1PQ7A

Trypsin at 0.8 a, ph5 / borax
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
224
structure length
224
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin
publication title Trypsin Revisited: CRYSTALLOGRAPHY AT (SUB) ATOMIC RESOLUTION AND QUANTUM CHEMISTRY REVEALING DETAILS OF CATALYSIS.
pubmed doi rcsb
total genus 55
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pq7A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pq7A01
3HKJB 2VWOA 4IN1A 3GCOA 2DE8A 3P8OA 1GI6A 1S0QA 1BRCE 3TH2H 2HRVA 4AX9H 1EASA 3UTUH 2VGCB 2PW8H 3ESTA 1P05A 1OWIA 4U01A 2ODYB 3A84A 1SLVB 1YCPH 1DICA 1TNHA 3GY6A 1TAWA 3E16B 4F4OC 2BY8X 4OS7A 3OY5U 1P9UA 4TYDA 4RN6A 1C2JA 5A2MH 1BIOA 2J4IA 1QB1A 2QA9E 1DSTA 1HXFH 1GPZA 1GHWH 1C5WB 1SFIA 1TGTA 3GOVB 4YESB 1SQAA 3A86A 1TGSZ 2BOKA 3PLPA 3ATIA 2ZFSA 1ABIH 1AFQB 1E37B 4UFGH 1G30B 2HPQH 4I32A 4IW4E 1O2HA 1H4WA 3ZVFA 3QWCH 2RG3A 1VR1H 1Y3YA 3RP2A 2LNCA 2BYAX 1D9IA 2ZU3A 5DP9A 3EA9A 1AVGH 3UWJH 3NXPA 1H8IH 3U8TH 3SV7A 1C1WH 1QBOA 3BIUH 1QR3E 3RXIA 2GT7A 1P2QA 4ZROA 3RXCA 3DHKH 1PQ8A 1W3CA 3LGWA 4FU7A 5LPRA 2EI7A 5E2PA 4NA8A 1EPTC 3BTEE 1JXPA 3BV9B 2BD3A 4DJZB 2B9LA 4JMYA 4Q80A 3SGBE 2BB4A 3LT3A 2O8UA 3SV6A 1G3BA 1O3NA 2GP9B 4H6SB 1G3CA 3PMHB 4B2AA 3G01A 1G9IE 4ZH8A 3T62A 2W3IA 3GY4A 1P03A 1SOZA 1QBVH 2G51A 1EAUA 3LC5A 3SHCH 3P95A 4WVPE 1GHBF 3O8CA 1H9IE 2C90B 1EATA 1C2IA 4AN7A 3UUZA 1K1LA 4FUJA 4ZXYH 1HJ9A 2HLCA 5L2YH 2R0KA 3V3MA 2Z6BD 4K1SA 1P2NA 2PKSC 1LKAA 4U30A 2ZHDA 5LGOA 1AUTC 1LPGB 1C5PA 1CBWC 1W13U 1S84A 2GDEH 4B1TA 1T7CA 3H7OA 4B71A 1XUGA 3MFJA 1BTUA 2TGPZ 1T4UH 5HM2A 3SNAA 1P11E 5C5NA 3R0FA 2J34A 1BMAA 1LVOA 1S6HA 3F9FA 3K9XB 4ZHAA 3MH5A 2AIPA 1CA8B 2Z3CA 6GCHG 4CR5A 1NO9H 3M7QA 4ZMAH 1FPHH 1JRSA 1GCDA 3SI3H 1OWJA 1K1IA 3RLYH 3RXKA 3SN8A 1DX5M 2QCYA 1EXFA 5L30H 1RIWC 1ANDA 1C1PA 3SNEA 1OYQA 4MPVA 2ZI2H 1LQEA 1AQ7A 1NU9A 2AEIH 3GY5A 4O3UA 1W7XH 3RU4T 2SFAA 4DG4A 2FOGA 2F9BH 4AZ2B 2HNTC 1N8OC 1NM6A 2OTVA 8KME2 2PLXA 1G37A 4FUHA 2I6SA 1TBZH 2Y5FA 1GDNA 4NWLA 1UVUH 1OP8A 1JWTA 3GCNA 1B0FA 1EX3A 3STIA 4NZLA 1AE5A 2IPHA 1NS3A 2ZFTA 1IOEA 1K21H 1ZHRA 2HGTH 2W7UA 3BTWE 1LPZB 2ZEBA 4BXSA 4GHTA 1V2WT 2A32A 2V35A 1D3TB 1AVWA 3M7UA 3MWIU 1A5IA 1O30A 1F2SE 1GCTC 4B74A 1LTOA 1P2IA 1CT2E 2A7JA 1BZXE 2BD5A 4Y8ZA 1TOCB 1YYY1 1SBWA 4ISOA 4X0WU 1SMFE 1THRH 4ABJA 2HVXA 2VIVA 4K1EA 1ZMJA 4DVAU 3LKWA 1V6DA 1EKBB 2P59A 5BRRE 2BXUH 1V2QT 1UVTH 1BQYA 4GHQA 2H9EH 5TCAA 1FV9A 1BOQA 1ZHPA 3MU4A 1P02A 1BBRK 1ESTA 1FZZA 3IITA 1ELAA 4ZKSU 4CH2B 4UFDH 2ILNA 2Z3DA 3FFGA 1MCTA 2ZDMA 3BG4B 2VIQA 3ENSB 1F92A 1O32A 1GMDG 2G81E 1AGJA 1GG6B 1XUJA 3A7ZA 4H42U 3LU9B 5JBBS 2BDAA 3SUDA 2NWNA 1HLTH 1AWFH 1DS2E 4ZKRU 1IQKA 4KP0A 1KSNA 1V2UT 3U1IB 5AFYH 2XC5A 1LQDB 1O3GA 1DUEA 1P8VC 1MZAA 5H4IB 2AGGX 5TJXA 4D7GA 2OD3B 2W3KA 4YLQH 1GJ6A 4FVDA 2BMGB 2UWLA 2BY9X 4X2WA 2GMTB 1S5SA 1O2TA 3KHVA 1EOLA 4FUBA 3BTDE 3EA7A 4Z0KA 1K9OE 4DY7B 4AFZA 5C1YA 3TVJB 3FVFB 3VGCB 1TPOA 1Z71A 1C1RA 1F5LA 1O2OA 3NPSA 2WV4A 3GY7A 1C5NH 3ZZ8A 3A8DA 1P06A 3M3VA 1HAXB 3KQEA 1S81A 1C1MA 2BVSH 3A7XA 1T8LA 4ZXXH 1EQ9A 1C5ZB 1WU1A 5DO4H 4CRDA 4ISIH 4NFEA 3SV8A 4YOGA 2QXJA 2RCEA 5K7RA 1UCYK 2H5CA 3TH4H 1WCZA 2Z9LA 1SHHB 3RXVA 3TU7H 2FI5E 2HWLB 1C1TA 1MAYA 2ODPA 2Y6TA 1O3FA 2J2UA 3QK1A 5C67A 2ODQA 4X8VH 4BTTB 4ESTE 1MTNC 1QTFA 5EXMA 2QC2A 4FUDA 2UUYA 5SGAE 3UNRA 1CSOE 1K2I1 5F6MA 1SLXB 2VU8E 4WH8A 1O5BB 2BVXH 3MU5A 1TMTH 2EC9H 5CMXH 1FQ3A 1INCA 1MKWH 3SO3A 1FI8A 1SLUB 1UO6A 3CS7A 2FPZA 2NU4E 1GHYH 3LGVA 1P01A 3HGPA 4YLUA 4AOQA 2P3TB 1QRZA 3GCHB 3B23B 1SHYA 3SW2B 1PPHE 2OLGA 4OS2A 1JRTA 1O0DH 4D7FA 5LH8A 1SR5C 1HRTH 1A2CH 1UVPA 1MU6B 1MD8A 2A5AA 1CHGA 2ZIQH 4RKOB 2ZU1A 2BZ6H 3T29A 1HUTH 1OWHA 1ANBA 1XKAC 1V2TT 4TPYA 2Z7FE 1ZSJA 4AGJA 1VITG 4ASHA 2ZU4A 1ZGIA 3MOCA 3SGQE 1QIXB 2BZAA 2W26A 5DP5A 1Z7KA 3BTGE 1QJ1B 4SGBE 3RUOA 3BN9A 3V12A 1V2NT 1AB9C 4TY7A 1DUAA 5A8XA 3Q76A 2AIQA 4WJG2 2FS9A 2WPIS 6GCHF 4KGAA 1LHGH 2XNIA 3UNSA 2XCFA 3TPIZ 1BTYA 2PSYA 5EW1H 1CHOG 4K5ZA 3RXLA 1B5GH 1L4ZA 5AHGH 2FLBH 2ZF0H 4X2YA 1IQGA 1V2PT 1DE7H 4ABHA 2PV9B 4ZKNU 4DOQA 1MTWA 2TIOA 1P57B 1WQSA 2QV1A 6LPRA 5FBIA 3HKIB 3KNXA 3F68H 3DD2H 2ZQ1A 1TWXB 4BAHB 3ELAH 1TPPA 1NZQH 5C1XA 2OC1A 2H9HA 1QJ7B 1XXDA 2H9TH 4CRBA 4GSOA 1UVOA 2GCTC 1YM0A 1SVPA 2A5KA 2CHAB 1FPCH 1B7XB 3ZZ7A 1ELDE 2J92A 3ZVEA 4OS1A 4INKA 3PMAB 4ABAA 1SGYE 1TABE 1HFDA 1MKWK 4JYTA 3LIWA 5JB9S 2ANWA 1V2JT 1EJMA 4CREA 1DITH 2AMPA 1DXWA 1UK2A 3RXMA 3ZYDA 5EPNA 4VGCC 3ZV8A 1LHFH 1O3OA 1AUJA 2ZTYA 3A8BA 5GXPA 1TGCA 3PLKA 4Y6DA 7ESTE 3NCLA 1QJ6B 3WY8A 3GDSA 3CP7A 3LC3A 2BLOA 2SGAA 4NWKA 1ELBA 2O8TA 3E1XB 1DPOA 2P8OC 3TGIE 3VEQB 1AU8A 1ZOMA 1GMDF 1TBRH 1ZPCA 3K6ZA 5GCHG 5FPYA 1FY8E 2ZGHA 1O31A 2ZDAH 4ZHLU 5CHAB 1OX1A 1C5VA 3SJ8A 2P3UB 4UEHH 4RSPA 3KIDU 1C2GA 4ABBA 3FANA 1GL0E 1O2PA 3AAVA 1HIAB 1YLCA 2FS8A 3A81A 5DP8A 3PWBA 3RXOA 4GCHG 3ZZAA 3BG8A 3SBKA 5FXLA 1BMMH 1W7GH 1QURH 2Y80A 2FODA 1CVWH 2ZFFH 3VXEH 1O2RA 3BIVH 1HAGE 3FP8E 4AG2A 2GT8A 1O2KA 2FOAA 4MPUA 4WMDA 2F9UA 2ZG0H 1IQIA 1TRMA 1KXEA 2J94A 2AGIX 4O03A 2ZFPH 5GPIB 