2BLVA

Trypsin before a high dose x-ray "burn"
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Improving Radiation-Damage Substructures for Rip.
pubmed doi rcsb
molecule tags Hydrolase
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2005-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2blvA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2blvA02
4AX9H 1WQVH 2NU0E 4CRCA 1ZHMA 3V12A 4TY7A 2BVXH 2WINI 1C5UA 2ZHFH 1S5SA 1C5TA 2ZFPH 2FI3E 2Z3EA 2SGAA 1LVOA 1C1SA 5C20A 4A7IB 2UUFB 2FOCA 2IJOB 2ZGBH 2FTLE 4F49A 1YLCA 5EPYA 1WU1A 3TGIE 1PQ7A 2P16A 3T5FH 1ZTKA 1P0SH 1F7ZA 1ZGIA 2G4UA 3T26A 3TIUA 3ZZ7A 1OWHA 1ZMNA 4R8TB 4ZMAH 3GCHC 2ZKSA 2XC5A 3PROA 1OOKB 4NZLA 2HNTE 2FO9A 1C2IA 4FU8A 5DP6A 2FI5E 2BOKA 4DW2U 3AAUA 4UFGH 1GGDC 1H4WA 3OY6U 1WCZA 1SQOA 4AN7A 1P3EA 1N8OC 2QY0B 2O8LA 2KAIA 4X1NU 4FUFA 3VGCC 2F9OA 1UTLM 1C5PA 1NTPA 1JRTA 2B8OH 1FIZA 2A5KA 2BXTH 3S9AA 2A4OA 1S84A 3GYLB 2O8TA 3U8RH 2VWOA 4IW4E 1DPOA 2FXRA 8KME2 2VIQA 4B2BA 2GDDA 1ARCA 2GCTB 4AFQA 2QF3A 3NUMA 4NFFA 4CR5A 1QRZA 2F91A 1P06A 5AHGH 3A7TA 1PYTD 1SC8U 4FUJA 3SNCA 1RFNA 5A09A 3RXKA 4XE4A 3FP8E 1BRCE 1U6QA 2PWXA 4NWLA 4FUCA 3A8CA 4D7FA 2JETB 1HYLA 4MLFB 2ZO3H 1C9TA 1KY9A 1OWKA 3LOXA 2K1QA 4BAHB 1XXFA 2A4RA 4I31A 1NFWA 2AS9A 4Q7ZA 1C2LA 1UVPA 3RXRA 3U1IB 3S69A 1QQ4A 4D76A 2GD4B 4X6OA 5C5OA 4IN1A 2BQ7B 3K65B 2UWPA 1KXEA 4MPWA 4E7RG 2IPHA 1CT4E 1HAHH 2BDGA 1HAVB 4WJG2 2Z9LA 2BY6X 2FLRH 2O8MA 4YOGA 5C1XA 3SQEE 1G2LA 3LGVA 2A0QB 4B73A 2Z7FE 1TX6A 4ESTE 2A4QA 1HAIH 3UR9A 1MZAA 3SORA 3P8GA 3NXPA 4ISOA 3CS0A 1ABJH 3OX7U 1YPLH 1P2JA 1C5VA 4B1TA 3VXFH 3STJA 4Q2KA 3TNTA 1C1MA 1UJ1A 3GY3A 1P02A 2VU8E 1IQIA 1TIOA 3JZ1B 1AE5A 2Y81A 4YT6H 3U8OH 1NM6A 4I8KA 1O5GH 1C1UH 5A8YA 4GHQA 1LQEA 3RXVA 1F0RA 1OWJA 3GY7A 5BPEA 3MO9A 1XVMA 1GI6A 4NWKA 2BDIA 1F0TA 2GVFA 2PUXB 1E38B 3M37A 5G4BA 5J4SA 1SOTA 1A3BH 4X8UH 3MNXA 1T31A 3S7HB 1GJ8B 5CE1A 3UWJH 3V7TA 1HGTH 3SU3A 3KQEA 2ZU3A 1KXCA 2F9BH 2WPKS 3ZV8A 1C1QA 2ODYB 3ITIA 2XNIA 4HZHA 1TBZH 4X2VA 2P8OB 1SQTA 1TWXB 4Y6DA 1T32A 1QB1A 2A32A 1LHDH 3RU4T 1L2EA 1ID5H 1T4VH 1THRH 3MNCA 4CHAB 1PPZA 4FUGA 3L33A 2FOBA 1T7CA 5DP5A 2SNVA 1O38A 1TX7A 1F0UA 2UWLA 1C1TA 1FY4A 2BY7X 3EA8A 1PQAA 1DDJA 1UVUH 4IN2A 1QJ6B 1H9LB 1ZLRA 5L2ZH 1W2KH 1ZSJA 1TB6H 1TGBA 1BA8B 4MNXA 4NFEA 1GMDG 2ZFQH 5EU8A 4NIXA 1EATA 1O2YA 1QIXB 1MU8B 3DHKH 5FPSA 3TU7H 1FN6A 1RTKA 1VR1H 4AORA 4JYTA 2PKAA 1SMFE 1VGCB 3SV7A 1NC6A 1KXAA 2GT8A 1QA7A 4WMFA 4KTSA 3RXFA 5T6DA 1GHAF 4PROA 1O2HA 3MH6A 1ESAA 2ANKH 1QA0A 1C1WH 1TA2A 1ELDE 3K2UA 2A2XH 2V3OH 1CA0B 3MU4A 4YTAA 2ZDMA 4O3TA 2WV4A 1O3FA 3SJKA 3O8DA 1YCPH 1XUHA 3UNSA 1YP9A 2NWNA 3MU0A 3ZVGA 4YM9A 2EC9H 2FOGA 6CHAC 2V3HH 4X6NA 3SV8A 2BD2A 2ZPQA 2P3UB 1CHGA 2ZWLH 1OP8A 1RXPA 1MKXK 1W3CA 1PYTC 3B9FH 1TABE 1AFQB 3SU1A 4BXSA 4K1SA 1J15A 1FAKH 1ANEA 3T2NA 3UQVA 2R3YA 1C9PA 1W0YH 2Q6DA 5E8EH 1BZXE 1WBGB 2QV1A 2ZFRH 5EXNA 3GCTF 3SHCH 3DT0H 1O3CA 1A61H 1BTUA 3ZZ3A 2STBE 4WMEA 1T4UH 1AD8H 2QXGA 1E35B 1GBHA 3UREA 3RXIA 3FZDA 2ZGCA 5A8ZA 1EB2A 4YT7H 2FOAA 4K1TA 2THFB 1FXYA 2TGAA 1NFUA 1PJPA 3RC4A 1UHBB 1A5IA 4MG3A 2C8XB 3SGAE 1ZHRA 1QURH 3P92A 4CRDA 1O3HA 1GI9B 1GHVH 2Y5GA 2TBSA 3EQ0H 4AG2A 2UUKB 2QIQA 4MNYA 2BDCA 1EP6A 1V2WT 1PQ5A 2XTTB 1BBRK 1CT2E 4FU7A 4Y8ZA 1G3BA 1SGQE 3ATLA 3ZVFA 5E0GA 3E1XB 1ZMJA 1QL9A 4RKJB 5DP7A 1ZTJA 1OX1A 1IQHA 3QTOH 4FVDA 2PSYA 3RXAA 1AGJA 5AVDA 4KKDA 2BD4A 1VITH 1F0SA 8GCHF 1O30A 2ZPSA 1NRQH 3TGKE 2ZU1A 3P8OA 1W13U 7GCHG 1RJXB 2CHAB 4ZKRU 5CHAC 2QCYA 3F6UH 4ZHMU 5EQQA 2CV3A 1RRKA 1A0HB 3M36A 1Z1JA 2BDYA 2ZTZA 4X1RU 3M5MA 5I46H 2HRVA 1C2KA 5SGAE 3KCGH 2H5DA 1O2OA 1P2MA 1S0QA 1OP2A 1Z6EA 5EQRA 2TGPZ 4A6LA 2R3UA 1GJDB 1S85A 4ZH8A 5C5NA 1D3TB 1S6HA 1UTPA 3Q77A 4U2WA 1VJAU 1O3IA 3UNRA 4Y10E 4YO9A 5FBEA 4DJZB 5PTPA 3FZZA 2FYQA 3GCTG 1O5FH 4XBBA 1TPOA 5FPTA 1AKSB 1S83A 4X8VH 2XW9A 3FVFB 3U9AH 1O2GH 1W14U 1DWBH 2Y7ZA 2PTNA 2DE8A 4FVBA 3TK5A 3MU8A 2P3FH 3F1SB 2O8UA 1QQUA 1FY8E 2J92A 2XCFA 5GCHG 4YOJA 2WYGA 1ELGA 1GCDA 1XMNB 1Q31A 3RC5A 1NRPH 3TH2H 2VVCA 3TJNA 3O8RA 1TPAE 1O3AA 4YLQH 1CA8B 1ESTA 1TQ0B 5B6OA 1C5YB 1O31A 1A3EH 3HKIB 2FX6A 1K1MA 4B2CA 4BANB 4ABAA 1UVTH 2VIDA 3M3VA 2HOBA 2BD3A 2BDBA 2HNTF 5HXFA 5FX6A 2ULLA 2ZHEH 4E05H 1A46H 3FANA 3TK6A 3RXJA 3TK9A 5EW1H 1HJ9A 1MZDA 4ABDA 4TY6A 1Q3XA 4KTCA 5TCCA 4AOQA 2FPZA 1MQ6A 1W10U 1IAUA 3I29A 4CRGA 2B9LA 1EAIA 2Q6GA 3UOUA 4HTCH 3BG4B 1QBNA 4R0IA 2BYAX 1KXBA 2ZU4A 3E91A 1TMUH 4YOIA 1QBVH 1CHOF 1O3OA 1E36B 1H8IH 2ZNKH 1C5LH 5LPFA 5J4QA 3NCLA 1V2OT 2R2WU 4NSYA 1Y3WA 3NKKA 3LJOA 3PMHB 3BIUH 3A85A 5BRRE 2FS9A 3RXTA 2H6MA 3PTBA 2QXIA 5F8ZA 3ZZ5A 1OS8A 1OYTH 2A4GA 1TNIA 2FOFA 1M9UA 1O5CB 2BHGA 1F2SE 3P95A 2AMDA 1YLDA 1ABIH 1ZHPA 3A89A 4FUIA 3H7TA 1K1NA 5FXLA 4ISHH 4VGCC 3ZVEA 4OS1A 1SLUB 1TBQH 1O3GA 5L30H 4LOYH 4WH8A 2W26A 1P57B 2Y5FA 2H1UA 2D26C 1BTYA 1C1VH 2B0FA 1GI4A 1MU6B 3BG8A 1ETRH 1HB0B 1RIWB 1GHBG 1MTNB 1V3XA 4MVNA 1MTWA 1IHSH 2ZGXH 3D65E 4XSKU 2A7CA 2CF9H 1Y5BT 3A80A 3PMJA 2RG3A 2J38A 1NFYA 2AGIX 5E0JA 1K1OA 1IQLA 4NA7A 2BD8A 1PPCE 4IC5A 1UO6A 2EEKA 