3MTYA

Comparison of the character and the speed of x-ray-induced structural changes of porcine pancreatic elastase at two temperatures, 100 and 15k. the data set was collected from region a of the crystal. first step of radiation damage
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNNGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray-induced deterioration of disulfide bridges at atomic resolution.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Chymotrypsin-like elastase family member 1
total genus 65
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2010-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mtyA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mtyA01
1K2I1 1NU9A 2G4UA 2ZFTA 5GWZA 3TNTA 2ZC9H 3QDZB 4NFEA 1YF4A 3KN2A 5T6FA 4E06H 1IHSH 2ZDKA 1SGQE 3RLWH 2I6SA 4YT7H 4NSYA 3RXSA 4ABEA 1QA0A 1GI6A 5K0HA 3Q77A 1JIMA 2TBSA 1KDQA 5E0GA 3DD2H 3U1JB 2C93B 1WTGH 3EDXB 2BX3A 2BDAA 2J92A 3M5LA 1MUEB 1A61H 1DDJA 1IQFA 1OP0A 4KTUA 2FOFA 3RXBA 1HNEE 1TOCB 5JB9S 1A3EH 2BM2A 2P16A 3DFJA 4TWYA 3I29A 3SNEA 3RUOA 1ESTA 4ZKOU 5DP3A 2A2QH 1T8NA 1JOUB 3ZZ8A 3ATIA 1UVSH 1HAXB 3E8LA 2XW9A 2GDDA 1ELGA 1GHXH 1O2VA 1GMDF 1UTMA 1DE7H 1P2NA 1ZZZA 3M5OA 1WQSA 2A1DB 1O2MA 1O5AB 4AYYB 1GBLA 3UQVA 1LPGB 3A7YA 2V35A 2A31A 3GISB 2Z9GA 1THPB 5DP4A 2ZU4A 1BRCE 1O38A 1NTPA 1W13U 3GY6A 2CHAC 1C5UA 3UNRA 1HFDA 3SU6A 3LIWA 1NZQH 5HYOA 4TPIZ 1IQKA 5AFYH 4XSKU 1KSNA 4JYVH 3K6ZA 1HXEH 1LKAA 4UD9H 1TMBH 2PWXA 2IN2A 2RG3A 4NZQA 3TNSA 3ZZ4A 3L33A 1GDUA 1UJ1A 1HAZB 1E34B 4MVNA 3M7UA 1K21H 3M3TA 1XUIA 1DUAA 2VJ1A 1C1TA 1BT7A 3T27A 1G3CA 1FY5A 3ZZDA 1W11U 2JKHA 1PPBH 5G4BA 5C1YA 3QTVH 5L30H 3OTJE 1SOTA 1P2KA 1GBDA 2TGPZ 5F8XA 1YPJH 1M9UA 1FY1A 1P04A 2BY5X 1YYY1 4FXGH 2D8WA 4DY7B 3E91A 3KQEA 3RXCA 1FZZA 3U8OH 1S5SA 2ZDMA 1CHGA 2BD9A 1EPTA 2CJIA 5E0HA 3UREA 1NESE 1TA6A 4CHAB 4DVAU 3A7VA 2PUQH 1FY3A 1ARBA 1UCYK 1E36B 1DICA 1FJSA 3EYDA 3NCLA 1WU1A 3SZNA 3S9AA 1K1IA 1ELTA 3RMLH 1HAVB 3LKWA 4NIYA 4FUHA 5L6NH 1KIGH 2PUXB 3TK5A 2F9NA 1C5NH 2BQWB 5E0JA 2A7JA 3E0PB 3ZYEA 3SNBA 4UFDH 1GBHA 4B75A 1KXDA 6ESTA 2H5DA 1HV7A 2FS8A 2ZFPH 1PQ5A 1ESBA 2WV4A 1O2WA 3LT3A 3PROA 3S9BA 4A5TS 2PSYA 1A0JA 1NFYA 1LCYA 1SLXB 3PV4A 3ZZAA 4ZMAH 3UR9A 1UTQA 2B9LA 5C20A 1C1RA 6GCHG 5EOKA 2GCTB 4X6OA 1SGIB 1ABIH 2R3YA 3V13A 4X6PA 1GDQA 1K28D 3C1KA 2WINI 1VITH 8GCHG 1FUJA 1GMCG 1OOKB 4RN6A 1BBRK 4ASHA 1TGBA 2UUYA 2QV1A 4BAKB 1IQEA 3I78A 3A86A 3MHWU 2PFEA 2CGAA 4FUJA 2P8OC 1IQLA 4GVUA 3BG8A 1P8VC 2A5AA 4O3TA 2XC4A 1LHCH 1P2IA 2ZGBH 1KXAA 1IAUA 2WUCA 3MU0A 3T2NA 4FUGA 1FY8E 1T4UH 4TY7A 1C5RA 3DFLA 3GOVB 1J17T 3LGUA 4B76A 3GDSA 4Y7BA 1F5LA 2LPRA 4MPVA 4VGCC 1CA0B 4XDEA 5AFZH 2EC9H 8LPRA 1BMNH 1PYTC 3LDXH 1CA8B 1PFXC 3DUXH 1DPOA 1OWDA 3UWJH 1G32B 5A8ZA 1O2XA 2RA0A 1QRXA 1XVOA 2Y80A 1YKTA 3MWIU 2VU8E 5EXNA 3IWMA 1GJAB 1QTFA 4H6SB 1DUEA 1S84A 3BF6H 1C2FA 1DM4B 3A88A 1C9PA 3E1XB 1EP5A 4GSOA 1OP8A 4INLA 1KXCA 3HK3B 2ZHEH 1XMNB 2GZ8A 3S69A 5L2YH 1GMCF 2B8OH 4R0IA 3RMMH 4A1VA 2SNWA 3SNAA 1O3EA 2QXHA 4F4OC 1KLTA 2BD7A 1V2VT 3NWUA 1ELFA 1PPCE 2C8XB 1TFXA 1IQNA 1P9SA 1QIXB 1SGTA 1Y3WA 3SV8A 1HRTH 4BAQB 3L3TA 3TJOA 2AIPA 4DGJA 1LPZB 3BTEE 2W3KA 2BLVA 5FBIA 3A8DA 4ZAEA 4X6MA 4LOYH 4IMZA 3TGIE 1SHHB 2FM2A 3E6PH 1F7ZA 1EAIA 3SUDA 1WBGB 2Z3EA 3MH4A 1BTWA 1K1NA 1FPHH 4Y6DA 3SV7A 4B71A 3SUGA 3RC5A 2QCYA 5EQQA 1TNLA 3GYMA 3JZ1B 1CT0E 3LGYA 3SW2B 3SNCA 1AKSA 1CT4E 1RXPA 2ZI2H 1HIAB 4Q7ZA 3NUMA 4Y71A 3SOSA 4CBNA 1AWHB 1BA8B 2Z9IA 3NPSA 2TIOA 1SL3A 1NRPH 1GVLA 1O5BB 4HZHA 1TPAE 3VXFH 1NRNH 1ELDE 2BY6X 4X2XA 5DP8A 2ZGCA 2EA3A 3M36A 4O97A 5SGAE 4OS6A 1T32A 1ZJDA 3A89A 4D7FA 4MNWA 3O8RA 1MH0A 1NU7B 3QGNB 3T62A 1FI8A 2FI3E 2AH4X 1C4Y2 2XRCA 5ABWA 3DT0H 1C1MA 1EJNA 2OBQA 2BHGA 5TCCA 2Z7FE 2Z3CA 5FAHA 2CMYA 1HIAA 3SQHE 1FONA 1UVPA 2W5EA 2FOMB 3AW0A 4NA8A 2ILNA 3K9XB 1GL1A 1UTPA 2P3FH 1T31A 4GUXA 3ZZCA 1UVUH 1N6XA 2BB4A 4D76A 2HRVA 2J4IA 5A0CA 4Q2KA 1H9LB 4Y8XA 4WMFA 3F9HA 1AVGH 2KAIA 3QTOH 4AG2A 4JZEH 1HUTH 3LOXA 3TIUA 4CRAA 2W7UA 2JETB 1IHTH 4ISLA 1SGYE 1GCTB 2ZU5A 2ZFFH 1YC0A 1QL7A 1C5LH 2FOGA 2VB0A 1MAYA 1WYKA 2XC5A 3JZ2B 3FZDA 3M5MA 3VB6A 1O5CB 3G01A 3PWCA 5FCRA 1OPHB 3BTQE 2RDLA 1K9OE 1DWBH 3KF2A 1GBCA 2HPPH 5DG6A 1TNHA 1MTNC 1DWCH 2VWOA 4MNYA 2VWLA 1K1JA 3V12A 2FOCA 2VGCB 1CHOG 1HJAB 1T8MA 2G8TA 3UNSA 3BTGE 2BLOA 4TPYA 4ABGA 1D6RA 1QA7A 3RXHA 3RXPA 4Y79A 1O3PB 4A1TA 3BIVH 5A8XA 3BTWE 2C8YB 1CGIE 3RXMA 3GCOA 4YO9A 4Y0ZE 4CR9A 1NRRH 1EASA 3ZZBA 4AB8A 2W3IA 3RXEA 1O36A 1P2QA 1TNIA 2LNCA 1EAWA 1VCQA 4MTBA 3I77A 4I8JA 3SUFA 1G2LA 2J34A 1PQ8A 4DT7B 3RC4A 1AWFH 3VGCC 1V2RT 4Z6AH 4FUDA 4NGAH 2BDGA 3BSQA 3KEEA 1C1UH 1TWXB 1FDPA 3AAUA 2JH0D 3SI4H 1DY8A 1AZZA 2ZU1A 4J2YB 1LHEH 3BEIB 1P11E 1GI2A 4M7GA 2FOBA 1UK4A 1JRSA 1TMUH 2C4FH 4DW2U 1ZGIA 1QBVH 1ZYOA 2ANMH 1ABJH 1TQ7B 1P2MA 2ZFRH 1XXDA 4IGDA 3CENA 1DWEH 1SGFG 1QBNA 1ZSJA 5LGOA 4JCNA 5T3HA 4MPUA 2HNTE 1WCZA 3R3GB 1V2KT 3MO6A 3PLKA 1ZPZA 4OS2A 3S0NA 4KGAA 3S7KB 2H1UA 3VFEA 4OS5A 2WPIS 5JPMH 4AORA 1GMHF 3H7TA 3IG6B 3FANA 3SHCH 1IOEA 3RXFA 3LH1A 1DLKB 2VVCA 6GCHF 3A7WA 3ZV9A 2PKSC 