4NIVA

Crystal structure of trypsiligase (k60e/n143h/y151h/d189k trypsin) trigonal form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
219
structure length
193
Chain Sequence
YTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYESGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYDSGGPVVCSGKLQGIVSWGSKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title N-terminal protein modification by substrate-activated reverse proteolysis.
pubmed doi rcsb
source organism Bos taurus
total genus 53
structure length 193
sequence length 219
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nivA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nivA02
2PKSC 2WYGA 3D62A 3SU1A 2TGAA 1YKTA 2BX4A 1GCDA 2G55A 2UUYA 4JZIA 3RXLA 3MU0A 1GBCA 1O2MA 1IQIA 2VVVA 2Y80A 4UEHH 4GVUA 2QV1A 4I8LA 4ABAA 1H8IH 1ESBA 2XXLA 1D9IA 4ISNA 2Q6DA 1EOLA 1PQ7A 2BHGA 2VGCC 3TK6A 5EG4A 4I32A 1LPZB 4O9VA 2DE8A 3A7WA 1PPBH 1EPTC 1VITG 1PQAA 1MKXH 4CRAA 1JRTA 5EW1H 5I25A 2XW9A 3RC4A 4YOIA 3A8AA 4DW2U 2XC5A 3SW2B 4NA7A 4DIHH 5ESBA 5AFZH 5FXLA 2Z7FE 4A7IB 4B2AA 3A82A 3HK6B 1TGSZ 2BQWB 3SUGA 1DITH 5C3NA 3QGJA 1C1SA 1BTUA 1Y5BT 1CVWH 4YESB 4IC5A 3E0PB 1A3BH 1O5BB 3CENA 1P05A 1BA8B 5DP6A 3B8JA 1ZYOA 1DVAH 3GCHC 1DWDH 2FP7B 1SB1H 1TMBH 1E38B 2GT7A 1TA6A 2RA0A 1KLJH 1Z8IB 1EATA 3F9EA 1BJUA 4JK6A 1Y59T 1TRYA 3RM2H 2FI5E 3U9AH 4H42U 1C1TA 5A2MH 5DPAA 4AFQA 4ABIA 2WPKS 4INLA 5ETXA 4MNWA 2ZDLA 3ZVDA 2BY8X 1EP6A 5EPNA 2OQUA 3L3TA 3SU4A 2FM2A 4OGYA 3GY2A 1W14U 1SLWB 4BXWA 3QO6A 3MNBA 3M5MA 3SZNA 3LONA 1EAXA 2BD7A 3GOVB 1V2RT 3MH4A 3QN7A 2EA3A 1K1OA 1GCTC 2XWAA 4I33A 3ZVFA 1ETSH 3RXIA 1V2KT 4AGKA 1A5GH 4DGJA 2EEKA 1PPZA 3H7OA 2CHAB 1A5HA 1V2UT 3RXUA 4A92A 4JCNA 1O2VA 3AAVA 2VWMA 3A7YA 2RG3A 2ZF0H 2PSXA 1AIXH 4ZMAH 4BOHA 1P8VC 5FBEA 2QXIA 1EUFA 3IITA 1TX8A 3SQHE 3N7OA 3GICB 3I77A 4FUGA 3S69A 1FONA 3EAJA 1RJXB 1Q3XA 1UJ1A 4GCHG 2BXTH 5J4SA 1GI5A 1TGTA 1ZGVA 1C5YB 2EC9H 2CJIA 1KXAA 3SV2H 1FAKH 4E05H 5LPFA 1Q31A 4OS5A 1MUEB 1CSOE 1NM6A 1F0TA 1AGJA 1AFQB 2HPPH 1DLKB 4TPYA 5DP7A 4BAOB 1DUAA 3PO1B 1TYNA 4A1XA 3V13A 3K9XB 1L1JA 4ZROA 1GJAB 3SU3A 2B8OH 1V2LT 2PGQB 1HAOH 3K65B 3P92A 3TVJB 3JZ1B 4ZHLU 1P3EA 4WXIA 5A8YA 5LPRA 1OPHB 2OC8A 1UTKA 1A0HB 1FLEE 1O2TA 1YCPK 1ZPBA 4NIVA 1YYY1 2EI7A 4E7RG 3DFLA 3BG4B 3DA9B 3TJNA 1IHTH 2BOKA 2CV3A 3O8DA 1NRNH 4A6LA 3UNRA 1C5OH 5FX6A 2OC0A 4J2YB 5EPYA 2J2UA 5LPEA 2F9BH 2QIQA 1EP5A 1NFYA 1DM4B 4NIWA 3RDZA 3ZZ7A 3BTWE 1ELBA 1G9IE 4BNRA 1GJ4H 1H1BA 2XCFA 4OGXA 3W95A 1K1NA 1LVOA 2VNTA 1AFEH 3NKKA 2F83A 4XBBA 5BPEA 7LPRA 4JYUH 2ZKSA 3T2NA 3ZVAA 1S6HA 2FDAA 1IQGA 5PTPA 6GCHG 5AFYH 3A8DA 1WU1A 3TH2H 1JWTA 1BRCE 3TGJE 1GI8B 1O3DA 1HDTH 3BEFB 1ZMNA 1W13U 1EJMA 2OD3B 2AMDA 4JZ1A 4O3UA 2R2MB 1MMJN 2OCVB 3P8OA 4K1SA 3TK5A 4X2WA 1FNIA 2G81E 2YOLA 3F68H 4SGAE 1LQDB 3DD2H 4D7FA 3HKJB 1YP9A 2CF8H 1ELCA 3RXHA 1WUNH 4UE7H 1F7ZA 3A89A 1C2DA 3T29A 1XUJA 2C4FH 3SOSA 3PB1E 5HYOA 2WUBA 1O3BA 2F9PA 1EKBB 1OSSA 5HM2A 1HRTH 1CHOF 1ZJKA 2AERH 2A1DB 4X0WU 1SGYE 2A2QH 4X6OA 1UHBB 2ANYA 1O2WA 4KP0A 2R0KA 1GBDA 2RDLA 4X6NA 2F9NA 4X1SU 3BIVH 2J92A 5FX5A 3RXAA 2ZCHP 4IW4E 1FN8A 1C4U2 2A32A 3E6PH 2PFEA 4IGDA 3LGVA 1JXPA 1KDQB 4MPWA 1XUFA 3GY8A 1P12E 1F5KU 3S7HB 1AQ7A 3DHKH 2OTVA 1O2OA 1KY9A 5TCAA 1D3TB 1J9CH 1FY4A 1ESAA 2PWXA 4UFDH 1EZQA 3PYHA 2GDEH 1BTYA 1QHRB 1NU9A 3MNXA 4A1TA 4K1EA 1AI8H 1OP0A 1T4VH 1DSUA 1SBWA 1GGDC 1W2KH 1CE5A 1P0SH 3NZIA 3Q00A 2SNWA 2DUCA 1SI5H 2C8YB 3AW1A 1EOJA 3A83A 2SNVA 1EJNA 3UUZA 1F5RA 2AGGX 2F9OA 3GY5A 5LGOA 3KN2A 1HB0B 4FUIA 2XRCA 3UY9A 1XUKA 1PJPA 3GDSA 1DXWA 3VPKA 3TLOA 4WJG2 1VJAU 4Y8ZA 1AVWA 1FPHH 1OKXA 1JBUH 1UCYH 3LU9B 4Y0YE 2BM2A 3FVFB 1MQ5A 1V2WT 1O32A 1G2LA 4TY6A 2AGIX 1MCVA 1S0RA 5DP4A 3SN8A 4AFUA 2O9QA 1GBKA 2J95A 1K1LA 1SGCA 2D2DA 3A7TA 2ILNA 2A0QB 1TIOA 3SNDA 1HIAB 2VIQA 1GBAA 3SJ9A 1NFWA 3RXSA 9ESTA 1O34A 2XYAA 3MYWA 1ZLRA 1L4DA 2W3KA 2BD3A 3D49H 3C27B 3SJOA 2W7UA 4I7YH 1VJ9U 1TNJA 4NSYA 2GX4A 3EA9A 5ABWA 2FO9A 1ZSJA 1HAIH 2ZHEH 3PO1C 2XBXA 3SU0A 2IOTA 4AYVB 4ZKRU 2FMJA 1G3DA 2FEQH 3UWIA 2FPZA 2STBE 3O8BA 1HAHH 5F03A 3CS7A 1OWDA 1H9LB 2GD4B 2OXSA 1FIZA 4Y6DA 3TJVA 1LHDH 4NIYA 2BD5A 3U8TH 2CN0H 1LO6A 2BTCE 4CHAB 2QYIA 3BEIB 5EXNA 4MQAA 4DY7B 4MNVA 5E0GA 1XUHA 1ELEE 1GL0E 1O2XA 1UTLM 2PV9B 4TWWA 2BD2A 4SGBE 1AD8H 3SGAE 5A0CA 3KCGH 3RXBA 1HAVB 5AVDA 1O2RA 4WMEA 4I8KA 2ODQA 3P95A 3E0NB 4X6MA 1C1NA 3SI4H 2ZCKP 4BAKB 3R3GB 2XWBI 1AKSA 1V2JT 2C8WB 4QT8C 1QA7A 3M3TA 2CF9H 1SGIB 2H5CA 4R8TB 1C2JA 3RXPA 1GVKB 4Q7ZA 2UWOA 2D1JA 2HRVA 2VWNA 3RXCA 1GL1A 3BTDE 5CMXH 8ESTE 1FY1A 2EI8A 1HGTH 2XNIA 1B7XB 1LQEA 3G01A 3CS0A 2Y5GA 2AMQA 2BZ6H 4FU7A 1GI6A 1D3QB 4X8TH 1C5PA 3AAUA 1XXDA 4MLFB 3M36A 1TRNA 2FOBA 3GCHB 1FIWA 3HKIB 8KME2 2W5EA 1D6WA 4TY7A 5E8EH 4ABDA 1QRXA 3W94A 2ZHDA 1FY3A 3KEEA 1MTSA 1YPGH 1NT1A 4UFGH 3UNQA 3A86A 1GHVH 1T31A 2D26C 2FX4A 1H8DH 3M35A 1CA8B 1GI7B 3TH3H 4KTCA 2J34A 1V2VT 1DE7H 4FUDA 2BQ7B 2I6SA 1AMHA 2GDDA 3OX7U 4YT6H 4X1QU 1SOTA 4CBNA 1GCTB 3PWCA 4ABEA 3LH1A 1O5CB 2BLVA 3PMHB 2J38A 2WPMS 5E0HA 4WH6A 1JRSA 1O3FA 1K2I1 2ZGJA 1TOCB 5L2YH 3IG6B 