1PQ7A

Trypsin at 0.8 a, ph5 / borax
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
224
structure length
224
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Trypsin Revisited: CRYSTALLOGRAPHY AT (SUB) ATOMIC RESOLUTION AND QUANTUM CHEMISTRY REVEALING DETAILS OF CATALYSIS.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Trypsin
total genus 55
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pq7A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pq7A01
4ABAA 5DKMA 3PB1E 3HK3B 1V2OT 3T62A 1A2CH 1FV9A 1VR1H 1TONA 2A5IA 4D76A 1AVGH 1UO6A 1EJMA 3F9FA 5DJ7A 3SHAH 3ODDA 3QTOH 2QV1A 3GISB 2IJOB 1O2RA 3GY2A 4HZHA 4BAHB 1QQUA 2XWAA 1RTKA 1WQVH 4Y8XA 2F83A 1K1LA 1TGCA 3A7XA 2F9OA 5A8XA 4AGJA 3PTBA 3SNCA 1T7CA 1PPZA 2ZFPH 1EXFA 1P11E 1EAWA 5T6FA 4CRBA 1SGNE 4BXSA 2JETB 1C4V2 3P8FA 6CHAC 1W7GH 5C20A 2EI6A 2ZC9H 2V0BA 2B8OH 2AFQB 2ZF0H 1LQDB 1DS2E 4RKJB 3E0PB 1UTQA 5HYOA 4Q7ZA 1TE0A 1GCDA 3UNSA 1PPFE 1QJ1B 4IW4E 1BMAA 2HOBA 1AWHB 1DY9A 1SR5C 2FOMB 2PUXB 4H4FA 1OWKA 1O2VA 1GJ6A 1ZYOA 2H9TH 1NU9A 2GVFA 1K1PA 3TLOA 2F9NA 2ZU1A 1P09A 3PYHA 2A4GA 1D3TB 1TBZH 1EOJA 1OWJA 4BXWA 3GYMA 1P2JA 3PV4A 3DHKH 1W3CA 1OYTH 1HAVA 4YZUA 4LK4A 3SZNA 1KLJH 3Q00A 3RC6A 2QN5T 5C1UA 2V3OH 2Y81A 4DGJA 3SNAA 2A2QH 3TGJE 4ABJA 3AAVA 5DG6A 4KP0A 4YTAA 3GY3A 3NXPA 2Y5FA 3GDVA 4JYUH 2Z9JA 2JETC 2BLQA 1GJDB 3LGTA 2FPZA 1K1OA 1V2WT 2PSYA 4ABDA 1ZPCA 1SL3A 5CE1A 2OC1A 1FXYA 2LPRA 2R3YA 3OSYA 2GV7A 2J2UA 2AEIH 3TIUA 1QRXA 5HM9A 1UTJA 1L4DA 2OCVB 4HFPB 3U8TH 2VINA 4I8HA 1NN6A 1KXEA 4MQAA 4ZUHA 2HALA 3LGYA 2W5EA 3SORA 1HPGA 2BY7X 2SGDE 4GCHF 1UTOA 4Y71A 3T26A 1DITH 1P2OA 1XKAC 4JZ1A 3FP7E 3O8BA 3EAJA 2XC0A 1EPTC 3V13A 1HNEE 3ZZBA 3VB5A 1AFQC 3GDUA 3RU4T 5L2YH 2A5AA 4MLFB 1ZMJA 4BAQB 2ZFRH 4Y8ZA 1GPZA 4DY7B 1A1RA 2P3FH 4IC6A 7LPRA 3LIWA 1CBWB 2DE9A 1VITG 2XBXA 2ZTYA 3T25A 1MTSA 3GCTG 7KMEH 1L0ZA 2A7HA 3SJ8A 1DPOA 2BD3A 2BDCA 1XM1A 5C2ZA 1H9LB 3FANA 1HLTH 2BD4A 1XXFA 3SU3A 1BQYA 5L30H 2FOBA 1C1UH 1K1MA 1QL8A 1WBGB 4THNH 1MTVA 1C1WH 3ZVCA 2STAE 3P6ZB 5H4IB 4B76A 1GMDF 1H4WA 3RXTA 2VNTA 1W8BH 1A0HB 1F0TA 1V2VT 5EXLA 1C9PA 5K7RA 2G5NA 3RXIA 4H6SB 2GCHF 1E36B 2PLXA 2TGTA 3U98H 2GMTC 4ABHA 1L4ZA 2PGQB 3AAUA 1THPB 5EG4A 1PJPA 1MQ6A 2V3HH 1RTLA 2PGBB 3L33A 6ESTA 1O2PA 1CBWC 4D8NA 4X1RU 1FPCH 3RXDA 4UFGH 3UNRA 1SMFE 1ZHPA 5IYTA 2ZTZA 1WTHD 1ARCA 4BTUB 2FMJA 2Q1JA 1ELTA 2GT7A 1GI7B 4MNVA 2A4QA 3RXRA 1O5BB 1D3DB 1MTNB 1EZUC 3M5NA 3UWIA 1MZDA 4KTUA 2VIDA 1RFNA 4Y6DA 3U8RH 2CV3A 1O3DA 4GLYA 4NSVA 3SNBA 1PPGE 4ABIA 1NFYA 1O36A 2TGPZ 3ATLA 3TJUA 4FVBA 1SG8B 6GCHF 3A8BA 2BB4A 1AB9C 1CSOE 1N6XA 2HNTC 1O3PB 2PKSC 3DA9B 5L6NH 3NKKA 2ZPRA 4I8KA 5E2OA 3WY8A 1AIXH 3A80A 5GCHG 1ORFA 4Y0YE 1O2XA 1Y3VA 4DVAU 2ZQ1A 1GMCG 5AF9H 2UUFB 1ELGA 1C5SA 1FQ3A 1PQAA 2Q6GA 2RA3A 1BHXB 1UK2A 2BLVA 2RG3A 4WY3A 2P3TB 3TGIE 4AZ2B 1Z7KA 1CE5A 1O2UA 3BIVH 3MH7A 1N1LA 3SNEA 4K1SA 3TH2H 1O30A 4ABBA 4A7IB 4H42U 4UE7H 4ZHLU 1V2JT 4KGAA 1C2HA 2IOTA 3SJOA 2BQWB 4X8VH 1C1TA 5DO4H 5J4SA 1GHAG 4BAOB 3MU1A 3ZZ8A 1TQ7B 2XBVA 2Y7XA 3UWJH 3BTEE 4NIXA 4JCNA 1SQTA 3STIA 2ZDKA 4X6MA 4AG1A 2H9HA 1YCPM 3HGNA 4KELA 1YBWA 1ZGIA 4K5ZA 1O3KA 4YOJA 2VIOA 1AN1E 1Y3WA 1FZZA 2QXGA 3SGAE 1GJCB 2CF8H 3Q3XA 5F6MA 2TGAA 6CHAB 3SJ9A 1ETTH 4QT8C 2Z9IA 5EOKA 1GDNA 4B1TA 1TMTH 2AIQA 2XTTB 1ZZZA 1QURH 2WINI 1AGJA 1O5FH 1GBKA 1UTMA 2PV9B 1BRUP 1CT0E 1GJBB 5DP5A 2YOLA 1E35B 1YLDA 1Z8GA 1O3HA 1NO9H 3T28A 4OS1A 1LHCH 3W94A 3PMHB 3BEFB 2AS9A 2ZHDA 3JZ2B 3MH5A 1NRQH 4ISNA 3LH3A 1THRH 1QB1A 1UTPA 1INCA 3W95A 3ENSB 4AYYB 3BTFE 1GJAB 3ZV8A 3M7QA 5EU8A 1F0UA 1HYLA 2BXUH 3A7WA 2OC0A 1Y5AT 3QO6A 1AO5A 2GZ7A 4WH8A 1EZSC 2XRCA 1X7AC 1MKXH 1ANBA 3HGPA 3K2UA 3MNBA 2C4FH 4JZEH 1AE8H 2XC4A 1O3OA 4X6NA 1SPJA 1NZQH 2A0QB 4GUXA 1O2WA 3RXCA 1CO7E 1BMMH 1SLWB 2G51A 3UY9A 1KDQA 1BTWA 5GIBA 1O32A 1GCTB 2SGFE 2AMDA 3UQOA 1HJ8A 4JYTA 1C5MD 1TGTA 1KXBA 2P94A 1Z1JA 2I6SA 4BAMB 3RXOA 1DWCH 2Y7ZA 2TIOA 2ZCHP 5EW1H 1D6RA 2AYWA 1TX7A 1P2QA 1Y3UA 2AIPA 1QL7A 2FI4E 1ZMLA 1TRYA 2QIQA 3BV9B 2VGCB 2ZCLP 1PPEE 3Q77A 5DP9A 3JZ1B 1O2KA 1W0ZU 4WVPE 2JKHA 4Q7YA 3HKJB 2H5CA 4D7FA 2BDHA 8KME2 3RC4A 1F5RA 2QF0A 1IHSH 8ESTE 1C2LA 4FUBA 5PTPA 2G55A 3OU0A 2FI3E 2ZGBH 4JZDH 2XBYA 1T8MA 1UMAH 1CGHA 2O8LA 4TY7A 3D65E 1G3DA 1TOMH 1S81A 3RXJA 1TLDA 2D2DA 3U69H 1DXPA 6LPRA 2R0LA 1RD3B 2FLBH 3VB7A 1J9CH 5JBAS 2HNTF 3A88A 1M9UA 1T4VH 1H8IH 1EB2A 3SUEA 1KXFA 4NSYA 1O3NA 1GBJA 1DLKB 4IBLH 3LONA 3K6YA 1N6YA 1DOJA 1HAXB 1XXDA 3VB6A 2A32A 1V2NT 4O9VA 1EZXC 1L1GA 1V6DA 2V6NA 3BG4B 3TH4H 4O03A 1TBRH 3RUOA 3GYLB 2J38A 1LQEA 1MBQA 1AI8H 1ESTA 2ZDLA 3MNSA 1UVSH 2FZZA 1O3MA 3MU0A 1HUTH 2AGGX 2Z9GA 3GICB 1BDAA 2ZHWH 1IHTH 3A7ZA 3SUGA 4DCDA 3RU4E 5C5NA 4K3JA 1GG6C 2ESTE 1JBUH 3ZZ6A 1K28D 3PMAB 3QN7A 3D23A 4CREA 4JYVH 2BX4A 1C5PA 2Y5GA 5BRRE 1V2QT 4NFFA 1G32B 3A87A 1C4U2 2W7UA 2ZPQA 1SGFA 2SGEE 2GCTB 3GCHB 1MH0A 3B23B 2OC8A 2JH5D 3GY4A 3UIRA 2G5VA 3GY5A 5HXFA 4Q2KA 3KGPA 3SU0A 5EGMA 1PPHE 4DOQA 2A7CA 1XVMA 4AX9H 3Q3YA 2ZDVH 3SQEE 3U1JB 1CGIE 2THFB 2ANYA 1T4UH 4BTTB 1OSSA 2GT8A 4K60A 4TPIZ 4E7RG 2BDYA 