2BLVA

Trypsin before a high dose x-ray "burn"
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TRYPSIN
publication title Improving Radiation-Damage Substructures for Rip.
pubmed doi rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2blvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2blvA02
3U8TH 4ZXXH 1QBVH 1LVYA 1O3DA 4K69A 3ZZ3A 3D49H 1EZUC 4ABDA 3URCA 2CXVA 3P8FA 4RKOB 1W3CA 2J9NA 3CENA 3MH4A 3SJIA 1DSUA 4NZLA 4NIYA 3NK8A 3QGNB 2H2ZA 3MH6A 3T27A 2ZHFH 1EZQA 1LVBA 3RXSA 1GJDB 2EC9H 1UTQA 3MH5A 3FANA 5BRRE 5EXLA 1C1QA 1GG6B 1E37B 1GBAA 2JKHA 3DUXH 1P05A 2FLRH 1BMNH 1AD8H 4JZFH 4K60A 4WXVA 2XC4A 4GLYA 2C90B 1O3NA 1SLWB 1L1NA 1V2RT 3LGWA 2ZDKA 4NFFA 1GJBB 4A7IB 1BUIA 4KP0A 1QJ6B 1QRWA 1TGTA 3MNCA 4K5ZA 1LHEH 3DFLA 6GCHF 1HFDA 4NG9H 1FY4A 1KYNA 1AUJA 2BDBA 3MU1A 1YPJH 1GCDA 5J4SA 2BLOA 1O2WA 1TQ7B 2CHAC 3RXDA 1C4Y2 1CO7E 1AKSB 1MBMA 3SU6A 4FUCA 1O3JA 2BDHA 1ARCA 1OSSA 4MVNA 4K8BA 2PKSB 2Y82A 1IQNA 3ZYDA 1F5RA 2FOMB 2PGQB 3SBKA 1QB6A 5CE1A 1JMOH 2C93B 4AFZA 1AU8A 4D8NA 1SVPA 4CHAB 5FBIA 5BPEA 5DP6A 4UFEH 2P8OB 1P3CA 1GBBA 2XWAA 4K1SA 4O9VA 3TH2H 2FP7B 4A92A 1VJ9U 1O2NA 1YPGH 2TIOA 1KY9A 1Q2WA 2ZHQH 1TA2A 3SU1A 1INCA 2BY9X 2H9EH 2BQ6B 1GJ7B 3K65B 1PJPA 3A84A 3M3VA 1PQ7A 2NWNA 2PTCE 1YPHE 2BXTH 3BG4B 1JRSA 1TX8A 1UTKA 4Z6AH 3ZZDA 5JBAS 2Z3EA 3HGPA 3HKIB 4X8UH 1GVKB 4IMZA 1DY9A 2J2UA 1AIXH 3QN7A 3UOUA 1NM6A 1PPHE 2P3UB 1LPZB 4TWYA 1GBJA 3GDUA 1SBWA 1C5UA 4CHAC 2H6MA 3EYDA 5C1YA 4ISLA 3A7YA 1O2LA 1FY8E 3NKKA 1FAXA 2P8OC 3UUZA 2A7CA 1XVMA 1Z71A 3MTYA 1SQTA 1HAVB 3UNSA 1ZYOA 3ZV9A 1JXPA 2J38A 1OWDA 1GHAF 1F7ZA 3LGUA 3PWBA 2FESH 2GX4A 3F9EA 3MWIU 1MU6B 2VIOA 2F83A 3QGJA 1THSH 3M5NA 2A5AA 1HJAC 4GHTA 1LHFH 4Y76A 4IBLH 4IW4E 1ETRH 1GCTB 3E8LA 5A0CA 1AMHA 2ZU1A 3P8OA 3QDZB 1J17T 1QY6A 1BHXF 5TCAA 3UR9A 1PPZA 1HUTH 1DVAH 1SFIA 3V7TA 3H7OA 3GCHB 3RXCA 5DP4A 8KME2 1GWAA 3PLPA 3VFEA 2HPQH 2V6NA 2G81E 2ZHEH 2ZFRH 4YO9A 1ELCA 1BTHH 4FVDA 1GDQA 1TNHA 2BD5A 1SPJA 1ZTKA 4JYUH 2Y5GA 1EPTB 1CA0B 1SC8U 3D62A 1H9IE 3T28A 4PROA 3C1KA 3EA9A 1ELDE 2AGIX 5ETXA 1TPPA 2W3IA 2UWLA 1BBRH 1MTUA 3UPEA 1GBMA 3E1XB 1HAHH 1DXWA 5T6FA 1C1PA 4K1TA 3O8RA 4CBOA 4RN6A 1NU7B 1ZLRA 1NROH 1ELGA 2VINA 2FX6A 2XXLA 3SU4A 5K0HA 1FZZA 1NPMA 1YPKH 1O2UA 4YLQH 2O8MA 3RMNH 3K9XB 3GCNA 1K21H 3RXPA 1YGCH 4D76A 1D6RA 1C5NH 4A1TA 1M9UA 3DT0H 3EA7A 2HRVA 1SGNE 1O2TA 1AHTH 1FDPA 4FXGH 1FV9A 1O3LA 2O8UA 2A7JA 2ZU2A 5CHAB 2W26A 3B23B 3RXHA 1H1BA 1CA0C 3EQ0H 5L2ZH 2BD8A 3F6UH 3AAUA 4X1NU 2LNCA 4LXBH 2FM2A 1Z8GA 1WCZA 4TPIZ 2BVSH 3STJA 1C2JA 2A2QH 4XBCA 1TGSZ 1N8OC 1GI3A 3S9AA 3BF6H 1TFXA 1GL1A 1LVOA 1P04A 3A80A 2VIQA 1L4DA 4HGCA 3RU4T 1O5FH 1S84A 2IJOB 1A5GH 4MPUA 2OQ5A 2PKAB 4NIVA 3EAJA 5E2OA 1P12E 1ZMLA 4GAWA 3SI4H 4GCHG 4ZKSU 7ESTE 4Y8XA 2GMTB 5A8YA 3QK1A 2Z9KA 1O3EA 1ZGVA 3MO6A 1O39A 1V2LT 4ABBA 1H8DH 1O5BB 2BY6X 2ZU4A 1LPGB 1HYLA 2YNBA 1FQ3A 4MG3A 4ISIH 2ZDMA 3P6ZB 4X1SU 1TA6A 3L33A 2VU8E 1ZSJA 3Q77A 1D6WA 3RLWH 4NZQA 4LOYH 1SGFG 2OUAA 4OS5A 2J95A 5E2PA 5F6MA 3RLYH 1MZDA 1Y3YA 4D9QA 2FI5E 3SQEE 2BQWB 4WMDA 3V3MA 5C5NA 1ZHPA 3MHWU 3PLBA 4X2WA 1RRKA 1OXGA 4U32A 2R3UA 2VWOA 3TNTA 4OS4A 1NU9A 1K1NA 1TRYA 3GY7A 2LPRA 5I25A 5LPRA 1TQ0B 2PHBA 1NN6A 1C9PA 1SGPE 1GI1A 4ABHA 4KELA 2QA9E 2ZFPH 3TU7H 2WPJS 1G32B 1KXBA 1XM1A 1UTNA 2A4GA 2O8WA 1XKBC 1Y3UA 1V2WT 4Y8YA 5E0JA 1O3GA 1OKXA 1YBWA 3UNQA 2XCFA 1O3FA 3TVJB 4B1TA 2ZQ2A 1FAKH 4ESTE 3U1JB 4Q7XA 4OS7A 1ZPBA 1DS2E 3SUFA 3BTHE 2R3YA 4MNVA 3DD2H 1MBQA 1TGNA 1WV7H 3TGJE 3QWCH 1W10U 1AGJA 5SGAE 3CP7A 3ZVCA 3A7VA 1D3QB 1C2DA 2ZTZA 2QAAA 3TJOA 1K28D 3S69A 4YTAA 1WYKA 2F9OA 3O8CA 2BYAX 2G8TA 1O5EH 2GZ7A 1NFWA 2ZTYA 5GCHF 2QN5T 4NCYA 3SUGA 2Q1JA 1IQKA 1OP8A 1IQFA 4H6SB 3QZRA 5C5OA 1GI6A 2H5DA 1GGDB 1Z1IA 4KTUA 1NESE 1C5MD 4ISNA 6LPRA 2VJ1A 3F1SB 5GDSH 1BRCE 4ABIA 4ABJA 1BTPA 1WTGH 3ZZ8A 1G2LA 1AUTC 1X7AC 2C4FH 1MD7A 2Y6TA 2ANYA 2AGGX 1GBHA 3KQCA 1Z8JB 1AE5A 1DE7H 1KXEA 3SNCA 4NA7A 2H1UA 1LO6A 2KAIB 1SLVB 1HV7A 4IN1A 2JH5D 2QGRA 4FUBA 3BIVH 1DSTA 3SNDA 4ZROA 3OY5U 4BAKB 1HIAA 2BD7A 1TGBA 1SGFA 1DWBH 2CJIA 1OX1A 3FZZA 4MPWA 2XBYA 2QXGA 2XRCA 1BBRK 3LGIA 4D9RA 1O5DH 2ZWLH 3DFJA 3PTNA 2ANMH 3FP7E 4CH2B 3M5MA 3IG6B 1WTHD 3NXPA 2DUCA 1AVWA 1HAOH 2FYQA 4I33A 1C5XB 1Y8TA 2JETB 3BTEE 2OINA 2ZIQH 1G3DA 1Y3XA 1GHYH 4WH6A 1UVPA 2ZCLP 5A09A 1LQEA 2VVUA 1V3XA 2FS8A 2SGAA 4YZUA 5JB8S 1ELFA 1O2XA 2F9BH 2BQ7B 3FP6E 3S7KB 2G5NA 1H4WA 1QQ4A 4DCDA 2ZDLA 3ATKA 1VITF 1B7XB 1HXFH 2QCYA 1SG8B 2QF0A 1L0ZA 1O2VA 1EJAA 3BTFE 3P70B 1GL0E 2R0LA 1OOKB 2EI6A 3ZYEA 2HNTF 1C5QA 1EXFA 2ANWA 3N7OA 2FPZA 3MU5A 4JCNA 3BTDE 2ZC9H 1YCPH 1FNIA 2SGEE 1ZJKA 1NS3A 3M35A 4D7GA 2GKVE 1HPGA 1TIOA 2BY8X 3M61U 1NRQH 4DT7B 1EAWA 3LPRA 1GPZA 3Q76A 1XKAC 2W7SA 3STIA 4JMYA 1VGCC 1A61H 3GCTF 5DP8A 1UVTH 2Z9LA 1W7GH 2H9TH 1O38A 4Y11E 2BVXH 1GDNA 4B71A 1K1IA 2XW9A 3P8GA 5A0BA 1HAIH 2F9UA 1AVXA 2CN0H 1CSOE 7GCHF 4MPVA 4AORA 1AO5A 2C8ZB 2D26C 8LPRA 4X0WU 2GCTB 3OYPA 1BIOA 2ODYB 1ZHMA 1ZOMA 2VVVA 2O8TA 2BLVA 2CF9H 5DP9A 1FUJA 1RTFB 1OWEA 1P2IA 1G3EA 4I8JA 1P01A 3TITA 1A5HA 