1O5CB 2BD3A 2CGAA 3RU4T 3SU5A 1DSTA 4LXBH 4O3UA 1ELAA 3RU4E 3A81A 3AVZA 1ELVA 1DY8A 1TPPA 1O3CA 2ZCLP 1XVOA 1AB9B 2J9NA 2WPKS 2GMTC 2FESH 1W8BH 1ELTA 8KME2 2FI4E 1SOTA 5F6MA 1UK2A 3T29A 1Z6JH 1TA6A 1FY5A 2ZHDA 1FIZA 1Z71A 1NTPA 1VJ9U 2BQ7B 3TK6A 4ZKOU 4CREA 1GG6B 2EA3A 2HRVA 3A7WA 1Z6EA 2QAAA 1QB1A 1LVOA 3QO6A 4WH6A 1GHWH 1M9UA 1FDPA 1UVTH 2DE8A 1O5FH 2O9QA 3RXAA 1DSUA 2QA9E 1ETTH 2B7DH 3U69H 1J9CH 4NFFA 4AGJA 1GL1A 4DURA 5HYOA 1OS8A 2I6SA 2ZTYA 1FQ3A 1KY9A 1C5XB 2THFB 3AASA 3I78A 4GHQA 1O3EA 2R0KA 4HTCH 4IMZA 1O37A 1UTQA 3QGJA 3LGUA 1PYTD 2UWLA 1YPHE 3TH4H 1SVPA 1G32B 1C4V2 1W14U 4CBOA 1CT0E 3BG8A 4DGJA 4UDWH 2RA3A 1B0EA 3FVFB 4FUHA 3GY8A 1A0LA 1NU9A 2GX4A 1LHDH 1O2LA 2PKAB 1BTPA 2XC0A 3SV2H 1GI4A 1O2KA 4ZHLU 1TGBA 2GDDA 1ESAA 5JBTA 1UVUH 3UUZA 1W13U 2PV9B 2QXIA 1SGYE 1GGDC 1O32A 4AFQA 2BDGA 4D9RA 3A86A 4K8YA 1O3PB 1QRWA 2BXTH 2ODYB 3P8GA 3T28A 4X6NA 3TK5A 1CSOE 2BQWB 2PLXA 1GI1A 1BB0B 4DVAU 1XKBC 4NIVA 3RP2A 1C5SA 1W7GH 1UTLM 3R3GB 1WYKA 4ZHMU 1MZAA 2IJOB 2VU8E 4SGBE 1O2YA 2JH5D 1NC6A 1OWDA 1S82A 3VFEA 1HAPH 1TE0A 1C5MD 1SC8U 2Z9KA 5DP6A 2F3CE 5CE1A 1BT7A 2VH6A 1TFXA 4H6TA 3T2NA 1TAWA 2QGRA 4NIXA 1F0SA 3LC5A 1EKBB 3M5LA 3MH6A 5EPNA 2C4FH 1NROH 1QB9A 2ZDKA 3S9BA 1TX7A 3B23B 5F8ZA 1EZQA 4YZUA 1TQ7B 1EJNA 1TGCA 2R0LA 2ZG0H 1H9IE 1P03A 2ZHFH 4ZUHA 2XCNA 1D9IA 4ISHH 2BDYA 3QTVH 1O2WA 3LPRA 2PKSB 2FIRH 4DY7B 1A3EH 4WMDA 2FX6A 4FUGA 4FUIA 1ESTA 5I25A 1MQ6A 1G2LA 4FVDA 1CBWC 1DY9A 2OC0A 5HM9A 3GYLB 2ULLA 1VZQH 3DT0H 3MNXA 1O3KA 4JCNA 4MTBA 3VXFH 1NRQH 5GCHF 1SGPE 4ISOA 2TPIZ 1C2FA 3MNCA 5JBAS 2WPHS 1ZR0A 5AFZH 1C5QA 2OC8A 1T8MA 1J17T 3E8LA 3TGIE 1ANDA 9ESTA 2PWXA 2ZDNA 3SZNA 4DIHH 3HGNA 2HOBA 1OWEA 4PROA 1GVZA 1ELGA 3PTNA 4XSKU 3RC6A 3TPIZ 2Z9LA 1DWBH 1TX6A 3PV4A 4BTIB 3SHAH 2BDAA 3UQVA 1AFQC 3PWBA 2F83A 3ELAH 1ZOMA 3KEEA 1V2NT 2OQUA 1J14A 3A8AA 1LHGH 3H7TA 4B2AA 5F8TA 1Y3UA 3T62A 3MU8A 4ABDA 1K1NA 4WXIA 2W7SA 1Z1IA 2QV1A 1GHAF 1Q3XA 2GD4B 5C67A 4Y76A 4IGDA 2XYAA 4JZDH 2R3UA 4IN1A 2WINI 3LGVA 2W3IA 3LOXA 3VPKA 2Z3DA 1H9HE 3HK6B 4ABIA 2BVXH 3O8CA 3PMBB 1SSXA 1BUIA 2VWMA 1EX3A 1TBRH 5C1UA 1ETSH 3TLOA 2UWPA 1BRBE 2WUCA 