3MTYA

Comparison of the character and the speed of x-ray-induced structural changes of porcine pancreatic elastase at two temperatures, 100 and 15k. the data set was collected from region a of the crystal. first step of radiation damage
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin-like elastase family member 1
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mtyA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mtyA01
1GJ8B 2EI7A 1MD7A 1DXPA 2FOMB 1T32A 3U1JB 1XVOA 3QUMP 1BDAA 3GCHC 1FONA 2BLOA 3ZVGA 1DUAA 3BTQE 1EPTB 3LT3A 2QIQA 1VCWA 4BAKB 4JZ1A 3QZRA 3BF6H 5A8XA 1QL7A 1H9LB 5K7RA 2F91A 1XVMA 1ELCA 1QURH 1AVXA 4JZIA 4A6LA 1A3BH 2ESTE 1PPFE 2VIPA 4DCDA 1W7GH 1SGQE 5T6FA 1VJ9U 4HTCH 1GBJA 1C5PA 2ZFQH 3BTTE 1K9OE 2PKAB 2IJOB 1MTVA 1T4UH 2HNTF 1HRTH 4HGCA 3RXDA 1O2LA 1TYNA 3VGCB 4BAOB 1GBAA 2XNIA 1JXPA 3SJOA 1FLEE 2P3UB 1GHVH 4NG9H 3ATLA 2J92A 2H9TH 1HCGA 1T31A 1DWEH 2G4UA 1A0JA 5E2PA 2ZPRA 1O2GH 2ZU1A 1FY1A 1DM4B 2FI3E 1AVGH 3RU4E 1QJ1B 1BBRK 3TH3H 1XX9A 1K1JA 5C1UA 1N6YA 1G30B 2BD5A 2FOBA 1NRPH 1XUFA 3Q77A 1P0SH 1C5SA 1V3XA 1QB9A 1THSH 1A2CH 1UCYK 1GVKB 1ARBA 1CSOE 2BQWB 2BVRH 2FODA 1S0RA 3RMNH 2VGCB 2ZZUH 2BM2A 4K1SA 4X0WU 1SQAA 5AFYH 3Q3XA 1O3AA 4MLFB 2ZTYA 1ZR0A 3G01A 2JETC 2EI6A 2SFAA 1C9PA 1FDPA 1TOMH 3PMJA 2NU0E 4GSOA 2PTNA 3ITIA 5ETXA 3AW1A 1FJSA 1BQYA 2ODQA 1QTFA 5AFZH 2BLVA 1X7AC 2AIQA 1GHWH 4GHQA 1FPHH 2P8OB 3A7WA 1EATA 1MZAA 3VB5A 1GJCB 1GPZA 3PLKA 1RFNA 5E8EH 1OP0A 1MD8A 2A0QB 1KXDA 1BRBE 2BMGB 4Y10E 2GDDA 2BD7A 4AG1A 1QRXA 1AQ7A 1SGDE 1V2KT 3F9HA 1LHCH 1FIWA 1MTUA 1VGCC 4YOGA 4D7GA 2H9EH 2NU1E 4FU8A 4CRAA 2ANKH 1G3DA 2UUJB 2XBXA 3MWIU 1EB2A 1HAXB 1UJ1A 1ZSLA 4UFFH 2Z6BD 1DICA 1TGNA 1OYQA 1ID5H 1C5XB 1Y59T 1GJDB 1YPKH 3SUDA 3HKJB 3TNTA 4FUDA 1MU8B 1YPGH 1ZPZA 4K60A 1TNGA 1SC8U 1JBUH 2BZAA 1LPGB 2BQ7B 1PQ8A 2OC8A 3PLPA 4FUHA 4XE4A 4JYTA 3NPSA 2BD2A 1GI4A 3BSQA 4YLQH 4UFEH 5F6MA 3M5MA 1N8OB 3ODFA 1SGPE 2FOEA 1NN6A 2ZGXH 1ZTLA 1L4ZA 1V2UT 2IPHA 4LZ1H 4K1TA 3RXQA 3TJNA 3GDUA 1O5AB 3QWCH 2WPLS 1GCTB 1O2JA 3Q76A 2OCVB 3NKKA 1EUFA 3ZZDA 4LXBH 2QF0A 2FMJA 1AO5A 1DLKB 3RLYH 1HBTH 1ZJKA 4TWWA 4CBNA 5LH8A 3PMAB 5DKMA 2PLXA 4RKOB 1C1PA 1GL0E 5DP5A 3E90B 1K1PA 2Y82A 2BY6X 2P8OC 4OGYA 1V2JT 3L3TA 1SFQB 9ESTA 3QLPH 2OXSA 4YO9A 6LPRA 1EB1H 1IQJA 3KL6A 5TCAA 4Y79A 2UUKB 3I78A 1G3BA 1ABIH 1IQMA 1TALA 1Z8RA 3QK1A 5DP6A 2P59A 1BRUP 1Q3XA 1AI8H 1IQKA 5TJXA 2TGPZ 3TPIZ 1SVPA 4K8BA 1IQNA 2V0BA 2DE8A 4WXIA 1GMHF 1HNEE 3NCLA 3TNSA 1OX1A 2J34A 3BIUH 3RXBA 1TGSZ 3BIVH 2Y7XA 1GI8B 4Y8YA 1GBKA 3RXHA 4MNVA 4B74A 1LQEA 4GCHG 5JBAS 1O2UA 3FZZA 1WQVH 1CT0E 1RIWB 2HOBA 1P9UA 2C8WB 1BIOA 1J17T 4FVBA 4X2WA 1SR5C 2ZU2A 5J4SA 1CQQA 1GGDB 1PQAA 5CHAB 1GVZA 2B5TB 4TWYA 4WWYA 1AIXH 1FY4A 1N8OC 1EAUA 1SGYE 4ZROA 1Q31A 4FUFA 5AF9H 5EW1H 5HMAA 1KXCA 5A09A 3A83A 2ZDKA 4JZFH 5A8ZA 5K0HA 3A85A 2ZFPH 2A32A 2IOTA 4ZAEA 1GI3A 3T5FH 1GBHA 5F8ZA 4R0IA 2FXRA 1SGRE 1VZQH 3MOCA 2R3YA 6CHAB 5FPTA 4A92A 1KLJH 2XXLA 1P57B 3SUGA 4KTSA 3FZDA 1SI5H 1SGFG 2KAIA 4ABGA 4INKA 2VIOA 4CRCA 3TGKE 4BAHB 1HAGE 2XC0A 1GMDG 3GYMA 5GJ4B 3BG4B 2VWMA 2AFQB 2JH5D 4GHTA 1O5DH 3UFAA 1HDTH 1C9TA 2V6NA 1DWDH 2V3OH 3MHWU 2Z7FE 2EC9H 3KEEA 2W26A 1QCPA 1P09A 1O2QA 2DE9A 1C1RA 1SL3A 4UD9H 1ORFA 1O3CA 3STIA 2F9NA 2PGBB 3BTDE 3UWIA 3NUMA 2PR3A 3TK5A 1EZSC 3T29A 1RD3B 1HAZB 2RG3A 5EW2H 1Z6JH 1GGDC 1CE5A 1DE7H 1IQHA 2QGRA 1SG8B 1W11U 1TOCB 2C4FH 3M3TA 1BCUH 2PSYA 1ETSH 1OWKA 1DITH 3BTHE 3GCOA 3NWUA 4DY7B 1W13U 1CO7E 1G36A 5ABWA 1BOQA 2JH0D 2GKVE 4UFDH 2Y5HA 2STBE 2AMDA 2A4QA 3P6ZB 5C67A 1LHFH 1EOLA 4U32A 1DVAH 3NZIA 1MKXH 2XC4A 3K2UA 5GDSH 1GCDA 2R9PA 2FDAA 3TH2H 3I29A 5SGAE 4DJZB 3VB3A 2J95A 3RLWH 1ZSKA 3P92A 3T62A 3LGTA 5ESTE 4BTUB 4ABBA 3TIUA 3K6YA 1OWHA 2W3KA 4X6MA 1GI0A 3PB1E 1BUIA 1CA8B 1NESE 1GJBB 4AFZA 5H4IB 1WYKA 4D7FA 2FLBH 1ANDA 1O5CB 3FP7E 3S9AA 4TYDA 2QXJA 1BTHH 5TCCA 3LONA 4I8LA 1EASA 2ZHQH 4AFSA 1KLTA 4AYVB 2Y80A 1C5OH 1V2OT 1AVWA 4X6OA 3SN8A 3S7HB 1WTGH 2Z9KA 2JKHA 5AVDA 1NFUA 1BMNH 4H6TA 2FTLE 2VWNA 4O3UA 1O0DH 1Z71A 5FHTA 1TQ7B 2ODYB 4ISNA 1QBOA 1BRCE 2ZO3H 3QGJA 3T2NA 1MQ6A 1BBRH 4UFGH 3A8BA 1QB1A 1EJAA 1N1LA 3SV8A 3EA9A 5T6GA 2Y81A 2A31A 1GI1A 2A7HA 2XBYA 1C5MD 1Z8IB 3E3TA 3GY4A 1O3JA 3EQ0H 1O3OA 4D8NA 1F5KU 3PROA 1XXFA 1KYNA 4GPGA 1O3GA 1O2XA 4MNXA 3UIRA 4I32A 4JZDH 1UVUH 4UE7H 3DD2H 5JPMH 1MTSA 7ESTE 3D23A 1Y3WA 1VITG 4BXWA 1TLDA 1Z6EA 1HB0B 2Z3CA 1RGQA 2ANYA 2QCYA 1FN8A 3TK9A 1O2RA 1EAXA 1FAKH 3RXUA 3E91A 2FS8A 1GDQA 4K3JA 2BX4A 5C5OA 1V2PT 1O5GH 2G5VA 3TVJB 2XC5A 4LOYH 1DT2A 3S69A 4FUBA 1MAYA 2A1DB 2ZHEH 4WH8A 2BD9A 1A5GH 1TA2A 1XUJA 3BEFB 2XCFA 1O3EA 3PMBB 4AB8A 2G5NA 2ZDNA 4ZXYH 4DT7B 4CREA 2CXVA 1P3CA 4ISLA 1DSTA 3SU3A 1S6HA 4YESB 2QAAA 5JYIA 4ABJA 3E0PB 1P11E 2ZDLA 3RU4D 3UNQA 1C2LA 2H5CA 1S82A 4SGAE 1FIZA 2XCNA 2GGVB 1MCTA 1P2KA 3SV7A 3TJVA 2AGEX 1H9IE 1QRWA 3RXAA 2EA3A 1F0TA 1AFQC 2BDCA 3MNSA 2FOFA 1CU1A 3RXRA 1SQTA 4TY7A 1BBRE 2B8OH 2OBQA 4E7RG 3BTME 5EXMA 1AZ8A 3HK6B 3V0XA 2VIVA 1ABJH 2NU3E 2ZQ1A 5HM2A 1J14A 3GCHB 3T25A 1A0HB 1C5ZB 1CT4E 2G8TA 