4NIVA

Crystal structure of trypsiligase (k60e/n143h/y151h/d189k trypsin) trigonal form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
219
structure length
193
Chain Sequence
YTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYESGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYDSGGPVVCSGKLQGIVSWGSKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title N-terminal protein modification by substrate-activated reverse proteolysis.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords Cationic trypsin
total genus 53
structure length 193
sequence length 219
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2013-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nivA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4nivA02
2O8LA 1PYTC 3ZZCA 4ASHA 3E3TA 4GAWA 1GJ4H 3ENSB 1OP0A 1T7CA 2ZF0H 1HAVB 1WU1A 2AGIX 1QJ6B 4IC5A 2P3UB 1V2QT 3RLWH 1QR3E 1RTLA 1TRNA 4MPUA 1O32A 1YBWA 2Z9KA 3QZQA 1GJCB 3BV9B 3U8OH 2C3SA 3RXRA 1UTPA 1GJ7B 3PLPA 1O2VA 2BY8X 1ELGA 5TJXA 2GDEH 2P93A 2BDYA 2RCEA 4HI3A 4ZAEA 3GY2A 1MZAA 2Z9IA 4ZHLU 4B71A 2H9HA 3AASA 3SORA 2XBYA 1OOKB 1F5KU 2GT7A 3A85A 1JXPA 2ZU3A 2FOEA 3QK1A 2RG3A 2UWLA 2PV9B 1C2KA 1SFQB 3LJOA 2FLBH 2A7CA 1K1MA 2ZQ1A 2CMYA 2FI4E 1MZDA 4YO9A 2G81E 5HGGA 3RU4T 1O2GH 1IQJA 4FU7A 1SVPA 1W11U 3RMMH 4DW2U 2SNVA 4AG2A 1KSNA 4R0IA 3M37A 4UFFH 5EPYA 3TNTA 2GP9B 3NPSA 1BBRK 1XKAC 2P16A 3OSYA 5JBBS 1NFXA 3EQ0H 1K28D 1WV7H 1GI2A 1ZSLA 3F6UH 1Z8GA 1GI8B 1L4DA 3D49H 2G00A 2QCYA 2V3OH 3TJNA 4CREA 1ZSJA 2H2ZA 4ZKRU 4CR9A 4YT7H 4Y8ZA 1SGFG 1P11E 1P02A 1J8AA 2P8OC 2W7SA 1XUIA 4DT7B 1H9IE 3SNAA 2BD2A 4DJZB 1YKTA 3U1IB 1H8IH 1QBNA 1CBWB 1C4Y2 1TFXA 2GVFA 3GCHC 1Z8JB 1V2OT 3MO9A 3KQDA 3L3TA 1P2KA 5FCKA 4OGXA 4AFZA 2F9UA 1MMJN 1NY22 3VGCB 5FX6A 2Z7FE 3BG4C 1DSTA 3DD2H 5FX5A 1H1BA 2CHAC 1AE5A 2J4IA 3ODDA 1GHAG 1O3JA 2VVCA 2ZGJA 1ARBA 1ANCA 2EC9H 1SB1H 4KKDA 3D62A 2PKSC 1OP2A 1F2SE 1ANDA 3EA8A 7KMEH 4YLQH 1MCVA 1QFKH 3A82A 4SGBE 1TX6A 3LGYA 1AHTH 3SN8A 1B0EA 1FONA 1YPJH 4NZQA 1O3IA 2R9PA 2BVSH 3VB4A 2A4GA 5DK1A 1NO9H 1QA0A 4XDEA 2A7HA 3SNDA 2VH0A 3U1JB 1EOJA 4I8KA 1T8MA 1K1PA 1PPGE 3GY7A 3NKKA 2GGVB 2BLQA 1FY4A 2ZNKH 1MTNB 1KXBA 2HWLB 1XUKA 2BD7A 5HM2A 1C2DA 2PR3A 5A09A 1UVPA 2C90B 2ZFTA 2STBE 1GBMA 1V2VT 1GBIA 4BXWA 1EJAA 1KXCA 1O5CB 1Y3WA 1C1MA 1O3KA 2VJ1A 1ZZZA 1VCQA 4AFSA 1EOLA 1FZZA 2BQ6B 1C1SA 1C5YB 1DPOA 3QGJA 1GHYH 1IQGA 1MTUA 1OS8A 2EEKA 4INLA 2ZDAH 3S7KB 4JK6A 4FUBA 2ZHEH 1G2LA 1TNGA 1HV7A 3SNBA 2QV1A 5GPIB 5T3HA 5JBAS 3PO1B 3IWMA 2SGQE 2FMJA 2XRCA 1ELBA 2ZHQH 1UTKA 2QAAA 2VNTA 2BDIA 4MNXA 3EAJA 1DLEA 2B5TB 3EYDA 2ALPA 1YPEH 1O2YA 1CHOG 5DGJA 2FOHA 7ESTE 1KLIH 3P95A 1O3PB 1C1TA 1GI9B 3P8GA 1QURH 3ZVDA 2FP7B 4UD9H 2ZPQA 5JDUB 1J17T 4NFFA 4UONA 3MNCA 4IN1A 2BLWA 5B6OA 3H5CB 5E2PA 3ZZAA 6ESTA 1IQIA 3ZV9A 2A31A 2G8TA 1RIWC 1W13U 1W7GH 2I6QA 1C5TA 2FS9A 2ASUB 2XWAA 4XE4A 3LJJA 1UCYK 3RXAA 1O37A 3ZZDA 4CRAA 4GUXA 3JZ2B 1SGIB 1HRTH 1C5NH 3TK5A 4CBNA 3H7OA 4NWLA 1HAIH 1O36A 1GVKB 1HCGA 4X8TH 3DUXH 2BY7X 4ZXXH 3RC6A 1J9CH 4IN2A 3HGPA 4ABJA 4X8VH 1EUFA 2F3CE 3M5NA 1GBAA 3M3TA 3BTFE 3SO3A 4A92A 5DP8A 1W10U 3PLBA 1CGIE 3PWBA 2V0BA 5AF9H 4ABIA 3LKWA 1S0QA 3QLPH 3BG8A 1AN1E 1QRZA 5PTPA 2J9NA 2VIQA 2G4TA 5LPRA 2G52A 3IG6B 5EXNA 2AMQA 3UPEA 3URCA 1EASA 1G30B 2PW8H 3OYPA 2ZDLA 1D9IA 3AVZA 1JIRA 3K6ZA 4I7YH 1GHWH 1GBJA 2GZ8A 5FPTA 1TMBH 3CS0A 3LGUA 2SGAA 1BTYA 1LVYA 5C3NA 2ZU2A 1AIXH 1GBLA 5C1XA 2WPJS 1K1OA 1Y5BT 1P06A 1XMNB 3PTBA 1H9HE 1V6DA 2UWPA 5SGAE 1V2MT 3OTJE 1GBFA 1B5GH 1BTWA 1MU6B 5EODA 5E0JA 1TQ0B 1KXDA 2VGCC 4WWYA 2KAIB 1K1NA 1DDJA 1EX3A 3TGJE 1QIXB 3RXUA 1UHBA 3ESTA 5C1UA 1IQLA 2DE9A 1N8OC 2BX4A 1ZHPA 1TA6A 4YTAA 1YCPM 1BIOA 1GJ5H 5ESBA 3VXFH 1TWXB 2GT8A 1OWKA 3E8LA 4WY3A 2AFQB 1C5SA 1O2QA 2O8WA 1MCTA 3Q3YA 3SU0A 2ZDMA 2GTBA 1HXEH 1BB0B 1QQUA 2XTTB 3GDUA 1K21H 4MTBA 1YGCH 1WYKA 5EU8A 1C5UA 1O2TA 2GMTB 2IPHA 2P3FH 2SFAA 1A3EH 3GCTG 1AZ8A 4X2VA 1ZYOA 1NU9A 1AVGH 3TITA 3ZZBA 1KY9A 7GCHF 1GMHG 2QF0A 1HAHH 3A8DA 2AS9A 4FUJA 1P2MA 3NUMA 3A89A 1UTMA 4DURA 3QZRA 2B0FA 2PSXA 1VGCB 1MBMA 2BQ7B 2EI8A 1YPHE 3P8OA 4JYUH 2ZTZA 4ZXYH 1PPBH 1TMTH 4YT6H 3RUOA 2ZC9H 1DITH 2B7DH 1SGYE 3RXKA 2F9PA 4NCYA 4ABFA 3O8CA 3M61U 2Y5HA 4E05H 2OQUA 1GI0A 1PPEE 2XWBI 4CH8B 2UUFB 3GY6A 1ELVA 2I6SA 4DY7B 1HAVA 5A0AE 1TPAE 1AFQC 1LVBA 1S5SA 2BB4A 1BTZA 1N8OB 1ELEE 5EW1H 2O9QA 2GZ9A 3LGWA 3A80A 4F4OC 1KIGH 4AOQA 1EATA 1BDAA 1EJNA 1T31A 5LH8A 1BJUA 2ZTYA 4X1NU 3KCGH 1DWBH 2PLXA 1F0SA 3ZZ8A 1RTFB 4JCNA 2GCTB 1ORFA 1OWDA 1ELFA 4MPVA 2ZDNA 1GJAB 4J2YB 1LTOA 2PUXB 3M7QA 1HAYB 2D2DA 1OKXA 3SV2H 4X2YA 3MU1A 3A8CA 1FQ3A 7LPRA 1O39A 1YPHC 1ZGVA 2Z3DA 3TH2H 1ELAA 3PTNA 2YNBA 3TJUA 3B23B 2QXIA 1WTGH 3P70B 4M7GA 1AUTC 1BOQA 1XVOA 3RXCA 2XBXA 5GXPA 1HPGA 2A2QH 3BEIB 3TK9A 2A1DB 1UVOA 1SSXA 1EPTB 1HAZB 3Q76A 2J94A 2Z94A 2FYQA 4DIHH 2IN2A 1GGDC 5AVDA 3UR6A 2GCTC 1HJ8A 2KAIA 1P57B 4NWKA 1ZR0A 1BQYA 1SQOA 2O8TA 2ZO3H 4TWWA 3BN9A 2J92A 5EQRA 1BRBE 1T4UH 1TRYA 4NIWA 3PLKA 1LHCH 1C1RA 1GDUA 1O3EA 3GOVB 3VB5A 4HFPB 1HJAC 1EQ9A 3SUGA 4AZ2B 1O0DH 1YCPK 2NU4E 1GI5A 1EB2A 1O5EH 4ZKSU 