1BRBE 1ANCA 1D4PB 1L2EA 3P17H 1GHBF 4KGAA 3MTYA 3P6ZB 1C5MD 1ID5H 4XDEA 1LVBA 3PLBA 1Z6EA 1V2OT 1EXFA 1NU7B 2AGEX 5C67A 1NTPA 1WCZA 2BDGA 2I6QA 2ZA5A 3TNTA 3URCA 5EU8A 5DG6A 1QRZA 3RLWH 3RMLH 1UTPA 5K7RA 1Z71A 3KNXA 4Y8XA 1TABE 3MU5A 1P2NA 3BTQE 1O3JA 1T8MA 2BVSH 1ELDE 1PPCE 4RN6A 2J4IA 1DLEA 3QTOH 1TX6A 1ARBA 1BBRE 1GBJA 2ZHWH 3NXPA 1NRPH 1QTFA 3PLKA 1EAUA 1HYLA 1O2NA 1P2MA 1UVTH 3T26A 4X8UH 1K1IA 1LHCH 1S85A 2J94A 1O3AA 3ZZ4A 1KLTA 3RXMA 1BRUP 4ZKOU 1CO7E 2Z9GA 4UONA 1QRWA 2GP9B 3KIDU 1W10U 4Q2KA 4Z0KA 1G3BA 1CT0E 1O3HA 3GY3A 4A1VA 3MU8A 2C8ZB 3RC5A 4ISHH 2R3YA 1O3EA 4CRGA 4ZH8A 4INKA 1B0EA 1DT2A 4D8NA 3ZZAA 1V2ST 2HLCA 1OOKB 1SGFA 3PWBA 2PGBB 1A0LA 4FUEA 5E2OA 5EW2H 1SFQB 1TONA 1DX5M 2Z3CA 1F0RA 1XKBC 4GCHF 3SNEA 4AZ2B 2Y81A 3SGBE 3GYMA 4JZEH 1BMAA 1K1MA 2FI3E 2W26A 3M7QA 4IMZA 1LDTT 4NG9H 2G8TA 4D7GA 2RCEA 1W7XH 3SUDA 4IN1A 5DP8A 3ZZ9A 3LGWA 1AU8A 1XUIA 1ZR0A 1MTWA 3SHCH 1BMNH 3OY6U 1C1RA 3A8BA 5L2ZH 1Y5AT 2VU8E 3JZ2B 4CHAC 1GJCB 4JZFH 1E36B 2FODA 3SV9A 2ZFRH 2ANMH 2GKVE 1ZGIA 3I78A 3E3TA 1MTUA 2TRMA 1L0ZA 3DT0H 1OWEA 2ZG0H 2ZNKH 3ATIA 3M37A 1FY5A 1O30A 3PLPA 1EASA 2VJ1A 1THSH 4ZKNU 1DS2E 3M7TA 1DANH 1NRRH 1H9IE 1F5LA 2FOAA 4U30A 5J4QA 5DP9A 3TU7H 4ISIH 4MDSA 3UR9A 1G2MA 1OS8A 2A4GA 3VXEH 3S9CA 4I8GA 1C9PA 2QCYA 2XTTB 1C1WH 4NWKA 1XX9A 3FANA 5C1XA 6GCHF 1VCWA 3BSQA 1N8OC 2CMYA 5B6OA 3FAOA 1A7SA 1GHBG 4O97A 1AZ8A 2QA9E 1SL3A 3A7ZA 3D65E 3MI4A 3LH3A 1QJ1B 5HMAA 3MH5A 2ZEBA 3GCTF 1HUTH 3Q77A 4Z6AH 1BTXA 7KMEH 1GJDB 2FYRA 2BY6X 4Y7BA 1T8OA 4HTCH 1TQ7B 1GJ5H 5L30H 2AFQB 1ZTKA 1T32A 1X7AC 2BDCA 2XBVA 2BMGB 2DE9A 3SORA 3SU2A 1GGDB 1TQ0B 4BAHB 1ZPCA 3A88A 3GDVA 1ELAA 2ZGHA 3SUFA 1T7CA 1ELGA 2AMPA 1GHYH 3RXGA 4X8VH 1TB6H 1IQEA 1FPCH 4H6SB 1C1UH 1TMTH 2H9HA 4AOQA 1MU6B 1RFNA 1QQ4A 1IQJA 3RC6A 5G4BA 3RU4D 2A7CA 1FUJA 1QL8A 5A8ZA 1ZHPA 2GVFA 1TLDA 2P93A 2QF3A 4NFFA 4AB9A 1CA0C 1L1NA 2BVXH 4GHQA 4B76A 1DDJA 1WYKA 1ETRH 1OP2A 1GBTA 3EQ0H 4B71A 1GMDG 1EZSC 5ESTE 2WV5A 1F2SE 3STJA 1IQNA 4OS4A 4OS7A 3GDUA 3HK3B 1O2SA 4D76A 1J15A 3SBKA 2WV4A 1Z1JA 2B9LA 1ZOMA 2A7JA 4AG2A 3ATWA 2FOCA 1A46H 2A5IA 2XCNA 1O2ZA 4FU9A 3MH7A 1ZTJA 2OP9A 3SJ8A 1PYTD 4ABFA 1F0SA 4ISLA 2PKAB 3F6UH 1XVMA 1YPJH 4B2CA 1A1RA 1CBWC 2G4TA 1G32B 1MAYA 4I8JA 3V7TA 3MH6A 4Y8YA 1ABJH 1NROH 5DKMA 4X6PA 1CHGA 2JKHA 1JMOH 2FS9A 3SO3A 1OYTH 1YGCH 3SV7A 5LH8A 1C2LA 1BMLA 5JB8S 3CP7A 4DIIH 2ODYB 1ZZZA 4UFEH 4MTBA 1UHBA 1AVXA 1GBEA 2A45B 3PMBB 4B73A 3SNAA 3MU4A 5DP3A 1S84A 1H9HE 3M3SA 1P3CA 3QUMP 4B74A 2FS8A 2XC4A 4FUBA 3LJOA 2VWLA 1XVOA 2Z9IA 4WF8A 1KDQA 3M5OA 4ZAEA 1EJAA 5T6GA 2W7SA 1BDAA 1ZMLA 1C5XB 3TPIZ 2PTNA 3ZZ8A 3LGYA 3NUMA 2BOHB 4LXBH 4ZXYH 1K22H 3LT3A 1K28D 1UVSH 1YPKH 3HGPA 2JH5D 1H4WA 2Z9LA 3T28A 1FN6A 3QLPH 2VIOA 3RLYH 1KXDA 2Y5FA 4NWLA 3M5NA 3QWCH 4D9QA 2ZDMA 1XMNB 2H1UA 3PMAB 2ESTE 2QGRA 3M3VA 1BTPA 2AIQA 1C5NH 1E34B 5JBAS 3GCTG 3UIRA 3IWMA 2UWPA 3VB5A 1BB0B 4MPUA 1GDUA 1BBRK 3R0FA 4AYYB 1MBQA 2AYWA 2V35A 1P2OA 2WPIS 1QY6A 1Y3WA 2ZHQH 2ZPQA 1YM0A 3KQBA 2OBOA 2NU0E 4X1NU 1O3IA 4LOYH 3I29A 1GHAF 1GMCF 3QZQA 2ZU2A 1J14A 3ZYEA 5JBBS 3DUXH 1DSTA 4F49A 3FP8E 4ABHA 4CRBA 4FVBA 1A3EH 1QBOA 3E90B 1V6DA 3U1JB 2OC1A 4OS2A 1TBZH 1HIAA 3A7VA 1DOJA 2OC7A 1AVGH 3GY7A 1P2IA 2FZZA 3MNCA 3MWIU 4WXVA 3K6YA 1HNEE 1K21H 1P9UA 5C5NA 1N6YA 1TX7A 7GCHF 1Y3VA 3SQEE 1GI9B 1TNGA 5FPSA 3S9BA 1OP8A 2ZC9H 1W12U 2WUCA 3FFGA 3ZZBA 3K2UA 1TBRH 4NCYA 1O2QA 3RMNH 1CU1A 1ANEA 1ELFA 3NPSA 1O36A 5FCRA 2Y82A 2ODPA 2WPJS 5EODA 3HGNA 5GIBA 3DFJA 1KXBA 2ZGBH 3LGIA 1C2GA 1SGEE 1MKWK 1SGRE 1O2YA 1IQMA 1Z8RA 3SU6A 1C1PA 2AH4X 5HXFA 1BT7A 3EA7A 1ZPZA 1C9TA 2BLOA 1G30B 1PQ5A 3SV6A 1V2QT 5HM9A 1EX3A 1T4UH 1HAVA 2TIOA 3RM0H 2GZ9A 3A81A 3NK8A 1WQSA 1O5AB 1TNIA 4DT7B 5EGMA 5FPTA 4CRCA 1WTHD 2OQ5A 3BTFE 1S83A 1P06A 3BEUA 1QBVH 3QTVH 4MG3A 1EPTA 1UK2A 3RXJA 4GHTA 3KL6A 1GBBA 2H9TH 1AN1E 1RGQA 4YTAA 1TPSA 3H7TA 4X1RU 4K1TA 3VB7A 2ZGXH 3EGKH 2ANWA 4ZKSU 5BRRE 5JDUB 5JBCS 1GMHG 4YLUA 4F4OC 1KXCA 1A4WH 1T8NA 2AIPA 4XOJA 1SSXA 1WQVH 1FMGA 3UOPA 5DK1A 2ZU5A 4X8SH 1UCYK 2FOFA 1MH0A 4HFPB 4U01A 3KF2A 4FUJA 1UK4A 3KQEA 1S81A 2G52A 3TJOA 2ZFPH 1QJ6B 3FZZA 3E8LA 5IDKA 1MCTA 2FOGA 1O0DH 1E0FD 1YC0A 3BF6H 4MNXA 3VGCC 4DURA 1PPGE 4CR9A 5F8TA 4K69A 4BXSA 4CH8B 1SGFG 1GJ9B 3F9HA 2GTBA 4D9RA 2P3FH 4DCDA 3SGQE 2SGFE 3V3MA 5EQSA 3RXFA 1DY9A 3M61U 1G3EA 4CRDA 1UTOA 1YF4A 2SFAA 4YLQH 1QL7A 2P3UB 1SLXB 1LHEH 2KAIB 3RXDA 1B0FA 4ABJA 1GHAG 1GMCG 1GG6C 6CHAC 1GDNA 1TFXA 2A2XH 3AASA 3ELAH 2H5DA 4PROA 1SQAA 1DUEA 1ZSKA 4BANB 4FUFA 1Z8JB 3OYPA 1SQOA 1PPEE 2ANKH 2HWLB 1OXGA 3RXQA 1P10A 1SFIA 4Y76A 4GPGA 1UVOA 1N8OB 2XBWA 2LNCA 3UR6A 4I31A 2HVXA 2F9VA 3MO6A 7GCHG 2P59A 3HPTB 2ZFSA 2C93B 2ZI2H 3MFJA 2ZWLH 2O8WA 1QFKH 3TITA 2Y6TA 5C5OA 4Y0ZE 1NY22 4CH2B 2UUFB 1AB9C 5AHGH 1GJ6A 3RU4E 1W3CA 1UTMA 2QN5T 1SC8U 1W0YH 5E2PA 3RUOA 1P11E 3L33A 3SUEA 1E37B 1P9SA 3BTHE 4CR5A 4Y71A 5DGJA 3UTUH 2AS9A 1AUTC 1JIRA 2ZTYA 1VZQH 1LPKB 2BB4A 1MBMA 1MZDA 3D23A 3EE0B 1P2JA 3P8FA 4CREA 1TA2A 3FP7E 3NWUA 1GBIA 2VIVA 1KYNA 4DJZB 1HLTH 8GCHG 2ZDKA 3ZVBA 1OWHA 5T6DA 5EOKA 1BUIA 3QGNB 2Z3EA 5FCKA 