4BTIB 1UCYE 1NM6A 2O8MA 4AN7A 4ZHMU 1NT1A 3RXIA 1BTZA 2XWAA 1VR1H 1P10A 3V3MA 3EE0B 2R2MB 3L33A 1GBLA 4FVDA 4UONA 1Y3VA 2GP9B 1DY8A 4I31A 1HJAC 2ZEBA 2XBWA 2JH6D 1C5UA 1LDTT 1V2WT 4KELA 2B0FA 2A7JA 3IG6B 1UVTH 1AE5A 1RTFB 3LGVA 2F9UA 3W94A 3ZZ5A 4GCHF 2O8WA 1ZSJA 1OWJA 2G55A 3VB6A 2A4GA 2A7CA 5LGOA 2ILNA 2SGQE 1IOEA 2BDHA 1RRKA 4MPVA 3TJOA 1AZZA 1YPMH 4ISOA 5CMXH 2AMPA 4ZH8A 2D2DA 2F3CE 5A0AE 3SV2H 5C20A 1GBEA 2ULLA 1H4WA 3A86A 2TGAA 3GICB 1BJUA 1TX7A 3SGQE 3SNCA 1L1JA 3BEIB 1O3KA 3PYHA 3MU4A 1TONA 5C3NA 2FM2A 4YTAA 1H8IH 1GBTA 2BDGA 4TPYA 3A8DA 1C2FA 1GG6C 1O2NA 1U6QA 3SI3H 2CV3A 4BOHA 5HGGA 2H9HA 2FWWA 1MKXK 2WV5A 2JETB 1TNJA 1C1VH 4Y6DA 3SJIA 3TU7H 2ZFSA 1GJ9B 3ATMA 2G81E 2CJIA 1A46H 1GMDF 3GDSA 1O36A 1LCYA 1SFIA 3SI4H 1ETRH 3ZVAA 2FI5E 2ZG0H 3Q3KA 3SNEA 1D3PB 2SGEE 3MO6A 5BRRE 1SGNE 4IN1A 1MUEB 4MQAA 2HLCA 1XXDA 1B0EA 1BMMH 3SU5A 5JDUB 3RP2A 1XKBC 3TITA 5DK1A 1FQ3A 2Y6TA 2FOAA 1AU8A 1IQLA 4VGCB 1T8MA 1OKXA 1OSSA 3JZ1B 3OTJE 4H42U 1MTNC 5L2ZH 1VGCB 1YCPM 2ODPA 1UO6A 1EZQA 2BXUH 1LVBA 4NA7A 1GHBG 2A4OA 1QY6A 1SBWA 6GCHG 1OP8A 2GX4A 2C8YB 2ZA5A 2C93B 1GHXH 1TMBH 2C3SA 1BTYA 4AORA 4X1PU 1ACBE 5JBBS 5LPEA 1HAHH 2GZ8A 1C1SA 2BQ6B 3A89A 2QXGA 1SLXB 1TRMA 1OP2A 1RXPA 3MU8A 4Y0YE 3A88A 2VB0A 1ANEA 4FUCA 4J2YB 1SLWB 2Z94A 5DP3A 3RXEA 2BDIA 2WUCA 4JYUH 1O3IA 2QV1A 5BPEA 1K21H 3RXGA 2FP7B 2ZFTA 1Z1JA 2TBSA 3ZZ7A 2GMTC 3A80A 1Y3UA 3M5LA 4AGJA 3SJ8A 1OPHB 2ANWA 1BTWA 1YGCH 1CHOG 1P05A 4IN2A 2GD4B 4DG4A 5DP9A 3BV9B 2BOKA 4Z0KA 1GBCA 3ZZCA 2ZU5A 2XRCA 1GVLA 3M3VA 3RC4A 5LPFA 2ZWLH 4E7NA 1FUJA 1YLCA 4VGCC 2ZFRH 2CN0H 1AKSB 3FANA 3Q3YA 4X8SH 2BZ6H 4XBBA 2HNTE 2VINA 3U8RH 2A45B 2V3HH 5I46H 4Y76A 3P8GA 1GI5A 1C4Y2 1KY9A 3ZZBA 1QA7A 1O2KA 2W3IA 4X6NA 5F03A 4XOJA 1F0UA 1K28D 4Y7AA 1O3MA 1E35B 4ABDA 3RU4T 2ZCKP 5FPYA 3RXCA 2P95A 3RM0H 8LPRA 1MCVA 2FS9A 1IQEA 1C5VA 1EXFA 1SGIB 1ZJDA 3UQVA 4E05H 4FUGA 1K2I1 4X8VH 1GJ6A 2YNAA 4DVAU 3ZYDA 6ESTA 4NZQA 4AB9A 4AFUA 1G2LA 3BG8A 2D1JA 2ZCHP 2SGPE 1D9IA 2ZFFH 2Z3DA 5FPSA 2FX6A 4NFFA 1NFYA 1TFXA 1VITF 2VH6A 3P70B 1P2MA 8GCHG 3KNXA 4UEHH 2P94A 1UK4A 3A87A 1ELDE 4Y11E 2QN5T 1E0FD 1GBFA 1EAWA 3MI4A 3Q00A 1INCA 1BMLA 2GV6A 2VNTA 4IMZA 1KXBA 1QHRB 4AGKA 2BDBA 5ESBA 5C2ZA 4FU9A 3A7ZA 2WPMS 1MBMA 1PPZA 4FU7A 4I8KA 2SNWA 1GDUA 3RUOA 5JBCS 3CS0A 1B7XB 1BJVA 9LPRA 1L0ZA 3D62A 3M7UA 1B5GH 1QQ4A 3URCA 1YPHC 2LPRA 1TNIA 3SU6A 2BVXH 1C5QA 4H6SB 2VVVA 1YPHE 1GBDA 1GJ4H 1LMWB 1W14U 4RKJB 1UTPA 3C1KA 3U1IB 3TGIE 1SB1H 1GHZA 3B23B 5C5NA 2BYAX 3PLBA 1GHYH 1KDQA 2PSXA 2BY7X 1ESAA 1HXFH 4PROA 4CH2B 3LGUA 2UWPA 4GAWA 2VWLA 1Z1IA 4WJG2 2G4TA 3ATKA 2GT7A 2PUQH 1O2WA 5EXNA 1UHBA 3HGNA 1F92A 4MPUA 3UOUA 3LGWA 3GCNA 5FBEA 1TBQH 1C2HA 3UNSA 2QY0B 1K1MA 1O2HA 1ZOMA 2QF3A 5A0BA 5EU8A 1QJ6B 1NPMA 1FNIA 3GY8A 3P8FA 2F83A 4B76A 2XWBI 4WXVA 1C2GA 4O03A 1CBWB 3D49H 5DJ7A 1A5HA 2OTVA 1HPGA 1JWTA 2BD8A 1XUKA 2I6SA 1F5LA 3RMMH 1HIAA 4JK5A 1ELVA 5F8XA 1ZYOA 2AERH 1FPCH 2HPPH 3V12A 1HGTH 4B2BA 1QA0A 1C2IA 1P8VC 2FX4A 4I8HA 2ZGJA 5FCRA 3BTGE 4MNWA 3GY3A 1THRH 3A7TA 3GY5A 2QA9E 1TBRH 4WF8A 4CH8B 3C27B 3GY2A 1O3HA 1W7XH 4NSYA 4X1QU 1W3CA 2D26C 3S7KB 5EPYA 3MMGA 4UDWH 3DFJA 3OSYA 2BLWA 1CVWH 3LIWA 2G51A 1G32B 3A8CA 1DX5M 2OD3B 1D3DB 4IMQA 1UTQA 5A2MH 4ISHH 2CGAA 1YPLH 2HRVA 1YLDA 3DUXH 3ZZAA 1W10U 2ZPQA 2BOHB 2XBVA 5E2OA 3SJKA 4B71A 3ATWA 1C5TA 1QR3E 1ZTKA 1Y5BT 4AFQA 2WPJS 1TGTA 4D76A 1LPZB 1YKTA 2ZGBH 4Y8ZA 1DS2E 1S0QA 1ZHMA 1F2SE 1LVOA 3SO3A 3UTUH 2AGGX 2BVSH 1P9SA 4JMYA 4R8TB 1MKWH 5L6NH 4Z6AH 2O8LA 3S9CA 1CBWC 1C5YB 2CMYA 2FYQA 2Q6FA 3VPKA 5J4QA 3OY5U 4BNRA 3U98H 1BB0B 2QYIA 1HUTH 2M5TA 3ZZ6A 2I6QA 2H6MA 4MPXA 1UTLM 2WINI 4YM9A 3D65E 1ELBA 4XSKU 5B6OA 3BTFE 3ODDA 1T7CA 1O39A 2ZIQH 1VCQA 1TPAE 2STAE 3T27A 3MNXA 1KIGH 1GHBF 1TB6H 4HFPB 3RXPA 3SU1A 4THNH 2CF9H 1TPOA 2ZKSA 2CF8H 1ZMLA 1EAIA 3K6ZA 1EKBB 3ZVFA 3SBKA 3M3SA 1YBWA 3ZVEA 5GCHG 3DFLA 1O2OA 2DUCA 2ZPSA 3GCTG 1C2MA 1C4U2 1T8LA 1YCPH 1NZQH 4RN6A 5PTPA 1BRAA 1CHGA 2F9PA 1E38B 2HVXA 1O30A 1O38A 2VU8E 1LTOA 2PUXB 2RDLA 2B9LA 8ESTE 2IN2A 3SORA 1AFQB 1C5WB 3V13A 3AASA 3QO6A 5FXLA 1AE8H 3N7OA 1S81A 1C2JA 1QQUA 1TA6A 1O2VA 1L1NA 1O3LA 1CT2E 1PPEE 1O3PB 2TPIZ 7KMEH 2W7SA 1SHYA 2SGAA 1V2QT 2FZZA 1Z8JB 3BEUA 1RS0A 1MMJN 1CHOF 1S5SA 4RSPA 1DANH 4ZHLU 4K2YA 2VWOA 3UQOA 2V35A 1THPB 1YC0A 2AS9A 2FI4E 1DLEA 2ZNKH 1UMAH 2BLQA 2BHGA 3KIDU 1GBBA 4MDSA 3M7TA 3UPEA 4JK6A 3TGJE 3SW2B 1RTKA 1W2KH 1UTOA 3TK6A 1OWIA 1HAVA 2CHAC 1HJAB 1ZRKA 1QIXB 1H1BA 3DT0H 4A1TA 5JB9S 1SMFE 4Y8XA 1GMCG 1UVPA 4BTTB 2YNBA 1Z8GA 2VIWA 3SZNA 2ZU3A 1LHGH 4X8UH 2Y7ZA 4D9RA 3U8TH 5GWZA 2NU2E 5L30H 2P3FH 3LGIA 1PQ7A 2H1UA 3O8DA 3QTVH 1KXAA 1JMOH 1A61H 1YF4A 3RM2H 3M61U 3AW0A 3RXVA 1CGHA 4TY6A 1S83A 1V2TT 4ABAA 1HAIH 3ZVBA 2PGQB 2QXIA 4MVNA 4ZHAA 1DWCH 3EGKH 3VB4A 1P2JA 8GCHF 4ZKRU 1HV7A 2R2WU 2GCHG 1E34B 1E37B 2Z9LA 5E0HA 4U30A 3JZ2B 5EQQA 2A5AA 1GG6B 4YT6H 4Q80A 3MH5A 4XDEA 3ESTA 2FO9A 2W7UA 1F0RA 3GY7A 2G52A 1N6XA 2R0LA 1SSXA 3EA8A 5T3HA 2VVUA 3GYLB 4X2XA 4IC5A 4YLUA 1C5NH 3V7TA 1FMGA 1Y3YA 3PWCA 4OS7A 3URDA 1O3NA 1W0ZU 4CHAC 2J94A 