1PQ7A

Trypsin at 0.8 a, ph5 / borax
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
224
structure length
224
Chain Sequence
IVGGTSASAGDFPFIVSISRNGGPWCGGSLLNANTVLTAAHCVSGYAQSGFQIRAGSLSRTSGGITSSLSSVRVHPSYSGNNNDLAILKLSTSIPSGGNIGYARLAASGSDPVAGSSATVAGWGATSEGGSSTPVNLLKVTVPIVSRATCRAQYGTSAITNQMFCAGVSSGGKDSCQGDSGGPIVDSSNTLIGAVSWGNGCARPNYSGVYASVGALRSFIDTYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Trypsin Revisited: CRYSTALLOGRAPHY AT (SUB) ATOMIC RESOLUTION AND QUANTUM CHEMISTRY REVEALING DETAILS OF CATALYSIS.
pubmed doi rcsb
molecule tags Hydrolase
total genus 55
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pq7A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1pq7A01
2OBOA 1GL1A 4DVAU 1E0FD 3DFLA 2HNTC 1OWKA 1HPGA 4NIVA 1YPHE 4JK5A 2YOLA 2QXGA 3FZZA 3KQEA 2B0FA 5LPFA 1GJDB 1BJVA 2NWNA 1AQ7A 1E36B 1GBEA 2QIQA 4WMEA 1HDTH 2XBXA 1YBWA 4K2YA 3ZZCA 2FI5E 4GAWA 2BZ6H 2THFB 4Y7BA 1ZR0A 3MH4A 4AFUA 1C5MD 2CMYA 4K1TA 4JYTA 1PQ7A 3HKIB 1SGNE 5J4SA 1BBRH 4ZHMU 1OXGA 1RGQA 1C2GA 2ZCLP 3SO3A 1WSSH 3BTHE 2C8XB 3RXRA 3U9AH 5L2ZH 3OYPA 4AFSA 2H9TH 3RU4D 1BUIA 1XXDA 1YM0A 1MQ5A 2EI6A 1O34A 2ZDAH 4SGAE 2ZGJA 2Y5FA 5GJ4B 1O2QA 1SGDE 3A86A 3MNBA 2Z9LA 1P05A 3A8AA 2FX4A 1PJPA 1C9TA 5EPYA 3PMJA 3EGKH 2BD2A 1D3DB 2BDYA 1ID5H 2BD8A 1AB9B 4OS4A 3MNCA 1LO6A 1DPOA 1AZZA 1KXFA 1TOMH 2G81E 3P6ZB 5TCCA 3MU0A 2F3CE 1ZTJA 1KSNA 2FYRA 2AERH 2RA0A 1TIOA 4ISNA 1A0JA 4MPXA 5ESTE 2QXHA 1C5LH 2QXIA 3BTEE 4I8KA 4BOHA 3S0NA 1SLXB 2AGEX 4TY6A 1TB6H 2Z9JA 1SGPE 1O30A 5DPAA 3T26A 3A7VA 3B9FH 1ANBA 3R0FA 2ZFTA 4YESB 4LZ1H 4A6LA 2AS9A 2QA9E 1OWJA 1HRTH 3SU0A 1P2QA 4Q7YA 1E38B 3UOPA 1GJ7B 1Z71A 3TJVA 2ANMH 3M3SA 2BY7X 3N7OA 4NSVA 4NCYA 3SNEA 2B8OH 1Z8GA 1K1LA 1RS0A 1TYNA 3EA8A 2ANKH 3RXMA 5JBAS 2PLXA 1OP8A 1BHXB 4FU9A 2ESTE 2RG3A 3A8BA 2Z3DA 1AKSA 1BTZA 4F4OC 2FIRH 1DDJA 3EDXB 2PHBA 7GCHG 4HGCA 2A0QB 1TX8A 4X8VH 2WPKS 1AD8H 1SB1H 3E1XB 1AWHB 1EXFA 5FBIA 1GCDA 4FUEA 1O3HA 3D62A 2PGQB 1GBHA 3K2UA 2FODA 1JIMA 3AAUA 4IMZA 1O32A 1TRNA 3LGIA 1BTPA 2BM2A 1LPZB 3SHAH 3ZZ4A 4X1NU 1DXWA 3FAOA 2FS8A 3F1SB 1ZTLA 2B9LA 4ISOA 1LPKB 4Y8YA 2QC2A 2OTVA 2BHGA 1VITG 2NU2E 3A84A 1SQAA 1MBQA 3JZ1B 4XBBA 1AUJA 4FUGA 2TGTA 1Y59T 1C2LA 2GCTB 1GI6A 1GL0E 1CT0E 3BTME 5DP6A 4CRGA 4DG4A 4ABBA 1C1SA 1T32A 5C5NA 1LVYA 2ZIQH 3RXCA 1SHHB 2F83A 3UR6A 2AYWA 3Q00A 3F9EA 2Z3EA 2VGCC 1KTSB 4AGJA 2VIQA 3QX5H 3NWUA 4JZ1A 1L4ZA 1PPBH 1QB1A 2VWNA 3UFAA 2HNTE 3UTUH 5LGOA 2J92A 5T6FA 1JIRA 1HUTH 4ABDA 2A2QH 1QQ4A 1OYQA 4K5ZA 5DG6A 4IMQA 3TNTA 1PQ5A 1LVBA 3QDZB 4XE4A 1C5TA 5A2MH 5ETXA 5E0GA 1QIXB 1F0UA 