1INCA 4I8HA 1AU8A 1EZXC 2GP9B 1EKBB 1UHBA 5JBCS 1C5MD 4MNVA 1LVBA 4Y0ZE 2VWMA 2AIPA 3A8DA 1GBAA 8ESTE 2PW8H 2BDAA 3LPRA 3QLPH 2ZU5A 4X1SU 1SQAA 4E06H 1YPMH 3HK3B 1AQ7A 1THPB 1QL8A 3U8TH 1EUFA 3URCA 1GJ7B 4A5TS 1KTSB 2BLQA 1QR3E 2HWLB 2OC8A 5GXPA 1SPJA 3LU9B 1H9IE 3ESTA 2Z9JA 1EQ9A 1QB9A 1C2HA 3A8AA 5FHTA 3SI4H 3RXMA 1O2PA 1RTLA 1BMAA 1LHFH 1TMBH 2ZF0H 1LPGB 1XX9A 4NGAH 5LGOA 2ZDAH 1JXPA 1GBKA 1DE7H 4Y7BA 1NO9H 1O2IA 2BY8X 4INKA 1ELFA 1SFQB 3W94A 5H4IB 2Y82A 3EDXB 2UUJB 3DUXH 1QTFA 1A5HA 3SJ9A 2SGPE 3F9HA 2XWAA 4LXBH 1E34B 1IQGA 2GT7A 2V0BA 1BOQA 2W7UA 3K9XB 1IHTH 4OS6A 2ESTE 2P93A 1GI0A 4JK6A 3GOVB 4ZAEA 5EOKA 1FY5A 1TRMA 3MU5A 2A45B 2XRCA 1XUFA 4MPVA 1D6WA 1V2QT 4A92A 4GCHG 1VZQH 1SGRE 4MNWA 6GCHG 2AIQA 3QTVH 1W8BH 3BIVH 1KDQB 1AB9B 1T8NA 3R3GB 4MPUA 1AKSA 1TONA 2RA0A 4CRFA 4UONA 5LPRA 3FP7E 3SI3H 2JH5D 1DSUA 1O39A 3N7OA 1CGHA 4XFQA 3BTGE 3QK1A 2ZHQH 1GMHG 1V2LT 1HAGE 4I7YH 1VCWA 2FEQH 3UWIA 2TIOA 3IWMA 2OXSA 1MTSA 3BTFE 1ELBA 5EXMA 4Y8XA 1TPSA 3ATMA 2VGCB 1C1RA 3EAJA 3LH1A 1QY6A 1O3BA 1G3EA 4BAMB 4F4OC 2GCHF 1BJUA 3ZZBA 1Z1IA 1J17T 1KTTB 2ZC9H 1B0FA 3H5CB 3OTJE 1DVAH 2Y7XA 2OQ5A 3SNEA 2Y6TA 2ZU2A 5A2MH 1CO7E 1G37A 3SZNA 1BBRE 2VNTA 3TH3H 1AVGH 2C93B 2CXVA 1UCYK 1O34A 4GVUA 1TRYA 1L1NA 2BX3A 3GDVA 3PO1C 3V0XA 5EPNA 1FN8A 1Y3YA 1O0DH 2QGRA 3LGIA 7KMEH 5L2YH 4E7NA 5A0AE 3BTHE 2J4IA 2W3KA 5E0HA 3SUDA 1DOJA 1ZRBA 1ELEE 1V2MT 2B5TB 1GG6C 1K9OE 3AVZA 1AIXH 1EJMA 4ZXYH 2AYWA 1HV7A 3UFAA 5HYOA 1SBWA 2ZI2H 4WF8A 1SGFA 1SL3A 1MUEB 2ALVA 2DE9A 4GHTA 1KYNA 4O3UA 4Q7YA 3F68H 2WPHS 1AUTC 2OINA 3M5LA 3MU1A 1OXGA 4JCNA 3RXUA 4HFPB 4TPYA 3BTEE 3DFLA 3SNDA 2W7SA 1EPTB 3A81A 1C1OA 4YZUA 1A1RA 1DX5M 2AH4X 4WWYA 1AWHB 3L3TA 3M3SA 1DANH 5IYTA 1QRXA 3GICB 3TJVA 1RD3B 2PKSC 2FZZA 1IQMA 3QGNB 3BN9A 1ETSH 1GI5A 1OKXA 1UVOA 5DO4H 2BQ6B 2QN5T 1CU1A 1TBRH 1RGQA 4ZKOU 1O2SA 1SLXB 1NU9A 3LKWA 4KELA 1C5QA 2BZ6H 1MKWH 4K5ZA 4ISIH 1P09A 3MOCA 3SBKA 5L6NH 3GY4A 2ZFSA 1VITF 1GI7B 1O2VA 4AZ2B 1BHXF 4DIIH 1KXFA 2HLCA 1ANCA 1NN6A 1ELAA 3SUFA 1BMNH 1G9IE 2D2DA 2ZQ1A 1C2GA 1F5KU 8LPRA 2EI7A 2Y80A 2GMTB 1P01A 4BAQB 4YESB 1QCPA 1JRSA 1V2KT 4BTUB 3GCOA 1ZJDA 3HPTB 3HGPA 1BQYA 1GJ4H 3ATWA 1NFXA 3U1JB 1ARBA 1V2ST 3SJIA 1BMLA 1F5RA 3JZ2B 4LZ1H 1DSTA 1EXFA 1YBWA 4ZHAA 1MCTA 1ZOMA 5EG4A 4B75A 2OD3B 1TALA 4O97A 1GBTA 1XUGA 1YCPM 3M3TA 1O3MA 5F8XA 1ZGVA 1ZZZA 2ZEBA 5HM9A 1NU7B 1LQDB 5T6GA 4K69A 5A0BA 2J94A 2BD5A 3Q3XA 4X1PU 4ABJA 1XUKA 4UDWH 1CT0E 1DUAA 1GBFA 3ZZCA 1GCTC 1LKBA 2XC4A 1TLDA 1F5LA 1N8OB 1UTOA 1NZQH 2JH0D 2H2ZA 1ORFA 2FLBH 3MNSA 5GPIB 1HJAC 5TJXA 2SGFE 1E37B 4AGKA 1DM4B 4UFEH 1W7XH 1OYQA 1P2IA 3LT3A 5K7RA 1DLEA 2G52A 1V2NT 2HVXA 4INHA 4OS2A 2AGEX 1OWIA 1BMMH 3LC5A 1LCYA 1EZUC 5C1YA 3SHAH 4ZUHA 3M7UA 1NS3A 1TX8A 1SGTA 4ZXXH 1NPMA 1LPKB 3D23A 4K60A 1TOMH 1T8LA 3GCHB 1KLIH 4XBDA 1Z71A 3GY5A 4GPGA 2ZPRA 1BUIA 1P9UA 4H42U 4OS7A 3BV9B 2HGTH 1A4WH 1KDQA 2HPQH 1BTHH 3PMBB 5F6MA 1GGDB 3ZVDA 3KF2A 5DK1A 4NA9H 1A2CH 1YYY1 1Z7KA 1O5EH 3VGCB 4Q80A 1QNJA 4J2YB 2OTVA 3SU5A 2FOEA 1C5XB 1T8MA 2H5CA 1LVMA 2ZA5A 1QGFA 2FWWA 3LC3A 2F9UA 1Y5AT 1K1IA 1P2QA 5AFZH 2GTBA 2G4TA 1XVOA 1GBCA 3IITA 2ASUB 4ISNA 1E0FD 1TNHA 4AFUA 1V2VT 1GHAG 1XUJA 1C5ZB 1PPHE 3OYPA 1K1JA 2GZ8A 3RC6A 2NU3E 1CGJE 3PWCA 4RKOB 3P70B 3E0NB 4WXVA 2XYAA 2ZFTA 2NU1E 3RLYH 4TYDA 2ZHDA 1WAYB 1LMWB 1SGDE 1Z8IB 4J1YA 4BXWA 1WYKA 3KQCA 1CVWH 3OY5U 2A5AA 3PTNA 3QN7A 2OUAA 1K1PA 1TAWA 1HAVA 1SGNE 3F9GA 1G2MA 1SGCA 2F3CE 2IOTA 1PQ8A 2QF0A 5AFYH 1A0JA 2AFQB 3TJUA 1WV7H 2FP7B 2ZHWH 4AB8A 3A86A 3A8BA 4DOQA 1OPHB 4SGBE 2FODA 4Z6AH 1HXFH 1UVSH 1FDPA 5F8TA 1DWDH 1AN1E 1TNJA 1DITH 2XCNA 1O2UA 1SGFG 1BHXB 4JZ1A 4DGJA 1VCPA 3ZYDA 1FNIA 3M7TA 3E8LA 1O2TA 4CH8B 3OSYA 1WSSH 4X8SH 3ZZ6A 2BTCE 5DP9A 1HIAB 1P9SA 4H6TA 1FI8A 2FTMA 3GDSA 3FFGA 2G51A 3SO3A 3UR6A 2OC1A 3O8CA 2OP9A 1C2DA 1QRWA 2GZ9A 1MD7A 1VJ9U 1OWEA 1UTNA 4NIVA 3ELAH 1MAYA 1EPTA 5C67A 1GVZA 3AW0A 1G30B 1O5DH 2FOHA 1V2JT 2QXHA 3PB1E 3W95A 2GCTC 2G8TA 5A8XA 3S9BA 4U32A 2VGCC 2C4FH 1HDTH 2TRMA 3K6YA 1XXDA 1THSH 1O2XA 2Z9KA 3RXDA 3Q00A 2CF8H 3SW2B 1V2RT 1O2KA 2JETC 1O37A 3GISB 4FU9A 1IQFA 4YLUA 2ODQA 3A84A 4ZKSU 4A1XA 1SOZA 1EAWA 2GX4A 2CGAA 3VEQB 3T29A 2OLGA 8GCHG 2A1DB 4IMQA 1HNEE 2LNCA 4Y7AA 3TVJB 1LO6A 1C4V2 1ZMLA 4K2YA 5JB8S 1Y5UT 3RXPA 2TGDA 1TGSZ 1S81A 1K22H 5JPMH 3SNBA 2GZ7A 2H9HA 1S82A 4XOJA 4UFFH 1GJCB 4NCYA 2R0LA 3MO6A 3S0NA 5HMAA 5GDSH 3KHVA 1GBIA 3RM0H 1MBQA 3U69H 2F9VA 1NRNH 1RS0A 1ELVA 3F9FA 2OC7A 4TPIZ 1DWEH 3URDA 1YF4A 1AVWA 3E90B 1ZPBA 3OU0A 3MH4A 4ZROA 1AZZA 2SGQE 1GI1A 1P3CA 4X2YA 1FMGA 1HCGA 1D6RA 1O3JA 1ELCA 3HKJB 5ESBA 2A31A 4CBOA 2VIPA 1GHXH 3PLBA 1DS2E 3QZQA 5DP3A 1G32B 1LKAA 4DG4A 4NIWA 3BEFB 5I25A 2R9PA 1P2NA 1SI5H 3A83A 1FY1A 6LPRA 6CHAB 3GYMA 1NROH 3M5OA 3UOPA 2C8WB 2P8OC 1C1PA 1ZSLA 4NZQA 5IDKA 1C5SA 1FPCH 2XBWA 3VB5A 1SGEE 2A7JA 1WTGH 4HI3A 5DKMA 4CHAC 1C5NH 2P94A 3LJJA 3QWCH 3DFJA 1SB1H 1V6DA 1ACBE 2J95A 3RU4D 3SUEA 3ZZ9A 2ZDKA 2PHBA 3A7VA 2VB0A 3C1KA 1EB1H 3EGKH 1BDAA 2XWBI 4MQAA 1J16A 1QBOA 1C2MA 1N6XA 7ESTE 4KP0A 1FAXA 1HXEH 4AYYB 1BJVA 