3UPEA 2PWXA 4NFEA 1D3QB 2D26C 1TPOA 2ZWLH 2BD5A 3ZZCA 4LZ4B 1S84A 1B0FA 1A46H 1YPJH 4INHA 1RIWC 1TNJA 1K1IA 1AD8H 4AOQA 1E34B 1GVZA 2SNWA 3ZVGA 1GI4A 5LPEA 3V0XA 1OP2A 1GBAA 3SV7A 5GJ4B 1IQGA 2BDIA 2ZU5A 3EA8A 1O34A 4HI3A 1Z6JH 1TNIA 2NU0E 1FY5A 1O2HA 4AFQA 1C5XB 2ZFSA 4B2CA 3EDXB 1BRCE 1JWTA 2ODYB 4YLQH 5FX6A 1KXDA 1WOFA 3RXPA 1YC0A 2C8ZB 1YF4A 3BEUA 3SW2B 1FAXA 2EI7A 2BYAX 2WV4A 2Y80A 5LH8A 1S6FA 2QY0B 1EQ9A 1Y3XA 3RMOH 4E7NA 2TPIZ 3RLYH 1MTNC 1BIOA 1UK3A 4MPWA 1QBNA 3ZZ5A 5GWZA 1TOCB 1S6HA 2P59A 2VWNA 1TRNA 4DIHH 4A1VA 1DUEA 1SFIA 2BMGB 2OUAA 3V3MA 4GHTA 5EW2H 1A3EH 2GKVE 4FUDA 1MCTA 4LXBH 1BJUA 1C5NH 3SBKA 1B7XB 5HMAA 4SGAE 1IOEA 2FOHA 2FYQA 1W7XH 4IS5A 2WUCA 1BBRH 3SO3A 1P01A 2Q6DA 1PYTD 1O38A 4I31A 2ZFTA 5ESBA 2BY5X 1QA7A 1MU8B 2KAIA 3VGCC 3E90B 4RSPA 1GJ9B 1BA8B 9ESTA 1QR3E 3A8AA 1ZRBA 2FX6A 1A5IA 1GI0A 2P3UB 4YLUA 2GZ9A 1AZ8A 5ETXA 2O9QA 2VIQA 4XBBA 2P95A 4AFUA 1FONA 3QLPH 1AHTH 4X1PU 1GI6A 4NIVA 2SGPE 3RXBA 5GDSH 4CH8B 1BTXA 1ELFA 3RMMH 4AYVB 3O8DA 2OD3B 3MO9A 4MPUA 1Z1IA 4NWKA 3LPRA 2HPQH 1DVAH 1GI8B 1LDTT 2ZI2H 1O5DH 4X2XA 1BB0B 3ATKA 3NCLA 1LPKB 1ETRH 1HAYB 1P12E 1GHBF 3ZZ4A 2WYGA 1AFQB 3SI4H 2IPHA 1OP8A 1S83A 4M7GA 2J9NA 2RA0A 3SU1A 4Y10E 1ZSKA 1WQSA 2BVSH 2WPLS 4MG3A 1NFXA 1SLVB 3HK6B 1QTFA 2ZIQH 4ZH8A 1BBRK 3BTWE 1OWDA 4ASHA 2RCEA 3ZZ3A 5LGOA 4OS5A 1MU6B 2F9BH 1C5TA 3VEQB 2VIPA 3RXMA 4F4OC 1NC6A 4IMQA 2BXTH 1VJ9U 1ELVA 2OC7A 1H1BA 1G3CA 1B5GH 5AFZH 3RC5A 1CA8B 1TA2A 2PR3A 1GMDG 2GD4B 2ZU4A 1F5LA 3P92A 1ZTLA 3LH1A 2W3KA 1PPCE 5E8EH 1D6WA 1GHXH 1YM0A 1EPTA 1UVPA 3ODFA 1EZQA 3NWUA 1GI3A 1A5HA 1EAIA 2HRVA 1C1RA 2ANKH 1K21H 3NZIA 1HB0B 3MYWA 1NFUA 3FZDA 5T6DA 4I7YH 1FUJA 2ZGCA 3T29A 2R2MB 4MNWA 2G81E 2GDEH 1QRZA 1VGCB 5C67A 1O5AB 3RP2A 4OGXA 3MO3A 3URDA 2G4TA 1ELEE 2SNVA 5EPNA 2OBQA 3RLWH 3L6PA 1T8OA 4ISHH 4ZHAA 1NRRH 1SGDE 2ZEBA 4Y8YA 2C8WB 1QNJA 1EB1H 2Z7FE 4MNYA 4VGCC 2Z9LA 5B6OA 3H5CB 2B5TB 4NZLA 4X6PA 1Z71A 2G00A 5TCCA 2BLWA 1VITF 1UCYK 4FUFA 1W10U 1DSTA 2ASUB 3B9FH 3RDZA 1WCZA 3VXEH 3E8LA 1C9TA 1TPSA 1HCGA 4DURA 5TJXA 4IC5A 3RMNH 3ZVBA 2EI8A 4ISLA 3VFEA 1P05A 1TNHA 3P95A 2Z94A 3ATIA 3ITIA 1GI1A 1UHBA 1C5RA 1E37B 3SGQE 4X2YA 1AE5A 2BQ6B 4A5TS 1LVOA 2O8MA 2XNIA 2BVXH 3RMLH 1O2SA 2WPIS 2RDLA 4NIWA 4U32A 1LMWB 1O37A 2FYRA 2OBOA 1D3PB 2Y6TA 4TWYA 1ID5H 3M5OA 3LOXA 4XDEA 3K6ZA 1C2DA 1HIAA 1ZHRA 3PO1B 3VB4A 2BVRH 5C1XA 4WMFA 2P16A 2GX4A 2ZHFH 4WF8A 1NESE 3BTME 4FUGA 2P93A 1UHBB 2CF9H 1LVBA 3S69A 3LT3A 1A0JA 1C2MA 2ZGJA 1GGDB 4ZMAH 3A7YA 3PROA 1YLCA 1F2SE 1FIZA 3N7OA 1UCYH 5FX5A 1J8AA 3QTVH 3IWMA 3P70B 2FOEA 2V35A 1OXGA 5CHAC 1Q31A 1BRAA 1BTZA 2GMTB 4ABFA 2ZZUH 1SBWA 2BM2A 1YCPK 5FHTA 1TGBA 4INKA 3GCOA 1V2ST 2UUKB 5DP7A 3S9AA 1UK4A 7GCHG 1EKBB 2WYJA 2C8YB 1QY6A 1GJ5H 4A1TA 3BG8A 2VWOA 3SOSA 3SNDA 3DFJA 3M3VA 1MD8A 2A7JA 1NT1A 1YPEH 1PFXC 3TITA 3V12A 4ZAEA 4YESB 2PTNA 1DWBH 3RU4D 1Y3YA 2FP7B 4MVNA 1A4WH 3P8GA 1O2OA 3LGVA 4H6TA 4R0IA 3M61U 3RXEA 3KQEA 3ZVFA 1DM4B 1GBLA 1TFXA 5T3HA 1LVYA 1P2IA 1O39A 2AGEX 4O3UA 1GJ7B 4OGYA 4YM9A 3QGNB 2Z3CA 1GBCA 2BY6X 4UEHH 1P03A 1Y8TA 4NWLA 3M35A 1S5SA 1YCPH 3QWCH 3TK9A 4AG2A 1N8OB 1LHEH 2YNAA 4B2BA 1FIWA 1TA6A 1AU8A 5F03A 2ODQA 2O8UA 4XOJA 1TAWA 1DUAA 5EQSA 1IQLA 2FI5E 7GCHF 3CS0A 3ZVDA 1UTKA 2VH0A 5EPYA 2QXIA 4E06H 3QDZB 1HAHH 1NRNH 4ZHMU 3M7TA 1HAOH 4X8SH 2SFAA 1LPGB 2TRMA 3GY6A 1MCVA 3M36A 2Q6FA 5FPYA 3S7HB 1BTPA 3KQCA 2CGAA 1O5CB 3EYDA 3GCNA 1UVOA 2H5DA 1T32A 2FOGA 4ZKOU 1YPHE 1NY22 3PMJA 1HDTH 2ZKSA 1BTHH 4Q80A 4ABGA 1C1SA 1O3LA 1BHXF 2ZFQH 5AFYH 1T8LA 2B9LA 5ABWA 4CRGA 1EP5A 2BD9A 1IQKA 4B75A 1O2LA 4DT7B 2AERH 1G36A 5AHGH 3F9GA 1SQAA 2H9EH 2BDBA 1QHRB 2DE8A 3S0NA 5C5OA 1O2IA 1HAZB 5L2ZH 2CHAB 3VPKA 1O2QA 2GCTC 4I8JA 3RXGA 1TWXB 1FY8E 1ZTJA 1UVUH 1XUIA 3A7VA 4UFEH 1O35A 2F9PA 5HGGA 4ZKSU 2O8WA 4DW2U 2XCFA 3A86A 2M5TA 3PWBA 3TNSA 3KN2A 4XFQA 1C5YB 1GGDC 1Y59T 3MO6A 1KLIH 1NRSH 1P8VC 1UTLM 1MKWH 1CHOG 2P8OB 4MNXA 5A0BA 1AY6H 3FP6E 1T8NA 1O2TA 2DUCA 3HKIB 1AFEH 1GVKB 1BITA 2GP9B 2CXVA 4B73A 4UONA 4CRAA 2XXLA 2FTMA 3EE0B 1V2MT 3RXQA 1HAVB 3M37A 4K8YA 1C1OA 1EOLA 2ZPSA 3BIUH 3E0NB 3QZRA 4MPXA 1GBMA 1VCQA 1BTUA 4X1SU 2FESH 2XW9A 1ZPZA 2VIVA 1VCWA 2HNTE 1XUJA 2BDGA 2XC5A 2ZHQH 4WH6A 1O2ZA 3K65B 1THSH 2BX3A 1VCPA 1GMHG 3MNCA 1V2TT 1MKWK 4Z0KA 3Q3KA 3C27B 4K8BA 1G9IE 3BTDE 1SHYA 2GCHG 3BEIB 1SGYE 1UVTH 2TBSA 2IN2A 1YYY1 4NGAH 1XKBC 4BANB 1S85A 2ZQ2A 1FNIA 3DFLA 4X8UH 2BZ6H 2G8TA 4Y0ZE 3SUFA 2FODA 1F5KU 4YOIA 1GHWH 4CBOA 1IQFA 1C2GA 1C4Y2 1A7SA 2CMYA 2FOFA 4YT7H 3E1XB 3IITA 2Z9KA 3A85A 5EQRA 1YPHC 4Y7BA 1AZZA 1LKBA 4RKOB 1AUTC 4CR5A 3SQHE 4U30A 5A0CA 4BNRA 2ZHEH 1IQNA 2BY9X 2C8XB 1C5ZB 3TH3H 1K2I1 4F49A 4Y76A 4XBDA 1P2NA 2ODPA 4FUIA 2R0KA 1O3AA 6GCHG 3LC3A 1O3BA 1KTSB 5DP3A 3U9AH 1PQ5A 1P57B 1LHFH 2GV6A 3O8CA 1GHYH 1QJ7B 5FAHA 1A61H 4JMYA 1O31A 1PYTC 2HVXA 2QCYA 3F9HA 1TPAE 2QYIA 1CHGA 2BLOA 2ZDMA 4MTBA 2UUJB 1Y5BT 1Z6EA 1TYNA 3TPIZ 3A8CA 4CR9A 1O2GH 1V2RT 1IQEA 1YPLH 2HLCA 5DK1A 3D49H 2JH6D 2ZA5A 3GY8A 2G52A 1AB9B 3UOUA 3ZVEA 4HGCA 3RM2H 1GL0E 2Z3EA 4X1NU 3BTHE 1NFWA 1ELAA 3TJVA 1ELDE 1C5VA 