4K60A 1ETTH 3QN7A 1U6QA 1UTNA 1G3CA 1FY5A 3UFAA 3HK3B 3SGBE 4KP0A 3M7UA 1DXWA 1SG8B 4X1RU 4NIYA 2AEIH 2Q6GA 2D26C 1BJVA 1O2JA 2BD3A 3GCNA 1C1WH 5DP7A 3LIWA 1LVMA 3PMJA 1LPGB 3MNSA 2BMGB 1ZPZA 2BX3A 1AMHA 1ELCA 1VGCC 2AMDA 3P17H 1P3CA 2W5EA 1GI6A 1RGQA 1ZLRA 4X8UH 3TH4H 2BY6X 2C8WB 1XVMA 1MTVA 1WCZA 2ALVA 2CXVA 2G5NA 3GCOA 1BZXE 2SGEE 1QNJA 1JRTA 2QY0B 2ZDVH 1T4VH 4IGDA 1QB9A 4LXBH 3TGKE 2JETC 3F1SB 3T27A 1SI5H 3LU9B 3MH5A 4X6MA 3MNXA 4FUCA 4PROA 1T32A 4KTCA 3U98H 3M3SA 3RP2A 1C1PA 4YESB 3RU4D 2G55A 1LO6A 1C1UH 1ZSKA 4MDSA 1FV9A 3SU3A 4IBLH 1GBDA 3SNEA 4O3TA 5HM9A 4OS6A 3K6YA 5AFYH 3A83A 2C4FH 1NRRH 2VINA 3OY5U 4X1QU 5EPNA 1PFXC 3QDZB 2P94A 1A2CH 4AN7A 3KEEA 1WQVH 1LHGH 4B2AA 3RMLH 1A61H 1AWHB 1NT1A 1LCYA 3VPKA 2QXHA 2PKAA 1O3FA 3PMBB 3SQHE 1YPKH 3KIDU 3MTYA 3A87A 1F0TA 4ABGA 4B74A 3ZZ4A 1GHVH 2EA3A 1MTSA 1WQSA 1LHFH 3ATWA 4D9RA 3GDVA 1IAUA 1QTFA 3RMOH 3O8RA 1BMAA 1VJAU 2PGBB 1W8BH 3HKIB 3FFGA 4A6LA 1TRMA 1FIWA 3FP7E 1VCWA 1GMHF 1L4ZA 4K8BA 5ESTE 3ELAH 4LK4A 5T6FA 3F9EA 2Z9GA 4Y7AA 1O2RA 3A7VA 4X6PA 3PM3A 4DVAU 2SGFE 4GVUA 2ANMH 4LZ4B 1C2EA 2GX4A 1HJ9A 5F8TA 5DPAA 1TYNA 4NIVA 1W12U 2A0QB 3QTVH 1J14A 4K5ZA 2AIQA 1SGQE 1C4U2 1D3TB 3U9AH 4I31A 5CHAC 2ANKH 3I29A 3BIUH 1FY1A 2HNTC 2WPKS 2ZG0H 5C67A 4H6TA 2FOAA 3SOSA 1TGCA 4MG3A 3RLYH 3V12A 2QN5T 3E0NB 4Y0ZE 3MU5A 2UUYA 1CU1A 4ISOA 1C2FA 2WINI 1EAWA 3F9HA 1SGCA 4O3UA 3AAVA 1C1NA 3M36A 5FBEA 1GGDB 3G01A 2FI3E 1A1RA 2F9VA 2Q6DA 3SV7A 1H4WA 3OX7U 1AKSB 1EZUC 4HTCH 1SGFA 4NZLA 1FAXA 1O5GH 3RXVA 1KXAA 4BAHB 1ZRBA 1BA8B 3UR9A 3STIA 4GCHF 1V2TT 1GHBF 1TGTA 4WJG2 4ABEA 3RXPA 1YPGH 1NTPA 1J16A 2WUCA 3T62A 1P3EA 1PPHE 2BDBA 1MTWA 2HNTF 3PV4A 1T8LA 3RXSA 1GJ9B 1B7XB 2HPPH 3U8RH 1SFIA 4NSYA 1TABE 4BTUB 3RXLA 4WF8A 4D8NA 2PFEA 4Y76A 1EZSC 4K69A 1C1OA 2ZFPH 2HOBA 1SGTA 5GIBA 1TOMH 2WPIS 3BTWE 3KQCA 4UFGH 4X6NA 1FY3A 1RRKA 1S0RA 1O2IA 4ZKOU 1D3DB 3Q00A 3U8TH 1TX8A 1Z6EA 1EP6A 1A5GH 4CRCA 3MU4A 8GCHG 2VIVA 1B0FA 1TNKA 5A0BA 2HGTH 2QXGA 4FU8A 2Z6BD 1JWTA 3M35A 2J95A 1AFQB 1FMGA 1OYTH 1ZTLA 3UUZA 4B73A 4RSPA 1PQ8A 1P2JA 2XBWA 1C2IA 3LOXA 4H6SB 4A5TS 3FANA 1O5BB 3URDA 1SC8U 2ZEBA 4X1PU 2H9EH 5C20A 3PROA 1GVLA 4DOQA 2Y82A 4RN6A 5FAHA 2SGPE 3KF2A 3STJA 1TPOA 1Y3YA 1JMOH 1O34A 1V3XA 1BUIA 1O31A 3VFEA 4B75A 2WUBA 1P9UA 3DFLA 1QCPA 2VWLA 3BEFB 5EXMA 5F03A 1O2HA 3T28A 1VCPA 4AYVB 1F7ZA 3W95A 2STAE 4FUEA 1L1GA 4E7RG 2BLOA 3SW2B 1TB6H 1L1NA 3HK6B 2EI7A 1QRWA 2GCHF 4YZUA 1V2UT 2A4OA 1GHXH 3JZ1B 2QGRA 1P05A 1G2MA 1EAUA 1SLWB 2ZIQH 3S9AA 2FEQH 5T6DA 4INKA 1HAGE 1HAOH 1AY6H 1UCYH 4ISNA 2JH6D 3RDZA 2PKSB 2D1JA 1BRUP 1NFYA 1SQTA 1MU8B 6GCHF 5DKMA 1L2EA 1AZZA 1V2WT 3FVFB 1NN6A 1NU7B 1Y5AT 1OXGA 1O2NA 2Z9LA 4AGJA 2F91A 3BTHE 3VGCC 1V2KT 2FX6A 1DM4B 4DGJA 1O2PA 2ULLA 3UIRA 9ESTA 3VB6A 1X7AC 5F6MA 1E37B 2GMTC 3PO1C 4ZROA 1ETSH 1GL0E 1VITH 3FZZA 3T29A 3A8BA 4BAQB 1QY6A 3ZYEA 2AMPA 5DP9A 4VGCC 1O33A 1QL7A 1EJMA 2ZHWH 1HDTH 2UUJB 4LZ1H 1A0JA 1EPTC 2ZFFH 1HBTH 3ZZ3A 4WXVA 5HMAA 4NFEA 3GYMA 3MYWA 1C5XB 4IMQA 1H8DH 1KXEA 2XXLA 4WH8A 2FS8A 1BT7A 2IOTA 3QTOH 2C8XB 4MNYA 2FTLE 1ZTKA 3RXEA 2VGCB 3TH3H 3QGNB 1GI7B 1P2NA 1AE8H 1SMFE 2FIRH 1EP5A 4Z0KA 2OC7A 4Y71A 2ZPRA 3SU6A 1NESE 2OC8A 1F0UA 1YP9A 1HLTH 4BAKB 5HXFA 3PMAB 2ZKSA 1LKBA 3LC3A 3UWJH 2JETB 4O03A 2ANWA 4JMYA 4AORA 1ANBA 1GHAF 1P2OA 3KN2A 1IQKA 1ZPCA 2OQ5A 1F5LA 4I8LA 3K65B 4MVNA 1C5OH 3UNQA 1O2LA 2Z3CA 3ATLA 5JBCS 2ZU4A 3UNRA 1O3MA 1GBEA 2BDCA 1DY9A 2Q6FA 2W3IA 5L30H 4JZDH 1FAKH 3SHCH 1O2XA 3A7XA 3ITIA 1MAXA 1ZTJA 3EA7A 5EG4A 3T25A 3QO6A 1Z8IB 1DICA 3V7TA 2A4RA 2ZGBH 2TIOA 1CA0C 2CGAA 4LOYH 2CHAB 1DANH 3MHWU 1FUJA 1NS3A 1J15A 4Y6DA 4Q7ZA 2ODQA 1C1VH 1BTHH 1JBUH 2FDAA 3U69H 1QL9A 1TA2A 2AYWA 4U32A 1GJ6A 1FI8A 2SNWA 3A88A 1V2ST 1PQ7A 3M7TA 4SGAE 3MO3A 1Y3UA 4ZH8A 3BTQE 4H42U 1V2LT 5LPFA 2A45B 3A7WA 3BTGE 1Y5UT 1O2MA 3QX5H 2BZ6H 2BZAA 3E16B 4B2BA 1VJ9U 1A4WH 2HPQH 5CHAB 4JK5A 1O3BA 3NZIA 1W3CA 4ISHH 2BOKA 1W0ZU 1IQMA 4B2CA 1A5IA 2XC5A 1O5FH 1UVSH 1CVWH 1RIWB 1BCUH 2WPLS 1A3BH 4NIXA 1UCYE 3F9GA 1CA8B 5EW2H 1BRCE 4AX9H 1ELTA 4NA7A 1L0ZA 2Y7XA 1ESAA 2Y81A 1LKAA 2FESH 3SUEA 1ZMLA 4D76A 1C2LA 2TGTA 3ZZ7A 1QB6A 3D23A 5T6GA 2XNIA 4K1SA 1DWCH 4A1XA 3I77A 4O9VA 4Q2KA 4MPWA 2VU8E 4A7IB 1IOEA 2A32A 4AGKA 4JZFH 1O3DA 2BY5X 3SJ9A 3MU8A 1EAIA 8LPRA 4D7GA 3Q3XA 1LMWB 1PYTD 5FPYA 2TGAA 5HYOA 1V2PT 4DG4A 2FPZA 4Y11E 5EQSA 1MKXK 4XBCA 1IHTH 4NA9H 1ZMJA 1PPZA 1ZHRA 3SI4H 2TRMA 2P3TB 1SHHB 1AFEH 1K1LA 1O2UA 1OPHB 2NU0E 2G51A 1INCA 4WMDA 1YPMH 2PUQH 1S83A 5L2YH 4CRBA 1UJ1A 4TPIZ 4WVPE 1V2RT 2A5AA 2ZWLH 5A8XA 2XW9A 3MO6A 5J4SA 3LGTA 1UHBB 2C8YB 1BMMH 2CF8H 1NRQH 2FWWA 1ACBE 1G3BA 2ODYB 1K1JA 1ANEA 1O2WA 3UQOA 1AI8H 5E8EH 3SJ8A 3UNSA 3K9XB 1DS2E 1TGBA 1G9IE 3LPRA 3PYHA 3EE0B 2ZQ2A 4TY6A 3HPTB 1C5WB 1L1JA 1TPPA 3RXMA 3SU2A 1UTJA 1SPJA 3RXOA 1C9PA 3GYLB 3LT3A 1BBRH 2VIOA 3E0PB 4OS5A 4E7NA 2WYJA 3MH6A 1TNIA 1EZQA 4KELA 3FP8E 1NC6A 1O5AB 3M5LA 3TJOA 3PMHB 1KLTA 1TOCB 1H9LB 1CBWC 8GCHF 2FOGA 2F9NA 2XYAA 3ATKA 4BOHA 2P8OB 1S85A 2PGQB 2OTVA 1C5QA 3SGAE 3ATIA 1K2I1 1EKBB 3TK6A 3A84A 1FJSA 2VVUA 3SV8A 1D4PB 3SUFA 2XCFA 2XCNA 1AKSA 1WSSH 