2BLVA

Trypsin before a high dose x-ray "burn"
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Improving Radiation-Damage Substructures for Rip.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2blvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2blvA02
1YCPK 7GCHG 2H2ZA 1SGPE 2BQ7B 3PLBA 3MU1A 4ZHMU 1Z1JA 3KEEA 1VCPA 1YCPH 3LKWA 3KL6A 2AGEX 3P95A 4HI3A 2FODA 4JZEH 5EXLA 1SMFE 3U8TH 2D26C 1HV7A 5K0HA 1C5MD 1TGTA 2A2XH 1K22H 4SGAE 1C1OA 4O03A 2RCEA 2ZDMA 1O2NA 1GI3A 4YESB 2ZHFH 2RDLA 2O8UA 3N7OA 2W7UA 4R8TB 1LQEA 1VJ9U 4RSPA 3FANA 1F0UA 3A7ZA 1QTFA 3PV4A 3S7KB 3IG6B 1HFDA 1SGQE 2P8OC 3SNEA 2AGGX 2WPLS 3M7TA 3SNAA 2J92A 1SBWA 2QCYA 3KF2A 2WYJA 1PFXC 4FUGA 2HVXA 1JRSA 1RS0A 1ARBA 2ZG0H 3A7XA 4NIYA 1C2KA 1MZAA 1MBMA 1WTGH 2VU8E 3LDXH 1AB9C 2OUAA 4XDEA 3TH4H 1O3AA 3O8CA 4WMDA 3UNSA 1FPHH 1K1OA 1PQ5A 5C1UA 2BB4A 2BD7A 5CHAC 1BB0B 1QY6A 2QXIA 1P09A 2F83A 1IQGA 3RC5A 2ZCHP 2ULLA 2AH4X 2XXLA 4X2VA 1DXPA 4Y6DA 2ZFFH 1SGEE 1FPCH 1B0FA 1XUKA 4ABEA 1BMLA 4TPIZ 1O39A 3RU4E 3LGUA 4ZHLU 1YGCH 4XOJA 1C2GA 3T27A 4JK5A 1K9OE 1VGCB 5C1XA 1SI5H 2BHGA 1OKXA 4Q7ZA 3Q3XA 2BVSH 1O32A 2BM2A 1BITA 3E8LA 1ZGVA 1ZMNA 2LPRA 1FXYA 1GBDA 3SJOA 1F5LA 1AKSA 2ZU1A 4AX9H 1TMUH 2C8ZB 1AVWA 1H9IE 1FIWA 1JBUH 1W12U 1BMNH 4GAWA 2GGVB 4IBLH 4TWYA 1C5VA 2R3YA 1QA0A 2BY7X 5K7RA 1T31A 4JYTA 2FWWA 1J14A 1TNLA 3MO3A 1SHHB 2VVVA 3RC4A 1AVXA 1O31A 5GJ4B 3E16B 2VNTA 1Y5AT 1OP8A 2OC0A 1O3IA 3SGAE 1O3CA 5SGAE 1C1TA 3FZZA 4BAHB 1O3HA 4RN6A 4BXSA 2TIOA 1AFEH 2FS8A 4XBCA 3PWBA 2YOLA 4Z6AH 1J17T 4HZHA 3HPTB 1G3EA 2P8OB 2C90B 3NXPA 4AOQA 3EDXB 1SG8B 1QQUA 1O35A 3T5FH 1W7GH 4IN2A 4X6NA 1P10A 1FN8A 3UQOA 3OY6U 1D3TB 1YM0A 1Y3XA 3RMMH 3SV6A 1S85A 1TMTH 1AB9B 4JZDH 1O34A 5GCHF 3HGNA 1KTSB 1RJXB 5CHAB 1MTNC 1QA7A 1FAKH 3STJA 3M3TA 1C1WH 3M5NA 4WH8A 1K21H 3M3VA 1N6XA 3F6UH 3MNXA 3RC6A 2PKSB 4IGDA 5ESBA 3A89A 1OWJA 1XUJA 1IHSH 2BLOA 4UD9H 1QBOA 2VWNA 3TLOA 4IMZA 5C2ZA 3UPEA 3ZVFA 5GIBA 2BDIA 2BLWA 2HNTE 1F5KU 2H9HA 1V6DA 2FYQA 1NROH 2UWPA 1P3CA 2EEKA 1G36A 1BTZA 3KGPA 2IOTA 4UEHH 1F92A 1A5HA 1BRUP 1Z6JH 3RP2A 4BTTB 2A1DB 4CREA 4H6SB 1O33A 1WAYB 4UFEH 3BV9B 4GHTA 1ESAA 1BBRK 3LH1A 3M5OA 1FAXA 1O3OA 3O8BA 1F2SE 2ZCKP 1MCTA 2STAE 3EAJA 2ZGHA 3WY8A 4M7GA 1LVMA 1V2LT 4NA7A 4GCHF 2GP9B 1YCPM 2FOFA 4Q2KA 1C5LH 2ZDVH 3HGPA 4FUDA 4I8HA 2ZU2A 4BTIB 5JBAS 1HUTH 3MU5A 3RXOA 1ESBA 4NA8A 3NCLA 3UNRA 1KXCA 2CF8H 1HAHH 3AW1A 4DIIH 1F0SA 1HAXB 1O5GH 3GY4A 1V2UT 2OBOA 1UTKA 1Z8JB 1MD8A 2XBVA 3PTBA 4QT8C 2F91A 1AD8H 2GZ7A 2Y7ZA 1TGSZ 2GZ8A 1NRPH 4Y8YA 5LPRA 1QL8A 3DHKH 1ABJH 4XSKU 2BX4A 3SHAH 1C1MA 1GBLA 2PKAA 3ZZAA 2BDAA 1SLWB 1GI1A 3ZZDA 1XVMA 3A88A 1WCZA 1MTNB 4MPWA 2A4GA 1DWBH 2FOGA 3EGKH 3TPIZ 5F03A 1NY22 1ELEE 1EJMA 3Q77A 2VIDA 2HWLB 1UTQA 2UUKB 1EPTC 3BTHE 1A0HB 2O8WA 2G51A 1GCDA 3NPSA 1P05A 1QRWA 4I31A 3UR6A 4ABGA 3MOCA 1OYQA 2ZC9H 3Q3KA 4OGXA 3RU4T 1MTUA 3GY2A 4DG4A 3RM2H 2HNTF 1C2JA 4BOHA 1AQ7A 1C2EA 3E91A 3T29A 2ZFQH 5DO4H 4BANB 3SV7A 1SGFG 1AWFH 1TRYA 3L3TA 1K1MA 1ZTKA 3T26A 3A8AA 3QO6A 1O37A 3E0PB 3GDUA 3RXVA 2VGCB 1T4UH 1SVPA 1QGFA 1HAYB 2SNVA 4XBBA 1G3DA 4GSOA 1GL0E 4FU7A 2BOKA 2ZHEH 3T28A 5DP9A 2AS9A 4GCHG 2Y5GA 3LC5A 2QYIA 3MHWU 4MNWA 1LVYA 1K1PA 2Y5FA 4AGJA 4D9RA 2F9UA 1C5YB 1JWTA 1GDQA 3AVZA 4FUIA 4IC6A 1GG6C 4X1SU 4X1PU 5GPIB 1SGRE 4K2YA 1UTLM 4K3JA 3LGVA 1UO6A 2W7SA 2GZ9A 2PUXB 2WPMS 1HIAB 2BX3A 1O30A 1GVLA 2BD2A 2FIRH 1C2MA 4MPXA 4DW2U 5FX5A 4CH2B 4H4FA 1C2LA 3PMBB 3S9AA 2ANYA 1TX6A 1WQSA 1G37A 4NGAH 3UNQA 1KXEA 4Y76A 1YLCA 2VVCA 5G4BA 1MU8B 1IQLA 1HJAB 3P8NA 3PB1E 4FVDA 3U9AH 1O2IA 1P2IA 7LPRA 5FCKA 4CRCA 1EAXA 1IQEA 1YPJH 1Q31A 3K65B 1ELAA 2OP9A 4MQAA 3BF6H 1TYNA 3EA7A 1P04A 1JIMA 1EPTB 1ETTH 4LXBH 4YT6H 2GT8A 3BTQE 2XYAA 3SBKA 1TALA 1BTUA 4E06H 1F5RA 2SFAA 2UWOA 4YM9A 3PWCA 2PTNA 1OP0A 1C5SA 4AB9A 3M5LA 2FI5E 1HDTH 3NK8A 1ZTJA 3NZIA 1W10U 1O2XA 1N8OC 1RFNA 4Q7XA 4ISIH 1L1JA 4DY7B 4NA9H 1GI9B 1C1PA 5H4IB 4X6PA 2ZECA 1ARCA 1DVAH 4AFZA 1O2TA 1S6HA 1QRZA 2BDGA 1HPGA 2B0FA 2XRCA 2HPPH 1O2QA 2OINA 3R3GB 3BEUA 1KLIH 9ESTA 1U6QA 1ANDA 1C5QA 2BQ6B 1SGCA 4I8KA 4ZH8A 1KLTA 3VB7A 2BDCA 3C1KA 3SW2B 1FDPA 2ZGBH 4CR5A 3I77A 3P6ZB 1SR5C 2ZGJA 1C4U2 3P8OA 2GCTC 1YPMH 1NFXA 3STIA 5T6DA 3OU0A 4ZAEA 1GHAF 2P59A 4JZFH 1GJDB 2BOHB 4AZ2B 1GG6B 2FMJA 4X6OA 2HPQH 1GHYH 5B6OA 5JB8S 2HALA 4O97A 4OS2A 3V12A 4BAMB 2GDDA 3LGIA 3TK5A 1EXFA 2ZHDA 1HGTH 5BRRE 1BHXB 1BMAA 1ELFA 1SGFA 1CO7E 1EAWA 2OLGA 4A6LA 3K6YA 1GDNA 2NU2E 1CA0C 5EPYA 3SHCH 1WQVH 1MKWK 1BJVA 4ABFA 3PYHA 2QXGA 1FLEE 2WPKS 3LGYA 2BZ6H 3ZVCA 3TNSA 1FY4A 6GCHF 5DJ7A 4CBOA 2Q6FA 1N6YA 4NZLA 2BY8X 2UUYA 1UVOA 2Q1JA 4INHA 9LPRA 1S82A 1MKWH 1YLDA 3QTOH 4MPUA 2FOAA 1LHDH 1T32A 3F9GA 3E90B 2WV5A 3RMLH 1H8DH 1NN6A 1QFKH 3ENSB 5F6MA 1AY6H 1MBQA 1JMOH 1Q2WA 2B9LA 1ZYOA 3V7TA 4X1QU 5EQSA 1QQ4A 3ZVDA 4XE4A 4X1RU 1IQIA 5FX6A 3M35A 2ZTXA 3U8RH 1CA8B 1DITH 1NM6A 1VZQH 1N8OB 1ZGIA 2G55A 4OGYA 2Q6DA 2VIVA 4WVPE 3H7OA 2Z3EA 1D4PB 1UHBA 3LU9B 1O2ZA 2ZDNA 2VWMA 1FI8A 1RRKA 1SOTA 2XWBI 1Y3VA 5A0BA 1UVPA 2F9BH 3SOSA 3GY7A 2P3FH 1SL3A 