1ZTLA 2VWOA 2A4OA 4VGCB 1Y5UT 3V12A 2HNTE 2VB0A 4GAWA 1BJVA 1CA0B 1LVYA 1AUJA 2ZFQH 1S82A 1Z7KA 2IPHA 5DP5A 4Y10E 1XXFA 1HAPH 3EDXB 2FXRA 3MOCA 3BTME 1U6QA 2ALVA 4E7NA 4OS6A 5H4IB 1LTOA 2GCTB 4JYTA 2CXVA 1C1MA 2FTLE 3F9GA 1WAYB 1UO6A 4WMFA 2FLBH 3RMMH 4BTIB 5A0BA 2F9UA 1QA0A 1MQ6A 2JETC 3EYDA 3ITIA 4X1PU 5A0AE 1CGHA 5CE1A 1OWIA 1GVZA 1Y3UA 1SPJA 3OY5U 1C5QA 1CBWB 2BDYA 4AFZA 2NU1E 2OUAA 4UDWH 2HNTF 3UOUA 1F92A 2QY0B 3VEQB 1AE8H 3BG8A 1D3PB 1NRSH 3PTBA 2GCHG 1OWKA 2JH6D 3UQOA 1O3MA 3LC3A 2R0LA 1QL9A 2YNAA 1ZSLA 1FI8A 2P8OC 2ZP0H 3S7KB 3SJIA 1P03A 2ZDNA 1AWFH 1QB6A 1AWHB 2FOEA 1TNKA 1ABIH 1ZMJA 1GMDF 1FDPA 1O35A 1P2QA 3MO9A 1P57B 1HPGA 2OLGA 1C4Y2 4ABGA 2IN2A 2BDBA 3SI3H 1O3CA 2FLRH 5T6FA 1GI3A 4FUHA 4LZ4B 2G51A 1SR5C 1TGBA 2FI4E 1HXEH 1O2IA 1A5IA 4K2YA 3V0XA 3PTNA 5C20A 2Z6BD 2TGTA 4O03A 1SGNE 2IJOB 3TNSA 2WYJA 4FVDA 4JK5A 2FWWA 2RA3A 3URDA 4LZ1H 1SHYA 5DJ7A 2ZQ1A 3GYLB 1RTFB 1BHXF 1JIMA 2SGAA 3UPEA 1FJSA 2G4UA 1C1VH 3RP2A 1D6RA 2BD8A 1WTGH 2STAE 2ZIQH 2ZO3H 2HNTC 1PYTC 4IBLH 1DWCH 1YBWA 3A85A 4ZUHA 3Q3XA 4NZLA 3SHAH 2VIDA 1E35B 1HJAB 3U8RH 1RRKA 4GSOA 1P09A 4K8YA 1NPMA 2JH0D 4ABBA 1EZXC 1K1PA 1KTSB 2B7DH 1C1QA 4RSPA 1FY8E 3SNBA 1O3LA 1KLIH 4H4FA 3UFAA 4DG4A 1NFXA 4KTSA 1HXFH 1GI2A 2FIRH 5IYTA 9LPRA 1OX1A 1KSNA 4HZHA 2XC0A 5K0HA 1FQ3A 2BD9A 3E91A 1O5GH 1O3KA 1RIWC 1DPOA 1GWAA 1WSSH 4K60A 4TYDA 5HGGA 2BD4A 1CT4E 1G36A 3T25A 1YPLH 1ACBE 2NU4E 3A87A 2BX3A 2VH0A 3FZDA 1MTVA 3ODDA 3MNSA 1YPHE 2ZQ2A 4INHA 1UCYE 1C5RA 1FZZA 2K1QA 1BTWA 2VH6A 4WWYA 2FOMB 1EAWA 1MKXK 1O3OA 1BOQA 2GV7A 1CT2E 3ZV8A 2QC2A 2R2WU 2PKAA 1C2IA 1FAXA 1QB1A 1TNHA 1QR3E 2Z3DA 2QXHA 4J1YA 1O31A 1O39A 1GBHA 3RU4T 1BCUH 3AVZA 2Y7ZA 2GT8A 3VB6A 1A2CH 1BRAA 1HJ9A 3A80A 4JZDH 5T3HA 1YLCA 3B9FH 3ZZ6A 1QBNA 5C1UA 3UQVA 3RXTA 1G37A 2TBSA 1Z6JH 1O2LA 1ARCA 1ZHRA 2FX6A 3L6PA 3P8NA 1ZRBA 2Z9JA 1N1LA 1K1JA 4XBDA 3A7XA 8LPRA 1W0ZU 1TNLA 1NC6A 2ZCLP 5EXLA 2VINA 4WH8A 1AHTH 1GBMA 5JYIA 1TRMA 4VGCC 1O3NA 3SV8A 4I8HA 1W7GH 1QGFA 1GBLA 2HGTH 1DWEH 1IAUA 1SG8B 1TMUH 1AZZA 1EB1H 1S5SA 1VITH 4HI3A 4RKOB 4JMYA 5A09A 1ZJDA 1DY8A 4E06H 2O8UA 3ZYDA 3VB4A 2GCTC 1THRH 1MAXA 2TPIZ 3MU1A 5AF9H 3RXOA 2PW8H 1YPMH 5GCHF 2A4RA 2F91A 4AX9H 1J17T 4U32A 3WY8A 4IMQA 4FU8A 1P02A 1XUGA 4DVAU 2GMTC 1S0QA 4TPIZ 5F8ZA 3KHVA 1DXPA 4NSVA 1V2PT 4ISOA 3VGCB 1YPHC 3BN9A 1YCPH 1P2KA 2R9PA 1YCPM 3S9AA 1RD3B 4IS5A 2VVUA 1MTNC 5FAHA 3TJUA 4B75A 3LJJA 1YLDA 1VGCB 5EQQA 4AN7A 1GJBB 1QJ7B 1A61H 1IQFA 2ZU3A 4Y79A 2BZAA 1N6XA 4XFQA 2Z9KA 2HOBA 3F9FA 4X2YA 1GG6B 6CHAB 1EZUC 1HAYB 1UTQA 2H9EH 2Z94A 3RXKA 1V2MT 1C1OA 3KQDA 3FP6E 3TIUA 1GMHF 1GJ7B 5EQRA 1IQLA 1Y3YA 4Q80A 3SJKA 5JB9S 2BLWA 3LPRA 1MD8A 1UTNA 1BQYA 1RTLA 1PPHE 3O8RA 1RS0A 1SGPE 4MVNA 2Q6FA 1GI0A 3C1KA 1ETTH 1PFXC 4MPVA 1C5VA 2TGPZ 3AW0A 4K8BA 3LIWA 3BTEE 1KTTB 1QURH 3MHWU 1ORFA 4GUXA 1TPOA 1UK3A 2ZGCA 2M5TA 4B1TA 3A84A 6ESTA 1C2EA 5GDSH 3T5FH 3ZZDA 1O37A 3T27A 2ZZUH 4IC6A 1C5ZB 1FV9A 1C2KA 5FBIA 2G5NA 4KTUA 2A7HA 2J9NA 3P8GA 2O8TA 1ANDA 3Q76A 1BBRH 3SU5A 1HFDA 1O5FH 1LKAA 1IOEA 2VIPA 1HJAC 2V6NA 4Q7YA 1AB9B 4MNYA 2BY5X 1Y8TA 4AG1A 3U69H 5E0JA 4BAQB 2PLXA 1TGNA 1AY6H 1IQHA 1SVPA 2V0BA 1TBQH 1GDQA 3Q3KA 4BTTB 5TCCA 3OU0A 1BZXE 2GGVB 3U1IB 2GZ8A 3B23B 2CGAA 4K5ZA 2XBYA 3VB3A 4YZUA 3GY4A 1C5LH 1DICA 4GLYA 1DWBH 1C5TA 3HATH 2LPRA 4H6TA 1O3PB 2BVRH 3GY6A 2UUJB 2QXJA 1UTJA 1C2MA 4ESTE 1TOMH 3STIA 1YPEH 1CQQA 1LHFH 3UWJH 2H6MA 3E1XB 1THPB 2SGEE 1Z1IA 4YOGA 3TK9A 1O2HA 3PV4A 4KKDA 5EXMA 4NZQA 1SQTA 2ZPSA 1IQKA 4IN2A 1MU8B 2OBQA 1EQ9A 3LGUA 1MKWH 3RXVA 2FYQA 1O2PA 4XE4A 5GCHG 5DO4H 1ANBA 1BTZA 2VVCA 3MMGA 4NFEA 4Q7XA 1C2HA 1NO9H 2A4QA 2B5TB 3BTTE 1O3GA 2JETB 2P16A 1GJ8B 1ELTA 2ULLA 1P04A 1XM1A 3BV9B 1GI4A 2WPLS 1LVMA 4CRFA 2R3UA 2O8LA 1IHSH 1SGQE 1ELVA 2ZFTA 4K3JA 3GISB 1WV7H 2BDHA 1OYQA 1V2TT 1W11U 1VCQA 2KAIA 1GI1A 8GCHF 3TGKE 4WVPE 2G00A 2B0FA 1S6FA 1QIXB 1TAWA 4BAMB 3F1SB 3A8CA 1UVUH 5C1YA 2P8OB 4Y7AA 4RKJB 3MO3A 3VFEA 4WMDA 1TPPA 1BITA 1J8AA 3BTGE 1SHHB 5GPIB 1ESTA 2BQ6B 4O3TA 3QZRA 3KQCA 4NA9H 4THNH 4ZXXH 4NA8A 1SOZA 4AFSA 2CHAC 4YT7H 3H5CB 1C4V2 1B5GH 1KXFA 2BY7X 2C8XB 1KIGH 2AEIH 4M7GA 3UREA 4DOQA 2Y5HA 4R0IA 1CGIE 1HBTH 2QXGA 2SGPE 2YNBA 1O2JA 4AGJA 1V3XA 1O2UA 3LC5A 2ZTXA 1O2KA 4LK4A 4BTUB 2NWNA 1HV7A 1MD7A 5CHAB 1AFQC 3OTJE 3NCLA 2QAAA 1EAIA 2GCHF 4X2XA 1HAGE 2PKSB 1HAXB 1VGCC 2UWLA 3ZVCA 5A8XA 3SNCA 1GVLA 2TGDA 2VIWA 4YOJA 1XKAC 1O5EH 4ZHAA 1BTHH 2HPQH 5JPMH 3U98H 5GXPA 1UMAH 1WOFA 3BG4C 1ZHMA 2P3TB 3U8OH 3T62A 4MPXA 4KELA 3QX5H 3QDZB 2ZTZA 1RIWB 1QNJA 1GBFA 1GHXH 2VGCB 2FESH 2ZU1A 2FOHA 3TGIE 4UFFH 1PPFE 1BIOA 1K9OE 2Y7XA 1VR1H 1BHXB 1EPTB 1QCPA 1P01A 1C5SA 2C90B 5FHTA 2SGQE 1NESE 1CHOG 3GCOA 1LHGH 5L6NH 4AORA 1FXYA 1J16A 1ZRKA 2A5KA 3ATMA 2F3CE 2ZHFH 2BDIA 1RTKA 5F6MA 5F8XA 5C2ZA 3Q3YA 1TGCA 2PTCE 3ZVEA 1SMFE 2BLQA 3RMOH 2ZDVH 1UVPA 3M5LA 4Y11E 4AB8A 4NGAH 1GHZA 1HAZB 3LGTA 3ATLA 2PUXB 3QK1A 1TPAE 1F0UA 3UNSA 2BDAA 1PQ8A 2EI6A 1NFUA 2SGDE 3ZV9A 1C5WB 3M7UA 1AO5A 1C5UA 4XBCA 1LPGB 4JYVH 2PSYA 1W8BH 4YM9A 2V3HH 2GZ7A 1SLVB 1SGDE 1VITF 1NN6A 1JOUB 2V3OH 3GCNA 1LMWB 2A5AA 2WPHS 3TH4H 