2ODYB 3BTME 2RCEA 2Y5FA 1PPEE 1S0RA 2XCFA 2FODA 1NN6A 1O3HA 3RXQA 3S7HB 1C1OA 2FWWA 1GBMA 4LXBH 3RXRA 1W7XH 2GT7A 1AGJA 3MNSA 3TLOA 1ELEE 1N6YA 1N8OB 2NU4E 1O2NA 1DLEA 2NU3E 2ZGXH 1RS0A 1UTJA 1O3KA 1BBRE 1J9CH 1P03A 1LKBA 1FIZA 4X6NA 1O33A 3PMJA 3BTFE 3STIA 1C5PA 1XM1A 1GI9B 1HJ9A 5F6MA 2FXRA 2R0KA 4BTUB 2ZTYA 3QK1A 1DS2E 1HPGA 2NWNA 1QRZA 1ESAA 1SOZA 1SI5H 3A81A 4IC5A 4TYDA 1EOLA 1AFEH 2TGAA 4K1TA 4YM9A 1V2OT 4JZ1A 1ANCA 1Z6EA 2AGIX 5T6GA 1TOMH 1NY22 4OS1A 3SJKA 1D4PB 4GAWA 1PPFE 1Y5UT 1O35A 2GCHG 4Y8ZA 2BZ6H 4CHAC 5EODA 3SJ9A 2Q6DA 1G37A 3ATMA 2DE8A 4THNH 2HNTF 1DY9A 2OQUA 2VVUA 1AE8H 2PV9B 4GHQA 1VITG 2FZZA 2B0FA 3OY5U 3T5FH 3SO3A 2K1QA 1SC8U 3U98H 3URCA 4YZUA 1BHXF 4MDSA 1FPCH 1ZOMA 1J15A 2PTNA 1WOFA 3NXPA 3TVJB 3MO9A 1GG6C 1C4V2 1L1GA 1C1QA 3O8BA 1RRKA 5I25A 1ACBE 4WVPE 2ANWA 4DG4A 2Q1JA 1MTWA 4X1PU 1BMLA 1EZSC 1O2JA 3ZVGA 2ZU3A 1C1SA 3SU4A 2ZGHA 3FP8E 1YP9A 5JBBS 1SVPA 3PB1E 1MD8A 1OWKA 3SGQE 1TGSZ 1BMAA 1GHAG 1VCPA 1N1LA 3M7QA 4BNRA 4K1EA 2A5IA 1QGFA 1ANDA 1GBFA 1UTKA 1Z8JB 2PGBB 3U9AH 1HJAC 1J14A 2CHAB 1QCPA 4K8BA 2FEQH 3PTBA 1Y8TA 1ZJKA 2Z9LA 3GY2A 1MTUA 1V2LT 3LH3A 4XBBA 1V2JT 4WMDA 1GI5A 3GCHB 1TPOA 1QB1A 3P70B 2ZCKP 1Q2WA 2A7CA 4D7GA 4UONA 1KLIH 2ZQ1A 4KTCA 3T28A 1P3CA 3A87A 1O5EH 1ZHRA 1TX8A 1P2JA 4WH8A 1NPMA 1W8BH 1LQDB 5F8TA 4OGXA 3A85A 2OLGA 3TPIZ 3D62A 1O2UA 1EXFA 3M35A 3ODDA 1PYTD 1A3BH 1O31A 1BJVA 1SPJA 1V6DA 1DXWA 1A7SA 1BRAA 1MQ5A 3RXOA 1EX3A 5ESTE 1XUHA 3S9CA 4I33A 2ZDLA 3EAJA 4F49A 1RJXB 2FS9A 5GCHG 2STAE 1O3LA 2A45B 1SR5C 3VXEH 4BXWA 1A0LA 1EPTC 1TB6H 8KME2 1A2CH 2ZHQH 5DP6A 2XNIA 4NIWA 1FY4A 1THRH 2ZNKH 3VEQB 4BAOB 1CU1A 1ID5H 4I8GA 4D9RA 3ITIA 1MU8B 2ZFSA 1EJMA 1CE5A 5A8YA 1YPLH 1C5TA 2WPMS 1LO6A 2AEIH 5EQSA 4CREA 1HAOH 3KCGH 2OP9A 1S82A 1D9IA 3PYHA 3CS7A 3P6ZB 1AB9C 5LPRA 1IQHA 4I31A 4FU8A 1G30B 2G5NA 3PO1C 1W0ZU 1RTFB 1G9IE 4BTIB 3P8FA 1MQ6A 4UE7H 4BAMB 1K1OA 1ELAA 2WPKS 2JH5D 3MH5A 1CQQA 3EE0B 2Z3DA 1ZPBA 1TNGA 2FP7B 1GVZA 2A4RA 5F03A 2V3HH 2OTVA 3ZZ5A 4PROA 2BOHB 2Y6TA 3SORA 5JBAS 4X2YA 3ZVAA 5EPNA 2F9OA 4DOQA 1EAUA 2C8WB 5DK1A 3MU5A 5CE1A 1XVMA 5C67A 1ZRKA 2QXIA 3MNBA 1P3EA 2AIQA 1T8LA 1AFQC 1IQJA 1BQYA 2SGAA 2FI4E 3MOCA 3M3SA 1QY6A 3HPTB 5AVDA 3SBKA 4ZUHA 3F68H 2GV6A 2A4OA 1NFWA 1SGRE 4I7YH 2YNAA 4AFSA 1SB1H 1RD3B 1F5RA 1BTPA 2CV3A 5LPFA 1Z6JH 3PMAB 1DWDH 1V2TT 4JZFH 4UFFH 1GI0A 1C5WB 3U8TH 1EJAA 2G00A 3KL6A 1WAYB 4NSVA 1C5ZB 1KXFA 3N7OA 2QXGA 3ZVFA 4YTAA 1KTTB 5DGJA 5C3NA 1TIOA 2F91A 3OU0A 5FPTA 1INCA 1KTSB 2SGDE 1TNJA 2VH0A 2BDCA 2P3TB 1O3JA 4X8VH 1OWIA 5LPEA 1CSOE 1LVYA 2CXVA 1G2MA 1UVOA 1MAXA 3T26A 2FYRA 1SGEE 1Y3XA 2D1JA 4I32A 1GBIA 2YNBA 3P95A 1Q31A 2ZEBA 9ESTA 2OXSA 2GZ7A 3M37A 1HBTH 4Z0KA 2GTBA 4JK5A 1GJ6A 4GHTA 4K8YA 2BVXH 3RXJA 3PMHB 1SMFE 3LC5A 1DT2A 4RKJB 1LVOA 5A2MH 2CN0H 1DXPA 1C2IA 1UTLM 4UEHH 1VGCB 3SI3H 3M7TA 2KAIB 5HXFA 1TQ0B 3BEFB 1LMWB 1NS3A 2QY0B 3H7OA 3MTYA 1BIOA 4UDWH 2TGTA 1YPEH 1TPPA 3TH2H 3VB5A 1SFIA 1UO6A 1BTHH 1Z71A 3W94A 2ZDVH 1QQ4A 2GVFA 3E90B 1O2KA 3B8JA 4CRGA 3RXKA 1B0EA 1PQAA 3CS0A 1VJ9U 3ATKA 1NRQH 1SLUB 2BY8X 4A92A 4GCHG 2GKVE 2W7SA 1YPHE 1DOJA 3P8OA 4X8SH 2A32A 3F9GA 1F0SA 3QUMP 4K2YA 5FPSA 1L1NA 1GVKB 3BG4C 1ZTJA 1JIRA 2EEKA 3RU4E 1GJCB 1Q3XA 2ZDNA 2C8ZB 2Q6FA 3UUZA 3RXAA 2ZIQH 1GI7B 2VIWA 1F5KU 2BVRH 4NA7A 1DSTA 4Q80A 2TPIZ 2BLQA 2ESTE 4NZLA 3MI4A 4OS7A 7LPRA 2B7DH 3B23B 1IQGA 3Q3XA 1S6FA 4AFZA 1AFQB 1CO7E 4X8UH 1HXFH 2Y5GA 3ATWA 4MPWA 4IN2A 1EOJA 4X1SU 2PGQB 3A7ZA 2Z6BD 2FESH 1LVBA 4ISNA 4WXIA 2BX4A 5IYTA 5JB8S 2FOHA 1O3GA 2BD4A 1LVMA 4MNVA 1QFKH 3MH7A 2GD4B 4KP0A 1BCUH 1BUIA 1GBJA 1GI4A 3RU4T 3MNCA 4MG3A 1GHVH 1P09A 2ZDAH 4CRBA 2IJOB 5A0AE 2ZGJA 2OCVB 4SGAE 1MTNB 3B9FH 3EGKH 1ELBA 1C5YB 3MU8A 4GCHF 3PTNA 2XBVA 1GHBG 2F9BH 2OBOA 2ZHDA 1FLEE 1S0QA 1MBQA 1NFUA 2PKSB 5J4QA 5C5NA 1GHYH 4ISHH 1GJ9B 7KMEH 2F9UA 2NU2E 2DUCA 1W10U 2XCNA 5DP7A 4U01A 1EATA 2Z9KA 1HAHH 2R0LA 1V2PT 1Z7KA 3UOPA 3GY8A 1P02A 5JBCS 5DPAA 2OC7A 1W12U 3ENSB 4IC6A 6LPRA 2FTLE 3LGVA 5FBEA 1A5IA 5AHGH 3A8AA 3TU7H 1G3BA 1LTOA 3UY9A 1TGCA 4XBDA 3RMNH 1QJ7B 1KYNA 2PW8H 4H6TA 2SGPE 4LK4A 3UFAA 1O2GH 3QZQA 3IITA 2H9EH 2ZQ2A 4ZHAA 2A2XH 1WQVH 1ZMJA 1QL8A 1YPHC 4XOJA 3BIUH 2HNTC 2G55A 4MQAA 2ZWLH 1YCPK 3EQ0H 4IW4E 2ZKSA 3GCTF 1GDNA 2QIQA 3A7TA 4MNXA 3VB4A 1PQ7A 2WUBA 3WY8A 4TWWA 4B74A 1NO9H 1H9IE 5GPIB 1MU6B 3F1SB 5CHAC 2J95A 1DITH 5E2OA 2GGVB 2BDBA 4ZROA 5GXPA 2PSXA 1EKBB 2Q6GA 4OGYA 5A0BA 8GCHF 4AFQA 2UUJB 3H5CB 3FVFB 1GWAA 2Y7ZA 3GCHC 4ZHLU 4FUBA 4YLQH 2R9PA 1G36A 1C2GA 3V3MA 4X2VA 1L0ZA 3QGJA 4WF8A 2ZPRA 1VR1H 2ZHWH 4NWKA 1DFPA 4OS4A 1HGTH 1O3FA 2P59A 3RMOH 1O0DH 1AE5A 1P9UA 3UIRA 1C2DA 1C5SA 3SGBE 5ETXA 3SJIA 1TX6A 5DP5A 2Y82A 4HGCA 3T29A 3D49H 1W14U 4I8KA 1ANBA 1FV9A 1TA2A 1V2WT 1CGJE 2BY7X 2WPHS 5FXLA 2GDEH 1W0YH 3C27B 3TH4H 1AMHA 4H42U 3SU3A 4YOIA 1VITF 2UUFB 2BQ6B 3RDZA 2BQ7B 1OYQA 2VNTA 1AZ8A 5ESBA 1P06A 1GI3A 2GMTC 4KELA 4WJG2 1GCTC 1QJ1B 4LZ1H 4KKDA 3GY3A 2JETC 4FU9A 1B7XB 4DIIH 1XUJA 3TGJE 1BTUA 4CBOA 1NC6A 3GY5A 1EPTB 1THSH 3V7TA 4ABIA 2AGGX 1V2NT 2J2UA 3SU0A 4K5ZA 5JYIA 1KLJH 2ZPSA 1JBUH 3SHAH 1SGFA 1OSSA 1Y3YA 