3ZVBA 1A46H 1OP8A 2DUCA 1ELDE 4Y8XA 1RD3B 4THNH 1GDQA 1Q31A 4I8HA 5E2OA 1HJAB 1UK2A 1C4V2 2FOFA 4ZHMU 1C2MA 4X1SU 3GCTF 1LQEA 3RM2H 1QA7A 1O2OA 1XX9A 3ZZ5A 1DSUA 1ETRH 2OC0A 3EGKH 1FDPA 1O3LA 2ZGCA 3DHKH 1LDTT 1O2SA 3UTUH 1G3DA 2ZCHP 3RU4E 1PJPA 1XUGA 1TALA 2A2XH 1E38B 4U01A 4XBDA 3SV9A 2ZU1A 2AH4X 4JYTA 1PPFE 4BNRA 4UFDH 1BBRE 4XSKU 1WOFA 3ZYDA 1UTOA 1WBGB 3F68H 2V6NA 3AW0A 4YOGA 1A7SA 3LH3A 1LVOA 4JZ1A 1A0HB 1TBQH 1BHXB 2Y6TA 2FI5E 4Q7XA 2WV4A 4OS7A 1HB0B 2LNCA 1P0SH 4B76A 5BRRE 1ABJH 3RXTA 1KLJH 4BANB 1AVXA 1O3OA 4ISIH 3SJKA 1BMNH 2ZGXH 2WPMS 1T8NA 1SGDE 3A7ZA 1AD8H 4E06H 3PB1E 1CHOF 3LH1A 3CS7A 4X2WA 2R0LA 1XUHA 1GI1A 4CHAC 2P95A 3UQVA 1S6FA 1NRPH 2F83A 5JPMH 1HUTH 3IITA 5GWZA 1EB1H 3S0NA 4IS5A 3T2NA 3RXQA 2PHBA 1AU8A 3BTME 1C5PA 1EZXC 3W94A 3M5OA 3VB7A 1D3PB 3T5FH 3RXJA 3ZVCA 2JKHA 1GI4A 2BLVA 1HFDA 3UOUA 2R3YA 2RDLA 1LHDH 2Z9JA 3O8DA 1Y8TA 1EPTA 1P09A 2BDGA 2BVXH 2TBSA 4CR5A 2W26A 3BTEE 4BTIB 3H7TA 3CP7A 3TPIZ 3NWUA 2BHGA 2H1UA 4D9QA 5DP6A 1SLXB 3DA9B 1QL8A 1Z8RA 3P92A 1FIZA 3RC4A 4YOJA 3SU1A 3FP6E 3D65E 4F49A 1MQ6A 1LQDB 5EGMA 2FODA 3F9FA 1K9OE 2FLRH 3R3GB 5JB8S 2ZDKA 2PKAB 3ZV8A 1K22H 2BXUH 1F92A 1GJ8B 3N7OA 2GZ7A 1VITG 1MD8A 2QIQA 5GCHG 3V0XA 3NXPA 3GY8A 1GWAA 3Q3KA 5G4BA 2VVVA 3ZZ9A 3UREA 1THRH 1Y3VA 4JZEH 2ANYA 1HIAB 2H5CA 2OC1A 4MQAA 8ESTE 8KME2 1OWIA 3UOPA 1W2KH 1ZJDA 4DCDA 2R2WU 1EXFA 1GMDF 1RJXB 1S6HA 3MU0A 1SGNE 2B8OH 4CRDA 3LGIA 4Y79A 1AO5A 1CT0E 2AGEX 1CHGA 4FUIA 2TGDA 1C5LH 4GLYA 1VR1H 5CE1A 4FUDA 4AFUA 2ZGHA 1O3CA 2FXRA 3C27B 2OP9A 3SJOA 1CGJE 1OWHA 3TU7H 3MNBA 4INHA 4AYYB 6CHAB 2OBQA 1GMDG 1NROH 1ZHMA 1MD7A 2BDAA 3UWIA 2C8ZB 2EI6A 3C1KA 3SNCA 4R8TB 1UVUH 2GV7A 1W14U 1XUJA 1CQQA 2ESTE 1Z6JH 1Z1JA 2BD4A 2W3KA 1E0FD 3Q77A 1FNIA 3NCLA 1GBCA 1OWEA 3V13A 1P2IA 2ZI2H 5E0GA 1TIOA 1CSOE 5GDSH 5ETXA 2Q1JA 2Z3EA 2FOBA 5FBIA 1MKXH 2B9LA 1ABIH 3DT0H 5I25A 4TY7A 4FUHA 4Q7YA 1DXPA 2TGPZ 5JB9S 1GJDB 1AB9C 1FPCH 2QC2A 2FOCA 1FLEE 1GBKA 1YCPH 1YYY1 5DO4H 3SHAH 3MWIU 1G37A 4TYDA 1N1LA 1Z1IA 1BTPA 5JBTA 4Y7BA 1MKWK 4KTUA 2BY9X 5JYIA 3DFJA 1RTKA 2K1QA 7GCHG 2H6MA 1P2QA 3QWCH 1XXDA 2GKVE 2FYRA 5C2ZA 1F5RA 4ZHAA 3S9CA 3MMGA 4ZMAH 5I46H 1BMLA 1ID5H 1KTSB 1S81A 5A0CA 3GCHB 1P9SA 3TIUA 2NU3E 4D7FA 1WAYB 3MI4A 1HNEE 1Z7KA 2BDHA 4IC6A 1XXFA 1KDQB 5GCHF 2FO9A 1DUEA 1YF4A 2J38A 3SGQE 1NRSH 1DWEH 2GDDA 3RXDA 1SHYA 2GCHG 4GSOA 5L2ZH 3LGVA 3SQEE 3T26A 1Q3XA 4B1TA 2HLCA 5CMXH 4K8YA 3P8FA 1TLDA 1OWJA 2O8MA 1XUFA 3GY4A 1PQAA 1NPMA 1O30A 3BTTE 2OUAA 3O8BA 4WXIA 2BD9A 1SL3A 2BD5A 4H4FA 3SI3H 4YLUA 1O2KA 1FXYA 2SGDE 3LDXH 4OS1A 1UVTH 5IDKA 1JOUB 1O3NA 1HIAA 5J4QA 4MLFB 4CHAB 3VXEH 4X6OA 2A5KA 1UK4A 5F8XA 3SV6A 2AIPA 1UO6A 2ZFQH 1O35A 5A8ZA 1C5VA 1GI3A 4Q80A 1Y3XA 1IHSH 1YC0A 1NFWA 2TPIZ 4UFEH 3RM0H 3MH7A 1JRSA 4RKJB 1C1QA 1CO7E 5LPEA 4RKOB 2BOHB 2JH0D 2ZP0H 2VIPA 3HATH 4MNVA 2ZZUH 3SBKA 1UTQA 1AQ7A 1OSSA 2CF9H 2ZPSA 2OLGA 1D3QB 1GCDA 2ZTXA 3A86A 4FUGA 3P8NA 3ZVAA 5EXLA 1SOZA 5TCCA 4ABDA 1QGFA 4XOJA 3TVJB 4YOIA 2H9TH 1CGHA 2G5VA 1TE0A 4Z6AH 4TPYA 1ESTA 2LPRA 2HALA 3GDSA 1ZOMA 2UWOA 2ZFRH 1ZPBA 1C2JA 5L6NH 1QJ7B 9LPRA 2OINA 1C2HA 1SBWA 1MTNC 2FX4A 3TGIE 1YLCA 5LGOA 2ODPA 2OCVB 1RXPA 3KGPA 5C1YA 1CT2E 1O5DH 1W0YH 3S69A 1IQNA 1FY8E 4GHQA 3TJVA 4CRFA 1TX7A 1BRAA 1GBBA 3OY6U 5H4IB 2IJOB 5A8YA 1M9UA 1SGEE 2WV5A 4KTSA 4TWYA 1E34B 4BAMB 1C5ZB 3GY3A 4WH6A 3OU0A 3NK8A 3BSQA 1TGNA 3RXHA 1GPZA 2VIDA 3QUMP 1KYNA 1IQFA 4HZHA 1AUJA 2HNTE 3KHVA 1NM6A 2CN0H 2P59A 1FPHH 2HVXA 3EA9A 2F9OA 1HAXB 2FOMB 2OXSA 3BIVH 4FVDA 3K2UA 3GY5A 1QJ1B 1GCTC 1GG6B 4KGAA 1LPKB 2GV6A 3MH4A 1TNLA 1BTXA 5FPSA 3RXBA 6LPRA 2R2MB 1GHZA 1QQ4A 3BG4B 2VWMA 1MQ5A 1G3EA 5K0HA 3AW1A 1GBTA 1GG6C 5DP5A 4U30A 5C5NA 2VH6A 3GISB 3VB3A 4FUFA 1UTLM 2WPHS 4XBBA 3RXFA 1W7XH 2BQWB 4FXGH 2PSYA 1GMCF 3E90B 1AB9B 2OD3B 1UK3A 4GHTA 2OBOA 1G36A 3R0FA 3WY8A 1A0LA 1C9TA 1FN6A 2R3UA 2D8WA 1FN8A 1CE5A 1QHRB 3B9FH 4I33A 4JYVH 4BXSA 1LPZB 2AGGX 4CRGA 1LHEH 3E6PH 1UMAH 4ZUHA 4Y10E 1KDQA 2CV3A 3GICB 2THFB 1QRXA 4AB9A 4Y8YA 3E91A 2ZA5A 1KTTB 3SU5A 2YNAA 3I78A 3M3VA 5EQQA 3SJIA 1VZQH 4X8SH 1C5RA 4Y0YE 3KQEA 4WMEA 3ZZ6A 3MOCA 1YM0A 4K2YA 1AVWA 2M5TA 3L33A 5IYTA 4GPGA 4NGAH 2PTNA 2Y5FA 3SU4A 3VEQB 1DY8A 1T8OA 1DLKB 4JZIA 2BD8A 5DJ7A 4I8GA 4U2WA 1SQAA 4IMZA 3ODFA 4X2XA 2ZHDA 1ZJKA 2ZFSA 2ZHFH 4O97A 2XBVA 1D6WA 3LC5A 2XC4A 2BM2A 4MNWA 1DVAH 5F8ZA 2ZU5A 4NSVA 1SOTA 1PPCE 3M5MA 4ESTE 2BYAX 2ZCLP 1QB1A 4WMFA 3KL6A 1C2GA 4ZKNU 1WUNH 1DFPA 5AFZH 2QA9E 4X0WU 1TPSA 2ZECA 3S9BA 1GMCG 3V3MA 2WYGA 4AFQA 1VITF 1TGSZ 3KNXA 4QT8C 2BXTH 4AG1A 2Y7ZA 3ZVFA 2RA3A 3A8AA 4I8JA 5K7RA 1YPLH 1Q2WA 2V3HH 5DP4A 3ZVEA 5EOKA 2FM2A 1OYQA 1F0RA 2GD4B 1HXFH 2G4UA 1AGJA 1GJBB 1TONA 2ILNA 1D6RA 4K1EA 1TAWA 1CA0B 1MH0A 5TCAA 1BHXF 3KQBA 5BPEA 4BTTB 2Y80A 1YLDA 3B8JA 3BF6H 3L6PA 1TMUH 5C5OA 1MUEB 3A81A 4HGCA 3E1XB 1NZQH 2NU2E 2VIWA 1TBRH 5DP3A 5FHTA 1GHBG 4UE7H 1DT2A 1ARCA 4ABHA 2UUKB 1BTUA 3ATMA 4DIIH 3SZNA 3P6ZB 2NWNA 3SUDA 1P04A 3ZVGA 1Z71A 3EDXB 1QBOA 1NFUA 1SLVB 2CJIA 2J34A 4OGYA 1N6XA 3RXGA 4UEHH 1O2ZA 1K1IA 4MPXA 4YM9A 1SGPE 1QBVH 2JH5D 2ZCKP 1SGRE 1TBZH 1SLUB 4A1VA 3UY9A 2VB0A 