3MTYA

Comparison of the character and the speed of x-ray-induced structural changes of porcine pancreatic elastase at two temperatures, 100 and 15k. the data set was collected from region a of the crystal. first step of radiation damage
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mtyA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mtyA01
1FIWA 3EDXB 1ELCA 4XE4A 5A0AE 6CHAC 1ELVA 1RS0A 2JH6D 2ZTXA 2Q6GA 3PMHB 1L0ZA 3BN9A 1BTXA 1SGEE 2VH0A 2WV5A 5DP7A 1DXPA 1ELBA 2EI6A 2PFEA 3E8LA 5DG6A 3SU3A 1UVOA 3A8CA 3PM3A 4IC5A 4D9QA 1DY9A 2GVFA 4FUBA 2R0KA 5C20A 2J9NA 4AZ2B 2ZHDA 1O2KA 2Y82A 4NIXA 2BDCA 1OP0A 1UK4A 1UTJA 1WU1A 4UDWH 3ZVEA 3RXBA 1LVOA 2PTNA 1C5VA 2BY5X 1BTYA 3A7YA 1P9SA 4OS5A 1WOFA 1KXAA 1J14A 5AVDA 5EXLA 1HBTH 1TPAE 1TA2A 4K1SA 4ESTE 8LPRA 3RC6A 1KXCA 5LPEA 4YOIA 2ZZUH 3UNRA 3DT0H 1CHOG 2D26C 2Z9KA 1KXFA 1UK2A 4I32A 4FUDA 4ABGA 3M36A 1TPOA 3ZZ5A 1AB9C 1VCWA 2AEIH 1P09A 3SV6A 2FPZA 2ZHWH 4Y10E 1PPCE 2A2QH 4JK6A 1QBVH 1S0RA 1TNKA 2Z9LA 4Y11E 4IN1A 1HAHH 1ESAA 1K28D 2ZGHA 1MU8B 1JBUH 2CF9H 2ILNA 1WUNH 1NC6A 3PO1B 1S6HA 1GI7B 2QIQA 3RXRA 2ZIQH 3OY6U 5EODA 1P2JA 3VGCC 4DOQA 4ZKOU 1UCYE 1H9LB 1N6YA 4E05H 3ZZDA 2PUQH 2BM2A 5C2ZA 4GAWA 1GBLA 5GCHF 1A5IA 1OKXA 7ESTE 2HGTH 4KGAA 1AY6H 1GVKB 3S9AA 4ABAA 1CHGA 3EYDA 2QXGA 2XWAA 1GBCA 2GZ7A 1HXEH 1YPKH 1D6RA 1JWTA 1V2JT 2AYWA 1O3AA 5HM2A 3Q3YA 3E91A 1NFYA 2ZDMA 1ELDE 1P2OA 1A3BH 3ZZ4A 4GSOA 2ZQ1A 3P8NA 1UHBB 2H1UA 4XFQA 3M5OA 1QY6A 3LGVA 3IITA 1KYNA 1MZAA 1NRNH 1OOKB 3GY7A 2OC8A 3SO3A 5E0JA 1DVAH 5TCAA 1IQEA 1O32A 2PW8H 2V3OH 2C93B 3RM0H 4CRBA 1C5ZB 3QZRA 3TH4H 1WTHD 1F0SA 1TQ7B 1G3EA 1INCA 1DPOA 3SUDA 1O3GA 3URDA 2UUYA 3TPIZ 2V0BA 1THRH 2TGPZ 2QC2A 3P70B 1IOEA 3U98H 1UTNA 4WF8A 1Z8RA 1ZRKA 3MO9A 2CGAA 2ZI2H 1BTWA 1ZMLA 4Y8XA 2R2WU 3LDXH 3W94A 4ABDA 1BIOA 7GCHF 1DT2A 1MKWK 3O8RA 2BLWA 2A5AA 2BD8A 3RMLH 3M7QA 1KLTA 5F8TA 1O0DH 5TJXA 1Y5BT 2FESH 5DP5A 3GCNA 1MKWH 2ZHFH 3QN7A 4UFDH 1O2MA 2PUXB 1O3MA 2ZU5A 1A4WH 2ZHEH 5B6OA 2CV3A 3E90B 5F8XA 4A6LA 3URCA 1ZMNA 5FXLA 1THSH 1TNGA 4AYYB 2BX3A 4K69A 3BTWE 1S6FA 1GDNA 2ZDKA 1PQ7A 4TPIZ 3ZZ6A 3FFGA 1OPHB 2QXHA 1QL9A 1O2QA 5E8EH 1YPHE 1T8OA 3M37A 1CA8B 5C1YA 3A83A 1C2MA 4AFUA 4YOJA 2AFQB 3T27A 1EZSC 1V2NT 1Y5UT 3NUMA 4H4FA 2GKVE 4YZUA 1DE7H 1LHCH 2SGFE 4IW4E 5FPSA 1O3PB 1GBTA 3RXFA 2TIOA 4A92A 1P2KA 1GHBF 2V35A 3TK5A 3M3VA 2TGAA 3M5NA 3P17H 3STJA 3SNAA 1GGDB 1SLUB 1MBQA 3EA9A 1MTNB 1XUHA 1S83A 2P95A 3M35A 4NA8A 1P9UA 3PMAB 1IQIA 2FS8A 2PGBB 4Y79A 1VZQH 1O2HA 1QBOA 1W14U 3A89A 1GL0E 2G4TA 4MPUA 1BBRK 1XM1A 2O9QA 2Z3EA 1HRTH 1HPGA 4ABIA 4D76A 5A2MH 1CGIE 2EEKA 2SNWA 1SGIB 4JK5A 3VB7A 3U8RH 4Z6AH 2J94A 4ZHLU 4DIIH 2ASUB 1O3HA 1EP6A 5T6DA 4ZHMU 1HAPH 2UUJB 3P8FA 2ZTZA 3PLBA 5FCKA 1W8BH 1DDJA 1Y3VA 4BAHB 5EW2H 4AFSA 4DT7B 3ZYEA 3KCGH 2VNTA 1ESBA 4AFZA 1ZSKA 1GJ8B 2JETB 3EA7A 1C1NA 1EATA 3MMGA 4JYTA 1OXGA 2D2DA 4ISHH 1SGPE 1XVOA 2BX4A 1YLCA 1SI5H 2ODPA 3RXOA 1C5WB 2HPPH 2J2UA 4MPXA 4X1NU 2OTVA 2VVCA 3ZZBA 3OYPA 1ZGVA 1Z6JH 3TGKE 1SGCA 5FHTA 5GCHG 4ISLA 2XC4A 2ZGCA 1O3DA 1RD3B 1YPMH 1FAKH 3RXVA 1QB6A 4DG4A 2ZCHP 4A1TA 4WMEA 1AO5A 5CMXH 1SVPA 1UJ1A 1V2QT 1ID5H 1UTQA 1GBBA 2GMTB 1SQAA 3QTOH 3SV7A 1ELGA 2ZDNA 3RMNH 5HXFA 1AFEH 5DO4H 1JIRA 1ACBE 1DLEA 4UE7H 2P59A 2OCVB 4Y7AA 4E06H 2B9LA 1SGFA 2RCEA 1ZPBA 4AG1A 3MU0A 4RSPA 1GI8B 3Q3XA 3RXIA 1WTGH 2Z94A 3SBKA 2VVUA 3KN2A 3A7TA 4Y71A 4YLQH 5JPMH 1EAIA 1ZLRA 1A3EH 1AIXH 2Z7FE 1XUIA 3MNCA 4XBBA 1Y3YA 3MH7A 2ZU2A 4LZ1H 1JMOH 1W7GH 4XOJA 4OGYA 1SGTA 1XKAC 5LPFA 4X6PA 1OP2A 1HB0B 2G81E 1DSUA 2WUCA 3VB6A 2ANKH 3QGJA 3HKIB 2C8XB 1DLKB 2FEQH 3BTDE 2NU4E 1QBNA 2CJIA 5HMAA 1P03A 1TGBA 5T6FA 1MTVA 7GCHG 3RXPA 1QTFA 1S85A 1EAXA 1HLTH 1PYTC 3VB3A 2YNBA 5GWZA 2BQ7B 3STIA 1JIMA 3LGUA 1MTWA 2XC0A 1IQJA 2OINA 3ATMA 5C1XA 1HDTH 2OQ5A 3RU4T 1TNHA 2ZDAH 5JDUB 3FP7E 1F5KU 1QGFA 3V13A 4WXVA 5AHGH 1EB1H 3SU2A 1D3DB 1SGFG 1JRTA 2KAIA 1OYTH 4HFPB 1C1TA 2ZCKP 3R3GB 1O2JA 4H42U 1O3JA 4X2YA 3FP6E 1VGCB 1O2OA 1Q2WA 2C4FH 2JH5D 1L1GA 1P01A 1PPFE 2OC7A 3LGIA 4DW2U 3FZZA 1NROH 3FP8E 1C2JA 4Q80A 4O3TA 4GUXA 1FMGA 1HIAB 3GYLB 3RXAA 1RTFB 2P3TB 2YNAA 2ZDVH 5LGOA 5DK1A 1FPCH 2PV9B 1TMTH 2AGEX 4WWYA 1GBFA 1GBJA 1BA8B 1J15A 2Y81A 3P6ZB 3HPTB 3D49H 1GHBG 4NWLA 4AB8A 4YT6H 2ZPRA 1BHXF 4MNVA 6GCHF 1Y3XA 4B2AA 5TCCA 5C3NA 1LMWB 3K65B 1FJSA 2R3UA 4ZH8A 1P11E 4NSVA 4WMFA 1DOJA 3HK3B 3LIWA 1F2SE 1KY9A 2ZWLH 1C4Y2 2HVXA 2OC0A 3M3TA 1P10A 1A0JA 3LC3A 4D8NA 1EOJA 1WAYB 2XBYA 4THNH 2ZA5A 4OS4A 1Y3WA 3S7KB 1W11U 2FTMA 3V7TA 3EA8A 3SJ9A 1Z6EA 3ATLA 5I46H 1SHYA 1WBGB 2P16A 1D3TB 3QTVH 4A1VA 1CA0B 1TYNA 1QRWA 3SQHE 4YO9A 1QJ6B 3TK9A 2BY9X 2PKAB 1CBWB 1DWDH 3UR9A 5DP4A 1V3XA 2XCFA 1SGDE 3DA9B 1C4U2 1VCPA 3U9AH 2A4GA 2A5IA 1EJAA 4YESB 1O3BA 1XXDA 4BTUB 4KTUA 2D1JA 5EU8A 2J4IA 1HXFH 8GCHF 5DP3A 2CMYA 1ANBA 1EX3A 3MTYA 3BTGE 1RIWB 1RFNA 2BXTH 2ZECA 4MPVA 4CR5A 2FTLE 2P8OB 1NRRH 1IQKA 1ZYOA 1YPJH 1O38A 3GCHB 1UVUH 4X2XA 2FS9A 9ESTA 4J2YB 4FUIA 2BOHB 4X1RU 2FZZA 1PFXC 1GJAB 3KF2A 1HGTH 2RDLA 1ZTLA 1F0UA 1GI9B 2G00A 1FY3A 1ETTH 1V2TT 1EAUA 