1YPGH 3BTTE 3SGAE 1ETSH 1KXEA 3P8GA 5EPYA 2SFAA 2WPJS 1FAXA 4BOHA 3ZVCA 4NFFA 3SJ8A 1YM0A 5EGMA 4A7IB 4VGCB 1TYNA 1S6HA 1GG6B 1RFNA 1BTZA 1PPGE 4B2AA 5L2ZH 2A4GA 3UWIA 1Y59T 1JRTA 5K7RA 4B73A 1FIWA 1A46H 2Y81A 3NK8A 4IMQA 5C1XA 3T25A 2H5CA 4WH6A 2AFQB 1W2KH 2F9PA 3ESTA 3P8NA 1QRWA 1GBEA 1UHBB 1F92A 1O3NA 1CHOF 4A6LA 5DJ7A 2BD2A 3QWCH 2IOTA 1O2LA 2ULLA 4CH2B 5C2ZA 3U1IB 1SFQB 5EW2H 1B0FA 3SU5A 3LJOA 1SLWB 1JWTA 3GCTG 2VWMA 5AF9H 1EUFA 1HAPH 1FN6A 5GJ4B 4CRFA 8ESTE 4AGJA 2UWOA 3MU4A 1EZUC 2ANKH 1TABE 1P2OA 2FX4A 2QGRA 1PPHE 3RXLA 1ZLRA 2BVSH 1UTOA 1MMJN 2DE9A 2AYWA 3QO6A 4ISOA 4AGKA 1AI8H 3SUEA 1GGDC 1YLDA 3R0FA 1XUFA 2O8UA 1XUGA 2XC0A 3ATLA 4E05H 2VIOA 1GHAF 3BTKE 3GDUA 1UCYH 2WYGA 1HAVA 3ZYDA 5FX5A 1O3OA 1AUJA 2PHBA 1TLDA 3NKKA 1O3MA 3MYWA 1EZQA 1JMOH 1EB2A 2Z94A 1D6WA 3K6YA 4J1YA 1KDQB 1TPSA 2ZTZA 4YT6H 4D9QA 1PPZA 2G51A 3SV6A 2QA9E 1MBMA 1GL0E 1UK2A 3GDVA 1OS8A 1XKAC 2ZU2A 1LHGH 2ZCLP 4FUEA 1GJ5H 1E35B 3LJJA 4ESTE 4ABFA 5HM9A 2BOKA 2A7HA 1W3CA 1J16A 1XXFA 1GMHG 4RSPA 1BTXA 4IS5A 3E16B 1WUNH 3MFJA 1C1VH 1H9HE 1IQIA 4AZ2B 5JDUB 2HWLB 1AQ7A 3ODFA 3VGCB 1J8AA 3EA7A 1DANH 1BRBE 1E37B 2VVVA 2RA3A 1AIXH 1Z1JA 3DA9B 2O8LA 1O2HA 3TH3H 2BYAX 1D3QB 4K60A 4CRDA 2FOEA 1H4WA 2G52A 1H8IH 4ZH8A 4XBCA 1V3XA 1ZTKA 3DHKH 3AVZA 3RXTA 4E7RG 2XTTB 4XE4A 4AFUA 5TJXA 4E7NA 2HLCA 1AN1E 3BG4B 1AKSB 2TGDA 2ZECA 1AVXA 2AMQA 3EA8A 4NIXA 1QB6A 3A84A 5EG4A 3PLBA 1HAGE 1AHTH 1K1MA 1N8OC 1E38B 2A4QA 2G4TA 1T8OA 2FI5E 5J4SA 2D2DA 4U30A 1AVWA 5JBTA 1TRNA 2HOBA 1Z8IB 3OSYA 3RLYH 3FAOA 1HDTH 1O3CA 1E0FD 4CH8B 3PO1B 1GHBF 3RM2H 2FDAA 3GY4A 1Z8GA 2BXUH 2R3UA 4Y76A 1AD8H 2W26A 2CF8H 1C1WH 1GCDA 1P0SH 1UHBA 3VB7A 2GMTB 5EQRA 1HJ8A 1YBWA 4NWLA 1F0TA 3A82A 2UWPA 4DURA 1O2YA 1VGCC 2BD5A 1D3PB 2SGFE 2F83A 3D65E 4JYUH 3ZVDA 4B2BA 5FCKA 2QF0A 1O2RA 1V2QT 3O8DA 4AOQA 1DX5M 4YLUA 1D3TB 2FMJA 6CHAC 4YOJA 2R2WU 1ARCA 2A5KA 3SU1A 1V2UT 1QJ6B 4GLYA 1NT1A 3AW1A 2OD3B 2VWNA 2F3CE 2FLBH 3SU2A 2EI6A 4IBLH 2AMDA 1V2ST 4K3JA 1CVWH 1S81A 2V3OH 3SN8A 5HMAA 3ZZ6A 1WSSH 4WXVA 3SQEE 2ZG0H 1L1JA 1C2KA 3F6UH 2ODQA 1A5HA 2NU0E 4ZKSU 3F9EA 1PJPA 3LONA 2JH6D 4D8NA 3A8BA 3M61U 2O8WA 1OKXA 1GJ4H 4RKOB 4X1RU 3P92A 3NZIA 2ODPA 3RXIA 2ASUB 3RM0H 3QX5H 2SGEE 1CBWC 3SNDA 4JZIA 3RC6A 1NRSH 3GY7A 1Z8RA 3LGIA 1F0RA 1XKBC 4X2WA 1ANEA 2OC1A 1V2MT 1BOQA 2PLXA 3PLPA 4AB9A 2BD8A 4ABDA 1C5QA 1F2SE 2J38A 2HVXA 2QAAA 5F8ZA 2CF9H 1YCPM 2VIPA 4HI3A 3SV9A 4Y8YA 1BITA 1QR3E 1SQTA 2VINA 4DIHH 3TJVA 3E0NB 2SNVA 4NG9H 1A0HB 1RTKA 3HGPA 1O2TA 1SSXA 3D23A 4FUIA 1KXBA 3GYLB 1XUKA 1C1NA 2BDHA 4XFQA 3OYPA 2XWBI 2VH6A 1TMTH 3MNXA 2VGCC 1WTHD 3FP7E 3KHVA 3MU1A 4FUCA 1P01A 4AN7A 1ZMLA 5FX6A 2UWLA 4FUFA 2GT8A 3BTDE 1QL9A 1G3EA 4DCDA 1TNKA 1D3DB 1MKXK 1BTYA 4HFPB 1C2EA 1Z1IA 1CBWB 1A4WH 2HGTH 1YPMH 3ZZ7A 2GCHF 5A09A 3Q00A 1BB0B 2OC0A 1IQMA 4JZDH 1QQUA 5LH8A 3RXDA 1MZDA 3TITA 2FPZA 1O2QA 1MZAA 5E8EH 2G5VA 3BTHE 3BV9B 2H6MA 7GCHF 2ALVA 2GZ9A 5H4IB 1UVTH 1O2PA 1T4VH 2EI7A 2OUAA 1C5VA 2BY9X 1ZSLA 1HB0B 1LDTT 2BZAA 2XBWA 3FP6E 3RXUA 1ZHPA 2ZA5A 3Q3YA 3QZRA 5EXMA 3KIDU 3VPKA 3Q3KA 1O39A 5CMXH 1O37A 1SQOA 1TONA 2QYIA 1QB9A 3STJA 2J9NA 6CHAB 2AS9A 4ZXXH 1O34A 2Z9JA 1GHZA 3HKJB 1H8DH 5E2PA 3KQCA 3MMGA 1MTVA 1C5OH 3GCNA 2ZTXA 1TALA 1CGHA 3Q76A 4Y10E 1ZHMA 1TAWA 5EU8A 5HGGA 2NU1E 5DO4H 4ISIH 2AMPA 2VIVA 1OP2A 1P10A 1AY6H 3TJNA 1GBTA 2OC8A 1QURH 1TGTA 1B5GH 1C2MA 1C5MD 1GJ7B 2ZHFH 1ELVA 3PM3A 1A1RA 3O8CA 1BRUP 1TRMA 3FFGA 5GDSH 1QHRB 5PTPA 2O9QA 2ZFQH 9LPRA 2OQ5A 1OX1A 2I6QA 3A8CA 1CA0C 1Y5AT 4JK6A 4Y11E 1C2JA 2THFB 1L4ZA 4Q7YA 4X1NU 4TY6A 5IDKA 2FLRH 1XX9A 4UFEH 1YCPH 3VB3A 2FO9A 4SGBE 4DJZB 1EB1H 4QT8C 2ZPQA 2G81E 5C5OA 4AG1A 1S85A 1UCYE 3CP7A 4BAHB 2QC2A 4YESB 1EAXA 2P8OB 2XXLA 2P95A 3MH6A 1UMAH 1GI8B 3ZVBA 3KNXA 3FZZA 3L6PA 1S83A 2XWAA 1ZGVA 2QXJA 1HAYB 2D26C 2BTCE 2C90B 1NM6A 2F9VA 2STBE 3URDA 4BTTB 1TE0A 1FN8A 1HAIH 1MD7A 1C2HA 4A1XA 1A5GH 3TGKE 3K2UA 4ABBA 3QN7A 1Y3UA 2V6NA 2P93A 1UTNA 3RU4D 3HATH 2GCTC 4X8TH 1MKWK 1BZXE 4CR5A 1DSUA 3ZVEA 1AUTC 2ZCHP 7ESTE 7GCHG 4I8LA 3A80A 3TK6A 1LHFH 3HK6B 3ZZ3A 1BJUA 3HGNA 4JMYA 1OXGA 4ZKRU 1O5GH 2H9HA 2GX4A 3F9FA 1O3AA 5GCHF 3AAVA 3SJOA 1C5XB 1MTSA 1FQ3A 1MCTA 4ZXYH 1SGDE 4AYVB 4O3UA 1X7AC 4AX9H 3ZV8A 1AO5A 1GGDB 3EA9A 1HCGA 1L2EA 1MCVA 4MLFB 5FHTA 1YLCA 2AGEX 2P94A 4ZHMU 4KTSA 4U2WA 2XBXA 1SGCA 4K1SA 3AASA 5DP9A 1SHYA 2V0BA 4FVDA 4BXSA 4B1TA 1TBZH 1F0UA 3UR6A 1ZR0A 1O2OA 1OYTH 4NA9H 4BANB 1EQ9A 4ZKNU 1FXYA 1O3IA 4MPXA 2YOLA 1GMDG 2H9TH 4FU7A 2BD3A 1RIWC 2M5TA 4HTCH 2A0QB 2TRMA 3PMBB 1T7CA 1ZSKA 2QF3A 3A83A 5HM2A 1SGPE 1RIWB 3KQDA 3LPRA 1P12E 1RGQA 1SG8B 3MO3A 4INKA 4R8TB 1O2ZA 1GJDB 1EZXC 1VCWA 3HKIB 2AERH 4ABAA 2UUKB 2XYAA 1GJ8B 2H2ZA 1G3DA 1HYLA 3U69H 3W95A 2PTCE 3PWBA 1AB9B 1O5FH 2SGQE 1K1LA 4WMEA 1C1PA 1ELCA 1K1PA 2BMGB 4K69A 2J94A 2IPHA 4B2CA 5I46H 1W7GH 1TGNA 1GBAA 3BEUA 5GIBA 1H1BA 3E3TA 2EI8A 1KY9A 5C1UA 3A7XA 1MKXH 5EXLA 3U8RH 1ZPCA 1ZTLA 3M3VA 2BDIA 3OX7U 2BLWA 4NCYA 4O03A 1P57B 1O3BA 2FX6A 1RTLA 1QNJA 2ZP0H 2PKAA 1Y5BT 5BRRE 2ZF0H 3K65B 4U32A 5EW1H 2PR3A 1GPZA 1OWEA 1QBOA 1FNIA 3RP2A 4O9VA 4NIVA 1C2LA 1L4DA 