2W5EA 2ZDVH 2OUAA 1PFXC 1O2YA 2C90B 1HJ8A 2BTCE 5CE1A 1T8OA 5FCKA 1JRTA 1QBNA 4NWKA 5JBTA 2AGIX 1WSSH 1BHXB 1EOJA 4IW4E 1SGCA 1AN1E 1W12U 3ZVDA 1A5IA 3P8OA 4DIIH 4XFQA 1UK2A 3VFEA 1IQFA 5JB8S 2BY8X 1Y3XA 4ABIA 2TRMA 3R3GB 2PTCE 1C1WH 4KTUA 1CGIE 3PTBA 1MTNB 3VXEH 2PFEA 3LU9B 3RXKA 1FY5A 4BANB 3F6UH 3SUFA 2QXHA 1GJ7B 4NA8A 4FUEA 1JOUB 1P03A 3PO1C 5L2YH 1QL8A 3A82A 2OBOA 3U69H 1BT7A 1UHBB 3O8RA 4ISIH 2FOCA 2VH0A 3AAVA 1ZGVA 1SOTA 4AG2A 5EPNA 1MKWK 5FX6A 3SJ9A 1FV9A 5GIBA 4O97A 2BDYA 1LVMA 1UVSH 2O8UA 4X1RU 1NU7B 1D6RA 1KLIH 4WMEA 1JRSA 3E1XB 4FXGH 5FBIA 4I33A 1HIAB 4CRBA 4CRFA 1ESTA 1NC6A 1AB9C 1BTUA 2KAIB 4ABHA 4IS5A 4B1TA 1LKBA 1OYTH 1O35A 1FI8A 3A81A 4OGXA 1ZPBA 2QC2A 3QX5H 4CR9A 3O8BA 2BXTH 2OQUA 2BDAA 2FIRH 4INHA 1EP5A 3NXPA 1JIMA 3AAUA 1AHTH 4MNYA 5DG6A 2GMTB 1AUTC 1K22H 4XBDA 4CRGA 1V2RT 4JYVH 3UY9A 1HFDA 1O3BA 1OWDA 3PM3A 1XUIA 1K1NA 1TMTH 3UR9A 2WYGA 1QJ7B 2A5KA 1LPKB 3F9FA 1P2NA 4DOQA 1O33A 2GZ9A 4ABFA 1GI7B 1VJAU 1WOFA 1NRQH 3MH7A 1YCPK 1W0YH 2R3UA 5GPIB 3KCGH 1Q2WA 1BTXA 1O3DA 3KQBA 3RMOH 1HYLA 3MU1A 2Z3EA 5DP8A 1UTJA 1C1UH 4OS1A 4F4OC 3NK8A 5E0GA 3CS7A 3ZYEA 2WPKS 1T4VH 1YPJH 1C1TA 3ZVCA 1ZGIA 1P2IA 2GVFA 3F9EA 2PKSC 5FX5A 3RXTA 3I77A 3W95A 1TNLA 4NIWA 1LKAA 1DOJA 3ZZ9A 1ETTH 3OYPA 3F9GA 3AVZA 1WCZA 1P2QA 1WAYB 3LOXA 4FUJA 3TH4H 1P01A 4BXSA 1TPPA 1QGFA 1FAXA 1PPHE 4KGAA 3ZZ3A 3QN7A 2XW9A 3KQCA 1SOZA 1S84A 1WBGB 1AGJA 2ANMH 1J16A 1DUEA 3RC5A 1LHEH 5E0JA 2PW8H 4Q2KA 5A8YA 3MO9A 2SGFE 3PV4A 1EPTC 4ASHA 1ARCA 2J4IA 4X2VA 1V2ST 1DSUA 4YOIA 2ASUB 1S85A 3IWMA 4O3TA 2HNTC 2D8WA 4DGJA 1PPBH 2BY9X 3ATIA 3E16B 5GCHF 4WY3A 3T28A 2TIOA 1L2EA 3FFGA 3QTOH 4JZEH 3TLOA 2A4RA 2EI8A 3GCTF 4AOQA 2BD3A 2THFB 3P17H 3MU0A 4OS5A 1M9UA 1HXEH 3QZQA 7GCHG 1P02A 4MG3A 3UUZA 3BTWE 1L1GA 3KF2A 1UTNA 1FZZA 3L6PA 5HYOA 2AIPA 2Z9IA 4K1EA 3LH1A 3FP6E 3VGCC 5EQSA 4WMDA 3LC5A 3RXFA 3DA9B 1ANCA 2B7DH 2J9NA 3OX7U 1IHSH 3OY6U 4IC6A 1CGJE 3IITA 1BTPA 1ZHRA 1TBZH 4WH6A 1TX6A 3MU5A 3LH3A 7LPRA 1EZXC 2OINA 1BITA 3RXMA 1O2SA 4NGAH 1DFPA 1G9IE 3E8LA 1TGBA 4H4FA 1VITH 1TNHA 2SNVA 1TNKA 1EP6A 3MH4A 1O5FH 1SHHB 1HAVB 5A0CA 2VGCC 1ANBA 1FY3A 1FXYA 1KTSB 1GI6A 5DGJA 1GMCF 1GBIA 4MTBA 4X1NU 5EOKA 1DDJA 1C1NA 1C1QA 1TE0A 1H9HE 3KQEA 5EG4A 1MZDA 4BAQB 1UVOA 4Y7BA 2ZQ2A 4K5ZA 1F7ZA 3ZZ8A 1NRSH 1ELGA 3GOVB 2ZHDA 1OXGA 1WV7H 4HI3A 1Y5UT 1ZPCA 3HKIB 4X6PA 2XYAA 1P04A 1GHAG 2ZCLP 3CENA 1S6FA 2F9VA 2GCTB 2AH4X 1DWBH 1EJNA 1C2DA 1IAUA 2YOLA 3FVFB 3HATH 3OU0A 1NY22 3EYDA 1LHDH 1XMNB 2AYWA 1AWHB 1IHTH 3GY6A 1F5RA 1SLUB 1FY8E 1J8AA 1OOKB 2GCHF 1A7SA 3B8JA 2ZDMA 4I8JA 1GL1A 3LPRA 2BY5X 1C1MA 4NA9H 1ZMNA 3M7QA 2FOHA 3A7YA 2F9OA 3MYWA 3H5CB 1EJMA 2O8TA 5EQRA 1TRYA 1EZUC 3SQEE 1V2MT 2GDEH 3MH6A 1K1IA 4ZMAH 1KTTB 3U8OH 4GLYA 4J1YA 4ZXXH 1RJXB 4AX9H 2WUBA 1Y8TA 5DP4A 3DHKH 4WMFA 3ZV9A 2GT8A 1T8NA 1A1RA 1J9CH 1KXFA 4OS4A 3BN9A 4DW2U 1JIRA 1ELAA 1G3EA 1LVYA 2PV9B 4Y71A 4CBOA 2J38A 4U01A 3U9AH 5IYTA 2HPQH 5GXPA 1AY6H 3KHVA 2OC1A 4B75A 3QDZB 4Y0ZE 1GCTC 2ZDAH 1SGFA 3S0NA 3A7VA 2FPZA 2EEKA 1QFKH 3F1SB 1XKAC 1ZZZA 5C1YA 3B9FH 1IQGA 4K8YA 1QL9A 1YP9A 1C4V2 4BAMB 2LNCA 2ZP0H 3GDVA 4X2YA 4X1SU 1ZLRA 1NRRH 1ELEE 1EPTA 2GCTC 4M7GA 3SV9A 1O2TA 4NZLA 2Q1JA 4YT7H 1O2MA 1O3FA 2P16A 1O5BB 2Y5GA 4NSVA 1TX8A 1LQDB 1H8DH 4U2WA 3RXJA 1NO9H 1WU1A 1J15A 3SNDA 1ZTJA 5T6DA 3K65B 4SGBE 5FAHA 1D3TB 3P8NA 2ZHFH 4FUIA 2P3TB 3BTKE 2Q6DA 1NROH 2A2QH 2AEIH 2WPHS 1BZXE 1A4WH 2PKAA 1GJ5H 2Z9JA 1NU9A 3SGAE 5HXFA 1RIWC 3FP8E 1GDNA 5EXLA 1ELFA 1YM0A 1TWXB 2Y5FA 3PTNA 5CHAC 3EDXB 3LJOA 4MPWA 2BB4A 1A3EH 1HAPH 4KTCA 3RDZA 3M36A 4HZHA 1XUHA 3UWJH 1BA8B 1TGCA 2FESH 1OS8A 1GJAB 4X8TH 1E36B 1C5LH 4ZKOU 1A0LA 1O31A 2PHBA 2TGDA 2VJ1A 1SLVB 1XM1A 1O34A 2VIDA 4QT8C 4A1XA 3EAJA 4NFEA 2FOGA 2ZI2H 1TQ0B 4Q7ZA 3M5NA 4ESTE 1WTHD 6CHAC 1QNJA 1GI9B 3KQDA 1SGTA 1OWEA 2CHAB 2H2ZA 4F49A 1HAOH 3SGBE 3LC3A 6GCHF 1NS3A 1MQ5A 3VEQB 4Q7XA 3SU0A 2ZGCA 1PPCE 2OP9A 3O8CA 4I7YH 1V6DA 1DXWA 3SHAH 4YZUA 1KSNA 2WPIS 2FEQH 3BG4C 4IBLH 3SQHE 4A7IB 1GBMA 2GV7A 3HK3B 3SV6A 4B2AA 2OC7A 5F8TA 4WVPE 4A5TS 1FN6A 3UOPA 1NFXA 3LKWA 1LO6A 2XTTB 1UK3A 3QGNB 3T26A 2ZGHA 3A7XA 2VVCA 2J2UA 2Z9GA 1O2IA 4Q7YA 1PPGE 4NWLA 4A1VA 2HWLB 3KN2A 2RCEA 1D6WA 2WYJA 1RTLA 1P3EA 2BD4A 1AKSA 3RXLA 2FLRH 1VCPA 1C2EA 1WQSA 1HLTH 3VB7A 5G4BA 4GVUA 2P93A 2FYRA 1UTKA 4GUXA 3PMHB 4ABEA 1F0SA 2ALVA 3MNCA 1SGEE 3WY8A 1AWFH 1XUGA 1BMAA 8KME2 1D4PB 1GWAA 1PYTD 3H7TA 3LGYA 1ZRBA 4CHAB 2ZTZA 1V2VT 5DO4H 2O9QA 5DP7A 1UCYH 1MAXA 3ZZ4A 5C1XA 3SNBA 2ZECA 4CRDA 7GCHF 2R0KA 2ZU4A 1K1LA 1MTWA 4OS6A 4TPIZ 1P06A 4NIVA 3P95A 1O37A 1O5EH 4INLA 1ESBA 1O2ZA 1PQ5A 4YOJA 3M5OA 4LZ4B 3STJA 1AUJA 1YPEH 2NU4E 2BX3A 3ENSB 4LK4A 2NWNA 5LPRA 1UTMA 3PO1B 1QRZA 2UWLA 3FAOA 1ZMJA 4B73A 1PJPA 1MH0A 3MO3A 3S9BA 1MBQA 5EODA 1C1OA 3M37A 4CR5A 3MFJA 3SHCH 3SU4A 3HGPA 3VXFH 1QB6A 1ZHPA 1C5RA 3MNBA 2HALA 4ZKSU 1V2NT 4NCYA 3GISB 3ZV8A 1TRNA 1B0FA 1L4DA 2A5IA 2ZF0H 4AYYB 1G3CA 1D3QB 1GMHG 5IDKA 1EX3A 4XBCA 1TIOA 1AB9B 3A8AA 3RMLH 2F9BH 3RXSA 2RA3A 3LDXH 1DY9A 1SPJA 1CA0B 3KGPA 1V2LT 1HAYB 1HJ9A 4ZUHA 3SU2A 4OS2A 3R0FA 3F68H 2ZHWH 1GI2A 3E6PH 3UREA 3CP7A 5EGMA 4E06H 3MTYA 2UUYA 2K1QA 1QBVH 1GHAF 1NRNH 4AZ2B 2C8XB 2ZTXA 3UNRA 4IGDA 2RA0A 3PWBA 1EQ9A 2OLGA 4NIXA 2TGTA 4JCNA 3SUEA 4O9VA 2VIQA 3E0NB 2Q6GA 4DURA 2G00A 1WUNH 1Z7KA 2GTBA 1TPSA 3EA7A 1KXEA 4I8GA 3BTEE 1KDQB 1AFEH 2GZ7A 2OQ5A 2WV4A 3LJJA 4KKDA 1G2MA 1Y5AT 4NIYA 2UUFB 2SGDE 2ZC9H 1BHXF 1W8BH 2OC0A 4K69A 1G37A 1O2PA 3SNAA 1K1OA 3SOSA 1SQOA 1ELTA 2A2XH 3HPTB 1AD8H 5DPAA 5AHGH 2ALPA 2PWXA 3RXOA 1TAWA 1YYY1 5HM9A 2UWOA 1MU6B 2PKSB 4DIHH 3UR6A 1C2KA 1P12E 5I25A 1IQIA 3RC6A 1O32A 4B2CA 2HGTH 1DPOA 1TABE 1NFWA 4ZKNU 3ELAH 3K9XB 3H7OA 4D9QA 4KP0A 1P2OA 1AMHA 2FTMA 1CA0C 1PYTC 3TJUA 1NTPA 2H5DA 2AMQA 3A84A 3M35A 2C8ZB 1TMUH