1O5DH 2W3IA 1GHWH 2Q6GA 2ASUB 2A31A 1KXEA 1QQUA 3O8CA 2OINA 2WINI 2ALPA 4UD9H 4XSKU 2D8WA 2THFB 4ASHA 1AKSB 1LCYA 1HJ8A 2NU3E 1C2FA 3P70B 2BXUH 3ZZ3A 5I46H 2Q1JA 2BY9X 1MZAA 3LKWA 2GMTB 3ZZCA 4FXGH 1AE5A 1DFPA 1RXPA 1HCGA 1O33A 1TE0A 1CGJE 5JBTA 2ZPRA 3ZVGA 1D3DB 1A0JA 3PROA 1Y3XA 3ZZ5A 5TJXA 3K6ZA 2NU2E 1VCPA 4HGCA 2C3SA 3BTKE 2UUKB 2PUQH 1MTNB 1NS3A 3KGPA 3RXEA 1O2GH 2PHBA 3ENSB 3VXFH 4NIXA 1QB9A 1Z8GA 1L4ZA 1GPZA 6LPRA 4CBOA 2P95A 4X2VA 3PMJA 5FPYA 4B2BA 2H2ZA 2ZFFH 1TWXB 1OWJA 1INCA 1LKBA 1O38A 4U2WA 4A5TS 4FUCA 2G5VA 3LDXH 2ZDAH 2ZU4A 3ATKA 4WY3A 3ODFA 3RXRA 5GWZA 1Q2WA 2HALA 3LOXA 3PM3A 4ZHMU 1NZQH 5SGAE 4TWYA 3BIUH 2FTMA 4YO9A 2PR3A 3OSYA 1T8LA 1NRQH 2QF0A 3EA8A 1V2NT 1L1GA 2P94A 1G3CA 2GV6A 3S0NA 1M9UA 1SLUB 1WBGB 5GJ4B 1EB2A 1BMMH 5CHAC 2BYAX 2ZECA 1TALA 3E16B 2O8MA 3ESTA 4OS1A 1SGTA 7ESTE
chains in the Genus database with same CATH superfamily
2PKSC 2WYGA 3D62A 3SU1A 2TGAA 1FX0B 1YKTA 2BX4A 1GCDA 2G55A 2UUYA 4JZIA 3RXLA 3MU0A 1GBCA 2CK3D 3EE7A 1O2MA 1IQIA 2VVVA 2Y80A 4UEHH 4GVUA 2QV1A 4I8LA 4ABAA 1H8IH 1ESBA 2XXLA 1D9IA 4ISNA 2Q6DA 1EOLA 1PQ7A 2BHGA 2VGCC 3TK6A 5EG4A 4I32A 1LPZB 4O9VA 2DE8A 3A7WA 1PPBH 1EPTC 1VITG 1PQAA 1MKXH 4CRAA 1JRTA 5EW1H 5I25A 2XW9A 3RC4A 4YOIA 3A8AA 4DW2U 2XC5A 3SW2B 4NA7A 4DIHH 5ESBA 5AFZH 5FXLA 2Z7FE 4A7IB 4B2AA 3A82A 5B6LA 3HK6B 1TGSZ 2BQWB 2XNDD 3SUGA 1DITH 5C3NA 3QGJA 1C1SA 1BTUA 1Y5BT 1CVWH 4YESB 4IC5A 3E0PB 1A3BH 1O5BB 3CENA 1P05A 1BA8B 5DP6A 3B8JA 1ZYOA 1DVAH 3GCHC 1DWDH 2FP7B 1SB1H 1TMBH 1E38B 2GT7A 1TA6A 2RA0A 1KLJH 1Z8IB 1EATA 3F9EA 3MQKC 1BJUA 4JK6A 1Y59T 1TRYA 3RM2H 2FI5E 3U9AH 4H42U 1C1TA 5A2MH 5DPAA 4AFQA 4ABIA 2WPKS 4INLA 5ETXA 4MNWA 5EIYA 2ZDLA 3ZVDA 2BY8X 1EP6A 5EPNA 2OQUA 3L3TA 3SU4A 2FM2A 4OGYA 3GY2A 1W14U 1SLWB 4BXWA 3QO6A 3MNBA 2EY4C 3M5MA 3SZNA 3LONA 1EAXA 2BD7A 3GOVB 1V2RT 3MH4A 3QN7A 2EA3A 1K1OA 1GCTC 2XWAA 3UAIC 4I33A 3ZVFA 1ETSH 3RXIA 1V2KT 4AGKA 1A5GH 2J5UA 2WV9A 4DGJA 2EEKA 1PPZA 3H7OA 2CHAB 1UW7A 1A5HA 1V2UT 3RXUA 4A92A 4JCNA 1O2VA 3AAVA 2VWMA 3A7YA 2RG3A 2ZF0H 2PSXA 1AIXH 4ZMAH 4BOHA 1P8VC 5FBEA 2QXIA 1EUFA 3IITA 1TX8A 3SQHE 3N7OA 3GICB 3I77A 4FUGA 3S69A 1FONA 3EAJA 1RJXB 1Q3XA 1UJ1A 4M9FA 4GCHG 2BXTH 5J4SA 1GI5A 1TGTA 1ZGVA 1C5YB 2EC9H 2CJIA 1KXAA 3SV2H 1FAKH 4E05H 5LPFA 1Q31A 4OS5A 1MUEB 1CSOE 1NM6A 1F0TA 1AGJA 1AFQB 2HPPH 1DLKB 4TPYA 5DP7A 4BAOB 1DUAA 3PO1B 1TYNA 4A1XA 3V13A 3K9XB 1L1JA 4ZROA 2M2AA 1GJAB 3SU3A 2B8OH 1V2LT 2PGQB 1HAOH 3K65B 3P92A 2RDEA 3TVJB 3JZ1B 4ZHLU 1P3EA 4WXIA 5A8YA 5LPRA 1OPHB 2OC8A 1UTKA 1A0HB 1FLEE 1O2TA 1YCPK 1ZPBA 4NIVA 1YYY1 2EI7A 4E7RG 3DFLA 3BG4B 3DA9B 3TJNA 1IHTH 2BOKA 2CV3A 3O8DA 1NRNH 4A6LA 3UNRA 1C5OH 5FX6A 2OC0A 4J2YB 3SYJA 5C0UA 5EPYA 2J2UA 5LPEA 2F9BH 2QIQA 1EP5A 1NFYA 1DM4B 4NIWA 3RDZA 3ZZ7A 3BTWE 1ELBA 1G9IE 4BNRA 1GJ4H 1H1BA 2XCFA 4OGXA 3W95A 4DT4A 1K1NA 1LVOA 2VNTA 1AFEH 3NKKA 2F83A 4XBBA 5BPEA 7LPRA 4JYUH 2ZKSA 3WWBA 3T2NA 3ZVAA 1S6HA 2FDAA 2K8IA 1IQGA 5PTPA 6GCHG 5AFYH 3A8DA 1H8ED 1WU1A 3TH2H 3F0OA 1JWTA 1BRCE 3TGJE 1GI8B 1O3DA 1HDTH 3BEFB 1ZMNA 1W13U 1EJMA 2OD3B 2AMDA 4JZ1A 4O3UA 2R2MB 1MMJN 2OCVB 3P8OA 4K1SA 3KYGA 3TK5A 4X2WA 1FNIA 2G81E 2YOLA 2HLDD 3F68H 4SGAE 1LQDB 3DD2H 4D7FA 3HKJB 1YP9A 2CF8H 1ELCA 3RXHA 1WUNH 4UE7H 1F7ZA 3A89A 1C2DA 3T29A 1XUJA 2C4FH 3SOSA 3PB1E 5HYOA 2WUBA 2F9PA 1O3BA 1EKBB 1OSSA 5HM2A 1HRTH 1CHOF 1ZJKA 2AERH 2A1DB 4X0WU 1SGYE 2A2QH 4X6OA 1UHBB 2ANYA 1O2WA 4KP0A 2R0KA 1GBDA 2RDLA 4X6NA 2F9NA 4X1SU 3BIVH 2J92A 5FX5A 5CHBA 3RXAA 2ZCHP 4IW4E 4TSFD 1FN8A 1C4U2 2A32A 3E6PH 2PFEA 4IGDA 3LGVA 5F53A 1JXPA 1KDQB 4MPWA 1XUFA 3GY8A 1P12E 1F5KU 2JJ2D 1AQ7A 3DHKH 3S7HB 2OTVA 1O2OA 1KY9A 4RI0A 5TCAA 1D3TB 1J9CH 1FY4A 1ESAA 2PWXA 4UFDH 1EZQA 3PYHA 2GDEH 1BTYA 1QHRB 1NU9A 3MNXA 4A1TA 4K1EA 1AI8H 1OP0A 1T4VH 1DSUA 1SBWA 1GGDC 1W2KH 1CE5A 1P0SH 3NZIA 3Q00A 2SNWA 1VKYA 2DUCA 1SI5H 2C8YB 3AW1A 1EOJA 3A83A 2SNVA 1EJNA 3UUZA 1F5RA 2AGGX 2F9OA 3GY5A 5LGOA 3KN2A 1HB0B 4FUIA 2XRCA 3UY9A 1XUKA 1PJPA 2QF4A 3GDSA 1DXWA 3VPKA 3TLOA 4WJG2 1VJAU 4Y8ZA 1AVWA 1FPHH 1OKXA 1JBUH 1UCYH 3LU9B 4Y0YE 2BM2A 3FVFB 1MQ5A 3DSOA 1V2WT 1O32A 1G2LA 4TY6A 2AGIX 1MCVA 1S0RA 5DP4A 3SN8A 4AFUA 2O9QA 1GBKA 2J95A 1K1LA 1SGCA 2D2DA 3A7TA 2ILNA 2A0QB 1TIOA 3SNDA 3PV5A 1HIAB 2VIQA 1GBAA 3SJ9A 1NFWA 3RXSA 9ESTA 1O34A 2XYAA 3MYWA 1ZLRA 1L4DA 2W3KA 2BD3A 3D49H 3C27B 3SJOA 2W7UA 4I7YH 1VJ9U 1TNJA 4NSYA 2J97A 1QZ8A 2GX4A 3EA9A 5ABWA 2FO9A 4RT0A 1ZSJA 1HAIH 2ZHEH 3PO1C 2XBXA 3SU0A 2IOTA 4AYVB 4ZKRU 2FMJA 1G3DA 5HIZA 2FEQH 3UWIA 2FPZA 2STBE 3O8BA 1HAHH 5F03A 3CS7A 1OWDA 1H9LB 2GD4B 1SQRA 2OXSA 1FIZA 4Y6DA 3TJVA 1LHDH 4NIYA 2BD5A 2EQNA 3U8TH 2CN0H 1LO6A 2BTCE 4CHAB 2QYIA 3BEIB 5EXNA 4MQAA 2KM0A 4MNVA 5E0GA 1XUHA 4DY7B 1ELEE 1GL0E 1O2XA 1UTLM 2PV9B 4TWWA 2BD2A 4SGBE 1AD8H 3SGAE 5A0CA 3KCGH 3RXBA 1HAVB 5AVDA 1O2RA 4WMEA 4I8KA 2ODQA 3P95A 3E0NB 4P02A 4X6MA 1C1NA 3SI4H 2ZCKP 4BAKB 3R3GB 2XWBI 1AKSA 1V2JT 2C8WB 4QT8C 1QA7A 3M3TA 2CF9H 1SGIB 2H5CA 4R8TB 1C2JA 3RXPA 1GVKB 4Q7ZA 2UWOA 2D1JA 2HRVA 2VWNA 3RXCA 1GL1A 3BTDE 5CMXH 8ESTE 1FY1A 2EI8A 1HGTH 2XNIA 1B7XB 1LQEA 3G01A 3CS0A 2Y5GA 