1Z1IA 1G3CA 3LC3A 1TNJA 1GBBA 1E38B 4LOYH 2AMPA 1V2PT 2ZU4A 3GCNA 3ZZ9A 4D8NA 1EZQA 4B75A 3K6ZA 2ZDLA 1TAWA 1IHTH 2WPJS 1TA2A 2JH0D 4IMQA 1J9CH 1Z8GA 4KTSA 1AKSB 1GHAG 2GCTB 1UTNA 3OTJE 1QL9A 5DP8A 3SN8A 1EB1H 3MU8A 3GY5A 3GYLB 1WBGB 4RKJB 3PLPA 3LJOA 4GLYA 1BTPA 5J4SA 4INKA 2A0QB 4NZQA 4CRBA 3ZZ4A 1HAVB 1O2UA 4DOQA 3I78A 5F8TA 1J16A 1CGIE 3UWJH 4TY7A 1O2WA 2NWNA 4WWYA 1NRRH 4UFGH 2H5DA 4BAQB 2OD3B 1C5WB 5E8EH 1DT2A 3KQCA 2OTVA 1CA0B 1M9UA 1PPBH 2PHBA 3BTTE 1CGJE 2Z9IA 5T6FA 4I7YH 1YPGH 2Y82A 1KXBA 3HK6B 4ABHA 4GUXA 6GCHG 1RIWB 2Z3DA 2DUCA 1INCA 1PPGE 1SLXB 3RUOA 1DY8A 3P8FA 2AMQA 5FXLA 1MAXA 2A4RA 3FVFB 4WH6A 3M3SA 1ABIH 4NWLA 3RXUA 1O2GH 1UCYK 2GDEH 3A7VA 1AMHA 2GV7A 1FV9A 1A5GH 1ZHPA 3OYPA 3P92A 3SU1A 4B76A 1GCTC 3QN7A 1YP9A 4Y7AA 1ZLRA 2PTCE 2B8OH 3OX7U 1O3MA 1UCYH 1V2NT 5E0HA 4ESTE 1CHGA 1CQQA 1GJ7B 2ZU5A 3A84A 3BG4C 3MO6A 4IW4E 3PLKA 1ELBA 3U8OH 1FY1A 1LKAA 1V2RT 2PKSC 1ANEA 1S0RA 1VJAU 3F9HA 4KP0A 3DT0H 4MLFB 1CU1A 2ZHQH 1UMAH 4FUFA 4YLUA 4DCDA 2CHAC 1GJCB 3QUMP 2VINA 1ZR0A 1W2KH 4WY3A 1W0YH 4Y79A 3FP7E 3V3MA 1B0EA 3S69A 3KCGH 2JH5D 2G00A 3UWIA 4FXGH 4OS4A 1MCVA 1BTWA 1TPSA 1ELTA 1MTWA 1JOUB 2QXJA 4BXWA 1NO9H 5AVDA 2TGTA 1BRCE 1L4DA 3RXFA 4AGKA 1TNHA 2F9VA 1SB1H 5E2OA 1ELDE 3TITA 3KHVA 3PM3A 1EUFA 4HGCA 2OQ5A 2SGQE 2NU3E 2FOEA 5JYIA 4TY6A 3S9BA 3TU7H 1C2FA 2WUCA 4YZUA 2F9NA 4KGAA 1HYLA 3ZZ8A 2HOBA 2ZIQH 3PMHB 1P2OA 3LGWA 2R0KA 1WU1A 1CT2E 1Z6EA 2WPIS 4HTCH 2SGDE 4A1VA 2QA9E 5ETXA 6ESTA 1GI4A 2ZQ2A 2P3TB 1D9IA 3ZZBA 2AMDA 5DP6A 3E6PH 3SV8A 1C1VH 3SI4H 2CN0H 3V0XA 1BT7A 2C93B 5GXPA 1GCTB 3A7TA 1C1NA 1C9PA 2FTLE 3GY6A 3M61U 2CF9H 2ZA5A 1LQDB 4X0WU 3PO1B 8KME2 1Z8RA 3FZDA 1CVWH 1P9SA 2ZEBA 3SNDA 1SHYA 4DVAU 2G52A 3P17H 1P2KA 1NS3A 3BG4B 3QZQA 3KQEA 1P06A 2QIQA 3ESTA 5EOKA 4FU8A 3HKJB 3NKKA 4CR9A 2ZPQA 4DIHH 3SU0A 2FZZA 2W5EA 1GL1A 2VH0A 2GTBA 3KIDU 1ZPCA 1O3GA 1DANH 2TGAA 1HRTH 1A61H 2CHAB 3BTEE 2WV4A 3F9EA 1QBVH 5I25A 4Q80A 1UTMA 5E0GA 3S0NA 5EGMA 1ZMLA 1EZUC 1IAUA 2W3KA 3E0NB 1OX1A 1P01A 2AYWA 4K5ZA 1MD7A 1GMCG 3I29A 1EB2A 1K28D 3A83A 3BN9A 5PTPA 4MNVA 4ZKRU 3PMJA 3ZVEA 2A7JA 3RXQA 1UTOA 2ANWA 2EI8A 3RXTA 1A4WH 1P2JA 5A8ZA 3ZZCA 1KXAA 1T7CA 3S9CA 3JZ2B 2VGCC 1Y8TA 5C1YA 1MTSA 1D3DB 1WOFA 2PUQH 2A7HA 4FUCA 1TWXB 1BBRH 3QX5H 3QGJA 1XMNB 2ZI2H 4A5TS 1HLTH 1AVGH 1TOCB 3QDZB 1QHRB 3SJ9A 2BY5X 3SV2H 2XCNA 3UREA 5F8XA 2RA3A 1G9IE 1YC0A 1O3KA 2GMTB 4NFFA 1WUNH 1O2JA 5HGGA 1QR3E 1JRTA 4E7RG 4BAKB 5DK1A 1NFYA 3MU0A 1HAOH 5FBIA 3A86A 3CS0A 2Z6BD 1UVUH 4Y71A 1XXFA 1YPHC 2AGIX 1RXPA 3F1SB 1YBWA 1ZSKA 3ATKA 3FP8E 5C5NA 3O8RA 1UTPA 1FMGA 2ANMH 1HJAC 2ZFRH 1S81A 3RXPA 1O2PA 3MI4A 5EW2H 4NCYA 4ZMAH 1OSSA 5FPSA 3ODFA 1NT1A 2VH6A 3RXKA 4MDSA 5EW1H 1DSTA 1YYY1 4H6TA 3ZV9A 3MNSA 1TBRH 1O5CB 1YF4A 1GHZA 1O3FA 3RXRA 3MFJA 2FI4E 1LDTT 4U30A 2FOMB 4AG2A 4NIWA 2WYGA 3RXCA 2FTMA 1DSUA 1TPPA 2FYRA 4MPVA 5T3HA 1B5GH 1AO5A 4Z0KA 3GISB 2I6SA 3DD2H 3BTWE 1RD3B 5JB9S 4JYVH 3QZRA 2PLXA 3PMAB 1PPEE 1W11U 3DUXH 1H1BA 2WPHS 2CMYA 4B1TA 1DLKB 2GV6A 1DICA 1XVOA 4TYDA 1FJSA 2UUFB 1K1NA 1T8LA 1HXEH 2XC5A 2PGBB 4D7FA 1GI6A 1PYTC 1MAYA 3D49H 3GCOA 3H7TA 1C1SA 3B23B 1DUEA 1GBAA 1QBNA 1ZPZA 3SQHE 4J2YB 1BHXF 1FONA 3UIRA 2GT7A 1NRSH 8LPRA 1GHWH 2FI3E 1TPOA 3LONA 4SGBE 3A8BA 4A92A 3DFJA 1ELCA 1GI0A 3BIVH 2QC2A 1V2VT 5L6NH 2Y6TA 1DWEH 3MNCA 3GCHC 3UOPA 5IDKA 1BDAA 3ODDA 3O8DA 1QB1A 2JETB 2ZPRA 3MYWA 5FAHA 2ZU3A 3M7UA 4DGJA 3CS7A 1TNKA 1Y3UA 1DS2E 4CH8B 5HMAA 5DGJA 1H8IH 1YPKH 4YOGA 2CXVA 1WYKA 5TCCA 1KXFA 4BAOB 2EC9H 1A5IA 1D6RA 2KAIB 4BNRA 1LTOA 3JZ1B 3ITIA 3A85A 3SJ8A 2P16A 5DP4A 3ZYEA 3NUMA 4I33A 1AZZA 1MU6B 3FP6E 1LHFH 4B71A 2ZO3H 2A5IA 4OS7A 3MH6A 3SGBE 1ELVA 4UFDH 4ZXXH 4ISLA 2EA3A 4NSYA 2BXUH 1FZZA 4FUJA 2H9EH 1XX9A 1Y59T 4AYYB 4K8YA 1EOLA 2AIQA 5T6GA 4Y11E 4X2YA 3T62A 2F9OA 1ORFA 3BG8A 4TWWA 1TABE 2DE8A 2A5KA 1LHEH 1HAGE 1UCYE 2B5TB 2F9PA 2G4TA 4X8VH 3DA9B 2FLRH 3Q76A 1TBQH 1L4ZA 4X2WA 4WJG2 3RMNH 2TRMA 1THSH 5EQQA 5TCAA 1C5TA 1DDJA 4UE7H 1EATA 1O5EH 8ESTE 2ALPA 2R2MB 1D3PB 7KMEH 1LMWB 2Y7XA 5FPTA 2PSYA 3UOUA 2O8MA 4ABBA 5DP7A 4NIXA 1G3BA 2A7CA 1GHBG 1SGYE 3E3TA 1FY5A 1MZDA 1TGNA 2XC4A 2ZQ1A 5AHGH 1GBMA 3SNBA 1GI5A 1L0ZA 3GY8A 4X8UH 1PPCE 1C2HA 3BEIB 4UFFH 5EXNA 4YOIA 1TQ0B 1AGJA 3ATMA 2STBE 3P70B 3SUDA 1A7SA 2PW8H 3M5MA 1S0QA 1AIXH 4ZKNU 3FFGA 1P8VC 4U2WA 1TRNA 3GCHB 3EA9A 2BY6X 2XC0A 4MNYA 2R3UA 2XW9A 3SI3H 3U1IB 1VITF 4LZ4B 2PV9B 1L1NA 2QXHA 1IOEA 1O2MA 3G01A 5A8YA 2VB0A 1V2TT 4XFQA 2Y80A 5JBTA 2A31A 1PQ7A 1RIWC 1C1QA 3U69H 2A32A 4Y10E 2NU0E 2OBQA 5A0AE 1GJ9B 4KTUA 4JZIA 3A82A 1E37B 1GDUA 1W7XH 3ATIA 1HIAA 3SUEA 5E0JA 1C1UH 3EYDA 3GCTF 4TPYA 1HNEE 1FNIA 2D1JA 4FVBA 1K1IA 4AYVB 1YKTA 3V13A 2BD8A 1T8OA 1MKXK 3AW0A 4DJZB 4IS5A 5AFZH 1LKBA 1GMDG 3W94A 2FM2A 2Z9KA 4ZUHA 1S5SA 2OXSA 5JBCS 5F8ZA 1BOQA 1MKXH 3A7WA 4WMEA 1AI8H 1TGCA 5EXMA 1TE0A 1FY3A 2AERH 3TJUA 1IQKA 2QY0B 2ILNA 4AFUA 1ACBE 4D7GA 4ZROA 1EPTA 2AIPA 1NU7B 1E36B 3SNCA 3VEQB 4K60A 5DKMA 2GKVE 1AE5A 2CJIA 2Z3CA 1XUFA 2FLBH 1JXPA 3BTKE 3SU4A 3ZVBA 4ASHA 4CRAA 4GHQA 1Q3XA 2ZTZA 