chains in the Genus database with same CATH superfamily
1GJ8B 2EI7A 1MD7A 1DXPA 2FOMB 1T32A 3U1JB 1XVOA 3QUMP 1BDAA 3GCHC 1FONA 2BLOA 3ZVGA 1DUAA 3BTQE 1EPTB 3LT3A 2QIQA 1VCWA 4BAKB 4JZ1A 3QZRA 3BF6H 5A8XA 1QL7A 1H9LB 5K7RA 2F91A 3KQ5A 1XVMA 1ELCA 1QURH 1AVXA 4JZIA 4A6LA 1A3BH 2ESTE 1PPFE 2VIPA 4DCDA 1W7GH 1SGQE 5T6FA 1VJ9U 4HTCH 1GBJA 1C5PA 2ZFQH 3BTTE 3F2FA 1K9OE 2PKAB 2IJOB 1MTVA 1T4UH 2HNTF 1HRTH 4HGCA 3RXDA 1O2LA 1TYNA 3VGCB 4BAOB 1GBAA 2XNIA 1JXPA 3SJOA 1FLEE 2P3UB 1GHVH 4NG9H 3ATLA 2J92A 2H9TH 1HCGA 1T31A 1DWEH 2G4UA 1A0JA 5E2PA 1E1QD 1O2GH 2ZPRA 2ZU1A 1FY1A 1DM4B 2FI3E 1AVGH 3RU4E 1QJ1B 1BBRK 3TH3H 1XX9A 1K1JA 5C1UA 1N6YA 1G30B 2BD5A 2FOBA 1NRPH 1XUFA 3Q77A 1P0SH 1C5SA 1V3XA 1QB9A 1THSH 1A2CH 1UCYK 1GVKB 1ARBA 1CSOE 2BQWB 2BVRH 2FODA 2LELA 1S0RA 3RMNH 2VGCB 2ZZUH 2BM2A 4K1SA 4X0WU 1SQAA 3UAIC 5AFYH 3Q3XA 1O3AA 4MLFB 2ZTYA 1ZR0A 3G01A 2JETC 2EI6A 2SFAA 1C9PA 1FDPA 1TOMH 3PMJA 2NU0E 4GSOA 2PTNA 3ITIA 5ETXA 3AW1A 1FJSA 2QF5A 1BQYA 2ODQA 4FOUC 1QTFA 5AFZH 2BLVA 1X7AC 2AIQA 1GHWH 4GHQA 1FPHH 2P8OB 3A7WA 1EATA 1MZAA 3VB5A 1GJCB 1GPZA 3PLKA 1RFNA 1YWUA 5E8EH 1OP0A 1MD8A 2A0QB 1KXDA 1BRBE 2BMGB 4Y10E 2GDDA 2BD7A 3H09A 4AG1A 1QRXA 1AQ7A 1SGDE 2WSSD 1V2KT 3F9HA 1LHCH 1FIWA 1MTUA 1VGCC 5IK2D 4YOGA 4D7GA 3KYGA 2H9EH 2NU1E 4FU8A 4CRAA 2ANKH 1G3DA 2UUJB 2XBXA 3MWIU 1EB2A 1HAXB 1UJ1A 1ZSLA 4UFFH 2Z6BD 1DICA 1TGNA 1OYQA 1ID5H 1C5XB 1Y59T 1GJDB 1YPKH 3SUDA 3HKJB 3TNTA 4FUDA 3OEHD 1MU8B 1YPGH 1ZPZA 4K60A 1TNGA 1SC8U 1JBUH 2BZAA 1LPGB 2BQ7B 1PQ8A 2OC8A 3PLPA 4FUHA 4XE4A 4JYTA 3NPSA 2BD2A 1GI4A 3BSQA 4YLQH 4UFEH 5F6MA 3M5MA 1N8OB 3ODFA 1SGPE 2FOEA 1NN6A 2ZGXH 1ZTLA 1L4ZA 1V2UT 2IPHA 4LZ1H 4K1TA 3RXQA 3TJNA 3GDUA 4TSFD 1O5AB 3QWCH 2WPLS 1GCTB 1O2JA 3Q76A 2OCVB 3NKKA 1EUFA 3ZZDA 4LXBH 2QF0A 2FMJA 1AO5A 1DLKB 3RLYH 1HBTH 1ZJKA 4TWWA 4CBNA 5LH8A 3PMAB 5DKMA 2PLXA 4RKOB 1C1PA 1GL0E 5DP5A 3E90B 1K1PA 2Y82A 2BY6X 2P8OC 4OGYA 1V2JT 3L3TA 1SFQB 9ESTA 3QLPH 2OXSA 4YO9A 6LPRA 1EB1H 1IQJA 3KL6A 3F2GA 5TCAA 4Y79A 2UUKB 5C0UA 3I78A 1G3BA 1ABIH 1IQMA 1TALA 1Z8RA 3QK1A 5DP6A 2P59A 1BRUP 1Q3XA 1AI8H 1IQKA 5TJXA 2TGPZ 3TPIZ 1SVPA 4K8BA 1IQNA 2V0BA 2DE8A 4WXIA 1GMHF 1HNEE 3NCLA 3TNSA 1OX1A 2J34A 3BIUH 4Q63A 3RXBA 1TGSZ 3BIVH 2Y7XA 1GI8B 4Y8YA 1GBKA 3RXHA 4MNVA 4B74A 1LQEA 4GCHG 5JBAS 1O2UA 3FZZA 1WQVH 1CT0E 1RIWB 2HOBA 1P9UA 2C8WB 1BIOA 1J17T 4FVBA 4X2WA 5EJZA 1SR5C 2WZQA 2ZU2A 5J4SA 1CQQA 1GGDB 1PQAA 5CHAB 1GVZA 2B5TB 4TWYA 4WWYA 1AIXH 1FY4A 1N8OC 1EAUA 1SGYE 4ZROA 1Q31A 4FUFA 5AF9H 3PRDA 5EW1H 5HMAA 1KXCA 5B6LA 1WXRA 5A09A 1NBME 3A83A 2ZDKA 4JZFH 5A8ZA 5K0HA 3A85A 2ZFPH 3OFND 3N7DA 2A32A 2IOTA 4ZAEA 1GI3A 3T5FH 1GBHA 5F8ZA 4R0IA 2FXRA 1SGRE 1VZQH 3MOCA 2R3YA 6CHAB 5FPTA 4A92A 1KLJH 2XXLA 3N7EA 1P57B 3SUGA 4KTSA 3FZDA 1SI5H 1SGFG 2KAIA 4ABGA 4INKA 2VIOA 4CRCA 3TGKE 4BAHB 1HAGE 2XC0A 1GMDG 3GYMA 5GJ4B 3BG4B 3DCLA 2VWMA 2AFQB 2JH5D 4GHTA 1O5DH 3UFAA 1HDTH 1C9TA 2V6NA 1DWDH 2V3OH 3MHWU 2Z7FE 2EC9H 3KEEA 2W26A 1QCPA 1P09A 1O2QA 2DE9A 1C1RA 1SL3A 4UD9H 1ORFA 1O3CA 3STIA 2F9NA 2PGBB 3BTDE 3UWIA 3NUMA 2PR3A 3TK5A 1EZSC 3T29A 1RD3B 1HAZB 2RG3A 5EW2H 1Z6JH 1GGDC 1CE5A 1DE7H 4XD7D 1IQHA 2QGRA 1SG8B 1W11U 1TOCB 2C4FH 3M3TA 2F4LA 1BCUH 2PSYA 1ETSH 1OWKA 1DITH 3BTHE 3GCOA 3NWUA 4DY7B 1W13U 1CO7E 1G36A 5ABWA 1BOQA 2JH0D 3NRLA 2GKVE 4UFDH 2Y5HA 2STBE 2WV9A 2AMDA 2A4QA 3P6ZB 2KCOA 5C67A 1LHFH 1EOLA 4U32A 1DVAH 3NZIA 1MKXH 2XC4A 2J97A 3K2UA 5GDSH 1GCDA 2R9PA 2FDAA 3TH2H 3I29A 5SGAE 4DJZB 3VB3A 3DSOA 2J95A 3RLWH 1ZSKA 3P92A 3T62A 3LGTA 5ESTE 4BTUB 4ABBA 2KCYA 3TIUA 2L74A 1OWHA 2W3KA 3K6YA 4X6MA 1GI0A 3PB1E 1BUIA 1CA8B 1NESE 1GJBB 4AFZA 5H4IB 1WYKA 4D7FA 2FLBH 1ANDA 1O5CB 3FP7E 3S9AA 4TYDA 2QXJA 1BTHH 5TCCA 3LONA 4I8LA 1EASA 2ZHQH 4AFSA 1KLTA 4AYVB 2Y80A 1C5OH 1V2OT 1AVWA 4X6OA 3SN8A 3S7HB 1WTGH 2Z9KA 2JKHA 5AVDA 1NFUA 1BMNH 4H6TA 2FTLE 2VWNA 4O3UA 2J5UA 1O0DH 1Z71A 5FHTA 1TQ7B 2ODYB 4ISNA 1QBOA 2HLDD 1BRCE 2ZO3H 3QGJA 3T2NA 1MQ6A 1BBRH 4UFGH 3A8BA 1QB1A 1EJAA 1N1LA 3SV8A 2LP6A 3EA9A 3OTPA 5T6GA 1KMHB 1W0KD 2Y81A 2A31A 1GI1A 3PRBA 2A7HA 2XBYA 1C5MD 1Z8IB 3E3TA 3GY4A 1O3JA 3EQ0H 1O3OA 4D8NA 1F5KU 3PROA 1XXFA 1KYNA 4GPGA 1O3GA 1O2XA 4MNXA 3UIRA 4I32A 4JZDH 1UVUH 4UE7H 3DD2H 5JPMH 1MTSA 7ESTE 3D23A 1Y3WA 1VITG 4BXWA 1TLDA 2WHXA 1Z6EA 1HB0B 2Z3CA 1RGQA 2ANYA 2QCYA 1FN8A 3TK9A 1O2RA 1EAXA 1FAKH 3RXUA 3E91A 2FS8A 1GDQA 