2F4LA 2AMQA 2BZ6H 4FU7A 1GI6A 1D3QB 4X8TH 1C5PA 3AAUA 1XXDA 4MLFB 3M36A 1TRNA 2FOBA 3GCHB 1FIWA 3HKIB 4Z1MD 8KME2 2W5EA 1D6WA 4TY7A 5E8EH 4ABDA 1QRXA 3W94A 2ZHDA 1FY3A 3KEEA 1MTSA 1YPGH 1NT1A 4UFGH 3UNQA 3A86A 1GHVH 1T31A 2D26C 2FX4A 1H8DH 3M35A 3PRBA 1CA8B 1GI7B 3TH3H 4KTCA 2J34A 1V2VT 1DE7H 4FUDA 2BQ7B 2I6SA 1AMHA 2GDDA 3OX7U 4YT6H 2LELA 4X1QU 1SOTA 4CBNA 1E1RD 1GCTB 3PWCA 4ABEA 3LH1A 1O5CB 2BLVA 3PMHB 2J38A 2WPMS 2WPDD 5E0HA 4WH6A 1JRSA 3OE7D 1O3FA 1K2I1 2ZGJA 1TOCB 5L2YH 3IG6B 1BRBE 1ANCA 1D4PB 1L2EA 3P17H 1GHBF 4KGAA 3MTYA 3P6ZB 1C5MD 1ID5H 4XDEA 1LVBA 3PLBA 1Z6EA 1V2OT 1EXFA 1NU7B 2AGEX 5C67A 1NTPA 1WCZA 2BDGA 2I6QA 2ZA5A 3TNTA 3URCA 5EU8A 5DG6A 1QRZA 3RLWH 3RMLH 1UTPA 5K7RA 1Z71A 3KNXA 4Y8XA 1TABE 3MU5A 1P2NA 3BTQE 1O3JA 1T8MA 2BVSH 1ELDE 1PPCE 4RN6A 2J4IA 1DLEA 3QTOH 1TX6A 1ARBA 1BBRE 1GBJA 2ZHWH 3NXPA 1NRPH 1QTFA 3PLKA 1EAUA 1HYLA 1O2NA 1P2MA 1UVTH 3T26A 4X8UH 1K1IA 4ACBA 1LHCH 1S85A 2J94A 1O3AA 3ZZ4A 1KLTA 3RXMA 1BRUP 4ZKOU 1CO7E 2Z9GA 4UONA 1QRWA 2GP9B 3KIDU 1W10U 4Q2KA 4Z0KA 1G3BA 1CT0E 1O3HA 3GY3A 4A1VA 3MU8A 2C8ZB 3RC5A 4ISHH 2R3YA 1O3EA 4CRGA 4ZH8A 2GJGA 4INKA 1B0EA 1DT2A 4D8NA 3ZZAA 1V2ST 2HLCA 1OOKB 1SGFA 3PWBA 2PGBB 1A0LA 4FUEA 5E2OA 5EW2H 1SFQB 1TONA 1DX5M 2Z3CA 1F0RA 1XKBC 4GCHF 3SNEA 4AZ2B 2Y81A 3SGBE 3GYMA 4JZEH 1BMAA 1K1MA 2FI3E 2W26A 3N99A 3M7QA 4IMZA 4TT3D 1LDTT 4NG9H 2G8TA 4D7GA 2RCEA 1W7XH 3SUDA 4IN1A 5DP8A 3ZZ9A 3LGWA 1AU8A 1XUIA 1ZR0A 1MTWA 3SHCH 1BMNH 3OY6U 1C1RA 3A8BA 5L2ZH 1Y5AT 2VU8E 3JZ2B 4CHAC 1GJCB 3F2FA 3U28C 4JZFH 1E36B 2FODA 2RFKC 3SV9A 2ZFRH 2ANMH 2GKVE 3F3BA 1ZGIA 3I78A 3E3TA 1MTUA 2TRMA 1L0ZA 3DT0H 1OWEA 2ZG0H 2ZNKH 3ATIA 3M37A 1FY5A 1O30A 3PLPA 2J98B 1EASA 2VJ1A 1THSH 4ZKNU 1DS2E 3M7TA 1DANH 1NRRH 1H9IE 1F5LA 2FOAA 4U30A 1WXRA 5J4QA 5DP9A 3TU7H 4ISIH 4MDSA 3UR9A 1G2MA 1OS8A 1SKYE 2A4GA 3VXEH 3S9CA 4I8GA 5KGOA 1C9PA 2QCYA 2XTTB 1C1WH 4NWKA 1XX9A 3FANA 5C1XA 6GCHF 1VCWA 3BSQA 1N8OC 2CMYA 5EJZA 5B6OA 3SZEA 3FAOA 1A7SA 1GHBG 4O97A 1AZ8A 2QA9E 1SL3A 3A7ZA 3D65E 3MI4A 3LH3A 1QJ1B 5HMAA 3MH5A 2ZEBA 3GCTF 1HUTH 3Q77A 4Z6AH 1BTXA 7KMEH 1GJDB 2FYRA 2BY6X 4Y7BA 1T8OA 1K0HA 4HTCH 1TQ7B 1GJ5H 5L30H 2AFQB 1ZTKA 1T32A 1X7AC 3KQ5A 3F0PA 2BDCA 2XBVA 2BMGB 2DE9A 3SORA 2OK5A 3SU2A 1GGDB 1TQ0B 4BAHB 1ZPCA 3A88A 3GDVA 1ELAA 4FETA 2ZGHA 3SUFA 1T7CA 1ELGA 2AMPA 1GHYH 3RXGA 4X8VH 1TB6H 1IQEA 4F55A 1FPCH 1EFRD 4H6SB 1C1UH 1TMTH 2H9HA 4XD7D 3OFND 4AOQA 3OEED 1MU6B 1RFNA 2KCAA 1QQ4A 1IQJA 3RC6A 5G4BA 3RU4D 2A7CA 1FUJA 4Q63A 1QL8A 5A8ZA 1ZHPA 2GVFA 1TLDA 2P93A 2QF3A 4NFFA 4AB9A 1CA0C 1L1NA 2BVXH 4GHQA 4B76A 2LP6A 1DDJA 1WYKA 1ETRH 1OP2A 1GBTA 3EQ0H 4B71A 1GMDG 1EZSC 2IJD1 5ESTE 2WV5A 1F2SE 3STJA 1IQNA 4OS4A 4OS7A 3GDUA 3HK3B 1O2SA 4D76A 1J15A 3SBKA 2WV4A 1Z1JA 2B9LA 1ZOMA 2A7JA 4AG2A 3ATWA 2FOCA 1A46H 2A5IA 2XCNA 1O2ZA 4FU9A 3MH7A 1ZTJA 2OP9A 3SJ8A 1PYTD 4ABFA 1F0SA 4ISLA 2PKAB 3F6UH 1XVMA 1YPJH 4B2CA 1A1RA 1CBWC 2G4TA 1G32B 1MAYA 4I8JA 3V7TA 3MH6A 4Y8YA 1ABJH 1NROH 5DKMA 4X6PA 1CHGA 2JKHA 1JMOH 2FS9A 3SO3A 1OYTH 1YGCH 3SV7A 5LH8A 1C2LA 1BMLA 5JB8S 3CP7A 4DIIH 2ODYB 1ZZZA 4UFEH 4MTBA 1UHBA 1AVXA 1GBEA 2A45B 3PMBB 4B73A 3SNAA 3MU4A 5DP3A 1S84A 1H9HE 3M3SA 1P3CA 3QUMP 4B74A 2FS8A 2XC4A 4FUBA 3LJOA 2VWLA 1XVOA 2Z9IA 4WF8A 1KDQA 3M5OA 4ZAEA 2QF5A 1EJAA 5T6GA 2W7SA 1BDAA 1ZMLA 1C5XB 3TPIZ 2PTNA 3ZZ8A 3LGYA 3NUMA 2BOHB 4LXBH 4ZXYH 1K22H 3LT3A 1K28D 5HIYA 1UVSH 1YPKH 3HGPA 2JH5D 1H4WA 2Z9LA 3T28A 1FN6A 3QLPH 2VIOA 3RLYH 1KXDA 2Y5FA 4NWLA 3M5NA 3QWCH 4D9QA 2ZDMA 1XMNB 2H1UA 3PMAB 2ESTE 2QGRA 3M3VA 1BTPA 2AIQA 1C5NH 1E34B 5JBAS 3GCTG 3UIRA 3IWMA 2UWPA 3VB5A 1BB0B 4MPUA 1GDUA 1BBRK 3R0FA 4AYYB 1MBQA 2AYWA 2V35A 1P2OA 2WPIS 1QY6A 1Y3WA 2ZHQH 2ZPQA 1YM0A 3KQBA 2OBOA 1COWD 2NU0E 4X1NU 1O3IA 4LOYH 3I29A 1GHAF 1GMCF 3QZQA 3OEHD 2ZU2A 4FOUC 1J14A 1OHHD 3W1EA 3ZYEA 5JBBS 3DUXH 1DSTA 4F49A 3FP8E 4ABHA 4CRBA 4FVBA 1A3EH 1QBOA 3E90B 1V6DA 3U1JB 2HVYB 2OC1A 4OS2A 1TBZH 1HIAA 3A7VA 1DOJA 2OC7A 1AVGH 3GY7A 1P2IA 2FZZA 3MNCA 3MWIU 4WXVA 3K6YA 1HNEE 1K21H 1P9UA 5C5NA 1N6YA 1TX7A 7GCHF 1Y3VA 3SQEE 1GI9B 1TNGA 5FPSA 3S9BA 1OP8A 2ZC9H 1W12U 2WUCA 3FFGA 3ZZBA 3K2UA 1TBRH 4NCYA 1O2QA 5FL7D 3RMNH 1CU1A 1ANEA 1ELFA 3NPSA 3NRLA 1O36A 5FCRA 2V7QD 2V3MA 2ODPA 2Y82A 2WPJS 5EODA 3HGNA 5GIBA 3DFJA 1KXBA 2ZGBH 3LGIA 1C2GA 1SGEE 1MKWK 1SGRE 4F48B 1O2YA 1IQMA 1Z8RA 3SU6A 1C1PA 2AH4X 5HXFA 1BT7A 3EA7A 1ZPZA 1C9TA 2BLOA 1G30B 1PQ5A 3SV6A 1V2QT 5HM9A 1EX3A 1T4UH 1HAVA 2TIOA 3RM0H 2GZ9A 3A81A 3NK8A 1WQSA 1O5AB 1TNIA 4DT7B 5EGMA 5FPTA 4CRCA 1WTHD 2OQ5A 3BTFE 1S83A 1P06A 3BEUA 1QBVH 3QTVH 4MG3A 1EPTA 1UK2A 3RXJA 4GHTA 3KL6A 1GBBA 2H9TH 1AN1E 1RGQA 4YTAA 1TPSA 3H7TA 4X1RU 4K1TA 3VB7A 2ZGXH 3EGKH 2ANWA 2YMSD 4ZKSU 5BRRE 5JDUB 5JBCS 1GMHG 4YLUA 3FOAA 4F4OC 1KXCA 1A4WH 1T8NA 2AIPA 4XOJA 1SSXA 1WQVH 4AC9A 1FMGA 3UOPA 5DK1A 2ZU5A 4X8SH 2KZ4A 1UCYK 2FOFA 1MH0A 4HFPB 4U01A 3KF2A 4FUJA 1UK4A 3KQEA 1S81A 2G52A 3TJOA 2ZFPH 1QJ6B 3FZZA 3E8LA 5IDKA 1MCTA 2FOGA 5T1VA 1O0DH 1E0FD 1YC0A 3BF6H 4MNXA 3VGCC 4DURA 1PPGE 2KX4A 4CR9A 5F8TA 4K69A 4BXSA 4CH8B 1SGFG 1GJ9B 3F9HA 2GTBA 4D9RA 2P3FH 4DCDA 