1SGNE 1ZSJA 4UONA 2IJOB 1A2CH 2BQWB 4KELA 1UK2A 3L33A 3A80A 1QJ1B 1V2JT 1A3EH 1VITH 1NESE 1XUIA 1GBEA 1AFQC 2BZAA 1OXGA 7ESTE 1AZ8A 1AN1E 3HATH 2ZGXH 2SGPE 4E7NA 4ZKOU 3QWCH 1NTPA 3BTDE 3RDZA 1P9UA 1QJ6B 1VITG 3RU4D 3VPKA 1O2YA 1W8BH 1XUHA 3AAVA 3A87A 1FUJA 4KKDA 2O8LA 4INLA 3U1JB 3MU4A 2BXTH 2P94A 4R0IA 1BUIA 5EODA 4FUEA 4B2BA 1EKBB 2VIQA 3GCTG 3Q00A 1BBRE 1T4VH 1K1LA 2YNBA 3SZNA 1AWHB 1W14U 2ZPSA 2QGRA 2W26A 3GDVA 4ISNA 1PQAA 1SOZA 1GVKB 3QTVH 4OS5A 3TJVA 1H9LB 4I8LA 5L2YH 1UVTH 3NWUA 1F0TA 1NU9A 3BTGE 1V2MT 1SLVB 3KNXA 3W95A 4AB8A 3RLYH 3MTYA 3GDSA 3RXEA 2XWAA 2J2UA 1TQ7B 1KLJH 4J1YA 2PSXA 2P93A 2ZTYA 3PO1C 2BDBA 1MUEB 3RXGA 1MH0A 1UVSH 5IYTA 3VB3A 3FAOA 1Z71A 5ESTE 5JBBS 4YLQH 3VGCC 1TGBA 2FO9A 4NFEA 2B7DH 1TBZH 2TPIZ 1LVBA 4A1TA 4F4OC 2QF0A 1EQ9A 3SV9A 5CMXH 1DPOA 3TVJB 2QF3A 6CHAB 2A45B 1S6FA 8GCHF 1LO6A 1O3LA 1CT0E 1EAUA 1UK3A 1CGHA 1SQOA 3F9FA 1GI2A 4K8BA 2TGPZ 3VB6A 2RG3A 3E1XB 2CV3A 2PFEA 4ISHH 1DFPA 3QLPH 1F7ZA 1O5DH 4O3UA 1SQTA 3ZV8A 1GMCF 1AFQB 1GJ6A 3RLWH 1O0DH 4B2AA 1PYTD 2R9PA 1KDQA 3TIUA 3ATWA 1THRH 3RXIA 1HB0B 2OC1A 3TJNA 1GBHA 3TK6A 1TFXA 2BMGB 3T2NA 1QNJA 1DLEA 1J15A 1BRBE 1O2RA 1TPAE 5LPEA 1XKBC 3D62A 1ZRBA 1YPHE 3PTNA 1DOJA 4X2XA 4MVNA 2FDAA 2ZNKH 1O3NA 2J95A 3U98H 1IQHA 1V2KT 2Q6GA 1LVOA 3UY9A 1GBKA 2BD4A 2AFQB 2THFB 4K69A 1O3BA 2GCHF 4U01A 2GMTC 2D2DA 1H4WA 3UUZA 1HAVA 1O2KA 1NRQH 1KYNA 1PPFE 1XXDA 2H6MA 4Y8ZA 2YNAA 1QL7A 1P11E 3A8DA 1EX3A 1C9TA 3LOXA 3TH3H 2BD9A 1O2HA 2O9QA 3RXBA 1O2LA 1O2OA 1ZTLA 2R2WU 1KY9A 1EP5A 3KN2A 3M36A 2PKAB 3GICB 3UQVA 1BZXE 4CHAC 4CRFA 2Z9GA 2ZFTA 1E0FD 1ESTA 4GVUA 4ABDA 1W13U 1GVZA 1L2EA 1A0JA 2VVUA 4FUBA 2BVXH 4JK6A 3SU6A 2QAAA 4UDWH 3VGCB 2BLVA 1O3EA 5E2PA 2R0LA 5LGOA 1AHTH 4FU9A 2FOCA 2I6QA 3F68H 1IQNA 1QRXA 3RXAA 2CGAA 2ODQA 4ZXYH 3SUGA 1WV7H 8GCHG 1LHCH 2DE9A 3CP7A 3ZZ3A 2QN5T 4CRDA 1TX7A 3Q3YA 2ZFSA 2H5CA 1WTHD 3SJKA 1K1JA 5CE1A 1E34B 1DE7H 3A8CA 3LPRA 1NRNH 3TGKE 1C5NH 2BVRH 4OS1A 4BTUB 5I46H 1BQYA 1VCWA 2LNCA 3B8JA 4WMFA 3URDA 1HBTH 3TJOA 2IN2A 1TRMA 3TNTA 3ZZ5A 1BTXA 5ABWA 1QCPA 1GJ8B 2G81E 2OCVB 2C8YB 4YO9A 3MH5A 1AU8A 1OWHA 1V3XA 3SU5A 5A2MH 2IPHA 5GWZA 1GPZA 1HCGA 2FOBA 1KXDA 1P2MA 3TGIE 4Y8XA 1NC6A 3PROA 3S7HB 3VB5A 1HAPH 1DX5M 4I8JA 2VIOA 1D6WA 1GGDC 1UTJA 4I32A 4ISOA 1TLDA 2VIWA 1P3EA 2M5TA 2J9NA 4MTBA 1AE8H 3ZYDA 3SU2A 3P8GA 2ZFPH 3L6PA 3MWIU 2UWLA 1T8NA 5GDSH 1BTHH 3SO3A 2GCHG 2XCFA 3BEFB 4I8GA 2P3UB 3IITA 1BJUA 4X1NU 5EU8A 1A46H 2BLQA 4ABIA 1OWKA 1K2I1 1SGDE 1SFIA 2FESH 1RGQA 1A1RA 1RTFB 3SJIA 1O5AB 2HLCA 2PGQB 2O8TA 2V3HH 1Y5BT 5JDUB 2FOHA 2ZHWH 3ATLA 2ODPA 1LPGB 1WSSH 4GPGA 1G2MA 2JETC 1BCUH 1GHVH 2FP7B 1FY8E 4CHAB 1P2NA 3BTFE 1BIOA 1PQ8A 5C67A 4Y0YE 3OY5U 2A2QH 2G4UA 2PR3A 4D9QA 3QGNB 4IC5A 2FPZA 1D3QB 1Z8IB 4YTAA 4B74A 2V0BA 2HGTH 1QB9A 3T25A 1TB6H 4OS6A 1KIGH 5DPAA 1MQ5A 5FBEA 1EAIA 1P03A 1SGIB 1SSXA 1OS8A 1Z7KA 3RXHA 5GCHG 1LPZB 4Y7BA 2GX4A 5L2ZH 1AUJA 1KTTB 5AFYH 2XNIA 2Y5HA 1PJPA 1GI7B 1C4Y2 3AASA 1O2SA 1C5RA 4NSVA 4NIVA 4WXIA 1C5OH 3EQ0H 4F49A 2Z9JA 2P95A 1B7XB 4H42U 4JYUH 1QB6A 5AF9H 1G30B 2SGAA 3MNBA 5EPNA 2H1UA 3TGJE 2OQUA 3R0FA 1AUTC 3ZZ6A 2BY9X 1TOMH 4D76A 1VR1H 1A0LA 4A7IB 1O38A 1GJ4H 2BD3A 3IWMA 5DP5A 1EASA 1BTYA 5HXFA 4NG9H 1W0ZU 2SGEE 3LIWA 1EP6A 4PROA 4ABJA 2JH6D 1G2LA 1O3JA 2J94A 3MH7A 5FPYA 1GGDB 3ELAH 3GY3A 1GHBF 1HJ8A 1GBTA 2V35A 3MO9A 5C5OA 4K1SA 4CRGA 1GBJA 3LH3A 5JPMH 1BRAA 1ZJDA 5EQRA 1XM1A 2HNTC 3K2UA 2UUJB 1DWDH 3KQDA 2ZF0H 1SFQB 1TIOA 4AFQA 3SORA 1SLUB 1IQFA 1N1LA 3HK3B 3QK1A 2ASUB 2ALVA 1HAZB 5TJXA 1IQMA 2VWOA 4IN1A 1C5UA 4X8SH 2FXRA 2G5NA 1V2ST 2J34A 1SGTA 2PWXA 1S84A 1CBWC 1P2QA 1PPZA 4WF8A 2WUBA 1RTKA 2C8XB 1VCQA 2XTTB 3RMOH 2XBYA 2Z9LA 3H5CB 1O5BB 1O3DA 1OWDA 4O3TA 4CBNA 1SQAA 1ZSLA 3UR9A 3VB4A 1BA8B 2ZGCA 1HAIH 1OWEA 1L1GA 1FQ3A 2Y81A 5L30H 1DUAA 2G8TA 1A3BH 3UTUH 3SUFA 1TNGA 1ETSH 4JZ1A 4Q7YA 4DT7B 4ZKSU 1PPHE 1P57B 1GBFA 2ZP0H 3RXLA 2ODYB 1CHOF 2NU4E 5BPEA 4E05H 1C2IA 1DWCH 1Y3WA 3RXSA 1MTVA 1ANCA 2NU1E 1ZHRA 1TA6A 2A5AA 3LJJA 4O9VA 1E35B 4K1TA 3KQBA 2BDYA 3ZZ7A 1TMBH 3A7YA 1LHGH 3M7QA 4MNXA 1GMDF 3RM0H 3TH2H 2J4IA 1NFUA 3TK9A 1OYTH 2ANKH 1DXWA 5C20A 3D23A 6LPRA 4KTCA 4AG1A 2Z7FE 1OOKB 1UHBB 5A09A 1P02A 1XUGA 1NZQH 4X6MA 1HJ9A 2C8WB 2ZZUH 2V3OH 2ZWLH 5A0CA 1ZZZA 2FS9A 2A4OA 4AORA 3VXFH 1C1RA 3M37A 1EZSC 1GMHF 4THNH 2GD4B 2Z94A 1OWIA 4A1XA 1DM4B 4VGCC 4ZHAA 2VWLA 5EG4A 4B73A 1LCYA 2OC8A 3A81A 4JCNA 4JMYA 2SNWA 1W3CA 2TBSA 3UFAA 2V6NA 3EA8A 4MG3A 2EI7A 2ZDAH 5LPFA 4HFPB 1P12E 1CT4E 1ID5H 2QV1A 1ZOMA 1ELGA 1X7AC 3RXDA 2VJ1A 1GJBB 3D65E 4LK4A 3SU3A 2BD5A 2G5VA 1LPKB 3HKIB 1NFWA 1ZPBA 2EI6A 2HRVA 3C27B 1THPB 1TONA 4NWKA 2BYAX 5DG6A 2ZCLP 1CBWB 1ZRKA 2A4QA 2J38A 7GCHF 1UK4A 1QURH 3GOVB 1CE5A 5LH8A 2H9TH 3VFEA 1C5ZB 2FX4A 1CSOE 1EOJA 1HXFH 2K1QA 3CENA 1OP2A 2XBXA 3B9FH 3ZVGA 3MH4A 5HM9A 1XKAC 1CHOG 2W3IA 1FN6A 1SPJA 2FEQH 2VIPA 1H9HE 1GHXH 1O2VA 4YOJA 5FCRA 1S83A 5HYOA 4WXVA 1C5PA 3MMGA 1QJ7B 1ZMJA 3LT3A 3RXJA 2GVFA 3BIUH 1GJAB 1MQ6A 3AAUA 4AN7A 3OSYA 1GWAA 1OPHB 2C3SA 1MMJN 1NPMA 1C4V2 1O36A 2KAIA 3BSQA 2SGFE 5DP3A 1YPLH 5A8XA 1C5XB 1GI8B 2ZDKA 1ETRH 1TX8A 2C4FH 2D8WA 3GYMA 2WINI 3RXMA 5J4QA 1EJNA 1GBIA 4X8TH 4AFSA 1EJAA 1Y3YA 1YPEH 1O5FH 1T8MA 2JKHA 4LZ1H 2RA0A 1J8AA 1F0RA 4K1EA 4RKOB 3URCA 1V2OT 1TNIA 1GMHG 4Y0ZE 3SQEE 3EE0B 1Y5UT 6CHAC 1V2WT 2ZKSA 4ABAA 2OC7A 1GBCA 1O3PB 5HM2A 4VGCB 1DY9A 2ESTE 1UJ1A 2BDHA 3K9XB 1G32B 1KSNA 4U32A 1P0SH 3DFLA 4XBDA 3VXEH 1EZXC 4DURA 1ZJKA 2FX6A 1V2QT 2XBWA 3ZVAA 4YT7H 5FHTA 2AEIH 1ZHMA 1IQJA 1FIZA 1GJ5H 5C3NA 1C2DA 4B2CA 1SC8U 1KDQB 2BTCE 1QIXB 2TGDA 1VGCC 4FUHA 1JIRA 1ANBA 3BTME 3SGQE 1BMMH 2F3CE 3LGTA 1RTLA