4IMZA 2FX4A 5GXPA 2C93B 1NRPH 2PFEA 3QK1A 4KTCA 2PW8H 1EPTB 1A0LA 1AWFH 4O3TA 3ZZAA 1RGQA 2PHBA 1MMJN 1QFKH 2AH4X 4GHQA 4X1QU 1VZQH 1HAGE 2FM2A 1OWHA 2H1UA 3AW1A 2I6QA 3UR6A 1ZJDA 2H6MA 4NA9H 3ATMA 1MAYA 1W14U 3S9CA 2A5KA 1JMOH 1MZAA 2VVUA 1FJSA 2J34A 3PM3A 1O2YA 2C3SA 1O3GA 2J94A 3TJOA 1GBHA 1TX8A 2Y5HA 1AVXA 1SI5H 1FY4A 4NG9H 3A84A 3MNXA 5F8ZA 2Z3DA 1IQIA 3E6PH 4WJG2 4X6OA 3MWIU 3DUXH 1TIOA 3LDXH 1DWEH 1JIMA 3UFAA 3K9XB 1BZXE 2ZU2A 1ZR0A 3RXFA 1VJAU 3FVFB 1QA0A 1SGCA 3KL6A 2ULLA 3KCGH 4YO9A 1P10A 5A2MH 1TRMA 3ZZDA 1HGTH 4Y79A 4DJZB 1EAUA 4DIIH 1TABE 1GJ4H 3RM0H 2VVCA 1ESAA 1HRTH 5FCKA 2BOHB 1P9SA 2BHGA 1V2LT 3GOVB 4TYDA 2K1QA 2WUBA 4ZXXH 1BMLA 3EGKH 4K1EA 1ANCA 3BTTE 1AVWA 1SHHB 1A5GH 3FP8E 4UDWH 1C1QA 1G37A 4I32A 2D1JA 5DP8A 3RXVA 2Z6BD 4UD9H 1AMHA 1MD7A 2J4IA 1CQQA 5JBCS 1RJXB 4FXGH 3SU6A 5JBTA 3B8JA 4ZXYH 3G01A 4WMDA 4WWYA 5EXNA 3E91A 1WV7H 2AGIX 3KIDU 1QQ4A 3SJKA 3MOCA 3PO1C 4WXIA 2QAAA 1H8DH 3ELAH 1WTGH 1SQOA 5K0HA 3ZZ7A 1HFDA 1QJ6B 3AVZA 3MU8A 1C2EA 1SB1H 5JPMH 1GHZA 2SGAA 2CN0H 1SGRE 1QIXB 2XYAA 2QF3A 4FU9A 1LHDH 1Z8IB 3V7TA 3NPSA 1EP6A 1KDQB 4I8LA 1LO6A 1P2MA 1K1NA 1SC8U 1QCPA 2B0FA 3IG6B 2FS8A 3FZZA 4XE4A 5FXLA 1PPBH 1F0RA 1BBRE 2ZGHA 8LPRA 2B7DH 3OX7U 3ZVAA 1EJAA 4FVDA 2VIWA 1ZSLA 1B0EA 1SLUB 3TU7H 1O3CA 4TPYA 5FBIA 2FLRH 4MDSA 3SJIA 2AMQA 3KF2A 1JRSA 2FEQH 1VITH 4ZROA 1MUEB 4E05H 1CT2E 1EUFA 2BDAA 1ELBA 4I8GA 2R9PA 1OYQA 2F3CE 3UREA 1GBFA 3E3TA 5F8TA 1NTPA 1EASA 1CT4E 1HIAB 4FUEA 3UNQA 1F0SA 1Q2WA 3H7TA 4AB8A 3EA9A 2PUQH 2QA9E 1J17T 4X0WU 2W3IA 3BSQA 2EC9H 1CGJE 1YPGH 4NA7A 2NU2E 1BT7A 1C5LH 1VGCC 1DY8A 4LZ1H 4CBNA 1SGIB 4K69A 4AORA 8GCHG 3F1SB 2WV5A 3TNTA 5DPAA 1CU1A 1SLXB 4GCHG 1TNLA 1FLEE 1PQ7A 3FAOA 1QB9A 3PTNA 3OY5U 1GL1A 1C2KA 2ZG0H 3GY7A 1O2MA 2CJIA 1DXWA 4FUHA 1A3BH 2NU4E 1HXEH 5T6GA 3RXSA 1C1NA 1W12U 2UUYA 3P8NA 3CENA 4R8TB 4ESTE 4CRCA 5IDKA 2AMPA 3PMBB 1HBTH 2HPPH 1J16A 3CP7A 1RXPA 3BG4C 4YOGA 1CA0C 1C5OH 5ESTE 1GBBA 1GWAA 1MQ5A 1GHVH 4AGKA 2VU8E 1FDPA 3M5LA 1SGFG 1BMNH 1C5WB 5HM2A 1BJVA 1ZGVA 2JH0D 2TGDA 2C90B 5BPEA 4NA8A 3S9BA 2VWLA 1P06A 1YP9A 5JYIA 1TNGA 2ZDNA 1WU1A 1T31A 1CHOF 3HATH 4Q7XA 4NZQA 2W7SA 4YT6H 1E38B 1O0DH 2H2ZA 1IAUA 1AKSA 1S0QA 1YGCH 2HWLB 2J95A 3TGKE 1RIWB 1XMNB 3R0FA 1QGFA 5SGAE 1Z8JB 3RXHA 1G2LA 1GMHF 1H9IE 3SU2A 3UTUH 1DSUA 2FIRH 3MH6A 3MH4A 3SUDA 1GHAF 1BRBE 3SV9A 1NM6A 2OP9A 3C1KA 3S7KB 1NPMA 3PLKA 2LNCA 4OS6A 4X8TH 1MTUA 1WUNH 1FY1A 1ANDA 1OKXA 5E0GA 2UWPA 4FU8A 1C2JA 1LKAA 1W2KH 2FXRA 4VGCB 1O5GH 5A0AE 2FWWA 2EEKA 1TGSZ 1PQ8A 3UR9A 1HJAB 1DWDH 1TPPA 2OLGA 1KSNA 1AKSB 4K1TA 3UQVA 1WAYB 5LPFA 2ZDAH 4B71A 1XX9A 3M3SA 5JB8S 1GBIA 3SN8A 3PLBA 3O8RA 1HAPH 1MKXK 2A31A 2UWLA 4AFSA 1HJAC 3MHWU 3GCHC 1KXCA 4OS7A 4FUCA 3TJNA 1L2EA 2STBE 3UUZA 1YPMH 1GCTC 4CRDA 3SU4A 1C2IA 1S82A 3SHCH 3QX5H 2A4RA 4UFFH 3U1IB 2VVVA 5G4BA 1G3BA 5FCRA 1ZTKA 3P17H 3RXUA 2OQUA 1ELCA 1OS8A 4I33A 1DX5M 4X2VA 3SV8A 3L3TA 1ZMNA 4GAWA 5JBBS 1KY9A 4LOYH 1BTYA 2OTVA 1QBVH 2GTBA 5EXMA 1MTWA 1O33A 2F9VA 4Z6AH 4AB9A 4OS4A 3BTGE 1TX6A 4GPGA 4TWWA 1KLTA 1Q3XA 4WXVA 2BY8X 4NIYA 1O3EA 1KYNA 1DFPA 1DDJA 1GDUA 3KQBA 2QGRA 2QXJA 3F9EA 4CHAC 3ZV9A 1LVMA 5J4QA 1O3IA 3M3TA 1TB6H 1W13U 3SU5A 1V2UT 4JZFH 3T5FH 1P04A 5CMXH 1LCYA 4D7GA 4AN7A 1S0RA 2VH6A 1ZOMA 5E2PA 3R3GB 1TMBH 3H7OA 4J1YA 3T2NA 3AASA 1LTOA 2KAIB 4GVUA 3A82A 1WSSH 3PLPA 3OTJE 4DG4A 1OX1A 3I29A 1GI9B 3A8DA 7ESTE 1FPHH 2Y82A 4RN6A 3MTYA 4UFDH 1DANH 3F68H 1EX3A 5FPTA 3AW0A 3DT0H 1P2KA 1J14A 2ILNA 2VWMA 1RTFB 5DP6A 3EQ0H 4ZKRU 1DT2A 1GVLA 1GBDA 1P0SH 2WPJS 3NUMA 3BTQE 3LGWA 3SV6A 1O2JA 4SGBE 1YKTA 1HAIH 1V2PT 4IGDA 1D9IA 1KIGH 2HGTH 2BD7A 3VGCB 1ESBA 1FN6A 3A81A 2FOAA 2BQ7B 3KEEA 1FI8A 1K9OE 1P3CA 1W11U 2QXHA 1XUHA 1GG6B 5EQQA 1WYKA 1J15A 1GBEA 5JDUB 1IQHA 1O5EH 4K2YA 1H9HE 4B2AA 5E0HA 2GGVB 2YNBA 1O3JA 3MMGA 5AVDA 2EA3A 1SGTA 4PROA 2XCNA 1O2NA 2R3UA 2ZU3A 5C1YA 5TCAA 1NS3A 3ATWA 3VXFH 3OYPA 4X2WA 3CS7A 2GZ8A 4CRFA 3TK5A 4AFZA 1SVPA 1ZHMA 1GI2A 5FPSA 1C2FA 3NK8A 1ABIH 3LKWA 1MAXA 3KNXA 5A8ZA 2WPMS 2BD2A 2FDAA 2G4UA 2A45B 3LJOA 1P3EA 1JXPA 2GDDA 4Y11E 4CHAB 1BUIA 1CVWH 1NROH 2A2XH 1N8OC 2ZCKP 1GDQA 4A6LA 4XBCA 2ZGXH 1G3EA 1EATA 2NWNA 3QUMP 3U8OH 1Z8RA 2R2WU 3QGJA 3QZQA 1Y5UT 3A89A 3LJJA 3E16B 5A8YA 3FFGA 1SSXA 1ZRKA 3MU4A 2PTCE 4IN1A 1W0YH 3T27A 1ANEA 4JK6A 1OWEA 4BTIB 3ESTA 1JRTA 1AQ7A 3MI4A 5GCHF 1KTTB 3GDSA 1ZPBA 3P8OA 4KKDA 3TVJB 2P8OC 3TK6A 2BZAA 3M7UA 1V3XA 1OPHB 2FS9A 3I78A 1E0FD 2BD8A 2VGCC 4A1XA 2J92A 1DICA 3DD2H 2A4OA 1JOUB 5F8XA 1HXFH 4ABEA 1L1JA 1AUJA 1G30B 2FOCA 5DGJA 1HV7A 4O97A 1BOQA 4TY6A 3RXLA 1IQMA 2F9UA 4JZIA 2VJ1A 5I25A 1OOKB 1YPKH 2NU3E 3MU5A 5GPIB 5CHAB 1UJ1A 1FY3A 1HJ9A 1ABJH 4FUJA 2SGQE 1ZLRA 1TGNA 2ZNKH 1SOZA 2D8WA 4BAKB 1SFQB 4OS2A 1U6QA 2PKAA 2ZECA 1XVOA 1ETSH 3KQDA 2A1DB 2NU1E 1BCUH 3ZZ9A 1P02A 1JIRA 1P9UA 1TMUH 2BTCE 3BTKE 4JK5A 1C1VH 4XSKU 1GI5A 1ARBA 1EJNA 3HPTB 3RXAA 4D9QA 1GMCF 1UTNA 5A09A 1FN8A 3ZYEA 3ZYDA 4INLA 2UWOA 5LPRA 1RS0A 4B74A 2PKSB 4MPVA 1IQJA 1K22H 3STJA 3RXKA 1DLEA 1G2MA 2PKAB 1V2KT 2ZFFH 2ZP0H 1SGQE 1GBTA 2F91A 5E0JA 1TNKA 5I46H 1L1NA 9LPRA 1SOTA 1TALA 1C5QA 3PWCA 1OWIA 1XUFA 2XBWA 1CA0B 4A92A 3VB3A 2WPHS 1LHGH 2FTLE 2ZTXA 5DP4A 5EODA 3LU9B 5C3NA 2FO9A 1KXAA 2WPKS 3URCA 1MBMA 3EA7A 2QC2A 4Y7AA 4ZKNU 5FBEA 4U01A 3OY6U 2OQ5A 3M5MA 4KTSA 1TQ0B 4U2WA 1ZSJA 1TBQH 4BOHA 3A83A 2OXSA 2CHAC 3Q76A 4ISIH 4CH2B 4D9RA 1D4PB 1QB6A 1C1PA 2ANMH 1K1JA 8GCHF 3LGUA 4ISOA 1RRKA 1ACBE 1C1MA 2ANWA 3D62A 4J2YB 3UOPA 1FMGA 1XUGA 3BF6H 3SI3H 2OINA 1NU7B 3GCTF 2ZO3H 4IN2A 1SGEE 1QL9A 1ZJKA 2ALVA 3KHVA 1C5UA 1F7ZA 2PSXA 1GHBG 3SGBE 1SGPE 1UCYE 3SV2H 3BN9A 2O8TA 4WMEA 2XWBI 1XUKA 1DE7H 1GJ8B 2BOKA 5JB9S 1QRWA 4GSOA 4HTCH 3I77A 1EAXA 1F92A 4NCYA 1LPZB 1FAKH 3LC5A 3A7TA 1OP0A 1O3FA 3F6UH 2ALPA 2VB0A 3MFJA 3LGIA 1QBOA 4FU7A 2W26A