1RTLA 1J14A 4ZKOU 1TALA 1HXEH 4AOQA 4YOIA 1MD8A 2HOBA 2GZ9A 5C1XA 2ZGHA 1ESBA 1BTWA 1ETSH 3F68H 4TPYA 5FX5A 4ZHMU 2BD2A 2IOTA 2GP9B 5HGGA 2ZDAH 2EI8A 4ZAEA 1K22H 1NFXA 2QC2A 3V13A 2B9LA 2TGPZ 1C5RA 2YNAA 1HGTH 4DW2U 1V2MT 1PPEE 1V2NT 3GOVB 3LJJA 1QB9A 1TRMA 3GCOA 2BD3A 8ESTE 2V3HH 2CGAA 4DIHH 6ESTA 3PO1B 3A89A 3BEUA 3PMJA 4H4FA 1EP5A 2STBE 1LTOA 1MAXA 3RM2H 4Q7ZA 3RUOA 2ALPA 3TGKE 1LVMA 1G30B 2OTVA 3HATH 1EB1H 1FN8A 1YLDA 2SGPE 3TNSA 1BRAA 5JBCS 3KQDA 2QXHA 1GI9B 4UD9H 3AVZA 1DUAA 1UCYE 1RIWB 1G3BA 1RS0A 1CGIE 1O2GH 4GVUA 2BXUH 2Z94A 2UWOA 2TBSA 1FPHH 1GBFA 2F9NA 3BTGE 4DVAU 1HAGE 5I46H 2BDAA 5JPMH 4BAQB 2ZP0H 4FUGA 1MUEB 1ARBA 3SV7A 3W94A 3RP2A 2GVFA 1OP0A 2Y7XA 3MNSA 3ZZCA 1D3PB 1C2GA 2A1DB 4CRAA 4ISOA 5HXFA 3PLKA 2Z9IA 3E6PH 8GCHF 1YPMH 3D23A 3SNAA 3H5CB 2ZO3H 4B73A 4GCHF 4DJZB 2SNWA 1HRTH 4CRFA 5FPTA 3D65E 5DG6A 1RJXB 2A4OA 1DXPA 2BX4A 1BT7A 1NO9H 2FO9A 1MQ5A 4X2VA 1T4UH 2VVCA 2BX3A 3V12A 1IAUA 1TPSA 1O3KA 1LMWB 1D4PB 1J16A 3A7TA 1GG6C 1ZRBA 2THFB 3RXFA 3ZVDA 3NUMA 1O2SA 1THRH 3MO3A 1HAZB 3L3TA 1P09A 1FONA 2SGQE 3SUEA 4K3JA 5GPIB 3LKWA 1O34A 1MTWA 2VIWA 2Y7ZA 1B0FA 1K9OE 3Q3XA 1L1GA 2FOBA 1UO6A 6CHAB 3LDXH 3UTUH 1EP6A 1O3IA 2BZAA 5DO4H 2VIDA 5FBEA 3RU4E 4DURA 1RGQA 1QIXB 1ZTLA 3A85A 2XNIA 1SI5H 2W5EA 1HNEE 1S83A 1F0TA 2PKSC 1Y3WA 2V35A 3PMHB 1GBTA 2XBWA 1E38B 4NGAH 1GVLA 3UIRA 1CHGA 3LU9B 4CR5A 4ASHA 1EUFA 1IOEA 1JBUH 1NRSH 5FCKA 1C5OH 1BA8B 3ZVBA 2V0BA 5DP5A 3M3TA 3T25A 4UDWH 1C1MA 1Z1JA 2XYAA 1A0JA 1EJMA 2OBQA 2ZGJA 1CHOG 2RCEA 2HPPH 1LQDB 3QZQA 4IC6A 1QR3E 1S85A 4FUHA 4Y0YE 2BMGB 1C5VA 1A0LA 3NZIA 2BTCE 1SGRE 3BTTE 1GBKA 3O8BA 4MNWA 1K2I1 1ZRKA 3E0PB 1HAVA 3BG4C 3RXLA 5FCRA 1O3AA 1GHBF 1XVOA 1YCPK 1GHZA 3VEQB 1GBDA 1HJ9A 3ZVAA 3RC5A 3SJKA 1WOFA 2BHGA 2A4QA 2P95A 1TYNA 1WBGB 2R2WU 2WYGA 4VGCB 1TBZH 3M7UA 3BV9B 3LGVA 3VB3A 2IPHA 3AW0A 1Z6JH 1K1LA 1TWXB 1QL8A 1OWKA 1YKTA 1GJ6A 1O35A 1EATA 4JZIA 2SGDE 3S0NA 1EOLA 1TONA 1V2VT 2WPIS 3TJVA 3NCLA 1FJSA 4R8TB 1T4VH 1P2NA 3DHKH 2ZI2H 4KTSA 4A1XA 3O8DA 5JBTA 1ZR0A 1JRTA 3K6ZA 3RC6A 4XDEA 5LGOA 1OWHA 1GBLA 1GMCG 3A83A 5LPFA 1E35B 1BOQA 1O2MA 1BZXE 1HCGA 5AFYH 1XX9A 1VITH 3M36A 1TMUH 2ESTE 2YOLA 1OWIA 4AYVB 5H4IB 1C1UH 2NU0E 2PUXB 3GY6A 1ELVA 1RFNA 1BMLA 2BDIA 1UMAH 3RXTA 1ELEE 1P02A 4CBNA 1YCPM 1GCTC 1SQAA 4UEHH 2A32A 2ZFSA 4VGCC 1LHDH 1T8LA 4FUEA 3LOXA 4ISHH 2M5TA 2B7DH 1ANCA 2FWWA 4HI3A 1AWHB 3E0NB 2FOCA 2V3OH 2Z9GA 1GI8B 1FY3A 2TGDA 3GCHC 3M7TA 2ZFFH 1SGCA 4XBDA 3BN9A 3ODFA 3ZZ5A 2FS9A 1TBQH 1HB0B 3LT3A 2RA0A 1A2CH 2ZCHP 1O2YA 1TBRH 1ZJDA 3RXJA 2PR3A 5L30H 1P2OA 2H9HA 2VWMA 3T5FH 4WJG2 3U8RH 1MKXH 3FP8E 3BTME 3SHCH 2Z3CA 1W11U 2Z6BD 3MU0A 2ZCKP 1EPTC 2BB4A 3SU0A 1DWCH 1MTNB 4MQAA 1P06A 3BEFB 3HKJB 1DUEA 1EB2A 1HJ8A 2UWPA 2ZPRA 4BTIB 4Z0KA 4UFDH 3KL6A 4DGJA 4NSYA 4DY7B 3RXKA 1PPFE 3U1IB 4O03A 4YT6H 2ZA5A 3TH3H 2BDYA 1DWEH 4NIWA 3TK6A 1TOCB 2IN2A 3KN2A 3SI3H 1QL9A 4YESB 4LK4A 1SL3A 5E0HA 4Y7BA 1C1NA 5TJXA 1V2UT 3JZ1B 1ETTH 1KLIH 1OS8A 3LONA 3S9BA 3R0FA 2PLXA 4SGBE 2BLWA 1QBNA 2I6SA 2ALVA 1IHSH 4QT8C 4CREA 4AB9A 1GMHF 5CHAC 2AYWA 3ZZ6A 1SSXA 6GCHG 4TY7A 3UNRA 4B2AA 3DA9B 1GI2A 2FOFA 3GDVA 1S0RA 1W0ZU 1ELAA 2ZG0H 3EE0B 1GHXH 4I7YH 1P9SA 1SGIB 1PQ8A 3UQVA 2PWXA 3ZV8A 3SN8A 1TABE 3FVFB 3KGPA 4TYDA 2AIQA 2AMDA 4AFUA 1C5SA 2HNTC 4AG2A 1CE5A 1V2QT 3SGAE 1TLDA 4TWWA 1QA7A 1Y5AT 4DOQA 4H42U 3SGQE 2STAE 3TH4H 2GMTC 3SU3A 1S6HA 2OBOA 5AVDA 3PMAB 2J92A 3MU4A 3F9FA 1SR5C 1FIWA 1VZQH 2AMQA 1SGTA 1V2OT 1AFQB 1W12U 2TPIZ 1ZSLA 3ATMA 1XUJA 1BMMH 3M5LA 1KDQA 5EGMA 1KLJH 4XFQA 3RMLH 3ZVEA 1TPOA 3ZZ4A 1GBEA 1NZQH 4H6TA 1UTJA 1FXYA 1VJAU 1D3TB 2F9VA 3W95A 1C1OA 2ZDNA 2QXIA 3RXEA 1T8OA 2P3FH 3MYWA 3SNBA 1CBWB 1ANEA 5AFZH 1ZPCA 3BEIB 4A5TS 1UVSH 3RXUA 3MO9A 3RMMH 1RXPA 3TIUA 4GUXA 3BTQE 3SV6A 1Y3VA 1GHAG 3OTJE 1NY22 1Y5UT 2HLCA 5HYOA 4Y8ZA 2OXSA 1O2IA 1QTFA 4BANB 3VB4A 2F9PA 4IS5A 4A6LA 1O3MA 5FXLA 1O3OA 2D2DA 1TMBH 5T3HA 1JOUB 2ZHWH 2ANKH 1S81A 1LKAA 3MFJA 4AYYB 1ZHRA 4JK5A 1ESAA 1NTPA 1P2KA 2AS9A 5C3NA 1LKBA 3GY3A 1ESTA 2WINI 1QJ7B 3EGKH 3HGNA 1C2EA 1CQQA 3SGBE 1L1JA 2UUFB 1DFPA 3OY6U 1J15A 3TJUA 4J1YA 1O2JA 3L6PA 4ABGA 1IQMA 2VWLA 7KMEH 4CRCA 4JZDH 4CH8B 1TOMH 2ODQA 4OS6A 4RKJB 1QNJA 1GJ8B 4ABFA 1QURH 3TK5A 4FUJA 1T8MA 1HIAB 2SGFE 2GT7A 2Y81A 3C27B 3SQHE 2WPHS 1GGDC 1QRZA 1C2KA 2FZZA 4XSKU 4UE7H 1C5PA 4YOJA 2OCVB 3RXQA 5CMXH 3HK6B 2GD4B 1KTSB 1P8VC 2FODA 3PTBA 1DLKB 4IC5A 3UREA 2ZZUH 1MQ6A 1UHBA 2VH6A 1DDJA 3ATIA 4Y79A 2GZ8A 1AB9B 1O5CB 5EOKA 1AN1E 3SHAH 4BAOB 2XTTB 1WQSA 3P8NA 1MTSA 1YPHC 2C8WB 1ACBE 1JIMA 4U01A 1MKXK 3ZVFA 4MNYA 1A4WH 3T29A 4ZHLU 1UTPA 3CS7A 2ZEBA 1TNGA 5HMAA 2GCHG 1IQHA 1DM4B 1O32A 3LH3A 2WPMS 3SJ9A 4BOHA 1O2ZA 3I29A 2GV7A 4OS1A 2C3SA 2R9PA 3VXFH 2O8LA 1CHOF 1DY8A 2C8XB 2PSYA 1IQJA 2C8YB 4ZKNU 2J34A 3P17H 2BY5X 1DWDH 1P11E 1SLUB 4U30A 2NU3E 3A81A 3E91A 1GI7B 2OP9A 3GY5A 3KCGH 1FI8A 2JETC 1ID5H 1E0FD 3TGIE 5K7RA 3BTWE 4X8VH 1QGFA 1PPGE 2QIQA 2RA3A 1F0SA 4J2YB 2ZNKH 4X6PA 5LPEA 3VGCB 1P03A 1TPAE 3GISB 1XXDA 1A3BH 4BNRA 4E06H 3ATWA 1HAPH 2VGCB 2BLQA 3B8JA 1Y59T 