1GVZA 1TFXA 1ARBA 2FP7B 3ODFA 3OSYA 1GI8B 3MO6A 1LVBA 1JBUH 4DW2U 1O5EH 4A1VA 4INHA 2W7SA 3V13A 2STAE 2FESH 4BTUB 1SGNE 2FWWA 1KLJH 5CE1A 1Y59T 4IGDA 3MNCA 1Y5BT 4JZEH 5EQRA 2ZDVH 9ESTA 3SUFA 2XBVA 4I8HA 1RJXB 3M35A 1TOMH 4I8JA 1GBAA 1GMHG 3GYMA 3TNTA 2R3UA 3BF6H 3PO1C 1T31A 2XWAA 1UTNA 2WV5A 2ZDNA 1E35B 1MKXK 4NIVA 3P8GA 1GBEA 2G55A 4K8BA 1GBLA 3KEEA 3O8BA 4NSVA 3E91A 1V2RT 2F9OA 1FY4A 1TNLA 4MPWA 1O5FH 3Q77A 3ZVAA 1GL1A 4MG3A 1TB6H 2GGVB 5E8EH 2XCNA 2VGCC 3ZZCA 1OKXA 4CRCA 1J16A 1MH0A 4BAKB 2Z9KA 3LGUA 1O3CA 1PPGE 3VB6A 2FTLE 1BHXF 3ZZ3A 4KELA 3SJIA 2XW9A 1O36A 1O3JA 1C5TA 1Y8TA 5FCKA 1ESAA 1C1QA 1DANH 3LGIA 1ANCA 1DWCH 2V3OH 3D62A 3BTKE 5GIBA 1CGHA 1GGDB 1TX6A 1AFQC 1O5CB 4YTAA 1FLEE 4R8TB 1GJBB 4JYUH 2B7DH 1VITF 4MVNA 3QDZB 1HAHH 2ZPSA 4BAQB 1O38A 2QF3A 3KGPA 1F5RA 4U2WA 5C5OA 1QY6A 3W95A 3TIUA 1K1NA 3AVZA 3DUXH 4UONA 3A85A 2A7CA 1O2VA 2C4FH 1S85A 1S0RA 2WYGA 1QQ4A 1Y5UT 2GZ7A 2O8WA 5T6FA 4I8GA 3VB4A 1GBJA 1CHOF 2EEKA 1CGIE 4GLYA 4DIHH 5IYTA 1D3PB 1HBTH 3LPRA 2XWBI 1VGCB 4FUCA 1P3CA 1P9SA 3Q3KA 1LHEH 5EU8A 1XX9A 4CRGA 2GX4A 3SU1A 2O9QA 3FAOA 2ZPQA 4NA9H 1MBMA 1MBQA 5HXFA 4ABDA 3U1JB 6ESTA 1O5DH 2Z9GA 1C2DA 1WTGH 1GHAG 1IQEA 4WXVA 1YLDA 3PLBA 2CGAA 3K6YA 1K28D 3SV2H 1UHBB 1NN6A 1SGPE 3RXJA 1P2KA 3D65E 4K8YA 2SGQE 1NRSH 1MTSA 4B75A 5A8YA 1N6YA 4DIIH 1G2LA 1MD7A 1C1VH 2F9VA 1C2FA 3M7TA 3RC6A 1MTUA 1GBBA 4CR9A 4Q7XA 1RGQA 1WV7H 3PYHA 1IHTH 4HI3A 3BTME 1O2NA 1CGJE 2Q1JA 1T32A 1SGEE 2R3YA 1BUIA 1ABJH 3T28A 3RU4D 1C5UA 1YCPK 2OQ5A 4D76A 1K1OA 4E7RG 1PJPA 3C1KA 3DT0H 1AVXA 1O37A 3TH3H 5E0HA 1O2GH 1AKSB 1HJAB 2VWNA 4IMQA 4H6TA 1XVMA 3LOXA 1KY9A 2FYQA 1LO6A 1C5XB 2BD8A 1SB1H 2ZCKP 1PYTD 3KQCA 1BRBE 2UUKB 3QX5H 1BB0B 5GCHF 1GI5A 2CF8H 3RXFA 1SLWB 5T6GA 3E3TA 4FUEA 3SHAH 2FI3E 2Y5GA 1FN8A 2Z3EA 2BY7X 5HM9A 3BEIB 1OXGA 1GBDA 3QN7A 3R3GB 1YC0A 3RXGA 5I25A 4GCHF 1C5LH 1XKBC 4ZUHA 1G2MA 4JZIA 1RTLA 2R2MB 4ABIA 2V3HH 5LPEA 2Z9IA 1DWBH 3L33A 4FVBA 1OOKB 1O2WA 1ZTLA 2AGEX 1O35A 4KTSA 2FMJA 3RXPA 2WYJA 4O9VA 1QQUA 3LONA 2BD7A 1QL9A 2R2WU 3V0XA 2G00A 1HAZB 1XM1A 3GY3A 1ETTH 4BOHA 3AASA 2AFQB 3BEFB 3M36A 3E8LA 2WINI 4B2BA 1C5QA 2F9NA 3LDXH 8GCHG 1O2JA 1A4WH 2F83A 3RMLH 2BX4A 1JIMA 1HCGA 1ZSKA 4Y0YE 3DA9B 3F9HA 2AMQA 3TGJE 2ASUB 4ISLA 1O2XA 1IQFA 2BD9A 1KDQB 1ACBE 2LPRA 5EOKA 1HIAA 1S6FA 3A7WA 4BAOB 1CU1A 1HAVB 3BTFE 1L2EA 1LVYA 4AGKA 2QAAA 1GMHF 1EP5A 1ZZZA 3URDA 3ZZDA 2BLVA 2OUAA 3P70B 3BG4C 1TA6A 5L2ZH 1A7SA 2Z9JA 1GG6C 4OGXA 4A92A 1PPEE 1H1BA 1O5GH 5JYIA 1KTTB 1NFWA 3A89A 2FM2A 1EAWA 3ATWA 1UJ1A 5J4QA 1W14U 5T6DA 1K1PA 4AG1A 1AIXH 4X6NA 1LKBA 1ETSH 3ZZBA 3EYDA 2WUCA 3KF2A 1FJSA 1W2KH 1TA2A 2P95A 3MYWA 2ZGJA 3MNXA 1IQJA 1P0SH 1SQOA 2R0LA 1TIOA 1ZR0A 2C93B 4ABEA 1A5HA 2QXHA 1DDJA 4B76A 1UTMA 2ZCLP 6CHAB 1NFUA 4Y10E 1BTPA 2GMTC 1BTXA 1QA7A 3RM0H 3EQ0H 2ZGCA 1IQNA 1GJAB 2A2QH 3QLPH 1O3AA 3VGCC 2ESTE 1L1NA 1D6WA 1CA0B 4FUFA 3UOPA 1AN1E 1YP9A 1GBKA 1XXFA 2DE9A 1O3MA 2NU1E 3M5OA 4HGCA 4J1YA 5I46H 2FTMA 4SGAE 3A7TA 4CRFA 2P94A 2VNTA 3VFEA 2BDBA 1D3DB 2J95A 2JH6D 1DOJA 2GDDA 1HYLA 2RA3A 5A0CA 2A2XH 1C5YB 2IJOB 3AAUA 1AO5A 1GJ9B 1J17T 1OWEA 1ANEA 3MHWU 1TNIA 3NK8A 4YOJA 1YPKH 1NFYA 1TNGA 1U6QA 1P09A 2BDHA 3NZIA 5K0HA 1HXEH 2H6MA 5A0BA 1AFEH 1T4VH 3ZZ5A 5C20A 4X2VA 1P2OA 1WBGB 3L6PA 4X1NU 4A6LA 1C2EA 1O2QA 2VVUA 4XFQA 2FI4E 1D3QB 2ANYA 2EI8A 1GHAF 3ATLA 5A09A 1MZDA 3GCHC 3MU0A 4MDSA 1QCPA 2WPHS 1HAOH 5EQQA 1T8OA 3SV9A 1ZTKA 1P10A 5F8XA 7LPRA 2QGRA 3SU4A 1DY8A 3BSQA 1PQ7A 2GCHG 1WUNH 5DG6A 1RTKA 4IC5A 2D2DA 1TRNA 2ZQ2A 2BLWA 4CRAA 1TONA 1QFKH 3SJKA 1RTFB 2GTBA 1NC6A 1SSXA 1GBIA 1GJ5H 5JB8S 1O2UA 4B73A 4IS5A 2FX4A 2ANMH 2OBQA 1YF4A 4I8LA 3ZVCA 3M5MA 1EB1H 1Q3XA 1MCVA 4Y7AA 2PUQH 1EOJA 2ANKH 1EZXC 1C9PA 4NZQA 2QF0A 1T8NA 1QL8A 3SI4H 3SORA 2Q6FA 1AD8H 1CO7E 1UHBA 3RDZA 1TBQH 3EGKH 1VZQH 1Q2WA 5EODA 2ZTXA 1SG8B 2BOHB 2PKAB 2V6NA 1HGTH 5FAHA 2YOLA 3ZVGA 1A3EH 2BHGA 5C2ZA 3TITA 3UY9A 5JBTA 3LGYA 3VB5A 1VJ9U 1W0YH 3H5CB 3SUEA 1NESE 2SNWA 2EI6A 2HOBA 2BDCA 3P92A 2FZZA 4MNYA 3ZZ9A 3S7HB 3SQEE 3GY8A 4Y8YA 1AKSA 5DP3A 3W94A 1TPAE 2IN2A 5EPYA 2BM2A 1SGTA 1HAYB 1OS8A 2CHAC 4MNWA 1G36A 4Q2KA 1DT2A 2C8ZB 2G4UA 3TJNA 3U98H 3MH7A 2UUFB 2GVFA 4LK4A 1ZHMA 3TK9A 4DCDA 4D9RA 8GCHF 2VJ1A 1ARCA 4YOIA 1O2SA 5GWZA 3TJOA 1MMJN 1ZMNA 1XMNB 3SU2A 1KIGH 5GJ4B 2VIPA 1SPJA 3T27A 3GICB 4JK6A 2J38A 1S83A 1W12U 1C5MD 4DT7B 1NTPA 1MUEB 3KN2A 1V2VT 1Z6EA 3E0NB 1PQ5A 1A0HB 1PFXC 2VINA 4JZFH 3ZYEA 5JDUB 4LZ4B 2STBE 3Q00A 5JPMH 1SGQE 4CHAB 2VIWA 3LGTA 1FIWA 4AB9A 2FOHA 1YPMH 1SQTA 4I33A 4X6OA 5CHAC 1IQLA 1O2MA 2BY6X 2XBWA 1O3EA 1NU7B 3T2NA 2RDLA 4B2CA 2D8WA 2PWXA 1L0ZA 3M5NA 5ESBA 1BJUA 1FAXA 3NWUA 4H4FA 5DP7A 2O8MA 2OINA 1KXBA 4K69A 1EAXA 1ZTJA 4KTCA 1C5RA 4Q7ZA 1EAIA 2H1UA 3AW0A 1KTSB 3S9AA 1A0JA 1XVOA 1V3XA 3GY2A 3SJOA 1KDQA 3E6PH 2ZHFH 1TX8A 1H9HE 3A83A 2F9PA 4XE4A 1ZRKA 1HAVA 1NY22 2BLQA 2ALVA 1C1SA 4FXGH 4NGAH 1SGFG 1O34A 1O3HA 1ZRBA 2J9NA 1SGIB 4O3TA 5DP6A 2BDYA 2IOTA 3L3TA 1GJCB 4FUIA 2ZC9H 2BD2A 3IG6B 2PHBA 1O3PB 1GJ7B 4K60A 3SU6A 5DPAA 2O8LA 3ODDA 2H5DA 1OYTH 4X2XA 1WYKA 1RXPA 