2GTBA 1CBWC 8LPRA 1QBNA 2STBE 2ZO3H 3BTKE 5C2ZA 1GBCA 1O2XA 2A1DB 4NZLA 1MD7A 4CR9A 5AHGH 2W7UA 4INHA 4I32A 4ZUHA 3BN9A 1SMFE 1NRPH 1E37B 1PPHE 3Q3XA 1KIGH 1SFIA 2BQ6B 1G30B 4FUIA 1EB1H 5A8XA 1C1QA 1UTMA 8KME2 1D6RA 2ZCHP 1C1VH 1P2NA 3F9FA 3PYHA 5HGGA 1V2QT 4X1PU 1H8DH 4YOJA 4MPUA 4AYYB 3SV8A 2WUCA 3RXHA 1OWDA 2WPLS 2Y6TA 1V2OT 3QZQA 3VB4A 1SC8U 1Z7KA 2VIOA 4U2WA 5HXFA 3KL6A 9ESTA 1WYKA 1SGEE 4DOQA 1IQFA 1BIOA 1O2LA 4K8BA 1TLDA 1G3EA 4BTTB 2SGEE 2DUCA 3FP7E 3LGWA 4X2WA 2DE8A 1DM4B 2ZHFH 4E05H 1JMOH 1GHBF 1KDQA 6GCHF 2FYQA 4X0WU 3UOUA 1RIWB 3E6PH 5E2OA 4E7NA 1NT1A 2JH0D 1FY1A 2UUYA 3RXOA 2ZDMA 2ZU4A 1GHWH 1EP5A 2C3SA 1MKWH 4AFQA 1GGDB 2ZFFH 4H4FA 3PLPA 3ZZAA 1LHDH 1K1NA 5B6OA 1YF4A 4K1EA 4Z0KA 3B23B 1YPLH 1LHGH 1P12E 2XC0A 4ZKNU 1GVLA 3A85A 1A3BH 1UCYH 1DOJA 4A1TA 1TBRH 1WQVH 2OXSA 3QTOH 2ZFPH 2CHAC 1SSXA 3SNDA 5DP9A 1AFQB 3S69A 4UEHH 2YNBA 1MD8A 2BDCA 3SV2H 5GDSH 1YPEH 3TH4H 2Y7XA 2ZNKH 2PW8H 3TJUA 1SLUB 4B2CA 2SNVA 1O36A 5JDUB 4ZXXH 3EA7A 1GMCF 2J94A 1GI1A 3K6ZA 2ZGXH 1XVMA 3SN8A 1RJXB 1A5GH 1JXPA 2V3OH 1FY8E 3IITA 4OGYA 4Q7XA 3NZIA 1O2HA 1DE7H 3ZZ6A 3S9CA 2SGAA 2YNAA 5DK1A 1O39A 2D1JA 1HJAB 1Z1IA 1YPMH 1WU1A 1FY5A 5A0AE 1DT2A 1QY6A 2G52A 1MMJN 1SQOA 3RXVA 4HZHA 3V3MA 3PO1C 2ANYA 1QHRB 2ZFSA 3A7WA 4Y0ZE 1O2NA 3V13A 1CHOG 3SNBA 1Z6JH 3T29A 3K9XB 4YOGA 3FP6E 4BTIB 5EGMA 3SJKA 3PTBA 1MTNB 2JETC 3QK1A 3QGJA 1QURH 1QR3E 2JH6D 3ZVBA 5IDKA 3FANA 4CHAB 1YPKH 1KLJH 3P8GA 1BT7A 3LIWA 3A87A 4OS5A 3VB3A 3IG6B 1WOFA 1GDNA 1RFNA 1B7XB 3M5LA 3BV9B 4GLYA 1GI4A 1N8OB 2NU3E 2ZDNA 4WH8A 3RXEA 4IGDA 4I7YH 3H5CB 4ZHAA 3RM2H 3U69H 2P3UB 3SOSA 3LPRA 1P10A 5EQRA 1MAXA 3A8DA 1C5PA 1ZRKA 1K1IA 3BG4C 3VXFH 3SJIA 4CBOA 4Y71A 3NUMA 5HYOA 2ZU3A 3P95A 1GBKA 4OGXA 3RXSA 3JZ2B 1Z8RA 3RXLA 4D8NA 1UTJA 4YTAA 1GJ8B 3MO6A 1LMWB 1G36A 1LHEH 2GX4A 3SJ8A 1SR5C 3GYLB 1A4WH 1IQMA 1EP6A 1G3CA 1BHXF 1YCPH 2BQWB 1GBAA 2BXTH 4JZEH 2FDAA 1G2LA 4CRCA 3AAVA 1KYNA 4RN6A 2FESH 3ENSB 2OC1A 1NRSH 1GI8B 1SL3A 2ZHDA 2XBWA 3VB7A 3I77A 2IPHA 4BAKB 4NIWA 2NU1E 2O8WA 3NXPA 5CHAB 1EZQA 4IN2A 1GCTC 4MPVA 5FCRA 2J2UA 2PWXA 1OKXA 3GICB 2R2MB 1FI8A 1YLCA 1UTNA 3AW1A 2JH5D 1BOQA 1GG6B 1UMAH 3KHVA 1NPMA 1V2ST 3U1IB 3M35A 1C2FA 2A4RA 2AEIH 1P01A 1S82A 1NN6A 3MH6A 4ABIA 4BXWA 4GPGA 2C93B 1YCPK 2BOKA 3U98H 3SQEE 2A5IA 3VB6A 1W3CA 2C8YB 2AFQB 2ZGCA 4MTBA 1W0ZU 1GBIA 1JWTA 2UUFB 1Z6EA 2C8WB 1C2KA 1CGIE 2PV9B 4IC5A 2SGPE 4I8JA 1SOZA 2TPIZ 2Z6BD 4U30A 1RRKA 5AVDA 2P8OB 1YGCH 4DCDA 1OX1A 1NC6A 2Z9GA 4K8YA 1O5FH 4OS2A 1V2NT 5L2YH 1UK2A 1C1OA 1EZSC 1WV7H 1SGCA 3D65E 1HCGA 5FBEA 3SU6A 1QJ6B 2GGVB 1S85A 