1SFIA 1V2TT 1XM1A 2XBVA 3LH3A 4M7GA 1HAPH 1SGYE 1DXWA 5GJ4B 1KLTA 1MKXH 2EA3A 3BEIB 1YCPK 1SR5C 2TPIZ 9ESTA 4KTUA 1PPBH 3SU4A 3O8BA 1IOEA 4X8TH 1CHOG 1FLEE 3ZVCA 1Z6JH 2YOLA 1OWDA 1VGCC 1D3QB 1O3LA 2RCEA 3I77A 1EOJA 2LPRA 3D49H 5EGMA 1DLKB 2VIWA 1BRUP 1GHZA 4DURA 1SG8B 4IS5A 1S0RA 1MTVA 1TGNA 1CA0C 4I8JA 3A88A 1XKBC 5JBBS 2BY9X 3ODFA 4UE7H 1MD8A 1C5RA 1TRNA 2D1JA 4HGCA 1W7GH 1TNLA 1L4DA 5HM2A 4JMYA 1AFQC 4OS4A 3RDZA 1HBTH 2Z3CA 4ABFA 1AO5A 2JH6D 2BM2A 1Q2WA 3PLKA 5CHAB 1GHWH 3SJ8A 1FIWA 4OS5A 2BLVA 3IG6B 3A82A 1BBRH 1GVKB 2V6NA 3A7WA 3SGQE 1O35A 1YPGH 1JWTA 3ZVAA 4FUBA 3SGBE 1QFKH 2BLOA 3BTME 2EI8A 1C5OH 1GVLA 5JB9S 1B7XB 3LIWA 2QAAA 2FOMB 3EYDA 1BB0B 2YNBA 2VIVA 3SOSA 1JOUB 1P10A 2YNAA 4DY7B 2I6SA 1TPPA 4X1QU 1WOFA 1O2RA 1UTJA 1P8VC 2P59A 1C1NA 2SGEE 2ZQ2A 4Z0KA 5F03A 2BY5X 3V3MA 3KN2A 1Z8RA 1YPJH 1QL7A 1HIAA 4NIYA 3CP7A 4I8LA 1P11E 5DG6A 1EZSC 2J9NA 1CGIE 1TGTA 3RM2H 1PFXC 1FY3A 2XXLA 3QX5H 1Z8GA 5FBIA 1OP0A 2WV5A 4ABEA 1ANBA 3RUOA 5C1UA 1ELTA 5JBAS 2A7HA 2ALPA 1L1GA 3VXEH 4RSPA 1K28D 3EA7A 4B71A 1KXDA 3KQDA 1FJSA 4BNRA 2VH0A 2CMYA 2J2UA 2Q6FA 3L6PA 2QYIA 1GBMA 4DT7B 1QJ1B 2BQWB 3RMOH 4WVPE 1L4ZA 3ZVBA 4SGAE 3LGWA 4JZFH 1GDNA 3ZZ4A 3T27A 2ZFFH 4ABBA 2W3IA 2CHAC 4Y8YA 4I33A 1GWAA 4ZHLU 3TGJE 1ETTH 2D8WA 4BAOB 1K1LA 2STAE 4LK4A 1BRBE 2NU4E 1AVXA 3P6ZB 1GMDF 2B7DH 2SNWA 1ZSKA 1C5WB 1EJAA 3S9CA 2A5IA 3RP2A 1GI3A 2ZGJA 3ZV9A 1GBEA 2TGTA 2UUYA 1YPHE 4DCDA 1HUTH 4D9RA 1DWCH 4AB9A 4LZ4B 2G81E 4Y76A 7LPRA 3BTWE 2AEIH 1BTZA 4AGJA 1HPGA 2BX4A 1UTKA 1DUEA 3PV4A 1TNKA 2H9EH 3E6PH 3RMNH 3VB3A 4IBLH 2ZGHA 5CMXH 2OC0A 1IQJA 1W11U 5DP8A 1GHYH 1NRSH 2ZG0H 1MCVA 1SLWB 3VB7A 3RXOA 1O2ZA 3RXGA 5TCAA 1AUJA 2VIOA 1Y8TA 2M5TA 1WUNH 1AE8H 1PPEE 5DPAA 3GY8A 4XBCA 1A5GH 3LGUA 5JYIA 3SV2H 2GGVB 4DIHH 5EODA 3I78A 3KL6A 4JZDH 5K0HA 1TA6A 4VGCB 1UK2A 1LDTT 3G01A 1T8OA 3NK8A 4AFSA 3SV6A 1AY6H 1O5AB 3E0PB 2ZDVH 4CREA 1CSOE 1SGIB 2ZDNA 3RXHA 1G3DA 3NWUA 5HGGA 3ZYEA 4WXIA 1LPZB 3CS7A 3TNSA 2PGQB 5DGJA 4X0WU 2H9TH 1AZ8A 1O2QA 2F83A 3GY2A 3ZZ8A 2NU2E 4I8GA 2GCHG 1JBUH 1F92A 3ODDA 2ZCHP 3RXSA 3BG4C 1YKTA 4JK5A 1NRRH 1GBLA 2ZZUH 3KQBA 4U01A 3AASA 1DICA 2PFEA 4Y79A 1GBBA 1UMAH 1KIGH 2ANYA 2FM2A 2WYJA 1TYNA 1G3CA 3HGNA 3A7XA 1FPHH 3AW1A 3Q3YA 1HLTH 1O2JA 1IQNA 2BVSH 2CJIA 3RXQA 4GSOA 2BMGB 1SGPE 1TGCA 2BB4A 5JDUB 1ZTLA 1HFDA 4X2XA 4B2AA 2HPPH 1C4U2 3EE0B 1ZYOA 3SV9A 2V35A 3MYWA 2ANMH 4WH6A 1TMTH 2RDLA 2WUCA 4FXGH 3P17H 6ESTA 3HATH 3M61U 2Z94A 2GDEH 4JYVH 1AHTH 3NPSA 3DD2H 1TE0A 1O33A 4NSVA 4UEHH 3BTQE 5DP4A 2GV7A 4MTBA 1P05A 5LH8A 1C2EA 2XBXA 3WY8A 2BZAA 3M7QA 7GCHF 1NESE 4WMDA 1BIOA 3GCNA 4FUHA 1GI8B 3M5NA 1CBWB 1ZRKA 4BTTB 4MPXA 2BOHB 1O2MA 2W5EA 1Y59T 4B74A 1TNGA 2OBOA 1GDQA 2PGBB 2JKHA 1AFEH 1SSXA 1XUIA 4IGDA 1NY22 4IMZA 4GUXA 3A7YA 5ESTE 4CRAA 4WY3A 2C3SA 1GJ6A 3BSQA 1IQEA 1X7AC 4K8YA 4CR9A 2OBQA 3QGJA 1JMOH 1RIWC 3B23B 1MTNC 3PWBA 2PUQH 3MTYA 4TWWA 1L0ZA 2VWLA 1AI8H 1KSNA 3VB4A 1BTPA 3RLWH 3RXBA 3PM3A 4FUEA 1GBJA 2ZTYA 3ENSB 3SU6A 3V13A 1NT1A 2F9NA 4QT8C 1P12E 1VITG 1UK4A 2PTCE 5ETXA 5JBTA 4DVAU 5GCHF 3Q76A 2VJ1A 4NA8A 1O5BB 4A1VA 3RXEA 1FZZA 2F9PA 4CBNA 1HAYB 1BTWA 1AMHA 3MHWU 4IC6A 3ATIA 3MFJA 1H9HE 2BD9A 1C2JA 1LVYA 2FDAA 1K21H 2ILNA 5FPYA 1HJ8A 3S7KB 2A2QH 1FV9A 1O2NA 1BTXA 1ZJKA 1TFXA 2Z9IA 3VPKA 2XBYA 1FONA 4Q7XA 3MH5A 3AAVA 3K6ZA 1DY8A 1GMCF 1O32A 2CN0H 3LGYA 4X2WA 2ZTXA 2VVVA 4D8NA 1JIMA 1H1BA 2WPMS 3PMAB 4BOHA 1O2WA 1W0ZU 2WUBA 1A7SA 4O03A 3RXLA 1GJ5H 4XDEA 3TPIZ 1D3PB 2QC2A 3E16B 2C8ZB 3A7ZA 1C2FA 1HAZB 4INLA 1GPZA 1GL0E 3PO1B 3BTDE 1TOCB 4JZIA 3BTTE 3Q3KA 2QA9E 2HNTC 2Z3DA 1MTUA 1L1JA 4K8BA 5AF9H 4ISLA 1FUJA 2HALA 4A1TA 3MWIU 3CENA 3STIA 1GG6B 2BLWA 5EW2H 1V2UT 3TITA 1LHCH 2DUCA 4OGXA 3MI4A 1G36A 1QHRB 1SVPA 3KGPA 3QUMP 2ZIQH 2P95A 3HK6B 1KLJH 3SJOA 3MNBA 4CRBA 1O36A 2SFAA 1UCYH 1UTQA 5C3NA 3QDZB 3RXCA 1UTMA 3RU4E 1AB9C 1DY9A 2Y5HA 1CE5A 3KNXA 1EX3A 4JZEH 1SLVB 3SU0A 1MH0A 2KAIB 4Y11E 1V2PT 1QB6A 3GDUA 1B0EA 2VWNA 2PV9B 2VVUA 3SN8A 3RMLH 1HRTH 2AERH 1ZR0A 3M35A 3B8JA 2XC0A 3BEUA 1RTFB 2WPJS 1P04A 1YPEH 2VINA 3UTUH 3T28A 2PR3A 5ABWA 1GHBF 1UK3A 1QJ7B 1K2I1 1EP5A 1YPHC 2PKSB 2ZDLA 4UFDH 3BTKE 4AFZA 3KEEA 1EAUA 1XKAC 1GBDA 2G55A 4UD9H 3TLOA 4X6MA 1TQ7B 3SU2A 1LHEH 5FCRA 1Y3XA 3FAOA 2AGGX 4MDSA 4O9VA 4THNH 2EI6A 1EJNA 4D9QA 4Y0YE 3EA9A 3VFEA 1IQKA 1ZPCA 3ATKA 1MAXA 1YGCH 1GMCG 5E2PA 4RN6A 5DJ7A 4K3JA 2G00A 3PYHA 1LTOA 1UCYE 5T3HA 1WQSA 5FX5A 3H7OA 3LGTA 3PLPA 3U98H 5EXLA 1HAXB 1O3EA 3UPEA 1N1LA 4TWYA 2G5NA 5E2OA 4ABIA 5GWZA 1O2LA 1GDUA 1ESBA 3SNAA 2OQUA 1B5GH 1AWFH 1BITA 3T25A 5GIBA 1ANDA 1W12U 1O3NA 1J14A 1CQQA 1J8AA 3KIDU 1H8DH 1MBMA 1OSSA 1EZQA 1MKWK 1SHYA 3BF6H 4NG9H 3ZZAA 4ZKNU 1VCQA 2FIRH 3R0FA 3NZIA 1EPTC 5EQSA 2OCVB 2FMJA 2O8WA 3UUZA 2QXJA 1P03A 2PLXA 1D9IA 3P8NA 3MH7A 3LONA 5FCKA 2GV6A 1GJBB 2IN2A 4OGYA 1O3PB 2GKVE 3UIRA 1C4Y2 1P2KA 2C8YB 1GJAB 2BD7A 1P2OA 1N6YA 4D7GA 1GCTB 1O3DA 2VH6A 3UNQA 3E3TA 1FQ3A 1PPFE 3QZRA 1D4PB 1EASA 1HJAB 2Q1JA 4H6SB 5LPEA 3DA9B 1BT7A 2BDHA 1A0LA 3T62A 2WPIS 2FYRA 2Z9GA 3D62A 1LHGH 1WTHD 3GY6A 3RMMH 1DXPA 1Y3VA 2FS8A 4ABHA 4CH2B 9LPRA 4FUDA 1DT2A 2R0KA 3F9EA 1S6FA 1BRAA 2FX4A 3QO6A 4GCHF 6GCHF 3MMGA 4KGAA 1YM0A 4AG1A 1JIRA 1PPGE 3TJOA 2AMPA 2GMTC 2I6QA 4BAKB 1GJ9B 1BCUH 1GMHF 2R2MB 3ZZDA 2ZCLP 1YC0A 4BTIB 4I32A 4X6PA 2ZP0H 1SHHB 1HAOH 3LDXH 1D3DB 4ABGA 4U30A 3MO3A 1GI2A 1J9CH 2FESH 1GL1A 1YPKH 2FI4E 2SGDE 2PKAB 2P3TB 2AMQA 5A0CA 3A87A 3SQHE 3VB6A 2O9QA 2G5VA 2ZECA 2Z6BD 4ASHA 4Y71A 4H4FA 1O3KA 2BVRH 2J34A 3UY9A 2WPLS 4GLYA 3UQOA 3P8FA 4AYVB 3TH4H 2ODPA 5FAHA 1MMJN 1EOLA 5C2ZA 2UWOA 1DFPA 2C90B 2RA3A 3FP6E 1EAXA 4JYUH 1MQ5A 4K1EA 3C27B 1CBWC 2PSXA 1Y3UA 2ZCKP 3SUGA 1ZPZA 2BXUH 4B76A 4GAWA 1Z8JB 5T6FA 2ANWA