chains in the Genus database with same CATH superfamily
4ABAA 5DKMA 3PB1E 3HK3B 1V2OT 3T62A 1A2CH 1FV9A 1VR1H 1TONA 2A5IA 3WWBA 4D76A 1AVGH 1UO6A 1EJMA 3F9FA 5DJ7A 3SHAH 3ODDA 3QTOH 3F2HA 2QV1A 3GISB 2IJOB 1O2RA 3GY2A 4HZHA 4BAHB 1QQUA 2XWAA 1RTKA 1WQVH 4Y8XA 2F83A 1K1LA 1TGCA 3A7XA 2F9OA 5A8XA 4AGJA 3PTBA 3SNCA 1T7CA 1PPZA 2ZFPH 1EXFA 1P11E 1EAWA 5T6FA 4CRBA 2YMSD 1SGNE 4BXSA 2JETB 1C4V2 3P8FA 6CHAC 1OHHD 1W7GH 5C20A 2EI6A 2ZC9H 4FOUC 2V0BA 2B8OH 2AFQB 2ZF0H 1LQDB 1DS2E 4RKJB 3E0PB 1UTQA 5HYOA 4Q7ZA 1TE0A 1GCDA 5C0UA 3UNSA 5KEDA 1PPFE 3FOAA 1QJ1B 4IW4E 2V3MA 1BMAA 2HOBA 1AWHB 1DY9A 1SR5C 2FOMB 2PUXB 4H4FA 1OWKA 1O2VA 1GJ6A 1ZYOA 2H9TH 1NU9A 2GVFA 1K1PA 3TLOA 2F9NA 2ZU1A 1P09A 3PYHA 2A4GA 1D3TB 2L6OA 1TBZH 1EOJA 1OWJA 4BXWA 3GYMA 1P2JA 3PV4A 3DHKH 1W3CA 1OYTH 2CK3D 1HAVA 4YZUA 4LK4A 4RI0A 3SZNA 1KLJH 3Q00A 2RDEA 3RC6A 2QN5T 5C1UA 2V3OH 2Y81A 4DGJA 3SNAA 2A2QH 3TGJE 4ABJA 3AAVA 5DG6A 4KP0A 4YTAA 3GY3A 3NXPA 2Y5FA 1NBMD 3GDVA 4JYUH 2Z9JA 2KR7A 2JETC 2BLQA 1GJDB 3LGTA 2FPZA 1K1OA 1V2WT 2PSYA 4ABDA 1ZPCA 1SL3A 5CE1A 2OC1A 1FXYA 2LPRA 2R3YA 3OSYA 2GV7A 2J2UA 2AEIH 3TIUA 1QRXA 5HM9A 4DT4A 1UTJA 1L4DA 2OCVB 4HFPB 3U8TH 2VINA 4I8HA 1NN6A 3OEED 1KXEA 4MQAA 4ZUHA 2HALA 3LGYA 2W5EA 3SORA 1HPGA 2BY7X 2SGDE 4GCHF 1UTOA 4Y71A 3T26A 1DITH 1P2OA 1XKAC 4JZ1A 3FP7E 3O8BA 2YMSB 3WWFA 3EAJA 2XC0A 1EPTC 3V13A 1HNEE 3ZZBA 3VB5A 1AFQC 3GDUA 3RU4T 5L2YH 2A5AA 4MLFB 1ZMJA 4BAQB 2ZFRH 4Y8ZA 1GPZA 4DY7B 1A1RA 2P3FH 4IC6A 7LPRA 3LIWA 1CBWB 2DE9A 1VITG 2XBXA 2ZTYA 3T25A 1MTSA 3GCTG 7KMEH 1L0ZA 1KMHB 2A7HA 3SJ8A 1DPOA 2BD3A 2BDCA 1XM1A 5C2ZA 1H9LB 3FANA 1HLTH 2BD4A 1XXFA 3SU3A 1BQYA 5L30H 2FOBA 1C1UH 1K1MA 1QL8A 1WBGB 4THNH 1MTVA 1C1WH 3ZVCA 2STAE 3P6ZB 5H4IB 4B76A 1GMDF 1H4WA 3RXTA 2VNTA 1W8BH 1A0HB 1F0TA 1V2VT 4TT3D 5EXLA 1C9PA 5K7RA 2G5NA 3RXIA 4H6SB 2GCHF 1E36B 2PLXA 2TGTA 3U98H 2GMTC 4ABHA 1L4ZA 2PGQB 3AAUA 1THPB 5EG4A 1PJPA 1MQ6A 2V3HH 1RTLA 2PGBB 3L33A 6ESTA 1O2PA 1CBWC 4D8NA 4X1RU 1FPCH 1BMFD 3RXDA 1S6LA 4UFGH 1SMFE 1ZHPA 2W6JD 5IYTA 2ZTZA 3UNRA 1WTHD 1ARCA 4BTUB 2FMJA 2Q1JA 1ELTA 2GT7A 1GI7B 4MNVA 2A4QA 3RXRA 1O5BB 1D3DB 1MTNB 1EZUC 3M5NA 3UWIA 1MZDA 4KTUA 1RFNA 2QF5A 2VIDA 4Y6DA 3U8RH 2CV3A 1O3DA 4GLYA 4NSVA 3H09A 3SNBA 5C94A 1PPGE 4ABIA 1NFYA 1O36A 2TGPZ 3ATLA 3TJUA 5EJ1A 4FVBA 1SG8B 6GCHF 3A8BA 1E1RD 2BB4A 1AB9C 1CSOE 1N6XA 2HNTC 1O3PB 2PKSC 3DA9B 5L6NH 3NKKA 2ZPRA 4I8KA 5E2OA 3WY8A 1AIXH 3A80A 5GCHG 1ORFA 4Y0YE 1O2XA 1Y3VA 4DVAU 2ZQ1A 1GMCG 5AF9H 2UUFB 1ELGA 1C5SA 1FQ3A 3MQKC 1PQAA 2Q6GA 2RA3A 1BHXB 1UK2A 2BLVA 2RG3A 2WZQA 4WY3A 2P3TB 3TGIE 4AZ2B 1Z7KA 1CE5A 1O2UA 3BIVH 1YLNA 3MH7A 1N1LA 3SNEA 4K1SA 3TH2H 1O30A 4ABBA 4A7IB 4H42U 4UE7H 4ZHLU 1V2JT 4KGAA 1C2HA 2IOTA 3SJOA 3CNRA 2BQWB 4X8VH 1C1TA 5DO4H 5J4SA 1GHAG 4BAOB 3MU1A 2KZ4A 1TQ7B 2XBVA 2Y7XA 3ZZ8A 3UWJH 3BTEE 4NIXA 4JCNA 1SQTA 3STIA 2ZDKA 4X6MA 4AG1A 2H9HA 1YCPM 3HGNA 4KELA 1YBWA 1ZGIA 4K5ZA 1O3KA 4YOJA 2VIOA 1AN1E 1Y3WA 1FZZA 2QXGA 4XD7D 3SGAE 1GJCB 2CF8H 3Q3XA 3U28C 2TGAA 5F6MA 6CHAB 3SJ9A 1ETTH 4QT8C 2Z9IA 1VKYA 5EOKA 1GDNA 4B1TA 1TMTH 2AIQA 2XTTB 1ZZZA 5C0TA 1QURH 2WINI 1AGJA 1O5FH 1GBKA 1UTMA 2PV9B 1BRUP 1CT0E 1GJBB 5DP5A 2YOLA 1E35B 1YLDA 4P02A 5DN6D 1Z8GA 1O3HA 1NO9H 3T28A 4OS1A 1LHCH 3W94A 3PMHB 3BEFB 2AS9A 2ZHDA 3JZ2B 3MH5A 1NRQH 4ISNA 3LH3A 1THRH 1QB1A 1UTPA 1INCA 3W95A 3ENSB 4AYYB 3BTFE 1GJAB 3ZV8A 3M7QA 5EU8A 1F0UA 1HYLA 2BXUH 3A7WA 2OC0A 1Y5AT 3QO6A 1AO5A 2GZ7A 4WH8A 1EZSC 2XRCA 1X7AC 1MKXH 1ANBA 3HGPA 3K2UA 3MNBA 2C4FH 4JZEH 1AE8H 2XC4A 1O3OA 2JJ1D 4X6NA 1SPJA 1NZQH 2A0QB 4GUXA 1O2WA 3RXCA 1CO7E 1BMMH 1SLWB 2G51A 3UY9A 1KDQA 1BTWA 5GIBA 1O32A 1GCTB 2SGFE 2AMDA 3UQOA 1HJ8A 4JYTA 2XNDD 1C5MD 1TGTA 1KXBA 2P94A 1Z1JA 2I6SA 4BAMB 3RXOA 1DWCH 2Y7ZA 2TIOA 2ZCHP 5EW1H 1D6RA 3SZEA 2AYWA 1TX7A 1P2QA 1Y3UA 5EJZA 2AIPA 1QL7A 2FI4E 1ZMLA 1TRYA 1FX0B 2W6ID 2QIQA 3BV9B 2VGCB 2ZCLP 1PPEE 3Q77A 5FL7D 5DP9A 3JZ1B 1O2KA 1W0ZU 4WVPE 2JKHA 4Q7YA 3HKJB 3N7EA 2H5CA 4D7FA 2BDHA 8KME2 3RC4A 1F5RA 2QF0A 1IHSH 8ESTE 1C2LA 4FUBA 2GJGA 5PTPA 2G55A 3OU0A 2FI3E 2ZGBH 4JZDH 2XBYA 1T8MA 1UMAH 1CGHA 2O8LA 4TY7A 3D65E 1G3DA 1TOMH 1S81A 3RXJA 1TLDA 2D2DA 3DSOA 3U69H 1DXPA 6LPRA 2R0LA 1RD3B 2FLBH 3VB7A 3DCLA 1J9CH 5JBAS 2HNTF 3A88A 1M9UA 1T4VH 1H8IH 1EB2A 3SUEA 1KXFA 4NSYA 1O3NA 1GBJA 1DLKB 4IBLH 3LONA 4ASUD 3K6YA 1N6YA 1DOJA 1HAXB 1XXDA 