1SR5C 2A5IA 1O3GA 2RA0A 1HAPH 1GBHA 2QYIA 3BTDE 2O8UA 1O3HA 2PTCE 1ZGIA 2V35A 5FXLA 1XKBC 1P8VC 1TQ7B 4FU9A 3TNSA 3BEUA 1BITA 2DE8A 6CHAC 1DX5M 1WTHD 2Y5GA 2F9BH 1DE7H 3CENA 1GDNA 1E36B 2A4QA 2BTCE 1ZMNA 4VGCB 2HRVA 1AWFH 3LONA 3A7YA 1DUAA 4CBOA 1V2JT 1EAXA 1C5MD 2BVRH 4OS2A 4OS4A 3BTKE 4IW4E 1DWDH 3RC5A 2C93B 1KXFA 1G32B 1RFNA 5GJ4B 1TNJA 3HKJB 4BAOB 1ESBA 4FVBA 4ISLA 2VWOA 4K3JA 1E35B 1S84A 3FZDA 1P03A 1O38A 1MKWH 1P12E 2H5DA 4I32A 3PWCA 5DG6A 1N6YA 1ZRKA 5E0HA 1IQEA 1IQHA 4XFQA 4ABBA 4NA8A 2W7UA 1V2NT 4AB8A 5FCRA 1MAYA 4NG9H 1GCTB 1GL1A 5AHGH 1HGTH 2FZZA 2QXJA 3HGNA 2A7JA 2QF3A 3RXIA 3S7HB 1NRNH 2R0KA 3TLOA 4A1TA 5A2MH 4ABAA 3A7TA 4GCHG 5ABWA 1THPB 1A5HA 1JIMA 1HYLA 1MBQA 1S82A 6GCHG 1P01A 1O3AA 3FAOA 4K1TA 2J2UA 2XC0A 2NU1E 1XM1A 1RS0A 3MFJA 1OX1A 3RMNH 1THSH 4CH2B 1P10A 4UDWH 3AAUA 1Y59T 2VWNA 1TNHA 1CT4E 2AERH 2YOLA 1GVZA 2FTMA 4J1YA 1PQ5A 2PWXA 1DOJA
chains in the Genus database with same CATH superfamily
2O8LA 1PYTC 3ZZCA 4ASHA 3E3TA 4GAWA 3DSGA 1GJ4H 3ENSB 1OP0A 1T7CA 2ZF0H 1HAVB 1WU1A 2AGIX 1QJ6B 4IC5A 2P3UB 1V2QT 3RLWH 1QR3E 1RTLA 1TRNA 4MPUA 1O32A 1YBWA 2Z9KA 3QZQA 1GJCB 3BV9B 3U8OH 2C3SA 2WHXA 3RXRA 1UTPA 1GJ7B 3PLPA 1O2VA 2BY8X 2KCPA 1ELGA 5TJXA 2GDEH 2P93A 2BDYA 2RCEA 4HI3A 4ZAEA 3GY2A 1MZAA 2Z9IA 4ZHLU 4B71A 2H9HA 3AASA 1FX0B 3SORA 2XBYA 1OOKB 1F5KU 2GT7A 3FKSD 3A85A 1JXPA 2ZU3A 2FOEA 5HIYA 3QK1A 2RG3A 2UWLA 2PV9B 1C2KA 1SFQB 3LJOA 2FLBH 2A7CA 1K1MA 2ZQ1A 2CMYA 2FI4E 1MZDA 4YO9A 2G81E 5HGGA 3RU4T 1O2GH 2OK5A 1IQJA 4FU7A 1SVPA 1W11U 3RMMH 4DW2U 2KCAA 2SNVA 4AG2A 1KSNA 4R0IA 3M37A 4UFFH 5EPYA 3TNTA 2GP9B 4RI0A 3NPSA 1BBRK 1XKAC 2P16A 3OSYA 5JBBS 1NFXA 3EQ0H 1K28D 1WV7H 3KQ5A 1GI2A 1ZSLA 3F6UH 1Z8GA 1GI8B 1L4DA 3D49H 2G00A 2QCYA 2V3OH 3TJNA 4CREA 1ZSJA 2H2ZA 4ZKRU 4CR9A 4YT7H 4Y8ZA 1SGFG 1P11E 1P02A 1J8AA 2P8OC 5GNDA 2W7SA 1XUIA 4DT7B 1H9IE 1SKYE 3SNAA 2BD2A 4DJZB 1YKTA 3U1IB 1H8IH 1QBNA 1CBWB 2L6OA 1C4Y2 2GVFA 1TFXA 3GCHC 4XRNA 1Z8JB 1V2OT 3MO9A 3KQDA 3L3TA 1P2KA 5FCKA 4OGXA 4AFZA 4P00A 2F9UA 1MMJN 1NY22 3VGCB 2JJ1D 5FX6A 2Z7FE 3BG4C 1DSTA 3DD2H 5FX5A 1H1BA 2CHAC 1AE5A 2J4IA 3ODDA 1GHAG 1O3JA 2VVCA 2ZGJA 1ARBA 1ANCA 2EC9H 1SB1H 4KKDA 3D62A 2PKSC 1OP2A 4Q63A 1F2SE 1ANDA 3EA8A 7KMEH 4YLQH 1MCVA 1QFKH 3A82A 4SGBE 1TX6A 3LGYA 1AHTH 3SN8A 1B0EA 1FONA 1YPJH 4NZQA 1O3IA 1OHHD 2R9PA 2BVSH 3VB4A 2A4GA 5DK1A 1NO9H 1QA0A 4XDEA 2A7HA 3SNDA 2VH0A 3U1JB 1EOJA 4I8KA 1T8MA 1K1PA 1PPGE 3GY7A 3NKKA 2GGVB 2BLQA 1FY4A 4Q4LA 2ZNKH 1MTNB 1KXBA 2HWLB 1XUKA 2BD7A 5HM2A 1C2DA 2PR3A 5A09A 1UVPA 2C90B 2ZFTA 2STBE 1GBMA 1V2VT 1GBIA 4BXWA 1EJAA 1KXCA 1O5CB 1Y3WA 5DN6D 1C1MA 1O3KA 2VJ1A 1ZZZA 1VCQA 4AFSA 1EOLA 1FZZA 2BQ6B 1C1SA 1C5YB 1DPOA 3QGJA 1GHYH 1IQGA 1MTUA 1OS8A 2EEKA 4INLA 2ZDAH 3S7KB 4JK6A 4FUBA 2ZHEH 1G2LA 1TNGA 1HV7A 3SNBA 2QV1A 5GPIB 5T3HA 5JBAS 3PO1B 3IWMA 2SGQE 2FMJA 2XRCA 1ELBA 2ZHQH 1UTKA 3N99A 2QAAA 2VNTA 2BDIA 4RT1A 4MNXA 3EAJA 1DLEA 2B5TB 3EYDA 2ALPA 1YPEH 1O2YA 1CHOG 5DGJA 2HVYB 2FOHA 7ESTE 1KLIH 3P95A 1O3PB 1C1TA 1GI9B 2YMSC 3P8GA 1QURH 3ZVDA 2FP7B 4UD9H 2ZPQA 5JDUB 3N7EA 1J17T 4NFFA 4UONA 3MNCA 4IN1A 2BLWA 5B6OA 3H5CB 5E2PA 3ZZAA 6ESTA 1IQIA 3ZV9A 2A31A 2G8TA 1RIWC 1W13U 1W7GH 2I6QA 1C5TA 2FS9A 1COWD 2ASUB 2XWAA 4XE4A 3LJJA 1UCYK 3RXAA 1O37A 3ZZDA 3F2FA 4CRAA 4GUXA 3JZ2B 1SGIB 3SZEA 1HRTH 1C5NH 3TK5A 4CBNA 3H7OA 4NWLA 1HAIH 1K0HA 1O36A 1GVKB 1HCGA 5CHBA 4X8TH 3DUXH 2BY7X 4ZXXH 3RC6A 1J9CH 4IN2A 3HGPA 4ABJA 4X8VH 1EUFA 2F3CE 3M5NA 1GBAA 3M3TA 3BTFE 3SO3A 4A92A 5DP8A 1W10U 3PLBA 1CGIE 3PWBA 2V0BA 5AF9H 4ABIA 3LKWA 1S0QA 3QLPH 3BG8A 1AN1E 1QRZA 5PTPA 2J9NA 2VIQA 2G4TA 5LPRA 2G52A 3IG6B 5EXNA 2AMQA 3UPEA 3URCA 2VBCA 1EASA 1G30B 2PW8H 3OYPA 2ZDLA 1D9IA 3AVZA 1JIRA 3K6ZA 5C94A 4I7YH 1GHWH 1GBJA 2GZ8A 5FPTA 1TMBH 3CS0A 3LGUA 2SGAA 1BTYA 1LVYA 5C3NA 2ZU2A 1AIXH 2EQNA 1GBLA 5C1XA 2WPJS 1K1OA 1Y5BT 1P06A 1XMNB 3PTBA 1H9HE 1V6DA 2UWPA 5SGAE 1V2MT 3OTJE 1GBFA 1B5GH 1BTWA 1MU6B 5EODA 5E0JA 1TQ0B 1KXDA 2VGCC 4WWYA 2KAIB 1K1NA 1DDJA 1EX3A 3TGJE 1QIXB 3RXUA 1UHBA 3ESTA 5C1UA 1IQLA 2DE9A 1N8OC 2BX4A 1ZHPA 4F48B 1TA6A 4YTAA 1W0JD 1YCPM 1BIOA 1GJ5H 4P02A 5ESBA 3VXFH 1TWXB 2GT8A 1OWKA 3E8LA 4WY3A 2AFQB 1C5SA 1O2QA 2O8WA 1MCTA 3Q3YA 4FOUC 3SU0A 2ZDMA 2GTBA 1HXEH 1BB0B 1QQUA 2XTTB 3GDUA 1K21H 4MTBA 1YGCH 1WYKA 5EU8A 1C5UA 1O2TA 2GMTB 2IPHA 2P3FH 2SFAA 2F4LA 1A3EH 3GCTG 1AZ8A 4X2VA 1ZYOA 1NU9A 1AVGH 3TITA 3ZZBA 1KY9A 7GCHF 1GMHG 2QF0A 1HAHH 3A8DA 2AS9A 4FUJA 1P2MA 3NUMA 2HLDD 3A89A 1UTMA 4DURA 3QZRA 2B0FA 2PSXA 1VGCB 1MBMA 2BQ7B 2EI8A 1YPHE 3P8OA 4JYUH 4HG6A 2ZTZA 4ZXYH 1PPBH 1TMTH 3F0OA 4YT6H 3RUOA 2ZC9H 1DITH 2B7DH 1SGYE 3RXKA 2F9PA 4NCYA 4ABFA 3O8CA 3M61U 2Y5HA 4E05H 2OQUA 3WWBA 1GI0A 1PPEE 2XWBI 4CH8B 2UUFB 3GY6A 1ELVA 2I6SA 2M2AA 4DY7B 1HAVA 5A0AE 1TPAE 1AFQC 1LVBA 1S5SA 2BB4A 1BTZA 1N8OB 1ELEE 5EW1H 2O9QA 2GZ9A 3LGWA 3A80A 4F4OC 4ASUD 1KIGH 4AOQA 1EATA 1BDAA 1EJNA 1T31A 5LH8A 1BJUA 2ZTYA 1EFRD 4X1NU 3KCGH 1DWBH 1UW7A 2PLXA 1F0SA 3ZZ8A 1RTFB 4JCNA 2GCTB 1ORFA 1OWDA 1ELFA 4MPVA 3UB0A 2ZDNA 1GJAB 4J2YB 1LTOA 2PUXB 3M7QA 1HAYB 2D2DA 1OKXA 3SV2H 4X2YA 3MU1A 3A8CA 1FQ3A 7LPRA 