1O5DH 1GBBA 1SQAA 3M5NA 2PKAB 4JYTA 1AU8A 1BHXB 5CHAB 3P17H 1VZQH 1BDAA 2WYJA 3LGTA 2VIQA 1TBQH 3TK9A 2OINA 2VIDA 1GI1A 1SBWA 2O8MA 3OY6U 1O2IA 2FYQA 4Q7XA 4Y0YE 4I8HA 3UOUA 1TX7A 1SLVB 1TRYA 2P3UB 3LU9B 2HPQH 4H4FA 5B6OA 4YOGA 1NROH 1WV7H 4INHA 1SGNE 3LGWA 5BPEA 1GBKA 2Y7XA 3QLPH 3LC3A 1Y3VA 4WWYA 2Y5HA 2ALPA 2B5TB 3GICB 1O32A 3UPEA 2BXTH 3SV2H 1NFXA 3TJUA 5DKMA 1LPKB 5FPYA 5TCAA 4IN1A 2BDYA 1K22H 2ZZUH 1O3DA 1MKWH 1OWHA 1YPKH 2ANYA 1C9TA 2O8TA 2QN5T 3ZZ9A 1UK3A 2WV5A 2HALA 1ORFA 2GP9B 3KGPA 1YGCH 1FMGA 3UNQA 1OWJA 1ETTH 1BBRH 2ZO3H 1P05A 1C4U2 4UFGH 4X1QU 3ELAH 2XBYA 4ABJA 4WY3A 1ZMNA 1JXPA 3RXGA 1BMMH 3BN9A 3UTUH 1FAKH 5T6DA 4ABHA 4FVBA 1CT2E 4Y7AA 1DVAH 2FIRH 1O30A 2R2MB 4GPGA 1EP6A 1ETRH 4CRCA 1LHDH 1LQEA 4LZ4B 1TBRH 1VJAU 3V0XA 1HLTH 2FTMA 1GJBB 4X0WU 3RXVA 2GV7A 2C3SA 1ZRBA 2FOAA 1U6QA 2WPLS 3UQOA 1GHWH 1O2SA 3KQBA
chains in the Genus database with same CATH superfamily
1K2I1 1NU9A 2G4UA 2ZFTA 5GWZA 3TNTA 2ZC9H 3QDZB 4NFEA 1E1QD 1YF4A 3KN2A 5T6FA 1IHSH 4E06H 2YMSB 1SGQE 2ZDKA 3RLWH 2I6SA 4YT7H 4NSYA 3RXSA 4ABEA 1QA0A 1GI6A 5K0HA 3Q77A 1JIMA 2TBSA 1KDQA 5E0GA 3DD2H 3U1JB 2C93B 1WTGH 3EDXB 2BX3A 2BDAA 2J92A 3M5LA 1MUEB 1A61H 1DDJA 1IQFA 1OP0A 4KTUA 2FOFA 3RXBA 1HNEE 1TOCB 5JB9S 1A3EH 2BM2A 2P16A 3DFJA 4TWYA 3I29A 3SNEA 3RUOA 1ESTA 4ZKOU 5DP3A 2A2QH 1T8NA 1JOUB 3ZZ8A 3ATIA 1UVSH 1HAXB 3E8LA 2XW9A 2GDDA 1ELGA 1GHXH 1O2VA 5KGOA 1GMDF 1UTMA 1DE7H 1P2NA 1ZZZA 3M5OA 1WQSA 2A1DB 1O2MA 1O5AB 4AYYB 1GBLA 3UQVA 1LPGB 3A7YA 2V35A 2A31A 3GISB 2Z9GA 1THPB 5DP4A 2ZU4A 1BRCE 1O38A 1NTPA 1W13U 3GY6A 2CHAC 1C5UA 3UNRA 1HFDA 3SU6A 2KCPA 3LIWA 1NZQH 5HYOA 4TPIZ 1IQKA 5AFYH 4XSKU 1KSNA 4JYVH 3K6ZA 1HXEH 1LKAA 4UD9H 1TMBH 2PWXA 2IN2A 2RG3A 4NZQA 3TNSA 3ZZ4A 3L33A 1GDUA 1KMHB 1UJ1A 1HAZB 1E34B 4MVNA 3M7UA 1K21H 3M3TA 1XUIA 1DUAA 2VJ1A 1C1TA 1BT7A 3T27A 1G3CA 1FY5A 3ZZDA 1W11U 2JKHA 1PPBH 5G4BA 5C1YA 3QTVH 5L30H 3OTJE 1SOTA 1P2KA 1GBDA 2TGPZ 5F8XA 1YPJH 1M9UA 1FY1A 1P04A 2BY5X 1YYY1 4FXGH 2D8WA 4DY7B 3E91A 3KQEA 3RXCA 1FZZA 3U8OH 1H8HD 1S5SA 2ZDMA 1CHGA 2BD9A 1EPTA 2CJIA 5E0HA 3UREA 1NESE 1TA6A 4CHAB 4DVAU 3A7VA 2PUQH 1FY3A 1ARBA 1UCYK 1E36B 1DICA 1FJSA 3EYDA 3NCLA 1WU1A 2QE7D 3SZNA 3S9AA 1K1IA 1ELTA 3RMLH 1HAVB 3LKWA 4NIYA 4FUHA 5L6NH 1KIGH 2PUXB 3TK5A 2F9NA 1C5NH 2BQWB 5E0JA 2A7JA 3E0PB 3ZYEA 3SNBA 4UFDH 1GBHA 4B75A 1KXDA 3F3BA 6ESTA 2H5DA 1HV7A 2FS8A 2ZFPH 1PQ5A 1ESBA 2WV4A 1O2WA 3LT3A 3PROA 3S9BA 4A5TS 2PSYA 1A0JA 1NFYA 1LCYA 1SLXB 3PV4A 3ZZAA 4ZMAH 3UR9A 1UTQA 2B9LA 5C20A 1C1RA 6GCHG 5EOKA 2EQNA 2L6OA 2GCTB 2J5UA 4X6OA 1SGIB 1ABIH 2R3YA 3V13A 4X6PA 1GDQA 1K28D 3C1KA 2WINI 1VITH 8GCHG 1FUJA 1GMCG 1OOKB 4RN6A 1BBRK 4ASHA 1TGBA 2UUYA 2QV1A 4BAKB 1IQEA 3I78A 3A86A 3MHWU 2PFEA 2CGAA 4FUJA 2P8OC 3W1EA 1IQLA 4GVUA 3BG8A 3F2GA 1P8VC 2A5AA 4O3TA 1FX0B 2XC4A 1LHCH 1P2IA 2ZGBH 1KXAA 1IAUA 2WUCA 3MU0A 3T2NA 4FUGA 1FY8E 1T4UH 4TY7A 1C5RA 3DFLA 3GOVB 1J17T 3LGUA 4B76A 2JJ1D 3GDSA 4Y7BA 2K8IA 1F5LA 2LPRA 4MPVA 4VGCC 1UW7A 1CA0B 4XDEA 5AFZH 2EC9H 2J97A 8LPRA 1BMNH 1PYTC 3LDXH 1CA8B 1PFXC 3DUXH 1DPOA 5HIZA 1OWDA 3UWJH 1G32B 2KCYA 5A8ZA 1O2XA 2RA0A 1QRXA 1XVOA 2WHXA 2Y80A 1YKTA 3MWIU 2VU8E 4OM9A 5EXNA 3IWMA 4Q4LA 1GJAB 1QTFA 4H6SB 2GJGA 1DUEA 1S84A 3BF6H 1C2FA 1DM4B 3A88A 1C9PA 3E1XB 1EP5A 4GSOA 1OP8A 4INLA 2EY4C 1KXCA 3CNRA 3HK3B 2ZHEH 1XMNB 2GZ8A 3S69A 5L2YH 1GMCF 2B8OH 4R0IA 3RMMH 4A1VA 2SNWA 3SNAA 1O3EA 2QXHA 4F4OC 1KLTA 2BD7A 1V2VT 3NWUA 1ELFA 1NBMD 1PPCE 2C8XB 1TFXA 1IQNA 1P9SA 1QIXB 1SGTA 1Y3WA 3SV8A 1HRTH 4BAQB 3L3TA 3TJOA 2AIPA 4DGJA 2KR7A 1LPZB 3BTEE 2W3KA 2BLVA 5FBIA 3A8DA 3F2HA 4ZAEA 4X6MA 4LOYH 4IMZA 3TGIE 1SHHB 2FM2A 3E6PH 1F7ZA 5C0TA 1EAIA 3SUDA 1WBGB 2Z3EA 3MH4A 1BTWA 1K1NA 1FPHH 4Y6DA 3SV7A 4B71A 3SUGA 3RC5A 2QCYA 5EQQA 1TNLA 3GYMA 3JZ1B 1CT0E 3LGYA 3SW2B 3SNCA 1AKSA 1CT4E 1RXPA 2ZI2H 1HIAB 4Q7ZA 3NUMA 2OK5A 4Y71A 3SOSA 4CBNA 1AWHB 1BA8B 2Z9IA 3NPSA 2TIOA 1SL3A 1NRPH 1GVLA 1O5BB 4HZHA 1TPAE 3VXFH 1NRNH 1ELDE 2BY6X 4X2XA 5DP8A 2ZGCA 2EA3A 3M36A 4O97A 5SGAE 4OS6A 1T32A 1ZJDA 3A89A 4D7FA 4MNWA 3O8RA 1MH0A 1NU7B 3OFND 3QGNB 3T62A 1FI8A 2FI3E 2L74A 2AH4X 1C4Y2 2XRCA 5ABWA 3DT0H 2K0QA 1C1MA 1EJNA 2OBQA 2BHGA 5TCCA 2Z7FE 2Z3CA 2KZ4A 5FAHA 2CMYA 1HIAA 3SQHE 1FONA 1UVPA 2W5EA 2FOMB 3AW0A 4NA8A 2ILNA 4FETA 3K9XB 1GL1A 1UTPA 2P3FH 1T31A 4GUXA 3ZZCA 1UVUH 1N6XA 2BB4A 4D76A 1K0HA 2HRVA 2J4IA 5A0CA 2YMSC 4Q2KA 1H9LB 4Y8XA 4WMFA 3F9HA 1AVGH 2KAIA 3QTOH 4AG2A 4JZEH 1HUTH 3LOXA 3TIUA 4CRAA 2W7UA 3PRBA 2JETB 1IHTH 4ISLA 1SGYE 1GCTB 2ZU5A 2ZFFH 4TSFD 1YC0A 1QL7A 1C5LH 2FOGA 2VB0A 1MAYA 1WYKA 2XC5A 2V7QD 3JZ2B 3FZDA 3M5MA 3VB6A 1O5CB 3G01A 3PWCA 5FCRA 1OPHB 3BTQE 2RDLA 1K9OE 1DWBH 3KF2A 1GBCA 2HPPH 5DG6A 1TNHA 3FOAA 1MTNC 1DWCH 2VWOA 1YY3A 2VWLA 4MNYA 1K1JA 3V12A 2FOCA 2VGCB 1CHOG 1HJAB 1T8MA 2G8TA 3UNSA 3BTGE 2BLOA 4TPYA 4ABGA 1D6RA 1QA7A 3RXHA 3RXPA 4Y79A 1O3PB 4A1TA 3BIVH 5A8XA 2JDID 3BTWE 2C8YB 1CGIE 3RXMA 3GCOA 4YO9A 4Y0ZE 4CR9A 1NRRH 3UAIC 1EASA 3ZZBA 4AB8A 2W3IA 3RXEA 5EJLA 1O36A 1P2QA 1TNIA 2LNCA 1EAWA 1VCQA 4MTBA 3I77A 4I8JA 3SUFA 1G2LA 2J34A 1PQ8A 4XRNA 4DT7B 3RC4A 1AWFH 3VGCC 