chains in the Genus database with same CATH superfamily
1YCPK 7GCHG 2H2ZA 1SGPE 2BQ7B 3PLBA 3MU1A 4ZHMU 1Z1JA 3KEEA 1VCPA 1YCPH 2EY4C 3LKWA 3KL6A 2AGEX 3P95A 4HI3A 2FODA 4JZEH 2WPDD 5EXLA 1SMFE 3U8TH 2D26C 1HV7A 5K0HA 1C5MD 1TGTA 2A2XH 1K22H 4SGAE 1C1OA 4O03A 2RCEA 2ZDMA 1O2NA 1GI3A 4YESB 2ZHFH 2RDLA 2O8UA 3N7OA 2W7UA 4R8TB 1LQEA 1VJ9U 4RSPA 3FANA 1F0UA 3A7ZA 1QTFA 3PV4A 3S7KB 3IG6B 1HFDA 1SGQE 2P8OC 3SNEA 2AGGX 2WPLS 3M7TA 3SNAA 2J92A 1SBWA 2QCYA 3KF2A 2WYJA 1PFXC 4FUGA 2HVXA 1JRSA 1RS0A 1ARBA 2ZG0H 3A7XA 4NIYA 1C2KA 1MZAA 1MBMA 1WTGH 2VU8E 5DSFA 3DSPA 3LDXH 1AB9C 2KCPA 2OUAA 4XDEA 3TH4H 1O3AA 3O8CA 4WMDA 3UNSA 1FPHH 1K1OA 1PQ5A 5C1UA 2BB4A 2BD7A 5CHAC 1BB0B 1QY6A 2QXIA 1P09A 5KGOA 2F83A 5FL7D 1IQGA 3RC5A 2ZCHP 2ULLA 2AH4X 2XXLA 4X2VA 1DXPA 2WZQA 4Y6DA 2ZFFH 1SGEE 1FPCH 1B0FA 1XUKA 1S6LA 4ABEA 1BMLA 4TPIZ 1O39A 3RU4E 3LGUA 4ZHLU 1YGCH 4XOJA 4B6FA 1C2GA 3T27A 4JK5A 1K9OE 1VGCB 5C1XA 1SI5H 2BHGA 1OKXA 4Q7ZA 3Q3XA 2BVSH 1O32A 2BM2A 1BITA 3E8LA 1ZGVA 3FOAA 1ZMNA 2LPRA 1FXYA 1GBDA 3SJOA 1F5LA 1AKSA 2ZU1A 4AX9H 1TMUH 2C8ZB 1AVWA 1H9IE 1FIWA 1JBUH 1W12U 1BMNH 4GAWA 2GGVB 4IBLH 4TWYA 1C5VA 2R3YA 1QA0A 2BY7X 5K7RA 1T31A 4JYTA 2FWWA 1J14A 1TNLA 3MO3A 1SHHB 2VVVA 3RC4A 1AVXA 1O31A 5GJ4B 3E16B 2VNTA 1Y5AT 1OP8A 2OC0A 5KEDA 1O3IA 4HG6A 3SGAE 1O3CA 5SGAE 1C1TA 3FZZA 4BAHB 1O3HA 4RN6A 4BXSA 2TIOA 1AFEH 2WSSD 3F3BA 2FS8A 4XBCA 3PWBA 2YOLA 4Z6AH 1J17T 4HZHA 3HPTB 1G3EA 2P8OB 2C90B 3NXPA 4AOQA 3EDXB 1SG8B 1QQUA 1O35A 3T5FH 1W7GH 4XRNA 4IN2A 4X6NA 1P10A 1FN8A 3UQOA 3OY6U 1D3TB 1YM0A 1Y3XA 3RMMH 3SV6A 1S85A 1TMTH 1AB9B 4JZDH 1O34A 5GCHF 2KCAA 3HGNA 1KTSB 1RJXB 5CHAB 1MTNC 1QA7A 1FAKH 3STJA 3M3TA 1C1WH 3M5NA 4WH8A 1K21H 3M3VA 1N6XA 3F6UH 3MNXA 3RC6A 2PKSB 4IGDA 5ESBA 3A89A 1OWJA 1XUJA 1IHSH 2BLOA 4UD9H 1QBOA 2VWNA 1UW7A 3TLOA 4IMZA 5C2ZA 3UPEA 3ZVFA 5GIBA 2BDIA 2BLWA 2HNTE 1F5KU 2H9HA 1V6DA 2FYQA 1NROH 2UWPA 1P3CA 2EEKA 1G36A 1BTZA 3KGPA 2IOTA 4UEHH 1F92A 1A5HA 1BRUP 1Z6JH 3RP2A 4BTTB 2A1DB 4CREA 2VBCA 4H6SB 1O33A 1WAYB 3F2GA 4UFEH 3BV9B 4GHTA 1ESAA 1BBRK 2KCYA 3LH1A 1FAXA 3M5OA 1O3OA 3O8BA 1F2SE 2ZCKP 1MCTA 2STAE 3EAJA 3FKSD 2ZGHA 3WY8A 4M7GA 1LVMA 2J5UA 1V2LT 2W6JD 4NA7A 3N7DA 4GCHF 2GP9B 1YCPM 2FOFA 4Q2KA 1C5LH 2ZDVH 3HGPA 4FUDA 4I8HA 2ZU2A 4BTIB 5JBAS 1HUTH 5B6LA 3MU5A 3RXOA 1ESBA 4NA8A 3NCLA 3UNRA 1KXCA 2CF8H 1HAHH 3AW1A 4DIIH 1F0SA 1HAXB 1O5GH 3GY4A 1V2UT 2OBOA 1UTKA 1Z8JB 1MD8A 2XBVA 3PTBA 4QT8C 2F91A 5C0TA 1AD8H 2GZ7A 1H8ED 1TGSZ 2GZ8A 1NRPH 2Y7ZA 4Y8YA 5LPRA 1QL8A 3DHKH 2XNDD 1ABJH 4XSKU 2BX4A 3SHAH 1C1MA 1GBLA 2PKAA 3ZZAA 2BDAA 1SLWB 1GI1A 1NBME 3ZZDA 1XVMA 3SZEA 3A88A 1WCZA 1MTNB 4MPWA 2A4GA 4DT4A 1DWBH 2FOGA 3EGKH 3TPIZ 5F03A 1NY22 1ELEE 2V7QD 2XOKD 1EJMA 3Q77A 2VIDA 2HWLB 1UTQA 2UUKB 1EPTC 3BTHE 1A0HB 2O8WA 3OEHD 2G51A 1GCDA 3NPSA 1P05A 1QRWA 4I31A 3UR6A 4ABGA 3MOCA 1OYQA 2ZC9H 3Q3KA 4OGXA 3RU4T 1BMFD 1MTUA 3GY2A 4DG4A 3RM2H 2HNTF 1C2JA 4BOHA 1AQ7A 1C2EA 3E91A 3T29A 2ZFQH 5DO4H 3SYJA 4BANB 3SV7A 1SGFG 1AWFH 5HKKD 1TRYA 3L3TA 1K1MA 1ZTKA 3T26A 1W0KD 3A8AA 3QO6A 1O37A 3E0PB 3GDUA 3RXVA 2VGCB 1T4UH 1SVPA 1QGFA 1HAYB 2SNVA 4XBBA 1G3DA 4GSOA 1GL0E 4FU7A 2BOKA 2ZHEH 3T28A 1MABB 5DP9A 2J97A 2AS9A 4GCHG 2Y5GA 3LC5A 2QYIA 3MHWU 4MNWA 3OAAD 1LVYA 1K1PA 2Y5FA 4AGJA 4D9RA 2F9UA 1C5YB 1JWTA 1GDQA 3AVZA 3UB0A 4FUIA 4IC6A 1GG6C 4X1SU 4X1PU 5GPIB 1SGRE 4OM9A 4K2YA 1UTLM 4K3JA 2JJ2D 3LGVA 1UO6A 2W7SA 2GZ9A 2PUXB 2WPMS 1HIAB 2BX3A 1O30A 1GVLA 2AHME 2BD2A 2FIRH 1C2MA 4MPXA 4DW2U 5FX5A 4CH2B 4H4FA 1C2LA 3PMBB 3S9AA 2ANYA 1TX6A 1WQSA 1G37A 4NGAH 3UNQA 1KXEA 4Y76A 1YLCA 2VVCA 3W1EA 5G4BA 1MU8B 1IQLA 1HJAB 3P8NA 3PB1E 4FVDA 2M2AA 3U9AH 1O2IA 1P2IA 7LPRA 5FCKA 4CRCA 1EAXA 1IQEA 1YPJH 1Q31A 3K65B 1ELAA 1VKYA 2OP9A 4MQAA 3BF6H 1TYNA 2F43B 3EA7A 1P04A 1JIMA 1EPTB 1ETTH 4LXBH 1YWUA 2GT8A 4YT6H 3BTQE 2XYAA 3SBKA 1TALA 1BTUA 4E06H 1F5RA 2SFAA 2UWOA 4YM9A 3PWCA 2PTNA 5IK2D 1OP0A 1C5SA 4AB9A 3M5LA 2FI5E 1HDTH 2KM0A 3NK8A 1ZTJA 3NZIA 1W10U 1O2XA 1N8OC 3FN8A 1RFNA 4Q7XA 2KR7A 4ISIH 1WXRA 1L1JA 4DY7B 4NA9H 1GI9B 1C1PA 5H4IB 4X6PA 2ZECA 1ARCA 1DVAH 4AFZA 1O2TA 2GJGA 1S6HA 1QRZA 2BDGA 1HPGA 2B0FA 2XRCA 2HPPH 1O2QA 2OINA 3R3GB 3BEUA 1KLIH 9ESTA 1U6QA 1ANDA 1C5QA 2BQ6B 4B6EA 1SGCA 1COWD 4I8KA 4ZH8A 1KLTA 3VB7A 2BDCA 3C1KA 3SW2B 1FDPA 2ZGBH 4CR5A 3I77A 3P6ZB 1SR5C 2ZGJA 1C4U2 3P8OA 2GCTC 3PRBA 1YPMH 1NFXA 3STIA 5T6DA 3OU0A 4ZAEA 1GHAF 2P59A 4JZFH 1GJDB 2BOHB 4AZ2B 1GG6B 2FMJA 4X6OA 2HPQH 1GHYH 5B6OA 