2ZU2A 4MPWA 1QA0A 3RMMH 4NA9H 4ZH8A 2WPJS 1T8MA 2A4OA 1H9IE 3SORA 3VFEA 1A5IA 1AE8H 4GUXA 3UQVA 1BMLA 2A32A 1EX3A 1HAZB 2OC7A 2W5EA 2ULLA 2BD5A 1CGHA 1MTSA 1GHAG 1FUJA 1G3DA 1L1NA 4O3TA 3KQBA 5JB9S 2K1QA 5E0HA 3VXEH 1Q3XA 1ZMLA 1SQTA 2XC5A 3URCA 1UTOA 1O2ZA 3DD2H 1FLEE 1C2MA 5HM2A 4IN1A 3LGVA 5ESBA 3SV9A 2F9NA 1GI3A 3LH3A 2FOEA 1C5VA 1P8VC 1PQAA 3A8CA 1O2WA 4Y6DA 1O3NA 2VWLA 1W14U 1C1NA 1T31A 2PKSC 3LKWA 4ZROA 4I8LA 4WMDA 5A8ZA 1F5KU 3RXPA 1C5YB 1G3BA 3KF2A 1P57B 1MQ6A 2ZDKA 3SUDA 1VCWA 2GCHG 2R0LA 5SGAE 4O97A 3AASA 2QY0B 4Y0YE 1NU7B 2BD3A 2SFAA 1W12U 4O9VA 4R0IA 3UY9A 1UVSH 5A0BA 2GZ9A 2ZFQH 4AYVB 1CA8B 1SI5H 1XM1A 1YP9A 4O03A 1HAXB 1A7SA 1O2GH 1QRZA 3SU4A 3SU1A 1XUIA 4K60A 1TGCA 3BEUA 2ZWLH 1O2OA 1J15A 4D7FA 4D9RA 2HLCA 3SV6A 1IQHA 1O2TA 1V6DA 2BMGB 1BRBE 1DITH 3RXBA 2FOHA 3LT3A 1H4WA 1FAKH 2A5KA 1XUHA 3MI4A 2D8WA 4YZUA 2FI4E 3SU2A 1YPGH 1BB0B 1SBWA 4B2AA 1EQ9A 2IJOB 2FOAA 2VH6A 1MCTA 2ZTYA 1HBTH 5DJ7A 4GVUA 1HB0B 1S6HA 3LJOA 5DGJA 1C5WB 1DWBH 5JB8S 5C1XA 1GBFA 1CO7E 1P2OA 3MU5A 3ODDA 4JZDH 2XCNA 2UUKB 1A5HA 2VIWA 1VZQH 5E8EH 2Z7FE 3DT0H 1GJAB 1LDTT 1T8NA 2GV6A 1E35B 5DP4A 4A7IB 2BOHB 3T25A 2GDDA 1AZ8A 3HGPA 3MFJA 4WXVA 2J38A 1RTFB 1D3QB 1ZHRA 3GCHC 3RXQA 1F92A 3MU1A 1RTKA 3MNXA 3UREA 1DUAA 4X8TH 1NRQH 3RXAA 3W94A 2VH0A 1A0LA 1EJNA 1O31A 2F9VA 1ZRBA 4UDWH 1AN1E 5A09A 3HKJB 2FOGA 5L6NH 1O0DH 4DJZB 1SGFG 3SGQE 4YT7H 4ZKOU 1BTWA 1QGFA 2P94A 4GCHF 3ZV8A 1NS3A 1UTQA 3ZVCA 2M5TA 3W95A 3BF6H 1KY9A 1YCPM 3S9BA 3QO6A 5EW2H 1QBOA 2W3IA 3KEEA 4BTUB 2VGCB 3M7UA 1LHFH 4H42U 1ZLRA 4NSYA 2H9HA 3RXTA 2QYIA 4RKJB 3GY8A 5EXMA 4LXBH 1QL8A 1LQDB 1XKBC 2A2XH 1KLTA 1CT4E 4MNVA 2FM2A 4FUFA 5FXLA 1C2DA 1C1WH 5FAHA 2SGDE 1NTPA 3DHKH 2WV5A 1ZTKA 1TFXA 4ABGA 2ZECA 1BTXA 5GCHF 4ZHLU 1MTUA 3A7XA 1BRAA 3QN7A 4JCNA 4MNWA 2BYAX 1C5UA 1VGCB 4TY7A 1QQUA 1TNJA 7GCHF 3O8RA 4ABEA 1OWEA 1TPPA 1N6XA 4ABAA 1PFXC 1Q2WA 5FPSA 3ZVDA 1P3CA 1K1PA 1RXPA 1XMNB 1IQIA 3V0XA 1BA8B 1NESE 4X2XA 1AUTC 5L30H 1C1RA 3MH5A 1M9UA 5EOKA 4JYUH 1P3EA 4JYVH 3TK6A 5GPIB 4Z6AH 4GHQA 3M7TA 4NFEA 1ANCA 3UIRA 4UD9H 5HM9A 2XNIA 1C1UH 2OP9A 3GOVB 3TITA 4ISHH 1EAWA 2CN0H 1BRCE 4Y11E 3E90B 3ZVEA 3A89A 1BQYA 1CHGA 3QTVH 2GD4B 3O8BA 1T7CA 1UK3A 5A8YA 2B7DH 1MTWA 1ANEA 1GHYH 4AX9H 3Q76A 1C9PA 2BVXH 3TK9A 4F49A 4X1QU 3M3TA 1THRH 3EQ0H 4MNXA 3ZZ9A 2GMTB 4RSPA 1V2VT 3ATWA 3RUOA 3STJA 1VJ9U 1S81A 3BEFB 1FPCH 4YOIA 1QA7A 2BY8X 2VU8E 3L3TA 3NK8A 4D76A 4UFEH 3HGNA 3LOXA 1TRMA 3GYMA 5DO4H 2EEKA 1TPSA 2AH4X 4FVDA 4M7GA 1S5SA 1FIZA 3E0PB 3GCOA 1LCYA 6ESTA 1DX5M 1QL9A 3BSQA 2AGIX 1C5QA 2TIOA 3ATLA 2ZCKP 1TGNA 1TX6A 