1V2RT 4Z6AH 4FUDA 4NGAH 2BDGA 3BSQA 3KEEA 1C1UH 1TWXB 1FDPA 3AAUA 2JH0D 3SI4H 1DY8A 1AZZA 2ZU1A 4J2YB 1LHEH 3BEIB 1P11E 1GI2A 4M7GA 2FOBA 1UK4A 1JRSA 1TMUH 2C4FH 4DW2U 1ZGIA 1QBVH 1ZYOA 2ANMH 1ABJH 1TQ7B 1P2MA 2ZFRH 4I86A 1XXDA 4IGDA 3CENA 1DWEH 5HKKD 5C94A 1SGFG 1QBNA 1ZSJA 1BMFD 5LGOA 4JCNA 5T3HA 3VG8A 4MPUA 2HNTE 1WCZA 3R3GB 1V2KT 3MO6A 3PLKA 1ZPZA 4OS2A 3WW7A 3S0NA 4KGAA 3S7KB 2H1UA 3VFEA 4OS5A 2WPIS 5JPMH 4AORA 1GMHF 3H7TA 3IG6B 3FANA 3SHCH 1IOEA 3RXFA 3LH1A 1DLKB 4B6FA 2VVCA 6GCHF 3A7WA 3ZV9A 2PKSC 2ODYB 3BTME 2RCEA 2Y5FA 1PPEE 1S0RA 2XCFA 2FODA 1NN6A 1O3HA 3RXQA 3SYJA 3S7HB 1C1OA 2FWWA 1GBMA 4LXBH 3RXRA 1W7XH 2GT7A 1AGJA 3MNSA 3TLOA 1ELEE 1N6YA 1N8OB 2NU4E 1O2NA 1DLEA 2NU3E 2ZGXH 1RS0A 1UTJA 1O3KA 1BBRE 1J9CH 1P03A 1LKBA 1FIZA 4X6NA 1O33A 3PMJA 3BTFE 3STIA 1C5PA 1XM1A 1GI9B 1HJ9A 5F6MA 2FXRA 2R0KA 4BTUB 2ZTYA 3QK1A 1DS2E 1HPGA 2NWNA 1QRZA 4YXWD 1ESAA 1SOZA 1SI5H 3A81A 4IC5A 4TYDA 1EOLA 1AFEH 2TGAA 4K1TA 4YM9A 1V2OT 4JZ1A 1ANCA 1Z6EA 3PV2A 2AGIX 5T6GA 1TOMH 1NY22 4OS1A 3SJKA 1D4PB 4GAWA 1PPFE 1Y5UT 5CDFE 1O35A 5DN6D 2GCHG 4Y8ZA 2BZ6H 2RDEA 4CHAC 5EODA 5GNDA 3SJ9A 2Q6DA 1G37A 3ATMA 2DE8A 4THNH 2HNTF 2KFWA 1DY9A 2OQUA 2VVUA 2LELA 1AE8H 2PV9B 4GHQA 1VITG 2FZZA 2B0FA 3OY5U 3T5FH 3SO3A 2K1QA 1SC8U 3U98H 3URCA 4YZUA 1BHXF 4MDSA 1FPCH 1ZOMA 1J15A 2PTNA 1WOFA 3NXPA 3TVJB 3MO9A 2QF5A 2F4LA 1GG6C 1C4V2 1L1GA 1C1QA 3O8BA 1RRKA 5I25A 1ACBE 4WVPE 2ANWA 4DG4A 2Q1JA 2VBCA 1MTWA 4X1PU 1BMLA 1EZSC 1O2JA 3ZVGA 2ZU3A 1C1SA 3SU4A 2ZGHA 3FP8E 1SQRA 1YP9A 5JBBS 1SVPA 3PB1E 1MD8A 1OWKA 3SGQE 1TGSZ 1BMAA 2LP6A 1GHAG 1VCPA 1N1LA 3M7QA 4BNRA 4K1EA 1W0KD 2A5IA 1QGFA 1ANDA 1GBFA 1UTKA 1Z8JB 2PGBB 3U9AH 1HJAC 1J14A 2CHAB 1QCPA 4K8BA 3NRLA 2FEQH 3PTBA 1Y8TA 1ZJKA 2Z9LA 3GY2A 1MTUA 1V2LT 3LH3A 4XBBA 1V2JT 4WMDA 1GI5A 4XD7D 3GCHB 1TPOA 1QB1A 3P70B 2ZCKP 1Q2WA 2A7CA 4D7GA 4UONA 1KLIH 2ZQ1A 4KTCA 3OAAD 3T28A 1P3CA 3A87A 1O5EH 4DT4A 1ZHRA 1TX8A 1P2JA 4WH8A 1NPMA 1W8BH 1LQDB 5F8TA 4OGXA 3A85A 2OLGA 3TPIZ 3D62A 1O2UA 1EXFA 3M35A 3ODDA 1PYTD 1A3BH 1O31A 1BJVA 1SPJA 1V6DA 4ASUD 1DXWA 1A7SA 1BRAA 1MQ5A 3RXOA 1EX3A 5ESTE 1XUHA 3S9CA 4I33A 3OE7D 2ZDLA 3EAJA 1VKYA 1RJXB 2FS9A 4F49A 5T1VA 5GCHG 5HIYA 2STAE 1O3LA 2A45B 1SR5C 3VXEH 4BXWA 1A0LA 1EPTC 1TB6H 8KME2 1A2CH 2ZHQH 5DP6A 2XNIA 4NIWA 2CK3D 1FY4A 1THRH 2ZNKH 3VEQB 4BAOB 1CU1A 1ID5H 4I8GA 4D9RA 3ITIA 1MU8B 2ZFSA 1EJMA 1CE5A 5A8YA 1YPLH 1C5TA 2WPMS 1LO6A 2AEIH 5EQSA 4CREA 1HAOH 3KCGH 2OP9A 3AK5A 1S82A 1D9IA 3PYHA 3CS7A 3P6ZB 1AB9C 5LPRA 1IQHA 4I31A 4FU8A 1G30B 2G5NA 3PO1C 1W0ZU 1RTFB 1G9IE 4BTIB 3P8FA 3OTPA 1MQ6A 4UE7H 4BAMB 1K1OA 1ELAA 1E79D 2JH5D 2WPKS 1CQQA 3MH5A 3EE0B 2Z3DA 1ZPBA 1MABB 1TNGA 2FP7B 1GVZA 2HLDD 2A4RA 5F03A 2V3HH 2OTVA 3ZZ5A 4PROA 2BOHB 2Y6TA 3SORA 5JBAS 4X2YA 3ZVAA 5EPNA 2F9OA 4DOQA 1EAUA 2C8WB 5DK1A 3MU5A 5CE1A 1XVMA 5C67A 1ZRKA 2QXIA 3MNBA 1P3EA 2AIQA 1T8LA 1AFQC 2RFKC 1IQJA 1BQYA 2SGAA 3WWBA 2FI4E 3MOCA 3M3SA 1QY6A 3HPTB 5AVDA 3SBKA 2PP6A 4ZUHA 3F68H 2GV6A 2A4OA 1NFWA 1SGRE 4I7YH 2YNAA 4AFSA 1SB1H 1RD3B 1F5RA 1BTPA 2CV3A 5LPFA 2KCAA 1Z6JH 3PMAB 4Z1MD 5F53A 1DWDH 1V2TT 2W6JD 4JZFH 4UFFH 1GI0A 1C5WB 3U8TH 1EJAA 2G00A 3KL6A 1WAYB 4NSVA 1C5ZB 1KXFA 3N7OA 2QXGA 3EE7A 3N7EA 2HVYB 3ZVFA 4YTAA 1KTTB 5DGJA 5C3NA 1TIOA 2F91A 3OU0A 5FPTA 1INCA 1EFRD 1KTSB 2SGDE 1TNJA 2VH0A 2BDCA 2P3TB 1O3JA 4X8VH 1OWIA 5LPEA 1CSOE 1LVYA 2CXVA 1G2MA 1UVOA 1MAXA 3T26A 4P00A 2FYRA 1SGEE 1Y3XA 2D1JA 4I32A 1GBIA 2YNBA 3P95A 1Q31A 2ZEBA 9ESTA 2OXSA 2GZ7A 3M37A 1HBTH 4Z0KA 2GTBA 4JK5A 1GJ6A 4GHTA 4K8YA 2BVXH 2JIZD 3RXJA 3PMHB 1SMFE 3LC5A 1DT2A 4RKJB 1LVOA 5A2MH 2CN0H 1DXPA 1C2IA 1UTLM 4UEHH 1VGCB 3SI3H 3M7TA 2KAIB 5HXFA 1TQ0B 3BEFB 1LMWB 1NS3A 2QY0B 3H7OA 3MTYA 1BIOA 4UDWH 2TGTA 1YPEH 1TPPA 3TH2H 3VB5A 1SFIA 1UO6A 1BTHH 1Z71A 3W94A 2ZDVH 1QQ4A 2GVFA 3E90B 1O2KA 3B8JA 4CRGA 3RXKA 1B0EA 1PQAA 3CS0A 1VJ9U 3ATKA 1NRQH 1SLUB 2BY8X 4A92A 4GCHG 2GKVE 3N7DA 2W7SA 1YPHE 1DOJA 3P8OA 4X8SH 2A32A 3F9GA 1F0SA 3QUMP 4K2YA 5FPSA 1L1NA 1GVKB 3F0OA 3BG4C 1ZTJA 1JIRA 2EEKA 3RU4E 1GJCB 1Q3XA 2ZDNA 2C8ZB 2Q6FA 4ACBA 3UUZA 3RXAA 2ZIQH 1GI7B 2VIWA 1F5KU 4RT1A 2BVRH 4NA7A 1DSTA 4Q80A 2TPIZ 5EJZA 2BLQA 2ESTE 4NZLA 3MI4A 4OS7A 7LPRA 2B7DH 3B23B 1IQGA 3Q3XA 1S6FA 4AFZA 1AFQB 1CO7E 4X8UH 1HXFH 2Y5GA 3ATWA 4MPWA 4IN2A 1EOJA 4ZCNA 4X1SU 2PGQB 3A7ZA 2Z6BD 2FESH 1LVBA 4ISNA 4WXIA 2BX4A 5IYTA 5JB8S 2FOHA 1O3GA 2BD4A 1LVMA 4MNVA 5DSFA 1QFKH 3MH7A 2GD4B 4KP0A 1BCUH 1BUIA 1GBJA 1GI4A 1YWUA 3RU4T 3MNCA 4MG3A 1GHVH 1P09A 2ZDAH 4TT3D 4CRBA 2IJOB 5A0AE 2ZGJA 2OCVB 4SGAE 1MTNB 3B9FH 3EGKH 1ELBA 1C5YB 3MU8A 4GCHF 3PTNA 2XBVA 1GHBG 2F9BH 2OBOA 2ZHDA 1FLEE 1S0QA 1MBQA 1NFUA 2PKSB 5J4QA 5C5NA 1GHYH 4ISHH 1GJ9B 3SZEA 7KMEH 2F9UA 2NU2E 2DUCA 1W10U 2XCNA 5DP7A 4U01A 1EATA 2Z9KA 1HAHH 2R0LA 1V2PT 1Z7KA 3UOPA 3GY8A 1P02A 5JBCS 5DPAA 2OC7A 1W12U 3ENSB 4IC6A 6LPRA 2FTLE 3LGVA 5FBEA 1A5IA 5AHGH 3A8AA 3TU7H 1G3BA 1LTOA 3UY9A 1TGCA 1OHHD 4XBDA 3RMNH 1QJ7B 1KYNA 2PW8H 4H6TA 2SGPE 4LK4A 2JJ2D 3UFAA 1O2GH 3QZQA 3H09A 3IITA 2H9EH 2ZQ2A 4ZHAA 2A2XH 1WQVH 1ZMJA 1QL8A 1YPHC 4XOJA 3BIUH 2HNTC 2G55A 4MQAA 2ZWLH 