3SGQE 2SGFE 3V3MA 5EQSA 3RXFA 1DY9A 3M61U 1G3EA 4CRDA 1UTOA 1YF4A 2SFAA 4YLQH 1QL7A 2P3UB 2W6JD 1SLXB 1LHEH 2KAIB 3RXDA 1B0FA 4ABJA 1GHAG 1GMCG 1GG6C 6CHAC 1GDNA 1TFXA 2A2XH 3AASA 3ELAH 2H5DA 4PROA 1SQAA 1DUEA 1ZSKA 4BANB 4FUFA 1Z8JB 3OYPA 1SQOA 1PPEE 2ANKH 2HWLB 1OXGA 3RXQA 1P10A 1SFIA 4Y76A 4GPGA 1UVOA 1N8OB 2XBWA 2LNCA 3UR6A 4I31A 2HVXA 2F9VA 3MO6A 7GCHG 3FN8A 2P59A 3HPTB 2ZFSA 2C93B 1E1QD 2ZI2H 3MFJA 2ZWLH 2O8WA 1QFKH 3TITA 2Y6TA 5C5OA 4Y0ZE 1NY22 4CH2B 2UUFB 1AB9C 5AHGH 1GJ6A 3RU4E 1W3CA 1UTMA 2QN5T 1SC8U 1W0YH 5E2PA 3RUOA 3FO8D 1P11E 3L33A 3SUEA 1E37B 1P9SA 3BTHE 4CR5A 4Y71A 5DGJA 3UTUH 2AS9A 1AUTC 1JIRA 2ZTYA 1VZQH 2JIZD 1LPKB 2BB4A 3WWFA 1MBMA 1MZDA 3D23A 3EE0B 1P2JA 3P8FA 4CREA 1TA2A 3FP7E 3NWUA 1GBIA 2VIVA 2WSSD 1KYNA 4DJZB 1HLTH 8GCHG 2ZDKA 3ZVBA 1OWHA 5T6DA 5EOKA 1BUIA 3QGNB 2Z3EA 5FCKA 1ZTLA 2VWOA 3OAAD 3PRDA 2A4OA 4VGCB 1Y5UT 3V12A 2HNTE 2VB0A 4GAWA 1BJVA 1CA0B 1LVYA 1AUJA 2ZFQH 1S82A 1Z7KA 2IPHA 5DP5A 4Y10E 1XXFA 3H09A 1HAPH 3EDXB 2FXRA 3MOCA 3BTME 1U6QA 2ALVA 2KCPA 4E7NA 4OS6A 5H4IB 5C94A 1LTOA 2KCOA 2GCTB 4JYTA 2CXVA 2WHXA 1C1MA 2FTLE 3F9GA 1WAYB 1UO6A 4WMFA 1MABB 2FLBH 3RMMH 4BTIB 5A0BA 2F9UA 1QA0A 1MQ6A 2JETC 3EYDA 3ITIA 4X1PU 5A0AE 1CGHA 5CE1A 1OWIA 1GVZA 1Y3UA 1SPJA 3OY5U 1C5QA 1CBWB 2BDYA 4AFZA 2NU1E 2OUAA 4UDWH 2HNTF 3UOUA 1F92A 2QY0B 3VEQB 1AE8H 2J98A 3BG8A 1D3PB 1NRSH 3PTBA 2GCHG 1OWKA 2JH6D 3UQOA 1O3MA 2QE7D 3LC3A 2R0LA 1QL9A 2YNAA 1ZSLA 1FI8A 2P8OC 2ZP0H 3S7KB 3SJIA 1P03A 2ZDNA 1AWFH 1QB6A 1AWHB 2FOEA 1TNKA 1ABIH 1ZMJA 1KMHB 1GMDF 1FDPA 1O35A 1P2QA 3MO9A 1P57B 1HPGA 2OLGA 1C4Y2 4ABGA 2IN2A 2BDBA 3SI3H 5HKKD 1O3CA 2FLRH 5T6FA 1GI3A 4FUHA 4LZ4B 2G51A 1SR5C 1TGBA 2FI4E 1HXEH 1O2IA 1A5IA 4K2YA 3V0XA 2YMSB 3PTNA 5C20A 2Z6BD 2TGTA 4O03A 1SGNE 2IJOB 3TNSA 2WYJA 4FVDA 4JK5A 2FWWA 2RA3A 3URDA 4LZ1H 1SHYA 5DJ7A 2ZQ1A 3GYLB 1RTFB 1BHXF 1JIMA 2SGAA 3UPEA 1FJSA 2G4UA 1C1VH 3RP2A 1D6RA 2BD8A 1WTGH 2STAE 2ZIQH 2ZO3H 1WDIA 2HNTC 1PYTC 4IBLH 1DWCH 1YBWA 3A85A 4ZUHA 3Q3XA 4NZLA 3SHAH 2VIDA 1E35B 1HJAB 3U8RH 1RRKA 4GSOA 1P09A 4K8YA 1W0JD 1NPMA 2JH0D 4ABBA 1EZXC 1K1PA 1KTSB 2B7DH 1C1QA 5KEDA 4RSPA 1FY8E 3SNBA 1O3LA 1KLIH 2VBCA 2KCYA 4H4FA 3UFAA 4DG4A 1NFXA 4KTSA 1HXFH 1GI2A 2FIRH 5IYTA 9LPRA 1OX1A 2PP6A 1KSNA 4HZHA 2XC0A 5K0HA 1FQ3A 4B6FA 2BD9A 4HG6A 5DSFA 3E91A 1O5GH 1O3KA 1RIWC 1DPOA 2W6ID 1GWAA 1WSSH 4K60A 4TYDA 5HGGA 2BD4A 2KR7A 1CT4E 1G36A 3T25A 2KFWA 1YPLH 1ACBE 2NU4E 3A87A 2BX3A 2VH0A 3FZDA 1MTVA 3ODDA 3MNSA 1YPHE 2ZQ2A 4INHA 1UCYE 1C5RA 1FZZA 2K1QA 1BTWA 2VH6A 4WWYA 2FOMB 1EAWA 1MKXK 1O3OA 1BOQA 2GV7A 1CT2E 3ZV8A 2QC2A 2R2WU 2PKAA 1C2IA 1FAXA 1QB1A 1TNHA 1QR3E 2Z3DA 2QXHA 4J1YA 1O31A 1O39A 1GBHA 3RU4T 1BCUH 3AVZA 2Y7ZA 2GT8A 3VB6A 1A2CH 1BRAA 1HJ9A 3A80A 4JZDH 5T3HA 1YLCA 3B9FH 3DSPA 3ZZ6A 1QBNA 4P00A 5C1UA 3UQVA 3RXTA 1G37A 2TBSA 1Z6JH 2L74A 1O2LA 1ARCA 1ZHRA 2FX6A 3L6PA 5C0TA 3P8NA 1ZRBA 2Z9JA 1N1LA 1K1JA 4XBDA 5EJ1A 3A7XA 8LPRA 1W0ZU 1TNLA 1NC6A 2ZCLP 5EXLA 2VINA 4WH8A 1AHTH 1GBMA 5JYIA 1TRMA 4VGCC 1O3NA 3SV8A 4I8HA 1W7GH 2XOKD 1QGFA 1GBLA 2HGTH 1DWEH 4YXWD 1IAUA 1SG8B 1TMUH 1AZZA 1EB1H 1S5SA 1VITH 4HI3A 4RKOB 3AK5A 4JMYA 2K0QA 5A09A 1ZJDA 1DY8A 4E06H 2O8UA 3ZYDA 3VB4A 2GCTC 1THRH 1MAXA 2TPIZ 3MU1A 5AF9H 3RXOA 2PW8H 1YPMH 5GCHF 2A4RA 2F91A 4AX9H 1J17T 4U32A 3WY8A 4IMQA 4FU8A 1P02A 1XUGA 4DVAU 2GMTC 1S0QA 4TPIZ 5F8ZA 3KHVA 1DXPA 4NSVA 1V2PT 4ISOA 3VGCB 1YY3A 1YPHC 3BN9A 1YCPH 1P2KA 2R9PA 1YCPM 3S9AA 1RD3B 4IS5A 5KECA 2VVUA 1MTNC 5FAHA 3TJUA 1S6LA 4B75A 3LJJA 1YLDA 1VGCB 5EQQA 4AN7A 1GJBB 1QJ7B 1A61H 1NBMD 1IQFA 2ZU3A 4Y79A 2BZAA 1N6XA 4XFQA 2Z9KA 2HOBA 3F9FA 4X2YA 1GG6B 6CHAB 1EZUC 1HAYB 1UTQA 2H9EH 2Z94A 3RXKA 1V2MT 1C1OA 3KQDA 3FP6E 3TIUA 1GMHF 4B6EA 1GJ7B 5EQRA 1IQLA 1Y3YA 4Q80A 3SJKA 5JB9S 2BLWA 3LPRA 1MD8A 1UTNA 1BQYA 1RTLA 1PPHE 3O8RA 1RS0A 1SGPE 4MVNA 2YMSC 2Q6FA 1GI0A 3C1KA 1ETTH 1PFXC 4MPVA 1C5VA 2TGPZ 3AW0A 4K8BA 3LIWA 3BTEE 1KTTB 1QURH 3MHWU 1ORFA 4GUXA 1TPOA 1UK3A 2ZGCA 2M5TA 4B1TA 3A84A 6ESTA 1C2EA 5GDSH 3T5FH 3ZZDA 1O37A 3T27A 2ZZUH 4IC6A 1C5ZB 1FV9A 4I86A 1C2KA 5FBIA 2G5NA 4KTUA 2A7HA 2J9NA 3P8GA 2O8TA 1ANDA 3Q76A 1BBRH 3SU5A 1HFDA 1O5FH 1LKAA 1IOEA 2VIPA 1HJAC 2V6NA 4Q7YA 1AB9B 4MNYA 2BY5X 1Y8TA 4AG1A 3U69H 5E0JA 4BAQB 2PLXA 1TGNA 3F2HA 1AY6H 1IQHA 1SVPA 2V0BA 1TBQH 1GDQA 3Q3KA 4BTTB 5TCCA 3OU0A 1BZXE 2GGVB 3U1IB 2GZ8A 3B23B 5CDFE 2CGAA 4K5ZA 2XBYA 3VB3A 4YZUA 3GY4A 1C5LH 1DICA 4GLYA 1DWBH 1C5TA 3HATH 2LPRA 1YWUA 4H6TA 1O3PB 2BVRH 3GY6A 2UUJB 2QXJA 1UTJA 1C2MA 4ESTE 1TOMH 3STIA 1YPEH 1CQQA 1LHFH 3UWJH 2H6MA 3E1XB 1THPB 2SGEE 1Z1IA 4YOGA 4ACAA 3TK9A 1O2HA 3PV4A 4KKDA 5EXMA 4NZQA 1SQTA 4Q4LA 2ZPSA 1IQKA 4IN2A 1MU8B 2OBQA 1EQ9A 3LGUA 1MKWH 4ZCNA 3RXVA 2FYQA 1O2PA 4XE4A 5GCHG 5DO4H 1ANBA 1BTZA 2VVCA 3MMGA 4NFEA 4Q7XA 1C2HA 1NO9H 2A4QA 2B5TB 3BTTE 1O3GA 2JETB 4XRNA 2P16A 3N7DA 2L6OA 1GJ8B 1ELTA 2ULLA 1P04A 1XM1A 3BV9B 1GI4A 2WPLS 1LVMA 4CRFA 2R3UA 2O8LA 1IHSH 1SGQE 2JJ1D 1ELVA 2ZFTA 4K3JA 3GISB 1WV7H 2BDHA 1OYQA 1V2TT 1W11U 1VCQA 2KAIA 1GI1A 8GCHF 3TGKE 4WVPE 2G00A 5GNDA 2B0FA 1S6FA 1QIXB 1TAWA 4BAMB 3F1SB 3A8CA 1UVUH 