4XOJA 4YLUA 3EYDA 1GL0E 4JMYA 1WUNH 1UMAH 1VJAU 2SGEE 3ZVBA 4INLA 4NIWA 5FBIA 1HCGA 2BD9A 3K2UA 4MPWA 1PFXC 1UCYH 1HJAC 1W0ZU 1CO7E 1HJ8A 4ABJA 2C3SA 3RXFA 1O3HA 2H5CA 3CS7A 1C5ZB 2SGQE 1MQ5A 3KQEA 4A1VA 1SFQB 2VINA 1QQUA 7GCHF 1MU8B 1Z7KA 2Q6FA 1FXYA 1O3NA 2CXVA 5C3NA 5JPMH 6GCHF 3S7HB 2NWNA 1S84A 1MTNB 2Q6DA 3BTGE 3M61U 1HAZB 1BQYA 1N8OC 2RA0A 2BY8X 5CHAC 4XBCA 4Y7AA 3BV9B 3TJOA 3SU1A 2HVXA 1H8DH 1BZXE 1P12E 1A46H 5DGJA 1BTXA 4YT6H 1VGCC 1BMLA 1RXPA 3NUMA 1SGFA 2GV6A 1GDQA 4WJG2 5FHTA 2NU3E 2BZAA 5GCHG 3KQCA 3UY9A 2BB4A 1DXWA 4MQAA 3ZZ7A 2H5DA 5A0CA 1HIAB 1C2IA 4DJZB 1AO5A 1C5WB 3P92A 5ESBA 4VGCB 3SU6A 1F7ZA 1Y3XA 5DP9A 1E0FD 8GCHF 4X6MA 1QA7A 4NA8A 5LH8A 3HKIB 2UWOA 1O36A 2FLBH 3W95A 1BBRK 2NU2E 1T8LA 2A4RA 2Z6BD 3AW1A 1K1JA 3SV9A 1LKBA 4B74A 5AFYH 1MD7A 3VEQB 1MU6B 1XUGA 1SL3A 1FMGA 5C1XA 3O8RA 3SJKA 3OYPA 4K1SA 2OP9A 4BANB 2C93B 4BNRA 1GPZA 1N6XA 3KN2A 1THRH 1A0HB 1YBWA 2V6NA 1L2EA 3FAOA 2ZDLA 1GHAG 2BVSH 4UFFH 1GJ6A 1Y5AT 1HB0B 1WAYB 2WV5A 1SG8B 3BTDE 4WF8A 3K9XB 2A2XH 3LJOA 4AORA 4FUBA 3KIDU 2ILNA 1OPHB 3TU7H 4GCHG 1O39A 3T26A 1GVKB 1P57B 2LPRA 3SNCA 2GDEH 4UFDH 3SUGA 1ANCA 1O2JA 1FIWA 1P9UA 2FYQA 1KTTB 3A7YA 4O9VA 1Z8IB 1FPHH 1D3DB 4I8HA 4X1PU 3BTKE 3FFGA 1T8NA 4TY7A 1C2EA 1WOFA 6ESTA 4AZ2B 1YPKH 3MFJA 1QR3E 1TX8A 5K0HA 1GBCA 1GVLA 3MI4A 3HK3B 1QBNA 2TBSA 3BTME 3GCHC 1DDJA 3E16B 2QYIA 1HAXB 4JYVH 2QC2A 1UTMA 1ANEA 1JBUH 2ZFQH 3FP6E 1TMBH 4NG9H 1DITH 2B0FA 1QBOA 1LCYA 3A82A 3QK1A 1K1MA 3F9GA 2BHGA 1BHXB 4DW2U 1AI8H 2VIOA 1MAYA 1OYQA 1DOJA 3BG4C 2A4GA 1ZJKA 2EI8A 3QZRA 4X8UH 2GT8A 1QY6A 1ESBA 4IN2A 3GCNA 3RXQA 1XXDA 1TRNA 4A7IB 4Y6DA 1GI5A 3S7KB 1O3FA 2PGBB 3C27B 1Z8RA 1AFEH 1HGTH 1HBTH 1SQOA 4ABEA 2P3FH 1W3CA 1BTHH 1ELBA 3UIRA 5EQRA 5E2OA 4O97A 4IC6A 1O31A 1Q2WA 2G5NA 3TK9A 3UR9A 1G36A 1FLEE 4WXVA 3U1IB 4GAWA 4THNH 3FANA 1CHOF 1A4WH 1HAIH 5EXLA 8GCHG 3QZQA 3SGQE 5DP8A 4D7FA 3CP7A 4FU7A 1MBMA 3QUMP 2HNTC 1ZTKA 3V3MA 4U2WA 1Y5BT 5EPYA 2QF3A 5E8EH 2FMJA 4U01A 4UE7H 1GDNA 4BAMB 1L0ZA 2ZTXA 1MCVA 1OX1A 4WWYA 3SHCH 4AOQA 1NU7B 3S9CA 2ZHEH 3I77A 3EDXB 3RXVA 1GI7B 2FOGA 4BOHA 1MKXK 3KF2A 3ZV8A 1H8IH 5A0AE 