3KL6A 4XBDA 5BPEA 1K22H 2D1JA 4XSKU 5DKMA 4ISNA 4X8TH 4Y79A 1V2OT 3F9GA 3URCA 3BTTE 2OC8A 2ZZUH 3SU0A 4OS6A 2JETB 4D8NA 1GI1A 3E0PB 2Y5HA 2UWOA 4FU8A 4IMZA 2QY0B 2WPKS 3D49H 4GAWA 3QTOH 4YT7H 3SUGA 1GI9B 1RD3B 1XUFA 1OWKA 2B5TB 1ELCA 3TGKE 4MTBA 3RXRA 3VPKA 1QL7A 1ZYOA 1C1UH 4JYVH 2M5TA 4X8SH 1TRYA 2Y82A 1Z8RA 3SQHE 2XBXA 3TK5A 1C4Y2 4LXBH 2ZWLH 1O3KA 1ZSLA 3T26A 2TPIZ 3ZVBA 1MTVA 3JZ2B 1DWDH 1ZJKA 4Z6AH 3AW1A 1HB0B 5PTPA 3FZDA 1MAXA 1O2IA 3P17H 1C2HA 4JK5A 1C9TA 2OXSA 5TCCA 1GHVH 2GCHF 1HNEE 1HPGA 2XYAA 1DLEA 2Q6GA 5HYOA 1MQ6A 2I6QA 4IN2A 4WF8A 1VCQA 1EJAA 3HPTB 3KQBA 5ABWA 2ZFQH 4E7NA 4X8UH 1GGDC 1A1RA 1Y3UA 5J4SA 1ELFA 5FBEA 1BBRE 1DM4B 4KTUA 1THPB 1P04A 2AYWA 4ZHMU 2KAIB 4NSYA 1YCPM 2VH6A 3B8JA 3U8OH 1PPCE 1WOFA 4JZDH 1O2YA 2FX6A 3OU0A 5A8ZA 4AYVB 1JIRA 4AYYB 1NRNH 4Y0ZE 5E0GA 4E06H 1BTHH 2C8XB 2CJIA 1WAYB 3MTYA 2A7HA 2ZGBH 3PTBA 1FIZA 2DUCA 2Y7XA 1SGCA 1ID5H 4AORA 4BNRA 3VB3A 2OCVB 1YGCH 1GBTA 1W8BH 1TPSA 3CS0A 1P2MA 1ETRH 3LH1A 1VGCC 1YPEH 1BDAA 1GJDB 4OS5A 3A7VA 1C4V2 1KLIH 2ZKSA 1YKTA 1J8AA 3UPEA 2C8YB 3PB1E 5L6NH 3TNSA 1BMNH 3MI4A 4WWYA 2PFEA 1D6RA 1SL3A 1Y5AT 2GV6A 3GDVA 3RXDA 2B0FA 2AERH 3MU1A 1M9UA 1YPGH 2FIRH 3VXFH 1KLTA 4UFEH 3UQOA 4IBLH 1OP0A 2ALPA 3ZVDA 1EPTB 2A45B 1BRUP 1CQQA 3E90B 2ZCHP 1VCPA 4NCYA 1OP2A 3EA8A 2QN5T 4NIWA 5A0AE 1AZZA 3QTVH 3SU5A 3NUMA 3S0NA 3RM2H 1GMCG 1TNKA 2AMDA 3TJUA 1VITH 1X7AC 2TGDA 1C1NA 1LPKB 1UCYE 1ZGVA 1HDTH 1UTLM 3RXUA 4QT8C 5IDKA 3OTJE 2WPLS 3LH3A 1E38B 1NROH 3A87A 1F0SA 2PKAA 1VJAU 3S9CA 1GBFA 1BBRH 3ATMA 2NU2E 1C2KA 1HJAC 3A7YA 5JBCS 1KXCA 1ZPBA 1V2KT 2FDAA 2SGDE 4HZHA 4I31A 4YZUA 3UR6A 3SNCA 4X6MA 1GDQA 3H7TA 1QGFA 2F91A 2XBYA 1ORFA 2PSXA 2PR3A 4DGJA 3PM3A 2PKSB 5F8ZA 3HK6B 4NA7A 1HJ8A 2FOFA 2ZU2A 1CE5A 1CBWB 5DP4A 1YPHC 1TMUH 2YNAA 2VH0A 1AWHB 1FNIA 1LMWB 2P3FH 1FAKH 4YO9A 3I29A 1MQ5A 1DXPA 2CN0H 1TNJA 1O3BA 1A46H 2VIDA 3RXAA 3UREA 4O97A 4J2YB 3O8RA 3HK3B 1F0TA 1N1LA 3PV4A 1UTPA 3SU3A 1BJVA 4MPXA 2W5EA 1RIWB 1EZQA 1G3EA 3QGNB 1CT4E 2GZ8A 1UTQA 1Z8JB 1K1MA 1E34B 1EUFA 1OPHB 1TGNA 1TYNA 2BY5X 5FHTA 5DJ7A 3U9AH 2UUJB 1P2JA 1N8OB 1O3LA 1AE8H 4CBNA 3QO6A 3O8DA 3ATKA 3UNQA 1VCWA 4BAMB 2P16A 4UFFH 2SGEE 4ZAEA 3RXSA 3S7KB 1QHRB 4Y11E 3P8NA 1TQ7B 1KYNA 3TLOA 2SNVA 1PYTC 1UCYH 3FZZA 3V7TA 1EZSC 1AI8H 1C5SA 1PPZA 2GD4B 1SOTA 3DFLA 1GWAA 3F1SB 4A5TS 1LHCH 5AVDA 1UVSH 2GV7A 1ZJDA 1GCTB 1GI4A 1HAIH 3A8AA 1W10U 2WPJS 3T25A 3IWMA 2GKVE 2VVVA 1Q31A 1JMOH 2C8WB 1BCUH 2FOCA 2ULLA 4BANB 2BX3A 7GCHG 3UR9A 1ELVA 1ZLRA 1AMHA 1V2ST 2XC0A 4U32A 2G8TA 5C1UA 1Y3XA 2A4OA 3EE0B 4OS4A 2FLRH 4ABFA 1Z1JA 2V0BA 1EP6A 2G52A 4NG9H 1L1GA 1WQVH 2ZHWH 2ZFRH 2C3SA 2SGPE 4Y76A 1A61H 6CHAC 1HAPH 2K1QA 2FOBA 1SGFA 2OC7A 2ZU5A 1T8MA 1A5GH 2JH0D 3A80A 1JOUB 2GZ9A 2A31A 2VIOA 1FUJA 1BA8B 3RC5A 3M61U 1CA0C 4AFUA 1TMBH 3MH6A 3BTQE 5G4BA 2PGQB 3TK6A 5FPSA 3GCTG 2A4QA 1GBMA 2Z94A 1GBHA 1A0LA 3F6UH 2HALA 4Y7BA 3M37A 4NIYA 4Y8XA 2CXVA 4X1SU 3SNBA 1SC8U 3A8CA 3OX7U 1AZ8A 2G5NA 1J14A 5EG4A 2BQ6B 2PGBB 1L1JA 3SJ9A 8ESTE 1SI5H 2NU3E 4TPIZ 4PROA 3VB7A 1Y3VA 4Q7YA 3MH4A 3SOSA 3RMOH 1ELTA 1O5AB 1UTKA 4YT6H 3C27B 2YNBA 1FMGA 1BT7A 4AB8A 2JH5D 1J9CH 5EGMA 1AY6H 1O2LA 4TY6A 3ZZ4A 1ZPZA 4MLFB 2THFB 4ISHH 3RXHA 1UMAH 2VWMA 3QZRA 2JKHA 1QB6A 3UOUA 3EAJA 1OSSA 4WMEA 2QYIA 2A4GA 1TX7A 4YM9A 2KAIA 1FXYA 1GJ4H 4X1RU 4HFPB 2B8OH 4FUGA 2R9PA 1NRQH 4A7IB 1GBCA 4K3JA 5EW2H 3RMNH 1QNJA 1TE0A 1BTWA 3NKKA 3QZQA 3I77A 4I8KA 1BITA 1DVAH 1MTNB 1DLKB 1ELEE 1PPBH 3Q3XA 4X1PU 3MMGA 1IAUA 4AFSA 1QRXA 3HGNA 3BEUA 1YPHE 2OP9A 2ZNKH 4WMFA 5GDSH 1J15A 1GI2A 1GMCF 4LOYH 2A5IA 2TGAA 1RS0A 2VWLA 3S9BA 1P12E 1IHSH 4WY3A 1G3DA 1Z1IA 3B9FH 4UDWH 1PPFE 3Q3YA 3QUMP 3P8FA 2F3CE 1O39A 3A82A 1XUIA 2ZGXH 2BQ7B 3LJOA 4R0IA 4NFFA 4INLA 3FP6E 3RXBA 2WUBA 1C5OH 1Z6JH 3KCGH 1O33A 5FX5A 2VB0A 2XTTB 4UD9H 1DY9A 3PTNA 1O3IA 2HNTE 4RKJB 1DFPA 1KXDA 1ELGA 1KXAA 2FO9A 7KMEH 4DURA 1D4PB 2BDGA 2XC4A 3RU4E 3RXEA 5EXNA 1BHXB 1ZMLA 3U69H 2ZO3H 3I78A 1IQHA 2ZDKA 1EPTA 3KQDA 2FOMB 3QGJA 3BTHE 1QBNA 2Q6DA 3RXTA 2BQWB 1UK4A 3SZNA 1LCYA 2UWPA 3ZV9A 2TBSA 2EA3A 1C1OA 4K1TA 3DFJA 2HNTF 4X6PA 1GDUA 5FCRA 1FDPA 2XRCA 1GI3A 1AB9B 4ZKOU 5B6OA 1XUKA 1NPMA 3S69A 1GJ8B 1UK3A 1F0RA 3GISB 4UE7H 1L4DA 4WH6A 3GYLB 4F49A 1GI0A 3UWIA 1UTJA 3RXQA 1V2MT 1PQAA 2P93A 3F9EA 1LDTT 4XOJA 5JBAS 4XBBA 2SGFE 4TWYA 4WXIA 1SFQB 1E0FD 2CF9H 1GHZA 3ITIA 1B0EA 4Y71A 4I7YH 1W11U 5HMAA 3RLWH 3RMMH 4KKDA 3SNDA 1BTZA 2PTNA 1QA0A 3P6ZB 5C3NA 1GHBG 4AFQA 1FY1A 1HV7A 2A4RA 2OQUA 4GPGA 4JCNA 1H9LB 1WTHD 3EDXB 1GI7B 2ZHQH 2TGTA 5AFZH 1QRWA 1A3BH 1MU8B 1E36B 2Y81A 5LPFA 1MKXH 2OC0A 2GCTB 1F5KU 3T5FH 3TJVA 3M3SA 2ZA5A 2BDIA 4IC6A 1FY3A 1BMLA 3PMJA 1G32B 3M5LA 3STJA 2H2ZA 4CHAC 2FEQH 1CT0E 1FONA 1N6XA 2QXGA 4CBOA 1BRAA 3K2UA 1GHXH 3K65B 1IQMA 1THSH 2A0QB 2ZDLA 3LJJA 7GCHF 4VGCB 4MNVA 1F7ZA 1LVMA 2QIQA 1TGBA 5FX6A 2BD4A 2ZP0H 5DK1A 5AF9H 4TWWA 1NT1A 3OY6U 3JZ1B 1O3DA 2CMYA 4X1QU 1P3EA 4M7GA 2P8OB 2PTCE 4OGYA 2ZECA 3CENA 4JZ1A 1C4U2 4A1TA 1ESBA 1C2LA 1O2ZA 1AHTH 2FOEA 5ESTE 5HGGA 2AS9A 9LPRA 2ZHEH 4LZ1H 1FY5A 4HTCH 2QXIA 1SGRE 3GCTF 3MNSA 3N7OA 1DSUA 5E2OA 3SGAE 4MQAA 1TALA 4GUXA 1Z8GA 8LPRA 1RFNA 4THNH 1UTOA 1RRKA 2ZTZA 3PWCA 1DWEH 2VVCA 5FPTA 2G4TA 1EJNA 2FYRA 1KXFA 1YPJH 2RA0A 1V2LT 1SGDE 5ETXA 3D23A 1LHDH 1NRPH 1WSSH 5EQSA 2BTCE 2JETC 3MNBA 2A1DB 1YPLH 3OYPA 3GDUA 3HATH 4XBCA 4E05H 5EXLA 1S82A 4ABGA 1EZUC 2Y7ZA 2D26C 5E0JA 2BVRH 5F03A 1Y3WA 4XDEA 4FU9A 4BTIB 4BXWA 4D9QA 3UQVA 1TLDA 3RC4A 3A88A 1EB2A 1GVLA 2AH4X 5F8TA 1NFXA 3PROA 1FN6A 1C2MA 1K1JA 2CV3A 1TQ0B 3FP7E 3U8RH 3UIRA 5DGJA 1QB9A 1OWDA 2HPPH 2WPMS 1YBWA 4NIXA 4K2YA 3PMBB 1Z8IB 2ZPRA 3MO9A 4MNXA 1F0UA 5T3HA 1GVKB 2NU0E 2XXLA 3PO1B 3MU8A 4GVUA 4A1XA 2TRMA 1W0ZU 1H8DH 2OBOA 3M3TA 3UFAA 1NRRH 2PUXB 1XUHA 2FXRA 4CH8B 3ZZ6A 2G5VA 3MO3A 2BXTH