5C1YA 2P8OB 4Y7AA 4RKJB 3MO3A 3VFEA 4WMDA 1TPPA 1BITA 1J8AA 3BTGE 1SHHB 3GS9A 5GPIB 1ESTA 2BQ6B 4O3TA 3QZRA 3KQCA 4NA9H 4THNH 4ZXXH 4NA8A 1SOZA 4AFSA 2CHAC 4YT7H 3H5CB 1C4V2 1B5GH 1KXFA 2BY7X 2C8XB 1KIGH 2AEIH 5EJLA 1E79D 4M7GA 3UREA 4DOQA 2Y5HA 4R0IA 1CGIE 1HBTH 2QXGA 2AHME 2SGPE 2YNBA 1O2JA 4AGJA 1V3XA 1O2UA 3LC5A 2F43B 2ZTXA 1O2KA 4LK4A 4BTUB 2NWNA 3DCLA 1HV7A 1MD7A 5CHAB 1AFQC 1W0KD 3OTJE 3NCLA 2QAAA 1EAIA 2GCHF 4X2XA 1HAGE 2PKSB 1HAXB 1VGCC 2UWLA 3ZVCA 5A8XA 3SNCA 1GVLA 2TGDA 2VIWA 4YOJA 3WW7A 1XKAC 3ZIAD 2IPQX 3VG8A 1O5EH 4ZHAA 1BTHH 2HPQH 5JPMH 3U98H 5GXPA 1UMAH 5IK2D 1WOFA 3BG4C 1BMFD 1ZHMA 2P3TB 3U8OH 3T62A 4MPXA 4KELA 3QX5H 3QDZB 2ZTZA 1RIWB 1QNJA 3CNRA 1GBFA 1GHXH 2VGCB 2FESH 2ZU1A 2FOHA 3KYFA 3TGIE 4UFFH 1PPFE 1BIOA 1K9OE 2Y7XA 1VR1H 1BHXB 1EPTB 1QCPA 1P01A 1C5SA 2C90B 5FHTA 2SGQE 1NESE 1CHOG 3GCOA 1LHGH 5L6NH 4AORA 1FXYA 1J16A 1ZRKA 2A5KA 3ATMA 2F3CE 2ZHFH 2BDIA 1RTKA 5F6MA 5F8XA 3DSGA 5C2ZA 3Q3YA 1TGCA 2PTCE 3ZVEA 1SMFE 3OTPA 2BLQA 3N7EA 3RMOH 2ZDVH 1UVPA 3M5LA 4Y11E 4AB8A 4NGAH 1GHZA 1HAZB 3LGTA 3ATLA 2PUXB 3QK1A 2JDID 1TPAE 1F0UA 3UNSA 2EI6A 2BDAA 1PQ8A 1NFUA 2SGDE 3ZV9A 1C5WB 3M7UA 1AO5A 1C5UA 4ASUD 4XBCA 1LPGB 4JYVH 2PSYA 1W8BH 5DN6D 4YM9A 2V3HH 2GZ7A 1SLVB 1SGDE 1VITF 1NN6A 1JOUB 2V3OH 3GCNA 3F2GA 1LMWB 2A5AA 2WPHS 3TH4H 1O5DH 2W3IA 1GHWH 2Q6GA 2ASUB 2A31A 1KXEA 1QQUA 3O8CA 2OINA 2WINI 2ALPA 4UD9H 4XSKU 2D8WA 2THFB 4ASHA 1AKSB 1H8HD 1LCYA 1HJ8A 2NU3E 1C2FA 3P70B 2BXUH 3ZZ3A 5I46H 2Q1JA 2BY9X 1NBME 1MZAA 3LKWA 2GMTB 3ZZCA 4FXGH 1AE5A 1DFPA 1RXPA 1HCGA 1O33A 1TE0A 1CGJE 5JBTA 2ZPRA 3ZVGA 1D3DB 1A0JA 3PROA 1Y3XA 3ZZ5A 5TJXA 3K6ZA 2NU2E 1VCPA 4HGCA 2C3SA 3BTKE 2UUKB 2PUQH 1MTNB 1NS3A 3KGPA 3RXEA 1O2GH 2PHBA 3ENSB 3VXFH 3UB0A 4NIXA 1QB9A 1Z8GA 1L4ZA 1GPZA 4OM9A 6LPRA 4CBOA 2P95A 4X2VA 3PMJA 5FPYA 5C17A 4B2BA 2H2ZA 2ZFFH 1TWXB 1OWJA 1INCA 3PV2A 1LKBA 1O38A 1YLNA 4U2WA 4A5TS 4RT1A 4FUCA 2G5VA 3LDXH 2ZDAH 2ZU4A 3ATKA 4WY3A 3ODFA 3RXRA 5GWZA 1Q2WA 2HALA 3LOXA 3PM3A 4ZHMU 1NZQH 5SGAE 4TWYA 3BIUH 2FTMA 4YO9A 2PR3A 2WZQA 3OSYA 1T8LA 1NRQH 2QF0A 3EA8A 3FKSD 1V2NT 1L1GA 2P94A 1G3CA 2GV6A 3S0NA 1M9UA 1SLUB 1WBGB 5GJ4B 1EB2A 1BMMH 5CHAC 2BYAX 2ZECA 1TALA 3E16B 2O8MA 3ESTA 4OS1A 1SGTA 7ESTE
chains in the Genus database with same CATH topology
2PKSC 2WYGA 3D62A 3SU1A 2TGAA 1YKTA 2BX4A 1GCDA 2G55A 2UUYA 4JZIA 3RXLA 3MU0A 1GBCA 1O2MA 1IQIA 2VVVA 2Y80A 4UEHH 4GVUA 2QV1A 4I8LA 4ABAA 1H8IH 1ESBA 2XXLA 1D9IA 4ISNA 2Q6DA 1EOLA 1PQ7A 2BHGA 2VGCC 3TK6A 5EG4A 4I32A 1LPZB 4O9VA 2DE8A 3A7WA 1PPBH 1EPTC 1VITG 1PQAA 1MKXH 4CRAA 1JRTA 5EW1H 5I25A 2XW9A 3RC4A 4YOIA 3A8AA 4DW2U 2XC5A 3SW2B 4NA7A 4DIHH 5ESBA 5AFZH 5FXLA 2Z7FE 4A7IB 4B2AA 3A82A 3HK6B 1TGSZ 2BQWB 3SUGA 1DITH 5C3NA 3QGJA 1C1SA 1BTUA 1Y5BT 1CVWH 4YESB 4IC5A 3E0PB 1A3BH 1O5BB 3CENA 1P05A 1BA8B 5DP6A 3B8JA 1ZYOA 1DVAH 3GCHC 1DWDH 2FP7B 1SB1H 1TMBH 1E38B 2GT7A 1TA6A 2RA0A 1KLJH 1Z8IB 1EATA 3F9EA 1BJUA 4JK6A 1Y59T 1TRYA 3RM2H 2FI5E 3U9AH 4H42U 1C1TA 5A2MH 5DPAA 4AFQA 4ABIA 2WPKS 4INLA 5ETXA 4MNWA 2ZDLA 3ZVDA 2BY8X 1EP6A 5EPNA 2OQUA 3L3TA 3SU4A 2FM2A 4OGYA 3GY2A 1W14U 1SLWB 4BXWA 3QO6A 3MNBA 3M5MA 3SZNA 3LONA 1EAXA 2BD7A 3GOVB 1V2RT 3MH4A 3QN7A 2EA3A 1K1OA 1GCTC 2XWAA 4I33A 3ZVFA 1ETSH 3RXIA 1V2KT 4AGKA 1A5GH 4DGJA 2EEKA 1PPZA 3H7OA 2CHAB 1A5HA 1V2UT 3RXUA 4A92A 4JCNA 1O2VA 3AAVA 2VWMA 3A7YA 2RG3A 2ZF0H 2PSXA 1AIXH 4ZMAH 4BOHA 1P8VC 5FBEA 2QXIA 1EUFA 3IITA 1TX8A 3SQHE 3N7OA 3GICB 3I77A 4FUGA 3S69A 1FONA 3EAJA 1RJXB 1Q3XA 1UJ1A 4GCHG 2BXTH 5J4SA 1GI5A 1TGTA 1ZGVA 1C5YB 2EC9H 2CJIA 1KXAA 3SV2H 1FAKH 4E05H 5LPFA 1Q31A 4OS5A 1MUEB 1CSOE 1NM6A 1F0TA 1AGJA 1AFQB 2HPPH 1DLKB 4TPYA 5DP7A 4BAOB 1DUAA 3PO1B 1TYNA 4A1XA 3V13A 3K9XB 1L1JA 4ZROA 1GJAB 3SU3A 2B8OH 1V2LT 2PGQB 1HAOH 3K65B 3P92A 3TVJB 3JZ1B 4ZHLU 1P3EA 4WXIA 5A8YA 5LPRA 1OPHB 2OC8A 1UTKA 1A0HB 1FLEE 1O2TA 1YCPK 1ZPBA 4NIVA 1YYY1 2EI7A 4E7RG 3DFLA 3BG4B 3DA9B 3TJNA 1IHTH 2BOKA 2CV3A 3O8DA 1NRNH 4A6LA 3UNRA 1C5OH 5FX6A 2OC0A 4J2YB 5EPYA 2J2UA 5LPEA 2F9BH 2QIQA 1EP5A 1NFYA 1DM4B 4NIWA 3RDZA 3ZZ7A 3BTWE 1ELBA 1G9IE 4BNRA 1GJ4H 1H1BA 2XCFA 4OGXA 3W95A 1K1NA 1LVOA 2VNTA 1AFEH 3NKKA 2F83A 4XBBA 5BPEA 7LPRA 4JYUH 2ZKSA 3T2NA 3ZVAA 1S6HA 2FDAA 1IQGA 5PTPA 6GCHG 5AFYH 3A8DA 1WU1A 3TH2H 1JWTA 1BRCE 3TGJE 1GI8B 1O3DA 1HDTH 3BEFB 1ZMNA 1W13U 1EJMA 2OD3B 2AMDA 4JZ1A 4O3UA 2R2MB 1MMJN 2OCVB 3P8OA 4K1SA 3TK5A 4X2WA 1FNIA 2G81E 2YOLA 3F68H 4SGAE 1LQDB 3DD2H 4D7FA 3HKJB 1YP9A 2CF8H 1ELCA 3RXHA 1WUNH 4UE7H 1F7ZA 3A89A 1C2DA 3T29A 1XUJA 2C4FH 3SOSA 3PB1E 5HYOA 2WUBA 1O3BA 2F9PA 1EKBB 1OSSA 5HM2A 1HRTH 1CHOF 1ZJKA 2AERH 2A1DB 4X0WU 1SGYE 2A2QH 4X6OA 1UHBB 2ANYA 1O2WA 4KP0A 2R0KA 1GBDA 2RDLA 4X6NA 2F9NA 4X1SU 3BIVH 2J92A 5FX5A 3RXAA 2ZCHP 4IW4E 1FN8A 1C4U2 2A32A 3E6PH 2PFEA 4IGDA 3LGVA 1JXPA 1KDQB 4MPWA 1XUFA 3GY8A 1P12E 1F5KU 3S7HB 1AQ7A 3DHKH 2OTVA 1O2OA 1KY9A 5TCAA 1D3TB 1J9CH 1FY4A 1ESAA 2PWXA 4UFDH 1EZQA 3PYHA 2GDEH 1BTYA 1QHRB 1NU9A 3MNXA 4A1TA 4K1EA 1AI8H 1OP0A 1T4VH 1DSUA 1SBWA 1GGDC 1W2KH 1CE5A 1P0SH 3NZIA 3Q00A 2SNWA 2DUCA 1SI5H 2C8YB 3AW1A 1EOJA 3A83A 2SNVA 1EJNA 3UUZA 