3VB6A 2A32A 2KCYA 1V2NT 4O9VA 1EZXC 1L1GA 1V6DA 2V6NA 3BG4B 3TH4H 4O03A 1TBRH 3RUOA 3GYLB 2J38A 1LQEA 1MBQA 1AI8H 4RT1A 1ESTA 2ZDLA 3MNSA 1UVSH 2FZZA 1O3MA 3MU0A 1HUTH 2AGGX 2Z9GA 3GICB 1K0HA 1BDAA 2ZHWH 1IHTH 3A7ZA 3SUGA 4DCDA 3RU4E 5C5NA 4K3JA 1GG6C 2ESTE 1JBUH 3ZZ6A 1K28D 3PMAB 3QN7A 3D23A 4CREA 4JYVH 2BX4A 1C5PA 2Y5GA 5BRRE 1V2QT 4NFFA 1G32B 3A87A 1C4U2 2W7UA 2ZPQA 1SGFA 2SGEE 2GCTB 3GCHB 2RFKC 1MH0A 3B23B 2OC8A 2JH5D 3GY4A 3UIRA 2G5VA 3GY5A 5HXFA 4Q2KA 3KGPA 5KECA 3SU0A 4F55A 5EGMA 1PPHE 4DOQA 2A7CA 1XVMA 4AX9H 3Q3YA 2ZDVH 3SQEE 3U1JB 1CGIE 2THFB 2ANYA 1T4UH 2EY4C 4BTTB 1OSSA 2GT8A 4K60A 5KGOA 4TPIZ 4E7RG 2BDYA 3UPEA 2PWXA 4NFEA 1D3QB 2D26C 1TPOA 2ZWLH 2BD5A 3ZZCA 4LZ4B 1S84A 1B0FA 1A46H 1YPJH 4INHA 3WW7A 1RIWC 1TNJA 1K1IA 1AD8H 4AOQA 1E34B 1GVZA 2SNWA 3ZVGA 1GI4A 5LPEA 3V0XA 1OP2A 1GBAA 3SV7A 5GJ4B 1IQGA 2BDIA 2ZU5A 3EA8A 1O34A 4HI3A 1Z6JH 1TNIA 2NU0E 1FY5A 1O2HA 4AFQA 1C5XB 2ZFSA 4B2CA 3EDXB 1BRCE 1JWTA 2ODYB 4YLQH 5FX6A 1KXDA 4RT0A 1WOFA 3RXPA 1YC0A 2C8ZB 1YF4A 3BEUA 3SW2B 1FAXA 2EI7A 2BYAX 2WV4A 2Y80A 5LH8A 1S6FA 2QY0B 1EQ9A 1Y3XA 3RMOH 4E7NA 2TPIZ 3RLYH 1MTNC 1BIOA 1UK3A 4MPWA 1QBNA 3ZZ5A 5GWZA 1TOCB 1S6HA 2JJ2D 2P59A 5EIYA 2VWNA 1TRNA 4DIHH 4A1VA 1DUEA 1SFIA 2BMGB 2OUAA 3V3MA 4GHTA 5EW2H 1A3EH 2GKVE 4FUDA 1MCTA 4LXBH 1BJUA 1C5NH 3SBKA 1B7XB 5HMAA 4SGAE 1IOEA 2FOHA 2FYQA 1W7XH 4IS5A 2WUCA 1BBRH 3SO3A 1P01A 2Q6DA 3ZIAD 1PYTD 1O38A 4I31A 2ZFTA 2LP6A 2BY5X 5ESBA 1QA7A 1MU8B 2KAIA 3VGCC 3E90B 4RSPA 1GJ9B 1BA8B 9ESTA 1QR3E 3OTPA 3A8AA 1ZRBA 2FX6A 1A5IA 1GI0A 1SKYE 2P3UB 2WV9A 4YLUA 2GZ9A 1AZ8A 5ETXA 2O9QA 2VIQA 4XBBA 2P95A 4AFUA 1FONA 3QLPH 1MABB 1AHTH 4X1PU 1GI6A 4NIVA 2SGPE 3RXBA 5GDSH 4CH8B 1W0JD 1QZ8A 1BTXA 1ELFA 3RMMH 4AYVB 3O8DA 2OD3B 3MO9A 4MPUA 1Z1IA 4NWKA 3LPRA 2HPQH 1DVAH 1GI8B 1LDTT 2ZI2H 1O5DH 4X2XA 1BB0B 3ATKA 3NCLA 3OE7D 1LPKB 1ETRH 1HAYB 1P12E 1GHBF 3ZZ4A 2WYGA 1AFQB 3SI4H 2IPHA 1OP8A 1S83A 4M7GA 2J9NA 2RA0A 3SU1A 4Y10E 1ZSKA 3DSPA 1WQSA 2BVSH 2WPLS 4MG3A 1NFXA 1SLVB 3HK6B 1QTFA 2ZIQH 4ZH8A 1BBRK 2L74A 3BTWE 1OWDA 4ASHA 2RCEA 3ZZ3A 5LGOA 4OS5A 1MU6B 2F9BH 1C5TA 3F2FA 3VEQB 2VIPA 3RXMA 4F4OC 3KYGA 3NRLA 1NC6A 3F3BA 4IMQA 2BXTH 1VJ9U 1ELVA 2OC7A 1H1BA 3DSGA 1G3CA 1B5GH 5AFZH 3RC5A 1CA8B 1TA2A 2PR3A 1GMDG 2GD4B 2ZU4A 1F5LA 3P92A 1ZTLA 3LH1A 2W3KA 1SQRA 1PPCE 5E8EH 1D6WA 1GHXH 1YM0A 2IPQX 1EPTA 1UVPA 2QF4A 3ODFA 1EZQA 3NWUA 1GI3A 1E79D 1A5HA 1EAIA 2HRVA 1C1RA 2ANKH 1K21H 3NZIA 1HB0B 3MYWA 1NFUA 3FZDA 5T6DA 4I7YH 1FUJA 2F43B 2ZGCA 3T29A 2R2MB 4MNWA 2G81E 2GDEH 1QRZA 1VGCB 5C67A 1O5AB 3RP2A 4OGXA 3MO3A 3URDA 2G4TA 1ELEE 2SNVA 1H8HD 5EPNA 2OBQA 3RLWH 3L6PA 1T8OA 4ISHH 4ZHAA 1NRRH 1SGDE 2ZEBA 4Y8YA 2C8WB 1QNJA 1EB1H 3SYJA 2Z7FE 4MNYA 4VGCC 2Z9LA 2KX4A 3UAIC 5B6OA 3H5CB 2B5TB 4NZLA 4X6PA 1Z71A 2G00A 5TCCA 2BLWA 1VITF 1UCYK 4FUFA 1W10U 1DSTA 3KQ5A 2ASUB 3B9FH 3RDZA 1WCZA 3VXEH 3E8LA 1C9TA 1TPSA 1HCGA 4DURA 5TJXA 4IC5A 3RMNH 3ZVBA 2EI8A 4ISLA 3VFEA 1P05A 1TNHA 3P95A 2Z94A 3ATIA 3ITIA 1GI1A 1UHBA 1C5RA 1E37B 3SGQE 4X2YA 1AE5A 2BQ6B 4A5TS 1LVOA 2O8MA 2XNIA 2EQNA 2BVXH 3RMLH 1O2SA 2WPIS 2RDLA 3EE7A 4NIWA 1EFRD 4U32A 1LMWB 1O37A 2FYRA 2OBOA 1D3PB 2Y6TA 4TWYA 4P00A 1ID5H 3M5OA 3LOXA 4XDEA 3K6ZA 1C2DA 1HIAA 1ZHRA 3PO1B 3VB4A 2BVRH 5C1XA 4WMFA 2P16A 2GX4A 2ZHFH 4WF8A 1NESE 3BTME 4FUGA 2P93A 1UHBB 2CF9H 1LVBA 3S69A 3LT3A 1A0JA 1C2MA 2ZGJA 1GGDB 4ZMAH 3A7YA 3PROA 1YLCA 1F2SE 1FIZA 3N7OA 1UCYH 5FX5A 1J8AA 3QTVH 3IWMA 4M9FA 3P70B 2FOEA 2V35A 1OXGA 5CHAC 5IK2D 1Q31A 1BRAA 1BTZA 2GMTB 4ABFA 2ZZUH 1SBWA 2BM2A 4B6EA 1YCPK 5FHTA 1TGBA 4INKA 3GCOA 1V2ST 2UUKB 5DP7A 3S9AA 1UK4A 7GCHG 1EKBB 2WYJA 2C8YB 1QY6A 1GJ5H 4A1TA 3BG8A 3KYFA 2VWOA 5F53A 3SOSA 4Z1MD 3SNDA 3DFJA 3M3VA 1MD8A 2A7JA 1NT1A 1YPEH 1PFXC 3TITA 3PV5A 3V12A 4ZAEA 4YESB 2PTNA 1DWBH 3RU4D 1Y3YA 2FP7B 4MVNA 1A4WH 2KCAA 3P8GA 1O2OA 3LGVA 4H6TA 4R0IA 3M61U 3RXEA 3KQEA 3ZVFA 1DM4B 1GBLA 4F48B 1TFXA 5T3HA 1LVYA 1P2IA 1O39A 2AGEX 4O3UA 1GJ7B 4OGYA 4YM9A 3QGNB 2Z3CA 1GBCA 2BY6X 4UEHH 1P03A 1Y8TA 4NWLA 3M35A 1COWD 1S5SA 1YCPH 3QWCH 3TK9A 4AG2A 1N8OB 1LHEH 2YNAA 4B2BA 1FIWA 1TA6A 1AU8A 5F03A 2ODQA 2O8UA 4XOJA 1TAWA 1DUAA 5EQSA 1IQLA 2FI5E 7GCHF 3CS0A 3ZVDA 1UTKA 2VH0A 5EPYA 2QXIA 4E06H 5B6LA 3QDZB 1HAHH 1NRNH 4ZHMU 3M7TA 1HAOH 4X8SH 2WHXA 2SFAA 1LPGB 2TRMA 3GY6A 5HIYA 1MCVA 3M36A 2Q6FA 5FPYA 3S7HB 1BTPA 3KQCA 1YY3A 2CGAA 1O5CB 3EYDA 3GCNA 1UVOA 2H5DA 1T32A 2FOGA 4ZKOU 1YPHE 1NY22 3PMJA 1HDTH 2ZKSA 3OFND 4I86A 3W1EA 1BTHH 4Q80A 4ABGA 1C1SA 1O3LA 1BHXF 2JIZD 2ZFQH 5AFYH 1T8LA 2B9LA 4ZCNA 5ABWA 4CRGA 1EP5A 2BD9A 1IQKA 4B75A 1O2LA 4DT7B 2AERH 1G36A 5AHGH 3F9GA 1SQAA 3FKSD 2H9EH 2BDBA 1QHRB 2DE8A 5T1VA 3S0NA 5C5OA 1O2IA 1HAZB 3OAAD 5L2ZH 2CHAB 3VPKA 1O2QA 2GCTC 4I8JA 3RXGA 1TWXB 1FY8E 1ZTJA 1UVUH 1XUIA 3A7VA 4UFEH 1O35A 2F9PA 5HGGA 4ZKSU 2O8WA 4DW2U 2XCFA 2M2AA 3A86A 2M5TA 3PWBA 3TNSA 3KN2A 4XFQA 1C5YB 1GGDC 1Y59T 3MO6A 1KLIH 1NRSH 1P8VC 1UTLM 1MKWH 1CHOG 2P8OB 4MNXA 5A0BA 1AY6H 3FP6E 1T8NA 1O2TA 2DUCA 2WPDD 3HKIB 1AFEH 1GVKB 1BITA 2GP9B 2CXVA 4B73A 4UONA 4CRAA 2XXLA 2FTMA 3EE0B 1WXRA 