chains in the Genus database with same CATH superfamily
3HKJB 3PRBA 2VWOA 4IN1A 5KECA 3FN8A 3GCOA 2DE8A 3P8OA 1GI6A 1S0QA 1BRCE 3UB0A 3TH2H 2HRVA 4AX9H 1EASA 3UTUH 2VGCB 2PW8H 3ESTA 1P05A 1OWIA 4U01A 2ODYB 3A84A 1SLVB 1YCPH 1DICA 1TNHA 2QF5A 3GY6A 1TAWA 1YLNA 3E16B 5F53A 4F4OC 2BY8X 4OS7A 3OY5U 1P9UA 4TYDA 4RN6A 1C2JA 5A2MH 1BIOA 2J4IA 1QB1A 2QA9E 1DSTA 1HXFH 1GPZA 1GHWH 1C5WB 1SFIA 1TGTA 3GOVB 4YESB 1SQAA 3A86A 1TGSZ 2BOKA 3PLPA 3ATIA 2ZFSA 1ABIH 1AFQB 1E37B 4UFGH 1G30B 2HPQH 4I32A 4IW4E 1O2HA 1H4WA 2YMSB 3ZVFA 3QWCH 2RG3A 1VR1H 1Y3YA 3RP2A 2LNCA 2BYAX 1D9IA 2ZU3A 5DP9A 3EA9A 1AVGH 1WXRA 3AK5A 3UWJH 3NXPA 1H8IH 3U8TH 3SV7A 1C1WH 1QBOA 3BIUH 1QR3E 3RXIA 2GT7A 1P2QA 4ZROA 1NBMD 3RXCA 3DHKH 1PQ8A 1W3CA 3LGWA 4FU7A 5LPRA 2EI7A 5E2PA 4NA8A 1EPTC 3BTEE 1JXPA 3BV9B 2BD3A 4DJZB 2B9LA 4RT1A 4JMYA 4Q80A 3SGBE 2BB4A 3LT3A 2O8UA 3SV6A 1G3BA 1O3NA 2GP9B 4H6SB 1G3CA 3PMHB 4B2AA 3G01A 1G9IE 4ZH8A 3T62A 2W3IA 3GY4A 1P03A 1SOZA 1QBVH 2G51A 1EAUA 3LC5A 3SHCH 3P95A 4WVPE 1GHBF 3O8CA 1H9IE 2C90B 1EATA 1C2IA 2J98B 4AN7A 3UUZA 1K1LA 4FUJA 4ZXYH 1HJ9A 2HLCA 5L2YH 2R0KA 3V3MA 2Z6BD 4K1SA 1P2NA 2PKSC 1LKAA 4U30A 2ZHDA 5LGOA 1AUTC 1LPGB 1C5PA 1CBWC 1W13U 1S84A 2GDEH 4B1TA 1T7CA 3H7OA 5KEDA 4B71A 1XUGA 3MFJA 1BTUA 2TGPZ 1T4UH 5HM2A 3SNAA 1P11E 5C5NA 3R0FA 2J34A 1BMAA 1LVOA 1S6HA 3F9FA 3K9XB 4ZHAA 3MH5A 2AIPA 1CA8B 2Z3CA 6GCHG 4CR5A 1NO9H 3M7QA 4ZMAH 1FPHH 1JRSA 1GCDA 3SI3H 1OWJA 1K1IA 3RLYH 3RXKA 3SN8A 1DX5M 2QCYA 1EXFA 5L30H 1RIWC 1ANDA 1C1PA 3SNEA 1OYQA 4MPVA 2ZI2H 1LQEA 1AQ7A 1NU9A 2AEIH 3GY5A 4O3UA 1W7XH 3RU4T 2SFAA 4DG4A 2FOGA 2F9BH 4AZ2B 2HNTC 1N8OC 1NM6A 2OTVA 8KME2 2PLXA 1G37A 4FUHA 2I6SA 1TBZH 2Y5FA 1GDNA 4NWLA 1UVUH 1OP8A 4Q63A 1JWTA 3GCNA 1B0FA 1EX3A 3STIA 4NZLA 1AE5A 2IPHA 1NS3A 2ZFTA 1IOEA 1K21H 1ZHRA 2HGTH 2W7UA 3BTWE 1LPZB 2ZEBA 4BXSA 4GHTA 5DSFA 4F48B 1V2WT 2A32A 2KFWA 2QE7D 2V35A 1D3TB 1AVWA 3M7UA 3MWIU 1A5IA 1O30A 4RI0A 1F2SE 1GCTC 4B74A 1LTOA 1P2IA 1CT2E 2HVYB 2A7JA 1BZXE 2BD5A 4Y8ZA 1TOCB 3KYGA 1YYY1 1SBWA 4ISOA 4X0WU 1SMFE 1THRH 4ABJA 2HVXA 2VIVA 4K1EA 1ZMJA 4DVAU 3LKWA 1V6DA 3F2FA 3ZIAD 1EKBB 2P59A 5BRRE 2BXUH 1V2QT 1UVTH 1BQYA 4GHQA 2H9EH 5TCAA 1FV9A 1BOQA 1ZHPA 3MU4A 1P02A 1BBRK 1ESTA 1FZZA 3IITA 1ELAA 4ZKSU 3EE7A 4CH2B 4UFDH 2ILNA 2Z3DA 3FFGA 1MCTA 2ZDMA 3BG4B 2VIQA 3ENSB 1F92A 1O32A 1GMDG 2G81E 1AGJA 1GG6B 1XUJA 5GNDA 3A7ZA 2J5UA 4H42U 3LU9B 5JBBS 2BDAA 3SUDA 2NWNA 1HLTH 1AWFH 5C0TA 1DS2E 4ZKRU 1IQKA 4KP0A 1KSNA 1V2UT 3U1IB 5AFYH 2XC5A 1LQDB 1O3GA 1DUEA 1P8VC 1MZAA 5H4IB 2AGGX 5TJXA 4D7GA 2OD3B 2W3KA 4YLQH 1GJ6A 5HIZA 4FVDA 2BMGB 2UWLA 5CDFE 2BY9X 4X2WA 2GMTB 5IK2D 1S5SA 1O2TA 3KHVA 1EOLA 4FUBA 3BTDE 3EA7A 4Z0KA 1K9OE 4DY7B 4AFZA 5C1YA 3TVJB 3FVFB 3VGCB 1TPOA 1Z71A 1C1RA 1F5LA 1O2OA 3NPSA 2WV4A 3GY7A 1C5NH 3ZZ8A 3A8DA 1P06A 3M3VA 1HAXB 2RDEA 3KQEA 1S81A 1C1MA 2BVSH 3A7XA 1T8LA 4ZXXH 1EQ9A 1C5ZB 1WU1A 5DO4H 4CRDA 4ISIH 4NFEA 3SV8A 4AC9A 4YOGA 2QXJA 2RCEA 5K7RA 1UCYK 2H5CA 3TH4H 1WCZA 2Z9LA 1SHHB 3RXVA 3TU7H 2FI5E 2HWLB 1C1TA 1MAYA 2ODPA 2Y6TA 1O3FA 2J2UA 3QK1A 5C67A 2V3MA 2ODQA 4X8VH 4BTTB 4ESTE 1MTNC 1QTFA 5EXMA 2QC2A 4FUDA 2UUYA 5SGAE 3UNRA 1CSOE 1K2I1 5F6MA 1SLXB 2VU8E 4WH8A 1O5BB 2BVXH 3MU5A 1TMTH 2EC9H 5CMXH 1FQ3A 1INCA 1MKWH 3SO3A 1FI8A 1SLUB 1UO6A 3CS7A 2FPZA 2NU4E 1GHYH 3LGVA 1P01A 3HGPA 4YLUA 4AOQA 1QZ8A 2P3TB 1QRZA 3GCHB 3B23B 1SHYA 3SW2B 1PPHE 2OLGA 4OS2A 1JRTA 1O0DH 4D7FA 5LH8A 1SR5C 1HRTH 1A2CH 1UVPA 1MU6B 1MD8A 1VKYA 2A5AA 1CHGA 2ZIQH 4RKOB 2ZU1A 2BZ6H 3T29A 1HUTH 1OWHA 1ANBA 1XKAC 1V2TT 4TPYA 2Z7FE 1ZSJA 4AGJA 3OE7D 1VITG 4ASHA 2ZU4A 1ZGIA 3MOCA 3SGQE 1QIXB 2BZAA 2W26A 5DP5A 1Z7KA 3BTGE 1QJ1B 4SGBE 3RUOA 3BN9A 3V12A 1V2NT 1AB9C 4TY7A 1DUAA 5A8XA 3Q76A 2AIQA 4WJG2 2FS9A 2WPIS 6GCHF 4KGAA 1LHGH 2XNIA 3UNSA 2XCFA 3TPIZ 1BTYA 2PSYA 5EW1H 1CHOG 4K5ZA 3RXLA 1B5GH 1L4ZA 5AHGH 2FLBH 2ZF0H 4X2YA 2J98A 1IQGA 1V2PT 1DE7H 4ABHA 2PV9B 4ZKNU 4DOQA 1MTWA 2TIOA 1P57B 1WQSA 2QV1A 6LPRA 5FBIA 3HKIB 3KNXA 3F68H 3DD2H 2ZQ1A 1TWXB 4BAHB 3ELAH 1TPPA 1NZQH 5C1XA 2OC1A 2H9HA 1QJ7B 1XXDA 2H9TH 4CRBA 4GSOA 1UVOA 2GCTC 1YM0A 1SVPA 2CHAB 2A5KA 1FPCH 1B7XB 3ZZ7A 1ELDE 2J92A 3ZVEA 4OS1A 4INKA 3PMAB 4ABAA 1SGYE 1TABE 1HFDA 1MKWK 4JYTA 3LIWA 5JB9S 2ANWA 1V2JT 1EJMA 4CREA 1DITH 2AMPA 1DXWA 1UK2A 3RXMA 3ZYDA 5EPNA 4VGCC 3ZV8A 1LHFH 1O3OA 1AUJA 2ZTYA 3A8BA 5GXPA 1TGCA 3PLKA 4Y6DA 