2EI7A 3T2NA 1Y5AT 1GVLA 2ALVA 3VEQB 1DWCH 1NN6A 1YLDA 3LC5A 1K1NA 4DURA 3A81A 4I8LA 1O3KA 2AS9A 1O39A 1YF4A 2BTCE 4AGJA 4HI3A 2FI5E 3SUEA 5ETXA 1TWXB 1XX9A 3LT3A 2V6NA 4BTTB 2ZEBA 1P8VC 1GPZA 2IOTA 3K6YA 3QDZB 1SGNE 4XDEA 2HPQH 1GL1A 3PWBA 3UUZA 1KIGH 2BXUH 3TJOA 3SZNA 3MI4A 4GVUA 1FY8E 2FOGA 1EJMA 1GHYH 4ISOA 1O3EA 1IQMA 1L2EA 1V2UT 1XUJA 1O36A 3ZYDA 3T26A 1QR3E 2BDIA 1HAVB 2FOEA 5F8ZA 3E6PH 1ARBA 3M3SA 1P02A 4RKJB 1HJ9A 2ZKSA 1G2LA 1O2UA 2F9VA 2Y7ZA 3AW1A 5A8ZA 1BOQA 1KLIH 1GBMA 3SJOA 1O31A 1ORFA 3LKWA 4MVNA 1MD8A 5DKMA 1O34A 1EXFA 2XRCA 2QYIA 2TGDA 5T3HA 1O2TA 4E7NA 3TGJE 3S69A 1SB1H 1G3BA 2AIPA 1T31A 1ZRBA 3U1JB 2TGTA 1EJNA 2VGCC 3P8OA 2EI8A 1C1MA 4UFEH 1TMBH 3S9CA 2GT7A 1DICA 3AAUA 1B0EA 4X8TH 1A2CH 1QNJA 3UWJH 3QUMP 1J9CH 1B7XB 2P3FH 2THFB 1V2VT 1C5TA 1MMJN 4B74A 3TK6A 2J95A 1FN8A 2P8OC 1BRBE 4M7GA 3I29A 1AD8H 3VB5A 1AI8H 1GJBB 2FOHA 1TABE 3GCHC 1KLJH 3LH3A 3RMOH 3TJVA 1PYTD 1AKSB 1RJXB 3PWCA 2XBWA 1WCZA 5AFZH 2Y7XA 3C27B 3EGKH 1BJUA 1P3EA 3NXPA 3MNBA 2NU2E 5DP8A 1DSTA 4HZHA 2PKAA 2AGGX 2BYAX 3SJIA 3TJUA 6GCHG 3OX7U 3UQOA 4X8SH 1TGTA 2FX6A 4X8VH 2FYRA 1A0HB 1FY4A 2SGDE 1EZQA 3RXUA 2XXLA 2GTBA 5CHAC 1J16A 3RMMH 4GCHF 3QGNB 2FOAA 3CENA 3EE0B 1GCTB 2WPHS 4AG2A 2BZ6H 4WH6A 2FDAA 1BTPA 1GMDF 5CE1A 1P05A 2GD4B 2ZC9H 1O2IA 3SQEE 3LONA 1VITH 1D9IA 2ZDLA 4ZXXH 1O3FA 3KIDU 4ZXYH 2XC5A 4X6OA 2G4UA 1GI5A 1O5BB 4AOQA 1C4V2 2VJ1A 1SGYE 2PKSB 1KDQA 1ZPZA 3SHCH 4F4OC 1GMCG 3K2UA 1LDTT 5EQRA 5L6NH 2G51A 5EG4A 1G3CA 1EP5A 1DUEA 4JZIA 4TYDA 1W10U 1NFXA 1SGRE 8GCHG 1TBQH 3ZZ3A 4DCDA 1C2FA 3SNDA 1C2GA 1K1IA 4BAMB 4CHAB 2H5CA 4Y0ZE 2BQ6B 5EQQA 3SV8A 4NIWA 1GJ7B 1H4WA 1GI2A 3VFEA 1UTKA 4D7GA 4MG3A 1UTOA 2Z9IA 1TE0A 1G37A 2GZ8A 3F9GA 3T28A 1EB2A 3PV4A 1FIZA 4Y0YE 4LZ4B 1PQ5A 4CRAA 3F6UH 3OY5U 3GCTF 4AGKA 3KQEA 1SR5C 4UD9H 1BDAA 2OXSA 3BSQA 2TRMA 2D8WA 1LKAA 3U1IB 4H6SB 2GGVB 3UFAA 1BT7A 3SU1A 1THPB 3K9XB 4JZEH 2A7CA 4I7YH 2QXJA 1WV7H 3GCOA 3SORA 1GG6B 2O8LA 3BV9B 3H5CB 4DY7B 5J4QA 3JZ1B 4I8HA 4SGBE 1PQ8A 3H7TA 4MLFB 1H9IE 1GBEA 1TRNA 1GBIA 1C5NH 5DGJA 1NRQH 1QJ1B 2F83A 1BZXE 1T4UH 3PO1C 2O8UA 4FU8A 1A5HA 4NFFA 2BZAA 5EQSA 1HAIH 3BTTE 1T8NA 4X6MA 4K2YA 2A2XH 4HGCA 4JZFH 2A7JA 2XBVA 2F91A 1HV7A 1E34B 2GZ9A 3UOUA 1SPJA 4CREA 1AKSA 1OWJA 2K1QA 1ELEE 2QGRA 5C1UA 4U2WA 5GJ4B 8KME2 3GOVB 4U32A 1TX6A 1S5SA 1FY5A 1CE5A 2FP7B 2VIPA 1TFXA 2QF0A 3F9HA 3SOSA 2EC9H 5DP9A 3SU0A 4ZROA 2FLRH 2LPRA 1BTHH 2H5DA 2RA3A 3SJKA 3F9EA 3PROA 1V2KT 2J38A 1EPTB 4Y76A 2NU0E 1ANDA 2BD3A 4AB9A 1HAGE 3VXEH 3H7OA 1AVGH 3BTKE 1SQOA 1CO7E 3AASA 2AIQA 1EZUC 2CHAB 2VWLA 4FUJA 4LXBH 3SNEA 2CN0H 2LNCA 2ZFRH 4IN2A 4ABFA 3UNQA 1GI1A 1CGHA 5AFYH 4CH2B 4YTAA 4FUHA 4GHTA 1JXPA 4INLA 1O5CB 3U8TH 1GI3A 1ZSJA 2HOBA 1H9HE 4NG9H 4K8BA 4ABEA 1L1JA 1DFPA 3M7TA 5A0CA 4ZAEA 1C1RA 3QX5H 1CVWH 5BRRE 5ESBA 4ABJA 4BXWA 1ZTJA 1DX5M 5FPYA 3AW0A 3MH6A 3RP2A 1O3LA 3Q77A 3SV2H 1AZZA 2G5NA 3HGNA 2GP9B 1NESE 1MBMA 2WPJS 2AMQA 1F5LA 1UHBA 1E0FD 4CBNA 1NZQH 4RKOB 3RXKA 1CT4E 3ODDA 3ZZ8A 1BRUP 1TA6A 4AFQA 4GCHG 3PTBA 2PSYA 2ODQA 4RN6A 2QXIA 4JMYA 2RG3A 1GMDG 1AFQB 2FXRA 2QN5T 2GT8A 1GI4A 1BMMH 2H2ZA 2CXVA 5JBAS 1A1RA 4CRFA 2SGQE 1PJPA 1O2VA 1LKBA 3BTHE 1U6QA 1Z1IA 1AMHA 1CQQA 2HWLB 2ZFFH 1C1WH 1O2PA 4LOYH 3SGBE 3A88A 1TALA 3OTJE 3RXCA 4UONA 1LCYA 4O97A 3RUOA 1AE8H 3SU4A 2VU8E 1C1SA 1QHRB 3W95A 1UVTH 4MNXA 3ZZCA 3TNSA 2GCHG 1O2ZA 4BAQB 1DUAA 1KXBA 2W5EA 1C2DA 3DD2H 3A87A 2OBQA 1KTTB 2SGAA 5K0HA 2BLVA 1YPLH 1NU9A 1XUKA 1GGDC 3L3TA 1MTNC 4IS5A 1BBRE 2PTCE 3NPSA 4A5TS 1WYKA 1AU8A 1Z1JA 1C5OH 1ANEA 4X8UH 1GBDA 1OWKA 1ESTA 3GCTG 1O2YA 3RXSA 1NPMA 4I8GA 5EW1H 2B0FA 3KQCA 3KQDA 8ESTE 1ZGIA 1C2EA 1ZHMA 1MAXA 1V2OT 7LPRA 3ATKA 1D6WA 2F9UA 3Q3KA 1SG8B 4XBCA 2BDAA 2XNIA 1QL7A 5JB8S 1HUTH 1TGSZ 4SGAE 3ZZ7A 2A32A 3RXMA 5A8YA 3Q00A 1UVSH 1DS2E 4DGJA 1Y3UA 1BQYA 2BQWB 2VIVA 1GHVH 2JETC 1T32A 2FM2A 1HAYB 4NA9H 1QB1A 3FZDA 1T8LA 2JH0D 1N8OB 3QLPH 1NO9H 4ZKRU 2PWXA 1HJAB 2ZU1A 2G5VA 3KQBA 1BJVA 4K5ZA 1SLXB 1TONA 1VCQA 3BTFE 4B71A 1O35A 1SFQB 1MCTA 1ZHRA 1YP9A 1NU7B 1LPGB 2ZU4A 4H6TA 3I78A 4Q7YA 3ZVGA 1H1BA 3P92A 1F7ZA 1O2GH 1PQAA 4D9RA 1MH0A 1V2ST 2IJOB 4J1YA 1BRAA 2GV7A 1DWBH 1YCPK 2ZFTA 4IBLH 1Y8TA 3V12A 2ODYB 4B2BA 4DVAU 3ENSB 2O8MA 1W0ZU 1YCPH 4NGAH 3RXJA 1GHXH 2QCYA 2A45B 3B9FH 5PTPA 2GMTC 4LK4A 5EGMA 3GYMA 4PROA 3BG8A 2A7HA 5LH8A 4BAKB 2QAAA 3AVZA 3LOXA 4FXGH 4JYVH 2R3YA 1C1VH 1GI6A 3D62A 5HGGA 2R2MB 2OUAA 1HCGA 3SUFA 1JRSA 2XTTB 3TIUA 1IQNA 1O3IA 1QQUA 1QL8A 2F9OA 3SUGA 4E7RG 3F9FA 1SHHB 2SGPE 2GDDA 1IQGA 1NM6A 4INHA 2ZHQH 5K7RA 1TBRH 4FUEA 3E0PB 4WXIA 3LGTA 1C1OA 1S81A 1LVBA 2GV6A 2I6QA 1ABIH 5SGAE 4VGCB 1TB6H 4GLYA 1PPGE 1T4VH 2B8OH 4KELA 1V2PT 1EZXC 2BD7A 4DJZB 4MTBA 2J92A 3SN8A 1CU1A 2CF8H 1AZ8A 1G36A 1GMCF 4KTSA 6CHAB 4K1TA 3ZVBA 4Y7BA 3E3TA 2V3HH 2A4OA 2FX4A 3RXHA 1W0YH 1TPPA 4IGDA 2ZFPH 2PR3A 2TPIZ 2Z3CA 2ULLA 1TQ0B 3P95A 1TPSA 2H6MA 4MNYA 3BG4B 1AWFH 3LGYA 1SLWB 1TRMA 2VINA 1D4PB 2ZFSA 5EPYA 3MNXA 4O03A 1UVPA 5AF9H 1OP8A 1VR1H 3U8OH 3V0XA 1MAYA 2UWPA 3V3MA 1ZMJA 1P2NA 3ZVFA 4YOGA 2OC1A 1VGCC 1YGCH 