1V2MT 3RXQA 1HAVB 3M37A 4K8YA 1C1OA 1EOLA 2ZPSA 3BIUH 3E0NB 3QZRA 4MPXA 1GBMA 1VCQA 1BTUA 4X1SU 2FESH 2XW9A 5HKKD 1ZPZA 2VIVA 1VCWA 2HNTE 1XUJA 2BDGA 2XC5A 2ZHQH 4WH6A 1O2ZA 3K65B 1THSH 2BX3A 1VCPA 1GMHG 3MNCA 1V2TT 1MKWK 4Z0KA 3Q3KA 3C27B 4K8BA 1G9IE 3BTDE 1SHYA 2GCHG 3BEIB 1SGYE 1UVTH 2TBSA 2IN2A 1YYY1 4NGAH 1XKBC 4BANB 1S85A 2ZQ2A 1FNIA 3DFLA 4X8UH 2BZ6H 2G8TA 4Y0ZE 3SUFA 2FODA 1F5KU 4YOIA 1GHWH 4CBOA 1IQFA 1C2GA 1C4Y2 1A7SA 2CMYA 2FOFA 4YT7H 3E1XB 3IITA 2Z9KA 3A85A 2KM0A 5EQRA 1YPHC 4Y7BA 1AZZA 1LKBA 4RKOB 1AUTC 4CR5A 3SQHE 4XRNA 2KCOA 4U30A 5A0CA 4BNRA 2ZHEH 1IQNA 2BY9X 2C8XB 1C5ZB 3TH3H 1K2I1 4F49A 4Y76A 4XBDA 1P2NA 2ODPA 4FUIA 2R0KA 1O3AA 6GCHG 3LC3A 1O3BA 1KTSB 5DP3A 3U9AH 1PQ5A 1P57B 1LHFH 2GV6A 3F0PA 3O8CA 1GHYH 1QJ7B 5FAHA 1A61H 4JMYA 1O31A 1PYTC 2HVXA 2QCYA 3F9HA 1TPAE 2QYIA 1CHGA 2BLOA 2ZDMA 4MTBA 2UUJB 1Y5BT 1Z6EA 1TYNA 3TPIZ 3A8CA 4CR9A 1O2GH 1V2RT 1IQEA 1YPLH 2HLCA 5DK1A 3D49H 2JH6D 2ZA5A 3GY8A 2G52A 1AB9B 3UOUA 3ZVEA 4HGCA 3RM2H 1GL0E 2Z3EA 4X1NU 3BTHE 1NFWA 1ELAA 3TJVA 1ELDE 1C5VA 4IMZA 2FX4A 5GXPA 2C93B 1NRPH 2PFEA 3QK1A 4KTCA 2PW8H 1EPTB 1A0LA 1AWFH 4O3TA 3ZZAA 1RGQA 2QE7D 2PHBA 1MMJN 1QFKH 2AH4X 4GHQA 4X1QU 1VZQH 1HAGE 2FM2A 1OWHA 2H1UA 3AW1A 2I6QA 3UR6A 1ZJDA 2H6MA 4NA9H 3ATMA 1MAYA 1W14U 3S9CA 2A5KA 1JMOH 1MZAA 2VVUA 1FJSA 2J34A 3PM3A 1O2YA 2C3SA 1O3GA 2J94A 3TJOA 1GBHA 1TX8A 2Y5HA 1AVXA 1SI5H 1FY4A 4NG9H 3A84A 3MNXA 5F8ZA 2Z3DA 1IQIA 3E6PH 4WJG2 4X6OA 3MWIU 3DUXH 1TIOA 3LDXH 1DWEH 1JIMA 3UFAA 3K9XB 1BZXE 2ZU2A 4Q4LA 1ZR0A 3RXFA 1VJAU 3FVFB 2J97A 1QA0A 1SGCA 3KL6A 2ULLA 3KCGH 4YO9A 1P10A 5A2MH 1TRMA 3ZZDA 1HGTH 4Y79A 4DJZB 1EAUA 5CHBA 4TSFD 4DIIH 1TABE 1GJ4H 3RM0H 2VVCA 1ESAA 1YWUA 1HRTH 5FCKA 3FO8D 2BOHB 1P9SA 4OM9A 2BHGA 1V2LT 3GOVB 4TYDA 2K1QA 2LELA 2WUBA 4ZXXH 1BMLA 3EGKH 4K1EA 1ANCA 3BTTE 1AVWA 1SHHB 1A5GH 3FP8E 3PV2A 4UDWH 1C1QA 1G37A 5C17A 4I32A 2D1JA 5DP8A 3RXVA 2Z6BD 4UD9H 1AMHA 1MD7A 2J4IA 1CQQA 5JBCS 1RJXB 4FXGH 3SU6A 5JBTA 3B8JA 4ZXYH 3G01A 4WMDA 4WWYA 5EXNA 3E91A 1WV7H 2AGIX 3KIDU 1QQ4A 3SJKA 3MOCA 3PO1C 4WXIA 2QAAA 1H8DH 3ELAH 1WTGH 1SQOA 5K0HA 3ZZ7A 1HFDA 1QJ6B 3AVZA 3MU8A 1C2EA 1SB1H 5JPMH 1GHZA 2SGAA 2CN0H 1SGRE 1QIXB 2XYAA 2QF3A 4FU9A 5HIZA 1LHDH 1Z8IB 3V7TA 3NPSA 1EP6A 1KDQB 4I8LA 1LO6A 1P2MA 3AK5A 1K1NA 1SC8U 1QCPA 2B0FA 3IG6B 2FS8A 3FZZA 3OEHD 4XE4A 5FXLA 1PPBH 5CDFE 1F0RA 3N7DA 1BBRE 2ZGHA 8LPRA 2B7DH 3OX7U 3ZVAA 1EJAA 4FVDA 2VIWA 1ZSLA 1B0EA 1SLUB 3TU7H 1O3CA 4TPYA 5FBIA 2FLRH 4MDSA 3SJIA 2AMQA 3KF2A 2KCPA 1JRSA 2FEQH 1VITH 4ZROA 1MUEB 4E05H 1CT2E 1EUFA 2BDAA 1ELBA 2IJD1 4I8GA 1WDIA 2R9PA 1OYQA 2F3CE 3UREA 1GBFA 3E3TA 5F8TA 2AHME 1NTPA 1EASA 1CT4E 1HIAB 4FUEA 3UNQA 1F0SA 1Q2WA 3H7TA 2HVYB 4AB8A 3EA9A 2PUQH 4ACAA 2QA9E 1J17T 4X0WU 2W3IA 3BSQA 2EC9H 4AC9A 1CGJE 1YPGH 4NA7A 2NU2E 1BT7A 1C5LH 1VGCC 1DY8A 4LZ1H 4CBNA 4YXWD 1SGIB 4K69A 4AORA 8GCHG 3F1SB 2WV5A 3TNTA 5DPAA 1CU1A 1SLXB 4GCHG 1TNLA 1FLEE 1PQ7A 3FAOA 1QB9A 3PTNA 3OY5U 1GL1A 1C2KA 2ZG0H 3GY7A 4FETA 1O2MA 2CJIA 1DXWA 2PP6A 4FUHA 1A3BH 2NU4E 1HXEH 5T6GA 3RXSA 1C1NA 1W12U 2UUYA 3P8NA 3CENA 4R8TB 4ESTE 4CRCA 5IDKA 2AMPA 3PMBB 1HBTH 2HPPH 1J16A 3CP7A 1RXPA 3BG4C 4YOGA 1CA0C 1C5OH 5ESTE 1GBBA 1GWAA 1MQ5A 1GHVH 4AGKA 2VU8E 1FDPA 3M5LA 1SGFG 1BMNH 1C5WB 5HM2A 1BJVA 4B6FA 1ZGVA 2JH0D 2TGDA 2C90B 5BPEA 4NA8A 3S9BA 2VWLA 1P06A 1YP9A 5JYIA 1TNGA 2ZDNA 1WU1A 1T31A 1CHOF 3HATH 4Q7XA 4NZQA 2W7SA 4YT6H 1E38B 1O0DH 2H2ZA 1IAUA 1AKSA 1S0QA 2HWLB 1YGCH 2KFWA 2J95A 3TGKE 1RIWB 1XMNB 2J5UA 3R0FA 1QGFA 5SGAE 1Z8JB 3RXHA 1G2LA 1GMHF 1H9IE 2J98A 3SU2A 3UTUH 1DSUA 2FIRH 3MH6A 3MH4A 3SUDA 1GHAF 1BRBE 3SV9A 1NM6A 2OP9A 3C1KA 3S7KB 1NPMA 3PLKA 2LNCA 4OS6A 4X8TH 1MTUA 1WUNH 1FY1A 1ANDA 1OKXA 5E0GA 2UWPA 4FU8A 1C2JA 1LKAA 1W2KH 2FXRA 4VGCB 1O5GH 5A0AE 2FWWA 2EEKA 1TGSZ 1PQ8A 3UR9A 1HJAB 1DWDH 1TPPA 2OLGA 1KSNA 1AKSB 4K1TA 3UQVA 1WAYB 5LPFA 2ZDAH 4B71A 1XX9A 3M3SA 5JB8S 1GBIA 3SN8A 3PLBA 3O8RA 1HAPH 1MKXK 2J98B 2A31A 2UWLA 1UW7A 4AFSA 1HJAC 3MHWU 3GCHC 1KXCA 4OS7A 4FUCA 3TJNA 1L2EA 2STBE 3UUZA 1YPMH 1GCTC 4CRDA 3SU4A 1C2IA 1S82A 3SHCH 3QX5H 2A4RA 4UFFH 3U1IB 2VVVA 5G4BA 1G3BA 5FCRA 1ZTKA 3P17H 3RXUA 2OQUA 1ELCA 2OK5A 1OS8A 4I33A 1DX5M 4X2VA 3SV8A 3L3TA 1ZMNA 4GAWA 5JBBS 1KY9A 4LOYH 1BTYA 2OTVA 1QBVH 2GTBA 5EXMA 1MTWA 1O33A 2F9VA 2JDID 4Z6AH 4AB9A 4OS4A 3BTGE 1TX6A 3PRBA 4GPGA 4TWWA 1KLTA 1Q3XA 4WXVA 2BY8X 4NIYA 1O3EA 1KYNA 1DFPA 1DDJA 1GDUA 3KQBA 2QGRA 3PRDA 2QXJA 3F9EA 4CHAC 3ZV9A 1LVMA 5J4QA 1O3IA 3M3TA 1TB6H 1W13U 3SU5A 1V2UT 4JZFH 3T5FH 1P04A 5CMXH 1LCYA 4D7GA 4AN7A 1S0RA 2VH6A 1ZOMA 5E2PA 3R3GB 1TMBH 3H7OA 4J1YA 3T2NA 3AASA 1LTOA 2KAIB 4GVUA 2K0QA 3A82A 1WSSH 3PLPA 3OTJE 5EJLA 4DG4A 1OX1A 3I29A 1GI9B 3A8DA 7ESTE 1FPHH 2Y82A 4RN6A 3MTYA 4UFDH 3F0OA 1DANH 3F68H 1EX3A 5FPTA 3AW0A 3DT0H 1P2KA 1J14A 1H8ED 2ILNA 2VWMA 1RTFB 5DP6A 3EQ0H 4ZKRU 1DT2A 1GVLA 1GBDA 1P0SH 2WPJS 3NUMA 3BTQE 3LGWA 3SV6A 1O2JA 4SGBE 1YKTA 1HAIH 1V2PT 4IGDA 1D9IA 1KIGH 2HGTH 2BD7A 3VGCB 1ESBA 1FN6A 3A81A 2FOAA 2BQ7B 3KEEA 1FI8A 1K9OE 1P3CA 1W11U 2QXHA 1XUHA 1GG6B 5EQQA 1WYKA 1J15A 1GBEA 