4K3JA 2BX4A 5C5OA 1V2PT 1O5GH 2G5VA 3TVJB 2XC5A 4LOYH 1DT2A 3S69A 4FUBA 1MAYA 2A1DB 2ZHEH 4WH8A 2BD9A 1A5GH 1TA2A 1XUJA 3BEFB 2XCFA 1O3EA 3PMBB 4AB8A 2G5NA 2ZDNA 4ZXYH 4DT7B 4CREA 2CXVA 1P3CA 4ISLA 1DSTA 3SU3A 1S6HA 4YESB 2K8IA 2QAAA 5JYIA 4ABJA 3E0PB 1P11E 2ZDLA 3RU4D 3UNQA 1C2LA 2H5CA 1S82A 4SGAE 1FIZA 2XCNA 2GGVB 1MCTA 1P2KA 3SV7A 3TJVA 2AGEX 4Z1MD 1H9IE 1QRWA 3RXAA 2EA3A 1F0TA 1AFQC 2BDCA 4YXWD 2KX4A 3MNSA 3SZEA 2FOFA 1CU1A 3RXRA 1SQTA 4TY7A 1BBRE 2B8OH 2OBQA 3U28C 4E7RG 3BTME 5EXMA 1AZ8A 3HK6B 3V0XA 2VIVA 1ABJH 2NU3E 2ZQ1A 5HM2A 1J14A 2GJGA 3GCHB 3T25A 1A0HB 1C5ZB 1CT4E 2G8TA 4BTIB 1UCYE 1NM6A 1SQRA 2O8MA 4AN7A 4ZHMU 1NT1A 3RXIA 1BTZA 2XWAA 1VR1H 1P10A 3V3MA 3EE0B 2R2MB 3L33A 1GBLA 1UW7A 4FVDA 4UONA 3SYJA 1Y3VA 2GP9B 1DY8A 2KCPA 4P00A 4I31A 1HJAC 5CHBA 2ZEBA 2XBWA 2JH6D 1C5UA 1LDTT 1V2WT 4KELA 2B0FA 2A7JA 3IG6B 1UVTH 1AE5A 1RTFB 3LGVA 2F9UA 3W94A 3ZZ5A 4GCHF 2O8WA 1ZSJA 1OWJA 2G55A 3VB6A 2A4GA 2A7CA 5LGOA 2ILNA 2SGQE 1IOEA 2BDHA 4RI0A 1RRKA 4MPVA 3TJOA 1AZZA 1YPMH 4ISOA 5CMXH 2AMPA 4ZH8A 2F3CE 2D2DA 3DSPA 5A0AE 2AHME 3SV2H 1GBEA 2ULLA 1H4WA 5C20A 3PV5A 3A86A 2TGAA 3GICB 1BJUA 1TX7A 3SGQE 3SNCA 1L1JA 3BEIB 1O3KA 3PYHA 1H8ED 3MU4A 1TONA 1MABB 5C3NA 2FM2A 4YTAA 1H8IH 1GBTA 2BDGA 4TPYA 3A8DA 1C2FA 1GG6C 1O2NA 1U6QA 3SI3H 2CV3A 4BOHA 2L6OA 5HGGA 2H9HA 2FWWA 1MKXK 2WV5A 2JETB 1TNJA 1C1VH 4Y6DA 3SJIA 3TU7H 2ZFSA 4RT0A 1GJ9B 3ATMA 2G81E 2CJIA 1A46H 1GMDF 3GDSA 1O36A 1LCYA 1SFIA 2M2AA 3SI4H 1ETRH 3ZVAA 2FI5E 2ZG0H 3Q3KA 2KR7A 3SNEA 1D3PB 2SGEE 3MO6A 5BRRE 1SGNE 4IN1A 1MUEB 4MQAA 2HLCA 1XXDA 1B0EA 1BMMH 2RDEA 3SU5A 5JDUB 3RP2A 1XKBC 3TITA 5DK1A 1FQ3A 2Y6TA 2FOAA 1AU8A 1IQLA 4VGCB 1T8MA 1OKXA 1OSSA 3JZ1B 3OTJE 4H42U 1MTNC 5L2ZH 1VGCB 1YCPM 2ODPA 2W6ID 1UO6A 1EZQA 2BXUH 1LVBA 4NA7A 1GHBG 2A4OA 1QY6A 1SBWA 3WW7A 6GCHG 1OP8A 2GX4A 2C8YB 2ZA5A 1QZ8A 2C93B 1GHXH 1TMBH 1SKYE 2C3SA 1BTYA 4AORA 4X1PU 1ACBE 5JBBS 5LPEA 1HAHH 2GZ8A 2JJ2D 1C1SA 2BQ6B 3A89A 5DN6D 2QXGA 1SLXB 1TRMA 1OP2A 1RXPA 3MU8A 4Y0YE 3A88A 2VB0A 1NBMD 1ANEA 4FUCA 4J2YB 1SLWB 2Z94A 5DP3A 3RXEA 2BDIA 2WUCA 4JYUH 1O3IA 2QV1A 5BPEA 1K21H 3RXGA 2FP7B 2ZFTA 1Z1JA 2TBSA 3ZZ7A 2GMTC 3A80A 1Y3UA 3M5LA 4AGJA 3SJ8A 1OPHB 3AK5A 2ANWA 4DT4A 1BTWA 1YGCH 1CHOG 1P05A 4IN2A 2GD4B 4DG4A 5DP9A 3BV9B 2BOKA 4Z0KA 1GBCA 3ZZCA 2ZU5A 2XRCA 1GVLA 3M3VA 3RC4A 5LPFA 2ZWLH 4E7NA 1FUJA 1YLCA 4VGCC 2ZFRH 2CN0H 1AKSB 3FANA 3Q3YA 4X8SH 2BZ6H 4XBBA 2V3MA 2HNTE 2VINA 3U8RH 2A45B 1YY3A 2V3HH 5I46H 4Y76A 3P8GA 1GI5A 1C4Y2 1KY9A 3ZZBA 1QA7A 1O2KA 2W3IA 4X6NA 5F03A 4XOJA 1F0UA 1K28D 4Y7AA 1O3MA 1E35B 4ABDA 3RU4T 2ZCKP 5FPYA 3RXCA 2P95A 3RM0H 8LPRA 1MCVA 2FS9A 1IQEA 1C5VA 1EXFA 1SGIB 1ZJDA 3UQVA 4E05H 4FUGA 1K2I1 4X8VH 1GJ6A 2YNAA 4DVAU 3ZYDA 6ESTA 4NZQA 4AB9A 4AFUA 1G2LA 3BG8A 2D1JA 2ZCHP 2SGPE 1D9IA 2ZFFH 2CK3D 2Z3DA 5FPSA 2FX6A 4NFFA 1NFYA 1TFXA 1VITF 2VH6A 3P70B 1P2MA 8GCHG 3KNXA 4UEHH 2P94A 1UK4A 3A87A 1ELDE 3OE7D 4Y11E 2QN5T 3ZIAD 1E0FD 1GBFA 1EAWA 3MI4A 3Q00A 1INCA 1BMLA 2GV6A 2VNTA 2WPDD 4IMZA 1KXBA 2V7QD 4M9FA 1QHRB 4AGKA 2BDBA 5ESBA 5C2ZA 4FU9A 3A7ZA 2WPMS 1MBMA 1PPZA 4FU7A 4I8KA 2SNWA 1GDUA 3RUOA 5JBCS 3CS0A 1VKYA 1B7XB 1BJVA 9LPRA 1L0ZA 3D62A 3M7UA 1B5GH 1QQ4A 3URCA 1YPHC 2LPRA 1TNIA 3SU6A 2BVXH 1C5QA 4H6SB 2VVVA 1YPHE 1GBDA 1GJ4H 1LMWB 1W14U 4RKJB 1UTPA 3C1KA 5KECA 3U1IB 3TGIE 1SB1H 1GHZA 3B23B 5C5NA 2BYAX 3PLBA 1GHYH 1KDQA 2PSXA 2BY7X 1ESAA 1HXFH 4PROA 4CH2B 3LGUA 2UWPA 4GAWA 2VWLA 1Z1IA 4WJG2 2G4TA 3ATKA 2GT7A 2PUQH 1O2WA 5EXNA 1UHBA 3HGNA 1F92A 4MPUA 1EFRD 3LGWA 3UOUA 5EJ1A 3GCNA 5FBEA 1TBQH 1C2HA 3UNSA 2QY0B 1K1MA 1O2HA 1ZOMA 2QF3A 5A0BA 5EU8A 1QJ6B 1NPMA 1FNIA 3GY8A 3P8FA 2F83A 4B76A 2XWBI 4WXVA 1C2GA 4O03A 1CBWB 3D49H 5DJ7A 1A5HA 2OTVA 1HPGA 1JWTA 2BD8A 1XUKA 2I6SA 1F5LA 4RT1A 3RMMH 1HIAA 4JK5A 1ELVA 5F8XA 1ZYOA 2AERH 1FPCH 2HPPH 3V12A 1HGTH 4B2BA 1QA0A 1C2IA 1P8VC 2FX4A 4I8HA 2ZGJA 5FCRA 3BTGE 4MNWA 3GY3A 1THRH 3A7TA 3GY5A 2QA9E 1TBRH 3EE7A 4WF8A 5GNDA 4CH8B 3C27B 3GY2A 1O3HA 1W7XH 4NSYA 4X1QU 1W3CA 2D26C 3S7KB 5EPYA 3MMGA 4UDWH 3DFJA 3OSYA 2BLWA 1CVWH 3LIWA 2G51A 1G32B 3A8CA 1DX5M 2OD3B 5KEDA 1D3DB 4IMQA 3CNRA 1UTQA 5A2MH 4ISHH 2CGAA 1YPLH 2HRVA 1YLDA 3DUXH 3ZZAA 1W10U 2ZPQA 2BOHB 2XBVA 5E2OA 3SJKA 4B71A 3ATWA 1C5TA 1QR3E 1ZTKA 2IJD1 1Y5BT 4AFQA 2WPJS 1TGTA 4D76A 1LPZB 1YKTA 2ZGBH 4Y8ZA 3F3BA 1DS2E 1S0QA 1ZHMA 1F2SE 1LVOA 3SO3A 3UTUH 2AGGX 2BVSH 1P9SA 4JMYA 4R8TB 1MKWH 5L6NH 4Z6AH 2O8LA 3S9CA 1CBWC 1C5YB 2CMYA 2FYQA 2Q6FA 3VPKA 5J4QA 3OY5U 4BNRA 3U98H 1BB0B 2QYIA 3W1EA 1HUTH 2M5TA 3ZZ6A 2I6QA 2H6MA 4MPXA 1UTLM 2WINI 3N99A 4YM9A 3D65E 1ELBA 4XSKU 5B6OA 3BTFE 3ODDA 1T7CA 1O39A 2ZIQH 1VCQA 1TPAE 2STAE 3T27A 3MNXA 1KIGH 1GHBF 1TB6H 4HG6A 4HFPB 3RXPA 3SU1A 4THNH 2CF9H 1TPOA 2ZKSA 2CF8H 1ZMLA 2XOKD 1EAIA 3K6ZA 1EKBB 3ZVFA 3SBKA 3M3SA 1YBWA 3ZVEA 5GCHG 3DFLA 1O2OA 2DUCA 2ZPSA 3GCTG 1C2MA 1C4U2 1T8LA 1YCPH 1NZQH 4RN6A 5PTPA 1BRAA 1CHGA 2F9PA 1E38B 2HVXA 1O30A 1O38A 2VU8E 1LTOA 2PUXB 2RDLA 2B9LA 8ESTE 2IN2A 3SORA 1AFQB 1C5WB 3V13A 3AASA 3QO6A 5FXLA 1AE8H 3N7OA 1S81A 1C2JA 1QQUA 1TA6A 1O2VA 1L1NA 