2GCTB 3M5LA 5JBCS 1AUTC 2Q1JA 1GMHF 1VITF 4WMDA 2STBE 1BRCE 3UNSA 1IHSH 1VJAU 3UREA 2A4QA 2FODA 3ELAH 3BEFB 3SNBA 3UQVA 5FX6A 1W7XH 3F68H 1V2RT 2BY7X 1AB9B 2Y5HA 1O3NA 3DFJA 4NA7A 1IQLA 2FI3E 1O5DH 2F9NA 2R9PA 1Z8GA 1FONA 1C5PA 1QA7A 2WYGA 1RTKA 2VIDA 3RU4D 3SGAE 4OGXA 1B0FA 2W7SA 3GY8A 1O5GH 4NSYA 1BMNH 1P2QA 1LQEA 1KXDA 1G2MA 5HM9A 1ELAA 3VGCB 4A1XA 5A8XA 1FNIA 1FUJA 1RRKA 3CP7A 1KSNA 2ZG0H 1NY22 2BDBA 1F5RA 1HIAA 1W13U 2FMJA 2PLXA 1AQ7A 1ZPCA 4R0IA 4I33A 1S84A 1LPZB 1UCYK 3BIVH 5FBEA 2UWOA 3MU1A 1P04A 5FAHA 1SOTA 2WPMS 3C1KA 4ISNA 5JBBS 3MH4A 1O3CA 2Y5GA 1W12U 1UCYH 2ZO3H 3SU6A 4TPYA 1CA0C 1C1QA 1HAZB 1GHZA 5FPTA 1CBWC 3GY3A 1QA0A 1C5SA 5H4IB 1MKXK 1QRXA 1FV9A 1AVXA 2BVXH 2ZF0H 3GISB 2F9BH 2IN2A 1E38B 1O2LA 4Q2KA 1IHTH 3TJNA 1MKXH 1O37A 1YPGH 1ZSLA 1QRZA 1MTUA 1RIWC 5E2PA 5EPNA 4TWYA 4NIVA 1CGJE 3L33A 2FWWA 2FYQA 2WPIS 5JBTA 1MUEB 2WUBA 3BG4C 2SGEE 1TNIA 4NIYA 1BITA 1QCPA 1GBKA 3ZV8A 1TAWA 2Z6BD 1NT1A 1HAXB 3RC5A 3TITA 1BUIA 1MD7A 1QIXB 1UTMA 4MNWA 4K8YA 4ZKSU 2GCTC 3KGPA 5EOKA 1ZR0A 1SL3A 3T29A 1QURH 3ZVDA 3DFLA 2P3UB 4JZDH 4BNRA 1C5RA 2ANWA 2NWNA 1ABJH 1WSSH 3O8DA 4TY7A 1KTSB 5FX5A 1EOLA 1Z7KA 1K21H 1NFUA 2HALA 3S0NA 3L6PA 2Z9GA 2XBXA 1P2IA 1V2MT 2BDGA 2BDYA 2Z3DA 3UTUH 1GJ9B 2NU1E 1YPHC 2Y80A 1ARCA 3B8JA 2WINI 1C5LH 3FANA 4ZUHA 3RXGA 1MTSA 4I8KA 4FU7A 3NCLA 1O30A 5I25A 1FPHH 4Q7ZA 1S82A 1LPKB 2BVSH 3A82A 1C9PA 3GICB 2OQUA 2FLBH 2PGQB 1K9OE 3RXLA 3HATH 1LQDB 3JZ2B 3BEIB 2A0QB 3E1XB 5DP6A 3VPKA 1OS8A 4NFEA 3M7UA 3BTME 1EKBB 3TLOA 1RGQA 2TBSA 4D7FA 1MU6B 3TNTA 3PLPA 1YYY1 3UY9A 3BF6H 3LJJA 1HFDA 2GCHF 1ZTKA 3ESTA 1OWEA 3MO3A 1BTZA 1ZHPA 2HNTF 1TX7A 3FAOA 1YC0A 1GBHA 1QJ7B 4I31A 1SSXA 3IG6B 2H9TH 2FOFA 3MHWU 4BAOB 3QZQA 1QFKH 1XVMA 1MCVA 4JCNA 2A1DB 1TX8A 4OS2A 1AWHB 2OLGA 1QB9A 1AVWA 2QV1A 3SJ8A 1LO6A 3RM2H 1YCPM 1O2XA 2VWOA 4CR9A 1C1PA 6ESTA 2DE9A 1S0QA 5JYIA 1HAVA 1L4DA 4B2CA 1OWHA 3SI4H 1Y59T 1K1PA 1SBWA 1GMHG 2Y6TA 1VITG 3FVFB 2SNVA 4BXSA 2RA0A 1V2LT 1GHAF 1GDUA 3ODFA 1T7CA 3BIUH 1TGNA 1ELFA 1EASA 1A61H 4QT8C 1IAUA 3SW2B 1MQ5A 3MYWA 3PYHA 1TRYA 2VIOA 2XYAA 2XW9A 4XSKU 1O5FH 3ZVAA 3KEEA 1UK3A 1GWAA 2H9HA 3UOPA 3KNXA 2PSXA 3A7XA 2Q6FA 1LHEH 4UFGH 2BLOA 2ZGJA 5J4SA 5JB9S 4FUCA 1FY1A 4O3UA 1MQ6A 5C67A 2W3IA 1Z8IB 1GCTC 1K2I1 1L1NA 1D3QB 3U69H 2WV4A 2AERH 2FIRH 3P8GA 1TIOA 1FLEE 1FXYA 1FQ3A 2OBOA 5IDKA 4XBDA 2BMGB 1LVYA 4WH8A 1ETRH 3O8BA 3A80A 4WY3A 2NU3E 4HTCH 2BOKA 2GDEH 3MOCA 2BVRH 4FVDA 4IMQA 5GPIB 2PKSC 3R0FA 1G32B 1C5QA 3HK6B 2HNTC 2W3KA 1TOCB 1AE5A 1O2RA 1C2LA 2DE8A 1J8AA 3ZZ9A 1MZDA 2C8YB 3SHAH 1PPZA 2ZGXH 4B76A 3TU7H 2PHBA 4I8JA 3GDVA 4B1TA 4CH8B 2WYJA 2A5KA 2C8ZB 3BEUA 3M5MA 4CHAC 1VJ9U 1C1UH 2Q6DA 2ZU3A 3MFJA 5C5OA 3Q76A 3A86A 1W2KH 2QA9E 1KXEA 1OWDA 3GY6A 3BTEE 1YM0A 1O33A 1XMNB 2KAIB 2H9EH 3GDUA 4OS1A 4BOHA 3NWUA 1FZZA 2OD3B 4AORA 1YKTA 3NKKA 3A8DA 1AN1E 1O2SA 3ITIA 2VB0A 1V6DA 3I77A 1UO6A 2BB4A 2ZP0H 4ZMAH 1P12E 1H8DH 3PB1E 2XCNA 1BBRH 1ZJDA 4Y8ZA 2SFAA 5BPEA 3SNCA 2P93A 5L30H 1GJ6A 1UTPA 2W26A 2BD4A 1O2NA 3N7OA 5L2ZH 1OWIA 1O3OA 3LU9B 1GG6C 1L4ZA 3TH3H 5T6GA 2A4RA 3MO6A 2ESTE 5L2YH 5GIBA 4CRDA 1W3CA 3MH5A 4Y6DA 3ATWA 4UFFH 2ZNKH 1BCUH 1TNLA 3G01A 1OYQA 2AGIX 1P57B 2P94A 3A84A 1HNEE 1K22H 1LHGH 1CT0E 1GDQA 5IYTA 4FUGA 4INKA 3UIRA 4ISIH 1UMAH 2UWLA 2AMPA 3MU4A 1K1MA 4DIHH 4FUFA 3IWMA 3PLKA 1O2WA 4ZHAA 4IC6A 4BTIB 1NRSH 5EXMA 1DXWA 3GY4A 2OP9A 1PPHE 3SGQE 4KTCA 3MNSA 1D3PB 3A85A 3EAJA 3T25A 1A46H 3KHVA 1AUJA 2ZGBH 4TWWA 1PPBH 4OS6A 2DUCA 1XKBC 1P3CA 1ELTA 1YBWA 2W7UA 1Q3XA 1EUFA 3BTQE 3SV9A 1P06A 2C90B 4NWKA 4FVBA 1EPTC 5FCRA 2ZTYA 4ABBA 1TMUH 1FAXA 1QQ4A 2AMDA 2IPHA 1V2WT 1LVMA 1GJ4H 3K6ZA 3F1SB 1C5MD 2WPLS 1O5EH 2CHAC 3CS0A 3UPEA 1SLVB 1N1LA 4NZLA 4K1EA 4KKDA 3GY5A 2VH6A 1FDPA 7KMEH 2UUKB 3UWIA 2VWMA 4CRGA 1E36B 1TLDA 3DUXH 1LTOA 1GHAG 1C9TA 1TOMH 1YPEH 2G52A 1C5YB 2HNTE 4ZKNU 1IQFA 3QWCH 1GCDA 3T5FH 2F9PA 3AAVA 3PTNA 4TY6A 2BLQA 4UEHH 2XWBI 1H8IH 2WPKS 2G8TA 1F0TA 1GBAA 1DY8A 3MU5A 1WQSA 4K60A 4AYVB 3B23B 2VIWA 1BB0B 1Z71A 1G3DA 3DHKH 3HKJB 4JZ1A 3RC4A 2C8WB 1EPTA 4Q7XA 1UTLM 3LH1A 4BANB 5A0BA 1TGCA 4WJG2 1A0LA 1ZOMA 3RXTA 1P2MA 1SOZA 2O8TA 3RXQA 1X7AC 1Z8JB 1N6XA 3TGIE 2UUFB 3GY2A 3RDZA 4CRCA 1G30B 5C5NA 5A09A 1AFQC 2BD2A 1F92A 4MPWA 2FOCA 3T62A 1PPEE 2QF3A 4NZQA 1J17T 4KP0A 3UR6A 3S7HB 1CT2E 4B75A 1T8MA 1ANCA 3A7VA 3SU5A 2FI4E 2ZQ2A 4U01A 3QO6A 1BHXB 1CHOF 1CSOE 1O5AB 4F49A 1C2IA 4IMZA 5ABWA 4JYUH 3RXEA 4X1QU 1AHTH 1FI8A 5FBIA 4Y8YA 3RLYH 3E16B 1LHFH 2C3SA 1OX1A 4FU9A 1TNJA 1E35B 2BDHA 1C5XB 4R8TB 4X1SU 1DM4B 1K1JA 2FO9A 2Z9JA 2BY8X 4MDSA 5F03A 1DITH 6LPRA 4YT7H 2ZPSA 3RU4E 4ABHA 4B73A 2ALPA 5E2OA 9LPRA 4X2VA 1DWEH 1G9IE 2B5TB 3O8CA 3VXFH 1XXFA 4K3JA 3D23A 1P0SH 1GI0A 3M61U 3RXDA 3OU0A 2R0LA 1A7SA 2BD5A 5G4BA 3MU8A 5HYOA 1SQTA 3A8AA 2BHGA 1RXPA 3OSYA 2F3CE 1TBZH 5E0GA 2G55A 3PMJA 4X6NA 4X0WU 3CS7A 1ZZZA 1BMLA 1NFWA 1GJ5H 1BTUA 4AX9H 2JKHA 4U30A 3VB4A 1BMAA 2Y5FA 2EA3A 1WQVH 4CBOA 1C2HA 2ANYA 4YM9A 1HYLA 4GHQA 3A7WA 4WVPE 2VGCB 4AN7A 3MWIU 3ZVCA 1C5UA 1N8OC 5EXNA 3ATIA 1HJAC 3EQ0H 1NS3A 2HLCA 3GDSA 3RLWH 1SGQE 2ANMH 1IQHA 1HJ8A 1C2KA 1EQ9A 5DJ7A 5F6MA 3PMBB 1K1OA 2FOMB 4A7IB 5LPRA 2VVVA 3NZIA 4Z0KA 3TVJB 2GX4A 3HGPA 1SMFE 2STAE 4MQAA 2QY0B 2AH4X 3WY8A 4NCYA 3ZZAA 4O9VA 5DPAA 2ZFQH 5GDSH 1GHWH 1GVZA 1F0RA 1A5GH 2M5TA 3A7ZA 3A8BA 1M9UA 1KDQB 2BD9A 4X1PU 3ZV9A 2HRVA 4ASHA 1RTLA 1OSSA 3LJOA 1XUFA 4GPGA 1K1LA 2O8WA 1SFIA 2ZPQA 1ETSH 1NRPH 3KL6A 3E0NB 1FN6A 1GJDB 1DANH 1SC8U 2FOBA 3LPRA 3SI3H 1NTPA 3S9BA 1LHDH 2A31A 4X2WA 5E0HA 5CHAB 1ZJKA 2B7DH 3QK1A 1HAOH 1EAWA 4YLUA 5ESTE 2BY6X 2YOLA 2J34A 1AGJA 3D65E 2VWNA 3LGWA 5GXPA 2VIQA 1JOUB 2ZCLP 3TH2H 4VGCC 1Q31A 1XUGA 3NK8A 1E37B 2I6SA 1GJCB 1B5GH 4OS7A