1O39A 1YPHC 1ZGVA 2Z3DA 3TH2H 1ELAA 3PTNA 2YNBA 3TJUA 5CDFE 3B23B 2QXIA 1WTGH 3P70B 4M7GA 2J98A 1AUTC 1BOQA 1XVOA 3RXCA 2XBXA 5GXPA 1HPGA 2A2QH 3BEIB 3TK9A 2A1DB 1UVOA 1SSXA 1EPTB 1HAZB 3Q76A 2J94A 2Z94A 2FYQA 4DIHH 2IN2A 1GGDC 5AVDA 3UR6A 2GCTC 1HJ8A 2KAIA 1P57B 4NWKA 1ZR0A 1BQYA 1SQOA 2O8TA 2ZO3H 4TWWA 3BN9A 2J92A 5EQRA 1BRBE 1T4UH 1TRYA 4NIWA 3PLKA 1LHCH 1C1RA 1GDUA 1O3EA 3GOVB 3VB5A 4HFPB 5EJ1A 1HJAC 1EQ9A 3SUGA 1BMFD 4AZ2B 1O0DH 1YCPK 2NU4E 1GI5A 2K8IA 1EB2A 1O5EH 4ZKSU 4K60A 1ETTH 3QN7A 1U6QA 1UTNA 1G3CA 1FY5A 3UFAA 3HK3B 3SGBE 4KP0A 3M7UA 1NBME 1DXWA 1SG8B 1NBMD 3H09A 4X1RU 4NIYA 2AEIH 2Q6GA 2D26C 1BJVA 2J98B 1O2JA 5T1VA 2BD3A 3GCNA 1C1WH 5DP7A 3LIWA 1LVMA 3PMJA 1LPGB 3MNSA 2BMGB 1ZPZA 2BX3A 1AMHA 1ELCA 3OTPA 1VGCC 2AMDA 3P17H 1P3CA 2W5EA 1GI6A 1RGQA 1ZLRA 4X8UH 3TH4H 2BY6X 2C8WB 1XVMA 1MTVA 1WCZA 2ALVA 2CXVA 2G5NA 3GCOA 1BZXE 2SGEE 1QNJA 1JRTA 2QY0B 2WSSD 2ZDVH 1T4VH 4IGDA 1QB9A 4LXBH 3TGKE 2JETC 3F1SB 3T27A 1SI5H 3LU9B 3MH5A 4X6MA 3MNXA 4FUCA 4PROA 3AK5A 1T32A 4KTCA 3U98H 3M3SA 3RP2A 1C1PA 4YESB 3RU4D 2G55A 1LO6A 1C1UH 1ZSKA 4MDSA 1FV9A 3SU3A 4IBLH 1GBDA 3SNEA 4O3TA 5HM9A 4OS6A 3K6YA 5AFYH 3A83A 2C4FH 1NRRH 2VINA 3OY5U 4X1QU 1YY3A 2L74A 5EPNA 1PFXC 3QDZB 2P94A 1A2CH 4AN7A 3KEEA 1WQVH 4YXWD 1LHGH 4B2AA 3RMLH 1A61H 1AWHB 1NT1A 1LCYA 3VPKA 2QXHA 2PKAA 1O3FA 3PMBB 3SQHE 1YPKH 3KIDU 3MTYA 3A87A 1F0TA 4ABGA 4B74A 3ZZ4A 1GHVH 3GS9A 2EA3A 1MTSA 1WQSA 1LHFH 3ATWA 4D9RA 2J5UA 1IAUA 3GDVA 1QTFA 3RMOH 3O8RA 1BMAA 1VJAU 2PGBB 1W8BH 3HKIB 3FFGA 4A6LA 1TRMA 1FIWA 3FP7E 1VCWA 1GMHF 1L4ZA 4K8BA 5ESTE 3ELAH 4LK4A 5T6FA 3F9EA 2Z9GA 2JIZD 1O2RA 3A7VA 4X6PA 4Y7AA 3PM3A 4DVAU 4ACBA 2SGFE 4GVUA 2ANMH 4LZ4B 1C2EA 2GX4A 1HJ9A 5F8TA 5DPAA 2QE7D 1TYNA 4NIVA 1W12U 2A0QB 3QTVH 1J14A 4K5ZA 2AIQA 1SGQE 1C4U2 1D3TB 3U9AH 4I31A 5CHAC 2ANKH 3I29A 3BIUH 1FY1A 2HNTC 2WPKS 2ZG0H 5C67A 4H6TA 2FOAA 3SOSA 1WXRA 1TGCA 4MG3A 3RLYH 3V12A 4DT4A 2QN5T 3E0NB 4Y0ZE 3MU5A 2UUYA 1CU1A 4ISOA 1C2FA 2WINI 1EAWA 3F9HA 1SGCA 4O3UA 3AAVA 1C1NA 3M36A 5FBEA 1GGDB 3G01A 2FI3E 1A1RA 2F9VA 2Q6DA 3SV7A 1H4WA 3OX7U 1AKSB 1EZUC 4HTCH 1SGFA 4NZLA 1FAXA 1O5GH 3RXVA 1KXAA 4BAHB 1ZRBA 1BA8B 3UR9A 3STIA 4GCHF 1V2TT 1GHBF 1TGTA 4WJG2 4ABEA 3RXPA 1YPGH 1NTPA 1J16A 2WUCA 3T62A 1P3EA 1PPHE 2BDBA 1MTWA 2HNTF 3PV4A 1T8LA 4TT3D 3RXSA 1GJ9B 1MABB 1B7XB 2HPPH 3DSPA 3U8RH 1SFIA 4NSYA 1TABE 4BTUB 3RXLA 4WF8A 4D8NA 5KEDA 2PFEA 4Y76A 1EZSC 2LP6A 4K69A 1C1OA 2ZFPH 2HOBA 3ZIAD 1SGTA 5GIBA 1TOMH 2WPIS 3BTWE 3KQCA 4UFGH 4X6NA 2V3MA 1FY3A 1RRKA 1S0RA 1O2IA 4ZKOU 1D3DB 3Q00A 3U8TH 1TX8A 1Z6EA 1EP6A 1A5GH 4CRCA 3MU4A 8GCHG 2VIVA 1B0FA 1TNKA 5A0BA 2HGTH 2QXGA 4FU8A 2Z6BD 1JWTA 3M35A 2J95A 1AFQB 1FMGA 1OYTH 1ZTLA 3UUZA 4B73A 4RSPA 1PQ8A 1P2JA 2XBWA 1C2IA 3LOXA 4H6SB 4A5TS 3FANA 1O5BB 3URDA 1SC8U 2ZEBA 3WWFA 4X1PU 2H9EH 5C20A 3PROA 1GVLA 4DOQA 2Y82A 4RN6A 5FAHA 2SGPE 3KF2A 3STJA 1TPOA 1Y3YA 1JMOH 1O34A 1V3XA 1BUIA 2IJD1 1O31A 3VFEA 4B75A 4AC9A 2WUBA 1P9UA 3DFLA 1QCPA 2VWLA 3BEFB 5EXMA 5F03A 1O2HA 3T28A 1VCPA 4AYVB 1F7ZA 3W95A 2STAE 4FUEA 1L1GA 4E7RG 2BLOA 3SW2B 1TB6H 1L1NA 3HK6B 2EI7A 1QRWA 2GCHF 4YZUA 1V2UT 2A4OA 1GHXH 3JZ1B 2QGRA 1P05A 1G2MA 1EAUA 1SLWB 2ZIQH 3S9AA 2FEQH 5T6DA 4INKA 1HAGE 1HAOH 1AY6H 1UCYH 4ISNA 2JH6D 3RDZA 2PKSB 2D1JA 1BRUP 1NFYA 1SQTA 1MU8B 6GCHF 2KX4A 5DKMA 1L2EA 1AZZA 1V2WT 3FVFB 1NN6A 1NU7B 1Y5AT 1OXGA 1O2NA 2Z9LA 4AGJA 2F91A 3BTHE 3VGCC 1V2KT 3KYGA 2FX6A 1DM4B 4DGJA 1O2PA 2ULLA 3UIRA 9ESTA 3VB6A 1X7AC 5F6MA 1E37B 3F3BA 2YMSD 2LELA 3EE7A 2GMTC 3PO1C 4ZROA 1ETSH 1GL0E 1VITH 3FZZA 3T29A 3A8BA 4BAQB 1QY6A 3ZYEA 2AMPA 5DP9A 4VGCC 1O33A 1QL7A 1EJMA 2ZHWH 1HDTH 2UUJB 4LZ1H 1A0JA 1EPTC 2ZFFH 1HBTH 3ZZ3A 4WXVA 5HMAA 4NFEA 3GYMA 3MYWA 1C5XB 4IMQA 1H8DH 1KXEA 2XXLA 4WH8A 2FS8A 1BT7A 2IOTA 3QTOH 2C8XB 4MNYA 1H8ED 2FTLE 3OFND 1ZTKA 3RXEA 2VGCB 3TH3H 3QGNB 1GI7B 1P2NA 1AE8H 1SMFE 2FIRH 1EP5A 4Z0KA 2OC7A 4Y71A 2ZPRA 3SU6A 1NESE 2OC8A 1F0UA 1YP9A 3FN8A 1HLTH 4BAKB 5HXFA 3PMAB 2ZKSA 1LKBA 3LC3A 3UWJH 2JETB 4O03A 2ANWA 4JMYA 4AORA 1ANBA 1GHAF 1P2OA 4M9FA 3KN2A 1IQKA 1ZPCA 2OQ5A 1F5LA 4I8LA 3K65B 4MVNA 1C5OH 3UNQA 1O2LA 2Z3CA 3ATLA 5JBCS 2ZU4A 3UNRA 1O3MA 1GBEA 2BDCA 2WPDD 1DY9A 2Q6FA 2W3IA 5L30H 4JZDH 1FAKH 3SHCH 1O2XA 3A7XA 3ITIA 1MAXA 1ZTJA 3EA7A 5EG4A 3T25A 3QO6A 1Z8IB 1DICA 4TSFD 3V7TA 2A4RA 2ZGBH 2TIOA 1CA0C 2CGAA 4LOYH 2CHAB 1DANH 3MHWU 1FUJA 1NS3A 1J15A 4Y6DA 4Q7ZA 2ODQA 1C1VH 5B6LA 1BTHH 1JBUH 2FDAA 3U69H 1QL9A 1TA2A 2AYWA 4U32A 1GJ6A 1FI8A 2SNWA 3A88A 1V2ST 1PQ7A 3M7TA 4SGAE 3MO3A 1Y3UA 4ZH8A 3BTQE 4H42U 1V2LT 5LPFA 2A45B 3A7WA 3BTGE 1Y5UT 2KM0A 1O2MA 2RDEA 3QX5H 2BZ6H 2BZAA 3E16B 4B2BA 1VJ9U 1A4WH 2HPQH 5CHAB 4JK5A 1O3BA 3NZIA 1W3CA 4ISHH 2BOKA 1W0ZU 1IQMA 4B2CA 1A5IA 2XC5A 2QF4A 1O5FH 1UVSH 1CVWH 1RIWB 1BCUH 2WPLS 5KGOA 1A3BH 4NIXA 1UCYE 3F9GA 1CA8B 5EW2H 1BRCE 4AX9H 1ELTA 4NA7A 1L0ZA 2Y7XA 1ESAA 2Y81A 1LKAA 2FESH 3SUEA 1ZMLA 4D76A 1C2LA 2TGTA 3ZZ7A 1QB6A 3D23A 5T6GA 2XNIA 4K1SA 1DWCH 4A1XA 3I77A 4O9VA 4Q2KA 4MPWA 2VU8E 5F53A 4A7IB 1IOEA 2A32A 4AGKA 4JZFH 1O3DA 2BY5X 3SJ9A 3MU8A 1EAIA 8LPRA 1S6LA 4D7GA 3Q3XA 1LMWB 1PYTD 