1F5RA 2AGGX 2F9OA 3GY5A 5LGOA 3KN2A 1HB0B 4FUIA 2XRCA 3UY9A 1XUKA 1PJPA 3GDSA 1DXWA 3VPKA 3TLOA 4WJG2 1VJAU 4Y8ZA 1AVWA 1FPHH 1OKXA 1JBUH 1UCYH 3LU9B 4Y0YE 2BM2A 3FVFB 1MQ5A 1V2WT 1O32A 1G2LA 4TY6A 2AGIX 1MCVA 1S0RA 5DP4A 3SN8A 4AFUA 2O9QA 1GBKA 2J95A 1K1LA 1SGCA 2D2DA 3A7TA 2ILNA 2A0QB 1TIOA 3SNDA 1HIAB 2VIQA 1GBAA 3SJ9A 1NFWA 3RXSA 9ESTA 1O34A 2XYAA 3MYWA 1ZLRA 1L4DA 2W3KA 2BD3A 3D49H 3C27B 3SJOA 2W7UA 4I7YH 1VJ9U 1TNJA 4NSYA 2GX4A 3EA9A 5ABWA 2FO9A 1ZSJA 1HAIH 2ZHEH 3PO1C 2XBXA 3SU0A 2IOTA 4AYVB 4ZKRU 2FMJA 1G3DA 2FEQH 3UWIA 2FPZA 2STBE 3O8BA 1HAHH 5F03A 3CS7A 1OWDA 1H9LB 2GD4B 2OXSA 1FIZA 4Y6DA 3TJVA 1LHDH 4NIYA 2BD5A 3U8TH 2CN0H 1LO6A 2BTCE 4CHAB 2QYIA 3BEIB 5EXNA 4MQAA 4DY7B 4MNVA 5E0GA 1XUHA 1ELEE 1GL0E 1O2XA 1UTLM 2PV9B 4TWWA 2BD2A 4SGBE 1AD8H 3SGAE 5A0CA 3KCGH 3RXBA 1HAVB 5AVDA 1O2RA 4WMEA 4I8KA 2ODQA 3P95A 3E0NB 4X6MA 1C1NA 3SI4H 2ZCKP 4BAKB 3R3GB 2XWBI 1AKSA 1V2JT 2C8WB 4QT8C 1QA7A 3M3TA 2CF9H 1SGIB 2H5CA 4R8TB 1C2JA 3RXPA 1GVKB 4Q7ZA 2UWOA 2D1JA 2HRVA 2VWNA 3RXCA 1GL1A 3BTDE 5CMXH 8ESTE 1FY1A 2EI8A 1HGTH 2XNIA 1B7XB 1LQEA 3G01A 3CS0A 2Y5GA 2AMQA 2BZ6H 4FU7A 1GI6A 1D3QB 4X8TH 1C5PA 3AAUA 1XXDA 4MLFB 3M36A 1TRNA 2FOBA 3GCHB 1FIWA 3HKIB 8KME2 2W5EA 1D6WA 4TY7A 5E8EH 4ABDA 1QRXA 3W94A 2ZHDA 1FY3A 3KEEA 1MTSA 1YPGH 1NT1A 4UFGH 3UNQA 3A86A 1GHVH 1T31A 2D26C 2FX4A 1H8DH 3M35A 1CA8B 1GI7B 3TH3H 4KTCA 2J34A 1V2VT 1DE7H 4FUDA 2BQ7B 2I6SA 1AMHA 2GDDA 3OX7U 4YT6H 4X1QU 1SOTA 4CBNA 1GCTB 3PWCA 4ABEA 3LH1A 1O5CB 2BLVA 3PMHB 2J38A 2WPMS 5E0HA 4WH6A 1JRSA 1O3FA 1K2I1 2ZGJA 1TOCB 5L2YH 3IG6B 1BRBE 1ANCA 1D4PB 1L2EA 3P17H 1GHBF 4KGAA 3MTYA 3P6ZB 1C5MD 1ID5H 4XDEA 1LVBA 3PLBA 1Z6EA 1V2OT 1EXFA 1NU7B 2AGEX 5C67A 1NTPA 1WCZA 2BDGA 2I6QA 2ZA5A 3TNTA 3URCA 5EU8A 5DG6A 1QRZA 3RLWH 3RMLH 1UTPA 5K7RA 1Z71A 3KNXA 4Y8XA 1TABE 3MU5A 1P2NA 3BTQE 1O3JA 1T8MA 2BVSH 1ELDE 1PPCE 4RN6A 2J4IA 1DLEA 3QTOH 1TX6A 1ARBA 1BBRE 1GBJA 2ZHWH 3NXPA 1NRPH 1QTFA 3PLKA 1EAUA 1HYLA 1O2NA 1P2MA 1UVTH 3T26A 4X8UH 1K1IA 1LHCH 1S85A 2J94A 1O3AA 3ZZ4A 1KLTA 3RXMA 1BRUP 4ZKOU 1CO7E 2Z9GA 4UONA 1QRWA 2GP9B 3KIDU 1W10U 4Q2KA 4Z0KA 1G3BA 1CT0E 1O3HA 3GY3A 4A1VA 3MU8A 2C8ZB 3RC5A 4ISHH 2R3YA 1O3EA 4CRGA 4ZH8A 4INKA 1B0EA 1DT2A 4D8NA 3ZZAA 1V2ST 2HLCA 1OOKB 1SGFA 3PWBA 2PGBB 1A0LA 4FUEA 5E2OA 5EW2H 1SFQB 1TONA 1DX5M 2Z3CA 1F0RA 1XKBC 4GCHF 3SNEA 4AZ2B 2Y81A 3SGBE 3GYMA 4JZEH 1BMAA 1K1MA 2FI3E 2W26A 3M7QA 4IMZA 1LDTT 4NG9H 2G8TA 4D7GA 2RCEA 1W7XH 3SUDA 4IN1A 5DP8A 3ZZ9A 3LGWA 1AU8A 1XUIA 1ZR0A 1MTWA 3SHCH 1BMNH 3OY6U 1C1RA 3A8BA 5L2ZH 1Y5AT 2VU8E 3JZ2B 4CHAC 1GJCB 4JZFH 1E36B 2FODA 3SV9A 2ZFRH 2ANMH 2GKVE 1ZGIA 3I78A 3E3TA 1MTUA 2TRMA 1L0ZA 3DT0H 1OWEA 2ZG0H 2ZNKH 3ATIA 3M37A 1FY5A 1O30A 3PLPA 1EASA 2VJ1A 1THSH 4ZKNU 1DS2E 3M7TA 1DANH 1NRRH 1H9IE 1F5LA 2FOAA 4U30A 5J4QA 5DP9A 3TU7H 4ISIH 4MDSA 3UR9A 1G2MA 1OS8A 2A4GA 3VXEH 3S9CA 4I8GA 1C9PA 2QCYA 2XTTB 1C1WH 4NWKA 1XX9A 3FANA 5C1XA 6GCHF 1VCWA 3BSQA 1N8OC 2CMYA 5B6OA 3FAOA 1A7SA 1GHBG 4O97A 1AZ8A 2QA9E 1SL3A 3A7ZA 3D65E 3MI4A 3LH3A 1QJ1B 5HMAA 3MH5A 2ZEBA 3GCTF 1HUTH 3Q77A 4Z6AH 1BTXA 7KMEH 1GJDB 2FYRA 2BY6X 4Y7BA 1T8OA 4HTCH 1TQ7B 1GJ5H 5L30H 2AFQB 1ZTKA 1T32A 1X7AC 2BDCA 2XBVA 2BMGB 2DE9A 3SORA 3SU2A 1GGDB 1TQ0B 4BAHB 1ZPCA 3A88A 3GDVA 1ELAA 2ZGHA 3SUFA 1T7CA 1ELGA 2AMPA 1GHYH 3RXGA 4X8VH 1TB6H 1IQEA 1FPCH 4H6SB 1C1UH 1TMTH 2H9HA 4AOQA 1MU6B 1RFNA 1QQ4A 1IQJA 3RC6A 5G4BA 3RU4D 2A7CA 1FUJA 1QL8A 5A8ZA 1ZHPA 2GVFA 1TLDA 2P93A 2QF3A 4NFFA 4AB9A 1CA0C 1L1NA 2BVXH 4GHQA 4B76A 1DDJA 1WYKA 1ETRH 1OP2A 1GBTA 3EQ0H 4B71A 1GMDG 1EZSC 5ESTE 2WV5A 1F2SE 3STJA 1IQNA 4OS4A 4OS7A 3GDUA 3HK3B 1O2SA 4D76A 1J15A 3SBKA 2WV4A 1Z1JA 2B9LA 1ZOMA 2A7JA 4AG2A 3ATWA 2FOCA 1A46H 2A5IA 2XCNA 1O2ZA 4FU9A 3MH7A 1ZTJA 2OP9A 3SJ8A 1PYTD 4ABFA 1F0SA 4ISLA 2PKAB 3F6UH 1XVMA 1YPJH 4B2CA 1A1RA 1CBWC 2G4TA 1G32B 1MAYA 4I8JA 3V7TA 3MH6A 4Y8YA 1ABJH 1NROH 5DKMA 4X6PA 1CHGA 2JKHA 1JMOH 2FS9A 3SO3A 1OYTH 1YGCH 3SV7A 5LH8A 1C2LA 1BMLA 5JB8S 3CP7A 4DIIH 2ODYB 1ZZZA 4UFEH 4MTBA 1UHBA 1AVXA 1GBEA 2A45B 3PMBB 4B73A 3SNAA 3MU4A 5DP3A 1S84A 1H9HE 3M3SA 1P3CA 3QUMP 4B74A 2FS8A 2XC4A 4FUBA 3LJOA 2VWLA 1XVOA 2Z9IA 4WF8A 1KDQA 3M5OA 4ZAEA 1EJAA 5T6GA 2W7SA 1BDAA 1ZMLA 1C5XB 3TPIZ 2PTNA 3ZZ8A 3LGYA 3NUMA 2BOHB 4LXBH 4ZXYH 1K22H 3LT3A 1K28D 1UVSH 1YPKH 3HGPA 2JH5D 1H4WA 2Z9LA 3T28A 1FN6A 3QLPH 2VIOA 3RLYH 1KXDA 2Y5FA 4NWLA 3M5NA 3QWCH 4D9QA 2ZDMA 1XMNB 2H1UA 3PMAB 2ESTE 2QGRA 3M3VA 1BTPA 2AIQA 1C5NH 1E34B 5JBAS 3GCTG 3UIRA 3IWMA 2UWPA 3VB5A 1BB0B 4MPUA 1GDUA 1BBRK 3R0FA 4AYYB 1MBQA 2AYWA 2V35A 1P2OA 2WPIS 1QY6A 1Y3WA 2ZHQH 2ZPQA 1YM0A 3KQBA 2OBOA 2NU0E 4X1NU 1O3IA 4LOYH 3I29A 1GHAF 1GMCF 3QZQA 2ZU2A 1J14A 3ZYEA 5JBBS 3DUXH 1DSTA 4F49A 3FP8E 4ABHA 4CRBA 4FVBA 1A3EH 1QBOA 3E90B 1V6DA 3U1JB 2OC1A 4OS2A 1TBZH 1HIAA 3A7VA 1DOJA 2OC7A 1AVGH 3GY7A 1P2IA 2FZZA 3MNCA 3MWIU 4WXVA 3K6YA 1HNEE 1K21H 1P9UA 5C5NA 1N6YA 1TX7A 7GCHF 1Y3VA 3SQEE 1GI9B 1TNGA 5FPSA 3S9BA 1OP8A 2ZC9H 1W12U 2WUCA 3FFGA 3ZZBA 3K2UA 1TBRH 4NCYA 1O2QA 3RMNH 1CU1A 1ANEA 1ELFA 3NPSA 1O36A 5FCRA 2Y82A 2ODPA 2WPJS 5EODA 3HGNA 5GIBA 3DFJA