chains in the Genus database with same CATH superfamily
4AX9H 1WQVH 2NU0E 4CRCA 1ZHMA 3V12A 4TY7A 2BVXH 2WINI 1C5UA 2ZHFH 1S5SA 1C5TA 2ZFPH 2FI3E 2Z3EA 2SGAA 1LVOA 1C1SA 5C20A 4A7IB 2UUFB 2FOCA 2IJOB 2ZGBH 2FTLE 4F49A 5B6LA 1YLCA 5EPYA 1WU1A 3TGIE 1PQ7A 2P16A 3T5FH 1ZTKA 1P0SH 1F7ZA 1ZGIA 2G4UA 3T26A 3TIUA 3ZZ7A 1OWHA 5F53A 1ZMNA 4R8TB 4ZMAH 3GCHC 2YMSC 2ZKSA 3FKSD 2HLDD 2XC5A 3PROA 1OOKB 4NZLA 2GJGA 2HNTE 2FO9A 1C2IA 4FU8A 5DP6A 2FI5E 2BOKA 4DW2U 3AAUA 4UFGH 1GGDC 1H4WA 2V3MA 3OY6U 1WCZA 1SQOA 4AN7A 1P3EA 1N8OC 2QY0B 2O8LA 2KAIA 4X1NU 4FUFA 3VGCC 2F9OA 1UTLM 1C5PA 1NTPA 1JRTA 2B8OH 1FIZA 2A5KA 2BXTH 3S9AA 2A4OA 1S84A 3GYLB 2O8TA 3U8RH 2VWOA 4IW4E 5IK2D 1DPOA 2FXRA 8KME2 2VIQA 4B2BA 2GDDA 1ARCA 2GCTB 4AFQA 2QF3A 3NUMA 4NFFA 4CR5A 1QRZA 2F91A 1P06A 5AHGH 3A7TA 1PYTD 1SC8U 4FUJA 3SNCA 1RFNA 5A09A 3RXKA 4XE4A 3FP8E 1BRCE 1U6QA 2PWXA 4NWLA 4FUCA 3A8CA 4D7FA 2JETB 1HYLA 3NRLA 4MLFB 2ZO3H 1C9TA 1KY9A 1OWKA 3LOXA 2K1QA 4BAHB 1XXFA 2A4RA 4I31A 1NFWA 2AS9A 4Q7ZA 1C2LA 1UVPA 3RXRA 3U1IB 2HVYB 3S69A 1QQ4A 4D76A 2GD4B 4X6OA 5C5OA 4IN1A 2BQ7B 3K65B 2UWPA 1KXEA 4MPWA 4E7RG 2IPHA 1CT4E 1HAHH 2J98B 2BDGA 1HAVB 4WJG2 2Z9LA 2BY6X 2FLRH 2O8MA 4YOGA 5C1XA 3SQEE 1G2LA 3LGVA 2A0QB 4B73A 2Z7FE 1TX6A 4ESTE 2A4QA 1HAIH 3UR9A 3OFND 1MZAA 3SORA 3P8GA 3NXPA 4ISOA 3CS0A 4XRNA 1ABJH 3OX7U 1YPLH 1P2JA 1C5VA 4B1TA 3VXFH 3STJA 4Q2KA 3TNTA 1C1MA 1UJ1A 3GY3A 1P02A 2VU8E 1IQIA 1TIOA 2IJD1 3JZ1B 1AE5A 2Y81A 4YT6H 3U8OH 1NM6A 4I8KA 1O5GH 1C1UH 5A8YA 4GHQA 1LQEA 3RXVA 1F0RA 1OWJA 3GY7A 3PRBA 5BPEA 3MO9A 1XVMA 5EJZA 5HIYA 1GI6A 4NWKA 2BDIA 1F0TA 2GVFA 2PUXB 1E38B 3M37A 5G4BA 5J4SA 1SOTA 1A3BH 4X8UH 3MNXA 1T31A 3S7HB 1GJ8B 5CE1A 3UWJH 3V7TA 1HGTH 3SU3A 3KQEA 2ZU3A 1KXCA 2F9BH 2WPKS 3ZV8A 1C1QA 2ODYB 3ITIA 2XNIA 4HZHA 1TBZH 4X2VA 2P8OB 1SQTA 1TWXB 4Y6DA 1T32A 1QB1A 2A32A 1LHDH 3RU4T 2CK3D 3WWFA 1L2EA 1ID5H 1T4VH 1THRH 3MNCA 4CHAB 1PPZA 4FUGA 3DSPA 3L33A 2FOBA 1T7CA 5DP5A 1SKYE 2SNVA 1O38A 1TX7A 1F0UA 3N7DA 2UWLA 1C1TA 1FY4A 2BY7X 3EA8A 1PQAA 1DDJA 1UVUH 4IN2A 1QJ6B 1H9LB 1ZLRA 5L2ZH 1W2KH 1ZSJA 1NBMD 1TB6H 1TGBA 1BA8B 4MNXA 4NFEA 1GMDG 2ZFQH 3SYJA 5EU8A 4NIXA 1EATA 1O2YA 1QIXB 1MU8B 3DHKH 5FPSA 2QF4A 3TU7H 1FN6A 1RTKA 1VR1H 2KZ4A 4AORA 4JYTA 2PKAA 1SMFE 1VGCB 3SV7A 1NC6A 1KXAA 2GT8A 1QA7A 4WMFA 4KTSA 3RXFA 5T6DA 1FX0B 1GHAF 4PROA 1O2HA 3MH6A 1ESAA 2ANKH 1QA0A 1C1WH 1TA2A 1ELDE 3K2UA 2A2XH 2V3OH 1CA0B 3MU4A 4YTAA 2ZDMA 4O3TA 2WV4A 3UB0A 2EY4C 1O3FA 3SJKA 3O8DA 1YCPH 1XUHA 3UNSA 1YP9A 2NWNA 3MU0A 3ZVGA 4YM9A 2EC9H 2FOGA 6CHAC 2V3HH 4X6NA 3SV8A 2BD2A 2ZPQA 2P3UB 1CHGA 2RDEA 2ZWLH 1OP8A 1RXPA 1MKXK 1W3CA 1PYTC 3B9FH 1TABE 1AFQB 3SU1A 4BXSA 4K1SA 1J15A 1FAKH 1ANEA 2KCAA 3T2NA 3UQVA 2R3YA 1C9PA 1W0YH 2Q6DA 5E8EH 1BZXE 1WBGB 2QV1A 2ZFRH 5EXNA 3GCTF 3SHCH 3DT0H 1O3CA 1A61H 1BTUA 3ZZ3A 2STBE 4WMEA 1T4UH 1AD8H 2QXGA 4AC9A 1E35B 1GBHA 3UREA 3RXIA 3FZDA 2ZGCA 5A8ZA 1EB2A 3KYFA 4YT7H 2FOAA 4K1TA 2THFB 1FXYA 2TGAA 1NFUA 1PJPA 3RC4A 1UHBB 1A5IA 4MG3A 2C8XB 3SGAE 1ZHRA 1QURH 3P92A 4CRDA 4Z1MD 2KFWA 1O3HA 1GI9B 1GHVH 2Y5GA 2TBSA 3EQ0H 4AG2A 2UUKB 2QIQA 4MNYA 2BDCA 1EP6A 1V2WT 1PQ5A 2XTTB 1BBRK 1CT2E 3OEHD 4FU7A 4Y8ZA 1G3BA 5C94A 1SGQE 3ATLA 3ZVFA 5E0GA 3E1XB 1ZMJA 1QL9A 4RKJB 5DP7A 1ZTJA 1OX1A 1IQHA 3QTOH 4FVDA 2PSYA 3RXAA 1AGJA 5AVDA 4KKDA 2BD4A 2LELA 2JJ1D 1VITH 1F0SA 8GCHF 1O30A 2ZPSA 3H09A 1NRQH 3TGKE 2ZU1A 3P8OA 1W13U 7GCHG 1RJXB 2CHAB 4ZKRU 5CHAC 2QCYA 3F6UH 4ZHMU 5EQQA 2CV3A 1RRKA 1A0HB 3M36A 1Z1JA 2BDYA 2ZTZA 4X1RU 3M5MA 5I46H 2HRVA 1C2KA 5KEDA 5SGAE 3KCGH 2H5DA 1O2OA 1P2MA 1S0QA 2J98A 1OP2A 1Z6EA 5EQRA 2TGPZ 4A6LA 2R3UA 1GJDB 1S85A 4ZH8A 1W0JD 5C5NA 1D3TB 1S6HA 1UTPA 3Q77A 4U2WA 1VJAU 1O3IA 3UNRA 4Y10E 4YO9A 5FBEA 4DJZB 5PTPA 3FZZA 2FYQA 3GCTG 1O5FH 4XBBA 1TPOA 5FPTA 1AKSB 1S83A 4X8VH 2XW9A 3FVFB 3U9AH 1O2GH 1W14U 1DWBH 2Y7ZA 2PTNA 2DE8A 4FVBA 3TK5A 3MU8A 2L6OA 2P3FH 3F1SB 2O8UA 1QQUA 1FY8E 2J92A 2XCFA 5GCHG 4YOJA 2WYGA 1ELGA 1GCDA 1XMNB 1Q31A 3RC5A 1NRPH 3TH2H 2VVCA 3TJNA 3O8RA 1TPAE 1O3AA 4YLQH 1CA8B 1ESTA 1TQ0B 5B6OA 1C5YB 1O31A 1A3EH 3HKIB 2FX6A 1K1MA 4B2CA 4BANB 4ABAA 1UVTH 2VIDA 3M3VA 2HOBA 2BD3A 2BDBA 2HNTF 5HXFA 5FX6A 2ULLA 2ZHEH 4E05H 1A46H 3FANA 3TK6A 3RXJA 3TK9A 5EW1H 1HJ9A 1MZDA 4ABDA 4TY6A 1Q3XA 4KTCA 5TCCA 4AOQA 2FPZA 1MQ6A 1W10U 1IAUA 3I29A 4CRGA 2B9LA 1EAIA 2Q6GA 3UOUA 4HTCH 3BG4B 1QBNA 4R0IA 2BYAX 1KXBA 2ZU4A 3E91A 1TMUH 4YOIA 1QBVH 1CHOF 