1YCPK 3EQ0H 4IW4E 2F43B 2ZKSA 3GCTF 1GDNA 2QIQA 3A7TA 4MNXA 3VB4A 1PQ7A 2WUBA 3WY8A 4TWWA 4B74A 1NO9H 1H9IE 5GPIB 1MU6B 3F1SB 5CHAC 2J95A 1DITH 5E2OA 2GGVB 3DCLA 2BDBA 4ZROA 5GXPA 2PSXA 5IK2D 1EKBB 2Q6GA 4OGYA 5A0BA 8GCHF 4AFQA 2UUJB 3H5CB 3FVFB 1GWAA 2Y7ZA 3GCHC 4ZHLU 4FUBA 4YLQH 2R9PA 1G36A 2KCOA 1C2GA 3V3MA 4X2VA 1L0ZA 3QGJA 4WF8A 2ZPRA 1VR1H 2ZHWH 4NWKA 1DFPA 4OS4A 1HGTH 1O3FA 2P59A 3RMOH 1O0DH 1AE5A 1P9UA 3UIRA 1C2DA 1C5SA 3SGBE 5ETXA 3SJIA 1TX6A 5DP5A 2Y82A 4HGCA 1COWD 3D49H 3T29A 1W14U 4I8KA 1ANBA 1FV9A 1TA2A 1V2WT 1CGJE 2BY7X 2WPHS 5FXLA 2GDEH 1W0YH 3C27B 3TH4H 1AMHA 4H42U 3SU3A 4YOIA 1VITF 2UUFB 2BQ6B 3RDZA 2BQ7B 1OYQA 2VNTA 1AZ8A 5ESBA 1P06A 1H8ED 1GI3A 2GMTC 3UB0A 4KELA 4WJG2 1GCTC 1QJ1B 4LZ1H 4KKDA 3GY3A 2JETC 4FU9A 1B7XB 4DIIH 1XUJA 3TGJE 1BTUA 4CBOA 1NC6A 3GY5A 1EPTB 1THSH 3V7TA 4ABIA 2AGGX 1V2NT 2J2UA 2M2AA 3SU0A 4K5ZA 5JYIA 1KLJH 2ZPSA 1JBUH 3SHAH 1SGFA 1OSSA 1Y3YA 1YPGH 3BTTE 3SGAE 1ETSH 1KXEA 3P8GA 5EPYA 2SFAA 2WPJS 1FAXA 4BOHA 5KECA 3ZVCA 4NFFA 3SJ8A 1YM0A 5EGMA 4A7IB 4VGCB 1TYNA 1S6HA 2WPDD 1GG6B 1RFNA 1BTZA 1PPGE 4B2AA 5L2ZH 2A4GA 3UWIA 1Y59T 1JRTA 5K7RA 4B73A 1FIWA 1A46H 2Y81A 3NK8A 4IMQA 5C1XA 3T25A 2H5CA 4WH6A 2AFQB 1W2KH 2F9PA 3ESTA 3P8NA 1QRWA 1GBEA 1UHBB 1F92A 1O3NA 1CHOF 4A6LA 3DSPA 5DJ7A 2BD2A 3QWCH 2IOTA 2V3MA 1O2LA 2ULLA 4CH2B 5C2ZA 3U1IB 1SFQB 5EW2H 1B0FA 3SU5A 3LJOA 1SLWB 1JWTA 3GCTG 2VWMA 5AF9H 1EUFA 2AHME 1HAPH 1FN6A 5GJ4B 4CRFA 8ESTE 4AGJA 2UWOA 3MU4A 1EZUC 2ANKH 1TABE 1P2OA 2FX4A 2QGRA 2XNDD 1PPHE 3RXLA 1ZLRA 2BVSH 5CHBA 1UTOA 1MMJN 2DE9A 2AYWA 3QO6A 4ISOA 4AGKA 1AI8H 3SUEA 2J98B 1GGDC 1YLDA 3R0FA 1XUFA 2O8UA 1XUGA 2XC0A 3ATLA 4E05H 2VIOA 1GHAF 3BTKE 3GDUA 1UCYH 2WYGA 1HAVA 3ZYDA 5FX5A 1O3OA 1AUJA 2PHBA 1TLDA 3NKKA 1O3MA 3MYWA 1EZQA 1JMOH 1EB2A 2Z94A 1D6WA 3K6YA 4J1YA 1KDQB 1TPSA 2ZTZA 4YT6H 4D9QA 1PPZA 2G51A 3SV6A 2QA9E 1MBMA 1GL0E 1UK2A 3GDVA 1OS8A 1XKAC 2ZU2A 1LHGH 2ZCLP 4FUEA 1GJ5H 1E35B 3LJJA 4ESTE 4ABFA 5HM9A 2BOKA 2YMSD 2A7HA 1W3CA 1J16A 1XXFA 1GMHG 4RSPA 1BTXA 4IS5A 3E16B 1WUNH 3MFJA 1C1VH 1H9HE 1IQIA 4AZ2B 3N99A 5JDUB 2HWLB 1AQ7A 3ODFA 3VGCB 1J8AA 3EA7A 1DANH 1BRBE 1E37B 2RA3A 2VVVA 1AIXH 1Z1JA 3DA9B 2O8LA 1O2HA 3TH3H 2BYAX 1D3QB 4K60A 4CRDA 2FOEA 1H4WA 2G52A 1H8IH 4ZH8A 4RI0A 4XBCA 1V3XA 1ZTKA 3DHKH 4B6EA 3AVZA 3RXTA 4E7RG 2XTTB 4XE4A 4AFUA 5TJXA 4E7NA 2HLCA 1AN1E 3BG4B 1AKSB 2TGDA 2ZECA 1AVXA 2AMQA 3EA8A 4NIXA 1QB6A 3A84A 5EG4A 3PLBA 1HAGE 1AHTH 1K1MA 2WZQA 1N8OC 1E38B 2A4QA 2G4TA 1T8OA 2FI5E 5J4SA 2D2DA 4U30A 1AVWA 5JBTA 1TRNA 2HOBA 1Z8IB 3OSYA 3RLYH 3FAOA 1HDTH 1O3CA 1E0FD 4CH8B 3PO1B 1GHBF 3RM2H 2FDAA 3GY4A 1Z8GA 2BXUH 2R3UA 4Y76A 1AD8H 2W26A 2CF8H 1C1WH 1GCDA 1P0SH 1UHBA 3VB7A 2GMTB 5EQRA 1HJ8A 1YBWA 3OEHD 2QF4A 4NWLA 1F0TA 3A82A 2UWPA 4DURA 1O2YA 1VGCC 2BD5A 1D3PB 2SGFE 2F83A 3D65E 4JYUH 3ZVDA 4B2BA 5FCKA 2QF0A 1O2RA 1V2QT 3O8DA 4AOQA 1DX5M 4YLUA 1D3TB 2FMJA 6CHAC 4YOJA 2R2WU 1ARCA 2A5KA 3SU1A 5EIYA 1V2UT 1QJ6B 4GLYA 1NT1A 3AW1A 2OD3B 2VWNA 2F3CE 2FLBH 3SU2A 2EI6A 4IBLH 2AMDA 3FN8A 1V2ST 4K3JA 1CVWH 1S81A 2V3OH 3SN8A 1WDIA 5HMAA 3ZZ6A 1WSSH 4WXVA 3SQEE 2ZG0H 1L1JA 2XOKD 1C2KA 3F6UH 2ODQA 1A5HA 2NU0E 4ZKSU 3F9EA 1PJPA 3LONA 2JH6D 4D8NA 3A8BA 3M61U 2O8WA 3KYFA 5C0UA 1OKXA 1GJ4H 4RKOB 4X1RU 3P92A 3NZIA 2ODPA 3RXIA 2ASUB 3RM0H 3QX5H 2SGEE 5FL7D 1CBWC 3SNDA 4JZIA 3RC6A 1NRSH 3GY7A 1Z8RA 3LGIA 1F0RA 1XKBC 4X2WA 1ANEA 2OC1A 1V2MT 1BOQA 2PLXA 3PLPA 4AB9A 2BD8A 4ABDA 1C5QA 1F2SE 2J38A 2HVXA 2QAAA 5F8ZA 2CF9H 1YCPM 2VIPA 4HI3A 3SV9A 4Y8YA 1BITA 1QR3E 1SQTA 2VINA 4DIHH 3TJVA 3E0NB 2SNVA 4NG9H 1A0HB 1RTKA 3HGPA 1O2TA 1SSXA 3D23A 4FUIA 1KXBA 3GYLB 1XUKA 1C1NA 2BDHA 4XFQA 3OYPA 1YLNA 2XWBI 2VH6A 1TMTH 3MNXA 2VGCC 1WTHD 3FP7E 3KHVA 3MU1A 4FUCA 1P01A 4AN7A 1ZMLA 5FX6A 2UWLA 4FUFA 2GT8A 3BTDE 1QL9A 1G3EA 4DCDA 2WV9A 1TNKA 1D3DB 1MKXK 1BTYA 4HFPB 1C2EA 1Z1IA 5KEDA 1CBWB 1A4WH 2HGTH 1YPMH 3ZZ7A 2GCHF 5A09A 3Q00A 1BB0B 2OC0A 1IQMA 4JZDH 1QQUA 5LH8A 3RXDA 1MZDA 3TITA 2FPZA 1O2QA 1MZAA 5E8EH 2G5VA 1E1RD 3BTHE 3BV9B 2H6MA 7GCHF 2ALVA 2GZ9A 5H4IB 1UVTH 1O2PA 1T4VH 2EI7A 2OUAA 3PRDA 1C5VA 2BY9X 1ZSLA 1HB0B 1LDTT 2BZAA 2XBWA 3FP6E 3RXUA 3PV5A 1ZHPA 2ZA5A 3Q3YA 3QZRA 5EXMA 3KIDU 3VPKA 3Q3KA 1O39A 5CMXH 1O37A 1SQOA 1TONA 2QYIA 1QB9A 3STJA 2J9NA 3DSOA 6CHAB 2AS9A 4ZXXH 1O34A 2Z9JA 1GHZA 3HKJB 1H8DH 5E2PA 3KQCA 3MMGA 1MTVA 5B6LA 1C5OH 1QZ8A 2ZTXA 3GCNA 1TALA 1CGHA 3Q76A 4Y10E 3F0PA 1ZHMA 1TAWA 5EU8A 5HGGA 2NU1E 5DO4H 4ISIH 2AMPA 2VIVA 1OP2A 1P10A 1AY6H 3TJNA 1GBTA 2OC8A 1QURH 1TGTA 1B5GH 1C2MA 1C5MD 1GJ7B 2ZHFH 1ELVA 3PM3A 1A1RA 3O8CA 1BRUP 1TRMA 3FFGA 5GDSH 1QHRB 5PTPA 2O9QA 2ZFQH 9LPRA 2OQ5A 1OX1A 2I6QA 3A8CA 1CA0C 1Y5AT 4JK6A 4Y11E 1C2JA 2THFB 1L4ZA 4Q7YA 4X1NU 4TY6A 5IDKA 2FLRH 1XX9A 4UFEH 4RT0A 1YCPH 3VB3A 2FO9A 4SGBE 4DJZB 1EB1H 4ACAA 4QT8C 2ZPQA 2G81E 2KM0A 2IPQX 5C5OA 4AG1A 1S85A 1UCYE 3CP7A 4BAHB 2QC2A 4YESB 1EAXA 2P8OB 2XXLA 2P95A 3MH6A 1UMAH 1GI8B 3ZVBA 3DSGA 3KNXA 3FZZA 3L6PA 1S83A 2XWAA 1ZGVA 2QXJA 1HAYB 2D26C 2BTCE 2C90B 1NM6A 2F9VA 2STBE 3URDA 4BTTB 1TE0A 1FN8A 1HAIH 4AC9A 1MD7A 1C2HA 4A1XA 1A5GH 3TGKE 3K2UA 4ABBA 