1O3LA 1CT2E 1PPEE 1O3PB 2TPIZ 7KMEH 2W7SA 2J98A 1SHYA 2SGAA 1V2QT 2FZZA 1Z8JB 3BEUA 1RS0A 1MMJN 1CHOF 1S5SA 4RSPA 1DANH 4ZHLU 4K2YA 2VWOA 3UQOA 3DSGA 2V35A 1THPB 1YC0A 2AS9A 2FI4E 1DLEA 2ZNKH 1UMAH 2BLQA 2BHGA 3KIDU 1GBBA 4MDSA 3M7TA 3OEED 3UPEA 4JK6A 3TGJE 3SW2B 1RTKA 1W2KH 1UTOA 3TK6A 1OWIA 1HAVA 2CHAC 1HJAB 1ZRKA 1QIXB 1H1BA 3DT0H 4A1TA 5JB9S 1SMFE 4Y8XA 1GMCG 1UVPA 4BTTB 2YNBA 1Z8GA 5C0TA 2VIWA 3SZNA 2ZU3A 1LHGH 4X8UH 2Y7ZA 4D9RA 3U8TH 5GWZA 2NU2E 5L30H 2P3FH 3LGIA 1PQ7A 2H1UA 3O8DA 3QTVH 1KXAA 5HIYA 1JMOH 2OK5A 1A61H 1YF4A 3RM2H 3M61U 3AW0A 3RXVA 1CGHA 4TY6A 1S83A 1V2TT 4ABAA 1HAIH 3ZVBA 2PGQB 2QXIA 4MVNA 4ZHAA 1DWCH 3EGKH 3VB4A 1P2JA 8GCHF 4FETA 4ZKRU 1HV7A 2R2WU 2GCHG 1E34B 1E37B 2Z9LA 5E0HA 4U30A 3JZ2B 5EQQA 2A5AA 1GG6B 4YT6H 4Q80A 3MH5A 4XDEA 3ESTA 2FO9A 2W7UA 1F0RA 5EIYA 3GY7A 2G52A 1N6XA 2R0LA 1SSXA 3EA8A 5T3HA 1COWD 2VVUA 3GYLB 4X2XA 4IC5A 4YLUA 1C5NH 3V7TA 1FMGA 1Y3YA 3PWCA 4OS7A 5F53A 4OM9A 3URDA 1O3NA 1W0ZU 4CHAC 2J94A 2W5EA 2ZDVH 2OUAA 1PFXC 1O2YA 2C90B 1HJ8A 2BTCE 5CE1A 1T8OA 5FCKA 1JRTA 1QBNA 4NWKA 5JBTA 2AGIX 1WSSH 1BHXB 1EOJA 4IW4E 1SGCA 1AN1E 1W12U 3ZVDA 1A5IA 3OAAD 3P8OA 4DIIH 4XFQA 5DSFA 1UK2A 3VFEA 1IQFA 2F43B 5JB8S 2BY8X 1Y3XA 4ABIA 2TRMA 3R3GB 2PTCE 1C1WH 4KTUA 1CGIE 3PTBA 1MTNB 3VXEH 2PFEA 3LU9B 3RXKA 1FY5A 4BANB 3F6UH 3SUFA 2JDID 2QXHA 2JJ1D 1GJ7B 4NA8A 4FUEA 1JOUB 1P03A 3PO1C 5L2YH 1QL8A 3A82A 2OBOA 3U69H 1BT7A 1UHBB 3O8RA 4ISIH 2FOCA 2VH0A 3AAVA 1ZGVA 1SOTA 4AG2A 5EPNA 1MKWK 5FX6A 3SJ9A 1FV9A 5GIBA 4O97A 2BDYA 1LVMA 1UVSH 2O8UA 2VBCA 1K0HA 4X1RU 1NU7B 1D6RA 1KLIH 4WMEA 1JRSA 3E1XB 4FXGH 5FBIA 4I33A 1HIAB 4CRBA 4CRFA 1ESTA 1NC6A 1AB9C 1BTUA 2KAIB 4ABHA 4IS5A 4B1TA 1LKBA 1OYTH 1O35A 1FI8A 3A81A 4OGXA 1ZPBA 2QC2A 3QX5H 4CR9A 3O8BA 2BXTH 2OQUA 2BDAA 2FIRH 4INHA 1EP5A 3NXPA 1JIMA 3AAUA 1AHTH 4MNYA 5DG6A 2GMTB 1AUTC 1K22H 4XBDA 4CRGA 1V2RT 4JYVH 3UY9A 1HFDA 1O3BA 1OWDA 3PM3A 1XUIA 1K1NA 2JIZD 1TMTH 4Q4LA 3UR9A 2WYGA 1QJ7B 2A5KA 1YLNA 1LPKB 3F9FA 1P2NA 4DOQA 1O33A 2K0QA 2GZ9A 1H8HD 1GI7B 4ABFA 1VJAU 1WOFA 1NRQH 3MH7A 2QF4A 1YCPK 3F2HA 1W0YH 2R3UA 5GPIB 3KCGH 1Q2WA 1BTXA 1O3DA 3KQBA 3RMOH 1HYLA 3MU1A 2Z3EA 5DP8A 1UTJA 1C1UH 4OS1A 4F4OC 2YMSD 3NK8A 5E0GA 3CS7A 3ZYEA 2WPKS 1T4VH 1YPJH 1C1TA 3ZVCA 1ZGIA 1P2IA 2GVFA 3F9EA 2PKSC 5FX5A 3RXTA 3I77A 3W95A 1TNLA 4NIWA 1LKAA 2QE7D 1DOJA 3ZZ9A 1ETTH 3OYPA 3F9GA 3AVZA 1WCZA 3FKSD 1P2QA 1WAYB 3LOXA 4FUJA 3TH4H 1P01A 4BXSA 1TPPA 1QGFA 1FAXA 1PPHE 4KGAA 3ZZ3A 3QN7A 2XW9A 3KQCA 1SOZA 1FX0B 1S84A 1AGJA 1WBGB 2ANMH 1J16A 1DUEA 4B6EA 3RC5A 1LHEH 5E0JA 2PW8H 4Q2KA 5A8YA 3MO9A 2SGFE 3PV4A 1EPTC 4ASHA 1ARCA 2J4IA 4X2VA 1V2ST 1DSUA 4YOIA 2ASUB 1E1RD 1S85A 3IWMA 4O3TA 2HNTC 2D8WA 4DGJA 1PPBH 2BY9X 3ATIA 3E16B 5GCHF 4WY3A 3T28A 2TIOA 1L2EA 3FFGA 3QTOH 4JZEH 3TLOA 2A4RA 2EI8A 3GCTF 4AOQA 2BD3A 2THFB 3P17H 3MU0A 4OS5A 1M9UA 1HXEH 2YMSB 3QZQA 7GCHG 1S6LA 1P02A 4MG3A 3UUZA 3BTWE 1L1GA 4I86A 3KF2A 1UTNA 1FZZA 3L6PA 5HYOA 2AIPA 2Z9IA 4K1EA 2KFWA 3LH1A 3FP6E 5HIZA 5EQSA 3VGCC 4WMDA 3LC5A 3RXFA 3DA9B 1ANCA 2B7DH 2J9NA 2J98B 3OX7U 1IHSH 3OY6U 4IC6A 1CGJE 1OHHD 3IITA 1BTPA 3WWBA 1ZHRA 1TBZH 2KCAA 4WH6A 1TX6A 3MU5A 3LH3A 7LPRA 1EZXC 2OINA 1BITA 3RXMA 1WDIA 1O2SA 4NGAH 1DFPA 1G9IE 3E8LA 1TGBA 4H4FA 1VITH 1TNHA 2SNVA 1TNKA 1EP6A 3MH4A 1O5FH 1SHHB 1HAVB 5A0CA 2VGCC 1ANBA 1FY3A 1FXYA 1KTSB 1GI6A 5DGJA 1GMCF 1GBIA 4MTBA 4X1NU 5EOKA 1DDJA 1C1NA 5FL7D 4F48B 1C1QA 1TE0A 1H9HE 3KQEA 5EG4A 1MZDA 4BAQB 1UVOA 4Y7BA 2ZQ2A 4K5ZA 1F7ZA 3ZZ8A 1NRSH 1ELGA 3GOVB 4AC9A 2ZHDA 1OXGA 1WV7H 4HI3A 1Y5UT 1ZPCA 3HKIB 4X6PA 2XYAA 2YMSC 1P04A 1GHAG 2ZCLP 3CENA 4ACBA 1S6FA 2F9VA 2GCTB 2AH4X 1DWBH 1EJNA 1C2DA 1IAUA 2YOLA 3FVFB 3HATH 3OU0A 1NY22 3EYDA 1LHDH 1XMNB 2AYWA 1AWHB 1IHTH 3GY6A 1F5RA 1SLUB 1FY8E 1J8AA 1OOKB 2GCHF 1A7SA 3B8JA 2ZDMA 4I8JA 1GL1A 3LPRA 2BY5X 1C1MA 4NA9H 3F0PA 1ZMNA 3M7QA 2KM0A 2FOHA 3KYFA 3A7YA 2F9OA 3MYWA 3H5CB 1EJMA 2O8TA 5EQRA 2EY4C 1TRYA 1EZUC 3SQEE 1V2MT 2GDEH 3MH6A 1K1IA 4ZMAH 1KTTB 3U8OH 4GLYA 1E79D 4J1YA 4ZXXH 1RJXB 4AX9H 2WUBA 1Y8TA 5DP4A 3DHKH 4WMFA 3ZV9A 2GT8A 1T8NA 1A1RA 1J9CH 1KXFA 4OS4A 3BN9A 4DW2U 1JIRA 1ELAA 1G3EA 1LVYA 2PV9B 4Y71A 4CBOA 2J38A 4U01A 3U9AH 5IYTA 2HPQH 2PP6A 5GXPA 1AY6H 3KHVA 1W0JD 2OC1A 4B75A 3QDZB 4Y0ZE 1GCTC 2ZDAH 1SGFA 3S0NA 3A7VA 2FPZA 2EEKA 1QFKH 3F1SB 1XKAC 1ZZZA 5C1YA 3B9FH 1IQGA 4K8YA 1QL9A 1YP9A 1C4V2 4BAMB 2LNCA 2ZP0H 3GDVA 4X2YA 4X1SU 3FO8D 1ZLRA 1NRRH 1ELEE 1EPTA 2GCTC 4M7GA 3SV9A 1O2TA 4NZLA 2Q1JA 4YT7H 1O2MA 1O3FA 2P16A 1O5BB 2Y5GA 4NSVA 1TX8A 1LQDB 1H8DH 4U2WA 3RXJA 1NO9H 1WU1A 1J15A 3SNDA 1ZTJA 5T6DA 3K65B 4SGBE 5FAHA 1D3TB 3P8NA 2KZ4A 2ZHFH 4FUIA 2P3TB 3BTKE 3MQKC 2Q6DA 2XNDD 1NROH 2A2QH 2AEIH 2WPHS 1BZXE 1A4WH 2PKAA 1GJ5H 2Z9JA 1NU9A 3SGAE 5HXFA 1RIWC 3FP8E 1GDNA 5EXLA 1ELFA 3UB0A 1YM0A 1TWXB 2Y5FA 3PTNA 5CHAC 3EDXB 3LJOA 4MPWA 2BB4A 1A3EH 1HAPH 3F0OA 4KTCA 3PV2A 3RDZA 3M36A 4HZHA 1XUHA 3UWJH 1BA8B 1TGCA 2FESH 1OS8A 1GJAB 4X8TH 1E36B 3WWFA 1C5LH 4ZKOU 1A0LA 1O31A 2PHBA 2TGDA 2VJ1A 1SLVB 1XM1A 1O34A 2VIDA 4QT8C 4A1XA 3EAJA 4NFEA 2FOGA 2ZI2H 