1O3OA 1E36B 1H8IH 2ZNKH 1C5LH 5LPFA 5J4QA 3NCLA 1V2OT 2R2WU 4NSYA 1Y3WA 3NKKA 3LJOA 3PMHB 3BIUH 3A85A 5BRRE 2FS9A 3RXTA 2H6MA 3PTBA 2QXIA 5F8ZA 3ZZ5A 1OS8A 1BMFD 1OYTH 2A4GA 1TNIA 2FOFA 1M9UA 1O5CB 2BHGA 1F2SE 3P95A 2AMDA 1YLDA 1ABIH 1ZHPA 3A89A 4P02A 4FUIA 2WHXA 3H7TA 1K1NA 5FXLA 4ISHH 4VGCC 3ZVEA 4OS1A 4DT4A 1SLUB 1TBQH 1O3GA 5L30H 3FO8D 4LOYH 4WH8A 2W26A 1P57B 2Y5FA 2H1UA 2D26C 1BTYA 1C1VH 2B0FA 1GI4A 1MU6B 3BG8A 1ETRH 4I86A 1HB0B 1RIWB 1GHBG 1MTNB 1V3XA 1S6LA 4MVNA 1MTWA 1IHSH 2ZGXH 5DSFA 3D65E 4XSKU 2A7CA 2CF9H 1Y5BT 3A80A 3PMJA 2RG3A 2J38A 1NFYA 2AGIX 5E0JA 1K1OA 1IQLA 4NA7A 2BD8A 1PPCE 4IC5A 1UO6A 2EEKA 1INCA 4I8HA 1AU8A 1EZXC 2GP9B 1EKBB 1UHBA 5JBCS 1C5MD 4MNVA 1LVBA 4Y0ZE 2VWMA 2AIPA 3A8DA 1GBAA 8ESTE 2PW8H 2BDAA 3LPRA 3QLPH 2ZU5A 4X1SU 1SQAA 4E06H 1YPMH 3HK3B 1AQ7A 1THPB 1QL8A 3U8TH 1EUFA 3URCA 1GJ7B 4A5TS 1KTSB 2BLQA 1QR3E 2HWLB 2OC8A 5GXPA 1SPJA 3LU9B 1H9IE 3ESTA 2Z9JA 1EQ9A 1QB9A 1C2HA 3A8AA 5FHTA 3SI4H 3RXMA 1O2PA 1RTLA 1BMAA 1LHFH 1TMBH 2ZF0H 1LPGB 2WV9A 1XX9A 2KCPA 4NGAH 2ZDAH 5LGOA 1JXPA 1GBKA 1DE7H 4Y7BA 1NO9H 1O2IA 2BY8X 4INKA 1ELFA 1SFQB 3W94A 2QE7D 5H4IB 2Y82A 3EDXB 2UUJB 3DUXH 1QTFA 1A5HA 3SJ9A 2SGPE 3F9HA 2XWAA 4LXBH 1E34B 1IQGA 2GT7A 2V0BA 1BOQA 2W7UA 3K9XB 1IHTH 4OS6A 2EQNA 2ESTE 2P93A 3FOAA 1GI0A 4JK6A 2KX4A 3GOVB 4ZAEA 5EOKA 1FY5A 1TRMA 3MU5A 2A45B 2XRCA 1XUFA 4MPVA 1D6WA 1V2QT 4A92A 4GCHG 1VZQH 1SGRE 4MNWA 6GCHG 2AIQA 3QTVH 1W8BH 3BIVH 1KDQB 1AB9B 1T8NA 2XNDD 3R3GB 1AKSA 1TONA 2RA0A 4MPUA 4CRFA 4UONA 5LPRA 3FP7E 3SI3H 2JH5D 3KQ5A 1DSUA 1O39A 3N7OA 1CGHA 4XFQA 3BTGE 3QK1A 2ZHQH 1GMHG 1V2LT 1HAGE 3F0OA 4I7YH 1VCWA 2FEQH 3UWIA 2QF5A 2TIOA 3IWMA 2OXSA 1MTSA 3BTFE 1ELBA 1NBME 4Y8XA 1TPSA 5EXMA 3ATMA 2VGCB 1C1RA 3EAJA 2XOKD 3LH1A 1QY6A 1O3BA 1G3EA 4BAMB 1W0KD 4F4OC 2GCHF 1BJUA 3ZZBA 2KCYA 1Z1IA 1J17T 1KTTB 2ZC9H 1B0FA 3H5CB 3OTJE 1DVAH 2Y7XA 2OQ5A 3SNEA 2Y6TA 2ZU2A 5A2MH 1CO7E 1G37A 3SZNA 1BBRE 2VNTA 3TH3H 1AVGH 2C93B 2CXVA 1UCYK 1O34A 4GVUA 1TRYA 1L1NA 2BX3A 3GDVA 3PO1C 3V0XA 5EPNA 1FN8A 1Y3YA 1O0DH 2QGRA 3LGIA 7KMEH 5L2YH 4E7NA 5A0AE 3BTHE 2J4IA 2W3KA 5E0HA 3SUDA 1DOJA 1ZRBA 1ELEE 1V2MT 2B5TB 1GG6C 1K9OE 3AVZA 1AIXH 1EJMA 4ZXYH 2AYWA 3OTPA 1HV7A 3UFAA 4Q4LA 5HYOA 1SBWA 2ZI2H 4WF8A 1SGFA 1SL3A 1MUEB 2ALVA 2DE9A 4GHTA 1KYNA 4O3UA 4Q7YA 3F68H 2WPHS 1AUTC 2OINA 3M5LA 3MU1A 1OXGA 4JCNA 3RXUA 3OEED 4HFPB 4TPYA 3BTEE 3DFLA 3SNDA 2W7SA 1EPTB 3A81A 1C1OA 4YZUA 1A1RA 1DX5M 2AH4X 4WWYA 1AWHB 3L3TA 4XD7D 2LP6A 3M3SA 1E1RD 1DANH 5IYTA 1QRXA 3GICB 3TJVA 1RD3B 2PKSC 2FZZA 1IQMA 1E1QD 3BN9A 3QGNB 1ETSH 1GI5A 1OKXA 1UVOA 5DO4H 2BQ6B 2QN5T 1CU1A 1TBRH 1RGQA 4ZKOU 1O2SA 1SLXB 1NU9A 3LKWA 4KELA 1C5QA 2BZ6H 5GNDA 1MKWH 4K5ZA 4ISIH 1P09A 4B6FA 3MOCA 3SBKA 5L6NH 3GY4A 2ZFSA 1VITF 1GI7B 1O2VA 4AZ2B 4OM9A 1BHXF 4DIIH 1KXFA 2HLCA 1ANCA 1NN6A 1ELAA 3SUFA 1BMNH 1G9IE 2D2DA 1YLNA 2ZQ1A 1C2GA 1F5KU 8LPRA 2EI7A 2Y80A 2GMTB 4F48B 1P01A 4BAQB 4YESB 1QCPA 1JRSA 4F55A 1V2KT 4BTUB 3GCOA 1ZJDA 3HPTB 3HGPA 1BQYA 1GJ4H 3ATWA 1NFXA 3U1JB 1ARBA 1V2ST 3SJIA 3DSOA 1BMLA 1F5RA 3JZ2B 1COWD 2OK5A 4LZ1H 1DSTA 1EXFA 1YBWA 4ZHAA 1MCTA 1ZOMA 5EG4A 2PP6A 4B75A 2OD3B 1TALA 4O97A 1GBTA 1XUGA 1YCPM 3M3TA 1O3MA 5F8XA 1ZGVA 1ZZZA 2ZEBA 5HM9A 1NU7B 1LQDB 5T6GA 4K69A 5A0BA 2J94A 2BD5A 3Q3XA 4X1PU 4ABJA 1XUKA 4UDWH 1CT0E 1DUAA 1GBFA 3ZZCA 1GCTC 1LKBA 2XC4A 1TLDA 1F5LA 1N8OB 1UTOA 1NZQH 2JH0D 2H2ZA 1ORFA 2FLBH 3MNSA 5GPIB 3AK5A 1HJAC 5TJXA 4TT3D 2SGFE 1E37B 4AGKA 1DM4B 4UFEH 1W7XH 3ZIAD 1OYQA 1P2IA 3LT3A 5K7RA 1DLEA 2G52A 1V2NT 2HVXA 4INHA 4OS2A 2AGEX 1OWIA 1BMMH 3LC5A 1LCYA 2JIZD 4FOUC 1EZUC 5C1YA 3SHAH 4ZUHA 3M7UA 1NS3A 1TX8A 1SGTA 4ZXXH 1NPMA 1LPKB 3D23A 4K60A 1TOMH 1T8LA 3GCHB 1KLIH 4XBDA 2YMSB 3KYGA 1Z71A 3GY5A 4GPGA 2ZPRA 1BUIA 1P9UA 4H42U 4OS7A 3BV9B 2HGTH 1A4WH 4M9FA 3SZEA 1KDQA 2HPQH 1BTHH 3PMBB 5F6MA 1GGDB 3ZVDA 1YWUA 3KF2A 5DK1A 4NA9H 1A2CH 1YYY1 1Z7KA 1O5EH 3VGCB 4Q80A 1QNJA 4J2YB 2OTVA 3SU5A 2FOEA 1C5XB 1T8MA 2H5CA 1LVMA 2ZA5A 1QGFA 2FWWA 3LC3A 2F9UA 1Y5AT 1K1IA 1P2QA 5AFZH 2GTBA 1H8HD 2G4TA 1XVOA 1GBCA 3IITA 3WW7A 2ASUB 4ISNA 1E0FD 1TNHA 4AFUA 1V2VT 1GHAG 1XUJA 1C5ZB 1PPHE 3OYPA 1K1JA 2GZ8A 3RC6A 2NU3E 1CGJE 3PWCA 4RKOB 3P70B 3E0NB 4WXVA 2XYAA 2ZFTA 2KM0A 2NU1E 3RLYH 3PRDA 3OE7D 4TYDA 2ZHDA 2WZQA 1WAYB 1LMWB 1SGDE 1Z8IB 4J1YA 2VBCA 4BXWA 1WYKA 3KQCA 1CVWH 3OY5U 2A5AA 3PTNA 3QN7A 3EE7A 2OUAA 1K1PA 1TAWA 1HAVA 1SGNE 3F9GA 1G2MA 1SGCA 2F3CE 2IOTA 1PQ8A 2QF0A 5AFYH 1A0JA 2AFQB 3TJUA 1WV7H 2FP7B 2ZHWH 4AB8A 3A86A 3A8BA 5T1VA 4DOQA 1OPHB 4SGBE 2FODA 4Z6AH 1HXFH 1UVSH 1FDPA 5F8TA 1DWDH 1AN1E 1TNJA 1DITH 2XCNA 1O2UA 1SGFG 1BHXB 4JZ1A 4DGJA 1VCPA 3ZYDA 1FNIA 3M7TA 3E8LA 1O2TA 4CH8B 3OSYA 1WSSH 4X8SH 3ZZ6A 2BTCE 5DP9A 1HIAB 1P9SA 4H6TA 1FI8A 3DCLA 2FTMA 3GDSA 3FFGA 2G51A 3SO3A 3UR6A 2OC1A 3O8CA 2OP9A 1C2DA 1QRWA 2GZ9A 1MD7A 1VJ9U 1OWEA 1UTNA 4NIVA 3ELAH 1MAYA 1EPTA 5C67A 1GVZA 3AW0A 1G30B 1O5DH 2FOHA 1V2JT 2QXHA 3PB1E 3W95A 2GCTC 2G8TA 5A8XA 3S9BA 4U32A 2VGCC 2C4FH 1HDTH 2TRMA 3K6YA 1XXDA 1THSH 1O2XA 2Z9KA 3RXDA 3Q00A 2CF8H 3SW2B 1V2RT 1O2KA 