7ESTE 3NCLA 3DCLA 3WW7A 1QJ6B 3WY8A 3GDSA 3CP7A 3LC3A 2BLOA 2SGAA 4NWKA 1ELBA 2O8TA 3E1XB 1DPOA 2P8OC 3TGIE 3VEQB 1AU8A 1ZOMA 1GMDF 1TBRH 1ZPCA 3K6ZA 5GCHG 5FPYA 1FY8E 2ZGHA 1O31A 2ZDAH 1EFRD 4ZHLU 3W1EA 5CHAB 1OX1A 1C5VA 3SJ8A 2P3UB 4ACBA 4UEHH 4RSPA 3KIDU 2KZ4A 1C2GA 4ABBA 3FANA 1GL0E 1O2PA 3AAVA 1HIAB 1YLCA 2FS8A 3A81A 5DP8A 3PWBA 3RXOA 4GCHG 3ZZAA 3BG8A 3SBKA 5FXLA 1BMMH 1W7GH 1QURH 2Y80A 2FODA 1CVWH 2ZFFH 3VXEH 1O2RA 3BIVH 1HAGE 3FP8E 4AG2A 2GT8A 1O2KA 2FOAA 4MPUA 4WMDA 3PV5A 2F9UA 2ZG0H 1IQIA 1TRMA 1KXEA 2J94A 2AGIX 4O03A 2ZFPH 5GPIB 1GVZA 1TFXA 2W6JD 1ARBA 2FP7B 3ODFA 3OSYA 1GI8B 3MO6A 1LVBA 1JBUH 4DW2U 1O5EH 4A1VA 4INHA 2W7SA 3V13A 2STAE 2V7QD 2FESH 4BTUB 1SGNE 2FWWA 1KLJH 5CE1A 1Y59T 4IGDA 3MNCA 1Y5BT 4JZEH 5EQRA 2ZDVH 9ESTA 3SUFA 2XBVA 4I8HA 1RJXB 3M35A 1TOMH 4I8JA 1GBAA 1GMHG 3GYMA 3TNTA 2R3UA 3BF6H 3PO1C 1T31A 3OEHD 2XWAA 1UTNA 1SQRA 2WV5A 2ZDNA 3KYFA 1E35B 1MKXK 4NIVA 3P8GA 1GBEA 4F55A 2G55A 4K8BA 1GBLA 3KEEA 3O8BA 4NSVA 3E91A 1V2RT 2F9OA 3FOAA 1FY4A 1TNLA 4MPWA 1O5FH 3Q77A 3ZVAA 1GL1A 4MG3A 1TB6H 2RFKC 2GGVB 5E8EH 2XCNA 2VGCC 3ZZCA 1OKXA 4CRCA 1SKYE 1J16A 1MH0A 4BAKB 2Z9KA 3LGUA 1O3CA 1PPGE 3VB6A 2J97A 2FTLE 1BHXF 3ZZ3A 4KELA 3SJIA 3OFND 2XW9A 1O36A 1O3JA 1C5TA 1Y8TA 5FCKA 3H09A 1ESAA 1C1QA 1DANH 3LGIA 1ANCA 1DWCH 2V3OH 3D62A 5EJ1A 3BTKE 5GIBA 1CGHA 1GGDB 1TX6A 1AFQC 1O5CB 4YTAA 4RT0A 1FLEE 2YMSC 4R8TB 1GJBB 4JYUH 2B7DH 1VITF 4MVNA 3QDZB 1HAHH 2ZPSA 4BAQB 1O38A 2QF3A 3KGPA 1F5RA 3N7DA 3FO8D 5B6LA 4U2WA 5C5OA 1QY6A 3W95A 2LP6A 3TIUA 1K1NA 3AVZA 5C94A 1YWUA 3DUXH 4UONA 3A85A 2A7CA 1O2VA 2C4FH 1S85A 1S0RA 2WYGA 1QQ4A 1Y5UT 2GZ7A 2O8WA 5T6FA 4I8GA 3VB4A 1MABB 1GBJA 1CHOF 2EEKA 1CGIE 4GLYA 4DIHH 5IYTA 1D3PB 1HBTH 1W0JD 3LPRA 2XWBI 1VGCB 4FUCA 1P3CA 1P9SA 3Q3KA 1LHEH 5EU8A 1XX9A 4CRGA 2GX4A 3SU1A 2O9QA 3FAOA 2ZPQA 4NA9H 1MBMA 1MBQA 5HXFA 4ABDA 3U1JB 6ESTA 1O5DH 2Z9GA 1C2DA 1WTGH 1GHAG 2IPQX 1IQEA 4WXVA 1YLDA 3PLBA 2CGAA 3K6YA 1K28D 3SV2H 1UHBB 1NN6A 1SGPE 3RXJA 1P2KA 3D65E 4K8YA 2L6OA 2SGQE 1NRSH 3WWFA 1MTSA 4B75A 5A8YA 1N6YA 4DIIH 1G2LA 1MD7A 1C1VH 2F9VA 1C2FA 3M7TA 3RC6A 1MTUA 1GBBA 4CR9A 4Q7XA 1RGQA 1WV7H 3PYHA 1IHTH 4HI3A 3BTME 1O2NA 1CGJE 2Q1JA 1T32A 1SGEE 2R3YA 1BUIA 1ABJH 3T28A 3RU4D 1C5UA 2QF4A 1YCPK 2OQ5A 4D76A 1K1OA 4E7RG 1PJPA 3C1KA 3DT0H 1AVXA 1O37A 3TH3H 5E0HA 1O2GH 1AKSB 1HJAB 2VWNA 4IMQA 4H6TA 1XVMA 3LOXA 1KY9A 2FYQA 2W6ID 1LO6A 1C5XB 2BD8A 3DSOA 1SB1H 2ZCKP 1PYTD 3KQCA 1BRBE 2UUKB 3QX5H 1BB0B 5GCHF 1GI5A 2CF8H 3RXFA 1SLWB 4Z1MD 5T6GA 3E3TA 4FUEA 3SHAH 2FI3E 2Y5GA 1FN8A 2Z3EA 2BY7X 5HM9A 3BEIB 1OXGA 1GBDA 3QN7A 3R3GB 1YC0A 3RXGA 5I25A 4TSFD 4GCHF 1C5LH 3OEED 1XKBC 4ZUHA 1G2MA 4JZIA 1RTLA 2R2MB 4ABIA 2V3HH 5LPEA 2Z9IA 1DWBH 3L33A 4FVBA 1OOKB 1O2WA 1ZTLA 2AGEX 1O35A 4KTSA 3F2GA 2FMJA 3RXPA 2WYJA 4O9VA 1QQUA 3LONA 2BD7A 1QL9A 2R2WU 3V0XA 2G00A 1HAZB 1XM1A 3GY3A 1ETTH 4BOHA 3AASA 2AFQB 3BEFB 3M36A 3E8LA 2WINI 4B2BA 2KCPA 1C5QA 2F9NA 3LDXH 8GCHG 1O2JA 1A4WH 2F83A 3RMLH 2BX4A 1JIMA 1HCGA 1ZSKA 4Y0YE 3DA9B 3F9HA 2AMQA 3TGJE 2ASUB 4ISLA 1O2XA 1IQFA 2BD9A 1KDQB 1ACBE 1S6LA 2LPRA 5EOKA 1HIAA 1S6FA 3A7WA 4BAOB 1CU1A 1HAVB 3BTFE 1L2EA 1LVYA 4AGKA 3MQKC 2QAAA 1GMHF 1EP5A 1ZZZA 3URDA 3ZZDA 2BLVA 2OUAA 3P70B 3BG4C 1TA6A 5L2ZH 1A7SA 2Z9JA 1GG6C 4OGXA 4A92A 1PPEE 1H1BA 1O5GH 5JYIA 1KTTB 1NFWA 3A89A 2FM2A 1EAWA 3ATWA 1UJ1A 5J4QA 1W14U 5T6DA 1K1PA 4AG1A 1AIXH 4X6NA 1LKBA 1ETSH 3ZZBA 3EYDA 2WUCA 3KF2A 1FJSA 1W2KH 1TA2A 2P95A 3MYWA 2ZGJA 3MNXA 1IQJA 1P0SH 1SQOA 2R0LA 1TIOA 1ZR0A 2C93B 4ABEA 1A5HA 2QXHA 1DDJA 2LELA 4B76A 1UTMA 2ZCLP 6CHAB 1NFUA 4Y10E 1BTPA 2GMTC 1BTXA 1QA7A 3RM0H 3EQ0H 2ZGCA 1IQNA 1GJAB 2A2QH 3QLPH 1O3AA 3VGCC 2ESTE 1L1NA 1D6WA 1CA0B 4FUFA 3UOPA 1AN1E 1YP9A 1GBKA 1XXFA 2DE9A 1O3MA 2NU1E 3M5OA 4HGCA 4J1YA 5I46H 2FTMA 4SGAE 3A7TA 4CRFA 2P94A 2VNTA 3VFEA 2BDBA 1D3DB 2J95A 2JH6D 1DOJA 2GDDA 1HYLA 3SZEA 2RA3A 5A0CA 2A2XH 1C5YB 1FX0B 2IJOB 3AAUA 1AO5A 1GJ9B 1J17T 1OWEA 1ANEA 3MHWU 1TNIA 3NK8A 4YOJA 1YPKH 1NFYA 1TNGA 1U6QA 1P09A 2BDHA 3NZIA 5K0HA 1HXEH 2H6MA 5A0BA 1AFEH 1T4VH 3ZZ5A 1NBME 3DSPA 5C20A 4X2VA 1P2OA 1WBGB 3L6PA 4X1NU 4A6LA 1C2EA 1O2QA 2VVUA 4XFQA 2FI4E 1D3QB 2ANYA 2EI8A 1GHAF 3ATLA 5A09A 1MZDA 3GCHC 3MU0A 4MDSA 1QCPA 2WPHS 4YXWD 1HAOH 5EQQA 1T8OA 3SV9A 1ZTKA 1P10A 5F8XA 7LPRA 5EIYA 2QGRA 3SU4A 1DY8A 3BSQA 1PQ7A 2GCHG 1WUNH 5DG6A 3GS9A 1RTKA 4IC5A 2D2DA 1TRNA 2ZQ2A 2BLWA 4CRAA 1TONA 1QFKH 3SJKA 1RTFB 2CK3D 2GTBA 1NC6A 1SSXA 1GBIA 1GJ5H 5JB8S 1O2UA 4B73A 4IS5A 2FX4A 2ANMH 2OBQA 1YF4A 4I8LA 3ZVCA 3M5MA 1EB1H 1Q3XA 1MCVA 4Y7AA 4B6FA 2PUQH 1EOJA 2ANKH 1EZXC 1C9PA 4NZQA 2QF0A 1T8NA 1QL8A 3SI4H 3SORA 2Q6FA 1AD8H 1CO7E 3CNRA 1UHBA 3RDZA 2OK5A 1TBQH 3EGKH 1VZQH 1Q2WA 4HG6A 5EODA 2ZTXA 1SG8B 2BOHB 2PKAB 2V6NA 1WDIA 1HGTH 5FAHA 2YOLA 3ZVGA 1A3EH 2BHGA 5C2ZA 3TITA 3UY9A 5JBTA 3LGYA 3VB5A 1VJ9U 1W0YH 3H5CB 3SUEA 1NESE 2SNWA 2EI6A 2HOBA 2GJGA 4ACAA 2BDCA 3U28C 3P92A 2FZZA 4MNYA 3ZZ9A 3S7HB 3SQEE 3GY8A 2K8IA 4Y8YA 1AKSA 5DP3A 3W94A 1TPAE 2IN2A 5EPYA 2BM2A 1SGTA 1HAYB 1OS8A 2CHAC 4MNWA 1G36A 4Q2KA 1DT2A 2C8ZB 2G4UA 