1O5AB 1G2MA 1B5GH 1O5GH 5DPAA 2FTMA 1AVXA 3PO1C 2C8WB 3SNEA 2CJIA 1KDQB 4KGAA 4OS2A 3NXPA 3NWUA 5ETXA 3ZZ9A 2AIPA 1FZZA 4DT7B 2ZDMA 1A0JA 2KAIA 3BIVH 3STIA 1SR5C 1RRKA 1EOJA 4BAKB 1FV9A 1LMWB 1V2MT 2FO9A 2OINA 5FCRA 3E3TA 1HAVB 2A4QA 4RSPA 3DD2H 1C5LH 4JYTA 1P06A 3MMGA 1Y8TA 1ZTLA 3MYWA 3RMLH 5HGGA 1G3EA 1MUEB 4CRCA 3ZVGA 3IITA 4CHAB 6CHAB 1YYY1 3UNSA 1V3XA 2ZGHA 4FVBA 3SNAA 3A80A 4DOQA 1TNGA 2BX3A 1O5DH 4AN7A 1EQ9A 2A5IA 1MTSA 2ZGXH 1GBLA 2FM2A 1C4U2 2FZZA 4FUFA 4CH8B 1AWHB 3F9EA 4BTUB 4X6PA 2P8OB 1AUTC 1D3PB 1GBEA 4BXSA 1HJ9A 3PLBA 2ZDAH 3NZIA 1YPHC 4ISLA 2P3UB 3Q00A 2ZF0H 8ESTE 1UK3A 5FAHA 1EPTB 4OS6A 2VIVA 1LDTT 3GYMA 4NA9H 1F5LA 2EI6A 4X2VA 2STAE 4LOYH 3MNBA 4WMEA 1XUIA 1T32A 4NWKA 2J95A 1UK4A 2OC7A 2A2QH 1UCYE 3Q3YA 1GBIA 1O2MA 1P05A 3K6ZA 4D8NA 1GMDG 4M7GA 1OP8A 1F2SE 1NESE 1B0FA 4TWYA 3VB6A 5ABWA 4ABGA 5JB8S 1GMCF 2AEIH 4GPGA 1AZZA 1FUJA 3F9HA 1P9SA 1RJXB 3BN9A 3Q76A 1G9IE 4RN6A 2FOBA 1EXFA 4MPXA 3RXIA 1A2CH 1G3CA 1CA0C 1ABJH 3MWIU 2A32A 1QJ7B 1EJMA 1MZDA 1O5EH 1SI5H 3RLWH 3UREA 4E7RG 3WY8A 1UHBB 4BAOB 1QIXB 2R3YA 4K69A 3RXJA 2FDAA 3QTOH 1BBRE 4MVNA 3LT3A 3V12A 2TGPZ 1E36B 2WYJA 1P2QA 1IQEA 1MTUA 2ODQA 3L33A 2OD3B 4AX9H 5HXFA 1AE8H 1HXEH 3QX5H 2Y7XA 1Q31A 4B2CA 2A0QB 3W94A 2A4OA 3HKJB 1V6DA 1HRTH 2GP9B 1WTGH 3LGIA 2BZ6H 1QL7A 3D62A 3IWMA 1RTKA 1X7AC 1KIGH 1V2VT 3M5OA 4ABBA 4Q7XA 3A7ZA 1V2UT 1EJAA 1LQDB 2IPHA 1YCPH 3K6YA 1PQAA 1NS3A 1BTWA 1GCDA 2FYRA 3QDZB 3A8DA 3VB4A 1EUFA 1GMHF 1HYLA 4H4FA 2QN5T 3AW0A 3ZZ8A 2ZU5A 5J4QA 1GI9B 4B73A 1KYNA 1GBHA 2BOKA 1GBAA 1AKSB 1BMMH 2EEKA 4TWWA 2GMTB 3M5MA 3SI3H 1T4VH 1WCZA 2OXSA 2RDLA 1C5TA 4OS7A 5A09A 5ESTE 3SUDA 5JB9S 2O8WA 1A5HA 3TJUA 1CT2E 2Z3CA 1XXFA 2VWNA 4Y0YE 5FX5A 1MAXA 3C1KA 2R2MB 2ZZUH 1AD8H 4FUEA 1EZUC 5LGOA 1SGRE 2BD4A 5GJ4B 2GCTC 2AGGX 3ATKA 4MDSA 4I8JA 1E35B 1GWAA 2F9BH 4ASHA 1VITF 3GY3A 1O2OA 2OCVB 4E7NA 1XUHA 2BYAX 2Q6GA 1PPEE 4I32A 2PW8H 4Y0ZE 1A1RA 1O0DH 1C1RA 3LH1A 1S81A 1P02A 2QXGA 3UFAA 3FZDA 2O8LA 7ESTE 1O30A 2PHBA 1TNJA 1AMHA 1TGTA 2ZCKP 3T25A 2RCEA 4X8VH 3M5NA 5C5NA 2F9VA 5LPRA 3QWCH 3TGJE 3RDZA 4Y10E 2W5EA 1TBZH 1ZLRA 2O8TA 5EODA 1V2PT 2YNAA