5JB8S 2HALA 4O97A 4OS2A 3V12A 4BAMB 2GDDA 4XD7D 2IPQX 3LGIA 3TK5A 1EXFA 2ZHDA 1HGTH 5BRRE 1BHXB 1SGFA 1BMAA 1ELFA 1CO7E 1EAWA 2OLGA 3N7EA 4A6LA 3K6YA 1GDNA 2NU2E 1CA0C 5EPYA 3SHCH 1WQVH 1MKWK 1BJVA 3EE7A 4ABFA 3PYHA 2QXGA 1FLEE 2WPKS 3LGYA 2BZ6H 3ZVCA 3TNSA 1FY4A 6GCHF 5DJ7A 4CBOA 2Q6FA 1N6YA 4NZLA 2BY8X 2UUYA 1UVOA 2Q1JA 4INHA 9LPRA 1S82A 1MKWH 1YLDA 2KFWA 3QTOH 4MPUA 2FOAA 1LHDH 1T32A 3F9GA 3E90B 2WV5A 3RMLH 5DN6D 1H8DH 1NN6A 1QFKH 3ENSB 5F6MA 1AY6H 1MBQA 1JMOH 1Q2WA 2B9LA 1ZYOA 3V7TA 4X1QU 5EQSA 1QQ4A 3ZVDA 4XE4A 4X1RU 1IQIA 5FX6A 3DSGA 3M35A 2ZTXA 3U8RH 1CA8B 1DITH 1NM6A 1VZQH 1N8OB 1ZGIA 2G55A 4OGYA 2Q6DA 2VIVA 4WVPE 3H7OA 2Z3EA 1D4PB 1UHBA 3LU9B 1O2ZA 2ZDNA 2VWMA 1FI8A 1RRKA 1SOTA 2WHXA 1Y3VA 2XWBI 5A0BA 1UVPA 2F9BH 3SOSA 3GY7A 1WDIA 2P3FH 1SL3A 1Z1IA 1G3CA 3LC3A 1TNJA 1GBBA 1E38B 4LOYH 2AMPA 1V2PT 2ZU4A 3GCNA 3ZZ9A 4D8NA 1EZQA 4B75A 3K6ZA 2ZDLA 1TAWA 1IHTH 2WPJS 1TA2A 2JH0D 5EJZA 4IMQA 1J9CH 1Z8GA 4KTSA 1AKSB 1GHAG 2GCTB 1UTNA 3OTJE 1QL9A 5DP8A 3SN8A 1EB1H 3MU8A 3GY5A 3GYLB 1WBGB 4RKJB 3PLPA 3LJOA 4GLYA 1BTPA 4P02A 5J4SA 4INKA 2A0QB 4NZQA 4CRBA 3ZZ4A 1HAVB 1O2UA 4DOQA 3I78A 2F4LA 1J16A 5F8TA 1CGIE 3UWJH 4TY7A 1O2WA 2NWNA 4WWYA 5HIYA 1NRRH 4UFGH 2H5DA 4BAQB 2OD3B 1C5WB 5E8EH 1DT2A 3KQCA 2OTVA 1CA0B 1M9UA 1PPBH 2L74A 2PHBA 1CGJE 3BTTE 3PV2A 2Z9IA 5T6FA 4I7YH 1YPGH 2Y82A 1KXBA 3HK6B 4ABHA 4GUXA 3H09A 1RIWB 3OTPA 2Z3DA 6GCHG 2DUCA 1INCA 1PPGE 1SLXB 3RUOA 1DY8A 3P8FA 2AMQA 5FXLA 1MAXA 2A4RA 3FVFB 4WH6A 3M3SA 1ABIH 4NWLA 3RXUA 1O2GH 1UCYK 2GDEH 3A7VA 1AMHA 2GV7A 1FV9A 1A5GH 1ZHPA 3OYPA 3P92A 3SU1A 4B76A 1GCTC 3QN7A 1YP9A 4Y7AA 1ZLRA 2PTCE 2B8OH 3OX7U 1O3MA 1UCYH 3VG8A 1V2NT 5E0HA 4ESTE 1CHGA 1CQQA 1GJ7B 1SQRA 2ZU5A 3A84A 3BG4C 3MO6A 4IW4E 3PLKA 1ELBA 3U8OH 1FY1A 1LKAA 1V2RT 2PKSC 1ANEA 1S0RA 1VJAU 3F9HA 4KP0A 3DT0H 4MLFB 1CU1A 2ZHQH 1UMAH 4FUFA 4YLUA 4DCDA 2CHAC 1GJCB 3QUMP 2VINA 1ZR0A 4P00A 1W2KH 4WY3A 1W0YH 4Y79A 3FP7E 3V3MA 1B0EA 3S69A 3KCGH 2JH5D 2G00A 3UWIA 4FXGH 4OS4A 1MCVA 1BTWA 1KMHB 1TPSA 1ELTA 1MTWA 1JOUB 2QXJA 1E1QD 2J98B 4BXWA 1NO9H 5AVDA 2TGTA 1BRCE 1L4DA 3RXFA 4AGKA 1TNHA 2F9VA 1SB1H 2KZ4A 5E2OA 1ELDE 3TITA 5EJLA 3KHVA 3PM3A 3OE7D 1EUFA 4HGCA 2OQ5A 2SGQE 2NU3E 2FOEA 5JYIA 4TY6A 3S9BA 3TU7H 1C2FA 2WUCA 4YZUA 2F9NA 4KGAA 1HYLA 3ZZ8A 2HOBA 2ZIQH 3PMHB 1P2OA 3LGWA 2R0KA 1WU1A 1CT2E 1Z6EA 2WPIS 4HTCH 2SGDE 4A1VA 2QA9E 2HVYB 5ETXA 6ESTA 1GI4A 3WW7A 2ZQ2A 2P3TB 1D9IA 4ACBA 3ZZBA 2JJ1D 2AMDA 5DP6A 3E6PH 3SV8A 4Q4LA 1C1VH 3SI4H 2CN0H 3V0XA 1BT7A 2C93B 5GXPA 1GCTB 3A7TA 1C1NA 1C9PA 2FTLE 3GY6A 3M61U 2CF9H 4F48B 5C0UA 2ZA5A 5CDFE 1LQDB 4X0WU 3PO1B 8KME2 1Z8RA 3FZDA 1CVWH 1P9SA 2ZEBA 3SNDA 1SHYA 4DVAU 2G52A 3P17H 1P2KA 1NS3A 3BG4B 3QZQA 3KQEA 1P06A 2QIQA 3ESTA 5EOKA 3OFND 4FU8A 3HKJB 3NKKA 4CR9A 2ZPQA 4DIHH 3SU0A 2FZZA 2W5EA 1GL1A 2VH0A 2GTBA 3KIDU 1ZPCA 1O3GA 1DANH 2TGAA 1HRTH 1A61H 2CHAB 3BTEE 2WV4A 3F9EA 1QBVH 5I25A 4Q80A 1UTMA 5E0GA 3S0NA 5EGMA 1ZMLA 1EZUC 1IAUA 2W3KA 3E0NB 1OX1A 1P01A 2AYWA 4K5ZA 1MD7A 1GMCG 3I29A 1EB2A 1K28D 3A83A 3BN9A 5PTPA 4MNVA 4ZKRU 3PMJA 3ZVEA 2A7JA 3RXQA 5C17A 2PP6A 1UTOA 2ANWA 2EI8A 3RXTA 1A4WH 1P2JA 5A8ZA 3ZZCA 1KXAA 1T7CA 3S9CA 3JZ2B 2VGCC 1Y8TA 5C1YA 1MTSA 1D3DB 1WOFA 2PUQH 2A7HA 4FUCA 1TWXB 1BBRH 3N99A 3QX5H 3QGJA 1XMNB 2ZI2H 4A5TS 1HLTH 1AVGH 1TOCB 3QDZB 1QHRB 3SJ9A 2BY5X 3SV2H 2XCNA 3UREA 5F8XA 4I86A 2RFKC 2RA3A 1G9IE 1YC0A 1O3KA 2GMTB 4NFFA 1WUNH 1O2JA 5HGGA 1QR3E 1JRTA 4E7RG 4BAKB 5DK1A 1NFYA 3MU0A 1HAOH 3PV5A 5FBIA 3A86A 3CS0A 2Z6BD 1UVUH 4Y71A 1XXFA 1YPHC 2AGIX 1RXPA 3F1SB 1YBWA 1ZSKA 3ATKA 3FP8E 5C5NA 3O8RA 1UTPA 1FMGA 2ANMH 1HJAC 2ZFRH 1S81A 3RXPA 1O2PA 3MI4A 5EW2H 4NCYA 4ZMAH 1OSSA 5FPSA 3ODFA 1NT1A 2VH6A 3RXKA 4MDSA 5EW1H 1DSTA 1YYY1 4H6TA 2LELA 3ZV9A 3MNSA 1TBRH 1O5CB 1YF4A 1GHZA 1O3FA 3RXRA 3MFJA 2FI4E 1LDTT 4U30A 2FOMB 4AG2A 4NIWA 2WYGA 3RXCA 2FTMA 1DSUA 1TPPA 2FYRA 4MPVA 5T3HA 1B5GH 1AO5A 4Z0KA 3GISB 2I6SA 3DD2H 3BTWE 1RD3B 1QZ8A 5JB9S 4JYVH 3QZRA 2PLXA 3PMAB 4F55A 1PPEE 1W11U 3DUXH 1H1BA 2WPHS 2CMYA 1E1RD 4B1TA 1DLKB 2GV6A 1DICA 3ZIAD 3WWBA 1XVOA 4TYDA 1FJSA 2UUFB 1K1NA 1T8LA 1HXEH 2XC5A 2PGBB 4D7FA 1GI6A 1PYTC 1MAYA 3D49H 3GCOA 3H7TA 2JIZD 1C1SA 3B23B 1DUEA 1GBAA 1QBNA 1ZPZA 3SQHE 4J2YB 1BHXF 1FONA 3UIRA 2GT7A 4FETA 1NRSH 8LPRA 1GHWH 2FI3E 1TPOA 3LONA 4SGBE 4ACAA 3A8BA 4A92A 3DFJA 4AC9A 1ELCA 1GI0A 3BIVH 4YXWD 2QC2A 1V2VT 5L6NH 2Y6TA 1DWEH 3MNCA 3GCHC 3UOPA 5IDKA 1BDAA 3ODDA 3O8DA 1QB1A 2JETB 2ZPRA 3MYWA 5FAHA 2ZU3A 3M7UA 4DGJA 3CS7A 1TNKA 1Y3UA 1DS2E 4CH8B 5HMAA 5DGJA 1H8IH 1YPKH 4YOGA 2CXVA 1WYKA 5TCCA 1KXFA 4BAOB 2EC9H 1A5IA 1D6RA 2KAIB 4BNRA 1LTOA 3JZ1B 3ITIA 3A85A 3SJ8A 2P16A 1YLNA 5DP4A 3ZYEA 3NUMA 4I33A 1AZZA 1MU6B 3FP6E 1LHFH 4B71A 2ZO3H 2A5IA 4RI0A 4OS7A 3MH6A 3SGBE 1ELVA 4UFDH 4ZXXH 2EQNA 4ISLA 2EA3A 4NSYA 2BXUH 1FZZA 4FUJA 2H9EH 1XX9A 1Y59T 4AYYB 4K8YA 1EOLA 5F53A 2AIQA 5T6GA 4ASUD 1FX0B 4Y11E 2V3MA 4X2YA 3T62A 2F9OA 1ORFA 3BG8A 4TWWA 1TABE 2DE8A 2A5KA 1LHEH 1HAGE 1UCYE 2B5TB 2F9PA 2G4TA 4X8VH 3DA9B 2FLRH 3Q76A 1TBQH 1L4ZA 4X2WA 2K8IA 4WJG2 