3QN7A 4F55A 1Y3UA 2V6NA 3ZIAD 2P93A 1UTNA 3RU4D 3HATH 2GCTC 4X8TH 1MKWK 4M9FA 1BZXE 4CR5A 1DSUA 3ZVEA 1AUTC 2ZCHP 7ESTE 7GCHG 4I8LA 3A80A 3TK6A 1LHFH 3HK6B 3ZZ3A 1BJUA 3HGNA 4JMYA 1OXGA 3GS9A 4ZKRU 1O5GH 2H9HA 2GX4A 3F9FA 1O3AA 5GCHF 3AAVA 3SJOA 1C5XB 1MTSA 1FQ3A 1MCTA 4ZXYH 1SGDE 4AYVB 4O3UA 1X7AC 4AX9H 3ZV8A 1AO5A 1GGDB 3EA9A 1HCGA 1WXRA 1L2EA 1MCVA 4MLFB 5FHTA 1YLCA 2AGEX 2P94A 4ZHMU 4KTSA 4U2WA 2XBXA 1SGCA 4K1SA 2W6ID 3AASA 5DP9A 3F2FA 1SHYA 2V0BA 4FVDA 4BXSA 3KQ5A 4B1TA 1TBZH 1F0UA 3UR6A 1ZR0A 1O2OA 1OYTH 4NA9H 4P02A 4BANB 1EQ9A 4ZKNU 1FXYA 1O3IA 4MPXA 2YOLA 1GMDG 2H9TH 4FU7A 2BD3A 1RIWC 2M5TA 4HTCH 2A0QB 2TRMA 3PMBB 1T7CA 1ZSKA 2QF3A 3A83A 5HM2A 1SGPE 1RIWB 3KQDA 3LPRA 1P12E 1RGQA 1SG8B 3MO3A 4INKA 4R8TB 1O2ZA 1GJDB 1EZXC 2IJD1 1VCWA 3HKIB 2AERH 3OEED 4ABAA 2UUKB 2XYAA 1GJ8B 2H2ZA 1G3DA 1HYLA 3U69H 3W95A 2PTCE 3PWBA 1AB9B 1O5FH 2SGQE 1K1LA 4WMEA 1C1PA 1ELCA 1K1PA 2BMGB 4K69A 2J94A 2IPHA 4B2CA 5I46H 1W7GH 1TGNA 1GBAA 2J98A 3BEUA 5GIBA 1H1BA 3E3TA 5EJ1A 2EI8A 1KY9A 5C1UA 3A7XA 1MKXH 5EXLA 3U8RH 1ZPCA 1ZTLA 3M3VA 2BDIA 3OX7U 1SKYE 2BLWA 4NCYA 4O03A 1P57B 1O3BA 2FX6A 1RTLA 1QNJA 2ZP0H 2PKAA 1Y5BT 5BRRE 2ZF0H 3K65B 4U32A 5EW1H 2PR3A 1GPZA 1OWEA 1QBOA 1FNIA 3RP2A 4O9VA 4NIVA 1C2LA 1L4DA 1O5DH 1GBBA 1SQAA 3M5NA 4HG6A 2PKAB 4JYTA 1AU8A 1BHXB 5CHAB 3P17H 1VZQH 1BDAA 2WYJA 3LGTA 2VIQA 1TBQH 2KX4A 3TK9A 2OINA 1GI1A 2O8MA 1SBWA 2VIDA 3OY6U 1O2IA 2FYQA 4Q7XA 4Y0YE 4I8HA 3UOUA 1TX7A 1SLVB 1TRYA 2P3UB 3LU9B 2HPQH 4H4FA 5B6OA 4YOGA 1NROH 1WV7H 4INHA 1SGNE 3LGWA 5BPEA 1GBKA 2Y7XA 3QLPH 3LC3A 1Y3VA 4WWYA 2Y5HA 2ALPA 2B5TB 3GICB 1O32A 2WSSD 3KYGA 3UPEA 2BXTH 3FO8D 1S6LA 3SV2H 1NFXA 3TJUA 5C17A 5DKMA 1LPKB 5FPYA 5TCAA 4IN1A 2BDYA 1K22H 2ZZUH 1O3DA 1MKWH 1OWHA 1YPKH 2ANYA 1C9TA 2O8TA 2QN5T 3ZZ9A 1UK3A 2WV5A 2HALA 3WWFA 4F48B 1ORFA 2GP9B 3KGPA 1YGCH 1FMGA 3UNQA 1OWJA 1ETTH 1BBRH 2ZO3H 1P05A 1C4U2 4UFGH 4X1QU 3ELAH 2XBYA 4ABJA 3MQKC 4WY3A 1ZMNA 1JXPA 3RXGA 1W0JD 1BMMH 3BN9A 3UTUH 1FAKH 3U28C 5T6DA 4ABHA 4FVBA 1CT2E 4FOUC 4Q63A 1DVAH 4Y7AA 2FIRH 1NBME 1O30A 2R2MB 4GPGA 1EP6A 1ETRH 4CRCA 1LHDH 1LQEA 4LZ4B 1TBRH 1VJAU 3V0XA 1HLTH 2FTMA 1GJBB 4X0WU 3RXVA 3FKSD 2GV7A 2C3SA 1ZRBA 2FOAA 1U6QA 2WPLS 3UQOA 1GHWH 1O2SA 3KQBA
chains in the Genus database with same CATH topology
1K2I1 1NU9A 2G4UA 2ZFTA 5GWZA 3TNTA 2ZC9H 3QDZB 4NFEA 1YF4A 3KN2A 5T6FA 4E06H 1IHSH 2ZDKA 1SGQE 3RLWH 2I6SA 4YT7H 4NSYA 3RXSA 4ABEA 1QA0A 1GI6A 5K0HA 3Q77A 1JIMA 2TBSA 1KDQA 5E0GA 3DD2H 3U1JB 2C93B 1WTGH 3EDXB 2BX3A 2BDAA 2J92A 3M5LA 1MUEB 1A61H 1DDJA 1IQFA 1OP0A 4KTUA 2FOFA 3RXBA 1HNEE 1TOCB 5JB9S 1A3EH 2BM2A 2P16A 3DFJA 4TWYA 3I29A 3SNEA 3RUOA 1ESTA 4ZKOU 5DP3A 2A2QH 1T8NA 1JOUB 3ZZ8A 3ATIA 1UVSH 1HAXB 3E8LA 2XW9A 2GDDA 1ELGA 1GHXH 1O2VA 1GMDF 1UTMA 1DE7H 1P2NA 1ZZZA 3M5OA 1WQSA 2A1DB 1O2MA 1O5AB 4AYYB 1GBLA 3UQVA 1LPGB 3A7YA 2V35A 2A31A 3GISB 2Z9GA 1THPB 5DP4A 2ZU4A 1BRCE 1O38A 1NTPA 1W13U 3GY6A 2CHAC 1C5UA 3UNRA 1HFDA 3SU6A 3LIWA 1NZQH 5HYOA 4TPIZ 1IQKA 5AFYH 4XSKU 1KSNA 4JYVH 3K6ZA 1HXEH 1LKAA 4UD9H 1TMBH 2PWXA 2IN2A 2RG3A 4NZQA 3TNSA 3ZZ4A 3L33A 1GDUA 1UJ1A 1HAZB 1E34B 4MVNA 3M7UA 1K21H 3M3TA 1XUIA 1DUAA 2VJ1A 1C1TA 1BT7A 3T27A 1G3CA 1FY5A 3ZZDA 1W11U 2JKHA 1PPBH 5G4BA 5C1YA 3QTVH 5L30H 3OTJE 1SOTA 1P2KA 1GBDA 2TGPZ 5F8XA 1YPJH 1M9UA 1FY1A 1P04A 2BY5X 1YYY1 4FXGH 2D8WA 4DY7B 3E91A 3KQEA 3RXCA 1FZZA 3U8OH 1S5SA 2ZDMA 1CHGA 2BD9A 1EPTA 2CJIA 5E0HA 3UREA 1NESE 1TA6A 4CHAB 4DVAU 3A7VA 2PUQH 1FY3A 1ARBA 1UCYK 1E36B 1DICA 1FJSA 3EYDA 3NCLA 1WU1A 3SZNA 3S9AA 1K1IA 1ELTA 3RMLH 1HAVB 3LKWA 4NIYA 4FUHA 5L6NH 1KIGH 2PUXB 3TK5A 2F9NA 1C5NH 2BQWB 5E0JA 2A7JA 3E0PB 3ZYEA 3SNBA 4UFDH 1GBHA 4B75A 1KXDA 6ESTA 2H5DA 1HV7A 2FS8A 2ZFPH 1PQ5A 1ESBA 2WV4A 1O2WA 3LT3A 3PROA 3S9BA 4A5TS 2PSYA 1A0JA 1NFYA 1LCYA 1SLXB 3PV4A 3ZZAA 4ZMAH 3UR9A 1UTQA 2B9LA 5C20A 1C1RA 6GCHG 5EOKA 2GCTB 4X6OA 1SGIB 1ABIH 2R3YA 3V13A 4X6PA 1GDQA 1K28D 3C1KA 2WINI 1VITH 8GCHG 1FUJA 1GMCG 1OOKB 4RN6A 1BBRK 4ASHA 1TGBA 2UUYA 2QV1A 4BAKB 1IQEA 3I78A 3A86A 3MHWU 2PFEA 2CGAA 4FUJA 2P8OC 1IQLA 4GVUA 3BG8A 1P8VC 2A5AA 4O3TA 2XC4A 1LHCH 1P2IA 2ZGBH 1KXAA 1IAUA 2WUCA 3MU0A 3T2NA 4FUGA 1FY8E 1T4UH 4TY7A 1C5RA 3DFLA 3GOVB 1J17T 3LGUA 4B76A 3GDSA 4Y7BA 1F5LA 2LPRA 4MPVA 4VGCC 1CA0B 4XDEA 5AFZH 2EC9H 8LPRA 1BMNH 1PYTC 3LDXH 1CA8B 1PFXC 3DUXH 1DPOA 1OWDA 3UWJH 1G32B 5A8ZA 1O2XA 2RA0A 1QRXA 1XVOA 2Y80A 1YKTA 3MWIU 2VU8E 5EXNA 3IWMA 1GJAB 1QTFA 4H6SB 1DUEA 1S84A 3BF6H 1C2FA 1DM4B 3A88A 1C9PA 3E1XB 1EP5A 4GSOA 1OP8A 4INLA 1KXCA 3HK3B 2ZHEH 1XMNB 2GZ8A 3S69A 5L2YH 1GMCF 2B8OH 4R0IA 3RMMH 4A1VA 2SNWA 3SNAA 1O3EA 2QXHA 4F4OC 1KLTA 2BD7A 1V2VT 3NWUA 1ELFA 1PPCE 2C8XB 1TFXA 1IQNA 1P9SA 1QIXB 1SGTA 1Y3WA 3SV8A 1HRTH 4BAQB 3L3TA 3TJOA 2AIPA 4DGJA 1LPZB 3BTEE 2W3KA 2BLVA 5FBIA 3A8DA 4ZAEA 4X6MA 4LOYH 4IMZA 3TGIE 1SHHB 2FM2A 3E6PH 1F7ZA 1EAIA 3SUDA 1WBGB 2Z3EA 3MH4A 1BTWA 1K1NA 1FPHH 4Y6DA 3SV7A 4B71A 3SUGA 3RC5A 2QCYA 5EQQA 1TNLA 3GYMA 3JZ1B 1CT0E 3LGYA 3SW2B 3SNCA 1AKSA 1CT4E 1RXPA 2ZI2H 1HIAB 4Q7ZA 3NUMA 4Y71A 3SOSA 4CBNA 1AWHB 1BA8B 2Z9IA 3NPSA 2TIOA 1SL3A 1NRPH 1GVLA 1O5BB 