2CV3A 1O2QA 2XWBI 1C1RA 1SB1H 1P9UA 2Y5FA 2PFEA 4I32A 4LZ4B 1BJUA 3RXGA 2DE9A 2SNVA 4NWKA 1Z7KA 1C1WH 2BDCA 5FHTA 1SGQE 2WUCA 4FU7A 1ABIH 2PGBB 3E90B 1EAXA 3UY9A 1IQIA 5JYIA 1BBRE 3T26A 2R0KA 3FFGA 2FEQH 1PQ5A 1KXCA 2P94A 3LC3A 1GJ5H 2G4UA 3VPKA 3SUDA 1TNKA 1D9IA 1P57B 3BSQA 3ATLA 2PW8H 1C1VH 3M3SA 4NWLA 4CRDA 1T32A 1BQYA 3ESTA 2Q6FA 2XBXA 1ZMJA 1O5AB 2UUKB 2QV1A 3ZZAA 1LPKB 1W2KH 1N6YA 1V2PT 1QB1A 4Y71A 1GHWH 4RSPA 3RXBA 4B2CA 2GCTC 4UFGH 3SV2H 2BOKA 2A5IA 4B2BA 2J94A 1GMDG 2OC1A 2WV5A 1Q3XA 1UK3A 1F0UA 2UUYA 1TNLA 2ILNA 5GWZA 4FUFA 1V6DA 2ZPSA 1YC0A 4O3TA 2BD9A 4BTTB 1C5WB 2G00A 4ZKRU 1TMTH 5EXMA 5HM2A 1K1MA 1EOJA 1AY6H 4HZHA 4AFSA 3GYLB 1G3CA 4KGAA 1AE8H 1A46H 1JWTA 2ZFTA 2CHAB 2B8OH 1OP2A 1CA8B 3QTOH 3ODDA 1C2IA 2TGTA 2WPKS 1BTXA 1ZGIA 2QYIA 1TAWA 1G36A 1CT0E 1LHCH 1K1PA 3KHVA 3T2NA 2W3KA 3PO1C 5GIBA 3PROA 1HAXB 1Y5BT 4INHA 4Y6DA 4ZMAH 1FY1A 2Z7FE 4Q7YA 5GCHG 5DP3A 1RTKA 4K2YA 4HTCH 1ZTJA 1YYY1 1G2MA 2F3CE 1U6QA 1YM0A 1BITA 1KXFA 1C2LA 2A31A 1T31A 1KIGH 3A82A 4K1EA 2AH4X 4X8SH 1C2HA 1XUKA 4THNH 3M7QA 3A8DA 1RIWC 1AKSA 1F5KU 1LDTT 3RC4A 1AQ7A 1OYQA 3R3GB 4ZH8A 1FIZA 4FU9A 4MPXA 1O36A 2P16A 3SW2B 3BG8A 1BTZA 5EXNA 5FAHA 2A0QB 2NU4E 3PB1E 2SFAA 3SJOA 2W7UA 1DX5M 1QBOA 4AFQA 1P0SH 2JH6D 1TX7A 1UTLM 5J4QA 3RXVA 1ANBA 1O0DH 4UONA 4ZXYH 1Z6EA 5EQQA 2TGAA 2BDGA 4BXSA 1O3CA 1BCUH 3ZZBA 4UFFH 3ITIA 1V2ST 1MAYA 1SGDE 4CRGA 3TPIZ 4BAHB 5E8EH 1C9TA 4MLFB 4FU8A 3UQOA 4XE4A 3QLPH 2ZF0H 3MI4A 4Y10E 1C4U2 1O2HA 2FTMA 4IGDA 1JIRA 3QUMP 1L2EA 1QA0A 2CF8H 1XUGA 1HDTH 2NU2E 1S6FA 3HK3B 2QXJA 4U2WA 5EQSA 4X1RU 1HJAB 4Y0ZE 3F9HA 2AFQB 2VIVA 1BMAA 4E05H 3A87A 3SZNA 3SV8A 4AGJA 4OGXA 1EZSC 2G55A 3EA8A 5HM9A 1VITG 2XCNA 4MTBA 5JB9S 1UTOA 5GXPA 2VIPA 3FZDA 4IN2A 1A3EH 1ZMNA 3LGYA 4HFPB 4I8KA 3P92A 4AZ2B 2AIPA 3GICB 1PYTD 3A88A 5E0GA 6CHAC 4AGKA 1EAUA 1N1LA 5ABWA 1O30A 4MDSA 3I78A 3PYHA 5GJ4B 4M7GA 3G01A 3TK9A 4X6MA 1IQLA 2ZFQH 1PPBH 1W13U 2PV9B 1PYTC 4Q80A 3E16B 3RXAA 3KNXA 2A4RA 2O9QA 1YF4A 3SV9A 2P59A 3GCTG 2ZGXH 4OS2A 5EODA 4YM9A 4NA9H 1O2KA 1KTTB 3KEEA 5DK1A 1IQGA 1A5IA 1ANDA 1DITH 7GCHG 2WV4A 4JYVH 2GDEH 1UJ1A 3M37A 1A7SA 1P3EA 1AZZA 3SU5A 2HWLB 1L4ZA 1H8IH 3Q00A 5C1UA 3NWUA 2Z3DA 1EPTA 2EI7A 4GSOA 1D3DB 1O2PA 1P2MA 1GHVH 1SOTA 1TRNA 3URDA 5EW1H 1CGJE 2I6QA 1SQOA 4R0IA 4X6OA 1C5TA 5A2MH 2FI3E 2P93A 2WPLS 3PM3A 1ELTA 4O97A 1AZ8A 5FX6A 1N8OB 3A8CA 1SOZA 2BD4A 5L6NH 1W8BH 1F2SE 3SJ8A 1K1JA 4X1PU 5AHGH 3LC5A 1LHGH 3U9AH 3SOSA 1VCPA 2ZU3A 3SNEA 3VB7A 3MOCA 1XMNB 1QFKH 5A8XA 3LJOA 4I8GA 1FY5A 5TCCA 4X6NA 4B76A 1FN6A 4ABEA 2FLBH 1GI0A 2D1JA 3KF2A 5DP7A 4E7RG 1B0EA 1OPHB 4KTCA 4NA8A 4X8TH 1UK4A 1Q31A 2A7HA 3KQBA 5T6DA 3WY8A 1GBIA 5F8XA 4CRBA 1J9CH 2FOEA 2XC5A 1BB0B 2GCHF 1N6XA 1A0HB 2BY7X 3RDZA 1TGCA 1VCWA 2JH0D 3AW1A 3QTVH 5A0AE 3CS0A 5JDUB 1CGHA 1MKWH 1QHRB 3MNBA 1YPEH 1NRNH 1UCYH 4LZ1H 2NU1E 2G5VA 1VCQA 2ULLA 2PKAA 1OWJA 1S82A 2VB0A 3GY2A 4NFEA 2OC8A 3FAOA 4B75A 1P2JA 1MTNC 4I31A 1W0YH 3Q3KA 4XBBA 1G9IE 1KLTA 3GDSA 1ZZZA 8GCHG 1O3PB 2FX4A 3GYMA 2K1QA 2RG3A 1BRUP 1E34B 1O2RA 1XUIA 4BAMB 1WQVH 1MTVA 4D7FA 3LGTA 5ESBA 2CMYA 2R2MB 4GPGA 1XUFA 4INKA 1DT2A 3RM0H 2EA3A 2A2XH 1SHYA 1ZSKA 3HPTB 4FUIA 1GI5A 3NPSA 1EKBB 1GJ4H 1NC6A 2GT8A 1UVOA 2BM2A 2VWNA 3SU2A 2OD3B 5DPAA 3A7WA 2ZQ1A 4OGYA 1AVGH 2QY0B 5EPYA 1VR1H 2AMPA 3GY8A 3P95A 2AGEX 2FOHA 1LCYA 4CR9A 1CT2E 2ZKSA 2PUQH 1MCTA 1O31A 1HLTH 5FPYA 1F92A 1C2MA 1UVUH 1DANH 1O33A 3UWJH 3QO6A 2FTLE 2B5TB 5DGJA 1V2JT 3S9CA 1QL7A 1KDQB 1EJNA 4B74A 2FOGA 1GMDF 5EPNA 2ZTXA 2PSXA 1EASA 3VB5A 4A1VA 1H9LB 2GTBA 3MMGA 2HALA 3U8OH 3K6YA 3VXEH 1Z8IB 2ODPA 1S5SA 3KQEA 1HAYB 3A8AA 4BXWA 1GJCB 3RXOA 1MZAA 3ZZ9A 1AWFH 2TRMA 5EU8A 7LPRA 2ZGCA 3LH1A 3UWIA 3RXRA 2AEIH 2ZECA 4NIXA 4FVBA 5LH8A 1C5ZB 1NT1A 2OC0A 1RD3B 3B9FH 2Q6GA 1GHBG 5B6OA 4AB8A 1DPOA 3UFAA 2G4TA 1AFQC 1CVWH 4WMFA 5C20A 2BZ6H 2P3TB 3TJNA 1CT4E 2FIRH 5F8TA 3T62A 2GDDA 4AN7A 1P10A 1C1TA 3F9GA 4WH8A 3U98H 1H9HE 1WAYB 4AG1A 1CBWC 1T8NA 1IHTH 4IMQA 1MCVA 2FMJA 4AX9H 1KXAA 3AASA 4TY6A 3LIWA 5DKMA 1O5GH 2WUBA 1GDUA 5C67A 2GGVB 1NRRH 1UK2A 2FOAA 1P2QA 1YPLH 3BTKE 5A8ZA 4O3UA 1THPB 2OC7A 2GV6A 5C2ZA 3EDXB 3BIUH 1SMFE 1EAIA 2WYJA 1F0RA 4K8YA 1C4V2 4E7NA 5L2YH 2ZPQA 2KAIA 1PPCE 1O2OA 2Z9JA 3GY4A 4YLUA 1XXFA 1QCPA 1UTMA 4MNXA 4JZEH 1F5LA 4Q2KA 4WXIA 1GJ9B 4WF8A 2ZGBH 4INLA 1ELBA 1PQAA 2BOHB 1AFEH 1QJ1B 1E36B 2D8WA 1BDAA 3JZ2B 5EW2H 3Q3YA 3RXMA 4JZ1A 4JK6A 1ABJH 3A8BA 2F91A 3A7ZA 2RDLA 3A7XA 2J4IA 1YLCA 3PWCA 1MMJN 3RU4D 2QF3A 1BJVA 1SLXB 1UHBB 4BTUB 1WUNH 3V0XA 1XUHA 3E3TA 1NFUA 1VGCB 1DOJA 3OSYA 1ORFA 4JYTA 3ZVGA 1KXDA 1GBCA 3MH7A 1A1RA 4NSVA 1FMGA 2Y80A 2B0FA 1SFQB 2HGTH 2AERH 3IWMA 2G51A 3OU0A 1MH0A 1QQUA 9LPRA 1C5YB 3OX7U 1YP9A 3A86A 4FUDA 4YOGA 3PV4A 3QX5H 1OYTH 5IYTA 1HBTH 1C2FA 1GJAB 4KKDA 2XBVA 3H7TA 1O3BA 4WMEA 1WSSH 3RXIA 5PTPA 5F03A 5EG4A 1TX6A 2PTNA 1ZPZA 1WU1A 4DG4A 1DLEA 2EEKA 1EQ9A 2ASUB 4ZUHA 2FI4E 1BRBE 2ZU5A 3VB6A 1W14U 1CU1A 1MKWK 1AB9C 1TNJA 1UCYK 1TE0A 3PMBB 4WWYA 4XOJA 1GMHG 1NFYA 3KIDU 3IITA 3UOPA 1S0QA 5JBBS 3MU8A 1C5LH 3SO3A 4I8LA 2XC0A 3I77A 4ZHAA 3M5OA 3K2UA 1W7XH 3S7HB 1DICA 2HNTE 5EQRA 1B5GH 1FLEE 1SGEE 3AAVA 4ABAA 1BTUA 1AI8H 1GI4A 2FXRA 1EZXC 1GMCF 2ZHDA 1C1SA 1TNIA 3RMOH 5DJ7A 3U69H 1BHXB 2ZDVH 5F8ZA 2H5CA 3ZZ7A 4X2XA 5AF9H 3UR6A 2HVXA 1KSNA 1T7CA 5G4BA 1V2TT 2OQUA 4X1QU 2Y5HA 2VNTA 4YT7H 3ENSB 5T6GA 1FPCH 2G52A 1BTYA 1SHHB 1GVZA 5FPSA 3VGCC 3TLOA 1PFXC 2FYRA 2VGCC 2Q6DA 2OLGA 2BVRH 1K1OA 3SORA 4F49A 1V2KT 4I8HA 2DE8A 2A5KA 2VH0A 4WY3A 5IDKA 2A45B 4WVPE 4Y7AA 5ESTE 4GHQA 1NRPH 1MU8B 1O37A 9ESTA 3MNXA 4SGAE 1Z8RA 1SGYE 2UUJB 1G37A 4F4OC 1TB6H 1J8AA 1O3HA 1QRXA 4X2YA 1EX3A 4DIIH 3ELAH 2FDAA 1IQEA