1Y5BT 3GDSA 1D4PB 1MH0A 1G9IE 3UNQA 4CH8B 4B73A 1ZGVA 4AGKA 4SGBE 3K6YA 1JRSA 3KCGH 1J8AA 2BDHA 2CHAB 1TE0A 1G2MA 1EOLA 2DE9A 3A7ZA 2ZHWH 4BAQB 1BBRE 1ZJKA 1P03A 2FS9A 2XW9A 1LVMA 4AB9A 1ZSLA 2PR3A 5AFYH 1FMGA 1O5EH 1MU6B 1YLDA 2B5TB 3T5FH 4IS5A 1W7GH 1P09A 2ZPRA 1TGSZ 4FU7A 1KLIH 3P8NA 1ZHPA 4J1YA 5BPEA 1EB2A 4WMFA 4J2YB 4H6TA 2OBQA 1A3EH 1FY3A 1C2JA 2XCFA 3A88A 1LVOA 4B2BA 3TU7H 1XX9A 1S83A 4YO9A 8ESTE 3ZZ5A 1O2RA 3IWMA 1A1RA 5DP5A 3WY8A 2A45B 1O3AA 1GBTA 1BTHH 2OQ5A 2BDGA 1P02A 5CE1A 2QAAA 3ODFA 3PWCA 1D3TB 2OC8A 4MG3A 3LC5A 2GCTC 2BDIA 2GT7A 4X6NA 1HAHH 1HAIH 1TNGA 2VWMA 1EAIA 2UUJB 5DP7A 1EOJA 2BB4A 1FN6A 1TMUH 1ZPBA 4JK6A 3LU9B 2GP9B 1GHBG 3RLWH 3DA9B 1DLEA 1H8IH 5DP8A 3ATIA 4NWKA 3ZZ7A 3O8DA 3O8CA 1O3CA 2D2DA 2A5AA 2JETB 1S84A 3GY7A 1O37A 2V3HH 4FUBA 2FTMA 3F68H 1KTTB 3QLPH 2D26C 1C5RA 1GI5A 3T27A 1OP0A 4AOQA 6CHAC 2PKAA 5EG4A 4CRFA 1DY8A 1SGYE 2WINI 4ZMAH 1D3PB 1YYY1 2GZ7A 2BY9X 2ZA5A 4DW2U 5C67A 1IQEA 1ZMJA 2XC4A 2Q6FA 3TGKE 2RDLA 1Q31A 1FV9A 1PPFE 2PKAB 1F2SE 1V2PT 1WTGH 3VPKA 1EAXA 4Y8ZA 5EXLA 1O2KA 4OS6A 4WY3A 3QZRA 3E16B 3UWIA 1KXEA 2VWOA 1H9LB 1GDUA 1O2SA 1T4VH 2BLOA 2ALVA 1AY6H 5J4QA 4K3JA 1OWHA 5I25A 1ZJDA 3ZYDA 2OQUA 2R3YA 2OCVB 3NCLA 2PTCE 1V2RT 1RD3B 1D9IA 1DY9A 2EI7A 2TGAA 1GMCG 3MWIU 8GCHG 3A82A 2V35A 4DGJA 4FXGH 2BLQA 3P92A 1O2VA 1DS2E 1HNEE 1HFDA 1GJBB 1UTPA 3TH3H 1HAGE 3F9GA 1CVWH 1XUGA 1ZGIA 1ELBA 5F8XA 1PYTD 1ELGA 1VCQA 1Y5UT 2Z3CA 1DWEH 2G4TA 3SNAA 1PPCE 3RLYH 1C4V2 3HPTB 2BDAA 1QB6A 1IOEA 1ARBA 1ELTA 3CS0A 1DFPA 1CHOF 1SGIB 1A2CH 1RIWC 1BCUH 1QNJA 1C5OH 3RDZA 3UQOA 2KAIA 1UJ1A 1XUKA 2G4UA 4O3UA 4X8SH 1ZPCA 5FHTA 1FAXA 4X2YA 4NIYA 1BDAA 2KAIB 3T2NA 2FOBA 3NKKA 3I78A 2ZPSA 1A61H 1AU8A 4FUCA 1Z8JB 1QRWA 3ITIA 1O2PA 5C5OA 1FZZA 1C2HA 1ELDE 1QL7A 5F03A 2AMDA 4WF8A 7ESTE 1SGQE 4X6MA 2VJ1A 1UTLM 5AFZH 1FONA 2UWPA 1S6FA 4ABJA 1GBJA 4Q80A 3ZZDA 2FLRH 3C27B 3PLKA 1YPJH 1O2JA 2ZDVH 4HTCH 1ZHMA 1O5AB 1O5BB 4IW4E 3PV4A 3RC4A 2F9PA 1MU8B 2A4QA 3RXUA 1ELEE 2HPQH 4CRDA 4I31A 3Q3YA 5LH8A 1ETTH 4ZKSU 3MU8A 3U8OH 2G8TA 3T28A 3V7TA 2ZHEH 5I46H 4UFFH 1O3LA 4ASHA 1P9SA 1C1PA 1FXYA 2VIVA 7KMEH 2R0KA 2OD3B 1XUFA 1A46H 2ILNA 1HJAC 1DANH 1HAVA 1W0YH 1C5XB 4XBCA 1NM6A 1PPGE 1BRUP 4VGCB 1GMDF 1D6WA 3FP8E 3KNXA 3OX7U 2BY5X 1DICA 1HAVB 2BTCE 1C1MA 2OC0A 1QTFA 1Y3XA 1V2LT 4CRAA 4KGAA 1CQQA 1OWIA 2BZAA 3RXFA 2FZZA 5GXPA 1L2EA 4RKOB 1AVXA 1CSOE 2BDBA 4A92A 1K1MA 1Z8IB 1IHSH 5FPYA 3GCTF 4AORA 1GMHF 4CHAC 4D7GA 1V3XA 3SNCA 1UCYE 1MKXH 3ZZBA 5EQQA 1SVPA 5A0CA 4ZXYH 3SGAE 3E91A 3U8RH 2FTLE 2W26A 3RXGA 3RU4T 1KXAA 1TNIA 2PKSB 1HAYB 1GVZA 