3TJNA 3U98H 3MH7A 2UUFB 2GVFA 4LK4A 1ZHMA 3TK9A 4DCDA 4D9RA 8GCHF 2VJ1A 1ARCA 4YOIA 1O2SA 5GWZA 3TJOA 1MMJN 1ZMNA 3F3BA 1XMNB 3SU2A 1KIGH 5GJ4B 2VIPA 1SPJA 2AHME 3T27A 3GICB 4JK6A 2J38A 1S83A 1W12U 1C5MD 4DT7B 1NTPA 1MUEB 3KN2A 1V2VT 1Z6EA 3E0NB 1PQ5A 1A0HB 1PFXC 2VINA 4JZFH 3ZYEA 5JDUB 4LZ4B 1E1RD 2STBE 3Q00A 5JPMH 1SGQE 4CHAB 2VIWA 3LGTA 1FIWA 4AB9A 2FOHA 1YPMH 1SQTA 4I33A 4X6OA 5CHAC 1IQLA 1O2MA 2BY6X 2XBWA 1O3EA 1NU7B 3T2NA 2RDLA 4B2CA 2D8WA 2PWXA 1L0ZA 3M5NA 5ESBA 1BJUA 1FAXA 3NWUA 4H4FA 5DP7A 2O8MA 2OINA 1KXBA 4K69A 1EAXA 2KCOA 1ZTJA 4KTCA 1C5RA 4Q7ZA 1EAIA 2H1UA 3AW0A 1KTSB 3S9AA 1A0JA 1XVOA 1V3XA 3GY2A 3SJOA 1KDQA 3E6PH 2ZHFH 1TX8A 1H9HE 3A83A 2F9PA 4P00A 4XE4A 1ZRKA 1HAVA 1NY22 2BLQA 2ALVA 1C1SA 4FXGH 4NGAH 1SGFG 1O34A 1O3HA 1ZRBA 2J9NA 1SGIB 4O3TA 5DP6A 2BDYA 2IOTA 3L3TA 1GJCB 4FUIA 2ZC9H 2BD2A 3IG6B 2PHBA 1O3PB 4ASUD 1GJ7B 4K60A 3SU6A 5DPAA 2O8LA 3ODDA 2H5DA 1OYTH 4X2XA 1WYKA 1RXPA 3KL6A 4XBDA 5BPEA 2WHXA 4OM9A 1K22H 2D1JA 4XSKU 5DKMA 4ISNA 4X8TH 4Y79A 1V2OT 3F9GA 3URCA 4Q4LA 3BTTE 2OC8A 2ZZUH 3SU0A 4OS6A 2JETB 4D8NA 1GI1A 3E0PB 3NRLA 2Y5HA 2UWOA 4FU8A 4IMZA 2QY0B 2WPKS 3D49H 4GAWA 3QTOH 4YT7H 3SUGA 2M2AA 1GI9B 1W0KD 1RD3B 1XUFA 1OWKA 2B5TB 1ELCA 3TGKE 4MTBA 2K0QA 3RXRA 3VPKA 1QL7A 1ZYOA 1C1UH 4JYVH 4ZCNA 2M5TA 3PRDA 4X8SH 1TRYA 2Y82A 1Z8RA 2EQNA 3SQHE 2XBXA 3TK5A 1C4Y2 4LXBH 2ZWLH 1O3KA 3FKSD 1ZSLA 3F2HA 3T26A 2TPIZ 3ZVBA 1MTVA 3WWBA 3JZ2B 1DWDH 1ZJKA 4Z6AH 3AW1A 1HB0B 5PTPA 3FZDA 1E1QD 1MAXA 1O2IA 3P17H 1C2HA 4JK5A 1C9TA 2OXSA 5TCCA 1GHVH 2GCHF 1HNEE 1HPGA 2XYAA 1DLEA 2Q6GA 5HYOA 1MQ6A 2I6QA 4IN2A 4WF8A 1VCQA 1EJAA 3HPTB 3KQBA 5ABWA 2ZFQH 4E7NA 4X8UH 1GGDC 1A1RA 1Y3UA 5J4SA 1ELFA 5FBEA 1BBRE 3N99A 1DM4B 4KTUA 1THPB 1P04A 2AYWA 4ZHMU 2KAIB 4NSYA 1YCPM 2VH6A 3B8JA 3U8OH 1PPCE 1WOFA 4JZDH 1O2YA 2FX6A 3OU0A 5A8ZA 4AYVB 2JDID 1JIRA 4AYYB 5EJZA 1NRNH 4Y0ZE 1OHHD 5E0GA 4E06H 1BTHH 2C8XB 2CJIA 1WAYB 3MTYA 2A7HA 2ZGBH 3PTBA 1FIZA 2DUCA 2F43B 2Y7XA 1SGCA 1ID5H 4AORA 4BNRA 3VB3A 2OCVB 1YGCH 1GBTA 1W8BH 1TPSA 3CS0A 1P2MA 1ETRH 3LH1A 1VGCC 1YPEH 1BDAA 1GJDB 1H8HD 4OS5A 3A7VA 1C4V2 5DN6D 1KLIH 2ZKSA 1YKTA 1J8AA 3UPEA 2C8YB 3PB1E 5L6NH 3TNSA 1BMNH 3MI4A 4WWYA 2PFEA 1D6RA 1SL3A 1Y5AT 2GV6A 3GDVA 3RXDA 2B0FA 2AERH 3MU1A 1M9UA 1YPGH 2FIRH 3VXFH 1KLTA 4UFEH 3UQOA 4IBLH 1OP0A 2ALPA 3ZVDA 1EPTB 2A45B 1BRUP 1CQQA 3E90B 2ZCHP 1VCPA 4NCYA 1OP2A 3EA8A 2QN5T 4NIWA 5A0AE 1AZZA 3QTVH 3SU5A 3NUMA 3S0NA 3RM2H 1GMCG 1TNKA 2AMDA 3TJUA 1VITH 1X7AC 2TGDA 5EJLA 1C1NA 1LPKB 1UCYE 1ZGVA 2XOKD 1HDTH 1UTLM 3RXUA 4QT8C 5IDKA 3OTJE 2WPLS 3LH3A 1E38B 1NROH 3A87A 1F0SA 2PKAA 5KGOA 1VJAU 3S9CA 1GBFA 1BBRH 3ATMA 2NU2E 1C2KA 1HJAC 3A7YA 5JBCS 1KXCA 1ZPBA 1V2KT 2FDAA 2SGDE 4HZHA 4I31A 4YZUA 3UR6A 3SNCA 4X6MA 1GDQA 3H7TA 1QGFA 2F91A 2KCAA 2XBYA 1ORFA 2PSXA 2PR3A 4DGJA 3PM3A 2PKSB 2WPDD 5F8ZA 3HK6B 2IJD1 4NA7A 1HJ8A 2JJ2D 2FOFA 2ZU2A 1CE5A 1CBWB 5DP4A 1YPHC 1TMUH 2YNAA 2VH0A 4DT4A 1AWHB 1FNIA 1LMWB 2P3FH 1FAKH 4YO9A 3I29A 1MQ5A 1DXPA 2CN0H 1TNJA 2PP6A 1COWD 1O3BA 1A46H 2VIDA 3RXAA 3UREA 4O97A 4J2YB 3VG8A 3O8RA 3HK3B 1F0TA 2EY4C 1N1LA 3PV4A 1UTPA 3SU3A 1BJVA 4MPXA 2W5EA 1RIWB 1EZQA 1H8ED 1G3EA 3QGNB 1CT4E 2GZ8A 1UTQA 1Z8JB 1K1MA 1E34B 1EUFA 1OPHB 1TGNA 1TYNA 2BY5X 5FHTA 5DJ7A 3U9AH 2UUJB 1P2JA 1YY3A 1N8OB 1O3LA 3F0PA 1AE8H 4CBNA 3QO6A 3O8DA 3ATKA 3UNQA 1VCWA 4BAMB 2P16A 4UFFH 2KR7A 2SGEE 4ZAEA 3RXSA 3S7KB 1QHRB 4Y11E 3P8NA 1TQ7B 2KX4A 1KYNA 3TLOA 2SNVA 1PYTC 1UCYH 3FZZA 3V7TA 3DSGA 1EZSC 1AI8H 5FL7D 1C5SA 1PPZA 2GD4B 1SOTA 3DFLA 1GWAA 3F1SB 4A5TS 1LHCH 1K0HA 4TT3D 4P02A 5AVDA 1UVSH 2GV7A 1ZJDA 1GCTB 1GI4A 1HAIH 3A8AA 1W10U 2WPJS 3T25A 3IWMA 2GKVE 2VVVA 1Q31A 1JMOH 2C8WB 3OAAD 1BCUH 2FOCA 3UAIC 2ULLA 4BANB 2BX3A 4M9FA 7GCHG 3UR9A 1ELVA 1ZLRA 1AMHA 1V2ST 2XC0A 4U32A 2G8TA 5C1UA 1Y3XA 2A4OA 3EE0B 4OS4A 2FLRH 4ABFA 1Z1JA 2V0BA 1EP6A 2G52A 2JJ1D 4NG9H 1L1GA 1WQVH 2ZHWH 2ZFRH 2C3SA 2SGPE 2XNDD 4Y76A 2KCYA 1A61H 6CHAC 1HAPH 2HLDD 2FOBA 2K1QA 1SGFA 2OC7A 2ZU5A 1T8MA 1A5GH 2JH0D 3A80A 1JOUB 2GZ9A 2A31A 2VIOA 1FUJA 1BA8B 3RC5A 3M61U 1CA0C 4AFUA 1TMBH 3MH6A 3BTQE 5G4BA 2PGQB 3TK6A 5FPSA 3GCTG 2A4QA 1GBMA 2Z94A 1GBHA 1A0LA 3F6UH 4B6EA 2HALA 3PV2A 4Y7BA 3M37A 4NIYA 4Y8XA 4FETA 2CXVA 2L74A 4X1SU 3SNBA 1SC8U 3A8CA 3OX7U 1AZ8A 2G5NA 1J14A 5EG4A 2BQ6B 4XD7D 2PGBB 1L1JA 3SJ9A 8ESTE 1SI5H 2NU3E 4TPIZ 4PROA 3VB7A 1Y3VA 4Q7YA 3MH4A 3SOSA 3RMOH 1ELTA 1O5AB 1UTKA 4YT6H 3C27B 2VBCA 2YNBA 1FMGA 1BT7A 4AB8A 2JH5D 1J9CH 5EGMA 1AY6H 1O2LA 4TY6A 3ZZ4A 1ZPZA 4MLFB 2THFB 4ISHH 3RXHA 1UMAH 2VWMA 3QZRA 2JKHA 1QB6A 3UOUA 3EAJA 1OSSA 4WMEA 2QYIA 2A4GA 1TX7A 4YM9A 2KAIA 1FXYA 1GJ4H 4X1RU 4HFPB 2B8OH 4FUGA 2R9PA 1NRQH 4A7IB 1GBCA 4K3JA 5EW2H 3RMNH 1QNJA 1TE0A 1BTWA 3NKKA 3QZQA 3I77A 4I8KA 1BITA 1DVAH 1MTNB 1DLKB 1ELEE 1PPBH 3Q3XA 4X1PU 3MMGA 1IAUA 4AFSA 1QRXA 5HIYA 3HGNA 3BEUA 1YPHE 2OP9A 2ZNKH 4WMFA 5GDSH 3F0OA 1J15A 1GI2A 1GMCF 4LOYH 2A5IA 2TGAA 1RS0A 2VWLA 3S9BA 2JIZD 1P12E 1IHSH 4WY3A 1G3DA 1Z1IA 3B9FH 4UDWH 1PPFE 3Q3YA 3QUMP 5CHBA 3P8FA 2F3CE 1O39A 3A82A 1XUIA 2ZGXH 2BQ7B 3LJOA 4R0IA 4NFFA 