5JDUB 1IQHA 1O5EH 2VBCA 4K2YA 1H9HE 4B2AA 5E0HA 2GGVB 2YNBA 1O3JA 3MMGA 5AVDA 2EA3A 1SGTA 4PROA 2XCNA 1O2NA 2R3UA 2ZU3A 5C1YA 5TCAA 1NS3A 3ATWA 3VXFH 3OYPA 4X2WA 3CS7A 2GZ8A 4CRFA 5GNDA 3TK5A 4AFZA 1SVPA 1ZHMA 1GI2A 5FPSA 1C2FA 3NK8A 1ABIH 3LKWA 1MAXA 3KNXA 4ACBA 5A8ZA 2WPMS 2BD2A 2FDAA 2G4UA 2A45B 3LJOA 1P3EA 1JXPA 2GDDA 4Y11E 4CHAB 1BUIA 1CVWH 1NROH 2A2XH 1N8OC 2ZCKP 1GDQA 4A6LA 4XBCA 2ZGXH 2WSSD 1G3EA 1EATA 2NWNA 3QUMP 3U8OH 1Z8RA 2R2WU 3QGJA 3QZQA 1Y5UT 3A89A 3LJJA 3E16B 5A8YA 3FFGA 1SSXA 1ZRKA 3MU4A 2PTCE 4IN1A 1W0YH 3T27A 1ANEA 4JK6A 1OWEA 4BTIB 3ESTA 1JRTA 1AQ7A 3MI4A 5GCHF 1KTTB 3GDSA 4HG6A 1ZPBA 3P8OA 1E1QD 4KKDA 3TVJB 2P8OC 3TK6A 2BZAA 3M7UA 1V3XA 1OPHB 2FS9A 3I78A 1E0FD 1W0KD 2BD8A 2VGCC 4A1XA 2J92A 1DICA 3DD2H 4Q63A 2A4OA 1JOUB 5F8XA 1HXFH 4ABEA 1L1JA 1AUJA 1G30B 2FOCA 5DGJA 1HV7A 4O97A 1BOQA 4TY6A 3RXLA 1IQMA 2F9UA 4JZIA 2VJ1A 5I25A 1OOKB 1YPKH 2NU3E 3MU5A 5GPIB 5CHAB 1UJ1A 1FY3A 1HJ9A 3N99A 1ABJH 2K8IA 4FUJA 2SGQE 1ZLRA 1TGNA 2ZNKH 1SOZA 2D8WA 4BAKB 2V7QD 1SFQB 4OS2A 2HLDD 1U6QA 2PKAA 2ZECA 1XVOA 1ETSH 3KQDA 2A1DB 2NU1E 1BCUH 3ZZ9A 1P02A 1JIRA 1P9UA 1TMUH 2BTCE 3BTKE 4JK5A 1C1VH 4XSKU 1GI5A 1ARBA 1EJNA 3HPTB 3RXAA 4D9QA 1GMCF 1UTNA 5A09A 1FN8A 3ZYEA 2YMSC 3ZYDA 4INLA 2UWOA 5LPRA 1RS0A 4B74A 2PKSB 4MPVA 1IQJA 1K22H 3STJA 5DSFA 3RXKA 1DLEA 1G2MA 2PKAB 1V2KT 2ZFFH 2ZP0H 1SGQE 1GBTA 2F91A 5E0JA 1TNKA 5I46H 1L1NA 9LPRA 1SOTA 1TALA 1C5QA 3PWCA 1OWIA 1XUFA 2XBWA 1CA0B 4A92A 3VB3A 2WPHS 1LHGH 2FTLE 2ZTXA 5DP4A 5EODA 3LU9B 5C3NA 2FO9A 1KXAA 2WPKS 3URCA 1MBMA 3EA7A 2QC2A 4Y7AA 4ZKNU 5FBEA 4U01A 3OY6U 2OQ5A 3M5MA 4KTSA 1TQ0B 4U2WA 1ZSJA 1TBQH 4BOHA 3A83A 2OXSA 2CHAC 3Q76A 4ISIH 4CH2B 3FN8A 4D9RA 1D4PB 1QB6A 1C1PA 2ANMH 1K1JA 8GCHF 3LGUA 4ISOA 1RRKA 1ACBE 1C1MA 3UB0A 2ANWA 3D62A 4J2YB 3UOPA 1FMGA 1XUGA 3BF6H 2XOKD 3SI3H 2OINA 1NU7B 3GCTF 2ZO3H 4IN2A 1SGEE 1QL9A 1ZJKA 2ALVA 3KHVA 1C5UA 3F2GA 1F7ZA 2PSXA 1GHBG 3SGBE 1SGPE 1UCYE 3SV2H 3VG8A 3BN9A 2O8TA 4WMEA 1XUKA 2XWBI 1DE7H 1GJ8B 3GS9A 2BOKA 5JB9S 1QRWA 4GSOA 4HTCH 3I77A 1EAXA 1F92A 4NCYA 1LPZB 1FAKH 3LC5A 3A7TA 1OP0A 2F4LA 1O3FA 3F6UH 2ALPA 1NBME 2VB0A 3MFJA 3LGIA 1QBOA 4FU7A 2W26A
chains in the Genus database with same CATH topology
4ABAA 5DKMA 3PB1E 3HK3B 1V2OT 3T62A 1A2CH 1FV9A 1VR1H 1TONA 2A5IA 4D76A 1AVGH 1UO6A 1EJMA 3F9FA 5DJ7A 3SHAH 3ODDA 3QTOH 2QV1A 3GISB 2IJOB 1O2RA 3GY2A 4HZHA 4BAHB 1QQUA 2XWAA 1RTKA 1WQVH 4Y8XA 2F83A 1K1LA 1TGCA 3A7XA 2F9OA 5A8XA 4AGJA 3PTBA 3SNCA 1T7CA 1PPZA 2ZFPH 1EXFA 1P11E 1EAWA 5T6FA 4CRBA 1SGNE 4BXSA 2JETB 1C4V2 3P8FA 6CHAC 1W7GH 5C20A 2EI6A 2ZC9H 2V0BA 2B8OH 2AFQB 2ZF0H 1LQDB 1DS2E 4RKJB 3E0PB 1UTQA 5HYOA 4Q7ZA 1TE0A 1GCDA 3UNSA 1PPFE 1QJ1B 4IW4E 1BMAA 2HOBA 1AWHB 1DY9A 1SR5C 2FOMB 2PUXB 4H4FA 1OWKA 1O2VA 1GJ6A 1ZYOA 2H9TH 1NU9A 2GVFA 1K1PA 3TLOA 2F9NA 2ZU1A 1P09A 3PYHA 2A4GA 1D3TB 1TBZH 1EOJA 1OWJA 4BXWA 3GYMA 1P2JA 3PV4A 3DHKH 1W3CA 1OYTH 1HAVA 4YZUA 4LK4A 3SZNA 1KLJH 3Q00A 3RC6A 2QN5T 5C1UA 2V3OH 2Y81A 4DGJA 3SNAA 2A2QH 3TGJE 4ABJA 3AAVA 5DG6A 4KP0A 4YTAA 3GY3A 3NXPA 2Y5FA 3GDVA 4JYUH 2Z9JA 2JETC 2BLQA 1GJDB 3LGTA 2FPZA 1K1OA 1V2WT 2PSYA 4ABDA 1ZPCA 1SL3A 5CE1A 2OC1A 1FXYA 2LPRA 2R3YA 3OSYA 2GV7A 2J2UA 2AEIH 3TIUA 1QRXA 5HM9A 1UTJA 1L4DA 2OCVB 4HFPB 3U8TH 2VINA 4I8HA 1NN6A 1KXEA 4MQAA 4ZUHA 2HALA 3LGYA 2W5EA 3SORA 1HPGA 2BY7X 2SGDE 4GCHF 1UTOA 4Y71A 3T26A 1DITH 1P2OA 1XKAC 4JZ1A 3FP7E 3O8BA 3EAJA 2XC0A 1EPTC 3V13A 1HNEE 3ZZBA 3VB5A 1AFQC 3GDUA 3RU4T 5L2YH 2A5AA 4MLFB 1ZMJA 4BAQB 2ZFRH 4Y8ZA 1GPZA 4DY7B 1A1RA 2P3FH 4IC6A 7LPRA 3LIWA 1CBWB 2DE9A 1VITG 2XBXA 2ZTYA 3T25A 1MTSA 3GCTG 7KMEH 1L0ZA 2A7HA 3SJ8A 1DPOA 2BD3A 2BDCA 1XM1A 5C2ZA 1H9LB 3FANA 1HLTH 2BD4A 1XXFA 3SU3A 1BQYA 5L30H 2FOBA 1C1UH 1K1MA 1QL8A 1WBGB 4THNH 1MTVA 1C1WH 3ZVCA 2STAE 3P6ZB 5H4IB 4B76A 1GMDF 1H4WA 3RXTA 2VNTA 1W8BH 1A0HB 1F0TA 1V2VT 5EXLA 1C9PA 5K7RA 2G5NA 3RXIA 4H6SB 2GCHF 1E36B 2PLXA 2TGTA 3U98H 2GMTC 4ABHA 1L4ZA 2PGQB 3AAUA 1THPB 5EG4A 1PJPA 1MQ6A 2V3HH 1RTLA 2PGBB 3L33A 6ESTA 1O2PA 1CBWC 4D8NA 4X1RU 1FPCH 3RXDA 4UFGH 3UNRA 1SMFE 1ZHPA 5IYTA 2ZTZA 1WTHD 1ARCA 4BTUB 2FMJA 2Q1JA 1ELTA 2GT7A 1GI7B 4MNVA 2A4QA 3RXRA 1O5BB 1D3DB 1MTNB 1EZUC 3M5NA 3UWIA 1MZDA 4KTUA 2VIDA 1RFNA 4Y6DA 3U8RH 2CV3A 1O3DA 4GLYA 4NSVA 3SNBA 1PPGE 4ABIA 1NFYA 1O36A 2TGPZ 3ATLA 3TJUA 4FVBA 1SG8B 6GCHF 3A8BA 2BB4A 1AB9C 1CSOE 1N6XA 2HNTC 1O3PB 2PKSC 3DA9B 5L6NH 3NKKA 2ZPRA 4I8KA 5E2OA 3WY8A 1AIXH 3A80A 5GCHG 1ORFA 4Y0YE 1O2XA 1Y3VA 4DVAU 2ZQ1A 1GMCG 5AF9H 2UUFB 1ELGA 1C5SA 1FQ3A 1PQAA 2Q6GA 2RA3A 1BHXB 1UK2A 2BLVA 2RG3A 4WY3A 2P3TB 3TGIE 4AZ2B 1Z7KA 1CE5A 1O2UA 3BIVH 3MH7A 1N1LA 3SNEA 4K1SA 3TH2H 1O30A 4ABBA 4A7IB 4H42U 4UE7H 4ZHLU 1V2JT 4KGAA 1C2HA 2IOTA 3SJOA 2BQWB 4X8VH 1C1TA 5DO4H 5J4SA 1GHAG 4BAOB 3MU1A 3ZZ8A 1TQ7B 2XBVA 2Y7XA 3UWJH 3BTEE 4NIXA 4JCNA 1SQTA 3STIA 2ZDKA 4X6MA 4AG1A 2H9HA 1YCPM 3HGNA 4KELA 1YBWA 1ZGIA 4K5ZA 1O3KA 4YOJA 2VIOA 1AN1E 1Y3WA 1FZZA 2QXGA 3SGAE 1GJCB 2CF8H 3Q3XA 5F6MA 2TGAA 6CHAB 3SJ9A 1ETTH 4QT8C 2Z9IA 5EOKA 1GDNA 4B1TA 1TMTH 2AIQA 2XTTB 1ZZZA 1QURH 2WINI 1AGJA 1O5FH 