3DSOA 3RMNH 2TRMA 1THSH 5EQQA 5TCAA 1C5TA 1DDJA 4UE7H 1EATA 1O5EH 8ESTE 2ALPA 2R2MB 1D3PB 7KMEH 1LMWB 2Y7XA 5FPTA 2PSYA 3UOUA 2O8MA 4ABBA 5DP7A 4NIXA 1G3BA 2A7CA 1GHBG 1SGYE 3E3TA 1FY5A 1MZDA 1TGNA 2XC4A 2ZQ1A 5AHGH 1GBMA 3SNBA 1GI5A 1L0ZA 3GY8A 4X8UH 1PPCE 1C2HA 3BEIB 4UFFH 5EXNA 2YMSD 4YOIA 1TQ0B 3KYGA 1AGJA 3ATMA 2STBE 3P70B 3SUDA 1A7SA 2PW8H 3M5MA 1S0QA 1AIXH 4ZKNU 3FFGA 1P8VC 4U2WA 1TRNA 3GCHB 3EA9A 2BY6X 2XC0A 4MNYA 2R3UA 2XW9A 3SI3H 3U1IB 1VITF 4LZ4B 2PV9B 1L1NA 2QXHA 1IOEA 1O2MA 3F2HA 3G01A 2VB0A 5A8YA 4M9FA 1V2TT 4XFQA 2Y80A 5JBTA 2A31A 1PQ7A 1RIWC 1C1QA 3U69H 2A32A 4Y10E 2NU0E 2OBQA 5A0AE 1GJ9B 4KTUA 4JZIA 3A82A 1E37B 1GDUA 1W7XH 3ATIA 1HIAA 3SUEA 5E0JA 1C1UH 3EYDA 3GCTF 4TPYA 1HNEE 1FNIA 2D1JA 4FVBA 1K1IA 4AYVB 1YKTA 3V13A 2BD8A 3U28C 1T8OA 1MKXK 3AW0A 4DJZB 4IS5A 5AFZH 1LKBA 1GMDG 3W94A 2FM2A 2Z9KA 4ZUHA 2QF4A 1S5SA 2OXSA 5JBCS 5F8ZA 1BOQA 4ZCNA 1MKXH 3A7WA 4WMEA 1AI8H 1TGCA 5EXMA 1TE0A 1FY3A 2AERH 3TJUA 1IQKA 2QY0B 2ILNA 4AFUA 1ACBE 2KX4A 4D7GA 4ZROA 1EPTA 2AIPA 3F0OA 1NU7B 1E36B 3SNCA 3VEQB 4K60A 5DKMA 2GKVE 1AE5A 2CJIA 2Z3CA 1XUFA 2FLBH 1JXPA 3BTKE 4RT1A 3SU4A 3ZVBA 4ASHA 4CRAA 4GHQA 1Q3XA 2ZTZA 1SGNE 1ZSJA 4UONA 2IJOB 1A2CH 2BQWB 4KELA 1UK2A 3L33A 3A80A 1QJ1B 1V2JT 1A3EH 3GS9A 1VITH 1NESE 1K0HA 1XUIA 1GBEA 1AFQC 2BZAA 1OXGA 7ESTE 1AZ8A 1AN1E 3HATH 2ZGXH 2SGPE 4E7NA 4ZKOU 3QWCH 1NTPA 3NRLA 3BTDE 3RDZA 1P9UA 1QJ6B 1VITG 3RU4D 3VPKA 1O2YA 1W8BH 1XUHA 3AAVA 3A87A 1FUJA 4KKDA 2O8LA 4INLA 3U1JB 3MU4A 2BXTH 2P94A 4R0IA 1BUIA 5EODA 4FUEA 4B2BA 4TT3D 1EKBB 2VIQA 3GCTG 3Q00A 1BBRE 1T4VH 1K1LA 2YNBA 3SZNA 1AWHB 1W14U 2ZPSA 2QGRA 2W26A 3GDVA 4ISNA 1PQAA 1SOZA 1GVKB 3QTVH 4OS5A 3TJVA 1H9LB 3WWFA 4I8LA 5L2YH 1UVTH 3NWUA 1F0TA 1NU9A 3BTGE 1V2MT 1SLVB 3KNXA 3W95A 3F2FA 3RLYH 4AB8A 3MTYA 3GDSA 3RXEA 2XWAA 2J2UA 1TQ7B 1KLJH 4J1YA 2PSXA 2P93A 2ZTYA 3PO1C 2BDBA 1MUEB 3RXGA 1MH0A 1UVSH 5IYTA 3VB3A 3FAOA 1Z71A 2WV9A 5ESTE 5JBBS 4YLQH 3VGCC 1TGBA 2FO9A 4NFEA 2B7DH 1TBZH 2TPIZ 1LVBA 4A1TA 4F4OC 2QF0A 1EQ9A 3SV9A 5CMXH 1DPOA 3DCLA 3TVJB 3MQKC 1W0JD 2QF3A 6CHAB 2A45B 1S6FA 8GCHF 1LO6A 1O3LA 1CT0E 1EAUA 1UK3A 1CGHA 1SQOA 3F9FA 1GI2A 4K8BA 2TGPZ 3VB6A 2RG3A 3E1XB 2CV3A 2PFEA 4ISHH 1DFPA 3QLPH 1F7ZA 1O5DH 4O3UA 1SQTA 3ZV8A 1GMCF 1AFQB 1GJ6A 3RLWH 1O0DH 4B2AA 1PYTD 2R9PA 1KDQA 1OHHD 3ATWA 1THRH 3RXIA 3TIUA 1HB0B 2OC1A 3TJNA 1GBHA 3TK6A 1TFXA 2BMGB 3T2NA 1QNJA 2YMSC 1DLEA 1J15A 1BRBE 1O2RA 1TPAE 5LPEA 1XKBC 3D62A 1ZRBA 1YPHE 3PTNA 5EIYA 1DOJA 4X2XA 4MVNA 2FDAA 2ZNKH 1O3NA 2J95A 3U98H 1IQHA 1V2KT 2Q6GA 1LVOA 3UY9A 1GBKA 2RDEA 1H8HD 2BD4A 2AFQB 2THFB 4K69A 1O3BA 2GCHF 4U01A 2GMTC 2D2DA 1H4WA 3UUZA 1HAVA 1O2KA 1NRQH 1KYNA 1PPFE 1XXDA 2H6MA 4Y8ZA 2YNAA 1QL7A 1P11E 2LP6A 3A8DA 1EX3A 1C9TA 3LOXA 3TH3H 2BD9A 1O2HA 2O9QA 3RXBA 1O2LA 1O2OA 1ZTLA 2R2WU 1KY9A 1EP5A 3KN2A 3M36A 2PKAB 3GICB 3UQVA 1BZXE 4CHAC 4CRFA 2Z9GA 2ZFTA 1E0FD 1ESTA 4GVUA 4ABDA 1W13U 1GVZA 5HIZA 1L2EA 1A0JA 2VVUA 4FUBA 2BVXH 4JK6A 3SU6A 2OK5A 2QAAA 4UDWH 3VGCB 2BLVA 1O3EA 5E2PA 2R0LA 5LGOA 1AHTH 4FU9A 2FOCA 2I6QA 3F68H 1IQNA 1QRXA 3RXAA 2CGAA 2ODQA 4ZXYH 3SUGA 1WV7H 8GCHG 1LHCH 2DE9A 3CP7A 3ZZ3A 2QN5T 4CRDA 1TX7A 3Q3YA 2ZFSA 2H5CA 2L6OA 1WTHD 3SJKA 1K1JA 5CE1A 1E34B 3CNRA 1DE7H 3A8CA 3LPRA 1NRNH 3TGKE 1C5NH 2BVRH 4OS1A 4BTUB 5I46H 1BQYA 1VCWA 2LNCA 3B8JA 4WMFA 3URDA 1HBTH 1NBMD 3TJOA 2IN2A 1TRMA 3TNTA 3ZZ5A 1BTXA 5ABWA 1QCPA 1GJ8B 2G81E 2OCVB 2C8YB 4YO9A 3MH5A 1AU8A 1OWHA 1V3XA 3SU5A 5A2MH 2IPHA 5GWZA 1GPZA 1HCGA 2FOBA 1KXDA 2YMSB 1P2MA 3TGIE 4Y8XA 1NC6A 3PROA 3S7HB 3VB5A 1HAPH 1DX5M 4Z1MD 4I8JA 2VIOA 1D6WA 1GGDC 1UTJA 4I32A 4ISOA 1TLDA 2VIWA 1P3EA 2M5TA 2J9NA 4MTBA 1AE8H 3ZYDA 3SU2A 3P8GA 2ZFPH 3L6PA 2J98A 3MWIU 2UWLA 1T8NA 5GDSH 1BTHH 3SO3A 2GCHG 2XCFA 3BEFB 4I8GA 2P3UB 3IITA 1BJUA 4X1NU 5EU8A 1A46H 2BLQA 4ABIA 1OWKA 1K2I1 1SGDE 1SFIA 2FESH 1RGQA 1A1RA 1RTFB 3SJIA 1O5AB 2HLCA 2PGQB 2O8TA 2V3HH 1Y5BT 5JDUB 2FOHA 2ZHWH 3ATLA 2ODPA 1LPGB 1WSSH 2IJD1 2QF5A 4GPGA 1G2MA 2JETC 1BCUH 1GHVH 2FP7B 1FY8E 4CHAB 1P2NA 3BTFE 1BIOA 1PQ8A 5C67A 4Y0YE 3OY5U 2A2QH 2G4UA 2PR3A 4D9QA 3QGNB 4IC5A 2FPZA 1D3QB 1YY3A 1Z8IB 3KYFA 4YTAA 4B74A 2V0BA 2HGTH 1QB9A 3T25A 1TB6H 4OS6A 1KIGH 5DPAA 1MQ5A 5FBEA 1EAIA 1P03A 1SGIB 1SSXA 1OS8A 1Z7KA 3RXHA 5GCHG 1LPZB 4Y7BA 2GX4A 5L2ZH 1AUJA 1KTTB 5AFYH 2XNIA 2Y5HA 1PJPA 1GI7B 1C4Y2 2HLDD 3AASA 1O2SA 1C5RA 4NSVA 4NIVA 4WXIA 1C5OH 3EQ0H 4F49A 2Z9JA 2P95A 1B7XB 4H42U 4JYUH 1QB6A 5AF9H 1G30B 2SGAA 3MNBA 5EPNA 2H1UA 3TGJE 2OQUA 3R0FA 1AUTC 3ZZ6A 2BY9X 1TOMH 4D76A 1VR1H 1A0LA 4A7IB 1O38A 1GJ4H 2BD3A 3IWMA 5DP5A 1EASA 1BTYA 5HXFA 4NG9H 1W0ZU 2SGEE 3LIWA 1EP6A 4PROA 4ABJA 2JH6D 1G2LA 1O3JA 2J94A 3MH7A 5FPYA 5T1VA 1GGDB 3ELAH 3GY3A 2QE7D 1GHBF 1HJ8A 1GBTA 2V35A 3MO9A 5C5OA 4K1SA 4CRGA 1GBJA 3LH3A 5JPMH 1BRAA 1ZJDA 5EQRA 1XM1A 2HNTC 3K2UA 2UUJB 1DWDH 3KQDA 5CHBA 2ZF0H 1SFQB 1TIOA 4AFQA 3SORA 1SLUB 1IQFA 1N1LA 3HK3B 3QK1A 2ASUB 2ALVA 1HAZB 5TJXA 1IQMA 2VWOA 4IN1A 1C5UA 4X8SH 2FXRA 2G5NA 1V2ST 2J34A 1SGTA 2PWXA 1S84A 1CBWC 1P2QA 1PPZA 4WF8A 2WUBA 1RTKA 