chains in the Genus database with same CATH superfamily
3U8TH 4ZXXH 1QBVH 2K0QA 1LVYA 1O3DA 2CK3D 4K69A 3ZZ3A 3D49H 1EZUC 4ABDA 3URCA 2CXVA 3P8FA 4RKOB 1W3CA 1SKYE 2J9NA 3CENA 3MH4A 3SJIA 1DSUA 4NZLA 4NIYA 3NK8A 3QGNB 2H2ZA 3MH6A 3T27A 2ZHFH 1EZQA 1LVBA 3RXSA 1GJDB 2EC9H 1UTQA 3MH5A 3FANA 5BRRE 5EXLA 1C1QA 1GG6B 3U28C 1E37B 1GBAA 4I86A 2JKHA 3DUXH 1P05A 2FLRH 1BMNH 1AD8H 4JZFH 4K60A 4WXVA 2XC4A 4GLYA 2C90B 4ASUD 1O3NA 1SLWB 5IK2D 1L1NA 1V2RT 3LGWA 2ZDKA 4NFFA 1GJBB 4A7IB 1BUIA 4KP0A 1QJ6B 1QRWA 1TGTA 3MNCA 4K5ZA 1LHEH 3DFLA 6GCHF 1HFDA 4NG9H 1FY4A 1KYNA 1AUJA 2BDBA 3MU1A 1YPJH 1GCDA 5J4SA 2BLOA 1O2WA 1TQ7B 2CHAC 3FKSD 3RXDA 1C4Y2 5C94A 1CO7E 5HIYA 1AKSB 1MBMA 3SU6A 4FUCA 1O3JA 2BDHA 1ARCA 1OSSA 4MVNA 4K8BA 2PKSB 2Y82A 1IQNA 3ZYDA 1F5RA 2FOMB 2PGQB 3SBKA 1QB6A 5CE1A 1JMOH 2C93B 4AFZA 1AU8A 3KQ5A 1YY3A 4D8NA 1SVPA 4CHAB 5FBIA 5BPEA 5DP6A 4UFEH 2P8OB 1P3CA 1GBBA 2XWAA 4K1SA 4O9VA 3TH2H 2FP7B 4A92A 1VJ9U 1O2NA 1YPGH 2TIOA 1KY9A 1Q2WA 2ZHQH 1TA2A 3SU1A 1INCA 2BY9X 2H9EH 2BQ6B 1GJ7B 3K65B 1PJPA 3A84A 3M3VA 1PQ7A 2NWNA 2PTCE 1YPHE 2BXTH 3BG4B 1JRSA 1TX8A 1UTKA 4Z6AH 3ZZDA 5KGOA 2Z3EA 3HGPA 3HKIB 4X8UH 5JBAS 4TSFD 1GVKB 4IMZA 1DY9A 2J2UA 1AIXH 3QN7A 3UOUA 1NM6A 1PPHE 2P3UB 1LPZB 4TWYA 1GBJA 4XRNA 4F48B 3GDUA 1SBWA 1C5UA 4CHAC 2H6MA 3EYDA 5C1YA 4ISLA 3A7YA 2HLDD 1O2LA 1FY8E 3NKKA 1FAXA 2P8OC 3UUZA 2A7CA 1XVMA 1Z71A 3MTYA 1SQTA 1HAVB 3UNSA 1ZYOA 3ZV9A 1JXPA 2J38A 1OWDA 2WV9A 1GHAF 1F7ZA 3LGUA 3PWBA 2FESH 2GX4A 3F9EA 1S6LA 3MWIU 1MU6B 2VBCA 2VIOA 3N99A 2F83A 3QGJA 1THSH 3M5NA 2A5AA 3N7EA 1HJAC 4GHTA 1LHFH 4Y76A 4IBLH 4IW4E 1ETRH 1GCTB 3E8LA 5A0CA 1AMHA 2ZU1A 3P8OA 4HG6A 3QDZB 1J17T 1QY6A 1BHXF 5TCAA 3UR9A 3FO8D 1PPZA 1HUTH 1DVAH 1SFIA 3V7TA 3H7OA 3GCHB 3RXCA 5DP4A 3H09A 8KME2 1GWAA 3PLPA 3VFEA 2HPQH 2V6NA 2G81E 2ZHEH 2ZFRH 4YO9A 1ELCA 1BTHH 4FVDA 1GDQA 1TNHA 2BD5A 1SPJA 1ZTKA 4JYUH 2Y5GA 1EPTB 1CA0B 1SC8U 3D62A 1H9IE 3T28A 4PROA 3C1KA 3EA9A 1ELDE 2AGIX 5ETXA 1TPPA 2W3IA 2UWLA 1BBRH 1MTUA 3UPEA 1GBMA 3E1XB 1HAHH 1DXWA 5T6FA 1C1PA 4K1TA 3KYFA 3O8RA 4CBOA 4RN6A 5FL7D 1NU7B 1ZLRA 1NROH 1ELGA 2VINA 2YMSB 2FX6A 2XXLA 3SU4A 5K0HA 1FZZA 1NPMA 1YPKH 1O2UA 4YLQH 2O8MA 3RMNH 3K9XB 3GCNA 1K21H 3RXPA 1YGCH 4D76A 1D6RA 1C5NH 4A1TA 1M9UA 3DT0H 3EA7A 2HRVA 1SGNE 1O2TA 1AHTH 1FDPA 1NBMD 4FXGH 1FV9A 1O3LA 2O8UA 2A7JA 2ZU2A 5CHAB 2W26A 3B23B 3RXHA 1H1BA 1CA0C 3EQ0H 3OAAD 5L2ZH 2BD8A 3F6UH 3AAUA 4X1NU 2LNCA 4LXBH 2FM2A 1Z8GA 1WCZA 4TPIZ 2BVSH 3STJA 1C2JA 2A2QH 4XBCA 1TGSZ 1N8OC 1GI3A 3F0PA 3S9AA 3BF6H 1TFXA 1GL1A 1LVOA 1P04A 3A80A 2VIQA 1L4DA 4HGCA 3RU4T 1O5FH 1S84A 2IJOB 5C17A 1A5GH 3FOAA 4MPUA 2OQ5A 2PKAB 4NIVA 3EAJA 5E2OA 4RT0A 1P12E 1ZMLA 4GAWA 3SI4H 4GCHG 4ZKSU 7ESTE 4Y8XA 2GMTB 5A8YA 3DSPA 3QK1A 2Z9KA 1O3EA 1ZGVA 3MO6A 1O39A 1V2LT 5DSFA 4ABBA 1H8DH 1O5BB 2BY6X 2ZU4A 1LPGB 1HYLA 2YNBA 1E79D 1FQ3A 4MG3A 4ISIH 3FN8A 2ZDMA 3P6ZB 4X1SU 1TA6A 3L33A 2VU8E 1ZSJA 3Q77A 1D6WA 3RLWH 4NZQA 4LOYH 1SGFG 2OUAA 4OS5A 2J95A 5E2PA 5F6MA 3RLYH 1MZDA 1Y3YA 4D9QA 2FI5E 3SQEE 2BQWB 4WMDA 3V3MA 5C5NA 1ZHPA 3MHWU 3PLBA 4X2WA 1RRKA 1OXGA 4U32A 2R3UA 2VWOA 3TNTA 4OS4A 1NU9A 1K1NA 1TRYA 3GY7A 2LPRA 5I25A 5LPRA 1TQ0B 2K8IA 2PHBA 1NN6A 1C9PA 1SGPE 1GI1A 4ABHA 4KELA 2QA9E 2ZFPH 3TU7H 2WPJS 1G32B 1KXBA 1XM1A 1UTNA 2A4GA 2O8WA 1XKBC 1Y3UA 1V2WT 4Y8YA 5E0JA 1O3GA 1OKXA 2KCAA 1YBWA 3UNQA 2XCFA 4ACBA 1O3FA 3TVJB 4B1TA 2ZQ2A 1FAKH 4ESTE 3U1JB 4Q7XA 4OS7A 1ZPBA 2L6OA 1DS2E 3SUFA 2EQNA 3BTHE 2R3YA 4MNVA 3DD2H 1MBQA 1TGNA 1WV7H 3TGJE 3QWCH 1W10U 3VG8A 1AGJA 3F0OA 5SGAE 3CP7A 3ZVCA 3A7VA 1D3QB 1C2DA 2ZTZA 2QAAA 3TJOA 1K28D 3S69A 4YTAA 1WYKA 2F9OA 3O8CA 2BYAX 2G8TA 1O5EH 2GZ7A 1NFWA 2ZTYA 5GCHF 2QN5T 2KCPA 4NCYA 3SUGA 2Q1JA 1IQKA 1OP8A 1IQFA 4H6SB 1W0JD 3QZRA 5C5OA 1GI6A 2H5DA 1GGDB 1Z1IA 2F43B 4KTUA 1NESE 1C5MD 4ISNA 6LPRA 2VJ1A 3F1SB 5GDSH 1BRCE 4ABIA 4ABJA 1BTPA 1WTGH 3ZZ8A 1G2LA 1AUTC 1X7AC 2C4FH 1MD7A 2Y6TA 2ANYA 2AGGX 1GBHA 3KQCA 1Z8JB 1AE5A 1DE7H 1KXEA 3SNCA 4NA7A 2H1UA 1LO6A 2KAIB 1SLVB 1HV7A 4IN1A 2JH5D 2QGRA 4FUBA 3BIVH 1DSTA 3SNDA 4ZROA 3OY5U 2KCOA 4BAKB 5EIYA 1HIAA 2BD7A 1TGBA 1SQRA 1SGFA 1DWBH 2J98B 2CJIA 1OX1A 3FZZA 4MPWA 2XBYA 2QXGA 2XRCA 1BBRK 3LGIA 4D9RA 1O5DH 2ZWLH 3DFJA 3PTNA 2ANMH 3FP7E 3DSOA 3M5MA 3IG6B 4CH2B 1WTHD 3NXPA 2DUCA 1AVWA 1HAOH 2FYQA 4I33A 1C5XB 1Y8TA 2JETB 3BTEE 2OINA 2ZIQH 1G3DA 1Y3XA 1GHYH 4WH6A 1UVPA 2ZCLP 5A09A 1LQEA 2VVUA 1V3XA 2FS8A 2SGAA 4YZUA 5JB8S 1ELFA 1O2XA 