1N8OC 1Z1JA 5LPRA 1EUFA 2QV1A 2OLGA 2H9EH 4INKA 1F0SA 1N6YA 1F0RA 2XYAA 2FOMB 3LJJA 2GV7A 2GVFA 3EAJA 3BG8A 3SV7A 2NU0E 2F9UA 2FO9A 4UONA 2O8TA 4ABHA 3GY5A 5EODA 1ZPZA 2NU4E 5C1UA 5CMXH 1W8BH 3Q77A 2WYGA 4MNYA 3VGCC 1ELCA 2H2ZA 3ZVAA 3SU5A 2FPZA 4ISIH 1K22H 4IBLH 2TGPZ 2WPMS 2Q1JA 1NFWA 3LGTA 2F9BH 1UK4A 1X7AC 1ZZZA 1ORFA 4BNRA 2I6QA 1EATA 3I29A 1JRTA 1ABJH 1NU9A 1CA0C 1ESBA 3RP2A 1MKXK 3SUGA 2FMJA 2BQ7B 3QUMP 1IQJA 2HALA 4E06H 1TONA 3KGPA 1FPHH 1QFKH 2A7JA 3GY2A 4A5TS 3ZZ8A 1FN8A 3T62A 1VITH 1V2TT 4MQAA 1V2WT 1AGJA 5CHAC 3SBKA 5BRRE 1F5RA 1TRYA 1FDPA 2Z9KA 1RTLA 3ZV9A 4FVBA 4ABFA 3A80A 2Q6GA 1Y3UA 3S7HB 2CGAA 4NA7A 1TMBH 1SPJA 4JZIA 2R3UA 4D9QA 1T4UH 1Y3VA 1AMHA 1GG6C 1UTKA 1LHCH 1PPEE 5C20A 1TOCB 2AGGX 4Y10E 4AB8A 1EPTC 3TIUA 1TPOA 3GY4A 3A7YA 1AVWA 2ZC9H 1TMTH 4LOYH 1SFQB 3RXDA 2ZP0H 2PSXA 3PLBA 3L6PA 1TABE 1LPGB 2VINA 3KQCA 2QF0A 4Y76A 1OP2A 3U1JB 1NRNH 3MOCA 5PTPA 4CREA 4ZKRU 4AN7A 3OU0A 2R2WU 1KXDA 2P8OC 1O33A 1MUEB 1TNLA 4DURA 2GT8A 2PFEA 1FJSA 1HGTH 2QGRA 3GDVA 5T6GA 4ISLA 1J16A 2ZZUH 3H7TA 1J14A 2R9PA 2V6NA 3S7KB 2EC9H 3TVJB 3H7OA 3UNSA 1IHTH 2CV3A 3HATH 4I8HA 2FOCA 2ZQ1A 1P2KA 3MU4A 1CGJE 1P0SH 4R8TB 2Y7ZA 1GJ9B 3G01A 1AE5A 1FNIA 4INLA 2P3TB 1W2KH 1C1TA 3SJOA 5H4IB 1TWXB 3RXKA 1C2IA 4AG2A 1L1JA 4Y8XA 3K65B 4KTUA 1F0TA 5ABWA 2TRMA 2GDEH 4MLFB 2BX3A 3F6UH 1AI8H 1O3JA 1F5LA 1TAWA 2H6MA 1O3DA 3ZVGA 3SZNA 1UVPA 1C4Y2 4KELA 1YKTA 1KXCA 5JYIA 1O3MA 2PUXB 5EXNA 1ELAA 1F7ZA 2ZFRH 1O3EA 4XDEA 4B74A 4NZQA 2AMQA 5EU8A 3RC6A 1ESAA 3ATKA 2ZKSA 4JMYA 3OSYA 1NZQH 1L0ZA 2W7SA 4WWYA 1HJ9A 2BXUH 1TBQH 1B0EA 2G55A 3BIVH 3SQHE 2UWLA 4JZFH 1O3GA 4WVPE 1O5DH 5IYTA 3F9HA 1O38A 2C4FH 1NROH 3MYWA 4WXIA 1THSH 2P3FH 3V12A 1W13U 4E7RG 3U8TH 4BXSA 2J95A 4GCHG 1WAYB 4BAMB 1Y5AT 3AVZA 1BBRK 1Y8TA 1GBMA 2QXJA 1L4DA 2ZG0H 4U32A 2BVSH 2Y5GA 3A7TA 1HYLA 4WH6A 5DP3A 3A81A 1SLWB 3KIDU 3BTFE 1CBWB 4GHTA 1EZUC 1MTVA 5T6DA 4B71A 4OS7A 1ZOMA 4Y79A 3PTNA 2WV4A 3SGBE 4YLUA 2P59A 2FWWA 2XXLA 3RC5A 1GJCB 1E34B 1ELVA 5GCHG 1TNKA 5JPMH 1MZAA 4KTCA 2G5VA 4YT6H 1P2JA 3M37A 1XKAC 4BANB 1ARCA 2ALPA 1AKSB 1EAUA 3UNRA 4ZAEA 2WUBA 4NA8A 5AF9H 1ZYOA 2J4IA 3NPSA 1DLKB 1QJ7B 1AVGH 1GWAA 3RMLH 2VVCA 4QT8C 1PPZA 2XBVA 1V2JT 1VITF 2RCEA 2Z94A 1AB9C 4TPYA 1TX7A 1BZXE 1GHVH 3HK3B 2SGFE 1U6QA 1FQ3A 1ZSKA 1UVTH 4X6OA 4X6PA 1HIAA 3VB5A 1HAOH 4Q7ZA 1J17T 7LPRA 1O2UA 1HIAB 2C8ZB 1ETSH 3TGIE 3UUZA 2VVUA 4CR5A 3RM0H 3B8JA 2HRVA 1PQ8A 1K9OE 3C1KA 1O3BA 1DUEA 3MTYA 1GHZA 2O9QA 4MVNA 2AIPA 2LNCA 1DWCH 1C4U2 3LC3A 3Q3KA 1EZXC 1QBVH 3MNSA 2EA3A 5DKMA 1BTYA 1O3IA 2FOFA 1J9CH 1GI0A 2FP7B 2UWOA 4KKDA 