1GBKA 1UTMA 2PV9B 1BRUP 1CT0E 1GJBB 5DP5A 2YOLA 1E35B 1YLDA 1Z8GA 1O3HA 1NO9H 3T28A 4OS1A 1LHCH 3W94A 3PMHB 3BEFB 2AS9A 2ZHDA 3JZ2B 3MH5A 1NRQH 4ISNA 3LH3A 1THRH 1QB1A 1UTPA 1INCA 3W95A 3ENSB 4AYYB 3BTFE 1GJAB 3ZV8A 3M7QA 5EU8A 1F0UA 1HYLA 2BXUH 3A7WA 2OC0A 1Y5AT 3QO6A 1AO5A 2GZ7A 4WH8A 1EZSC 2XRCA 1X7AC 1MKXH 1ANBA 3HGPA 3K2UA 3MNBA 2C4FH 4JZEH 1AE8H 2XC4A 1O3OA 4X6NA 1SPJA 1NZQH 2A0QB 4GUXA 1O2WA 3RXCA 1CO7E 1BMMH 1SLWB 2G51A 3UY9A 1KDQA 1BTWA 5GIBA 1O32A 1GCTB 2SGFE 2AMDA 3UQOA 1HJ8A 4JYTA 1C5MD 1TGTA 1KXBA 2P94A 1Z1JA 2I6SA 4BAMB 3RXOA 1DWCH 2Y7ZA 2TIOA 2ZCHP 5EW1H 1D6RA 2AYWA 1TX7A 1P2QA 1Y3UA 2AIPA 1QL7A 2FI4E 1ZMLA 1TRYA 2QIQA 3BV9B 2VGCB 2ZCLP 1PPEE 3Q77A 5DP9A 3JZ1B 1O2KA 1W0ZU 4WVPE 2JKHA 4Q7YA 3HKJB 2H5CA 4D7FA 2BDHA 8KME2 3RC4A 1F5RA 2QF0A 1IHSH 8ESTE 1C2LA 4FUBA 5PTPA 2G55A 3OU0A 2FI3E 2ZGBH 4JZDH 2XBYA 1T8MA 1UMAH 1CGHA 2O8LA 4TY7A 3D65E 1G3DA 1TOMH 1S81A 3RXJA 1TLDA 2D2DA 3U69H 1DXPA 6LPRA 2R0LA 1RD3B 2FLBH 3VB7A 1J9CH 5JBAS 2HNTF 3A88A 1M9UA 1T4VH 1H8IH 1EB2A 3SUEA 1KXFA 4NSYA 1O3NA 1GBJA 1DLKB 4IBLH 3LONA 3K6YA 1N6YA 1DOJA 1HAXB 1XXDA 3VB6A 2A32A 1V2NT 4O9VA 1EZXC 1L1GA 1V6DA 2V6NA 3BG4B 3TH4H 4O03A 1TBRH 3RUOA 3GYLB 2J38A 1LQEA 1MBQA 1AI8H 1ESTA 2ZDLA 3MNSA 1UVSH 2FZZA 1O3MA 3MU0A 1HUTH 2AGGX 2Z9GA 3GICB 1BDAA 2ZHWH 1IHTH 3A7ZA 3SUGA 4DCDA 3RU4E 5C5NA 4K3JA 1GG6C 2ESTE 1JBUH 3ZZ6A 1K28D 3PMAB 3QN7A 3D23A 4CREA 4JYVH 2BX4A 1C5PA 2Y5GA 5BRRE 1V2QT 4NFFA 1G32B 3A87A 1C4U2 2W7UA 2ZPQA 1SGFA 2SGEE 2GCTB 3GCHB 1MH0A 3B23B 2OC8A 2JH5D 3GY4A 3UIRA 2G5VA 3GY5A 5HXFA 4Q2KA 3KGPA 3SU0A 5EGMA 1PPHE 4DOQA 2A7CA 1XVMA 4AX9H 3Q3YA 2ZDVH 3SQEE 3U1JB 1CGIE 2THFB 2ANYA 1T4UH 4BTTB 1OSSA 2GT8A 4K60A 4TPIZ 4E7RG 2BDYA 3UPEA 2PWXA 4NFEA 1D3QB 2D26C 1TPOA 2ZWLH 2BD5A 3ZZCA 4LZ4B 1S84A 1B0FA 1A46H 1YPJH 4INHA 1RIWC 1TNJA 1K1IA 1AD8H 4AOQA 1E34B 1GVZA 2SNWA 3ZVGA 1GI4A 5LPEA 3V0XA 1OP2A 1GBAA 3SV7A 5GJ4B 1IQGA 2BDIA 2ZU5A 3EA8A 1O34A 4HI3A 1Z6JH 1TNIA 2NU0E 1FY5A 1O2HA 4AFQA 1C5XB 2ZFSA 4B2CA 3EDXB 1BRCE 1JWTA 2ODYB 4YLQH 5FX6A 1KXDA 1WOFA 3RXPA 1YC0A 2C8ZB 1YF4A 3BEUA 3SW2B 1FAXA 2EI7A 2BYAX 2WV4A 2Y80A 5LH8A 1S6FA 2QY0B 1EQ9A 1Y3XA 3RMOH 4E7NA 2TPIZ 3RLYH 1MTNC 1BIOA 1UK3A 4MPWA 1QBNA 3ZZ5A 5GWZA 1TOCB 1S6HA 2P59A 2VWNA 1TRNA 4DIHH 4A1VA 1DUEA 1SFIA 2BMGB 2OUAA 3V3MA 4GHTA 5EW2H 1A3EH 2GKVE 4FUDA 1MCTA 4LXBH 1BJUA 1C5NH 3SBKA 1B7XB 5HMAA 4SGAE 1IOEA 2FOHA 2FYQA 1W7XH 4IS5A 2WUCA 1BBRH 3SO3A 1P01A 2Q6DA 1PYTD 1O38A 4I31A 2ZFTA 5ESBA 2BY5X 1QA7A 1MU8B 2KAIA 3VGCC 3E90B 4RSPA 1GJ9B 1BA8B 9ESTA 1QR3E 3A8AA 1ZRBA 2FX6A 1A5IA 1GI0A 2P3UB 4YLUA 2GZ9A 1AZ8A 5ETXA 2O9QA 2VIQA 4XBBA 2P95A 4AFUA 1FONA 3QLPH 1AHTH 4X1PU 1GI6A 4NIVA 2SGPE 3RXBA 5GDSH 4CH8B 1BTXA 1ELFA 3RMMH 4AYVB 3O8DA 2OD3B 3MO9A 4MPUA 1Z1IA 4NWKA 3LPRA 2HPQH 1DVAH 1GI8B 1LDTT 2ZI2H 1O5DH 4X2XA 1BB0B 3ATKA 3NCLA 1LPKB 1ETRH 1HAYB 1P12E 1GHBF 3ZZ4A 2WYGA 1AFQB 3SI4H 2IPHA 1OP8A 1S83A 4M7GA 2J9NA 2RA0A 3SU1A 4Y10E 1ZSKA 1WQSA 2BVSH 2WPLS 4MG3A 1NFXA 1SLVB 3HK6B 1QTFA 2ZIQH 4ZH8A 1BBRK 3BTWE 1OWDA 4ASHA 2RCEA 3ZZ3A 5LGOA 4OS5A 1MU6B 2F9BH 1C5TA 3VEQB 2VIPA 3RXMA 4F4OC 1NC6A 4IMQA 2BXTH 1VJ9U 1ELVA 2OC7A 1H1BA 1G3CA 1B5GH 5AFZH 3RC5A 1CA8B 1TA2A 2PR3A 1GMDG 2GD4B 2ZU4A 1F5LA 3P92A 1ZTLA 3LH1A 2W3KA 1PPCE 5E8EH 1D6WA 1GHXH 1YM0A 1EPTA 1UVPA 3ODFA 1EZQA 3NWUA 1GI3A 1A5HA 1EAIA 2HRVA 1C1RA 2ANKH 1K21H 3NZIA 1HB0B 3MYWA 1NFUA 3FZDA 5T6DA 4I7YH 1FUJA 2ZGCA 3T29A 2R2MB 4MNWA 2G81E 2GDEH 1QRZA 1VGCB 5C67A 1O5AB 3RP2A 4OGXA 3MO3A 3URDA 2G4TA 1ELEE 2SNVA 5EPNA 2OBQA 3RLWH 3L6PA 1T8OA 4ISHH 4ZHAA 1NRRH 1SGDE 2ZEBA 4Y8YA 2C8WB 1QNJA 1EB1H 2Z7FE 4MNYA 4VGCC 2Z9LA 5B6OA 3H5CB 2B5TB 4NZLA 4X6PA 1Z71A 2G00A 5TCCA 2BLWA 1VITF 1UCYK 4FUFA 1W10U 1DSTA 2ASUB 3B9FH 3RDZA 1WCZA 3VXEH 3E8LA 1C9TA 1TPSA 1HCGA 4DURA 5TJXA 4IC5A 3RMNH 3ZVBA 2EI8A 4ISLA 3VFEA 1P05A 1TNHA 3P95A 2Z94A 3ATIA 3ITIA 1GI1A 1UHBA 1C5RA 1E37B 3SGQE 4X2YA 1AE5A 2BQ6B 4A5TS 1LVOA 2O8MA 2XNIA 2BVXH 3RMLH 1O2SA 2WPIS 2RDLA 4NIWA 4U32A 1LMWB 1O37A 2FYRA 2OBOA 1D3PB 2Y6TA 4TWYA 1ID5H 3M5OA 3LOXA 4XDEA 3K6ZA 1C2DA 1HIAA 1ZHRA 3PO1B 3VB4A 2BVRH 5C1XA 4WMFA 2P16A 2GX4A 2ZHFH 4WF8A 1NESE 3BTME 4FUGA 2P93A 1UHBB 2CF9H 1LVBA 3S69A 3LT3A 1A0JA 1C2MA 2ZGJA 1GGDB 4ZMAH 3A7YA 3PROA 1YLCA 1F2SE 1FIZA 3N7OA 1UCYH 5FX5A 1J8AA 3QTVH 3IWMA 3P70B 2FOEA 2V35A 1OXGA 5CHAC 1Q31A 1BRAA 1BTZA 2GMTB 4ABFA 2ZZUH 1SBWA 2BM2A 1YCPK 5FHTA 1TGBA 4INKA 3GCOA 1V2ST 2UUKB 5DP7A 3S9AA 1UK4A 7GCHG 1EKBB 2WYJA 2C8YB 1QY6A 1GJ5H 4A1TA 3BG8A 2VWOA 3SOSA 3SNDA 3DFJA 3M3VA 1MD8A 2A7JA 1NT1A 1YPEH 1PFXC 3TITA 3V12A 4ZAEA 4YESB 2PTNA 1DWBH 3RU4D 1Y3YA 2FP7B 4MVNA 1A4WH 3P8GA 1O2OA 3LGVA 4H6TA 4R0IA 3M61U 3RXEA 3KQEA 3ZVFA 1DM4B 1GBLA 1TFXA 5T3HA 1LVYA 1P2IA 1O39A 2AGEX 4O3UA 1GJ7B 4OGYA 4YM9A 3QGNB 2Z3CA 1GBCA 2BY6X 4UEHH 1P03A 1Y8TA 4NWLA 3M35A 1S5SA 1YCPH 3QWCH 3TK9A 4AG2A 1N8OB 1LHEH 2YNAA 4B2BA 1FIWA 1TA6A 1AU8A 5F03A 2ODQA 2O8UA 4XOJA 1TAWA 1DUAA 5EQSA 1IQLA 2FI5E 7GCHF 3CS0A 3ZVDA 1UTKA 2VH0A 5EPYA 2QXIA 4E06H 3QDZB 1HAHH 1NRNH 4ZHMU 3M7TA 1HAOH 4X8SH 2SFAA 1LPGB 2TRM