2F9BH 2BQ7B 3FP6E 3S7KB 2G5NA 1H4WA 1QQ4A 4DCDA 2ZDLA 3ATKA 1VITF 1B7XB 3CNRA 1HXFH 2QCYA 1SG8B 2QF0A 1L0ZA 1O2VA 1EJAA 3BTFE 3P70B 1GL0E 5CDFE 2R0LA 1OOKB 2EI6A 3ZYEA 2HNTF 1C5QA 1EXFA 2ANWA 3N7OA 2FPZA 3MU5A 4JCNA 3BTDE 2ZC9H 1YCPH 1FNIA 2SGEE 1ZJKA 1EFRD 1NS3A 3M35A 4D7GA 2GKVE 1HPGA 2V3MA 1TIOA 3OEED 2BY8X 3M61U 1NRQH 4DT7B 1EAWA 3LPRA 1GPZA 3Q76A 1XKAC 2W7SA 3STIA 4JMYA 1VGCC 1A61H 3GCTF 5DP8A 1UVTH 2Z9LA 1W7GH 2H9TH 1O38A 4Y11E 2BVXH 1GDNA 4B71A 1K1IA 2XW9A 3P8GA 5A0BA 1HAIH 2F9UA 1AVXA 2CN0H 1CSOE 7GCHF 4MPVA 4AORA 1AO5A 2C8ZB 2D26C 8LPRA 4X0WU 2GCTB 3OYPA 1BIOA 2ODYB 1ZHMA 1ZOMA 2VVVA 2O8TA 2BLVA 2CF9H 5DP9A 1FUJA 1RTFB 1OWEA 1P2IA 1G3EA 4I8JA 1P01A 3TITA 1A5HA 1RTLA 1J14A 4ZKOU 1TALA 1HXEH 1COWD 4AOQA 4YOIA 1MD8A 2HOBA 2GZ9A 5C1XA 2ZGHA 1ESBA 1BTWA 1ETSH 3F68H 4TPYA 5FX5A 4ZHMU 2BD2A 2IOTA 2GP9B 5HGGA 2V7QD 2ZDAH 2EI8A 4ZAEA 1K22H 1NFXA 2QC2A 3V13A 2B9LA 2TGPZ 1C5RA 2YNAA 1HGTH 4DW2U 1V2MT 1PPEE 1V2NT 3GOVB 3LJJA 1QB9A 1TRMA 2WPDD 2BD3A 3GCOA 8ESTE 2V3HH 2CGAA 4DIHH 5HKKD 2F4LA 6ESTA 3PO1B 3A89A 3BEUA 3PMJA 4H4FA 1EP5A 3WWFA 2STBE 1LTOA 1MAXA 3RM2H 4Q7ZA 3RUOA 2ALPA 3TGKE 1LVMA 1G30B 2OTVA 3HATH 1EB1H 1FN8A 1YLDA 2SGPE 3TNSA 3OEHD 2W6ID 1BRAA 5JBCS 3KQDA 2QXHA 1GI9B 4UD9H 3AVZA 1DUAA 1UCYE 1RIWB 1G3BA 1RS0A 1CGIE 1O2GH 4GVUA 2BXUH 2Z94A 2UWOA 2TBSA 1FPHH 1GBFA 2F9NA 3BTGE 4DVAU 1HAGE 5I46H 2BDAA 5JPMH 4BAQB 2ZP0H 4FUGA 1MUEB 3F2GA 1ARBA 3SV7A 3W94A 3RP2A 2GVFA 1OP0A 2Y7XA 3MNSA 3ZZCA 4B6FA 1D3PB 1C2GA 2A1DB 4CRAA 4ISOA 5HXFA 3PLKA 2Z9IA 3E6PH 8GCHF 1YPMH 3D23A 3SNAA 3H5CB 2ZO3H 4B73A 4GCHF 4DJZB 2SNWA 1HRTH 4CRFA 2KM0A 5FPTA 3D65E 5DG6A 1RJXB 2A4OA 1DXPA 2BX4A 1BT7A 1NO9H 2FO9A 1MQ5A 4X2VA 1T4UH 5T1VA 2VVCA 2BX3A 3V12A 1IAUA 1TPSA 1O3KA 1LMWB 1D4PB 1J16A 3A7TA 1GG6C 1ZRBA 2THFB 3RXFA 3ZVDA 3NUMA 1O2SA 1THRH 3MO3A 1HAZB 3L3TA 1P09A 1FONA 2SGQE 3SUEA 4K3JA 5GPIB 3LKWA 1O34A 1MTWA 2VIWA 2Y7ZA 1B0FA 1K9OE 3Q3XA 1L1GA 2FOBA 1UO6A 6CHAB 3LDXH 3UTUH 1EP6A 1O3IA 2BZAA 5DO4H 2VIDA 5FBEA 3RU4E 4DURA 1RGQA 1QIXB 1ZTLA 3A85A 2XNIA 1SI5H 2W5EA 1HNEE 1S83A 1F0TA 2PKSC 1Y3WA 2V35A 3PMHB 1GBTA 2XBWA 1E38B 4NGAH 1GVLA 2KX4A 3UIRA 1CHGA 3LU9B 4CR5A 4ASHA 1EUFA 1IOEA 1JBUH 1NRSH 5FCKA 1C5OH 1BA8B 3ZVBA 2V0BA 5DP5A 2QF5A 3M3TA 2RFKC 3T25A 4UDWH 4XD7D 1C1MA 1Z1JA 2XYAA 1A0JA 1EJMA 2OBQA 2ZGJA 1CHOG 2RCEA 2HPPH 1LQDB 3QZQA 2IJD1 4IC6A 1QR3E 1S85A 4FUHA 4Y0YE 2BMGB 3OE7D 1C5VA 1A0LA 3NZIA 2BTCE 1SGRE 3BTTE 1GBKA 3O8BA 4MNWA 1K2I1 1ZRKA 3E0PB 1HAVA 3BG4C 3RXLA 5FCRA 1O3AA 1GHBF 1XVOA 1YCPK 1GHZA 3VEQB 1GBDA 1HJ9A 3ZVAA 3RC5A 3SJKA 1WOFA 2BHGA 2A4QA 2P95A 1TYNA 1WBGB 2R2WU 2WYGA 4VGCB 1TBZH 3M7UA 2GJGA 3BV9B 3LGVA 3VB3A 3F3BA 2IPHA 3AW0A 1Z6JH 1K1LA 1TWXB 1QL8A 1OWKA 1YKTA 1GJ6A 1O35A 1EATA 4JZIA 2SGDE 3S0NA 1EOLA 1TONA 1V2VT 2WPIS 1K0HA 3TJVA 3NCLA 1FJSA 4R8TB 1T4VH 1P2NA 3DHKH 2ZI2H 4KTSA 4A1XA 3O8DA 3EE7A 5JBTA 1ZR0A 1JRTA 3K6ZA 3RC6A 4XDEA 5LGOA 1OWHA 1GBLA 1GMCG 3A83A 5LPFA 1E35B 1BOQA 1O2MA 2JIZD 1BZXE 1HCGA 5AFYH 1XX9A 1VITH 3M36A 1TMUH 2ESTE 1FX0B 1OWIA 2YOLA 4AYVB 5H4IB 1C1UH 2NU0E 2PUXB 3GY6A 1ELVA 2KCYA 5HIZA 1RFNA 1BMLA 2BDIA 1UMAH 3RXTA 1ELEE 1P02A 4CBNA 1YCPM 1GCTC 1SQAA 4UEHH 2A32A 2ZFSA 4VGCC 1LHDH 1T8LA 4FUEA 3LOXA 4ISHH 2M5TA 2B7DH 1ANCA 2FWWA 4HI3A 1AWHB 3E0NB 2FOCA 2V3OH 2Z9GA 1GI8B 1FY3A 2TGDA 3GCHC 3M7TA 2ZFFH 1SGCA 2L74A 4XBDA 3BN9A 3ODFA 3ZZ5A 2FS9A 1TBQH 1HB0B 3LT3A 2RA0A 5F53A 1A2CH 2ZCHP 1O2YA 1TBRH 1ZJDA 3RXJA 2PR3A 5L30H 1P2OA 2H9HA 2VWMA 3T5FH 4WJG2 3U8RH 3DCLA 1MKXH 3FP8E 3BTME 3SHCH 2Z3CA 1W11U 2Z6BD 3MU0A 2ZCKP 1EPTC 2BB4A 3SU0A 1DWCH 1MTNB 4MQAA 1P06A 3BEFB 3HKJB 1DUEA 1EB2A 1HJ8A 4P02A 5KEDA 2UWPA 2ZPRA 4BTIB 4Z0KA 4UFDH 2YMSD 3KL6A 4DGJA 4NSYA 4DY7B 3RXKA 1PPFE 3U1IB 4O03A 4YT6H 2ZA5A 3TH3H 2BDYA 1DWEH 4NIWA 4B6EA 3TK6A 2YMSC 1TOCB 2IN2A 3KN2A 3SI3H 1QL9A 4YESB 4LK4A 1SL3A 5E0HA 4Y7BA 1C1NA 5TJXA 1V2UT 3JZ1B 1ETTH 1KLIH 1OS8A 3LONA 3S9BA 3R0FA 2PLXA 4SGBE 2BLWA 2OK5A 1QBNA 2I6SA 2ALVA 1IHSH 2J97A 4QT8C 4CREA 4AB9A 5C0UA 1GMHF 5CHAC 2AYWA 3ZZ6A 1SSXA 6GCHG 4TY7A 3UNRA 4B2AA 3DA9B 1GI2A 2FOFA 3GDVA 1S0RA 1W0ZU 5CHBA 1ELAA 2ZG0H 3EE0B 1GHXH 4I7YH 1P9SA 1SGIB 1PQ8A 3UQVA 2PWXA 2JJ2D 3ZV8A 3SN8A 1TABE 3FVFB 3KGPA 4TYDA 2AIQA 2AMDA 4M9FA 4AFUA 1C5SA 2HNTC 4AG2A 3PRDA 1CE5A 1V2QT 3SGAE 1TLDA 4TWWA 1QA7A 1Y5AT 4DOQA 4H42U 3SGQE 2STAE 3TH4H 2GMTC 3SU3A 2WHXA 1S6HA 3DSGA 2OBOA 5AVDA 3PMAB 2J92A 3MU4A 3F9FA 2WZQA 1SR5C 1FIWA 1VZQH 2AMQA 1SGTA 2JJ1D 1V2OT 1AFQB 1W12U 2TPIZ 1ZSLA 3ATMA 1XUJA 1BMMH 3M5LA 1KDQA 5EGMA 1KLJH 4XFQA 3RMLH 3ZVEA 1TPOA 3ZZ4A 1GBEA 1NZQH 4H6TA 1UTJA 1FXYA 1VJAU 1D3TB 2F9VA 3W95A 1C1OA 2ZDNA 2QXIA 3RXEA 1T8OA 2P3FH 3MYWA 3SNBA 1CBWB 1ANEA 5AFZH 1ZPCA 3BEIB 4A5TS 1UVSH 3RXUA 3MO9A 3RMMH 1RXPA 3TIUA 4GUXA 3BTQE 3SV6A 1Y3VA 1GHAG 3OTJE 3WW7A 1NY22 1Y5UT 2HLCA 5HYOA 4Y8ZA 2OXSA 1O2IA 1QTFA 4BANB 3VB4A 2F9PA 4IS5A 1YWUA 4A6LA 1O3MA 5FXLA 1O3OA 2D2DA 1TMBH 5T3HA 1JOUB 2ZHWH 2ANKH 1S81A 1LKAA 3MFJA 4AYYB 1ZHRA 4JK5A 1ESAA 1NTPA 1P2KA 2AS9A 5C3NA 1LKBA 3GY3A 1ESTA 2WINI 1QJ7B 2RDEA 