2JETC 1O37A 3GISB 4FU9A 1IQFA 4YLUA 2ODQA 3A84A 4ZKSU 4A1XA 1SOZA 1EAWA 2GX4A 4Q63A 2CGAA 3VEQB 3T29A 2OLGA 8GCHG 2A1DB 4IMQA 1HNEE 2LNCA 1OHHD 4Y7AA 3TVJB 1LO6A 1C4V2 1ZMLA 4K2YA 5JB8S 1Y5UT 5EIYA 3RXPA 2TGDA 1TGSZ 1S81A 1K22H 5JPMH 3SNBA 2GZ7A 2H9HA 1S82A 4XOJA 4UFFH 1GJCB 4NCYA 2R0LA 3MO6A 3S0NA 5HMAA 5GDSH 3KHVA 1GBIA 3RM0H 1MBQA 3U69H 2F9VA 1NRNH 1RS0A 1ELVA 3F9FA 2OC7A 4TPIZ 1DWEH 3URDA 1YF4A 3F2GA 1AVWA 3E90B 1ZPBA 3OU0A 3MH4A 4ZROA 1AZZA 3WWBA 2SGQE 1GI1A 1P3CA 4X2YA 1FMGA 1HCGA 1D6RA 1O3JA 4ACBA 1ELCA 2J97A 3HKJB 5ESBA 2A31A 4CBOA 2VIPA 1GHXH 3PLBA 1DS2E 3QZQA 5DP3A 1G32B 1LKAA 4DG4A 4NIWA 3BEFB 5I25A 2R9PA 1P2NA 1SI5H 3A83A 2WPDD 1FY1A 6LPRA 6CHAB 3GYMA 1NROH 1K0HA 3M5OA 3UOPA 2C8WB 2P8OC 1C1PA 1ZSLA 1E79D 4NZQA 5IDKA 1C5SA 1FPCH 2XBWA 3VB5A 1SGEE 2A7JA 1WTGH 4HI3A 5DKMA 4CHAC 1C5NH 2P94A 3LJJA 3QWCH 3DFJA 1SB1H 1V6DA 1ACBE 2J95A 3RU4D 3SUEA 3ZZ9A 2ZDKA 2PHBA 3A7VA 2VB0A 3N7EA 3C1KA 1EB1H 3EGKH 1BDAA 2XWBI 4MQAA 2KCOA 1J16A 1QBOA 1C2MA 1N6XA 7ESTE 4KP0A 1FAXA 1HXEH 4AYYB 1BJVA 1SFIA 1V2TT 1XM1A 2XBVA 3LH3A 4M7GA 1HAPH 1SGYE 1DXWA 5GJ4B 1KLTA 1MKXH 2EA3A 3BEIB 1YCPK 1SR5C 2TPIZ 9ESTA 4KTUA 1PPBH 3SU4A 3O8BA 1IOEA 4X8TH 1CHOG 1FLEE 3ZVCA 1Z6JH 2YOLA 1OWDA 1VGCC 1D3QB 3PV2A 1O3LA 2RCEA 3I77A 1EOJA 2LPRA 3D49H 5EGMA 1DLKB 2VIWA 1BRUP 1GHZA 3CNRA 4DURA 1SG8B 5KECA 4IS5A 1S0RA 1MTVA 1TGNA 1CA0C 4I8JA 3A88A 1XKBC 5JBBS 2BY9X 3ODFA 4UE7H 1MD8A 4RT0A 1UW7A 1C5RA 1TRNA 2D1JA 4HGCA 1W7GH 1TNLA 1L4DA 5HM2A 4JMYA 1AFQC 4OS4A 3RDZA 1HBTH 2Z3CA 4ABFA 1AO5A 2JH6D 2BM2A 1Q2WA 3PLKA 5CHAB 1GHWH 3SJ8A 1FIWA 4OS5A 2BLVA 3IG6B 3A82A 1BBRH 1GVKB 2V6NA 3A7WA 3SGQE 1O35A 1YPGH 1JWTA 3ZVAA 4FUBA 3SGBE 1QFKH 3VG8A 2BLOA 1WXRA 3BTME 2EI8A 1C5OH 1GVLA 5JB9S 1B7XB 3LIWA 2QAAA 2FOMB 3EYDA 1BB0B 2YNBA 2VIVA 3SOSA 1JOUB 1P10A 2YNAA 4DY7B 2I6SA 1TPPA 4X1QU 1WOFA 1O2RA 1UTJA 1P8VC 2P59A 1C1NA 2SGEE 3U28C 2ZQ2A 4Z0KA 5F03A 2BY5X 3V3MA 3KN2A 1Z8RA 1YPJH 1QL7A 1HIAA 5EJLA 4NIYA 3CP7A 4I8LA 2RFKC 1P11E 5DG6A 1EZSC 2J9NA 1CGIE 1TGTA 3RM2H 1PFXC 1FY3A 2XXLA 3QX5H 1Z8GA 5FBIA 1OP0A 2WV5A 4ABEA 1ANBA 3RUOA 5C1UA 1ELTA 5JBAS 2A7HA 2ALPA 1L1GA 3VXEH 4RSPA 1K28D 3EA7A 4B71A 1KXDA 3KQDA 1FJSA 4BNRA 2VH0A 2CMYA 2J2UA 2Q6FA 3L6PA 2QYIA 1GBMA 4DT7B 1QJ1B 2BQWB 3RMOH 4WVPE 1L4ZA 3ZVBA 4SGAE 3LGWA 4JZFH 1GDNA 3ZZ4A 3T27A 2ZFFH 4ABBA 2W3IA 2CHAC 4Y8YA 4I33A 1GWAA 4ZHLU 3TGJE 1ETTH 2D8WA 4BAOB 1K1LA 2STAE 4LK4A 1BRBE 2NU4E 1AVXA 5FL7D 3P6ZB 1GMDF 2B7DH 2SNWA 1ZSKA 1C5WB 1EJAA 3PV5A 3S9CA 2A5IA 3RP2A 2J5UA 1GI3A 2ZGJA 3ZV9A 5DN6D 1GBEA 2TGTA 2UUYA 1YPHE 4DCDA 1HUTH 4D9RA 1DWCH 4AB9A 4RI0A 4LZ4B 2G81E 4Y76A 3OAAD 7LPRA 3BTWE 2AEIH 1BTZA 4AGJA 1HPGA 2BX4A 1UTKA 1DUEA 3PV4A 1TNKA 2H9EH 3E6PH 3RMNH 3VB3A 4IBLH 2ZGHA 5CMXH 2OC0A 1IQJA 1W11U 5DP8A 1GHYH 2AHME 1NRSH 2ZG0H 1MCVA 1SLWB 3VB7A 3RXOA 3FN8A 4TSFD 1O2ZA 3RXGA 5TCAA 1AUJA 2VIOA 1Y8TA 2M5TA 3F2FA 1WUNH 1AE8H 1PPEE 5DPAA 3GY8A 4XBCA 1A5GH 3LGUA 5JYIA 3SV2H 2GGVB 4DIHH 5EODA 3I78A 3KL6A 4JZDH 5K0HA 1TA6A 4VGCB 1UK2A 1LDTT 3G01A 1T8OA 3NK8A 4AFSA 3SV6A 1AY6H 1O5AB 3E0PB 2ZDVH 4CREA 1CSOE 1SGIB 2ZDNA 3RXHA 1G3DA 3NWUA 5HGGA 3ZYEA 4WXIA 1LPZB 3CS7A 3TNSA 2PGQB 5DGJA 4X0WU 2H9TH 1AZ8A 1O2QA 2F83A 3GY2A 3ZZ8A 2NU2E 4I8GA 2GCHG 1JBUH 1F92A 3ODDA 2ZCHP 3RXSA 3BG4C 1YKTA 4JK5A 1NRRH 1GBLA 2ZZUH 3KQBA 4U01A 3AASA 1DICA 2PFEA 4Y79A 1GBBA 1UMAH 1KIGH 2WSSD 2ANYA 2FM2A 2WYJA 1TYNA 1G3CA 1VKYA 3HGNA 3A7XA 1FPHH 3AW1A 3Q3YA 1HLTH 1O2JA 1IQNA 2BVSH 2CJIA 3RXQA 4GSOA 2BMGB 1SGPE 1TGCA 2BB4A 5JDUB 1ZTLA 1HFDA 4X2XA 4B2AA 2HPPH 1C4U2 3EE0B 1ZYOA 3SV9A 2V35A 3MYWA 2ANMH 4WH6A 1TMTH 2RDLA 2WUCA 4FXGH 3P17H 6ESTA 3HATH 3M61U 2Z94A 2GDEH 4JYVH 1AHTH 3NPSA 3DD2H 1TE0A 1O33A 4NSVA 4UEHH 3BTQE 5DP4A 2GV7A 4MTBA 1P05A 2M2AA 5LH8A 1C2EA 2XBXA 3WY8A 2BZAA 3M7QA 7GCHF 1NESE 4WMDA 3F2HA 1BIOA 3GCNA 4FUHA 1GI8B 3M5NA 3F3BA 1CBWB 1ZRKA 4BTTB 4MPXA 2BOHB 1O2MA 2W5EA 1Y59T 4B74A 5C17A 1TNGA 2OBOA 1GDQA 2PGBB 2JKHA 1AFEH 1SSXA 1XUIA 4IGDA 1NY22 4IMZA 4GUXA 3A7YA 5ESTE 4CRAA 4WY3A 2C3SA 5HIZA 1GJ6A 3BSQA 1IQEA 1X7AC 4K8YA 4CR9A 2OBQA 3QGJA 1JMOH 1RIWC 3B23B 1MTNC 3PWBA 2PUQH 3MTYA 4TWWA 1L0ZA 2VWLA 1AI8H 1KSNA 3VB4A 1BTPA 3RLWH 3RXBA 3PM3A 4FUEA 2K8IA 1GBJA 2ZTYA 4YXWD 3ENSB 3SU6A 3V13A 1NT1A 2F9NA 4QT8C 1P12E 1VITG 1UK4A 2PTCE 5ETXA 5JBTA 4DVAU 5GCHF 3Q76A 2VJ1A 4NA8A 1O5BB 4A1VA 3RXEA 1FZZA 3N99A 2F9PA 4CBNA 1HAYB 1BTWA 1AMHA 3MHWU 4IC6A 3ATIA 3MFJA 1H9HE 2BD9A 3F0PA 1C2JA 1LVYA 2FDAA 1K21H 2ILNA 5CHBA 5FPYA 1HJ8A 3S7KB 2A2QH 1FV9A 1O2NA 1BTXA 1ZJKA 1TFXA 2Z9IA 3VPKA 2XBYA 1FONA 4Q7XA 3MQKC 3MH5A 3AAVA 3K6ZA 1DY8A 1GMCF 1O32A 2CN0H 3LGYA 4X2WA 2ZTXA 2VVVA 4D8NA 1JIMA 2W6ID 1H1BA 2WPMS 3PMAB 4BOHA 1O2WA 1W0ZU 2WUBA 1A7SA 4O03A 3RXLA 1GJ5H 5C0UA 4XDEA 3TPIZ 1D3PB 2QC2A 3E16B 2C8ZB 3A7ZA 1C2FA 1MABB 1HAZB 4INLA 1GPZA 1GL0E 3PO1B 3BTDE 1TOCB 4JZIA 3BTTE 3Q3KA 2JJ2D 2QA9E 2HNTC 2IPQX 2Z3DA 1MTUA 1L1JA 4K8BA 5AF9H 4ISLA 1FUJA 2HALA 3GS9A 4A1TA 3MWIU 3CENA 3STIA 1GG6B 2BLWA 5EW2H 1V2UT 3TITA 1LHCH 4FETA 2DUCA 4OGXA 3MI4A 1G36A 3DSGA 1QHRB 1SVPA 3KGPA 