chains in the Genus database with same CATH superfamily
1FIWA 1SKYE 3EDXB 1ELCA 4XE4A 5A0AE 2XOKD 1ELVA 1RS0A 2JH6D 3PV5A 6CHAC 2ZTXA 2Q6GA 3PMHB 1L0ZA 3BN9A 1BTXA 1SGEE 2VH0A 2WV5A 5DP7A 1DXPA 1ELBA 2EI6A 2PFEA 3E8LA 5DG6A 3SU3A 1UVOA 3A8CA 3PM3A 4IC5A 4D9QA 1DY9A 2GVFA 4FUBA 2R0KA 5C20A 2J9NA 4AZ2B 2ZHDA 1O2KA 2Y82A 4NIXA 2BDCA 1OP0A 1UK4A 1UTJA 1WU1A 4UDWH 3ZVEA 3RXBA 1LVOA 2PTNA 1C5VA 2BY5X 4B6FA 1BTYA 1H8HD 3A7YA 1P9SA 4OS5A 1WOFA 1KXAA 1J14A 5AVDA 5EXLA 1HBTH 1TPAE 1TA2A 4K1SA 4ESTE 8LPRA 3RC6A 1KXCA 5LPEA 4YOIA 2ZZUH 3UNRA 3DT0H 1CHOG 2D26C 2Z9KA 1KXFA 1UK2A 4I32A 4FUDA 4ABGA 3M36A 1TPOA 3ZZ5A 1AB9C 1VCWA 2AEIH 1P09A 3SV6A 2FPZA 2ZHWH 4Y10E 1PPCE 2A2QH 4JK6A 1QBVH 1S0RA 1TNKA 2Z9LA 4Y11E 2YMSC 1HAHH 1ESAA 1K28D 2ZGHA 4IN1A 4Q4LA 1MU8B 1JBUH 5KEDA 2CF9H 2ILNA 1WUNH 1NC6A 3PO1B 1S6HA 1GI7B 2QIQA 3RXRA 2ZIQH 3OY6U 5EODA 1P2JA 3VGCC 4DOQA 4ZKOU 1UCYE 1H9LB 1N6YA 4E05H 3ZZDA 2PUQH 2BM2A 5C2ZA 4GAWA 1GBLA 5GCHF 1A5IA 1OKXA 7ESTE 2HGTH 4KGAA 1AY6H 1GVKB 3S9AA 4ABAA 1CHGA 3EYDA 2QXGA 2XWAA 1GBCA 2GZ7A 4ZCNA 1HXEH 1YPKH 1D6RA 1JWTA 1V2JT 2AYWA 1O3AA 5HM2A 3Q3YA 3E91A 1NFYA 2ZDMA 1ELDE 1P2OA 1A3BH 3ZZ4A 4GSOA 2ZQ1A 3P8NA 1UHBB 2H1UA 4XFQA 3M5OA 1QY6A 3LGVA 3IITA 1KYNA 1MZAA 1NRNH 1OOKB 3GY7A 2OC8A 3SO3A 5E0JA 1DVAH 5TCAA 1IQEA 1O32A 2PW8H 2V3OH 2C93B 3RM0H 1OHHD 4CRBA 1C5ZB 3QZRA 3TH4H 1WTHD 1F0SA 1TQ7B 1G3EA 1INCA 1DPOA 3SUDA 1O3GA 1W0JD 3URDA 2UUYA 3TPIZ 2V0BA 1THRH 2TGPZ 2QC2A 3P70B 1IOEA 3U98H 1UTNA 4WF8A 1Z8RA 1ZRKA 3MO9A 2CGAA 2ZI2H 1BTWA 1ZMLA 4Y8XA 2R2WU 3LDXH 4OM9A 3W94A 4ABDA 1BIOA 7GCHF 1DT2A 1MKWK 3O8RA 2BLWA 2A5AA 2BD8A 3RMLH 3M7QA 1KLTA 5F8TA 5F53A 1O0DH 5TJXA 1Y5BT 2FESH 5DP5A 3GCNA 1MKWH 2ZHFH 3KQ5A 3QN7A 4UFDH 1O2MA 2PUXB 1O3MA 2ZU5A 1A4WH 2ZHEH 5B6OA 5CHBA 2CV3A 2WZQA 3E90B 5F8XA 4A6LA 3URCA 1ZMNA 5FXLA 2QF5A 1THSH 1TNGA 4AYYB 2BX3A 4K69A 3BTWE 1S6FA 4B6EA 1GDNA 2ZDKA 1PQ7A 4TPIZ 3ZZ6A 3FFGA 1OPHB 2QXHA 1QL9A 2QF4A 1O2QA 5E8EH 1YPHE 1T8OA 3M37A 1CA8B 5C1YA 3A83A 1C2MA 3PV2A 4AFUA 4YOJA 2AFQB 3T27A 1EZSC 1V2NT 1Y5UT 3NUMA 1UW7A 2GKVE 4H4FA 4YZUA 3MQKC 1DE7H 3KYFA 1LHCH 2SGFE 4IW4E 5FPSA 1O3PB 1GBTA 3RXFA 3GS9A 2TIOA 4A92A 1P2KA 1GHBF 2V35A 3TK5A 3M3VA 2TGAA 3M5NA 3P17H 3STJA 3OEHD 3SNAA 1GGDB 1SLUB 2M2AA 1MBQA 3EA9A 1MTNB 1XUHA 1S83A 2P95A 3M35A 4NA8A 1P9UA 3PMAB 1IQIA 2FS8A 2PGBB 4Y79A 1VZQH 1O2HA 1QBOA 1W14U 3A89A 1GL0E 2G4TA 4MPUA 1BBRK 1XM1A 2O9QA 2Z3EA 1HRTH 2EY4C 1HPGA 4ABIA 4D76A 5A2MH 1CGIE 2EEKA 2SNWA 1SGIB 4JK5A 3VB7A 3U8RH 4Z6AH 2J94A 4ZHLU 4DIIH 2ASUB 1O3HA 1EP6A 5T6DA 4ZHMU 1HAPH 2UUJB 3P8FA 2ZTZA 3PLBA 5FCKA 1W8BH 1DDJA 1Y3VA 4BAHB 5EW2H 4AFSA 4DT7B 3ZYEA 3KCGH 2VNTA 1ESBA 4AFZA 1ZSKA 1GJ8B 2JETB 3EA7A 1C1NA 1EATA 3MMGA 4JYTA 1OXGA 2D2DA 4ISHH 1SGPE 1XVOA 2BX4A 1YLCA 1SI5H 2ODPA 3RXOA 1C5WB 3ZIAD 3W1EA 2HPPH 2J2UA 3FO8D 4MPXA 4X1NU 2OTVA 2VVCA 3ZZBA 3OYPA 1ZGVA 1Z6JH 3TGKE 1SGCA 5FHTA 5GCHG 4ISLA 2XC4A 2ZGCA 4XRNA 1O3DA 1RD3B 1YPMH 1FAKH 3RXVA 1QB6A 4DG4A 2ZCHP 4A1TA 4WMEA 1AO5A 5CMXH 1SVPA 1UJ1A 1V2QT 1ID5H 1UTQA 1GBBA 2GMTB 1SQAA 3QTOH 2YMSD 3SV7A 1ELGA 2ZDNA 3OTPA 3RMNH 5HXFA 1AFEH 1SQRA 5DO4H 1JIRA 5FL7D 1ACBE 2KX4A 1DLEA 4UE7H 2P59A 2OCVB 4Y7AA 4E06H 2B9LA 1SGFA 2RCEA 1ZPBA 4AG1A 3MU0A 4RSPA 1GI8B 3Q3XA 3RXIA 1WTGH 2Z94A 3SBKA 2VVUA 3KN2A 5KECA 2JIZD 3A7TA 5T1VA 4Y71A 4YLQH 4RI0A 5JPMH 1EAIA 1ZLRA 1A3EH 1AIXH 2Z7FE 1XUIA 3MNCA 4XBBA 1Y3YA 3MH7A 2ZU2A 4LZ1H 1JMOH 1W0KD 1W7GH 4XOJA 4OGYA 3PRDA 1SGTA 3F2HA 1XKAC 5LPFA 4FOUC 4AC9A 4X6PA 1OP2A 1HB0B 2G81E 1DSUA 2WUCA 3VB6A 2ANKH 3QGJA 3HKIB 2C8XB 1DLKB 3F2GA 2FEQH 3BTDE 2NU4E 1QBNA 2CJIA 5HMAA 1P03A 1TGBA 5T6FA 1MTVA 7GCHG 3RXPA 1QTFA 1S85A 1EAXA 1HLTH 1PYTC 3VB3A 2YNBA 5GWZA 2BQ7B 3STIA 1JIMA 3LGUA 1MTWA 4TSFD 2XC0A 1IQJA 2OINA 4I86A 3ATMA 5C1XA 1HDTH 2OQ5A 3RU4T 1TNHA 2ZDAH 1YLNA 5JDUB 3FP7E 1F5KU 1QGFA 3V13A 4WXVA 4P00A 5AHGH 1EB1H 3SU2A 5GNDA 1D3DB 1SGFG 2WSSD 1JRTA 2KAIA 1OYTH 2W6ID 4HFPB 4Q63A 1C1TA 3EE7A 2ZCKP 3R3GB 1O2JA 4H42U 1O3JA 4X2YA 3FP6E 1VGCB 1FX0B 1O2OA 1Q2WA 2C4FH 2JH5D 1L1GA 3F3BA 1P01A 1PPFE 2OC7A 3LGIA 4DW2U 3FZZA 1NROH 3FP8E 5C0TA 1C2JA 4Q80A 4O3TA 4GUXA 1FMGA 1HIAB 2WV9A 3GYLB 3RXAA 1RTFB 2P3TB 2YNAA 2ZDVH 5LGOA 5DK1A 1FPCH 2PV9B 1TMTH 2AGEX 4WWYA 1GBFA 1GBJA 1BA8B 1J15A 2Y81A 3P6ZB 3HPTB 3D49H 2J5UA 1GHBG 4NWLA 4AB8A 3FOAA 4YT6H 2ZPRA 1BHXF 4MNVA 6GCHF 1Y3XA 4B2AA 5TCCA 5C3NA 1LMWB 3K65B 1FJSA 2R3UA 4ZH8A 