5FPYA 2TGAA 5HYOA 1V2PT 4DG4A 2FPZA 4Y11E 5EQSA 1MKXK 4XBCA 1IHTH 4NA9H 1ZMJA 1PPZA 1ZHRA 3SI4H 2TRMA 2P3TB 1SHHB 1AFEH 2JDID 1K1LA 1O2UA 1OPHB 2NU0E 2G51A 1INCA 3DCLA 3UAIC 4WMDA 1YPMH 2PUQH 1S83A 5L2YH 4CRBA 1UJ1A 4TPIZ 4WVPE 1V2RT 2A5AA 2ZWLH 5A8XA 2XW9A 3MO6A 5J4SA 3LGTA 1UHBB 2C8YB 1BMMH 2CF8H 1NRQH 2FWWA 1ACBE 1G3BA 2ODYB 1K1JA 1ANEA 1O2WA 3UQOA 1AI8H 5E8EH 3SJ8A 3UNSA 3K9XB 1DS2E 1TGBA 1G9IE 3LPRA 3PYHA 3EE0B 2ZQ2A 4TY6A 3HPTB 1C5WB 1L1JA 1TPPA 3RXMA 3SU2A 1UTJA 1SPJA 3RXOA 1C9PA 3GYLB 3LT3A 1BBRH 2VIOA 3E0PB 4OS5A 4E7NA 2WYJA 3MH6A 1TNIA 1EZQA 4KELA 3FP8E 1NC6A 1O5AB 3M5LA 3TJOA 3PMHB 1KLTA 1TOCB 1H9LB 1CBWC 8GCHF 2FOGA 2F9NA 2XYAA 3ATKA 4BOHA 2P8OB 1S85A 3SYJA 2PGQB 2OTVA 1C5QA 3SGAE 3ATIA 1K2I1 1EKBB 3TK6A 3A84A 1FJSA 2VVUA 3SV8A 1D4PB 3SUFA 2XCFA 3OAAD 2XCNA 1AKSA 1WSSH 3ZVBA 1A46H 1OP8A 2DUCA 1ELDE 4Y8XA 1RD3B 4THNH 1GDQA 1Q31A 2W6ID 4I8HA 5E2OA 1HJAB 1UK2A 1C4V2 2FOFA 4ZHMU 2XOKD 3KYFA 1C2MA 4X1SU 3GCTF 1LQEA 3RM2H 1QA7A 1O2OA 1XX9A 3ZZ5A 1DSUA 1ETRH 2OC0A 3EGKH 1FDPA 1O3LA 2ZGCA 3DHKH 1LDTT 1O2SA 2YMSB 3UTUH 1G3DA 2ZCHP 3RU4E 1PJPA 1XUGA 1TALA 2A2XH 2RFKC 1E38B 4U01A 4XBDA 3SV9A 2ZU1A 2AH4X 4JYTA 1PPFE 4BNRA 4UFDH 2IPQX 1BBRE 2PP6A 1WOFA 4XSKU 3ZYDA 1UTOA 1WBGB 3F68H 3PRBA 2V6NA 3AW0A 4YOGA 1A7SA 3LH3A 1LVOA 4JZ1A 1A0HB 1TBQH 2GJGA 1BHXB 2Y6TA 2FI5E 4Q7XA 2WV4A 4OM9A 4OS7A 1HB0B 2LNCA 1P0SH 4B76A 3MQKC 5BRRE 1ABJH 3RXTA 1KLJH 4BANB 1AVXA 1O3OA 4ISIH 3SJKA 1BMNH 2ZGXH 2WPMS 1T8NA 1SGDE 3A7ZA 1AD8H 4E06H 3PB1E 1CHOF 3LH1A 3CS7A 3N7DA 4X2WA 2R0LA 1XUHA 1GI1A 4CHAC 2P95A 3UQVA 1S6FA 1NRPH 2F83A 5JPMH 1HUTH 3IITA 5GWZA 1EB1H 3S0NA 4IS5A 3T2NA 3RXQA 2PHBA 1AU8A 3BTME 1C5PA 1EZXC 3W94A 3M5OA 3VB7A 1D3PB 3T5FH 3RXJA 3ZVCA 2JKHA 1GI4A 4B6EA 2BLVA 1HFDA 3UOUA 2R3YA 2RDLA 1LHDH 2Z9JA 3O8DA 1Y8TA 1EPTA 1P09A 2BDGA 2BVXH 2TBSA 4CR5A 2W26A 3BTEE 4BTIB 3H7TA 3CP7A 3OEED 3TPIZ 3NWUA 1KMHB 2BHGA 2H1UA 4D9QA 5DP6A 1SLXB 3DA9B 1QL8A 1Z8RA 3P92A 1FIZA 5C0UA 3RC4A 4YOJA 3SU1A 3FP6E 3D65E 4F49A 1MQ6A 1LQDB 5EGMA 2FODA 3F9FA 1K9OE 2FLRH 3R3GB 5JB8S 2ZDKA 2PKAB 3ZV8A 1K22H 2BXUH 1F92A 3NRLA 1GJ8B 3N7OA 2GZ7A 1VITG 1MD8A 2QIQA 5GCHG 3V0XA 3NXPA 3GY8A 1GWAA 3Q3KA 3PV5A 2VVVA 5G4BA 3ZZ9A 3UREA 1THRH 1Y3VA 4JZEH 2ANYA 1HIAB 2H5CA 2OC1A 4F55A 4MQAA 8ESTE 8KME2 1OWIA 3UOPA 1W2KH 1ZJDA 4DCDA 2R2WU 4Z1MD 1EXFA 1GMDF 1RJXB 1S6HA 3MU0A 1SGNE 2B8OH 4CRDA 3LGIA 1H8HD 1AO5A 1CT0E 2AGEX 4Y79A 1CHGA 4FUIA 2TGDA 3CNRA 1YLNA 1C5LH 4GLYA 2XNDD 1VR1H 5CE1A 4FUDA 4AFUA 2ZGHA 1O3CA 2FXRA 3C27B 2OP9A 3OEHD 3SJOA 1CGJE 1OWHA 3TU7H 3MNBA 4INHA 4AYYB 6CHAB 2OBQA 1VKYA 1GMDG 1NROH 1ZHMA 1MD7A 2BDAA 3UWIA 2C8ZB 2EI6A 3C1KA 3SNCA 4R8TB 1UVUH 2GV7A 1W14U 1XUJA 1CQQA 2ESTE 1Z6JH 1Z1JA 2BD4A 2W3KA 1E0FD 3Q77A 1FNIA 3NCLA 1GBCA 1OWEA 3V13A 1P2IA 2ZI2H 2CK3D 4FETA 5E0GA 1TIOA 2KFWA 1CSOE 5GDSH 5ETXA 2Q1JA 2Z3EA 2FOBA 5FBIA 1MKXH 2B9LA 1ABIH 3DT0H 5I25A 4TY7A 4FUHA 4Q7YA 1DXPA 2TGPZ 5JB9S 1GJDB 1AB9C 3F0PA 1FPCH 3PV2A 2QC2A 2FOCA 1FLEE 1GBKA 1YCPH 1YYY1 5DO4H 3SHAH 3MWIU 1G37A 4TYDA 1N1LA 1Z1IA 1BTPA 5JBTA 2KCYA 4Y7BA 1MKWK 4KTUA 2BY9X 5JYIA 3DFJA 1RTKA 1E1RD 2K1QA 7GCHG 2H6MA 1P2QA 3QWCH 1XXDA 2GKVE 2FYRA 5C2ZA 1F5RA 4ZHAA 3S9CA 3MMGA 4ZMAH 5I46H 1QZ8A 1ID5H 1KTSB 1BMLA 1S81A 5A0CA 3GCHB 1P9SA 3PRDA 3TIUA 1E1QD 2NU3E 1WAYB 4D7FA 3MI4A 1HNEE 1Z7KA 2BDHA 4IC6A 1XXFA 1KDQB 5GCHF 2FO9A 1DUEA 1YF4A 2J38A 3SGQE 1NRSH 1DWEH 2GDDA 3RXDA 1SHYA 2GCHG 3FOAA 4GSOA 5L2ZH 3LGVA 3SQEE 3T26A 1Q3XA 4B1TA 2HLCA 5CMXH 4K8YA 3P8FA 1TLDA 1OWJA 2O8MA 1XUFA 2KR7A 3GY4A 1PQAA 1NPMA 3FO8D 1O30A 3BTTE 2OUAA 3O8BA 4WXIA 2BD9A 1SL3A 2BD5A 4H4FA 3SI3H 4YLUA 1O2KA 1FXYA 2SGDE 3LDXH 4OS1A 1UVTH 5IDKA 5HKKD 1JOUB 1O3NA 1HIAA 5J4QA 4MLFB 4CHAB 3VXEH 4X6OA 2A5KA 1UK4A 5F8XA 3SV6A 2AIPA 1UO6A 2ZFQH 1O35A 5A8ZA 1C5VA 1GI3A 4Q80A 1Y3XA 1IHSH 1YC0A 1NFWA 2TPIZ 4UFEH 3RM0H 3MH7A 1JRSA 4RKJB 1C1QA 1CO7E 5LPEA 4RKOB 2BOHB 2JH0D 2ZP0H 2VIPA 3HATH 4MNVA 2ZZUH 3SBKA 1UTQA 1AQ7A 1OSSA 2CF9H 1SQRA 2ZPSA 2OLGA 1D3QB 1GCDA 2ZTXA 3A86A 4FUGA 3P8NA 3ZVAA 5EXLA 1SOZA 5TCCA 4ABDA 1QGFA 5FL7D 4XOJA 3TVJB 4YOIA 2H9TH 5C17A 1CGHA 2G5VA 1TE0A 4Z6AH 4TPYA 1ESTA 2EY4C 2HALA 2LPRA 3GDSA 1ZOMA 2UWOA 1YWUA 2ZFRH 1ZPBA 1C2JA 5L6NH 1QJ7B 9LPRA 2OINA 1C2HA 1SBWA 1MTNC 2FX4A 3TGIE 1YLCA 5LGOA 2ODPA 2OCVB 1RXPA 3KGPA 5C1YA 1CT2E 1O5DH 1W0YH 3S69A 1IQNA 1FY8E 4GHQA 3TJVA 4CRFA 1TX7A 1BRAA 1GBBA 3OY6U 5H4IB 4I86A 2IJOB 5A8YA 1M9UA 1SGEE 2WV5A 4KTSA 4TWYA 1E34B 4BAMB 1C5ZB 3GY3A 4WH6A 3OU0A 3NK8A 3BSQA 1TGNA 3RXHA 1GPZA 2VIDA 3QUMP 1KYNA 1IQFA 4HZHA 1AUJA 2HNTE 3KHVA 4B6FA 1NM6A 2CN0H 2P59A 1FPHH 2HVXA 3EA9A 2F9OA 1HAXB 2FOMB 2OXSA 3BIVH 4FVDA 3K2UA 3GY5A 1QJ1B 1GCTC 1GG6B 4KGAA 1LPKB 2GV6A 3MH4A 1TNLA 1BTXA 5FPSA 3RXBA 6LPRA 2R2MB 1GHZA 1QQ4A 3BG4B 2VWMA 1MQ5A 1G3EA 5K0HA 3AW1A 1GBTA 1GG6C 5DP5A 4U30A 5C5NA 2VH6A 3GISB 3VB3A 4FUFA 1UTLM 2WPHS 4XBBA 3RXFA 1W7XH 2BQWB 4FXGH 2PSYA 1GMCF 3E90B 1AB9B 2OD3B 1UK3A 4GHTA 2OBOA 3W1EA 1G36A 3R0FA 3WY8A 1A0LA 1C9TA 1FN6A 2R3UA 2D8WA 4XD7D 1FN8A 1CE5A 1QHRB 3B9FH 4I33A 4JYVH 4BXSA 1LPZB 2AGGX 4CRGA 1LHEH 3E6PH 2V7QD 1UMAH 4ZUHA 