3QUMP 2ZIQH 2P95A 3HK6B 1KLJH 3SJOA 3MNBA 4ASUD 4P00A 4CRBA 1O36A 2SFAA 1UCYH 1UTQA 5C3NA 3QDZB 3RXCA 1UTMA 3RU4E 1AB9C 2L74A 1DY9A 2Y5HA 1CE5A 3KNXA 1EX3A 4JZEH 4ACAA 1SLVB 3UAIC 3SU0A 1MH0A 2KAIB 4Y11E 1V2PT 1QB6A 2F4LA 3GDUA 1B0EA 2VWNA 2PV9B 2VVUA 3SN8A 3RMLH 1HRTH 2AERH 1ZR0A 3M35A 3B8JA 2XC0A 3BEUA 1RTFB 5HKKD 2WPJS 1P04A 1YPEH 2VINA 3UTUH 3T28A 2PR3A 5ABWA 1GHBF 1UK3A 1QJ7B 1K2I1 1EP5A 1YPHC 2PKSB 2ZDLA 4UFDH 3BTKE 4AFZA 3KEEA 1EAUA 1XKAC 1GBDA 2G55A 4UD9H 3TLOA 4X6MA 1TQ7B 3SU2A 1LHEH 5FCRA 1Y3XA 3FAOA 2AGGX 4MDSA 4O9VA 4THNH 2EI6A 1EJNA 4D9QA 4Y0YE 3EA9A 3VFEA 1IQKA 2W6JD 1ZPCA 3ATKA 1MAXA 1YGCH 1GMCG 5E2PA 4RN6A 5DJ7A 1EFRD 4K3JA 2G00A 3PYHA 1LTOA 1UCYE 5T3HA 2YMSD 1WDIA 1WQSA 5FX5A 1H8ED 3H7OA 3LGTA 3PLPA 3U98H 5EXLA 1HAXB 1O3EA 4RT1A 3UPEA 3W1EA 1N1LA 4TWYA 5KGOA 2G5NA 5E2OA 4ABIA 1SQRA 5GWZA 1O2LA 1GDUA 1ESBA 2V7QD 3SNAA 2OQUA 4HG6A 1B5GH 1AWFH 1BITA 3T25A 5GIBA 1ANDA 1W12U 1O3NA 1J14A 1CQQA 1J8AA 2KR7A 3KIDU 1H8DH 1MBMA 1OSSA 1EZQA 1MKWK 1SHYA 3BF6H 5C0TA 4NG9H 3ZZAA 4ZKNU 1VCQA 2FIRH 3R0FA 3NZIA 1EPTC 5EQSA 2OCVB 2FMJA 2O8WA 3UUZA 2QXJA 1P03A 5EJ1A 2PLXA 1D9IA 3P8NA 3MH7A 4B6EA 3LONA 5FCKA 2GV6A 1GJBB 2IN2A 4OGYA 1O3PB 2GKVE 3UIRA 1C4Y2 1P2KA 2C8YB 1GJAB 2BD7A 1P2OA 1N6YA 4D7GA 1GCTB 1O3DA 2VH6A 5CDFE 3UNQA 3E3TA 1FQ3A 1PPFE 3QZRA 1D4PB 1EASA 1HJAB 2Q1JA 4H6SB 5LPEA 3DA9B 1BT7A 2BDHA 1A0LA 3T62A 2WPIS 2JDID 2FYRA 2Z9GA 3D62A 1LHGH 1WTHD 3GY6A 3RMMH 1DXPA 1Y3VA 2FS8A 4ABHA 4CH2B 9LPRA 4FUDA 1DT2A 2R0KA 3F9EA 1S6FA 1BRAA 2FX4A 3QO6A 4GCHF 6GCHF 3MMGA 4KGAA 1YM0A 4AG1A 1JIRA 1PPGE 3TJOA 2AMPA 2GMTC 2I6QA 4BAKB 1GJ9B 1YY3A 1BCUH 1GMHF 2R2MB 3ZZDA 2ZCLP 1YC0A 4BTIB 4I32A 4X6PA 2ZP0H 1SHHB 1HAOH 3LDXH 1D3DB 2K0QA 4ABGA 4U30A 3MO3A 1GI2A 1J9CH 1KMHB 2FESH 1GL1A 1YPKH 2FI4E 2SGDE 2PKAB 2P3TB 2AMQA 5A0CA 3A87A 3SQHE 3VB6A 2O9QA 2G5VA 1QZ8A 2ZECA 2Z6BD 4ASHA 4ZCNA 4Y71A 4H4FA 1O3KA 2BVRH 2J34A 3UY9A 2WPLS 4GLYA 3UQOA 3P8FA 4AYVB 3TH4H 2ODPA 5FAHA 1MMJN 1EOLA 5C2ZA 2UWOA 1DFPA 2C90B 2RA3A 3FP6E 1EAXA 4JYUH 2F43B 1MQ5A 4K1EA 3C27B 1CBWC 2PSXA 1Y3UA 2ZCKP 3SUGA 1ZPZA 2BXUH 4B76A 4GAWA 1Z8JB 5T6FA 2ANWA
chains in the Genus database with same CATH topology
4AX9H 1WQVH 2NU0E 4CRCA 1ZHMA 3V12A 4TY7A 2BVXH 2WINI 1C5UA 2ZHFH 1S5SA 1C5TA 2ZFPH 2FI3E 2Z3EA 2SGAA 1LVOA 1C1SA 5C20A 4A7IB 2UUFB 2FOCA 2IJOB 2ZGBH 2FTLE 4F49A 1YLCA 5EPYA 1WU1A 3TGIE 1PQ7A 2P16A 3T5FH 1ZTKA 1P0SH 1F7ZA 1ZGIA 2G4UA 3T26A 3TIUA 3ZZ7A 1OWHA 1ZMNA 4R8TB 4ZMAH 3GCHC 2ZKSA 2XC5A 3PROA 1OOKB 4NZLA 2HNTE 2FO9A 1C2IA 4FU8A 5DP6A 2FI5E 2BOKA 4DW2U 3AAUA 4UFGH 1GGDC 1H4WA 3OY6U 1WCZA 1SQOA 4AN7A 1P3EA 1N8OC 2QY0B 2O8LA 2KAIA 4X1NU 4FUFA 3VGCC 2F9OA 1UTLM 1C5PA 1NTPA 1JRTA 2B8OH 1FIZA 2A5KA 2BXTH 3S9AA 2A4OA 1S84A 3GYLB 2O8TA 3U8RH 2VWOA 4IW4E 1DPOA 2FXRA 8KME2 2VIQA 4B2BA 2GDDA 1ARCA 2GCTB 4AFQA 2QF3A 3NUMA 4NFFA 4CR5A 1QRZA 2F91A 1P06A 5AHGH 3A7TA 1PYTD 1SC8U 4FUJA 3SNCA 1RFNA 5A09A 3RXKA 4XE4A 3FP8E 1BRCE 1U6QA 2PWXA 4NWLA 4FUCA 3A8CA 4D7FA 2JETB 1HYLA 4MLFB 2ZO3H 1C9TA 1KY9A 1OWKA 3LOXA 2K1QA 4BAHB 1XXFA 2A4RA 4I31A 1NFWA 2AS9A 4Q7ZA 1C2LA 1UVPA 3RXRA 3U1IB 3S69A 1QQ4A 4D76A 2GD4B 4X6OA 5C5OA 4IN1A 2BQ7B 3K65B 2UWPA 1KXEA 4MPWA 4E7RG 2IPHA 1CT4E 1HAHH 2BDGA 1HAVB 4WJG2 2Z9LA 2BY6X 2FLRH 2O8MA 4YOGA 5C1XA 3SQEE 1G2LA 3LGVA 2A0QB 4B73A 2Z7FE 1TX6A 4ESTE 2A4QA 1HAIH 3UR9A 1MZAA 3SORA 3P8GA 3NXPA 4ISOA 3CS0A 1ABJH 3OX7U 1YPLH 1P2JA 1C5VA 4B1TA 3VXFH 3STJA 4Q2KA 3TNTA 1C1MA 1UJ1A 3GY3A 1P02A 2VU8E 1IQIA 1TIOA 3JZ1B 1AE5A 2Y81A 4YT6H 3U8OH 1NM6A 4I8KA 1O5GH 1C1UH 5A8YA 4GHQA 1LQEA 3RXVA 1F0RA 1OWJA 3GY7A 5BPEA 3MO9A 1XVMA 1GI6A 4NWKA 2BDIA 1F0TA 2GVFA 2PUXB 1E38B 3M37A 5G4BA 5J4SA 1SOTA 1A3BH 4X8UH 3MNXA 1T31A 3S7HB 1GJ8B 5CE1A 3UWJH 3V7TA 1HGTH 3SU3A 3KQEA 2ZU3A 1KXCA 2F9BH 2WPKS 3ZV8A 1C1QA 2ODYB 3ITIA 2XNIA 4HZHA 1TBZH 4X2VA 2P8OB 1SQTA 1TWXB 4Y6DA 1T32A 1QB1A 2A32A 1LHDH 3RU4T 1L2EA 1ID5H 1T4VH 1THRH 3MNCA 4CHAB 1PPZA 4FUGA 3L33A 2FOBA 1T7CA 5DP5A 2SNVA 1O38A 1TX7A 1F0UA 2UWLA 1C1TA 1FY4A 2BY7X 3EA8A 1PQAA 1DDJA 1UVUH 4IN2A 1QJ6B 1H9LB 1ZLRA 5L2ZH 1W2KH 1ZSJA 1TB6H 1TGBA 1BA8B 4MNXA 4NFEA 1GMDG 2ZFQH 5EU8A 4NIXA 1EATA 1O2YA 1QIXB 1MU8B 3DHKH 5FPSA 3TU7H 1FN6A 1RTKA 1VR1H 4AORA 4JYTA 2PKAA 1SMFE 1VGCB 3SV7A 1NC6A 1KXAA 2GT8A 1QA7A 4WMFA 4KTSA 3RXFA 5T6DA 1GHAF 4PROA 1O2HA 3MH6A 1ESAA 2ANKH 1QA0A 1C1WH 1TA2A 1ELDE 3K2UA 2A2XH 2V3OH 1CA0B 3MU4A 4YTAA 2ZDMA 4O3TA 2WV4A 1O3FA 3SJKA 3O8DA 1YCPH 1XUHA 3UNSA 1YP9A 2NWNA 3MU0A 3ZVGA 4YM9A 2EC9H 2FOGA 6CHAC 2V3HH 4X6NA 3SV8A 2BD2A 2ZPQA 2P3UB 1CHGA 2ZWLH 1OP8A 1RXPA 1MKXK 1W3CA 1PYTC 3B9FH 1TABE 1AFQB 3SU1A 4BXSA 4K1SA 1J15A 1FAKH 1ANEA 3T2NA 3UQVA 2R3YA 1C9PA 1W0YH 2Q6DA 5E8EH 1BZXE 1WBGB 2QV1A 2ZFRH 5EXNA 3GCTF 3SHCH 3DT0H 1O3CA 1A61H 1BTUA 3ZZ3A 2STBE 4WMEA 1T4UH 1AD8H 2QXGA 1E35B 1GBHA 3UREA 3RXIA 3FZDA 2ZGCA 5A8ZA 1EB2A 4YT7H 2FOAA 4K1TA 2THFB 1FXYA 2TGAA 1NFUA 1PJPA 3RC4A 1UHBB 1A5IA 4MG3A 2C8XB 3SGAE 1ZHRA 1QURH 3P92A 4CRDA 1O3HA 1GI9B 1GHVH 2Y5GA 2TBSA 3EQ0H 4AG2A 2UUKB 2QIQA 4MNYA 2BDCA 1EP6A 1V2WT 