1P11E 4NSVA 4WMFA 1DOJA 3HK3B 3LIWA 1F2SE 1KY9A 2ZWLH 1C4Y2 2HVXA 2OC0A 3M3TA 1P10A 2KCAA 1A0JA 3LC3A 4D8NA 1EOJA 1WAYB 2XBYA 4THNH 2ZA5A 4RT1A 4OS4A 1Y3WA 3S7KB 1W11U 2FTMA 3V7TA 3EA8A 1BMFD 3SJ9A 1Z6EA 3ATLA 5I46H 1SHYA 1WBGB 2P16A 1D3TB 3QTVH 4A1VA 1CA0B 1TYNA 1QRWA 3SQHE 4YO9A 1QJ6B 3TK9A 2BY9X 2PKAB 1CBWB 1DWDH 3UR9A 5DP4A 1V3XA 2XCFA 1SGDE 3DA9B 1C4U2 1VCPA 3U9AH 2A4GA 2A5IA 1EJAA 4YESB 1O3BA 1XXDA 4BTUB 4KTUA 2D1JA 5EU8A 2J4IA 1HXFH 8GCHF 5DP3A 2CMYA 1ANBA 1EX3A 3MTYA 3BTGE 1RIWB 1RFNA 2BXTH 2ZECA 4MPVA 4CR5A 2FTLE 2P8OB 1NRRH 1IQKA 1ZYOA 1YPJH 1O38A 3GCHB 1UVUH 4X2XA 2FS9A 9ESTA 4J2YB 4FUIA 4HG6A 2BOHB 4X1RU 2FZZA 2IPQX 1PFXC 1GJAB 3KF2A 1HGTH 2RDLA 1ZTLA 1F0UA 1GI9B 2G00A 1FY3A 1ETTH 1V2TT 1EAUA 2EI7A 3T2NA 1Y5AT 1GVLA 2ALVA 3VEQB 1DWCH 1NN6A 1YLDA 2EQNA 3LC5A 1KMHB 2LP6A 1K1NA 4DURA 2J98B 3A81A 4I8LA 1O3KA 2AS9A 1O39A 1YF4A 2BTCE 4AGJA 4HI3A 2FI5E 3SUEA 5ETXA 1TWXB 1XX9A 3LT3A 2V6NA 4BTTB 2ZEBA 1P8VC 1GPZA 2IOTA 3K6YA 3QDZB 1SGNE 4XDEA 2HPQH 1GL1A 3PWBA 3UUZA 3CNRA 1KIGH 2BXUH 3TJOA 3SZNA 3MI4A 4GVUA 5HKKD 1FY8E 2FOGA 1EJMA 1GHYH 4ISOA 1O3EA 1IQMA 1L2EA 1V2UT 1XUJA 1O36A 3ZYDA 3T26A 1QR3E 2BDIA 1HAVB 2FOEA 5F8ZA 3E6PH 1ARBA 3M3SA 1P02A 4RKJB 1HJ9A 1YY3A 2ZKSA 1G2LA 1O2UA 2F9VA 2Y7ZA 3AW1A 5A8ZA 1BOQA 5EIYA 1KLIH 1GBMA 3SJOA 1O31A 1ORFA 3LKWA 2JDID 4MVNA 1MD8A 5DKMA 1O34A 1EXFA 2XRCA 2QYIA 2TGDA 5T3HA 1O2TA 4E7NA 3TGJE 3S69A 1SB1H 1G3BA 2AIPA 1T31A 1ZRBA 3U1JB 2TGTA 1EJNA 2WHXA 2VGCC 3P8OA 2EI8A 3F2FA 1C1MA 4UFEH 2KZ4A 1TMBH 3S9CA 2GT7A 1DICA 3AAUA 1B0EA 2K0QA 4X8TH 1A2CH 1QNJA 3UWJH 3QUMP 1J9CH 1B7XB 2P3FH 2THFB 1V2VT 1C5TA 1MMJN 3H09A 4B74A 3TK6A 2J95A 1FN8A 2P8OC 1BRBE 4M7GA 3I29A 1AD8H 3VB5A 1AI8H 1GJBB 2FOHA 1TABE 3GCHC 1KLJH 3LH3A 3RMOH 3TJVA 1PYTD 1AKSB 1RJXB 3PWCA 2XBWA 1WCZA 5AFZH 2Y7XA 3C27B 3EGKH 1BJUA 1P3EA 3NXPA 3MNBA 2NU2E 5DP8A 1DSTA 4HZHA 2PKAA 2AGGX 2BYAX 3SJIA 3TJUA 6GCHG 3OX7U 3UQOA 4X8SH 1TGTA 2FX6A 4X8VH 2FYRA 1A0HB 1FY4A 2SGDE 1EZQA 3RXUA 2XXLA 2GTBA 5CHAC 1J16A 3RMMH 4GCHF 3QGNB 2FOAA 3CENA 3EE0B 1GCTB 2WPHS 4AG2A 2BZ6H 4WH6A 2FDAA 1BTPA 1GMDF 5CE1A 2F4LA 1P05A 2GD4B 2ZC9H 1O2IA 3SQEE 3LONA 1VITH 1D9IA 2ZDLA 4ZXXH 1O3FA 3KIDU 4ZXYH 2XC5A 4X6OA 2G4UA 1GI5A 1O5BB 4AOQA 1C4V2 2VJ1A 1SGYE 4F55A 2PKSB 1KDQA 1ZPZA 3SHCH 4F4OC 1GMCG 3K2UA 1LDTT 5EQRA 5L6NH 2G51A 5EG4A 1G3CA 1EP5A 1DUEA 4JZIA 4TYDA 1W10U 1NFXA 1SGRE 8GCHG 1TBQH 3ZZ3A 4DCDA 1C2FA 3SNDA 1C2GA 4P02A 1K1IA 4BAMB 2KCPA 4CHAB 2H5CA 4Y0ZE 2BQ6B 5EQQA 3SV8A 4NIWA 1GJ7B 1H4WA 1GI2A 3VFEA 1UTKA 4D7GA 4MG3A 1UTOA 2Z9IA 1TE0A 1G37A 2GZ8A 3F9GA 3T28A 1EB2A 3PV4A 1FIZA 4Y0YE 4LZ4B 1PQ5A 4CRAA 3F6UH 3OY5U 3GCTF 4AGKA 3KQEA 1SR5C 4UD9H 1BDAA 2OXSA 3BSQA 2TRMA 2D8WA 1LKAA 4M9FA 3U1IB 4H6SB 5C17A 2GGVB 3UFAA 1BT7A 3SU1A 1THPB 3K9XB 4JZEH 2A7CA 4I7YH 2QXJA 1WV7H 3GCOA 3SORA 1GG6B 2O8LA 3BV9B 3H5CB 4DY7B 5J4QA 3JZ1B 4I8HA 4SGBE 1PQ8A 3H7TA 4MLFB 1H9IE 1GBEA 1TRNA 1GBIA 1C5NH 5DGJA 1NRQH 1QJ1B 2F83A 1BZXE 1T4UH 3PO1C 2O8UA 4FU8A 1A5HA 4NFFA 2BZAA 5EQSA 1HAIH 3BTTE 1T8NA 4X6MA 4K2YA 2A2XH 4HGCA 4JZFH 2A7JA 2XBVA 2F91A 1HV7A 1E34B 2GZ9A 3UOUA 3F0OA 1SPJA 4CREA 1AKSA 1OWJA 2K1QA 1ELEE 2QGRA 5C1UA 4U2WA 5GJ4B 8KME2 3GOVB 4U32A 1TX6A 2W6JD 1S5SA 1FY5A 1CE5A 2FP7B 2VIPA 1TFXA 2QF0A 3F9HA 3SOSA 2EC9H 5DP9A 3SU0A 4ZROA 2FLRH 2LPRA 1BTHH 2H5DA 2RA3A 3SJKA 3F9EA 3PROA 1V2KT 2J38A 1EPTB 4Y76A 2NU0E 1ANDA 2BD3A 4AB9A 1HAGE 3VXEH 3H7OA 1AVGH 3BTKE 1SQOA 1CO7E 2OK5A 3AASA 2AIQA 1EZUC 2CHAB 2VWLA 4FUJA 4LXBH 3SNEA 2CN0H 2LNCA 2ZFRH 4IN2A 4ABFA 3UNQA 1GI1A 1CGHA 5AFYH 4CH2B 4YTAA 4FUHA 4GHTA 1JXPA 4INLA 1O5CB 3U8TH 1GI3A 1ZSJA 2HOBA 1H9HE 4NG9H 4K8BA 4ABEA 1L1JA 1DFPA 3M7TA 5A0CA 4ZAEA 1C1RA 3QX5H 1CVWH 5BRRE 5ESBA 4ABJA 4BXWA 1ZTJA 1DX5M 5FPYA 3AW0A 3MH6A 3RP2A 1O3LA 3Q77A 2JJ1D 3SV2H 1AZZA 2G5NA 3HGNA 4FETA 2GP9B 2IJD1 1NESE 1MBMA 2WPJS 2AMQA 1F5LA 1UHBA 1E0FD 4CBNA 1NZQH 4RKOB 3RXKA 1CT4E 3ODDA 3ZZ8A 1BRUP 1TA6A 4AFQA 4GCHG 3PTBA 5C0UA 2PSYA 2ODQA 4RN6A 2QXIA 4JMYA 2RG3A 1GMDG 1AFQB 2FXRA 2QN5T 2GT8A 1GI4A 1BMMH 4XD7D 2H2ZA 2CXVA 5JBAS 1A1RA 4CRFA 2SGQE 1PJPA 1O2VA 1LKBA 3NRLA 3BTHE 1U6QA 1Z1IA 1AMHA 1CQQA 2HWLB 2ZFFH 1C1WH 1O2PA 4LOYH 3SGBE 3A88A 1TALA 3OTJE 3RXCA 4UONA 1LCYA 4O97A 3RUOA 1AE8H 2WPDD 3SU4A 2VU8E 1C1SA 1QHRB 3W95A 1UVTH 4MNXA 3ZZCA 3TNSA 2GCHG 1O2ZA 4BAQB 1DUAA 3N7EA 1KXBA 2W5EA 1C2DA 3DD2H 3A87A 2OBQA 1KTTB 2SGAA 5K0HA 2BLVA 1YPLH 1NU9A 1XUKA 1GGDC 3L3TA 1MTNC 4IS5A 1BBRE 2PTCE 3NPSA 4A5TS 1WYKA 1AU8A 1Z1JA 1C5OH 1ANEA 4X8UH 1GBDA 1QZ8A 1OWKA 1ESTA 3GCTG 1O2YA 3RXSA 1NPMA 4I8GA 5EW1H 2B0FA 3KQCA 3KQDA 8ESTE 1ZGIA 1C2EA 1ZHMA 1MAXA 1H8ED 1V2OT 7LPRA 3ATKA 1D6WA 2F9UA 3Q3KA 1SG8B 4XBCA 2BDAA 2XNIA 1QL7A 5JB8S 1HUTH 1TGSZ 4SGAE 3ZZ7A 2A32A 3RXMA 5A8YA 3OE7D 3Q00A 1UVSH 1DS2E 4DGJA 1Y3UA 1BQYA 1EFRD 2BQWB 2VIVA 1GHVH 2JETC 1T32A 2FM2A 1HAYB 4NA9H 3KYGA 1QB1A 3FZDA 1T8LA 2JH0D 1N8OB 3QLPH 1NO9H 4ZKRU 2PWXA 1HJAB 2ZU1A 5DSFA 2G5VA 3KQBA 1BJVA 4K5ZA 1MABB 1SLXB 1TONA 1VCQA 3BTFE 4B71A 1O35A 1SFQB 1MCTA 1ZHRA 5KGOA 2KFWA 1YP9A 3WW7A 1NU7B 1LPGB 