3EGKH 3HGNA 1C2EA 1CQQA 3SGBE 1L1JA 2UUFB 1DFPA 3OY6U 1J15A 3TJUA 2PP6A 4J1YA 1O2JA 3L6PA 4ABGA 1IQMA 2VWLA 7KMEH 3SZEA 4CRCA 4JZDH 4CH8B 1TOMH 2ODQA 4OS6A 4RKJB 2XNDD 1QNJA 1GJ8B 4ABFA 1QURH 3TK5A 4FUJA 3UB0A 1T8MA 1HIAB 2SGFE 2GT7A 2Y81A 3C27B 3SQHE 2WPHS 1GGDC 1QRZA 3SYJA 1C2KA 1WDIA 2FZZA 4XSKU 4UE7H 1C5PA 4YOJA 2OCVB 3RXQA 5CMXH 3HK6B 2GD4B 1KTSB 1P8VC 2FODA 3PTBA 1DLKB 4IC5A 3UREA 2ZZUH 1MQ6A 1UHBA 2VH6A 1DDJA 3ATIA 4Y79A 2GZ8A 1AB9B 1O5CB 5EOKA 1AN1E 3SHAH 1NBME 2XTTB 4BAOB 1WQSA 3P8NA 1MTSA 1YPHC 2C8WB 1ACBE 1JIMA 4U01A 1MKXK 3ZVFA 4MNYA 1A4WH 3T29A 4YXWD 4ZHLU 1UTPA 3CS7A 2ZEBA 1TNGA 5HMAA 2GCHG 1IQHA 1DM4B 1O32A 3LH3A 2WPMS 3SJ9A 4BOHA 1O2ZA 3I29A 2GV7A 4OS1A 2C3SA 2R9PA 3VXFH 2O8LA 1CHOF 1DY8A 2C8XB 2PSYA 1IQJA 2C8YB 4ZKNU 2LELA 2J34A 3P17H 2BY5X 2QE7D 1DWDH 1P11E 1SLUB 4U30A 2NU3E 3A81A 3E91A 1GI7B 2OP9A 2LP6A 3GY5A 3KCGH 1FI8A 2JETC 1ID5H 3ZIAD 4P00A 1E0FD 3TGIE 5K7RA 3BTWE 4X8VH 1QGFA 1PPGE 2QIQA 2RA3A 1F0SA 4J2YB 2ZNKH 4X6PA 5LPEA 3VGCB 1P03A 1TPAE 3GISB 1XXDA 1A3BH 4BNRA 4E06H 3ATWA 1HAPH 2VGCB 2BLQA 3B8JA 1Y59T 2CV3A 1O2QA 2XWBI 1C1RA 3PV5A 1SB1H 1P9UA 2Y5FA 2PFEA 4I32A 4LZ4B 1BJUA 3RXGA 2DE9A 2SNVA 4NWKA 1Z7KA 1C1WH 2BDCA 5FHTA 1SGQE 2WUCA 4FU7A 1ABIH 2PGBB 3E90B 1EAXA 3UY9A 1IQIA 5JYIA 1BBRE 3T26A 2R0KA 3FFGA 2FEQH 1PQ5A 1KXCA 2P94A 3LC3A 1UW7A 1GJ5H 2G4UA 3VPKA 1KMHB 3SUDA 1TNKA 1D9IA 1P57B 3BSQA 3ATLA 2PW8H 1C1VH 2QF4A 3M3SA 4NWLA 4CRDA 1T32A 1BQYA 3ESTA 2Q6FA 2XBXA 1ZMJA 1O5AB 2UUKB 2QV1A 3ZZAA 1LPKB 1W2KH 1N6YA 1V2PT 1QB1A 4Y71A 2AHME 1GHWH 4RSPA 3RXBA 4B2CA 2GCTC 4UFGH 3SV2H 2BOKA 2A5IA 4B2BA 2J94A 1GMDG 2OC1A 2WV5A 1Q3XA 1UK3A 1F0UA 2UUYA 1TNLA 4AC9A 2ILNA 5GWZA 4FUFA 1V6DA 2ZPSA 1YC0A 4O3TA 2BD9A 4BTTB 1C5WB 2G00A 4ZKRU 1TMTH 5EXMA 5HM2A 1K1MA 1EOJA 1AY6H 4HZHA 4AFSA 4TT3D 3GYLB 1G3CA 4KGAA 1AE8H 1A46H 1JWTA 2ZFTA 2CHAB 2B8OH 1OP2A 1CA8B 3QTOH 3ODDA 1C2IA 2TGTA 2WPKS 1BTXA 1ZGIA 2QYIA 1TAWA 1G36A 1CT0E 1LHCH 1K1PA 3KHVA 3T2NA 2W3KA 3PO1C 5GIBA 3PROA 1HAXB 1Y5BT 4INHA 4Y6DA 4ZMAH 1FY1A 2Z7FE 4Q7YA 5GCHG 5DP3A 2J5UA 1RTKA 4K2YA 4HTCH 1ZTJA 1YYY1 1G2MA 2F3CE 1U6QA 1YM0A 1BITA 1KXFA 1C2LA 2A31A 1T31A 1KIGH 3A82A 4K1EA 2AH4X 4X8SH 1C2HA 1XUKA 4THNH 3M7QA 3A8DA 1RIWC 1AKSA 1WXRA 1F5KU 1LDTT 2EY4C 3RC4A 1AQ7A 1OYQA 3R3GB 4ZH8A 1FIZA 4FU9A 4MPXA 1O36A 2P16A 3SW2B 3BG8A 1BTZA 5EXNA 5FAHA 2A0QB 2NU4E 3PB1E 2SFAA 3SJOA 2W7UA 1DX5M 1QBOA 4AFQA 1P0SH 2JDID 2JH6D 1TX7A 1UTLM 5J4QA 3RXVA 1ANBA 4ZCNA 1O0DH 4UONA 4ZXYH 1Z6EA 5EQQA 2TGAA 2BDGA 4BXSA 1O3CA 3F2FA 2KFWA 1BCUH 3ZZBA 4UFFH 3ITIA 1V2ST 1MAYA 1SGDE 4CRGA 3TPIZ 4BAHB 5EJLA 5E8EH 1C9TA 4MLFB 4FU8A 3UQOA 4XE4A 3QLPH 2ZF0H 3MI4A 4Y10E 1C4U2 1O2HA 5EJZA 2FTMA 4IGDA 1JIRA 3QUMP 1L2EA 1QA0A 2CF8H 1XUGA 1HDTH 2NU2E 4Z1MD 1S6FA 3HK3B 2QXJA 4U2WA 2WSSD 5EQSA 4X1RU 1HJAB 4Y0ZE 3F9HA 2AFQB 2VIVA 1BMAA 4E05H 3A87A 3SZNA 3SV8A 4AGJA 4OGXA 1EZSC 2G55A 3EA8A 4Q4LA 1VITG 5HM9A 2XCNA 4MTBA 3AK5A 5JB9S 1UTOA 5GXPA 2VIPA 3FZDA 4IN2A 1A3EH 1ZMNA 3LGYA 4HFPB 4I8KA 3P92A 4AZ2B 2AIPA 3GICB 1PYTD 3A88A 5E0GA 6CHAC 4AGKA 1EAUA 1N1LA 5ABWA 1O30A 4MDSA 3I78A 3PYHA 5GJ4B 4M7GA 1MABB 3G01A 3TK9A 3OTPA 4X6MA 1IQLA 2ZFQH 1PPBH 1W13U 2PV9B 1PYTC 4Q80A 3E16B 3RXAA 3KNXA 2A4RA 2O9QA 1YF4A 3SV9A 2P59A 3GCTG 2ZGXH 4OS2A 5EODA 4YM9A 5C0TA 4NA9H 1O2KA 1KTTB 1E1RD 3KEEA 5DK1A 1IQGA 1A5IA 4FOUC 1ANDA 1DITH 7GCHG 2WV4A 4JYVH 2GDEH 3WWBA 1UJ1A 3M37A 1A7SA 4OM9A 1P3EA 1AZZA 3SU5A 2HWLB 1L4ZA 1H8IH 3Q00A 5C1UA 3NWUA 2Z3DA 1EPTA 2EI7A 4GSOA 1D3DB 1O2PA 1P2MA 1GHVH 1SOTA 1TRNA 3URDA 5EW1H 1CGJE 2I6QA 1SQOA 4R0IA 4X6OA 1C5TA 5A2MH 2FI3E 2P93A 2WPLS 3PM3A 1ELTA 4O97A 1AZ8A 5FX6A 1N8OB 3A8CA 1SOZA 2BD4A 5L6NH 1W8BH 1F2SE 3SJ8A 3W1EA 1K1JA 4X1PU 5AHGH 3LC5A 1LHGH 3U9AH 3SOSA 1VCPA 2ZU3A 3SNEA 3VB7A 3MOCA 1QZ8A 1XMNB 1QFKH 5A8XA 3LJOA 4I8GA 1FY5A 5TCCA 4X6NA 4B76A 1FN6A 4ABEA 2FLBH 1GI0A 2D1JA 3KF2A 5DP7A 4E7RG 1B0EA 1OPHB 4KTCA 4NA8A 4X8TH 1UK4A 1Q31A 2A7HA 3KQBA 5T6DA 3WY8A 1GBIA 5F8XA 4CRBA 1J9CH 2FOEA 2XC5A 1BB0B 2GCHF 1N6XA 1A0HB 2BY7X 3RDZA 1TGCA 1VCWA 2JH0D 3AW1A 3QTVH 5A0AE 3CS0A 5JDUB 1CGHA 1MKWH 1QHRB 3MNBA 1YPEH 1NRNH 1UCYH 4LZ1H 2NU1E 2G5VA 1VCQA 2ULLA 3PV2A 2PKAA 1OWJA 1S82A 2VB0A 3GY2A 4NFEA 2OC8A 3FAOA 4B75A 1P2JA 1MTNC 4I31A 1W0YH 3Q3KA 4XBBA 1G9IE 1KLTA 3GDSA 1ZZZA 8GCHG 1O3PB 2FX4A 3GYMA 2K1QA 2RG3A 1BRUP 1E34B 1O2RA 1XUIA 4BAMB 1WQVH 4Q63A 1MTVA 4D7FA 3LGTA 5ESBA 2CMYA 2R2MB 4GPGA 1XUFA 4INKA 1DT2A 3RM0H 2EA3A 2A2XH 1SHYA 2XOKD 1ZSKA 3HPTB 4RT1A 4FUIA 1GI5A 3NPSA 1EKBB 4RI0A 1GJ4H 1NC6A 2GT8A 1UVOA 2BM2A 2VWNA 3SU2A 2OD3B 5DPAA 3GS9A 3A7WA 2ZQ1A 4OGYA 1AVGH 2QY0B 5EPYA 1VR1H 2AMPA 3GY8A 3P95A 2AGEX 3KYGA 2FOHA 1LCYA 4CR9A 1CT2E 2ZKSA 2PUQH 1MCTA 1O31A 1HLTH 5FPYA 1F92A 1C2MA 1UVUH 1DANH 1O33A 3UWJH 3QO6A 2FTLE 1VKYA 2B5TB 5DGJA 1V2JT 3S9CA 1QL7A 1KDQB 1EJNA 4B74A 2FOGA 1GMDF 5EPNA 2ZTXA 2PSXA 1EASA 3VB5A 5DN6D 4A1VA 1H9LB 4ACAA 2GTBA 1OHHD 3MMGA 2HALA 3U8OH 3K6YA 3VXEH 1Z8IB 2ODPA 1S5SA 3KQEA 1HAYB 3A8AA 4BXWA 1GJCB 3RXOA 4FETA 1MZAA 3ZZ9A 1AWFH 2TRMA 5EU8A 7LPRA 2ZGCA 