4HZHA 1TPAE 3VXFH 1NRNH 1ELDE 2BY6X 4X2XA 5DP8A 2ZGCA 2EA3A 3M36A 4O97A 5SGAE 4OS6A 1T32A 1ZJDA 3A89A 4D7FA 4MNWA 3O8RA 1MH0A 1NU7B 3QGNB 3T62A 1FI8A 2FI3E 2AH4X 1C4Y2 2XRCA 5ABWA 3DT0H 1C1MA 1EJNA 2OBQA 2BHGA 5TCCA 2Z7FE 2Z3CA 5FAHA 2CMYA 1HIAA 3SQHE 1FONA 1UVPA 2W5EA 2FOMB 3AW0A 4NA8A 2ILNA 3K9XB 1GL1A 1UTPA 2P3FH 1T31A 4GUXA 3ZZCA 1UVUH 1N6XA 2BB4A 4D76A 2HRVA 2J4IA 5A0CA 4Q2KA 1H9LB 4Y8XA 4WMFA 3F9HA 1AVGH 2KAIA 3QTOH 4AG2A 4JZEH 1HUTH 3LOXA 3TIUA 4CRAA 2W7UA 2JETB 1IHTH 4ISLA 1SGYE 1GCTB 2ZU5A 2ZFFH 1YC0A 1QL7A 1C5LH 2FOGA 2VB0A 1MAYA 1WYKA 2XC5A 3JZ2B 3FZDA 3M5MA 3VB6A 1O5CB 3G01A 3PWCA 5FCRA 1OPHB 3BTQE 2RDLA 1K9OE 1DWBH 3KF2A 1GBCA 2HPPH 5DG6A 1TNHA 1MTNC 1DWCH 2VWOA 4MNYA 2VWLA 1K1JA 3V12A 2FOCA 2VGCB 1CHOG 1HJAB 1T8MA 2G8TA 3UNSA 3BTGE 2BLOA 4TPYA 4ABGA 1D6RA 1QA7A 3RXHA 3RXPA 4Y79A 1O3PB 4A1TA 3BIVH 5A8XA 3BTWE 2C8YB 1CGIE 3RXMA 3GCOA 4YO9A 4Y0ZE 4CR9A 1NRRH 1EASA 3ZZBA 4AB8A 2W3IA 3RXEA 1O36A 1P2QA 1TNIA 2LNCA 1EAWA 1VCQA 4MTBA 3I77A 4I8JA 3SUFA 1G2LA 2J34A 1PQ8A 4DT7B 3RC4A 1AWFH 3VGCC 1V2RT 4Z6AH 4FUDA 4NGAH 2BDGA 3BSQA 3KEEA 1C1UH 1TWXB 1FDPA 3AAUA 2JH0D 3SI4H 1DY8A 1AZZA 2ZU1A 4J2YB 1LHEH 3BEIB 1P11E 1GI2A 4M7GA 2FOBA 1UK4A 1JRSA 1TMUH 2C4FH 4DW2U 1ZGIA 1QBVH 1ZYOA 2ANMH 1ABJH 1TQ7B 1P2MA 2ZFRH 1XXDA 4IGDA 3CENA 1DWEH 1SGFG 1QBNA 1ZSJA 5LGOA 4JCNA 5T3HA 4MPUA 2HNTE 1WCZA 3R3GB 1V2KT 3MO6A 3PLKA 1ZPZA 4OS2A 3S0NA 4KGAA 3S7KB 2H1UA 3VFEA 4OS5A 2WPIS 5JPMH 4AORA 1GMHF 3H7TA 3IG6B 3FANA 3SHCH 1IOEA 3RXFA 3LH1A 1DLKB 2VVCA 6GCHF 3A7WA 3ZV9A 2PKSC 2ODYB 3BTME 2RCEA 2Y5FA 1PPEE 1S0RA 2XCFA 2FODA 1NN6A 1O3HA 3RXQA 3S7HB 1C1OA 2FWWA 1GBMA 4LXBH 3RXRA 1W7XH 2GT7A 1AGJA 3MNSA 3TLOA 1ELEE 1N6YA 1N8OB 2NU4E 1O2NA 1DLEA 2NU3E 2ZGXH 1RS0A 1UTJA 1O3KA 1BBRE 1J9CH 1P03A 1LKBA 1FIZA 4X6NA 1O33A 3PMJA 3BTFE 3STIA 1C5PA 1XM1A 1GI9B 1HJ9A 5F6MA 2FXRA 2R0KA 4BTUB 2ZTYA 3QK1A 1DS2E 1HPGA 2NWNA 1QRZA 1ESAA 1SOZA 1SI5H 3A81A 4IC5A 4TYDA 1EOLA 1AFEH 2TGAA 4K1TA 4YM9A 1V2OT 4JZ1A 1ANCA 1Z6EA 2AGIX 5T6GA 1TOMH 1NY22 4OS1A 3SJKA 1D4PB 4GAWA 1PPFE 1Y5UT 1O35A 2GCHG 4Y8ZA 2BZ6H 4CHAC 5EODA 3SJ9A 2Q6DA 1G37A 3ATMA 2DE8A 4THNH 2HNTF 1DY9A 2OQUA 2VVUA 1AE8H 2PV9B 4GHQA 1VITG 2FZZA 2B0FA 3OY5U 3T5FH 3SO3A 2K1QA 1SC8U 3U98H 3URCA 4YZUA 1BHXF 4MDSA 1FPCH 1ZOMA 1J15A 2PTNA 1WOFA 3NXPA 3TVJB 3MO9A 1GG6C 1C4V2 1L1GA 1C1QA 3O8BA 1RRKA 5I25A 1ACBE 4WVPE 2ANWA 4DG4A 2Q1JA 1MTWA 4X1PU 1BMLA 1EZSC 1O2JA 3ZVGA 2ZU3A 1C1SA 3SU4A 2ZGHA 3FP8E 1YP9A 5JBBS 1SVPA 3PB1E 1MD8A 1OWKA 3SGQE 1TGSZ 1BMAA 1GHAG 1VCPA 1N1LA 3M7QA 4BNRA 4K1EA 2A5IA 1QGFA 1ANDA 1GBFA 1UTKA 1Z8JB 2PGBB 3U9AH 1HJAC 1J14A 2CHAB 1QCPA 4K8BA 2FEQH 3PTBA 1Y8TA 1ZJKA 2Z9LA 3GY2A 1MTUA 1V2LT 3LH3A 4XBBA 1V2JT 4WMDA 1GI5A 3GCHB 1TPOA 1QB1A 3P70B 2ZCKP 1Q2WA 2A7CA 4D7GA 4UONA 1KLIH 2ZQ1A 4KTCA 3T28A 1P3CA 3A87A 1O5EH 1ZHRA 1TX8A 1P2JA 4WH8A 1NPMA 1W8BH 1LQDB 5F8TA 4OGXA 3A85A 2OLGA 3TPIZ 3D62A 1O2UA 1EXFA 3M35A 3ODDA 1PYTD 1A3BH 1O31A 1BJVA 1SPJA 1V6DA 1DXWA 1A7SA 1BRAA 1MQ5A 3RXOA 1EX3A 5ESTE 1XUHA 3S9CA 4I33A 2ZDLA 3EAJA 4F49A 1RJXB 2FS9A 5GCHG 2STAE 1O3LA 2A45B 1SR5C 3VXEH 4BXWA 1A0LA 1EPTC 1TB6H 8KME2 1A2CH 2ZHQH 5DP6A 2XNIA 4NIWA 1FY4A 1THRH 2ZNKH 3VEQB 4BAOB 1CU1A 1ID5H 4I8GA 4D9RA 3ITIA 1MU8B 2ZFSA 1EJMA 1CE5A 5A8YA 1YPLH 1C5TA 2WPMS 1LO6A 2AEIH 5EQSA 4CREA 1HAOH 3KCGH 2OP9A 1S82A 1D9IA 3PYHA 3CS7A 3P6ZB 1AB9C 5LPRA 1IQHA 4I31A 4FU8A 1G30B 2G5NA 3PO1C 1W0ZU 1RTFB 1G9IE 4BTIB 3P8FA 1MQ6A 4UE7H 4BAMB 1K1OA 1ELAA 2WPKS 2JH5D 3MH5A 1CQQA 3EE0B 2Z3DA 1ZPBA 1TNGA 2FP7B 1GVZA 2A4RA 5F03A 2V3HH 2OTVA 3ZZ5A 4PROA 2BOHB 2Y6TA 3SORA 5JBAS 4X2YA 3ZVAA 5EPNA 2F9OA 4DOQA 1EAUA 2C8WB 5DK1A 3MU5A 5CE1A 1XVMA 5C67A 1ZRKA 2QXIA 3MNBA 1P3EA 2AIQA 1T8LA 1AFQC 1IQJA 1BQYA 2SGAA 2FI4E 3MOCA 3M3SA 1QY6A 3HPTB 5AVDA 3SBKA 4ZUHA 3F68H 2GV6A 2A4OA 1NFWA 1SGRE 4I7YH 2YNAA 4AFSA 1SB1H 1RD3B 1F5RA 1BTPA 2CV3A 5LPFA 1Z6JH 3PMAB 1DWDH 1V2TT 4JZFH 4UFFH 1GI0A 1C5WB 3U8TH 1EJAA 2G00A 3KL6A 1WAYB 4NSVA 1C5ZB 1KXFA 3N7OA 2QXGA 3ZVFA 4YTAA 1KTTB 5DGJA 5C3NA 1TIOA 2F91A 3OU0A 5FPTA 1INCA 1KTSB 2SGDE 1TNJA 2VH0A 2BDCA 2P3TB 1O3JA 4X8VH 1OWIA 5LPEA 1CSOE 1LVYA 2CXVA 1G2MA 1UVOA 1MAXA 3T26A 2FYRA 1SGEE 1Y3XA 2D1JA 4I32A 1GBIA 2YNBA 3P95A 1Q31A 2ZEBA 9ESTA 2OXSA 2GZ7A 3M37A 1HBTH 4Z0KA 2GTBA 4JK5A 1GJ6A 4GHTA 4K8YA 2BVXH 3RXJA 3PMHB 1SMFE 3LC5A 1DT2A 4RKJB 1LVOA 5A2MH 2CN0H 1DXPA 1C2IA 1UTLM 4UEHH 1VGCB 3SI3H 3M7TA 2KAIB 5HXFA 1TQ0B 3BEFB 1LMWB 1NS3A 2QY0B 3H7OA 3MTYA 1BIOA 4UDWH 2TGTA 1YPEH 1TPPA 3TH2H 3VB5A 1SFIA 1UO6A 1BTHH 1Z71A 3W94A 2ZDVH 1QQ4A 2GVFA 3E90B 1O2KA 3B8JA 4CRGA 3RXKA 1B0EA 1PQAA 3CS0A 1VJ9U 3ATKA 1NRQH 1SLUB 2BY8X 4A92A 4GCHG 2GKVE 2W7SA 1YPHE 1DOJA 3P8OA 4X8SH 2A32A 3F9GA 1F0SA 3QUMP 4K2YA 5FPSA 1L1NA 1GVKB 3BG4C 1ZTJA 1JIRA 2EEKA 3RU4E 1GJCB 1Q3XA 2ZDNA 2C8ZB 2Q6FA 3UUZA 3RXAA 2ZIQH 1GI7B 2VIWA 1F5KU 2BVRH 4NA7A 1DSTA 4Q80A 2TPIZ 2BLQA 2ESTE 4NZLA 3MI4A 4OS7A 7LPRA 2B7DH 3B23B 1IQGA 3Q3XA 1S6FA 4AFZA 1AFQB 1CO7E 4X8UH 1HXFH 2Y5GA 3ATWA 4MPWA 4IN2A 1EOJA 4X1SU 2PGQB 3A7ZA 2Z6BD 2FESH 1LVBA 4ISNA 4WXIA 2BX4A 5IYTA 5JB8S 2FOHA 1O3GA 2BD4A