2ZU4A 4H6TA 3I78A 4Q7YA 3ZVGA 1H1BA 3P92A 1F7ZA 1O2GH 1PQAA 2HVYB 4D9RA 1MH0A 1V2ST 2IJOB 4J1YA 1BRAA 2GV7A 1DWBH 1YCPK 2ZFTA 4IBLH 1Y8TA 3V12A 2ODYB 4B2BA 4DVAU 3ENSB 2O8MA 1W0ZU 1YCPH 4NGAH 3RXJA 1GHXH 2QCYA 2A45B 3B9FH 5PTPA 2GMTC 4LK4A 5EGMA 3GYMA 4PROA 3BG8A 2A7HA 5LH8A 4BAKB 3DSGA 2QAAA 3AVZA 3LOXA 4FXGH 4JYVH 2R3YA 1C1VH 1GI6A 3D62A 3PRBA 5HGGA 2R2MB 2OUAA 1HCGA 3SUFA 2KM0A 1JRSA 2XTTB 3TIUA 1IQNA 1O3IA 1QQUA 1QL8A 2F9OA 3SUGA 3FN8A 4E7RG 3UB0A 3F9FA 1SHHB 2SGPE 2GDDA 1IQGA 1NM6A 4INHA 2ZHQH 5K7RA 1TBRH 4FUEA 3E0PB 4WXIA 3LGTA 1C1OA 1S81A 1LVBA 2GV6A 2I6QA 1ABIH 5SGAE 4VGCB 1TB6H 4GLYA 1NBMD 1PPGE 1T4VH 2B8OH 4KELA 1V2PT 1EZXC 2BD7A 4DJZB 4MTBA 2J92A 3SN8A 1CU1A 2CF8H 1AZ8A 1G36A 1GMCF 4KTSA 2XNDD 6CHAB 4K1TA 3ZVBA 5EJLA 4Y7BA 3N99A 3E3TA 2V3HH 2A4OA 2FX4A 3RXHA 4RT0A 1W0YH 1TPPA 4IGDA 2ZFPH 2PR3A 2TPIZ 2RDEA 2Z3CA 2ULLA 3AK5A 1TQ0B 3P95A 1TPSA 2H6MA 4MNYA 2L6OA 3BG4B 1AWFH 3LGYA 1SLWB 1TRMA 2VINA 1D4PB 2ZFSA 5EPYA 3MNXA 4O03A 1UVPA 5AF9H 1OP8A 1VR1H 3U8OH 3V0XA 1MAYA 2UWPA 3V3MA 1ZMJA 1P2NA 3ZVFA 4YOGA 2OC1A 1VGCC 1YGCH 2GCTB 3M5LA 5JBCS 1AUTC 2Q1JA 1GMHF 1VITF 4WMDA 2STBE 1BRCE 3UNSA 1IHSH 1VJAU 3UREA 2A4QA 2FODA 2KCYA 3ELAH 3BEFB 3SNBA 3UQVA 5FX6A 1W7XH 3F68H 1COWD 1V2RT 2BY7X 1AB9B 2Y5HA 1O3NA 3DSOA 3DFJA 4NA7A 1IQLA 2FI3E 1O5DH 2F9NA 2R9PA 1Z8GA 1FONA 1C5PA 1QA7A 2WYGA 1RTKA 1E1QD 2VIDA 2AHME 3RU4D 4OGXA 1B0FA 2F43B 3SGAE 2W7SA 3GY8A 1O5GH 4ACBA 1WDIA 4NSYA 1BMNH 1P2QA 1LQEA 1KXDA 1G2MA 5HM9A 1ELAA 3VGCB 4A1XA 5A8XA 1FNIA 1FUJA 1RRKA 3CP7A 1KSNA 2ZG0H 1NY22 2BDBA 1F5RA 3FKSD 1HIAA 1W13U 2FMJA 2PLXA 1AQ7A 1ZPCA 2PP6A 4R0IA 4I33A 1S84A 1LPZB 1UCYK 3BIVH 5FBEA 2UWOA 3MU1A 1P04A 5FAHA 1SOTA 2WPMS 3C1KA 4ISNA 5JBBS 3MH4A 1O3CA 2Y5GA 1W12U 1UCYH 2ZO3H 3SU6A 4TPYA 1CA0C 1C1QA 1HAZB 1GHZA 5FPTA 1CBWC 3GY3A 1QA0A 1C5SA 5H4IB 1MKXK 1QRXA 1FV9A 1AVXA 2BVXH 2ZF0H 3GISB 2F9BH 2IN2A 1E38B 1O2LA 4Q2KA 1IHTH 3TJNA 3DSPA 1MKXH 1O37A 1YPGH 1ZSLA 1QRZA 1MTUA 1RIWC 5E2PA 5EPNA 4TWYA 4NIVA 1CGJE 3L33A 2FWWA 2FYQA 2WPIS 5JBTA 1MUEB 2J97A 2WUBA 3BG4C 2SGEE 1TNIA 4DT4A 2LELA 1BITA 4NIYA 2V3MA 1QCPA 1GBKA 3ZV8A 1TAWA 2Z6BD 1NT1A 1HAXB 3RC5A 3TITA 1BUIA 1MD7A 1QIXB 1UTMA 4MNWA 4K8YA 4ZKSU 2GCTC 3KGPA 5EOKA 1ZR0A 1SL3A 3T29A 1QURH 3ZVDA 3DFLA 2P3UB 4JZDH 4BNRA 1C5RA 2ANWA 2NWNA 1ABJH 1WSSH 3O8DA 4TY7A 1KTSB 5FX5A 1EOLA 1Z7KA 1K21H 1NFUA 2HALA 3S0NA 3L6PA 2Z9GA 2XBXA 1P2IA 1V2MT 2BDGA 2BDYA 2Z3DA 3UTUH 2HLDD 1GJ9B 2NU1E 1YPHC 2Y80A 1ARCA 3B8JA 2WINI 1C5LH 3FANA 4ZUHA 3RXGA 1MTSA 4I8KA 4FU7A 3NCLA 1O30A 5I25A 1FPHH 4Q7ZA 1S82A 1LPKB 2BVSH 3A82A 1C9PA 3GICB 2OQUA 2FLBH 2PGQB 1K9OE 3RXLA 3HATH 1LQDB 3JZ2B 3BEIB 2A0QB 3E1XB 5DP6A 3VPKA 1OS8A 4NFEA 3M7UA 3BTME 1EKBB 3TLOA 1RGQA 2TBSA 4D7FA 1MU6B 3TNTA 3PLPA 2J98A 1YYY1 3UY9A 3BF6H 3LJJA 1HFDA 2GCHF 1ZTKA 3ESTA 1OWEA 3MO3A 1BTZA 1ZHPA 2HNTF 1TX7A 3FAOA 1YC0A 1GBHA 1QJ7B 4I31A 1SSXA 3IG6B 2H9TH 2FOFA 3MHWU 4BAOB 3QZQA 1QFKH 1XVMA 1MCVA 4JCNA 2A1DB 1TX8A 4OS2A 1AWHB 1YWUA 2OLGA 1QB9A 1AVWA 2QV1A 3SJ8A 1LO6A 3RM2H 1YCPM 1O2XA 2VWOA 4CR9A 1C1PA 6ESTA 2DE9A 1S0QA 5JYIA 1HAVA 1L4DA 4B2CA 1OWHA 3SI4H 1Y59T 1K1PA 1SBWA 1GMHG 2Y6TA 1VITG 3FVFB 2SNVA 4BXSA 2RA0A 1V2LT 1GHAF 1GDUA 4YXWD 3ODFA 1T7CA 3BIUH 1TGNA 1ELFA 1EASA 1A61H 4QT8C 1IAUA 3SW2B 1MQ5A 3MYWA 3PYHA 1TRYA 2VIOA 2XYAA 2XW9A 4XSKU 1O5FH 3ZVAA 3KEEA 1UK3A 1GWAA 2H9HA 3UOPA 3KNXA 2PSXA 3A7XA 4TT3D 2Q6FA 1LHEH 4UFGH 2BLOA 2ZGJA 5J4SA 5JB9S 4FUCA 1FY1A 4O3UA 1MQ6A 5C67A 3OFND 2W3IA 1Z8IB 3UAIC 1GCTC 1K2I1 1L1NA 1E79D 1D3QB 3U69H 2WV4A 2AERH 2FIRH 3P8GA 1TIOA 1FLEE 1FXYA 1FQ3A 2OBOA 5IDKA 4XBDA 2BMGB 1LVYA 4WH8A 1ETRH 3O8BA 3A80A 4WY3A 2NU3E 4HTCH 2BOKA 2GDEH 3MOCA 3N7DA 5EJ1A 3SYJA 2BVRH 4FVDA 4IMQA 5GPIB 4ACAA 2PKSC 5B6LA 2RFKC 2KCOA 2JJ2D 3R0FA 1G32B 1C5QA 3HK6B 2HNTC 2W3KA 1TOCB 1AE5A 1O2RA 1C2LA 2DE8A 1J8AA 3ZZ9A 1MZDA 2C8YB 3SHAH 1PPZA 2ZGXH 4B76A 3TU7H 2PHBA 4I8JA 3GDVA 4B1TA 4CH8B 2WYJA 2A5KA 2C8ZB 3BEUA 3M5MA 4CHAC 1VJ9U 1C1UH 2Q6DA 2ZU3A 3MFJA 5C5OA 3Q76A 3A86A 1W2KH 2QA9E 1KXEA 1OWDA 3GY6A 2CK3D 3BTEE 1YM0A 1O33A 1XMNB 2KAIB 2H9EH 3GDUA 4OS1A 3SZEA 4BOHA 3NWUA 1FZZA 2OD3B 4AORA 1YKTA 3NKKA 3A8DA 1AN1E 1O2SA 3ITIA 2VB0A 1V6DA 3I77A 1UO6A 2BB4A 2ZP0H 4ZMAH 1P12E 1H8DH 3PB1E 2XCNA 2K8IA 1BBRH 1ZJDA 4Y8ZA 2SFAA 5BPEA 3SNCA 2P93A 5L30H 1GJ6A 1UTPA 2W26A 2BD4A 1O2NA 3N7OA 5L2ZH 1OWIA 1O3OA 3LU9B 1GG6C 1L4ZA 3TH3H 5T6GA 2A4RA 3MO6A 5EJZA 2ESTE 5L2YH 5GIBA 4CRDA 1W3CA 3MH5A 4Y6DA 3ATWA 4UFFH 3U28C 2ZNKH 1BCUH 1TNLA 3G01A 1OYQA 2AGIX 1P57B 2P94A 3A84A 1HNEE 1K22H 5DN6D 1LHGH 1CT0E 1GDQA 5IYTA 4FUGA 4INKA 3UIRA 4ISIH 1UMAH 2UWLA 2AMPA 3MU4A 1K1MA 4DIHH 4FUFA 3IWMA 3PLKA 1O2WA 4ZHAA 4IC6A 4BTIB 1NRSH 5EXMA 1DXWA 3GY4A 2OP9A 1PPHE 3SGQE 4KTCA 3MNSA 1D3PB 3A85A 3EAJA 3T25A 5HIZA 1A46H 3KHVA 1AUJA 2ZGBH 4TWWA 1PPBH 4OS6A 2DUCA 1XKBC 1P3CA 1ELTA 1YBWA 2W7UA 1Q3XA 1EUFA 3BTQE 1E1RD 3SV9A 1P06A 2C90B 4NWKA 4FVBA 1EPTC 5FCRA 2ZTYA 4ABBA 1TMUH 1FAXA 5HIYA 1QQ4A 2AMDA 2IPHA 1V2WT 1LVMA 1GJ4H 3K6ZA 3F1SB 1C5MD 2WPLS 1O5EH 2CHAC 3CS0A 3UPEA 1SLVB 