4INLA 1BMFD 5C17A 3FP6E 3RXBA 2WUBA 1C5OH 1Z6JH 3KCGH 1O33A 5FX5A 2VB0A 2XTTB 4UD9H 1DY9A 3PTNA 1O3IA 2HNTE 4RKJB 1DFPA 1KXDA 3KQ5A 1ELGA 1KXAA 2FO9A 7KMEH 4DURA 1D4PB 2BDGA 2XC4A 1UW7A 3RU4E 3RXEA 5EXNA 1BHXB 1ZMLA 3U69H 2ZO3H 4I86A 3I78A 1IQHA 2ZDKA 1EPTA 3KQDA 2FOMB 3QGJA 3BTHE 1QBNA 2Q6DA 3RXTA 2BQWB 2KM0A 1UK4A 3SZNA 1LCYA 3OTPA 2UWPA 4XRNA 3ZV9A 2TBSA 2EA3A 1C1OA 4K1TA 3DFJA 2HNTF 4X6PA 1GDUA 5FCRA 1FDPA 2XRCA 1GI3A 1AB9B 4ZKOU 5B6OA 1XUKA 1NPMA 3S69A 1GJ8B 1UK3A 1F0RA 3GISB 4UE7H 1L4DA 4WH6A 3GYLB 4F49A 1GI0A 3UWIA 1UTJA 3RXQA 1V2MT 1PQAA 3SYJA 2P93A 3F9EA 1LDTT 4XOJA 5JBAS 4XBBA 2SGFE 4TWYA 4WXIA 1SFQB 1E0FD 2CF9H 1GHZA 3ITIA 1B0EA 4Y71A 4I7YH 1W11U 5HMAA 3RLWH 3RMMH 4KKDA 3SNDA 1BTZA 2PTNA 1QA0A 3P6ZB 5C3NA 1GHBG 4AFQA 1FY1A 1HV7A 2A4RA 2OQUA 4GPGA 4JCNA 1H9LB 1WTHD 3EDXB 1GI7B 2ZHQH 2TGTA 5AFZH 1QRWA 5HKKD 1A3BH 1MU8B 1E36B 2Y81A 5LPFA 1MKXH 2OC0A 2GCTB 1F5KU 3T5FH 3TJVA 3M3SA 2ZA5A 2BDIA 4IC6A 1FY3A 1BMLA 3PMJA 1G32B 3M5LA 3STJA 2H2ZA 4CHAC 2FEQH 1CT0E 1FONA 1N6XA 2QXGA 4CBOA 1BRAA 3K2UA 1GHXH 3K65B 1IQMA 1THSH 2A0QB 2ZDLA 3LJJA 7GCHF 4VGCB 4MNVA 1F7ZA 1LVMA 2QIQA 1TGBA 5FX6A 2BD4A 2ZP0H 5DK1A 5AF9H 5C0UA 4TWWA 4FOUC 1NT1A 3OY6U 3JZ1B 1O3DA 2CMYA 4X1QU 1P3EA 4M7GA 2P8OB 2PTCE 4OGYA 2WZQA 2ZECA 3CENA 4JZ1A 1C4U2 4A1TA 1ESBA 1C2LA 1O2ZA 2FOEA 1AHTH 5ESTE 5HGGA 2AS9A 1KMHB 2WV9A 2ZHEH 9LPRA 5T1VA 4LZ1H 1FY5A 4HTCH 2QXIA 2WSSD 1SGRE 3GCTF 3MNSA 3N7OA 1DSUA 5E2OA 3SGAE 4MQAA 1TALA 4GUXA 1Z8GA 8LPRA 1RFNA 2F4LA 4THNH 1UTOA 1RRKA 2ZTZA 3PWCA 1DWEH 2VVCA 5FPTA 2G4TA 1EJNA 2FYRA 1KXFA 1YPJH 2RA0A 1V2LT 1SGDE 5ETXA 3D23A 1LHDH 1NRPH 1WSSH 5EQSA 2BTCE 2JETC 3MNBA 2A1DB 1YPLH 3OYPA 3GDUA 3HATH 4XBCA 4E05H 5EXLA 1S82A 4ABGA 1EZUC 2Y7ZA 2D26C 5E0JA 2BVRH 5F03A 1Y3WA 4XDEA 4FU9A 4BTIB 4BXWA 4D9QA 3UQVA 1TLDA 3RC4A 3A88A 1EB2A 1GVLA 2AH4X 5F8TA 1NFXA 3PROA 1FN6A 1C2MA 1K1JA 2CV3A 1TQ0B 3FP7E 3U8RH 3UIRA 2YMSD 5DGJA 1QB9A 1OWDA 2HPPH 2WPMS 1YBWA 4NIXA 4K2YA 3PMBB 1E79D 1Z8IB 2ZPRA 3MO9A 4MNXA 1F0UA 5T3HA 1GVKB 2NU0E 2XXLA 3PO1B 3MU8A 4GVUA 4A1XA 2TRMA 1W0ZU 1H8DH 2OBOA 3M3TA 3UFAA 1NRRH 2PUXB 3N7EA 1XUHA 2FXRA 4CH8B 3ZZ6A 2G5VA 3MO3A 2BXTH
chains in the Genus database with same CATH topology
3HKJB 2VWOA 4IN1A 3GCOA 2DE8A 3P8OA 1GI6A 1S0QA 1BRCE 3TH2H 2HRVA 4AX9H 1EASA 3UTUH 2VGCB 2PW8H 3ESTA 1P05A 1OWIA 4U01A 2ODYB 3A84A 1SLVB 1YCPH 1DICA 1TNHA 3GY6A 1TAWA 3E16B 4F4OC 2BY8X 4OS7A 3OY5U 1P9UA 4TYDA 4RN6A 1C2JA 5A2MH 1BIOA 2J4IA 1QB1A 2QA9E 1DSTA 1HXFH 1GPZA 1GHWH 1C5WB 1SFIA 1TGTA 3GOVB 4YESB 1SQAA 3A86A 1TGSZ 2BOKA 3PLPA 3ATIA 2ZFSA 1ABIH 1AFQB 1E37B 4UFGH 1G30B 2HPQH 4I32A 4IW4E 1O2HA 1H4WA 3ZVFA 3QWCH 2RG3A 1VR1H 1Y3YA 3RP2A 2LNCA 2BYAX 1D9IA 2ZU3A 5DP9A 3EA9A 1AVGH 3UWJH 3NXPA 1H8IH 3U8TH 3SV7A 1C1WH 1QBOA 3BIUH 1QR3E 3RXIA 2GT7A 1P2QA 4ZROA 3RXCA 3DHKH 1PQ8A 1W3CA 3LGWA 4FU7A 5LPRA 2EI7A 5E2PA 4NA8A 1EPTC 3BTEE 1JXPA 3BV9B 2BD3A 4DJZB 2B9LA 4JMYA 4Q80A 3SGBE 2BB4A 3LT3A 2O8UA 3SV6A 1G3BA 1O3NA 2GP9B 4H6SB 1G3CA 3PMHB 4B2AA 3G01A 1G9IE 4ZH8A 3T62A 2W3IA 3GY4A 1P03A 1SOZA 1QBVH 2G51A 1EAUA 3LC5A 3SHCH 3P95A 4WVPE 1GHBF 3O8CA 1H9IE 2C90B 1EATA 1C2IA 4AN7A 3UUZA 1K1LA 4FUJA 4ZXYH 1HJ9A 2HLCA 5L2YH 2R0KA 3V3MA 2Z6BD 4K1SA 1P2NA 2PKSC 1LKAA 4U30A 2ZHDA 5LGOA 1AUTC 1LPGB 1C5PA 1CBWC 1W13U 1S84A 2GDEH 4B1TA 1T7CA 3H7OA 4B71A 1XUGA 3MFJA 1BTUA 2TGPZ 1T4UH 5HM2A 3SNAA 1P11E 5C5NA 3R0FA 2J34A 1BMAA 1LVOA 1S6HA 3F9FA 3K9XB 4ZHAA 3MH5A 2AIPA 1CA8B 2Z3CA 6GCHG 4CR5A 1NO9H 3M7QA 4ZMAH 1FPHH 1JRSA 1GCDA 3SI3H 1OWJA 1K1IA 3RLYH 3RXKA 3SN8A 1DX5M 2QCYA 1EXFA 5L30H 1RIWC 1ANDA 1C1PA 3SNEA 1OYQA 4MPVA 2ZI2H 1LQEA 1AQ7A 1NU9A 2AEIH 3GY5A 4O3UA 1W7XH 3RU4T 2SFAA 4DG4A 2FOGA 2F9BH 4AZ2B 2HNTC 1N8OC 1NM6A 2OTVA 8KME2 2PLXA 1G37A 4FUHA 2I6SA 1TBZH 2Y5FA 1GDNA 4NWLA 1UVUH 1OP8A 1JWTA 3GCNA 1B0FA 1EX3A 3STIA 4NZLA 1AE5A 2IPHA 1NS3A 2ZFTA 1IOEA 1K21H 1ZHRA 2HGTH 2W7UA 3BTWE 1LPZB 2ZEBA 4BXSA 4GHTA 1V2WT 2A32A 2V35A 1D3TB 1AVWA 3M7UA 3MWIU 1A5IA 1O30A 1F2SE 1GCTC 4B74A 1LTOA 1P2IA 1CT2E 2A7JA 1BZXE 2BD5A 4Y8ZA 1TOCB 1YYY1 1SBWA 4ISOA 4X0WU 1SMFE 1THRH 4ABJA 2HVXA 2VIVA 4K1EA 1ZMJA 4DVAU 3LKWA 1V6DA 1EKBB 2P59A 5BRRE 2BXUH 1V2QT 1UVTH 1BQYA 4GHQA 2H9EH 5TCAA 1FV9A 1BOQA 1ZHPA 3MU4A 1P02A 1BBRK 1ESTA 1FZZA 3IITA 1ELAA 4ZKSU 4CH2B 4UFDH 2ILNA 2Z3DA 3FFGA 1MCTA 2ZDMA 3BG4B 2VIQA 3ENSB 1F92A 1O32A 1GMDG 2G81E 1AGJA 1GG6B 1XUJA 3A7ZA 4H42U 3LU9B 5JBBS 2BDAA 3SUDA 2NWNA 1HLTH 1AWFH 1DS2E 4ZKRU 1IQKA 4KP0A 1KSNA 1V2UT 3U1IB 5AFYH 2XC5A 1LQDB 1O3GA 1DUEA 1P8VC 1MZAA 5H4IB 2AGGX 5TJXA 4D7GA 2OD3B 2W3KA 4YLQH 1GJ6A 4FVDA 2BMGB 2UWLA 2BY9X 4X2WA 2GMTB 1S5SA 1O2TA 3KHVA 1EOLA 4FUBA 3BTDE 3EA7A 4Z0KA 1K9OE 4DY7B 4AFZA 5C1YA 3TVJB 3FVFB 3VGCB 1TPOA 1Z71A 1C1RA 1F5LA 1O2OA 3NPSA 2WV4A 3GY7A 1C5NH 3ZZ8A 3A8DA 1P06A 3M3VA 1HAXB 3KQEA 1S81A 1C1MA 2BVSH 3A7XA 1T8LA 4ZXXH 1EQ9A 1C5ZB 1WU1A 5DO4H 4CRDA 4ISIH 4NFEA 3SV8A 4YOGA 2QXJA 2RCEA 5K7RA 1UCYK 2H5CA 3TH4H 1WCZA 2Z9LA 1SHHB 3RXVA 3TU7H 2FI5E 2HWLB 1C1TA 1MAYA 2ODPA 2Y6TA 1O3FA 2J2UA 3QK1A 5C67A 2ODQA 4X8VH 4BTTB 4ESTE 1MTNC 