2H1UA 1O2MA 6CHAB 1EJAA 1GBDA 2Z9IA 3P70B 3SUFA 3QWCH 1THPB 1HAPH 3ZYEA 2H5CA 2SNWA 4NFFA 3FFGA 1AWFH 3KQDA 2HNTF 2FEQH 3RMNH 1TA6A 1YC0A 1VGCC 2ZDLA 2HVXA 2PGBB 1P11E 1NO9H 2Y5HA 3QGNB 4DIIH 2GKVE 1UHBA 2ZEBA 4B75A 1SHYA 2LPRA 1NY22 4CH2B 1DXPA 3BTDE 5C3NA 2CJIA 3CS7A 1DSUA 1ZMNA 1UVUH 2ZGBH 3UR9A 4X1RU 1H9HE 1UHBB 3LH1A 3BTGE 1BMAA 3TJOA 4LZ4B 4UFDH 1HXEH 2BLVA 1K1OA 1LKBA 2C90B 3PMAB 2HOBA 2ODPA 2P16A 1C2EA 2ZGHA 3MMGA 1GJ5H 2ZPQA 3PO1B 1INCA 1HJ8A 3SI4H 4Q2KA 1T8LA 2PUQH 2ZQ2A 4I33A 2BX4A 3S9AA 3TH2H 6GCHG 4MDSA 3BTWE 4GSOA 4X1SU 4A1VA 4U01A 3MO9A 3LGUA 4FUHA 2V0BA 1GBBA 2A7HA 4K69A 2GMTC 3D49H 5GIBA 3PMHB 1VJAU 5LPEA 1KDQB 1ELFA 1GDQA 4CRBA 2G5NA 4NGAH 2CXVA 1A0HB 3RXIA 3P17H 4AFZA 1AHTH 1T8OA 3GY3A 3UWJH 1NFXA 2QCYA 1ABIH 1K28D 1B0FA 4BAHB 4LK4A 1W10U 3EYDA 5K0HA 4UFGH 3ELAH 3GISB 1ZSJA 3DUXH 2W3KA 5C1YA 2ZU5A 1SOTA 3BG4B 1UVOA 1WCZA 4ESTE 4YLQH 1G32B 3TGJE 1AFEH 3SI3H 1L1GA 3MHWU 2WYJA 4TPIZ 4DIHH 1VR1H 1TALA 1BMMH 2P93A 1QCPA 1GI9B 1CE5A 3E8LA 2GZ8A 5E0JA 4PROA 1DWDH 2ASUB 2XRCA 3CP7A 1KXBA 3BTQE 4B1TA 2AIQA 5EPNA 4FU8A 8GCHF 1P2MA 1TA2A 4THNH 5FCKA 9LPRA 1MAYA 3DFJA 1C5NH 6LPRA 1MKWK 4DY7B 3ATMA 3HK6B 2QF3A 2A7CA 2ZI2H 4K1SA 1NFYA 4AG1A 1SGTA 1SGFA 1HV7A 3EE0B 5E2PA 1MBMA 2PSYA 3VEQB 4NIXA 1UCYK 1GCTB 3GDUA 1TGBA 1C5SA 4HFPB 3PB1E 3AW0A 3M5MA 3MO3A 1IQGA 3ESTA 1WQSA 3TPIZ 1GGDC 3M5OA 2F91A 3TJNA 3TNSA 2SGQE 1TNHA 1K21H 2ODYB 1OYTH 2VIDA 4X8UH 4XBDA 2XBYA 1QJ1B 1XXFA 1JBUH 1IQLA 1LKAA 3M36A 2ZTXA 2QN5T 1OSSA 2Y81A 1B5GH 2WPIS 3PMBB 4A1XA 3FZDA 1OOKB 1AFQC 2BVRH 5F8TA 2RA3A 5TJXA 1BJUA 3PM3A 2BY6X 2XWBI 2TGDA 2CF9H 3M5NA 3P8OA 1YPHC 3LONA 1TQ7B 3FVFB 1C5ZB 2STAE 2HGTH 2P95A 1QB9A 5JBCS 4I8GA 2HPPH 2IN2A 2OINA 2FLBH 5T3HA 5G4BA 3SUEA 1V2MT 3R3GB 4WJG2 3VGCB 2J9NA 3L33A 1DVAH 3SU3A 1QRXA 3RXJA 1AIXH 1O3PB 4NWLA 1LQEA 3P8FA 2I6SA 1EJMA 1N1LA 3RU4E 3ZVFA 1NRRH 3TLOA 1FIWA 1CA0B 3KN2A 3SJ9A 2FX6A 4FUJA 2VIPA 1W11U 1O5CB 1GI7B 2IOTA 1ESTA 1H1BA 2VVVA 4X2VA 1GBLA 3UPEA 3URDA 1XUJA 1EKBB 4NG9H 1GMDG 2ZF0H 1TGTA 3E3TA 2BLWA 3BTTE 1TPAE 1BTUA 1MTNC 1Y3WA 2J34A 2ZU1A 3EA9A 1S0QA 1CT2E 2VB0A 2F9OA 3STIA 3SW2B 2Y82A 1GJ6A 4KP0A 5FX5A 2Q6DA 1EPTA 2G00A 3GCTG 4HI3A 5HMAA 1GMHG 5JBBS 1UO6A 1P9UA 1WBGB 1O2IA 4AZ2B 1K1JA 1FY4A 1EPTB 3CENA 1S0RA 1AO5A 4IC6A 1P2IA 1WTHD 2PTNA 2WPHS 5JBTA 1OPHB 1O3KA 3OTJE 3ZZ3A 4FUDA 4TYDA 3E0NB 4H6SB 5EQSA 4B76A 3BIUH 1XVOA 2BD7A 1V2UT 2A31A 2BD4A 1GVKB 3PWBA 4CBNA 4KTSA 1IAUA 3BEIB 3TK5A 1SG8B 1O3OA 1CU1A 3LGYA 2HWLB 5GWZA 1SGRE 1GHXH 1HLTH 1MCVA 3M3VA 3RMOH 2O8LA 3LDXH 1GJ4H 2AMPA 2FI3E 3M7QA 1LTOA 3GCNA 2CF8H 