1TQ0B 4Q7ZA 3M5NA 4ESTE 5HKKD 1WTHD 6CHAC 1QNJA 1GI9B 3KQDA 1SGTA 1OWEA 2CHAB 2H2ZA 4F49A 1HAOH 3SGBE 3LC3A 6GCHF 1NS3A 1MQ5A 3VEQB 4Q7XA 3SU0A 2ZGCA 1PPCE 2OP9A 3GS9A 3O8CA 1V6DA 3FN8A 3SHAH 4I7YH 1DXWA 4YZUA 4ASUD 1KSNA 2WPIS 4F55A 2FEQH 3BG4C 4IBLH 3SQHE 4A7IB 1GBMA 2GV7A 3HK3B 3SV6A 4B2AA 2OC7A 5F8TA 4WVPE 4A5TS 1FN6A 3UOPA 1NFXA 3LKWA 1LO6A 2XTTB 5EJLA 1UK3A 3QGNB 3T26A 2ZGHA 5CDFE 3A7XA 2VVCA 2J2UA 2Z9GA 1O2IA 4Q7YA 1PPGE 4NWLA 3VG8A 4A1VA 2HWLB 3KN2A 2W6JD 4ZCNA 2RCEA 1D6WA 2WYJA 1RTLA 1P3EA 2BD4A 1AKSA 3RXLA 2FLRH 1VCPA 1C2EA 1WQSA 1HLTH 4P02A 2EQNA 5G4BA 3VB7A 4GVUA 2P93A 2FYRA 1UTKA 4GUXA 3PMHB 4ABEA 1F0SA 2ALVA 3MNCA 1SGEE 3FOAA 1AWFH 3WY8A 1BMFD 1XUGA 1BMAA 8KME2 5C94A 1D4PB 1GWAA 1PYTD 3H7TA 3LGYA 1ZRBA 4CHAB 5KGOA 2ZTZA 1V2VT 5DO4H 2O9QA 5DP7A 1UCYH 1MAXA 3ZZ4A 5C1XA 3SNBA 2ZECA 4CRDA 7GCHF 2R0KA 2ZU4A 1K1LA 1MTWA 4OS6A 4TPIZ 1P06A 4NIVA 3P95A 1O37A 1O5EH 4INLA 1ESBA 1O2ZA 1PQ5A 4YOJA 3M5OA 4LZ4B 3STJA 1AUJA 1YPEH 2NU4E 2BX3A 3ENSB 4LK4A 2NWNA 4TT3D 5LPRA 1UTMA 3PO1B 1QRZA 2UWLA 3FAOA 1ZMJA 4B73A 1PJPA 1MH0A 3MO3A 3S9BA 1MBQA 5EODA 1C1OA 3M37A 4CR5A 3MFJA 3SHCH 3SU4A 3HGPA 3VXFH 1QB6A 1ZHPA 1C5RA 3MNBA 2HALA 4ZKSU 1V2NT 4NCYA 3GISB 3ZV8A 1TRNA 1B0FA 1L4DA 2A5IA 2ZF0H 4AYYB 1G3CA 1D3QB 1GMHG 5IDKA 1EX3A 4XBCA 1TIOA 1AB9B 3A8AA 3RMLH 2F9BH 3RXSA 2RA3A 4ACAA 3LDXH 1DY9A 1SPJA 1CA0B 3KGPA 2RFKC 1V2LT 1HAYB 1HJ9A 4ZUHA 3SU2A 4OS2A 3R0FA 3F68H 2ZHWH 1GI2A 3E6PH 3UREA 3CP7A 5T1VA 5EGMA 4E06H 3MTYA 2UUYA 2K1QA 1QBVH 2IPQX 1GHAF 1NRNH 4AZ2B 2C8XB 2ZTXA 3UNRA 4IGDA 2RA0A 3PWBA 1EQ9A 2OLGA 4NIXA 2TGTA 4JCNA 3SUEA 4O9VA 2VIQA 3E0NB 2Q6GA 4DURA 2G00A 1WUNH 1Z7KA 2GTBA 1TPSA 3EA7A 1KXEA 4I8GA 3BTEE 1KDQB 1AFEH 2GZ7A 2OQ5A 2WV4A 3LJJA 4KKDA 1G2MA 1Y5AT 4NIYA 2UUFB 2SGDE 2ZC9H 1BHXF 1W8BH 2OC0A 4B6FA 4K69A 1G37A 1O2PA 3SNAA 1K1OA 3SOSA 1SQOA 1ELTA 2A2XH 3HPTB 1AD8H 5DPAA 5AHGH 2ALPA 2PWXA 3RXOA 1TAWA 1YYY1 5HM9A 2UWOA 1MU6B 2PKSB 4DIHH 3UR6A 1C2KA 2HVYB 1P12E 5I25A 1IQIA 3RC6A 1O32A 5C17A 4B2CA 2HGTH 1DPOA 1TABE 1NFWA 4ZKNU 3ELAH 3K9XB 3H7OA 4D9QA 4KP0A 1P2OA 1AMHA 2FTMA 1CA0C 1PYTC 3TJUA 1NTPA 2H5DA 2AMQA 3A84A 3M35A 4XRNA 2C8ZB 1TMUH
chains in the Genus database with same CATH topology
1GJ8B 2EI7A 1MD7A 1DXPA 2FOMB 1T32A 3U1JB 1XVOA 3QUMP 1BDAA 3GCHC 1FONA 2BLOA 3ZVGA 1DUAA 3BTQE 1EPTB 3LT3A 2QIQA 1VCWA 4BAKB 4JZ1A 3QZRA 3BF6H 5A8XA 1QL7A 1H9LB 5K7RA 2F91A 1XVMA 1ELCA 1QURH 1AVXA 4JZIA 4A6LA 1A3BH 2ESTE 1PPFE 2VIPA 4DCDA 1W7GH 1SGQE 5T6FA 1VJ9U 4HTCH 1GBJA 1C5PA 2ZFQH 3BTTE 1K9OE 2PKAB 2IJOB 1MTVA 1T4UH 2HNTF 1HRTH 4HGCA 3RXDA 1O2LA 1TYNA 3VGCB 4BAOB 1GBAA 2XNIA 1JXPA 3SJOA 1FLEE 2P3UB 1GHVH 4NG9H 3ATLA 2J92A 2H9TH 1HCGA 1T31A 1DWEH 2G4UA 1A0JA 5E2PA 2ZPRA 1O2GH 2ZU1A 1FY1A 1DM4B 2FI3E 1AVGH 3RU4E 1QJ1B 1BBRK 3TH3H 1XX9A 1K1JA 5C1UA 1N6YA 1G30B 2BD5A 2FOBA 1NRPH 1XUFA 3Q77A 1P0SH 1C5SA 1V3XA 1QB9A 1THSH 1A2CH 1UCYK 1GVKB 1ARBA 1CSOE 2BQWB 2BVRH 2FODA 1S0RA 3RMNH 2VGCB 2ZZUH 2BM2A 4K1SA 4X0WU 1SQAA 5AFYH 3Q3XA 1O3AA 4MLFB 2ZTYA 1ZR0A 3G01A 2JETC 2EI6A 2SFAA 1C9PA 1FDPA 1TOMH 3PMJA 2NU0E 4GSOA 2PTNA 3ITIA 5ETXA 3AW1A 1FJSA 1BQYA 2ODQA 1QTFA 5AFZH 2BLVA 1X7AC 2AIQA 1GHWH 4GHQA 1FPHH 2P8OB 3A7WA 1EATA 1MZAA 3VB5A 1GJCB 1GPZA 3PLKA 1RFNA 5E8EH 1OP0A 1MD8A 2A0QB 1KXDA 1BRBE 2BMGB 4Y10E 2GDDA 2BD7A 4AG1A 1QRXA 1AQ7A 1SGDE 1V2KT 3F9HA 1LHCH 1FIWA 1MTUA 1VGCC 4YOGA 4D7GA 2H9EH 2NU1E 4FU8A 4CRAA 2ANKH 1G3DA 2UUJB 2XBXA 3MWIU 1EB2A 1HAXB 1UJ1A 1ZSLA 4UFFH 2Z6BD 1DICA 1TGNA 1OYQA 1ID5H 1C5XB 1Y59T 1GJDB 1YPKH 3SUDA 3HKJB 3TNTA 4FUDA 1MU8B 1YPGH 1ZPZA 4K60A 1TNGA 1SC8U 1JBUH 2BZAA 1LPGB 2BQ7B 1PQ8A 2OC8A 3PLPA 4FUHA 4XE4A 4JYTA 3NPSA 2BD2A 1GI4A 3BSQA 4YLQH 4UFEH 5F6MA 3M5MA 1N8OB 3ODFA 1SGPE 2FOEA 1NN6A 2ZGXH 1ZTLA 1L4ZA 1V2UT 2IPHA 4LZ1H 4K1TA 3RXQA 3TJNA 3GDUA 1O5AB 3QWCH 2WPLS 1GCTB 1O2JA 3Q76A 2OCVB 3NKKA 1EUFA 3ZZDA 4LXBH 2QF0A 2FMJA 1AO5A 1DLKB 3RLYH 1HBTH 1ZJKA 4TWWA 4CBNA 5LH8A 3PMAB 5DKMA 2PLXA 4RKOB 1C1PA 1GL0E 5DP5A 3E90B 1K1PA 2Y82A 2BY6X 2P8OC 4OGYA 1V2JT 3L3TA 1SFQB 9ESTA 3QLPH 2OXSA 4YO9A 6LPRA 1EB1H 1IQJA 3KL6A 5TCAA 4Y79A 2UUKB 3I78A 1G3BA 1ABIH 1IQMA 1TALA 1Z8RA 3QK1A 5DP6A 2P59A 1BRUP 1Q3XA 1AI8H 1IQKA 5TJXA 2TGPZ 3TPIZ 1SVPA 4K8BA 1IQNA 2V0BA 2DE8A 4WXIA 1GMHF 1HNEE 3NCLA 3TNSA 1OX1A 2J34A 3BIUH 3RXBA 1TGSZ 3BIVH 2Y7XA 1GI8B 4Y8YA 1GBKA 3RXHA 4MNVA 4B74A 1LQEA 4GCHG 5JBAS 1O2UA 3FZZA 1WQVH 1CT0E 1RIWB 2HOBA 1P9UA 2C8WB 1BIOA 1J17T 4FVBA 4X2WA 1SR5C 2ZU2A 5J4SA 1CQQA 1GGDB 1PQAA 5CHAB 1GVZA 2B5TB 4TWYA 4WWYA 1AIXH 1FY4A 1N8OC 1EAUA 1SGYE 4ZROA 1Q31A 4FUFA 5AF9H 5EW1H 5HMAA 1KXCA 5A09A 3A83A 2ZDKA 4JZFH 5A8ZA 5K0HA 3A85A 2ZFPH 2A32A 2IOTA 4ZAEA 1GI3A 3T5FH 1GBHA 5F8ZA 4R0IA 2FXRA 1SGRE 1VZQH 3MOCA 2R3YA 6CHAB 5FPTA 4A92A 1KLJH 2XXLA 1P57B 3SUGA 4KTSA 3FZDA 1SI5H 1SGFG 2KAIA 4ABGA 4INKA 2VIOA 4CRCA 3TGKE 4BAHB 1HAGE 2XC0A 1GMDG 3GYMA 5GJ4B 3BG4B 2VWMA 2AFQB 2JH5D 4GHTA 1O5DH 3UFAA 1HDTH 1C9TA 2V6NA 1DWDH 2V3OH 3MHWU 2Z7FE 2EC9H 3KEEA 2W26A 1QCPA 1P09A 1O2QA 2DE9A 1C1RA 1SL3A 4UD9H 1ORFA 1O3CA 3STIA 2F9NA 2PGBB 3BTDE 