4Y10E 1KDQA 2CV3A 3GICB 2THFB 1QRXA 4AB9A 4Y8YA 3E91A 2ZA5A 2WV9A 1KTTB 3SU5A 2YNAA 5DSFA 3I78A 3M3VA 5EQQA 3SJIA 1VZQH 4X8SH 1C5RA 4ZCNA 4Y0YE 2JJ2D 3KQEA 4WMEA 3ZZ6A 3MOCA 1YM0A 4K2YA 1AVWA 2M5TA 3L33A 5IYTA 4GPGA 5IK2D 4NGAH 2PTNA 2Y5FA 3SU4A 3VEQB 1DY8A 1T8OA 1DLKB 4JZIA 2BD8A 5DJ7A 4I8GA 4U2WA 1SQAA 4IMZA 3ODFA 4X2XA 2ZHDA 1E79D 1ZJKA 2ZFSA 2ZHFH 5EIYA 4O97A 2XBVA 1D6WA 3LC5A 2XC4A 2BM2A 4MNWA 1DVAH 5F8ZA 2ZU5A 4NSVA 1SOTA 1PPCE 3M5MA 4ESTE 2BYAX 2ZCLP 1QB1A 4WMFA 3KL6A 1C2GA 4ZKNU 1WUNH 1DFPA 5AFZH 2QA9E 3DSOA 4X0WU 1TPSA 2ZECA 3S9BA 1GMCG 3V3MA 3F2GA 2WYGA 4AFQA 1VITF 1TGSZ 3KNXA 4QT8C 2BXTH 4RT0A 4AG1A 2Y7ZA 3ZVFA 2RA3A 3A8AA 4I8JA 5K7RA 1YPLH 1Q2WA 2V3HH 5DP4A 3ZVEA 3VG8A 5EOKA 2FM2A 1WDIA 1OYQA 1F0RA 2GD4B 2J97A 1HXFH 2G4UA 1AGJA 1GJBB 1TONA 2ILNA 1D6RA 4K1EA 1TAWA 1CA0B 2W6JD 5HIZA 1MH0A 5TCAA 1BHXF 3KQBA 5BPEA 4BTTB 2Y80A 1YLDA 3B8JA 3BF6H 3L6PA 1TMUH 5C5OA 1MUEB 3A81A 4HGCA 3E1XB 1NZQH 2NU2E 2VIWA 1TBRH 5DP3A 5FHTA 1GHBG 4UE7H 1DT2A 1ARCA 3WW7A 4ABHA 2UUKB 1BTUA 3ATMA 4DIIH 3SZNA 3F2HA 3P6ZB 2NWNA 3SUDA 1P04A 3ZVGA 1W0KD 1Z71A 3EDXB 2KCOA 1QBOA 1NFUA 1SLVB 2CJIA 2J34A 4OGYA 1N6XA 3RXGA 4UEHH 1O2ZA 1K1IA 4MPXA 4YM9A 1SGPE 1QBVH 2JH5D 2ZCKP 1SGRE 1TBZH 1SLUB 4A1VA 3OE7D 3UY9A 2VB0A 1SR5C 2A5IA 1O3GA 2RA0A 1HAPH 1GBHA 2QYIA 3BTDE 2O8UA 1O3HA 2PTCE 1ZGIA 2V35A 5FXLA 1XKBC 1P8VC 1TQ7B 4FU9A 3TNSA 3BEUA 1BITA 2DE8A 6CHAC 1DX5M 1WTHD 2Y5GA 2F9BH 1DE7H 3CENA 1GDNA 1E36B 2A4QA 2BTCE 1ZMNA 4VGCB 2HRVA 1AWFH 3LONA 2AHME 3A7YA 1DUAA 4CBOA 1V2JT 1EAXA 1C5MD 2BVRH 4OS2A 4OS4A 2F43B 3BTKE 4IW4E 1DWDH 5EJLA 2C93B 3RC5A 1KXFA 1G32B 1RFNA 5GJ4B 1TNJA 3HKJB 4BAOB 1ESBA 4FVBA 5EJZA 4ISLA 2VWOA 4K3JA 1E35B 1S84A 3FZDA 1P03A 1O38A 1MKWH 1P12E 2H5DA 4I32A 3PWCA 5DG6A 1N6YA 1ZRKA 5E0HA 1IQEA 1IQHA 4XFQA 4ABBA 4NA8A 4ACAA 2QF5A 2W7UA 5KECA 1V2NT 5C0TA 4AB8A 5FCRA 1MAYA 2WZQA 4NG9H 1GCTB 1GL1A 5AHGH 1HGTH 2FZZA 2QXJA 3HGNA 2A7JA 2QF3A 3RXIA 3S7HB 1NRNH 2K0QA 2R0KA 3TLOA 4A1TA 5A2MH 4ABAA 3A7TA 4GCHG 5ABWA 1THPB 3U28C 1A5HA 1JIMA 1HYLA 1MBQA 1S82A 6GCHG 1P01A 1O3AA 3FAOA 4K1TA 2J2UA 2XC0A 2NU1E 1XM1A 1RS0A 3MFJA 1OX1A 3RMNH 1THSH 4CH2B 1P10A 4UDWH 3AAUA 2KZ4A 1Y59T 2VWNA 1TNHA 1CT4E 2AERH 2YOLA 1GVZA 2FTMA 4J1YA 1PQ5A 2PWXA 1DOJA
chains in the Genus database with same CATH topology
2O8LA 1PYTC 3ZZCA 4ASHA 3E3TA 4GAWA 1GJ4H 3ENSB 1OP0A 1T7CA 2ZF0H 1HAVB 1WU1A 2AGIX 1QJ6B 4IC5A 2P3UB 1V2QT 3RLWH 1QR3E 1RTLA 1TRNA 4MPUA 1O32A 1YBWA 2Z9KA 3QZQA 1GJCB 3BV9B 3U8OH 2C3SA 3RXRA 1UTPA 1GJ7B 3PLPA 1O2VA 2BY8X 1ELGA 5TJXA 2GDEH 2P93A 2BDYA 2RCEA 4HI3A 4ZAEA 3GY2A 1MZAA 2Z9IA 4ZHLU 4B71A 2H9HA 3AASA 3SORA 2XBYA 1OOKB 1F5KU 2GT7A 3A85A 1JXPA 2ZU3A 2FOEA 3QK1A 2RG3A 2UWLA 2PV9B 1C2KA 1SFQB 3LJOA 2FLBH 2A7CA 1K1MA 2ZQ1A 2CMYA 2FI4E 1MZDA 4YO9A 2G81E 5HGGA 3RU4T 1O2GH 1IQJA 4FU7A 1SVPA 1W11U 3RMMH 4DW2U 2SNVA 4AG2A 1KSNA 4R0IA 3M37A 4UFFH 5EPYA 3TNTA 2GP9B 3NPSA 1BBRK 1XKAC 2P16A 3OSYA 5JBBS 1NFXA 3EQ0H 1K28D 1WV7H 1GI2A 1ZSLA 3F6UH 1Z8GA 1GI8B 1L4DA 3D49H 2G00A 2QCYA 2V3OH 3TJNA 4CREA 1ZSJA 2H2ZA 4ZKRU 4CR9A 4YT7H 4Y8ZA 1SGFG 1P11E 1P02A 1J8AA 2P8OC 2W7SA 1XUIA 4DT7B 1H9IE 3SNAA 2BD2A 4DJZB 1YKTA 3U1IB 1H8IH 1QBNA 1CBWB 1C4Y2 1TFXA 2GVFA 3GCHC 1Z8JB 1V2OT 3MO9A 3KQDA 3L3TA 1P2KA 5FCKA 4OGXA 4AFZA 2F9UA 1MMJN 1NY22 3VGCB 5FX6A 2Z7FE 3BG4C 1DSTA 3DD2H 5FX5A 1H1BA 2CHAC 1AE5A 2J4IA 3ODDA 1GHAG 1O3JA 2VVCA 2ZGJA 1ARBA 1ANCA 2EC9H 1SB1H 4KKDA 3D62A 2PKSC 1OP2A 1F2SE 1ANDA 3EA8A 7KMEH 4YLQH 1MCVA 1QFKH 3A82A 4SGBE 1TX6A 3LGYA 1AHTH 3SN8A 1B0EA 1FONA 1YPJH 4NZQA 1O3IA 2R9PA 2BVSH 3VB4A 2A4GA 5DK1A 1NO9H 1QA0A 4XDEA 2A7HA 3SNDA 2VH0A 3U1JB 1EOJA 4I8KA 1T8MA 1K1PA 1PPGE 3GY7A 3NKKA 2GGVB 2BLQA 1FY4A 2ZNKH 1MTNB 1KXBA 2HWLB 1XUKA 2BD7A 5HM2A 1C2DA 2PR3A 5A09A 1UVPA 2C90B 2ZFTA 2STBE 1GBMA 1V2VT 1GBIA 4BXWA 1EJAA 1KXCA 1O5CB 1Y3WA 1C1MA 1O3KA 2VJ1A 1ZZZA 1VCQA 4AFSA 1EOLA 1FZZA 2BQ6B 1C1SA 1C5YB 1DPOA 3QGJA 1GHYH 1IQGA 1MTUA 1OS8A 2EEKA 4INLA 2ZDAH 3S7KB 4JK6A 4FUBA 2ZHEH 1G2LA 1TNGA 1HV7A 3SNBA 2QV1A 5GPIB 5T3HA 5JBAS 3PO1B 3IWMA 2SGQE 2FMJA 2XRCA 1ELBA 2ZHQH 1UTKA 2QAAA 2VNTA 2BDIA 4MNXA 3EAJA 1DLEA 2B5TB 3EYDA 2ALPA 1YPEH 1O2YA 1CHOG 5DGJA 2FOHA 7ESTE 1KLIH 3P95A 1O3PB 1C1TA 1GI9B 3P8GA 1QURH 3ZVDA 2FP7B 4UD9H 2ZPQA 5JDUB 1J17T 4NFFA 4UONA 3MNCA 4IN1A 2BLWA 5B6OA 3H5CB 5E2PA 3ZZAA 6ESTA 1IQIA 3ZV9A 2A31A 2G8TA 1RIWC 1W13U 1W7GH 2I6QA 1C5TA 2FS9A 2ASUB 2XWAA 4XE4A 3LJJA 1UCYK 3RXAA 1O37A 3ZZDA 4CRAA 4GUXA 3JZ2B 1SGIB 1HRTH 1C5NH 3TK5A 4CBNA 3H7OA 4NWLA 1HAIH 1O36A 1GVKB 1HCGA 4X8TH 3DUXH 2BY7X 4ZXXH 3RC6A 1J9CH 4IN2A 3HGPA 4ABJA 4X8VH 1EUFA 2F3CE 3M5NA 1GBAA 3M3TA 3BTFE 3SO3A 4A92A 5DP8A 1W10U 3PLBA 1CGIE 3PWBA 2V0BA 5AF9H 4ABIA 3LKWA 1S0QA 3QLPH 3BG8A 1AN1E 1QRZA 5PTPA 2J9NA 2VIQA 2G4TA 5LPRA 2G52A 3IG6B 5EXNA 2AMQA 3UPEA 3URCA 1EASA 1G30B 2PW8H 3OYPA 2ZDLA 1D9IA 3AVZA 1JIRA 3K6ZA 4I7YH 1GHWH 1GBJA 2GZ8A 5FPTA 1TMBH 3CS0A 3LGUA 2SGAA 1BTYA 1LVYA 5C3NA 2ZU2A 1AIXH 1GBLA 5C1XA 2WPJS 1K1OA 1Y5BT 1P06A 1XMNB 3PTBA 1H9HE 1V6DA 2UWPA 5SGAE 1V2MT 3OTJE 1GBFA 1B5GH 1BTWA 1MU6B 5EODA 5E0JA 1TQ0B 1KXDA 2VGCC 