2OUAA 1TQ0B 3OY5U 1BMNH 4BAOB 3D23A 2EI8A 1GHAF 3GY6A 3MH7A 4XSKU 5FPTA 1V2KT 2ZTZA 5FX6A 4OS1A 1W7XH 1VCPA 2ZHQH 4XOJA 1JOUB 1SLVB 1GI2A 4TWWA 2VNTA 2XWAA 5EW1H 4VGCC 2JKHA 1ACBE 5F8ZA 1OS8A 1WUNH 1P04A 3SHCH 1DSTA 1PYTC 1O2YA 1P06A 1G37A 1O3FA 2O8UA 4TWYA 4XFQA 2A4GA 2TBSA 2O8MA 3OY6U 3PROA 5TCAA 1EASA 3GCHB 1NFUA 1ETRH 2Y80A 3A83A 1TBZH 4UE7H 1HXFH 1O35A 2ODQA 2GCHF 4DT7B 3M61U 2ANWA 2G51A 1K2I1 2FXRA 1GPZA 2H5DA 1ANDA 1MZDA 2XTTB 1BITA 4Y7AA 1Y3YA 4YM9A 2BD9A 5F6MA 1IQKA 5K7RA 1IQNA 1O5GH
chains in the Genus database with same CATH superfamily
2OBOA 1GL1A 4DVAU 1E0FD 5C0TA 3DFLA 2HNTC 3NRLA 1OWKA 1HPGA 4NIVA 1YPHE 4JK5A 2YOLA 2QXGA 3FZZA 3KQEA 2B0FA 1OHHD 5LPFA 1GJDB 1BJVA 2NWNA 1AQ7A 1E36B 1GBEA 2QIQA 5DN6D 4WMEA 1HDTH 2XBXA 1YBWA 4K2YA 3ZZCA 2FI5E 4GAWA 2BZ6H 2THFB 4Y7BA 1E79D 1ZR0A 3MH4A 2HLDD 4AFUA 1C5MD 2CMYA 4K1TA 4JYTA 1PQ7A 3HKIB 1SGNE 5J4SA 1BBRH 4ZHMU 1OXGA 1RGQA 1C2GA 2ZCLP 3SO3A 1WSSH 3BTHE 2C8XB 3RXRA 3U9AH 5L2ZH 3OYPA 4AFSA 2H9TH 3RU4D 1BUIA 1XXDA 1YM0A 1MQ5A 2OK5A 2EI6A 1O34A 2ZDAH 4SGAE 2ZGJA 2Y5FA 5GJ4B 1O2QA 1SGDE 3A86A 3MNBA 2Z9LA 1P05A 3A8AA 2FX4A 1PJPA 1C9TA 5EPYA 3PMJA 3EGKH 2BD2A 1D3DB 2BDYA 1ID5H 2BD8A 5EJZA 1AB9B 4OS4A 3MNCA 1LO6A 1DPOA 1AZZA 1KXFA 1TOMH 2G81E 3P6ZB 5TCCA 3MU0A 2F3CE 1ZTJA 1KSNA 2FYRA 2AERH 2RA0A 1TIOA 4ISNA 1A0JA 4MPXA 5ESTE 2QXHA 1C5LH 2QXIA 3BTEE 4I8KA 3F2FA 4BOHA 3S0NA 1SLXB 2AGEX 4TY6A 1TB6H 2Z9JA 1SGPE 1O30A 5DPAA 3T26A 3A7VA 2WZQA 3F2GA 3B9FH 1ANBA 3R0FA 2ZFTA 4YESB 4LZ1H 4A6LA 2AS9A 2QA9E 1OWJA 1HRTH 3SU0A 1P2QA 2EY4C 4Q7YA 1E38B 3UOPA 1GJ7B 1Z71A 3TJVA 2ANMH 3M3SA 2BY7X 3OAAD 3N7OA 4NSVA 4NCYA 3SNEA 4TT3D 5EJ1A 2B8OH 1Z8GA 1K1LA 1RS0A 1TYNA 3EA8A 2ANKH 3RXMA 5JBAS 2PLXA 3DCLA 1OP8A 1BHXB 4FU9A 2ESTE 2RG3A 3A8BA 2Z3DA 1AKSA 1BTZA 4F4OC 2FIRH 1DDJA 3EDXB 2PHBA 7GCHG 4HGCA 5EIYA 2A0QB 1TX8A 4X8VH 2WPKS 3PV5A 1AD8H 1SB1H 4B6EA 3E1XB 1AWHB 1EXFA 5FBIA 1GCDA 4FUEA 1O3HA 3D62A 2PGQB 1GBHA 3K2UA 2FODA 1JIMA 3AAUA 4IMZA 1O32A 1TRNA 3LGIA 1BTPA 2BM2A 1LPZB 1SKYE 3SHAH 3ZZ4A 4X1NU 1DXWA 3FAOA 2FS8A 3F1SB 1ZTLA 2B9LA 4ISOA 1LPKB 4Y8YA 2QC2A 2OTVA 2BHGA 1VITG 2NU2E 3A84A 1SQAA 1MBQA 3JZ1B 4XBBA 1AUJA 4FUGA 2TGTA 1Y59T 1C2LA 2GCTB 1GI6A 1GL0E 1CT0E 3BTME 5DP6A 5GNDA 4CRGA 4DG4A 4ABBA 1C1SA 1T32A 5C5NA 1LVYA 1WXRA 2ZIQH 3RXCA 1SHHB 2F83A 3UR6A 2AYWA 3Q00A 3F0OA 3F9EA 2L6OA 3F2HA 2Z3EA 2VGCC 1KTSB 4AGJA 2VIQA 3QX5H 3NWUA 4JZ1A 1L4ZA 1PPBH 1QB1A 2VWNA 3UFAA 2HNTE 3UTUH 5LGOA 2J92A 5T6FA 1JIRA 1HUTH 4ABDA 2A2QH 1QQ4A 1OYQA 4K5ZA 5DG6A 4IMQA 3PRDA 3TNTA 1PQ5A 1LVBA 3QDZB 4XE4A 1C5TA 5A2MH 5ETXA 