3UWIA 3NUMA 2PR3A 3TK5A 1EZSC 3T29A 1RD3B 1HAZB 2RG3A 5EW2H 1Z6JH 1GGDC 1CE5A 1DE7H 1IQHA 2QGRA 1SG8B 1W11U 1TOCB 2C4FH 3M3TA 1BCUH 2PSYA 1ETSH 1OWKA 1DITH 3BTHE 3GCOA 3NWUA 4DY7B 1W13U 1CO7E 1G36A 5ABWA 1BOQA 2JH0D 2GKVE 4UFDH 2Y5HA 2STBE 2AMDA 2A4QA 3P6ZB 5C67A 1LHFH 1EOLA 4U32A 1DVAH 3NZIA 1MKXH 2XC4A 3K2UA 5GDSH 1GCDA 2R9PA 2FDAA 3TH2H 3I29A 5SGAE 4DJZB 3VB3A 2J95A 3RLWH 1ZSKA 3P92A 3T62A 3LGTA 5ESTE 4BTUB 4ABBA 3TIUA 3K6YA 1OWHA 2W3KA 4X6MA 1GI0A 3PB1E 1BUIA 1CA8B 1NESE 1GJBB 4AFZA 5H4IB 1WYKA 4D7FA 2FLBH 1ANDA 1O5CB 3FP7E 3S9AA 4TYDA 2QXJA 1BTHH 5TCCA 3LONA 4I8LA 1EASA 2ZHQH 4AFSA 1KLTA 4AYVB 2Y80A 1C5OH 1V2OT 1AVWA 4X6OA 3SN8A 3S7HB 1WTGH 2Z9KA 2JKHA 5AVDA 1NFUA 1BMNH 4H6TA 2FTLE 2VWNA 4O3UA 1O0DH 1Z71A 5FHTA 1TQ7B 2ODYB 4ISNA 1QBOA 1BRCE 2ZO3H 3QGJA 3T2NA 1MQ6A 1BBRH 4UFGH 3A8BA 1QB1A 1EJAA 1N1LA 3SV8A 3EA9A 5T6GA 2Y81A 2A31A 1GI1A 2A7HA 2XBYA 1C5MD 1Z8IB 3E3TA 3GY4A 1O3JA 3EQ0H 1O3OA 4D8NA 1F5KU 3PROA 1XXFA 1KYNA 4GPGA 1O3GA 1O2XA 4MNXA 3UIRA 4I32A 4JZDH 1UVUH 4UE7H 3DD2H 5JPMH 1MTSA 7ESTE 3D23A 1Y3WA 1VITG 4BXWA 1TLDA 1Z6EA 1HB0B 2Z3CA 1RGQA 2ANYA 2QCYA 1FN8A 3TK9A 1O2RA 1EAXA 1FAKH 3RXUA 3E91A 2FS8A 1GDQA 4K3JA 2BX4A 5C5OA 1V2PT 1O5GH 2G5VA 3TVJB 2XC5A 4LOYH 1DT2A 3S69A 4FUBA 1MAYA 2A1DB 2ZHEH 4WH8A 2BD9A 1A5GH 1TA2A 1XUJA 3BEFB 2XCFA 1O3EA 3PMBB 4AB8A 2G5NA 2ZDNA 4ZXYH 4DT7B 4CREA 2CXVA 1P3CA 4ISLA 1DSTA 3SU3A 1S6HA 4YESB 2QAAA 5JYIA 4ABJA 3E0PB 1P11E 2ZDLA 3RU4D 3UNQA 1C2LA 2H5CA 1S82A 4SGAE 1FIZA 2XCNA 2GGVB 1MCTA 1P2KA 3SV7A 3TJVA 2AGEX 1H9IE 1QRWA 3RXAA 2EA3A 1F0TA 1AFQC 2BDCA 3MNSA 2FOFA 1CU1A 3RXRA 1SQTA 4TY7A 1BBRE 2B8OH 2OBQA 4E7RG 3BTME 5EXMA 1AZ8A 3HK6B 3V0XA 2VIVA 1ABJH 2NU3E 2ZQ1A 5HM2A 1J14A 3GCHB 3T25A 1A0HB 1C5ZB 1CT4E 2G8TA 4BTIB 1UCYE 1NM6A 2O8MA 4AN7A 4ZHMU 1NT1A 3RXIA 1BTZA 2XWAA 1VR1H 1P10A 3V3MA 3EE0B 2R2MB 3L33A 1GBLA 4FVDA 4UONA 1Y3VA 2GP9B 1DY8A 4I31A 1HJAC 2ZEBA 2XBWA 2JH6D 1C5UA 1LDTT 1V2WT 4KELA 2B0FA 2A7JA 3IG6B 1UVTH 1AE5A 1RTFB 3LGVA 2F9UA 3W94A 3ZZ5A 4GCHF 2O8WA 1ZSJA 1OWJA 2G55A 3VB6A 2A4GA 2A7CA 5LGOA 2ILNA 2SGQE 1IOEA 2BDHA 1RRKA 4MPVA 3TJOA 1AZZA 1YPMH 4ISOA 5CMXH 2AMPA 4ZH8A 2D2DA 2F3CE 5A0AE 3SV2H 5C20A 1GBEA 2ULLA 1H4WA 3A86A 2TGAA 3GICB 1BJUA 1TX7A 3SGQE 3SNCA 1L1JA 3BEIB 1O3KA 3PYHA 3MU4A 1TONA 5C3NA 2FM2A 4YTAA 1H8IH 1GBTA 2BDGA 4TPYA 3A8DA 1C2FA 1GG6C 1O2NA 1U6QA 3SI3H 2CV3A 4BOHA 5HGGA 2H9HA 2FWWA 1MKXK 2WV5A 2JETB 1TNJA 1C1VH 4Y6DA 3SJIA 3TU7H 2ZFSA 1GJ9B 3ATMA 2G81E 2CJIA 1A46H 1GMDF 3GDSA 1O36A 1LCYA 1SFIA 3SI4H 1ETRH 3ZVAA 2FI5E 2ZG0H 3Q3KA 3SNEA 1D3PB 2SGEE 3MO6A 5BRRE 1SGNE 4IN1A 1MUEB 4MQAA 2HLCA 1XXDA 1B0EA 1BMMH 3SU5A 5JDUB 3RP2A 1XKBC 3TITA 5DK1A 1FQ3A 2Y6TA 2FOAA 1AU8A 1IQLA 4VGCB 1T8MA 1OKXA 1OSSA 3JZ1B 3OTJE 4H42U 1MTNC 5L2ZH 1VGCB 1YCPM 2ODPA 1UO6A 1EZQA 2BXUH 1LVBA 4NA7A 1GHBG 2A4OA 1QY6A 1SBWA 6GCHG 1OP8A 2GX4A 2C8YB 2ZA5A 2C93B 1GHXH 1TMBH 2C3SA 1BTYA 4AORA 4X1PU 1ACBE 5JBBS 5LPEA 1HAHH 2GZ8A 1C1SA 2BQ6B 3A89A 2QXGA 1SLXB 1TRMA 1OP2A 1RXPA 3MU8A 4Y0YE 3A88A 2VB0A 1ANEA 4FUCA 4J2YB 1SLWB 2Z94A 5DP3A 3RXEA 2BDIA 2WUCA 4JYUH 1O3IA 2QV1A 5BPEA 1K21H 3RXGA 2FP7B 2ZFTA 1Z1JA 2TBSA 3ZZ7A 2GMTC 3A80A 1Y3UA 3M5LA 4AGJA 3SJ8A 1OPHB 2ANWA 1BTWA 1YGCH 1CHOG 1P05A 4IN2A 2GD4B 4DG4A 5DP9A 3BV9B 2BOKA 4Z0KA 1GBCA 3ZZCA 2ZU5A 2XRCA 1GVLA 3M3VA 3RC4A 5LPFA 2ZWLH 4E7NA 1FUJA 1YLCA 4VGCC 2ZFRH 2CN0H 1AKSB 3FANA 3Q3YA 4X8SH 2BZ6H 4XBBA 2HNTE 2VINA 3U8RH 2A45B 2V3HH 5I46H 4Y76A 3P8GA 1GI5A 1C4Y2 1KY9A 3ZZBA 1QA7A 1O2KA 2W3IA 4X6NA 5F03A 4XOJA 1F0UA 1K28D 4Y7AA 1O3MA 1E35B 4ABDA 3RU4T 2ZCKP 5FPYA 3RXCA 2P95A 3RM0H 8LPRA 1MCVA 2FS9A 1IQEA 1C5VA 1EXFA 1SGIB 1ZJDA 3UQVA 4E05H 4FUGA 1K2I1 4X8VH 1GJ6A 2YNAA 4DVAU 3ZYDA 6ESTA 4NZQA 4AB9A 4AFUA 1G2LA 3BG8A 2D1JA 2ZCHP 2SGPE 1D9IA 2ZFFH 2Z3DA 5FPSA 2FX6A 4NFFA 1NFYA 1TFXA 1VITF 2VH6A 3P70B 1P2MA 8GCHG 3KNXA 4UEHH 2P94A 1UK4A 3A87A 1ELDE 4Y11E 2QN5T 1E0FD 1GBFA 1EAWA 3MI4A 3Q00A 1INCA 1BMLA 2GV6A 2VNTA 4IMZA 1KXBA 1QHRB 4AGKA 2BDBA 5ESBA 5C2ZA 4FU9A 3A7ZA 2WPMS 1MBMA 1PPZA 4FU7A 4I8KA 2SNWA 1GDUA 3RUOA 5JBCS 3CS0A 1B7XB 1BJVA 9LPRA 1L0ZA 3D62A 3M7UA 1B5GH 1QQ4A 3URCA 1YPHC 2LPRA 1TNIA 3SU6A 2BVXH 1C5QA 4H6SB 2VVVA 1YPHE 1GBDA 1GJ4H 1LMWB 1W14U 4RKJB 1UTPA 3C1KA 3U1IB 3TGIE 1SB1H 1GHZA 3B23B 5C5NA 2BYAX 3PLBA 1GHYH 1KDQA 2PSXA 2BY7X 1ESAA 1HXFH 4PROA 4CH2B 3LGUA 2UWPA 4GAWA 2VWLA 1Z1IA 4WJG2 2G4TA 3ATKA 2GT7A 2PUQH 1O2WA 5EXNA 1UHBA 3HGNA 1F92A 4MPUA 3UOUA 3LGWA 3GCNA 5FBEA 1TBQH 1C2HA 3UNSA 2QY0B 1K1MA 1O2HA 1ZOMA 2QF3A 5A0BA 5EU8A 1QJ6B 1NPMA 1FNIA 3GY8A 3P8FA 2F83A 4B76A 2XWBI 4WXVA 1C2GA 4O03A 1CBWB 3D49H 5DJ7A 1A5HA 2OTVA 1HPGA 1JWTA 2BD8A 1XUKA 2I6SA 1F5LA 3RMMH 1HIAA 4JK5A 1ELVA 5F8XA 1ZYOA 2AERH 1FPCH 2HPPH 3V12A 1HGTH 4B2BA 1QA0A 1C2IA 1P8VC 2FX4A 4I8HA 2ZGJA 5FCRA 3BTGE 4MNWA 3GY3A 1THRH 3A7TA 3GY5A 2QA9E 1TBRH 4WF8A 4CH8B 3C27B 3GY2A 1O3HA 1W7XH 4NSYA 4X1QU 1W3CA 2D26C 3S7KB 5EPYA 3MMGA 4UDWH 3DFJA 3OSYA 2BLWA 1CVWH 3LIWA 2G51A 1G32B 3A8CA 1DX5M 2OD3B 1D3DB 4IMQA 1UTQA 5A2MH 4ISHH 2CGAA 1YPLH 2HRVA 1YLDA 3DUXH 3ZZAA 1W10U