1N1LA 4NZLA 4K1EA 4KKDA 3GY5A 1NBME 2VH6A 1FDPA 2L74A 2UUKB 7KMEH 3UWIA 2VWMA 4CRGA 1E36B 1TLDA 3DUXH 1LTOA 1GHAG 1C9TA 1TOMH 1YPEH 2G52A 1C5YB 2HNTE 4ZKNU 1IQFA 3QWCH 1GCDA 3T5FH 3DCLA 2F9PA 3AAVA 3PTNA 4TY6A 2BLQA 4UEHH 2XWBI 3OAAD 2GJGA 1H8IH 2WPKS 2G8TA 1F0TA 1GBAA 1DY8A 3MU5A 1WQSA 4K60A 4AYVB 3B23B 2VIWA 1BB0B 1Z71A 1G3DA 3DHKH 3HKJB 4JZ1A 3RC4A 2C8WB 1EPTA 4Q7XA 1UTLM 3LH1A 4BANB 5A0BA 1TGCA 4WJG2 1A0LA 1ZOMA 5CDFE 3RXTA 1P2MA 1SOZA 2O8TA 3RXQA 1X7AC 1Z8JB 1N6XA 3TGIE 2UUFB 3GY2A 3RDZA 4CRCA 1G30B 5C5NA 5A09A 1AFQC 2BD2A 2QE7D 1F92A 4MPWA 2FOCA 3T62A 1PPEE 4F48B 2QF3A 4NZQA 1J17T 4KP0A 3UR6A 3S7HB 1CT2E 4B75A 3WWFA 1T8MA 1ANCA 3A7VA 3SU5A 2FI4E 2ZQ2A 4U01A 3QO6A 1BHXB 1CHOF 1CSOE 1O5AB 4F49A 1C2IA 4IMZA 5ABWA 4JYUH 3RXEA 4X1QU 1AHTH 1FI8A 5FBIA 4Y8YA 3RLYH 3E16B 1LHFH 2C3SA 1OX1A 4FU9A 1TNJA 1E35B 2BDHA 1C5XB 4Z1MD 2V7QD 4R8TB 4X1SU 1DM4B 1K1JA 2FO9A 2Z9JA 2BY8X 4MDSA 5F03A 1DITH 6LPRA 4YT7H 2ZPSA 3RU4E 4ABHA 4B73A 2ALPA 5E2OA 9LPRA 4X2VA 1DWEH 1G9IE 2B5TB 3O8CA 3VXFH 1XXFA 3F0PA 4K3JA 3D23A 1P0SH 1GI0A 3M61U 3RXDA 3OU0A 2R0LA 1A7SA 2BD5A 5G4BA 3MU8A 5HYOA 1SQTA 3A8AA 2BHGA 1RXPA 3OSYA 2F3CE 1TBZH 5E0GA 2G55A 3PMJA 4X6NA 4X0WU 3CS7A 1ZZZA 1BMLA 1NFWA 1GJ5H 1BTUA 4AX9H 2JKHA 4U30A 3VB4A 1BMAA 2Y5FA 2EA3A 1WQVH 4CBOA 1C2HA 2ANYA 4YM9A 1HYLA 2KR7A 3A7WA 4GHQA 4WVPE 2VGCB 4AN7A 3MWIU 3ZVCA 1C5UA 1N8OC 2VBCA 5EXNA 3ATIA 1HJAC 3EQ0H 1NS3A 2HLCA 3GDSA 3RLWH 1SGQE 2ANMH 1IQHA 1HJ8A 1WXRA 1C2KA 5C94A 1EQ9A 5DJ7A 5F6MA 3PMBB 1K1OA 2FOMB 4A7IB 5LPRA 2VVVA 3NZIA 4Z0KA 3TVJB 2GX4A 3HGPA 1VKYA 1SMFE 2STAE 4MQAA 2QY0B 2AH4X 3WY8A 4NCYA 3ZZAA 4O9VA 5DPAA 2ZFQH 5GDSH 1K0HA 4ASUD 1GHWH 1GVZA 1F0RA 1A5GH 2M5TA 3A7ZA 3A8BA 1M9UA 1KDQB 2BD9A 4X1PU 3ZV9A 2HRVA 4ASHA 1RTLA 1OSSA 3LJOA 1XUFA 4GPGA 1K1LA 2O8WA 1SFIA 2ZPQA 1ETSH 1NRPH 3KL6A 3E0NB 2YMSB 1FN6A 1GJDB 3OEED 1DANH 1SC8U 2FOBA 3LPRA 3SI3H 1NTPA 5IK2D 3S9BA 1LHDH 2A31A 4X2WA 5E0HA 5CHAB 1ZJKA 2B7DH 3QK1A 1HAOH 1EAWA 4YLUA 5ESTE 2BY6X 2YOLA 2J34A 1AGJA 3D65E 2VWNA 3LGWA 5GXPA 2VIQA 1JOUB 1S6LA 2ZCLP 3TH2H 4VGCC 3WWBA 1Q31A 1XUGA 3NK8A 1E37B 2I6SA 1GJCB 3VG8A 1B5GH 4OS7A
chains in the Genus database with same CATH topology
1FIWA 3EDXB 1ELCA 4XE4A 5A0AE 6CHAC 1ELVA 1RS0A 2JH6D 2ZTXA 2Q6GA 3PMHB 1L0ZA 3BN9A 1BTXA 1SGEE 2VH0A 2WV5A 5DP7A 1DXPA 1ELBA 2EI6A 2PFEA 3E8LA 5DG6A 3SU3A 1UVOA 3A8CA 3PM3A 4IC5A 4D9QA 1DY9A 2GVFA 4FUBA 2R0KA 5C20A 2J9NA 4AZ2B 2ZHDA 1O2KA 2Y82A 4NIXA 2BDCA 1OP0A 1UK4A 1UTJA 1WU1A 4UDWH 3ZVEA 3RXBA 1LVOA 2PTNA 1C5VA 2BY5X 1BTYA 3A7YA 1P9SA 4OS5A 1WOFA 1KXAA 1J14A 5AVDA 5EXLA 1HBTH 1TPAE 1TA2A 4K1SA 4ESTE 8LPRA 3RC6A 1KXCA 5LPEA 4YOIA 2ZZUH 3UNRA 3DT0H 1CHOG 2D26C 2Z9KA 1KXFA 1UK2A 4I32A 4FUDA 4ABGA 3M36A 1TPOA 3ZZ5A 1AB9C 1VCWA 2AEIH 1P09A 3SV6A 2FPZA 2ZHWH 4Y10E 1PPCE 2A2QH 4JK6A 1QBVH 1S0RA 1TNKA 2Z9LA 4Y11E 4IN1A 1HAHH 1ESAA 1K28D 2ZGHA 1MU8B 1JBUH 2CF9H 2ILNA 1WUNH 1NC6A 3PO1B 1S6HA 1GI7B 2QIQA 3RXRA 2ZIQH 3OY6U 5EODA 1P2JA 3VGCC 4DOQA 4ZKOU 1UCYE 1H9LB 1N6YA 4E05H 3ZZDA 2PUQH 2BM2A 5C2ZA 4GAWA 1GBLA 5GCHF 1A5IA 1OKXA 7ESTE 2HGTH 4KGAA 1AY6H 1GVKB 3S9AA 4ABAA 1CHGA 3EYDA 2QXGA 2XWAA 1GBCA 2GZ7A 1HXEH 1YPKH 1D6RA 1JWTA 1V2JT 2AYWA 1O3AA 5HM2A 3Q3YA 3E91A 1NFYA 2ZDMA 1ELDE 1P2OA 1A3BH 3ZZ4A 4GSOA 2ZQ1A 3P8NA 1UHBB 2H1UA 4XFQA 3M5OA 1QY6A 3LGVA 3IITA 1KYNA 1MZAA 1NRNH 1OOKB 3GY7A 2OC8A 3SO3A 5E0JA 1DVAH 5TCAA 1IQEA 1O32A 2PW8H 2V3OH 2C93B 3RM0H 4CRBA 1C5ZB 3QZRA 3TH4H 1WTHD 1F0SA 1TQ7B 1G3EA 1INCA 1DPOA 3SUDA 1O3GA 3URDA 2UUYA 3TPIZ 2V0BA 1THRH 2TGPZ 2QC2A 3P70B 1IOEA 3U98H 1UTNA 4WF8A 1Z8RA 1ZRKA 3MO9A 2CGAA 2ZI2H 1BTWA 1ZMLA 4Y8XA 2R2WU 3LDXH 3W94A 4ABDA 1BIOA 7GCHF 1DT2A 1MKWK 3O8RA 2BLWA 2A5AA 2BD8A 3RMLH 3M7QA 1KLTA 5F8TA 1O0DH 5TJXA 1Y5BT 2FESH 5DP5A 3GCNA 1MKWH 2ZHFH 3QN7A 4UFDH 1O2MA 2PUXB 1O3MA 2ZU5A 1A4WH 2ZHEH 5B6OA 2CV3A 3E90B 5F8XA 4A6LA 3URCA 1ZMNA 5FXLA 1THSH 1TNGA 4AYYB 2BX3A 4K69A 3BTWE 1S6FA 1GDNA 2ZDKA 1PQ7A 4TPIZ 3ZZ6A 3FFGA 1OPHB 2QXHA 1QL9A 1O2QA 5E8EH 1YPHE 1T8OA 3M37A 1CA8B 5C1YA 3A83A 1C2MA 4AFUA 4YOJA 2AFQB 3T27A 1EZSC 1V2NT 1Y5UT 3NUMA 4H4FA 2GKVE 4YZUA 1DE7H 1LHCH 2SGFE 4IW4E 5FPSA 1O3PB 1GBTA 3RXFA 2TIOA 4A92A 1P2KA 1GHBF 2V35A 3TK5A 3M3VA 2TGAA 3M5NA 3P17H 3STJA 3SNAA 1GGDB 1SLUB 1MBQA 3EA9A 1MTNB 1XUHA 1S83A 2P95A 3M35A 4NA8A 1P9UA 3PMAB 1IQIA 2FS8A 2PGBB 4Y79A 1VZQH 1O2HA 1QBOA 1W14U 3A89A 1GL0E 2G4TA 4MPUA 1BBRK 1XM1A 2O9QA 2Z3EA 1HRTH 1HPGA 4ABIA 4D76A 5A2MH 1CGIE 2EEKA 2SNWA 1SGIB 4JK5A 3VB7A 3U8RH 4Z6AH 2J94A 4ZHLU 4DIIH 2ASUB 1O3HA 1EP6A 5T6DA 4ZHMU 1HAPH 2UUJB 3P8FA 2ZTZA 3PLBA 5FCKA 1W8BH 1DDJA 1Y3VA 4BAHB 5EW2H 4AFSA 4DT7B 3ZYEA 3KCGH 2VNTA 1ESBA 4AFZA 1ZSKA 1GJ8B 2JETB 3EA7A 1C1NA 1EATA 3MMGA 4JYTA 1OXGA 2D2DA 4ISHH 1SGPE 1XVOA 2BX4A 1YLCA 1SI5H 2ODPA 3RXOA 1C5WB 2HPPH 2J2UA 4MPXA 4X1NU 2OTVA 2VVCA 3ZZBA 3OYPA 1ZGVA 1Z6JH 3TGKE 1SGCA 5FHTA 5GCHG 4ISLA 2XC4A 2ZGCA 1O3DA 1RD3B 1YPMH 1FAKH 3RXVA 1QB6A 4DG4A 2ZCHP 4A1TA 4WMEA 1AO5A 5CMXH 1SVPA 1UJ1A 1V2QT 1ID5H 1UTQA 1GBBA 2GMTB 1SQAA 3QTOH 3SV7A 1ELGA 2ZDNA 3RMNH 