1QTFA 5EXMA 2QC2A 4FUDA 2UUYA 5SGAE 3UNRA 1CSOE 1K2I1 5F6MA 1SLXB 2VU8E 4WH8A 1O5BB 2BVXH 3MU5A 1TMTH 2EC9H 5CMXH 1FQ3A 1INCA 1MKWH 3SO3A 1FI8A 1SLUB 1UO6A 3CS7A 2FPZA 2NU4E 1GHYH 3LGVA 1P01A 3HGPA 4YLUA 4AOQA 2P3TB 1QRZA 3GCHB 3B23B 1SHYA 3SW2B 1PPHE 2OLGA 4OS2A 1JRTA 1O0DH 4D7FA 5LH8A 1SR5C 1HRTH 1A2CH 1UVPA 1MU6B 1MD8A 2A5AA 1CHGA 2ZIQH 4RKOB 2ZU1A 2BZ6H 3T29A 1HUTH 1OWHA 1ANBA 1XKAC 1V2TT 4TPYA 2Z7FE 1ZSJA 4AGJA 1VITG 4ASHA 2ZU4A 1ZGIA 3MOCA 3SGQE 1QIXB 2BZAA 2W26A 5DP5A 1Z7KA 3BTGE 1QJ1B 4SGBE 3RUOA 3BN9A 3V12A 1V2NT 1AB9C 4TY7A 1DUAA 5A8XA 3Q76A 2AIQA 4WJG2 2FS9A 2WPIS 6GCHF 4KGAA 1LHGH 2XNIA 3UNSA 2XCFA 3TPIZ 1BTYA 2PSYA 5EW1H 1CHOG 4K5ZA 3RXLA 1B5GH 1L4ZA 5AHGH 2FLBH 2ZF0H 4X2YA 1IQGA 1V2PT 1DE7H 4ABHA 2PV9B 4ZKNU 4DOQA 1MTWA 2TIOA 1P57B 1WQSA 2QV1A 6LPRA 5FBIA 3HKIB 3KNXA 3F68H 3DD2H 2ZQ1A 1TWXB 4BAHB 3ELAH 1TPPA 1NZQH 5C1XA 2OC1A 2H9HA 1QJ7B 1XXDA 2H9TH 4CRBA 4GSOA 1UVOA 2GCTC 1YM0A 1SVPA 2A5KA 2CHAB 1FPCH 1B7XB 3ZZ7A 1ELDE 2J92A 3ZVEA 4OS1A 4INKA 3PMAB 4ABAA 1SGYE 1TABE 1HFDA 1MKWK 4JYTA 3LIWA 5JB9S 2ANWA 1V2JT 1EJMA 4CREA 1DITH 2AMPA 1DXWA 1UK2A 3RXMA 3ZYDA 5EPNA 4VGCC 3ZV8A 1LHFH 1O3OA 1AUJA 2ZTYA 3A8BA 5GXPA 1TGCA 3PLKA 4Y6DA 7ESTE 3NCLA 1QJ6B 3WY8A 3GDSA 3CP7A 3LC3A 2BLOA 2SGAA 4NWKA 1ELBA 2O8TA 3E1XB 1DPOA 2P8OC 3TGIE 3VEQB 1AU8A 1ZOMA 1GMDF 1TBRH 1ZPCA 3K6ZA 5GCHG 5FPYA 1FY8E 2ZGHA 1O31A 2ZDAH 4ZHLU 5CHAB 1OX1A 1C5VA 3SJ8A 2P3UB 4UEHH 4RSPA 3KIDU 1C2GA 4ABBA 3FANA 1GL0E 1O2PA 3AAVA 1HIAB 1YLCA 2FS8A 3A81A 5DP8A 3PWBA 3RXOA 4GCHG 3ZZAA 3BG8A 3SBKA 5FXLA 1BMMH 1W7GH 1QURH 2Y80A 2FODA 1CVWH 2ZFFH 3VXEH 1O2RA 3BIVH 1HAGE 3FP8E 4AG2A 2GT8A 1O2KA 2FOAA 4MPUA 4WMDA 2F9UA 2ZG0H 1IQIA 1TRMA 1KXEA 2J94A 2AGIX 4O03A 2ZFPH 5GPIB 1GVZA 1TFXA 1ARBA 2FP7B 3ODFA 3OSYA 1GI8B 3MO6A 1LVBA 1JBUH 4DW2U 1O5EH 4A1VA 4INHA 2W7SA 3V13A 2STAE 2FESH 4BTUB 1SGNE 2FWWA 1KLJH 5CE1A 1Y59T 4IGDA 3MNCA 1Y5BT 4JZEH 5EQRA 2ZDVH 9ESTA 3SUFA 2XBVA 4I8HA 1RJXB 3M35A 1TOMH 4I8JA 1GBAA 1GMHG 3GYMA 3TNTA 2R3UA 3BF6H 3PO1C 1T31A 2XWAA 1UTNA 2WV5A 2ZDNA 1E35B 1MKXK 4NIVA 3P8GA 1GBEA 2G55A 4K8BA 1GBLA 3KEEA 3O8BA 4NSVA 3E91A 1V2RT 2F9OA 1FY4A 1TNLA 4MPWA 1O5FH 3Q77A 3ZVAA 1GL1A 4MG3A 1TB6H 2GGVB 5E8EH 2XCNA 2VGCC 3ZZCA 1OKXA 4CRCA 1J16A 1MH0A 4BAKB 2Z9KA 3LGUA 1O3CA 1PPGE 3VB6A 2FTLE 1BHXF 3ZZ3A 4KELA 3SJIA 2XW9A 1O36A 1O3JA 1C5TA 1Y8TA 5FCKA 1ESAA 1C1QA 1DANH 3LGIA 1ANCA 1DWCH 2V3OH 3D62A 3BTKE 5GIBA 1CGHA 1GGDB 1TX6A 1AFQC 1O5CB 4YTAA 1FLEE 4R8TB 1GJBB 4JYUH 2B7DH 1VITF 4MVNA 3QDZB 1HAHH 2ZPSA 4BAQB 1O38A 2QF3A 3KGPA 1F5RA 4U2WA 5C5OA 1QY6A 3W95A 3TIUA 1K1NA 3AVZA 3DUXH 4UONA 3A85A 2A7CA 1O2VA 2C4FH 1S85A 1S0RA 2WYGA 1QQ4A 1Y5UT 2GZ7A 2O8WA 5T6FA 4I8GA 3VB4A 1GBJA 1CHOF 2EEKA 1CGIE 4GLYA 4DIHH 5IYTA 1D3PB 1HBTH 3LPRA 2XWBI 1VGCB 4FUCA 1P3CA 1P9SA 3Q3KA 1LHEH 5EU8A 1XX9A 4CRGA 2GX4A 3SU1A 2O9QA 3FAOA 2ZPQA 4NA9H 1MBMA 1MBQA 5HXFA 4ABDA 3U1JB 6ESTA 1O5DH 2Z9GA 1C2DA 1WTGH 1GHAG 1IQEA 4WXVA 1YLDA 3PLBA 2CGAA 3K6YA 1K28D 3SV2H 1UHBB 1NN6A 1SGPE 3RXJA 1P2KA 3D65E 4K8YA 2SGQE 1NRSH 1MTSA 4B75A 5A8YA 1N6YA 4DIIH 1G2LA 1MD7A 1C1VH 2F9VA 1C2FA 3M7TA 3RC6A 1MTUA 1GBBA 4CR9A 4Q7XA 1RGQA 1WV7H 3PYHA 1IHTH 4HI3A 3BTME 1O2NA 1CGJE 2Q1JA 1T32A 1SGEE 2R3YA 1BUIA 1ABJH 3T28A 3RU4D 1C5UA 1YCPK 2OQ5A 4D76A 1K1OA 4E7RG 1PJPA 3C1KA 3DT0H 1AVXA 1O37A 3TH3H 5E0HA 1O2GH 1AKSB 1HJAB 2VWNA 4IMQA 4H6TA 1XVMA 3LOXA 1KY9A 2FYQA 1LO6A 1C5XB 2BD8A 1SB1H 2ZCKP 1PYTD 3KQCA 1BRBE 2UUKB 3QX5H 1BB0B 5GCHF 1GI5A 2CF8H 3RXFA 1SLWB 5T6GA 3E3TA 4FUEA 3SHAH 2FI3E 2Y5GA 1FN8A 2Z3EA 2BY7X 5HM9A 3BEIB 1OXGA 1GBDA 3QN7A 3R3GB 1YC0A 3RXGA 5I25A 4GCHF 1C5LH 1XKBC 4ZUHA 1G2MA 4JZIA 1RTLA 2R2MB 4ABIA 2V3HH 5LPEA 2Z9IA 1DWBH 3L33A 4FVBA 1OOKB 1O2WA 1ZTLA 2AGEX 1O35A 4KTSA 2FMJA 3RXPA 2WYJA 4O9VA 1QQUA 3LONA 2BD7A 1QL9A 2R2WU 3V0XA 2G00A 1HAZB 1XM1A 3GY3A 1ETTH 4BOHA 3AASA 2AFQB 3BEFB 3M36A 3E8LA 2WINI 4B2BA 1C5QA 2F9NA 3LDXH 8GCHG 1O2JA 1A4WH 2F83A 3RMLH 2BX4A 1JIMA 1HCGA 1ZSKA 4Y0YE 3DA9B 3F9HA 2AMQA 3TGJE 2ASUB 4ISLA 1O2XA 1IQFA 2BD9A 1KDQB 1ACBE 2LPRA 5EOKA 1HIAA 1S6FA 3A7WA 4BAOB 1CU1A 1HAVB 3BTFE 1L2EA 1LVYA 4AGKA 2QAAA 1GMHF 1EP5A 1ZZZA 3URDA 3ZZDA 2BLVA 2OUAA 3P70B 3BG4C 1TA6A 5L2ZH 1A7SA 2Z9JA 1GG6C 4OGXA 4A92A 1PPEE 1H1BA 1O5GH 5JYIA 1KTTB 1NFWA 3A89A 2FM2A 1EAWA 3ATWA 1UJ1A 5J4QA 1W14U 5T6DA 1K1PA 4AG1A 1AIXH 4X6NA 1LKBA 1ETSH 3ZZBA 3EYDA 2WUCA 3KF2A 1FJSA 1W2KH 1TA2A 2P95A 3MYWA 2ZGJA 3MNXA 1IQJA 1P0SH 1SQOA 2R0LA 1TIOA 1ZR0A 2C93B 4ABEA 1A5HA 2QXHA 1DDJA 4B76A 1UTMA 2ZCLP 6CHAB 1NFUA 4Y10E 1BTPA 2GMTC 1BTXA 1QA7A 3RM0H 3EQ0H 2ZGCA 1IQNA 1GJAB 2A2QH 3QLPH 1O3AA 3VGCC 2ESTE 1L1NA 1D6WA 1CA0B 4FUFA 3UOPA 1AN1E 1YP9A 1GBKA 1XXFA 2DE9A 1O3MA 2NU1E 3M5OA 4HGCA 4J1YA 5I46H 2FTMA 4SGAE 3A7TA 4CRFA 2P94A 2VNTA 3VFEA 2BDBA 1D3DB 2J95A 2JH6D 1DOJA 2GDDA 1HYLA 2RA3A 5A0CA 2A2XH 1C5YB 2IJOB 3AAUA 1AO5A 1GJ9B 1J17T 1OWEA 1ANEA 3MHWU 1TNIA 3NK8A 4YOJA 1YPKH 1NFYA 1TNGA 1U6QA 1P09A 2BDHA 3NZIA 5K0HA 1HXEH 2H6MA 5A0BA 1AFEH 1T4VH 3ZZ5A 5C20A 4X2VA 1P2OA 1WBGB 3L6PA 4X1NU 4A6LA 1C2EA 1O2QA 2VVUA 4XFQA