4WWYA 2KAIB 1K1NA 1DDJA 1EX3A 3TGJE 1QIXB 3RXUA 1UHBA 3ESTA 5C1UA 1IQLA 2DE9A 1N8OC 2BX4A 1ZHPA 1TA6A 4YTAA 1YCPM 1BIOA 1GJ5H 5ESBA 3VXFH 1TWXB 2GT8A 1OWKA 3E8LA 4WY3A 2AFQB 1C5SA 1O2QA 2O8WA 1MCTA 3Q3YA 3SU0A 2ZDMA 2GTBA 1HXEH 1BB0B 1QQUA 2XTTB 3GDUA 1K21H 4MTBA 1YGCH 1WYKA 5EU8A 1C5UA 1O2TA 2GMTB 2IPHA 2P3FH 2SFAA 1A3EH 3GCTG 1AZ8A 4X2VA 1ZYOA 1NU9A 1AVGH 3TITA 3ZZBA 1KY9A 7GCHF 1GMHG 2QF0A 1HAHH 3A8DA 2AS9A 4FUJA 1P2MA 3NUMA 3A89A 1UTMA 4DURA 3QZRA 2B0FA 2PSXA 1VGCB 1MBMA 2BQ7B 2EI8A 1YPHE 3P8OA 4JYUH 2ZTZA 4ZXYH 1PPBH 1TMTH 4YT6H 3RUOA 2ZC9H 1DITH 2B7DH 1SGYE 3RXKA 2F9PA 4NCYA 4ABFA 3O8CA 3M61U 2Y5HA 4E05H 2OQUA 1GI0A 1PPEE 2XWBI 4CH8B 2UUFB 3GY6A 1ELVA 2I6SA 4DY7B 1HAVA 5A0AE 1TPAE 1AFQC 1LVBA 1S5SA 2BB4A 1BTZA 1N8OB 1ELEE 5EW1H 2O9QA 2GZ9A 3LGWA 3A80A 4F4OC 1KIGH 4AOQA 1EATA 1BDAA 1EJNA 1T31A 5LH8A 1BJUA 2ZTYA 4X1NU 3KCGH 1DWBH 2PLXA 1F0SA 3ZZ8A 1RTFB 4JCNA 2GCTB 1ORFA 1OWDA 1ELFA 4MPVA 2ZDNA 1GJAB 4J2YB 1LTOA 2PUXB 3M7QA 1HAYB 2D2DA 1OKXA 3SV2H 4X2YA 3MU1A 3A8CA 1FQ3A 7LPRA 1O39A 1YPHC 1ZGVA 2Z3DA 3TH2H 1ELAA 3PTNA 2YNBA 3TJUA 3B23B 2QXIA 1WTGH 3P70B 4M7GA 1AUTC 1BOQA 1XVOA 3RXCA 2XBXA 5GXPA 1HPGA 2A2QH 3BEIB 3TK9A 2A1DB 1UVOA 1SSXA 1EPTB 1HAZB 3Q76A 2J94A 2Z94A 2FYQA 4DIHH 2IN2A 1GGDC 5AVDA 3UR6A 2GCTC 1HJ8A 2KAIA 1P57B 4NWKA 1ZR0A 1BQYA 1SQOA 2O8TA 2ZO3H 4TWWA 3BN9A 2J92A 5EQRA 1BRBE 1T4UH 1TRYA 4NIWA 3PLKA 1LHCH 1C1RA 1GDUA 1O3EA 3GOVB 3VB5A 4HFPB 1HJAC 1EQ9A 3SUGA 4AZ2B 1O0DH 1YCPK 2NU4E 1GI5A 1EB2A 1O5EH 4ZKSU 4K60A 1ETTH 3QN7A 1U6QA 1UTNA 1G3CA 1FY5A 3UFAA 3HK3B 3SGBE 4KP0A 3M7UA 1DXWA 1SG8B 4X1RU 4NIYA 2AEIH 2Q6GA 2D26C 1BJVA 1O2JA 2BD3A 3GCNA 1C1WH 5DP7A 3LIWA 1LVMA 3PMJA 1LPGB 3MNSA 2BMGB 1ZPZA 2BX3A 1AMHA 1ELCA 1VGCC 2AMDA 3P17H 1P3CA 2W5EA 1GI6A 1RGQA 1ZLRA 4X8UH 3TH4H 2BY6X 2C8WB 1XVMA 1MTVA 1WCZA 2ALVA 2CXVA 2G5NA 3GCOA 1BZXE 2SGEE 1QNJA 1JRTA 2QY0B 2ZDVH 1T4VH 4IGDA 1QB9A 4LXBH 3TGKE 2JETC 3F1SB 3T27A 1SI5H 3LU9B 3MH5A 4X6MA 3MNXA 4FUCA 4PROA 1T32A 4KTCA 3U98H 3M3SA 3RP2A 1C1PA 4YESB 3RU4D 2G55A 1LO6A 1C1UH 1ZSKA 4MDSA 1FV9A 3SU3A 4IBLH 1GBDA 3SNEA 4O3TA 5HM9A 4OS6A 3K6YA 5AFYH 3A83A 2C4FH 1NRRH 2VINA 3OY5U 4X1QU 5EPNA 1PFXC 3QDZB 2P94A 1A2CH 4AN7A 3KEEA 1WQVH 1LHGH 4B2AA 3RMLH 1A61H 1AWHB 1NT1A 1LCYA 3VPKA 2QXHA 2PKAA 1O3FA 3PMBB 3SQHE 1YPKH 3KIDU 3MTYA 3A87A 1F0TA 4ABGA 4B74A 3ZZ4A 1GHVH 2EA3A 1MTSA 1WQSA 1LHFH 3ATWA 4D9RA 3GDVA 1IAUA 1QTFA 3RMOH 3O8RA 1BMAA 1VJAU 2PGBB 1W8BH 3HKIB 3FFGA 4A6LA 1TRMA 1FIWA 3FP7E 1VCWA 1GMHF 1L4ZA 4K8BA 5ESTE 3ELAH 4LK4A 5T6FA 3F9EA 2Z9GA 4Y7AA 1O2RA 3A7VA 4X6PA 3PM3A 4DVAU 2SGFE 4GVUA 2ANMH 4LZ4B 1C2EA 2GX4A 1HJ9A 5F8TA 5DPAA 1TYNA 4NIVA 1W12U 2A0QB 3QTVH 1J14A 4K5ZA 2AIQA 1SGQE 1C4U2 1D3TB 3U9AH 4I31A 5CHAC 2ANKH 3I29A 3BIUH 1FY1A 2HNTC 2WPKS 2ZG0H 5C67A 4H6TA 2FOAA 3SOSA 1TGCA 4MG3A 3RLYH 3V12A 2QN5T 3E0NB 4Y0ZE 3MU5A 2UUYA 1CU1A 4ISOA 1C2FA 2WINI 1EAWA 3F9HA 1SGCA 4O3UA 3AAVA 1C1NA 3M36A 5FBEA 1GGDB 3G01A 2FI3E 1A1RA 2F9VA 2Q6DA 3SV7A 1H4WA 3OX7U 1AKSB 1EZUC 4HTCH 1SGFA 4NZLA 1FAXA 1O5GH 3RXVA 1KXAA 4BAHB 1ZRBA 1BA8B 3UR9A 3STIA 4GCHF 1V2TT 1GHBF 1TGTA 4WJG2 4ABEA 3RXPA 1YPGH 1NTPA 1J16A 2WUCA 3T62A 1P3EA 1PPHE 2BDBA 1MTWA 2HNTF 3PV4A 1T8LA 3RXSA 1GJ9B 1B7XB 2HPPH 3U8RH 1SFIA 4NSYA 1TABE 4BTUB 3RXLA 4WF8A 4D8NA 2PFEA 4Y76A 1EZSC 4K69A 1C1OA 2ZFPH 2HOBA 1SGTA 5GIBA 1TOMH 2WPIS 3BTWE 3KQCA 4UFGH 4X6NA 1FY3A 1RRKA 1S0RA 1O2IA 4ZKOU 1D3DB 3Q00A 3U8TH 1TX8A 1Z6EA 1EP6A 1A5GH 4CRCA 3MU4A 8GCHG 2VIVA 1B0FA 1TNKA 5A0BA 2HGTH 2QXGA 4FU8A 2Z6BD 1JWTA 3M35A 2J95A 1AFQB 1FMGA 1OYTH 1ZTLA 3UUZA 4B73A 4RSPA 1PQ8A 1P2JA 2XBWA 1C2IA 3LOXA 4H6SB 4A5TS 3FANA 1O5BB 3URDA 1SC8U 2ZEBA 4X1PU 2H9EH 5C20A 3PROA 1GVLA 4DOQA 2Y82A 4RN6A 5FAHA 2SGPE 3KF2A 3STJA 1TPOA 1Y3YA 1JMOH 1O34A 1V3XA 1BUIA 1O31A 3VFEA 4B75A 2WUBA 1P9UA 3DFLA 1QCPA 2VWLA 3BEFB 5EXMA 5F03A 1O2HA 3T28A 1VCPA 4AYVB 1F7ZA 3W95A 2STAE 4FUEA 1L1GA 4E7RG 2BLOA 3SW2B 1TB6H 1L1NA 3HK6B 2EI7A 1QRWA 2GCHF 4YZUA 1V2UT 2A4OA 1GHXH 3JZ1B 2QGRA 1P05A 1G2MA 1EAUA 1SLWB 2ZIQH 3S9AA 2FEQH 5T6DA 4INKA 1HAGE 1HAOH 1AY6H 1UCYH 4ISNA 2JH6D 3RDZA 2PKSB 2D1JA 1BRUP 1NFYA 1SQTA 1MU8B 6GCHF 5DKMA 1L2EA 1AZZA 1V2WT 3FVFB 1NN6A 1NU7B 1Y5AT 1OXGA 1O2NA 2Z9LA 4AGJA 2F91A 3BTHE 3VGCC 1V2KT 2FX6A 1DM4B 4DGJA 1O2PA 2ULLA 3UIRA 9ESTA 3VB6A 1X7AC 5F6MA 1E37B 2GMTC 3PO1C 4ZROA 1ETSH 1GL0E 1VITH 3FZZA 3T29A 3A8BA 4BAQB 1QY6A 3ZYEA 2AMPA 5DP9A 4VGCC 1O33A 1QL7A 1EJMA 2ZHWH 1HDTH 2UUJB 4LZ1H 1A0JA 1EPTC 2ZFFH 1HBTH 3ZZ3A 4WXVA 5HMAA 4NFEA 3GYMA 3MYWA 1C5XB 4IMQA 1H8DH 1KXEA 2XXLA 4WH8A 2FS8A 1BT7A 2IOTA 3QTOH 2C8XB 4MNYA 2FTLE 1ZTKA 3RXEA 2VGCB 3TH3H 3QGNB 1GI7B 1P2NA 1AE8H 1SMFE 2FIRH 1EP5A 4Z0KA 2OC7A 4Y71A 2ZPRA 3SU6A 1NESE 2OC8A 1F0UA 1YP9A 1HLTH 4BAKB 5HXFA 3PMAB 2ZKSA 1LKBA 3LC3A 3UWJH 2JETB 4O03A 2ANWA 4JMYA 4AORA 1ANBA 1GHAF 1P2OA 3KN2A 1IQKA 1ZPCA 2OQ5A 1F5LA 4I8LA 3K65B 4MVNA 1C5OH 3UNQA 1O2LA 2Z3CA 3ATLA 5JBCS 2ZU4A 3UNRA 1O3MA 1GBEA 2BDCA 1DY9A 2Q6FA 2W3IA 5L30H 4JZDH 1FAKH 3SHCH 1O2XA 3A7XA 3ITIA 1MAXA 1ZTJA 3EA7A 5EG4A 3T25A 3QO6A 1Z8IB 1DICA 3V7TA 2A4RA 2ZGBH 2TIOA 1CA0C 2CGAA