5HXFA 1AFEH 5DO4H 1JIRA 1ACBE 1DLEA 4UE7H 2P59A 2OCVB 4Y7AA 4E06H 2B9LA 1SGFA 2RCEA 1ZPBA 4AG1A 3MU0A 4RSPA 1GI8B 3Q3XA 3RXIA 1WTGH 2Z94A 3SBKA 2VVUA 3KN2A 3A7TA 4Y71A 4YLQH 5JPMH 1EAIA 1ZLRA 1A3EH 1AIXH 2Z7FE 1XUIA 3MNCA 4XBBA 1Y3YA 3MH7A 2ZU2A 4LZ1H 1JMOH 1W7GH 4XOJA 4OGYA 1SGTA 1XKAC 5LPFA 4X6PA 1OP2A 1HB0B 2G81E 1DSUA 2WUCA 3VB6A 2ANKH 3QGJA 3HKIB 2C8XB 1DLKB 2FEQH 3BTDE 2NU4E 1QBNA 2CJIA 5HMAA 1P03A 1TGBA 5T6FA 1MTVA 7GCHG 3RXPA 1QTFA 1S85A 1EAXA 1HLTH 1PYTC 3VB3A 2YNBA 5GWZA 2BQ7B 3STIA 1JIMA 3LGUA 1MTWA 2XC0A 1IQJA 2OINA 3ATMA 5C1XA 1HDTH 2OQ5A 3RU4T 1TNHA 2ZDAH 5JDUB 3FP7E 1F5KU 1QGFA 3V13A 4WXVA 5AHGH 1EB1H 3SU2A 1D3DB 1SGFG 1JRTA 2KAIA 1OYTH 4HFPB 1C1TA 2ZCKP 3R3GB 1O2JA 4H42U 1O3JA 4X2YA 3FP6E 1VGCB 1O2OA 1Q2WA 2C4FH 2JH5D 1L1GA 1P01A 1PPFE 2OC7A 3LGIA 4DW2U 3FZZA 1NROH 3FP8E 1C2JA 4Q80A 4O3TA 4GUXA 1FMGA 1HIAB 3GYLB 3RXAA 1RTFB 2P3TB 2YNAA 2ZDVH 5LGOA 5DK1A 1FPCH 2PV9B 1TMTH 2AGEX 4WWYA 1GBFA 1GBJA 1BA8B 1J15A 2Y81A 3P6ZB 3HPTB 3D49H 1GHBG 4NWLA 4AB8A 4YT6H 2ZPRA 1BHXF 4MNVA 6GCHF 1Y3XA 4B2AA 5TCCA 5C3NA 1LMWB 3K65B 1FJSA 2R3UA 4ZH8A 1P11E 4NSVA 4WMFA 1DOJA 3HK3B 3LIWA 1F2SE 1KY9A 2ZWLH 1C4Y2 2HVXA 2OC0A 3M3TA 1P10A 1A0JA 3LC3A 4D8NA 1EOJA 1WAYB 2XBYA 4THNH 2ZA5A 4OS4A 1Y3WA 3S7KB 1W11U 2FTMA 3V7TA 3EA8A 3SJ9A 1Z6EA 3ATLA 5I46H 1SHYA 1WBGB 2P16A 1D3TB 3QTVH 4A1VA 1CA0B 1TYNA 1QRWA 3SQHE 4YO9A 1QJ6B 3TK9A 2BY9X 2PKAB 1CBWB 1DWDH 3UR9A 5DP4A 1V3XA 2XCFA 1SGDE 3DA9B 1C4U2 1VCPA 3U9AH 2A4GA 2A5IA 1EJAA 4YESB 1O3BA 1XXDA 4BTUB 4KTUA 2D1JA 5EU8A 2J4IA 1HXFH 8GCHF 5DP3A 2CMYA 1ANBA 1EX3A 3MTYA 3BTGE 1RIWB 1RFNA 2BXTH 2ZECA 4MPVA 4CR5A 2FTLE 2P8OB 1NRRH 1IQKA 1ZYOA 1YPJH 1O38A 3GCHB 1UVUH 4X2XA 2FS9A 9ESTA 4J2YB 4FUIA 2BOHB 4X1RU 2FZZA 1PFXC 1GJAB 3KF2A 1HGTH 2RDLA 1ZTLA 1F0UA 1GI9B 2G00A 1FY3A 1ETTH 1V2TT 1EAUA 2EI7A 3T2NA 1Y5AT 1GVLA 2ALVA 3VEQB 1DWCH 1NN6A 1YLDA 3LC5A 1K1NA 4DURA 3A81A 4I8LA 1O3KA 2AS9A 1O39A 1YF4A 2BTCE 4AGJA 4HI3A 2FI5E 3SUEA 5ETXA 1TWXB 1XX9A 3LT3A 2V6NA 4BTTB 2ZEBA 1P8VC 1GPZA 2IOTA 3K6YA 3QDZB 1SGNE 4XDEA 2HPQH 1GL1A 3PWBA 3UUZA 1KIGH 2BXUH 3TJOA 3SZNA 3MI4A 4GVUA 1FY8E 2FOGA 1EJMA 1GHYH 4ISOA 1O3EA 1IQMA 1L2EA 1V2UT 1XUJA 1O36A 3ZYDA 3T26A 1QR3E 2BDIA 1HAVB 2FOEA 5F8ZA 3E6PH 1ARBA 3M3SA 1P02A 4RKJB 1HJ9A 2ZKSA 1G2LA 1O2UA 2F9VA 2Y7ZA 3AW1A 5A8ZA 1BOQA 1KLIH 1GBMA 3SJOA 1O31A 1ORFA 3LKWA 4MVNA 1MD8A 5DKMA 1O34A 1EXFA 2XRCA 2QYIA 2TGDA 5T3HA 1O2TA 4E7NA 3TGJE 3S69A 1SB1H 1G3BA 2AIPA 1T31A 1ZRBA 3U1JB 2TGTA 1EJNA 2VGCC 3P8OA 2EI8A 1C1MA 4UFEH 1TMBH 3S9CA 2GT7A 1DICA 3AAUA 1B0EA 4X8TH 1A2CH 1QNJA 3UWJH 3QUMP 1J9CH 1B7XB 2P3FH 2THFB 1V2VT 1C5TA 1MMJN 4B74A 3TK6A 2J95A 1FN8A 2P8OC 1BRBE 4M7GA 3I29A 1AD8H 3VB5A 1AI8H 1GJBB 2FOHA 1TABE 3GCHC 1KLJH 3LH3A 3RMOH 3TJVA 1PYTD 1AKSB 1RJXB 3PWCA 2XBWA 1WCZA 5AFZH 2Y7XA 3C27B 3EGKH 1BJUA 1P3EA 3NXPA 3MNBA 2NU2E 5DP8A 1DSTA 4HZHA 2PKAA 2AGGX 2BYAX 3SJIA 3TJUA 6GCHG 3OX7U 3UQOA 4X8SH 1TGTA 2FX6A 4X8VH 2FYRA 1A0HB 1FY4A 2SGDE 1EZQA 3RXUA 2XXLA 2GTBA 5CHAC 1J16A 3RMMH 4GCHF 3QGNB 2FOAA 3CENA 3EE0B 1GCTB 2WPHS 4AG2A 2BZ6H 4WH6A 2FDAA 1BTPA 1GMDF 5CE1A 1P05A 2GD4B 2ZC9H 1O2IA 3SQEE 3LONA 1VITH 1D9IA 2ZDLA 4ZXXH 1O3FA 3KIDU 4ZXYH 2XC5A 4X6OA 2G4UA 1GI5A 1O5BB 4AOQA 1C4V2 2VJ1A 1SGYE 2PKSB 1KDQA 1ZPZA 3SHCH 4F4OC 1GMCG 3K2UA 1LDTT 5EQRA 5L6NH 2G51A 5EG4A 1G3CA 1EP5A 1DUEA 4JZIA 4TYDA 1W10U 1NFXA 1SGRE 8GCHG 1TBQH 3ZZ3A 4DCDA 1C2FA 3SNDA 1C2GA 1K1IA 4BAMB 4CHAB 2H5CA 4Y0ZE 2BQ6B 5EQQA 3SV8A 4NIWA 1GJ7B 1H4WA 1GI2A 3VFEA 1UTKA 4D7GA 4MG3A 1UTOA 2Z9IA 1TE0A 1G37A 2GZ8A 3F9GA 3T28A 1EB2A 3PV4A 1FIZA 4Y0YE 4LZ4B 1PQ5A 4CRAA 3F6UH 3OY5U 3GCTF 4AGKA 3KQEA 1SR5C 4UD9H 1BDAA 2OXSA 3BSQA 2TRMA 2D8WA 1LKAA 3U1IB 4H6SB 2GGVB 3UFAA 1BT7A 3SU1A 1THPB 3K9XB 4JZEH 2A7CA 4I7YH 2QXJA 1WV7H 3GCOA 3SORA 1GG6B 2O8LA 3BV9B 3H5CB 4DY7B 5J4QA 3JZ1B 4I8HA 4SGBE 1PQ8A 3H7TA 4MLFB 1H9IE 1GBEA 1TRNA 1GBIA 1C5NH 5DGJA 1NRQH 1QJ1B 2F83A 1BZXE 1T4UH 3PO1C 2O8UA 4FU8A 1A5HA 4NFFA 2BZAA 5EQSA 1HAIH 3BTTE 1T8NA 4X6MA 4K2YA 2A2XH 4HGCA 4JZFH 2A7JA 2XBVA 2F91A 1HV7A 1E34B 2GZ9A 3UOUA 1SPJA 4CREA 1AKSA 1OWJA 2K1QA 1ELEE 2QGRA 5C1UA 4U2WA 5GJ4B 8KME2 3GOVB 4U32A 1TX6A 1S5SA 1FY5A 1CE5A 2FP7B 2VIPA 1TFXA 2QF0A 3F9HA 3SOSA 2EC9H 5DP9A 3SU0A 4ZROA 2FLRH 2LPRA 1BTHH 2H5DA 2RA3A 3SJKA 3F9EA 3PROA 1V2KT 2J38A 1EPTB 4Y76A 2NU0E 1ANDA 2BD3A 4AB9A 1HAGE 3VXEH 3H7OA 1AVGH 3BTKE 1SQOA 1CO7E 3AASA 2AIQA 1EZUC 2CHAB 2VWLA 4FUJA 4LXBH 3SNEA 2CN0H 2LNCA 2ZFRH 4IN2A 4ABFA 3UNQA 1GI1A 1CGHA 5AFYH 4CH2B 4YTAA 4FUHA 4GHTA 1JXPA 4INLA 1O5CB 3U8TH 1GI3A 1ZSJA 2HOBA 1H9HE 4NG9H 4K8BA 4ABEA 1L1JA 1DFPA 3M7TA 5A0CA 4ZAEA 1C1RA 3QX5H 1CVWH 5BRRE 5ESBA 4ABJA 4BXWA 1ZTJA 1DX5M 5FPYA 3AW0A 3MH6A 3RP2A 1O3LA 3Q77A 3SV2H 1AZZA 2G5NA 3HGNA 2GP9B 1NESE 1MBMA 2WPJS 2AMQA 1F5LA 1UHBA 1E0FD 4CBNA 1NZQH 4RKOB 3RXKA 1CT4E 3ODDA 3ZZ8A 1BRUP 1TA6A 4AFQA 4GCHG 3PTBA 2PSYA 2ODQA 4RN6A 2QXIA 4JMYA 2RG3A 1GMDG 1AFQB 2FXRA 2QN5T 2GT8A 1GI4A 1BMMH 2H2ZA 2CXVA 5JBAS 1A1RA 4CRFA 2SGQE 1PJPA 1O2VA 1LKBA 3BTHE 1U6QA 1Z1IA 1AMHA 1CQQA 2HWLB <