1PQ5A 2XTTB 1BBRK 1CT2E 4FU7A 4Y8ZA 1G3BA 1SGQE 3ATLA 3ZVFA 5E0GA 3E1XB 1ZMJA 1QL9A 4RKJB 5DP7A 1ZTJA 1OX1A 1IQHA 3QTOH 4FVDA 2PSYA 3RXAA 1AGJA 5AVDA 4KKDA 2BD4A 1VITH 1F0SA 8GCHF 1O30A 2ZPSA 1NRQH 3TGKE 2ZU1A 3P8OA 1W13U 7GCHG 1RJXB 2CHAB 4ZKRU 5CHAC 2QCYA 3F6UH 4ZHMU 5EQQA 2CV3A 1RRKA 1A0HB 3M36A 1Z1JA 2BDYA 2ZTZA 4X1RU 3M5MA 5I46H 2HRVA 1C2KA 5SGAE 3KCGH 2H5DA 1O2OA 1P2MA 1S0QA 1OP2A 1Z6EA 5EQRA 2TGPZ 4A6LA 2R3UA 1GJDB 1S85A 4ZH8A 5C5NA 1D3TB 1S6HA 1UTPA 3Q77A 4U2WA 1VJAU 1O3IA 3UNRA 4Y10E 4YO9A 5FBEA 4DJZB 5PTPA 3FZZA 2FYQA 3GCTG 1O5FH 4XBBA 1TPOA 5FPTA 1AKSB 1S83A 4X8VH 2XW9A 3FVFB 3U9AH 1O2GH 1W14U 1DWBH 2Y7ZA 2PTNA 2DE8A 4FVBA 3TK5A 3MU8A 2P3FH 3F1SB 2O8UA 1QQUA 1FY8E 2J92A 2XCFA 5GCHG 4YOJA 2WYGA 1ELGA 1GCDA 1XMNB 1Q31A 3RC5A 1NRPH 3TH2H 2VVCA 3TJNA 3O8RA 1TPAE 1O3AA 4YLQH 1CA8B 1ESTA 1TQ0B 5B6OA 1C5YB 1O31A 1A3EH 3HKIB 2FX6A 1K1MA 4B2CA 4BANB 4ABAA 1UVTH 2VIDA 3M3VA 2HOBA 2BD3A 2BDBA 2HNTF 5HXFA 5FX6A 2ULLA 2ZHEH 4E05H 1A46H 3FANA 3TK6A 3RXJA 3TK9A 5EW1H 1HJ9A 1MZDA 4ABDA 4TY6A 1Q3XA 4KTCA 5TCCA 4AOQA 2FPZA 1MQ6A 1W10U 1IAUA 3I29A 4CRGA 2B9LA 1EAIA 2Q6GA 3UOUA 4HTCH 3BG4B 1QBNA 4R0IA 2BYAX 1KXBA 2ZU4A 3E91A 1TMUH 4YOIA 1QBVH 1CHOF 1O3OA 1E36B 1H8IH 2ZNKH 1C5LH 5LPFA 5J4QA 3NCLA 1V2OT 2R2WU 4NSYA 1Y3WA 3NKKA 3LJOA 3PMHB 3BIUH 3A85A 5BRRE 2FS9A 3RXTA 2H6MA 3PTBA 2QXIA 5F8ZA 3ZZ5A 1OS8A 1OYTH 2A4GA 1TNIA 2FOFA 1M9UA 1O5CB 2BHGA 1F2SE 3P95A 2AMDA 1YLDA 1ABIH 1ZHPA 3A89A 4FUIA 3H7TA 1K1NA 5FXLA 4ISHH 4VGCC 3ZVEA 4OS1A 1SLUB 1TBQH 1O3GA 5L30H 4LOYH 4WH8A 2W26A 1P57B 2Y5FA 2H1UA 2D26C 1BTYA 1C1VH 2B0FA 1GI4A 1MU6B 3BG8A 1ETRH 1HB0B 1RIWB 1GHBG 1MTNB 1V3XA 4MVNA 1MTWA 1IHSH 2ZGXH 3D65E 4XSKU 2A7CA 2CF9H 1Y5BT 3A80A 3PMJA 2RG3A 2J38A 1NFYA 2AGIX 5E0JA 1K1OA 1IQLA 4NA7A 2BD8A 1PPCE 4IC5A 1UO6A 2EEKA 1INCA 4I8HA 1AU8A 1EZXC 2GP9B 1EKBB 1UHBA 5JBCS 1C5MD 4MNVA 1LVBA 4Y0ZE 2VWMA 2AIPA 3A8DA 1GBAA 8ESTE 2PW8H 2BDAA 3LPRA 3QLPH 2ZU5A 4X1SU 1SQAA 4E06H 1YPMH 3HK3B 1AQ7A 1THPB 1QL8A 3U8TH 1EUFA 3URCA 1GJ7B 4A5TS 1KTSB 2BLQA 1QR3E 2HWLB 2OC8A 5GXPA 1SPJA 3LU9B 1H9IE 3ESTA 2Z9JA 1EQ9A 1QB9A 1C2HA 3A8AA 5FHTA 3SI4H 3RXMA 1O2PA 1RTLA 1BMAA 1LHFH 1TMBH 2ZF0H 1LPGB 1XX9A 4NGAH 5LGOA 2ZDAH 1JXPA 1GBKA 1DE7H 4Y7BA 1NO9H 1O2IA 2BY8X 4INKA 1ELFA 1SFQB 3W94A 5H4IB 2Y82A 3EDXB 2UUJB 3DUXH 1QTFA 1A5HA 3SJ9A 2SGPE 3F9HA 2XWAA 4LXBH 1E34B 1IQGA 2GT7A 2V0BA 1BOQA 2W7UA 3K9XB 1IHTH 4OS6A 2ESTE 2P93A 1GI0A 4JK6A 3GOVB 4ZAEA 5EOKA 1FY5A 1TRMA 3MU5A 2A45B 2XRCA 1XUFA 4MPVA 1D6WA 1V2QT 4A92A 4GCHG 1VZQH 1SGRE 4MNWA 6GCHG 2AIQA 3QTVH 1W8BH 3BIVH 1KDQB 1AB9B 1T8NA 3R3GB 4MPUA 1AKSA 1TONA 2RA0A 4CRFA 4UONA 5LPRA 3FP7E 3SI3H 2JH5D 1DSUA 1O39A 3N7OA 1CGHA 4XFQA 3BTGE 3QK1A 2ZHQH 1GMHG 1V2LT 1HAGE 4I7YH 1VCWA 2FEQH 3UWIA 2TIOA 3IWMA 2OXSA 1MTSA 3BTFE 1ELBA 5EXMA 4Y8XA 1TPSA 3ATMA 2VGCB 1C1RA 3EAJA 3LH1A 1QY6A 1O3BA 1G3EA 4BAMB 4F4OC 2GCHF 1BJUA 3ZZBA 1Z1IA 1J17T 1KTTB 2ZC9H 1B0FA 3H5CB 3OTJE 1DVAH 2Y7XA 2OQ5A 3SNEA 2Y6TA 2ZU2A 5A2MH 1CO7E 1G37A 3SZNA 1BBRE 2VNTA 3TH3H 1AVGH 2C93B 2CXVA 1UCYK 1O34A 4GVUA 1TRYA 1L1NA 2BX3A 3GDVA 3PO1C 3V0XA 5EPNA 1FN8A 1Y3YA 1O0DH 2QGRA 3LGIA 7KMEH 5L2YH 4E7NA 5A0AE 3BTHE 2J4IA 2W3KA 5E0HA 3SUDA 1DOJA 1ZRBA 1ELEE 1V2MT 2B5TB 1GG6C 1K9OE 3AVZA 1AIXH 1EJMA 4ZXYH 2AYWA 1HV7A 3UFAA 5HYOA 1SBWA 2ZI2H 4WF8A 1SGFA 1SL3A 1MUEB 2ALVA 2DE9A 4GHTA 1KYNA 4O3UA 4Q7YA 3F68H 2WPHS 1AUTC 2OINA 3M5LA 3MU1A 1OXGA 4JCNA 3RXUA 4HFPB 4TPYA 3BTEE 3DFLA 3SNDA 2W7SA 1EPTB 3A81A 1C1OA 4YZUA 1A1RA 1DX5M 2AH4X 4WWYA 1AWHB 3L3TA 3M3SA 1DANH 5IYTA 1QRXA 3GICB 3TJVA 1RD3B 2PKSC 2FZZA 1IQMA 3QGNB 3BN9A 1ETSH 1GI5A 1OKXA 1UVOA 5DO4H 2BQ6B 2QN5T 1CU1A 1TBRH 1RGQA 4ZKOU 1O2SA 1SLXB 1NU9A 3LKWA 4KELA 1C5QA 2BZ6H 1MKWH 4K5ZA 4ISIH 1P09A 3MOCA 3SBKA 5L6NH 3GY4A 2ZFSA 1VITF 1GI7B 1O2VA 4AZ2B 1BHXF 4DIIH 1KXFA 2HLCA 1ANCA 1NN6A 1ELAA 3SUFA 1BMNH 1G9IE 2D2DA 2ZQ1A 1C2GA 1F5KU 8LPRA 2EI7A 2Y80A 2GMTB 1P01A 4BAQB 4YESB 1QCPA 1JRSA 1V2KT 4BTUB 3GCOA 1ZJDA 3HPTB 3HGPA 1BQYA 1GJ4H 3ATWA 1NFXA 3U1JB 1ARBA 1V2ST 3SJIA 1BMLA 1F5RA 3JZ2B 4LZ1H 1DSTA 1EXFA 1YBWA 4ZHAA 1MCTA 1ZOMA 5EG4A 4B75A 2OD3B 1TALA 4O97A 1GBTA 1XUGA 1YCPM 3M3TA 1O3MA 5F8XA 1ZGVA 1ZZZA 2ZEBA 5HM9A 1NU7B 1LQDB 5T6GA 4K69A 5A0BA 2J94A 2BD5A 3Q3XA 4X1PU 4ABJA 1XUKA 4UDWH 1CT0E 1DUAA 1GBFA 3ZZCA 1GCTC 1LKBA 2XC4A 1TLDA 1F5LA 1N8OB 1UTOA 1NZQH 2JH0D 2H2ZA 1ORFA 2FLBH 3MNSA 5GPIB 1HJAC 5TJXA 2SGFE 1E37B 4AGKA 1DM4B 4UFEH 1W7XH 1OYQA 1P2IA 3LT3A 5K7RA 1DLEA 2G52A 1V2NT 2HVXA 4INHA 4OS2A 2AGEX 1OWIA 1BMMH 3LC5A 1LCYA 1EZUC 5C1YA 3SHAH 4ZUHA 3M7UA 1NS3A 1TX8A 1SGTA 4ZXXH 1NPMA 1LPKB 3D23A 4K60A 1TOMH 1T8LA 3GCHB 1KLIH 4XBDA 1Z71A 3GY5A 4GPGA 2ZPRA 1BUIA 1P9UA 4H42U 4OS7A 3BV9B 2HGTH 1A4WH 1KDQA 2HPQH 1BTHH 3PMBB 5F6MA 1GGDB 3ZVDA 3KF2A 5DK1A 4NA9H 1A2CH 1YYY1 1Z7KA 1O5EH 3VGCB 4Q80A 1QNJA 4J2YB 2OTVA 3SU5A 2FOEA 1C5XB 1T8MA 2H5CA 1LVMA 2ZA5A 1QGFA 2FWWA 3LC3A 2F9UA 1Y5AT 1K1IA 1P2QA 5AFZH 2GTBA 2G4TA 1XVOA 1GBCA 3IITA 2ASUB 4ISNA 1E0FD 1TNHA 4AFUA 1V2VT 1GHAG 1XUJA 1C5ZB 1PPHE 3OYPA 1K1JA 2GZ8A 3RC6A 2NU3E