3LH1A 3UWIA 3RXRA 2AEIH 2ZECA 4NIXA 4FVBA 5LH8A 1C5ZB 1NT1A 2OC0A 1RD3B 3B9FH 2Q6GA 1GHBG 5B6OA 4AB8A 1DPOA 3UFAA 2G4TA 1AFQC 1H8HD 1CVWH 4WMFA 5C20A 2BZ6H 2P3TB 3TJNA 1CT4E 2FIRH 5F8TA 5GNDA 2GDDA 2M2AA 1H8ED 3T62A 4AN7A 1P10A 1C1TA 2KZ4A 3F9GA 4WH8A 3U98H 1H9HE 1WAYB 4AG1A 1CBWC 1T8NA 1IHTH 4IMQA 1MCVA 2FMJA 4AX9H 1KXAA 3AASA 4TY6A 1W0KD 3LIWA 5DKMA 1O5GH 3PRBA 2WUBA 1GDUA 5C67A 2GGVB 1NRRH 1UK2A 2FOAA 1P2QA 1YPLH 3BTKE 5A8ZA 4O3UA 1THPB 2OC7A 2GV6A 5C2ZA 3EDXB 3BIUH 1SMFE 1EAIA 2WYJA 1F0RA 4K8YA 1C4V2 4E7NA 5L2YH 2ZPQA 2KAIA 1PPCE 1O2OA 2Z9JA 3GY4A 4YLUA 1XXFA 1QCPA 2IPQX 1UTMA 4MNXA 5B6LA 4JZEH 1F5LA 4Q2KA 4WXIA 1GJ9B 4WF8A 2ZGBH 4INLA 1ELBA 1PQAA 2BOHB 1AFEH 1QJ1B 1E36B 2D8WA 1BDAA 2J98A 3JZ2B 5EW2H 3Q3YA 3RXMA 4JZ1A 4JK6A 1ABJH 3A8BA 2F91A 3A7ZA 2RDLA 3A7XA 2J4IA 1YLCA 3PWCA 1MMJN 3RU4D 2QF3A 1BJVA 1SLXB 1UHBB 4BTUB 1WUNH 3V0XA 1XUHA 5KECA 3E3TA 3MQKC 1NFUA 1VGCB 1DOJA 3OSYA 1ORFA 4JYTA 2KR7A 3ZVGA 1KXDA 1GBCA 3MH7A 1A1RA 4NSVA 1FMGA 2Y80A 2B0FA 1SFQB 2HGTH 2AERH 1YLNA 3IWMA 2G51A 3OU0A 1MH0A 2W6JD 1QQUA 9LPRA 1C5YB 3OX7U 1YP9A 3A86A 4FUDA 4YOGA 3PV4A 3QX5H 1OYTH 5IYTA 1HBTH 1C2FA 1GJAB 4KKDA 2HVYB 2XBVA 3H7TA 3NRLA 1O3BA 3OFND 4WMEA 1WSSH 3RXIA 5PTPA 5F03A 5EG4A 1TX6A 2PTNA 1ZPZA 1WU1A 4DG4A 1DLEA 2EEKA 1EQ9A 2ASUB 4ZUHA 2FI4E 1BRBE 2ZU5A 3VB6A 1W14U 1CU1A 1MKWK 1AB9C 1TNJA 1UCYK 1TE0A 3PMBB 4WWYA 4XOJA 1GMHG 1NFYA 3KIDU 3IITA 3UOPA 1S0QA 5JBBS 3MU8A 1C5LH 3SO3A 4I8LA 2XC0A 3I77A 4ZHAA 3M5OA 3K2UA 1W7XH 3UAIC 3S7HB 3N7DA 1DICA 2HNTE 5EQRA 1B5GH 1FLEE 1SGEE 3AAVA 4ABAA 1BTUA 1AI8H 1GI4A 2FXRA 1EZXC 1GMCF 5EJ1A 2ZHDA 1C1SA 1TNIA 3RMOH 5DJ7A 3U69H 1BHXB 2ZDVH 5F8ZA 2H5CA 3ZZ7A 4X2XA 5AF9H 3UR6A 2HVXA 1KSNA 1T7CA 5G4BA 1V2TT 2OQUA 4X1QU 2Y5HA 2VNTA 4YT7H 3ENSB 1BMFD 5T6GA 1FPCH 2G52A 1BTYA 1SHHB 1GVZA 5FPSA 3VGCC 3TLOA 1PFXC 2FYRA 2VGCC 2Q6DA 4DT4A 2OLGA 2BVRH 3F2HA 1K1OA 3SORA 4F49A 1V2KT 4I8HA 2DE8A 2A5KA 2VH0A 4WY3A 5IDKA 2A45B 4WVPE 4Y7AA 5ESTE 4GHQA 4F55A 1NRPH 1MU8B 1O37A 9ESTA 3MNXA 4SGAE 1Z8RA 1SGYE 2UUJB 1E1QD 1G37A 4F4OC 1TB6H 1J8AA 1O3HA 1QRXA 4X2YA 1EX3A 4DIIH 3ELAH 2FDAA 1IQEA
chains in the Genus database with same CATH topology
3U8TH 4ZXXH 1QBVH 1LVYA 1O3DA 4K69A 3ZZ3A 3D49H 1EZUC 4ABDA 3URCA 2CXVA 3P8FA 4RKOB 1W3CA 2J9NA 3CENA 3MH4A 3SJIA 1DSUA 4NZLA 4NIYA 3NK8A 3QGNB 2H2ZA 3MH6A 3T27A 2ZHFH 1EZQA 1LVBA 3RXSA 1GJDB 2EC9H 1UTQA 3MH5A 3FANA 5BRRE 5EXLA 1C1QA 1GG6B 1E37B 1GBAA 2JKHA 3DUXH 1P05A 2FLRH 1BMNH 1AD8H 4JZFH 4K60A 4WXVA 2XC4A 4GLYA 2C90B 1O3NA 1SLWB 1L1NA 1V2RT 3LGWA 2ZDKA 4NFFA 1GJBB 4A7IB 1BUIA 4KP0A 1QJ6B 1QRWA 1TGTA 3MNCA 4K5ZA 1LHEH 3DFLA 6GCHF 1HFDA 4NG9H 1FY4A 1KYNA 1AUJA 2BDBA 3MU1A 1YPJH 1GCDA 5J4SA 2BLOA 1O2WA 1TQ7B 2CHAC 3RXDA 1C4Y2 1CO7E 1AKSB 1MBMA 3SU6A 4FUCA 1O3JA 2BDHA 1ARCA 1OSSA 4MVNA 4K8BA 2PKSB 2Y82A 1IQNA 3ZYDA 1F5RA 2FOMB 2PGQB 3SBKA 1QB6A 5CE1A 1JMOH 2C93B 4AFZA 1AU8A 4D8NA 1SVPA 4CHAB 5FBIA 5BPEA 5DP6A 4UFEH 2P8OB 1P3CA 1GBBA 2XWAA 4K1SA 4O9VA 3TH2H 2FP7B 4A92A 1VJ9U 1O2NA 1YPGH 2TIOA 1KY9A 1Q2WA 2ZHQH 1TA2A 3SU1A 1INCA 2BY9X 2H9EH 2BQ6B 1GJ7B 3K65B 1PJPA 3A84A 3M3VA 1PQ7A 2NWNA 2PTCE 1YPHE 2BXTH 3BG4B 1JRSA 1TX8A 1UTKA 4Z6AH 3ZZDA 5JBAS 2Z3EA 3HGPA 3HKIB 4X8UH 1GVKB 4IMZA 1DY9A 2J2UA 1AIXH 3QN7A 3UOUA 1NM6A 1PPHE 2P3UB 1LPZB 4TWYA 1GBJA 3GDUA 1SBWA 1C5UA 4CHAC 2H6MA 3EYDA 5C1YA 4ISLA 3A7YA 1O2LA 1FY8E 3NKKA 1FAXA 2P8OC 3UUZA 2A7CA 1XVMA 1Z71A 3MTYA 1SQTA 1HAVB 3UNSA 1ZYOA 3ZV9A 1JXPA 2J38A 1OWDA 1GHAF 1F7ZA 3LGUA 3PWBA 2FESH 2GX4A 3F9EA 3MWIU 1MU6B 2VIOA 2F83A 3QGJA 1THSH 3M5NA 2A5AA 1HJAC 4GHTA 1LHFH 4Y76A 4IBLH 4IW4E 1ETRH 1GCTB 3E8LA 5A0CA 1AMHA 2ZU1A 3P8OA 3QDZB 1J17T 1QY6A 1BHXF 5TCAA 3UR9A 1PPZA 1HUTH 1DVAH 1SFIA 3V7TA 3H7OA 3GCHB 3RXCA 5DP4A 8KME2 1GWAA 3PLPA 3VFEA 2HPQH 2V6NA 2G81E 2ZHEH 2ZFRH 4YO9A 1ELCA 1BTHH 4FVDA 1GDQA 1TNHA 2BD5A 1SPJA 1ZTKA 4JYUH 2Y5GA 1EPTB 1CA0B 1SC8U 3D62A 1H9IE 3T28A 4PROA 3C1KA 3EA9A 1ELDE 2AGIX 5ETXA 1TPPA 2W3IA 2UWLA 1BBRH 1MTUA 3UPEA 1GBMA 3E1XB 1HAHH 1DXWA 5T6FA 1C1PA 4K1TA 3O8RA 4CBOA 4RN6A 1NU7B 1ZLRA 1NROH 1ELGA 2VINA 2FX6A 2XXLA 3SU4A 5K0HA 1FZZA 1NPMA 1YPKH 1O2UA 4YLQH 2O8MA 3RMNH 3K9XB 3GCNA 1K21H 3RXPA 1YGCH 4D76A 1D6RA 1C5NH 4A1TA 1M9UA 3DT0H 3EA7A 2HRVA 1SGNE 1O2TA 1AHTH 1FDPA 4FXGH 1FV9A 1O3LA 2O8UA 2A7JA 2ZU2A 5CHAB 2W26A 3B23B 3RXHA 1H1BA 1CA0C 3EQ0H 5L2ZH 2BD8A 3F6UH 3AAUA 4X1NU 2LNCA 4LXBH 2FM2A 1Z8GA 1WCZA 4TPIZ 2BVSH 3STJA 1C2JA 2A2QH 4XBCA 1TGSZ 1N8OC 1GI3A 3S9AA 3BF6H 1TFXA 1GL1A 1LVOA 1P04A 3A80A 2VIQA 1L4DA 4HGCA 3RU4T 1O5FH 1S84A 2IJOB 1A5GH 4MPUA 2OQ5A 2PKAB 4NIVA 3EAJA 5E2OA 1P12E 1ZMLA 4GAWA 3SI4H 4GCHG 4ZKSU 7ESTE 4Y8XA 2GMTB 5A8YA 3QK1A 2Z9KA 1O3EA 1ZGVA 3MO6A 1O39A 1V2LT 4ABBA 1H8DH 1O5BB 2BY6X 2ZU4A 1LPGB 1HYLA 2YNBA 1FQ3A 4MG3A 4ISIH 2ZDMA 3P6ZB 4X1SU 1TA6A 3L33A 2VU8E 1ZSJA 3Q77A 1D6WA 3RLWH 4NZQA 4LOYH 1SGFG 2OUAA 4OS5A 2J95A 5E2PA 5F6MA 3RLYH 1MZDA 1Y3YA 4D9QA 2FI5E 3SQEE 2BQWB 4WMDA 3V3MA 5C5NA 1ZHPA 3MHWU 3PLBA 4X2WA 1RRKA 1OXGA 4U32A 2R3UA 2VWOA 3TNTA 4OS4A 1NU9A 1K1NA 1TRYA 3GY7A 2LPRA 