2C8XB 1VCQA 2XTTB 3RMOH 2XBYA 2Z9LA 3H5CB 1O5BB 1O3DA 1OWDA 4O3TA 4CBNA 1SQAA 1ZSLA 3UR9A 3VB4A 1BA8B 2ZGCA 1HAIH 1OWEA 1L1GA 1FQ3A 3KQ5A 2Y81A 5L30H 1DUAA 2G8TA 1A3BH 3UTUH 3SUFA 1TNGA 1ETSH 4JZ1A 4Q63A 4Q7YA 4ZKSU 1PPHE 1P57B 1GBFA 2ZP0H 3RXLA 4DT7B 2ODYB 1CHOF 2NU4E 5BPEA 4E05H 1C2IA 1DWCH 1Y3WA 3RXSA 1MTVA 1ANCA 2NU1E 1ZHRA 1TA6A 2A5AA 3LJJA 4O9VA 1E35B 4K1TA 3KQBA 2BDYA 3ZZ7A 1TMBH 3A7YA 1LHGH 3M7QA 4MNXA 1SKYE 1GMDF 3RM0H 3TH2H 2J4IA 1NFUA 3TK9A 1OYTH 2ANKH 1DXWA 5C20A 3D23A 6LPRA 4KTCA 4AG1A 2Z7FE 1OOKB 1UHBB 5A09A 1P02A 1XUGA 1NZQH 4X6MA 1HJ9A 2C8WB 2ZZUH 2V3OH 2ZWLH 5A0CA 1ZZZA 2FS9A 2A4OA 4AORA 3VXFH 1C1RA 3M37A 1EZSC 1GMHF 4THNH 2GD4B 4RT0A 2Z94A 1OWIA 4A1XA 1DM4B 4VGCC 4ZHAA 2VWLA 5EG4A 4B73A 1LCYA 2KCOA 2OC8A 3A81A 4JCNA 4JMYA 2SNWA 1W3CA 2TBSA 3UFAA 2V6NA 3EA8A 4MG3A 1E79D 2EI7A 2ZDAH 5LPFA 4HFPB 3FO8D 1P12E 1CT4E 1ID5H 2QV1A 1ZOMA 4FOUC 1ELGA 1X7AC 2K0QA 3RXDA 2VJ1A 1GJBB 3D65E 4LK4A 3SU3A 2BD5A 2G5VA 1LPKB 3HKIB 1NFWA 1ZPBA 2EI6A 2HRVA 3C27B 1THPB 3PRDA 1EFRD 1TONA 4NWKA 2BYAX 5DG6A 2ZCLP 1CBWB 1ZRKA 2A4QA 2J38A 7GCHF 1UK4A 1QURH 3GOVB 1CE5A 5LH8A 2H9TH 3VFEA 1C5ZB 2FX4A 1CSOE 1EOJA 1HXFH 3F0PA 2K1QA 3CENA 1OP2A 5EJ1A 5GNDA 2XBXA 3B9FH 3ZVGA 3MH4A 5HM9A 1XKAC 1CHOG 2W3IA 1FN6A 1SPJA 2FEQH 2VIPA 1H9HE 1GHXH 1O2VA 4YOJA 5FCRA 1S83A 5HYOA 3AK5A 4WXVA 1C5PA 3MMGA 1QJ7B 1ZMJA 3LT3A 3RXJA 2GVFA 3BIUH 1GJAB 1MQ6A 3AAUA 4AN7A 3OSYA 2W6ID 1GWAA 1OPHB 2C3SA 1MMJN 1NPMA 1C4V2 1O36A 2KAIA 3BSQA 2SGFE 5DP3A 1YPLH 5A8XA 1C5XB 1GI8B 2ZDKA 1ETRH 1TX8A 2C4FH 2D8WA 3GYMA 2WINI 3RXMA 5J4QA 1EJNA 1GBIA 3OEED 4X8TH 4AFSA 1EJAA 1Y3YA 1YPEH 1O5FH 2CK3D 1T8MA 2JKHA 4LZ1H 2RA0A 1J8AA 1F0RA 4K1EA 4RKOB 3URCA 1V2OT 1TNIA 1GMHG 4Y0ZE 3SQEE 3EE0B 1Y5UT 6CHAC 1V2WT 2ZKSA 4ABAA 5KECA 2OC7A 1GBCA 1O3PB 3UAIC 5HM2A 4VGCB 1DY9A 2ESTE 1UJ1A 2BDHA 3K9XB 1G32B 1KSNA 4U32A 1P0SH 3DFLA 2JDID 4TSFD 4XBDA 3VXEH 1EZXC 4DURA 1ZJKA 2FX6A 1V2QT 2XBWA 3ZVAA 4YT7H 5FHTA 2AEIH 1ZHMA 1IQJA 1FIZA 1GJ5H 5C3NA 1C2DA 4B2CA 1SC8U 1KDQB 2BTCE 5C94A 1QIXB 2TGDA 1VGCC 4FUHA 1JIRA 1ANBA 3BTME 3SGQE 1BMMH 2F3CE 3LGTA 1RTLA
chains in the Genus database with same CATH topology
1YCPK 7GCHG 2H2ZA 1SGPE 2BQ7B 3PLBA 3MU1A 4ZHMU 1Z1JA 3KEEA 1VCPA 1YCPH 3LKWA 3KL6A 2AGEX 3P95A 4HI3A 2FODA 4JZEH 5EXLA 1SMFE 3U8TH 2D26C 1HV7A 5K0HA 1C5MD 1TGTA 2A2XH 1K22H 4SGAE 1C1OA 4O03A 2RCEA 2ZDMA 1O2NA 1GI3A 4YESB 2ZHFH 2RDLA 2O8UA 3N7OA 2W7UA 4R8TB 1LQEA 1VJ9U 4RSPA 3FANA 1F0UA 3A7ZA 1QTFA 3PV4A 3S7KB 3IG6B 1HFDA 1SGQE 2P8OC 3SNEA 2AGGX 2WPLS 3M7TA 3SNAA 2J92A 1SBWA 2QCYA 3KF2A 2WYJA 1PFXC 4FUGA 2HVXA 1JRSA 1RS0A 1ARBA 2ZG0H 3A7XA 4NIYA 1C2KA 1MZAA 1MBMA 1WTGH 2VU8E 3LDXH 1AB9C 2OUAA 4XDEA 3TH4H 1O3AA 3O8CA 4WMDA 3UNSA 1FPHH 1K1OA 1PQ5A 5C1UA 2BB4A 2BD7A 5CHAC 1BB0B 1QY6A 2QXIA 1P09A 2F83A 1IQGA 3RC5A 2ZCHP 2ULLA 2AH4X 2XXLA 4X2VA 1DXPA 4Y6DA 2ZFFH 1SGEE 1FPCH 1B0FA 1XUKA 4ABEA 1BMLA 4TPIZ 1O39A 3RU4E 3LGUA 4ZHLU 1YGCH 4XOJA 1C2GA 3T27A 4JK5A 1K9OE 1VGCB 5C1XA 1SI5H 2BHGA 1OKXA 4Q7ZA 3Q3XA 2BVSH 1O32A 2BM2A 1BITA 3E8LA 1ZGVA 1ZMNA 2LPRA 1FXYA 1GBDA 3SJOA 1F5LA 1AKSA 2ZU1A 4AX9H 1TMUH 2C8ZB 1AVWA 1H9IE 1FIWA 1JBUH 1W12U 1BMNH 4GAWA 2GGVB 4IBLH 4TWYA 1C5VA 2R3YA 1QA0A 2BY7X 5K7RA 1T31A 4JYTA 2FWWA 1J14A 1TNLA 3MO3A 1SHHB 2VVVA 3RC4A 1AVXA 1O31A 5GJ4B 3E16B 2VNTA 1Y5AT 1OP8A 2OC0A 1O3IA 3SGAE 1O3CA 5SGAE 1C1TA 3FZZA 4BAHB 1O3HA 4RN6A 4BXSA 2TIOA 1AFEH 2FS8A 4XBCA 3PWBA 2YOLA 4Z6AH 1J17T 4HZHA 3HPTB 1G3EA 2P8OB 2C90B 3NXPA 4AOQA 3EDXB 1SG8B 1QQUA 1O35A 3T5FH 1W7GH 4IN2A 4X6NA 1P10A 1FN8A 3UQOA 3OY6U 1D3TB 1YM0A 1Y3XA 3RMMH 3SV6A 1S85A 1TMTH 1AB9B 4JZDH 1O34A 5GCHF 3HGNA 1KTSB 1RJXB 5CHAB 1MTNC 1QA7A 1FAKH 3STJA 3M3TA 1C1WH 3M5NA 4WH8A 1K21H 3M3VA 1N6XA 3F6UH 3MNXA 3RC6A 2PKSB 4IGDA 5ESBA 3A89A 1OWJA 1XUJA 1IHSH 2BLOA 4UD9H 1QBOA 2VWNA 3TLOA 4IMZA 5C2ZA 3UPEA 3ZVFA 5GIBA 2BDIA 2BLWA 2HNTE 1F5KU 2H9HA 1V6DA 2FYQA 1NROH 2UWPA 1P3CA 2EEKA 1G36A 1BTZA 3KGPA 2IOTA 4UEHH 1F92A 1A5HA 1BRUP 1Z6JH 3RP2A 4BTTB 2A1DB 4CREA 4H6SB 1O33A 1WAYB 4UFEH 3BV9B 4GHTA 1ESAA 1BBRK 3LH1A 3M5OA 1FAXA 1O3OA 3O8BA 1F2SE 2ZCKP 1MCTA 2STAE 3EAJA 2ZGHA 3WY8A 4M7GA 1LVMA 1V2LT 4NA7A 4GCHF 2GP9B 1YCPM 2FOFA 4Q2KA 1C5LH 2ZDVH 3HGPA 4FUDA 4I8HA 2ZU2A 4BTIB 5JBAS 1HUTH 3MU5A 3RXOA 1ESBA 4NA8A 3NCLA 3UNRA 1KXCA 2CF8H 1HAHH 3AW1A 4DIIH 1F0SA 1HAXB 1O5GH 3GY4A 1V2UT 2OBOA 1UTKA 1Z8JB 1MD8A 2XBVA 3PTBA 4QT8C 2F91A 1AD8H 2GZ7A 2Y7ZA 1TGSZ 2GZ8A 1NRPH 4Y8YA 5LPRA 1QL8A 3DHKH 1ABJH 4XSKU 2BX4A 3SHAH 1C1MA 1GBLA 2PKAA 3ZZAA 2BDAA 1SLWB 1GI1A 3ZZDA 1XVMA 3A88A 1WCZA 1MTNB 4MPWA 2A4GA 1DWBH 2FOGA 3EGKH 3TPIZ 5F03A 1NY22 1ELEE 1EJMA 3Q77A 2VIDA 2HWLB 1UTQA 2UUKB 1EPTC 3BTHE 1A0HB 2O8WA 2G51A 1GCDA 3NPSA 1P05A 1QRWA 4I31A 3UR6A 4ABGA 3MOCA 1OYQA 2ZC9H 3Q3KA 4OGXA 3RU4T 1MTUA 3GY2A 4DG4A 3RM2H 2HNTF 1C2JA 4BOHA 1AQ7A 1C2EA 3E91A 3T29A 2ZFQH 5DO4H 4BANB 3SV7A 1SGFG 1AWFH 1TRYA 3L3TA 1K1MA 1ZTKA 3T26A 3A8AA 3QO6A 1O37A 3E0PB 3GDUA 3RXVA 2VGCB 1T4UH 1SVPA 1QGFA 1HAYB 2SNVA 4XBBA 1G3DA 4GSOA 1GL0E 4FU7A 2BOKA 2ZHEH 3T28A 