5I25A 5LPRA 1TQ0B 2PHBA 1NN6A 1C9PA 1SGPE 1GI1A 4ABHA 4KELA 2QA9E 2ZFPH 3TU7H 2WPJS 1G32B 1KXBA 1XM1A 1UTNA 2A4GA 2O8WA 1XKBC 1Y3UA 1V2WT 4Y8YA 5E0JA 1O3GA 1OKXA 1YBWA 3UNQA 2XCFA 1O3FA 3TVJB 4B1TA 2ZQ2A 1FAKH 4ESTE 3U1JB 4Q7XA 4OS7A 1ZPBA 1DS2E 3SUFA 3BTHE 2R3YA 4MNVA 3DD2H 1MBQA 1TGNA 1WV7H 3TGJE 3QWCH 1W10U 1AGJA 5SGAE 3CP7A 3ZVCA 3A7VA 1D3QB 1C2DA 2ZTZA 2QAAA 3TJOA 1K28D 3S69A 4YTAA 1WYKA 2F9OA 3O8CA 2BYAX 2G8TA 1O5EH 2GZ7A 1NFWA 2ZTYA 5GCHF 2QN5T 4NCYA 3SUGA 2Q1JA 1IQKA 1OP8A 1IQFA 4H6SB 3QZRA 5C5OA 1GI6A 2H5DA 1GGDB 1Z1IA 4KTUA 1NESE 1C5MD 4ISNA 6LPRA 2VJ1A 3F1SB 5GDSH 1BRCE 4ABIA 4ABJA 1BTPA 1WTGH 3ZZ8A 1G2LA 1AUTC 1X7AC 2C4FH 1MD7A 2Y6TA 2ANYA 2AGGX 1GBHA 3KQCA 1Z8JB 1AE5A 1DE7H 1KXEA 3SNCA 4NA7A 2H1UA 1LO6A 2KAIB 1SLVB 1HV7A 4IN1A 2JH5D 2QGRA 4FUBA 3BIVH 1DSTA 3SNDA 4ZROA 3OY5U 4BAKB 1HIAA 2BD7A 1TGBA 1SGFA 1DWBH 2CJIA 1OX1A 3FZZA 4MPWA 2XBYA 2QXGA 2XRCA 1BBRK 3LGIA 4D9RA 1O5DH 2ZWLH 3DFJA 3PTNA 2ANMH 3FP7E 4CH2B 3M5MA 3IG6B 1WTHD 3NXPA 2DUCA 1AVWA 1HAOH 2FYQA 4I33A 1C5XB 1Y8TA 2JETB 3BTEE 2OINA 2ZIQH 1G3DA 1Y3XA 1GHYH 4WH6A 1UVPA 2ZCLP 5A09A 1LQEA 2VVUA 1V3XA 2FS8A 2SGAA 4YZUA 5JB8S 1ELFA 1O2XA 2F9BH 2BQ7B 3FP6E 3S7KB 2G5NA 1H4WA 1QQ4A 4DCDA 2ZDLA 3ATKA 1VITF 1B7XB 1HXFH 2QCYA 1SG8B 2QF0A 1L0ZA 1O2VA 1EJAA 3BTFE 3P70B 1GL0E 2R0LA 1OOKB 2EI6A 3ZYEA 2HNTF 1C5QA 1EXFA 2ANWA 3N7OA 2FPZA 3MU5A 4JCNA 3BTDE 2ZC9H 1YCPH 1FNIA 2SGEE 1ZJKA 1NS3A 3M35A 4D7GA 2GKVE 1HPGA 1TIOA 2BY8X 3M61U 1NRQH 4DT7B 1EAWA 3LPRA 1GPZA 3Q76A 1XKAC 2W7SA 3STIA 4JMYA 1VGCC 1A61H 3GCTF 5DP8A 1UVTH 2Z9LA 1W7GH 2H9TH 1O38A 4Y11E 2BVXH 1GDNA 4B71A 1K1IA 2XW9A 3P8GA 5A0BA 1HAIH 2F9UA 1AVXA 2CN0H 1CSOE 7GCHF 4MPVA 4AORA 1AO5A 2C8ZB 2D26C 8LPRA 4X0WU 2GCTB 3OYPA 1BIOA 2ODYB 1ZHMA 1ZOMA 2VVVA 2O8TA 2BLVA 2CF9H 5DP9A 1FUJA 1RTFB 1OWEA 1P2IA 1G3EA 4I8JA 1P01A 3TITA 1A5HA 1RTLA 1J14A 4ZKOU 1TALA 1HXEH 4AOQA 4YOIA 1MD8A 2HOBA 2GZ9A 5C1XA 2ZGHA 1ESBA 1BTWA 1ETSH 3F68H 4TPYA 5FX5A 4ZHMU 2BD2A 2IOTA 2GP9B 5HGGA 2ZDAH 2EI8A 4ZAEA 1K22H 1NFXA 2QC2A 3V13A 2B9LA 2TGPZ 1C5RA 2YNAA 1HGTH 4DW2U 1V2MT 1PPEE 1V2NT 3GOVB 3LJJA 1QB9A 1TRMA 3GCOA 2BD3A 8ESTE 2V3HH 2CGAA 4DIHH 6ESTA 3PO1B 3A89A 3BEUA 3PMJA 4H4FA 1EP5A 2STBE 1LTOA 1MAXA 3RM2H 4Q7ZA 3RUOA 2ALPA 3TGKE 1LVMA 1G30B 2OTVA 3HATH 1EB1H 1FN8A 1YLDA 2SGPE 3TNSA 1BRAA 5JBCS 3KQDA 2QXHA 1GI9B 4UD9H 3AVZA 1DUAA 1UCYE 1RIWB 1G3BA 1RS0A 1CGIE 1O2GH 4GVUA 2BXUH 2Z94A 2UWOA 2TBSA 1FPHH 1GBFA 2F9NA 3BTGE 4DVAU 1HAGE 5I46H 2BDAA 5JPMH 4BAQB 2ZP0H 4FUGA 1MUEB 1ARBA 3SV7A 3W94A 3RP2A 2GVFA 1OP0A 2Y7XA 3MNSA 3ZZCA 1D3PB 1C2GA 2A1DB 4CRAA 4ISOA 5HXFA 3PLKA 2Z9IA 3E6PH 8GCHF 1YPMH 3D23A 3SNAA 3H5CB 2ZO3H 4B73A 4GCHF 4DJZB 2SNWA 1HRTH 4CRFA 5FPTA 3D65E 5DG6A 1RJXB 2A4OA 1DXPA 2BX4A 1BT7A 1NO9H 2FO9A 1MQ5A 4X2VA 1T4UH 2VVCA 2BX3A 3V12A 1IAUA 1TPSA 1O3KA 1LMWB 1D4PB 1J16A 3A7TA 1GG6C 1ZRBA 2THFB 3RXFA 3ZVDA 3NUMA 1O2SA 1THRH 3MO3A 1HAZB 3L3TA 1P09A 1FONA 2SGQE 3SUEA 4K3JA 5GPIB 3LKWA 1O34A 1MTWA 2VIWA 2Y7ZA 1B0FA 1K9OE 3Q3XA 1L1GA 2FOBA 1UO6A 6CHAB 3LDXH 3UTUH 1EP6A 1O3IA 2BZAA 5DO4H 2VIDA 5FBEA 3RU4E 4DURA 1RGQA 1QIXB 1ZTLA 3A85A 2XNIA 1SI5H 2W5EA 1HNEE 1S83A 1F0TA 2PKSC 1Y3WA 2V35A 3PMHB 1GBTA 2XBWA 1E38B 4NGAH 1GVLA 3UIRA 1CHGA 3LU9B 4CR5A 4ASHA 1EUFA 1IOEA 1JBUH 1NRSH 5FCKA 1C5OH 1BA8B 3ZVBA 2V0BA 5DP5A 3M3TA 3T25A 4UDWH 1C1MA 1Z1JA 2XYAA 1A0JA 1EJMA 2OBQA 2ZGJA 1CHOG 2RCEA 2HPPH 1LQDB 3QZQA 4IC6A 1QR3E 1S85A 4FUHA 4Y0YE 2BMGB 1C5VA 1A0LA 3NZIA 2BTCE 1SGRE 3BTTE 1GBKA 3O8BA 4MNWA 1K2I1 1ZRKA 3E0PB 1HAVA 3BG4C 3RXLA 5FCRA 1O3AA 1GHBF 1XVOA 1YCPK 1GHZA 3VEQB 1GBDA 1HJ9A 3ZVAA 3RC5A 3SJKA 1WOFA 2BHGA 2A4QA 2P95A 1TYNA 1WBGB 2R2WU 2WYGA 4VGCB 1TBZH 3M7UA 3BV9B 3LGVA 3VB3A 2IPHA 3AW0A 1Z6JH 1K1LA 1TWXB 1QL8A 1OWKA 1YKTA 1GJ6A 1O35A 1EATA 4JZIA 2SGDE 3S0NA 1EOLA 1TONA 1V2VT 2WPIS 3TJVA 3NCLA 1FJSA 4R8TB 1T4VH 1P2NA 3DHKH 2ZI2H 4KTSA 4A1XA 3O8DA 5JBTA 1ZR0A 1JRTA 3K6ZA 3RC6A 4XDEA 5LGOA 1OWHA 1GBLA 1GMCG 3A83A 5LPFA 1E35B 1BOQA 1O2MA 1BZXE 1HCGA 5AFYH 1XX9A 1VITH 3M36A 1TMUH 2ESTE 2YOLA 1OWIA 4AYVB 5H4IB 1C1UH 2NU0E 2PUXB 3GY6A 1ELVA 1RFNA 1BMLA 2BDIA 1UMAH 3RXTA 1ELEE 1P02A 4CBNA 1YCPM 1GCTC 1SQAA 4UEHH 2A32A 2ZFSA 4VGCC 1LHDH 1T8LA 4FUEA 3LOXA 4ISHH 2M5TA 2B7DH 1ANCA 2FWWA 4HI3A 1AWHB 3E0NB 2FOCA 2V3OH 2Z9GA 1GI8B 1FY3A 2TGDA 3GCHC 3M7TA 2ZFFH 1SGCA 4XBDA 3BN9A 3ODFA 3ZZ5A 2FS9A 1TBQH 1HB0B 3LT3A 2RA0A 1A2CH 2ZCHP 1O2YA 1TBRH 1ZJDA 3RXJA 2PR3A 5L30H 1P2OA 2H9HA 2VWMA 3T5FH 4WJG2 3U8RH 1MKXH 3FP8E 3BTME 3SHCH 2Z3CA 1W11U 2Z6BD 3MU0A 2ZCKP 1EPTC 2BB4A 3SU0A 1DWCH 1MTNB 4MQAA 1P06A 3BEFB 3HKJB 1DUEA 1EB2A 1HJ8A 2UWPA 2ZPRA 4BTIB 4Z0KA 4UFDH 3KL6A 4DGJA 4NSYA 4DY7B 3RXKA 1PPFE 3U1IB 4O03A 4YT6H 2ZA5A 3TH3H 2BDYA 1DWEH 4NIWA 3TK6A 1TOCB 2IN2A 3KN2A 3SI3H 1QL9A 4YESB 4LK4A 1SL3A 5E0HA 4Y7BA 1C1NA 5TJXA 1V2UT 3JZ1B 1ETTH 1KLIH 1OS8A 3LONA 3S9BA 3R0FA 2PLXA 4SGBE 2BLWA 1QBNA 2I6SA 2ALVA 1IHSH 4QT8C 4CREA 4AB9A 1GMHF 5CHAC 2AYWA 3ZZ6A 1SSXA 6GCHG 4TY7A 3UNRA 4B2AA 3DA9B 1GI2A 2FOFA 3GDVA 1S0RA 1W0ZU 1ELAA 2ZG0H 3EE0B 1GHX<