5DP9A 2AS9A 4GCHG 2Y5GA 3LC5A 2QYIA 3MHWU 4MNWA 1LVYA 1K1PA 2Y5FA 4AGJA 4D9RA 2F9UA 1C5YB 1JWTA 1GDQA 3AVZA 4FUIA 4IC6A 1GG6C 4X1SU 4X1PU 5GPIB 1SGRE 4K2YA 1UTLM 4K3JA 3LGVA 1UO6A 2W7SA 2GZ9A 2PUXB 2WPMS 1HIAB 2BX3A 1O30A 1GVLA 2BD2A 2FIRH 1C2MA 4MPXA 4DW2U 5FX5A 4CH2B 4H4FA 1C2LA 3PMBB 3S9AA 2ANYA 1TX6A 1WQSA 1G37A 4NGAH 3UNQA 1KXEA 4Y76A 1YLCA 2VVCA 5G4BA 1MU8B 1IQLA 1HJAB 3P8NA 3PB1E 4FVDA 3U9AH 1O2IA 1P2IA 7LPRA 5FCKA 4CRCA 1EAXA 1IQEA 1YPJH 1Q31A 3K65B 1ELAA 2OP9A 4MQAA 3BF6H 1TYNA 3EA7A 1P04A 1JIMA 1EPTB 1ETTH 4LXBH 4YT6H 2GT8A 3BTQE 2XYAA 3SBKA 1TALA 1BTUA 4E06H 1F5RA 2SFAA 2UWOA 4YM9A 3PWCA 2PTNA 1OP0A 1C5SA 4AB9A 3M5LA 2FI5E 1HDTH 3NK8A 1ZTJA 3NZIA 1W10U 1O2XA 1N8OC 1RFNA 4Q7XA 4ISIH 1L1JA 4DY7B 4NA9H 1GI9B 1C1PA 5H4IB 4X6PA 2ZECA 1ARCA 1DVAH 4AFZA 1O2TA 1S6HA 1QRZA 2BDGA 1HPGA 2B0FA 2XRCA 2HPPH 1O2QA 2OINA 3R3GB 3BEUA 1KLIH 9ESTA 1U6QA 1ANDA 1C5QA 2BQ6B 1SGCA 4I8KA 4ZH8A 1KLTA 3VB7A 2BDCA 3C1KA 3SW2B 1FDPA 2ZGBH 4CR5A 3I77A 3P6ZB 1SR5C 2ZGJA 1C4U2 3P8OA 2GCTC 1YPMH 1NFXA 3STIA 5T6DA 3OU0A 4ZAEA 1GHAF 2P59A 4JZFH 1GJDB 2BOHB 4AZ2B 1GG6B 2FMJA 4X6OA 2HPQH 1GHYH 5B6OA 5JB8S 2HALA 4O97A 4OS2A 3V12A 4BAMB 2GDDA 3LGIA 3TK5A 1EXFA 2ZHDA 1HGTH 5BRRE 1BHXB 1BMAA 1ELFA 1SGFA 1CO7E 1EAWA 2OLGA 4A6LA 3K6YA 1GDNA 2NU2E 1CA0C 5EPYA 3SHCH 1WQVH 1MKWK 1BJVA 4ABFA 3PYHA 2QXGA 1FLEE 2WPKS 3LGYA 2BZ6H 3ZVCA 3TNSA 1FY4A 6GCHF 5DJ7A 4CBOA 2Q6FA 1N6YA 4NZLA 2BY8X 2UUYA 1UVOA 2Q1JA 4INHA 9LPRA 1S82A 1MKWH 1YLDA 3QTOH 4MPUA 2FOAA 1LHDH 1T32A 3F9GA 3E90B 2WV5A 3RMLH 1H8DH 1NN6A 1QFKH 3ENSB 5F6MA 1AY6H 1MBQA 1JMOH 1Q2WA 2B9LA 1ZYOA 3V7TA 4X1QU 5EQSA 1QQ4A 3ZVDA 4XE4A 4X1RU 1IQIA 5FX6A 3M35A 2ZTXA 3U8RH 1CA8B 1DITH 1NM6A 1VZQH 1N8OB 1ZGIA 2G55A 4OGYA 2Q6DA 2VIVA 4WVPE 3H7OA 2Z3EA 1D4PB 1UHBA 3LU9B 1O2ZA 2ZDNA 2VWMA 1FI8A 1RRKA 1SOTA 2XWBI 1Y3VA 5A0BA 1UVPA 2F9BH 3SOSA 3GY7A 2P3FH 1SL3A 1Z1IA 1G3CA 3LC3A 1TNJA 1GBBA 1E38B 4LOYH 2AMPA 1V2PT 2ZU4A 3GCNA 3ZZ9A 4D8NA 1EZQA 4B75A 3K6ZA 2ZDLA 1TAWA 1IHTH 2WPJS 1TA2A 2JH0D 4IMQA 1J9CH 1Z8GA 4KTSA 1AKSB 1GHAG 2GCTB 1UTNA 3OTJE 1QL9A 5DP8A 3SN8A 1EB1H 3MU8A 3GY5A 3GYLB 1WBGB 4RKJB 3PLPA 3LJOA 4GLYA 1BTPA 5J4SA 4INKA 2A0QB 4NZQA 4CRBA 3ZZ4A 1HAVB 1O2UA 4DOQA 3I78A 5F8TA 1J16A 1CGIE 3UWJH 4TY7A 1O2WA 2NWNA 4WWYA 1NRRH 4UFGH 2H5DA 4BAQB 2OD3B 1C5WB 5E8EH 1DT2A 3KQCA 2OTVA 1CA0B 1M9UA 1PPBH 2PHBA 3BTTE 1CGJE 2Z9IA 5T6FA 4I7YH 1YPGH 2Y82A 1KXBA 3HK6B 4ABHA 4GUXA 6GCHG 1RIWB 2Z3DA 2DUCA 1INCA 1PPGE 1SLXB 3RUOA 1DY8A 3P8FA 2AMQA 5FXLA 1MAXA 2A4RA 3FVFB 4WH6A 3M3SA 1ABIH 4NWLA 3RXUA 1O2GH 1UCYK 2GDEH 3A7VA 1AMHA 2GV7A 1FV9A 1A5GH 1ZHPA 3OYPA 3P92A 3SU1A 4B76A 1GCTC 3QN7A 1YP9A 4Y7AA 1ZLRA 2PTCE 2B8OH 3OX7U 1O3MA 1UCYH 1V2NT 5E0HA 4ESTE 1CHGA 1CQQA 1GJ7B 2ZU5A 3A84A 3BG4C 3MO6A 4IW4E 3PLKA 1ELBA 3U8OH 1FY1A 1LKAA 1V2RT 2PKSC 1ANEA 1S0RA 1VJAU 3F9HA 4KP0A 3DT0H 4MLFB 1CU1A 2ZHQH 1UMAH 4FUFA 4YLUA 4DCDA 2CHAC 1GJCB 3QUMP 2VINA 1ZR0A 1W2KH 4WY3A 1W0YH 4Y79A 3FP7E 3V3MA 1B0EA 3S69A 3KCGH 2JH5D 2G00A 3UWIA 4FXGH 4OS4A 1MCVA 1BTWA 1TPSA 1ELTA 1MTWA 1JOUB 2QXJA 4BXWA 1NO9H 5AVDA 2TGTA 1BRCE 1L4DA 3RXFA 4AGKA 1TNHA 2F9VA 1SB1H 5E2OA 1ELDE 3TITA 3KHVA 3PM3A 1EUFA 4HGCA 2OQ5A 2SGQE 2NU3E 2FOEA 5JYIA 4TY6A 3S9BA 3TU7H 1C2FA 2WUCA 4YZUA 2F9NA 4KGAA 1HYLA 3ZZ8A 2HOBA 2ZIQH 3PMHB 1P2OA 3LGWA 2R0KA 1WU1A 1CT2E 1Z6EA 2WPIS 4HTCH 2SGDE 4A1VA 2QA9E 5ETXA 6ESTA 1GI4A 2ZQ2A 2P3TB 1D9IA 3ZZBA 2AMDA 5DP6A 3E6PH 3SV8A 1C1VH 3SI4H 2CN0H 3V0XA 1BT7A 2C93B 5GXPA 1GCTB 3A7TA 1C1NA 1C9PA 2FTLE 3GY6A 3M61U 2CF9H 2ZA5A 1LQDB 4X0WU 3PO1B 8KME2 1Z8RA 3FZDA 1CVWH 1P9SA 2ZEBA 3SNDA 1SHYA 4DVAU 2G52A 3P17H 1P2KA 1NS3A 3BG4B 3QZQA 3KQEA 1P06A 2QIQA 3ESTA 5EOKA 4FU8A 3HKJB 3NKKA 4CR9A 2ZPQA 4DIHH 3SU0A 2FZZA 2W5EA 1GL1A 2VH0A 2GTBA 3KIDU 1ZPCA 1O3GA 1DANH 2TGAA 1HRTH 1A61H 2CHAB 3BTEE 2WV4A 3F9EA 1QBVH 5I25A 4Q80A 1UTMA 5E0GA 3S0NA 5EGMA 1ZMLA 1EZUC 1IAUA 2W3KA 3E0NB 1OX1A 1P01A 2AYWA 4K5ZA 1MD7A 1GMCG 3I29A 1EB2A 1K28D 3A83A 3BN9A 5PTPA 4MNVA 4ZKRU 3PMJA 3ZVEA 2A7JA 3RXQA 1UTOA 2ANWA 2EI8A 3RXTA 1A4WH 1P2JA 5A8ZA 3ZZCA 1KXAA 1T7CA 3S9CA 3JZ2B 2VGCC 1Y8TA 5C1YA 1MTSA 1D3DB 1WOFA 2PUQH 2A7HA 4FUCA 1TWXB 1BBRH 3QX5H 3QGJA 1XMNB 2ZI2H 4A5TS 1HLTH 1AVGH 1TOCB 3QDZB 1QHRB 3SJ9A 2BY5X 3SV2H 2XCNA 3UREA 5F8XA 2RA3A 1G9IE 1YC0A 1O3KA 2GMTB 4NFFA 1WUNH 1O2JA 5HGGA 1QR3E 1JRTA 4E7RG 4BAKB 5DK1A 1NFYA 3MU0A 1HAOH 5FBIA 3A86A 3CS0A 2Z6BD 1UVUH 4Y71A 1XXFA 1YPHC 2AGIX 1RXPA 3F1SB 1YBWA 1ZSKA 3ATKA 3FP8E 5C5NA 3O8RA 1UTPA 1FMGA 2ANMH 1HJAC 2ZFRH 1S81A 3RXPA 1O2PA 3MI4A 5EW2H 4NCYA 4ZMAH 1OSSA 5FPSA 3ODFA 1NT1A 2VH6A 3RXKA 4MDSA 5EW1H 1DSTA 1YYY1 4H6TA 3ZV9A 3MNSA 1TBRH 1O5CB 1YF4A 1GHZA 1O3FA 3RXRA 3MFJA 2FI4E 1LDTT 4U30A 2FOMB 4AG2A 4NIWA 2WYGA 3RXCA 2FTMA 1DSUA 1TPPA 2FYRA 4MPVA 5T3HA 1B5GH 1AO5A 4Z0KA 3GISB 2I6SA 3DD2H 3BTWE 1RD3B 5JB9S 4JYVH 3QZRA 2PLXA 3PMAB 1PPEE 1W11U 3DUXH 1H1BA 2WPHS 2CMYA 4B1TA 1DLKB 2GV6A 1DICA 1XVOA 4TYDA 1FJSA 2UUFB 1K1NA 1T8LA 1HXEH 2XC5A 2PGBB 4D7FA 1GI6A 1PYTC 1MAYA 3D49H 3GCOA 3H7TA 1C1SA 3B23B 1DUEA