5E0GA 1QIXB 1F0UA 2GTBA 4RT0A 1CBWC 8LPRA 1QBNA 2STBE 2ZO3H 3BTKE 5C2ZA 1GBCA 5DSFA 1O2XA 2A1DB 4NZLA 1MD7A 4CR9A 5AHGH 2W7UA 4INHA 4I32A 4ZUHA 3BN9A 1SMFE 1NRPH 1E37B 1PPHE 3Q3XA 1KIGH 1SFIA 2BQ6B 1G30B 4FUIA 1EB1H 5HKKD 5A8XA 1C1QA 1UTMA 8KME2 1D6RA 2ZCHP 1C1VH 1P2NA 3F9FA 3PYHA 5HGGA 1V2QT 4X1PU 1H8DH 4YOJA 4MPUA 4AYYB 3SV8A 2WUCA 3RXHA 1OWDA 2WPLS 2Y6TA 1V2OT 3QZQA 3VB4A 1SC8U 1Z7KA 2VIOA 4U2WA 5HXFA 3KL6A 9ESTA 1WYKA 1SGEE 4DOQA 1IQFA 2W6ID 1BIOA 1O2LA 4K8BA 1TLDA 1G3EA 4BTTB 2SGEE 2DUCA 3FP7E 3LGWA 4X2WA 2DE8A 1DM4B 2ZHFH 4E05H 1JMOH 1GHBF 1KDQA 6GCHF 2FYQA 4X0WU 3UOUA 1RIWB 3E6PH 5E2OA 4E7NA 1NT1A 2JH0D 1FY1A 2UUYA 3RXOA 2ZDMA 2ZU4A 1GHWH 1EP5A 2C3SA 1MKWH 4AFQA 1GGDB 2ZFFH 4H4FA 3PLPA 3ZZAA 1LHDH 1K1NA 5B6OA 1YF4A 4K1EA 4Z0KA 3B23B 1YPLH 1LHGH 1P12E 2XC0A 4ZKNU 1GVLA 3A85A 1A3BH 1UCYH 1DOJA 4A1TA 1TBRH 1WQVH 2OXSA 3QTOH 2ZFPH 2CHAC 1SSXA 3SNDA 5DP9A 1AFQB 3S69A 4UEHH 2YNBA 1MD8A 2BDCA 2KR7A 3UAIC 3SV2H 5GDSH 1YPEH 3TH4H 2CK3D 2Y7XA 2ZNKH 2PW8H 2YMSD 3TJUA 1SLUB 4B2CA 2SNVA 1O36A 5JDUB 4ZXXH 3WWBA 3EA7A 1GMCF 2J94A 3F3BA 1GI1A 3K6ZA 2ZGXH 1XVMA 3SN8A 1RJXB 1A5GH 1JXPA 2V3OH 1FY8E 3IITA 4OGYA 4Q7XA 3NZIA 1VKYA 1O2HA 1DE7H 3ZZ6A 3S9CA 2SGAA 2YNAA 5DK1A 1O39A 2D1JA 1HJAB 1Z1IA 1YPMH 1WU1A 1FY5A 5A0AE 1DT2A 1QY6A 2G52A 1MMJN 1SQOA 3RXVA 4HZHA 3V3MA 3PO1C 2ANYA 1QHRB 2ZFSA 3A7WA 4Y0ZE 1O2NA 3V13A 1CHOG 3SNBA 4M9FA 1Z6JH 3T29A 3K9XB 4YOGA 3FP6E 4BTIB 5EGMA 3SJKA 3PTBA 1MTNB 2JETC 3QK1A 3QGJA 1QURH 1QR3E 2JH6D 3ZVBA 5IDKA 3FANA 4CHAB 1YPKH 1KLJH 3P8GA 1BT7A 3LIWA 3A87A 4OS5A 3VB3A 3IG6B 1WOFA 1GDNA 1RFNA 1B7XB 3M5LA 3BV9B 4GLYA 1GI4A 1N8OB 2NU3E 2ZDNA 4WH8A 3RXEA 4IGDA 4I7YH 3H5CB 4ZHAA 3RM2H 3U69H 2P3UB 3SOSA 3LPRA 1P10A 5EQRA 2JJ2D 1MAXA 2F43B 3A8DA 1C5PA 1ZRKA 1K1IA 3BG4C 3VXFH 3SJIA 4CBOA 4Y71A 3NUMA 5HYOA 2ZU3A 3P95A 1GBKA 4OGXA 3RXSA 3JZ2B 1Z8RA 3RXLA 4D8NA 1UTJA 4YTAA 1GJ8B 3MO6A 1LMWB 1G36A 1LHEH 2GX4A 3SJ8A 2YMSB 1SR5C 3GYLB 1A4WH 1IQMA 1EP6A 1G3CA 1BHXF 1YCPH 2BQWB 1GBAA 2BXTH 4JZEH 2FDAA 1G2LA 4CRCA 3AAVA 1KYNA 4RN6A 2FESH 3ENSB 2OC1A 1NRSH 1GI8B 1SL3A 2ZHDA 3DSOA 2XBWA 3VB7A 3I77A 2IPHA 4BAKB 4NIWA 2NU1E 2O8WA 3NXPA 5CHAB 1EZQA 4ZCNA 4IN2A 1GCTC 2QE7D 4MPVA 5FCRA 2J2UA 2JDID 2PWXA 1OKXA 3GICB 2R2MB 1FI8A 1YLCA 1UTNA 5IK2D 3AW1A 2JH5D 1BOQA 1GG6B 1UMAH 3KHVA 1NPMA 1V2ST 3U1IB 1W0KD 3M35A 1C2FA 2A4RA 2AEIH 1P01A 1S82A 1NN6A 3MH6A 4ABIA 4BXWA 4GPGA 2C93B 1YCPK 2BOKA 3U98H 3SQEE 2A5IA 3VB6A 1W3CA 2C8YB 2AFQB 2ZGCA 4MTBA 1W0ZU 1GBIA 1JWTA 2UUFB 1Z6EA 2C8WB 5B6LA 1C2KA 2LELA 2WPDD 2RFKC 1CGIE 2PV9B 4IC5A 2SGPE 4I8JA 1SOZA 2TPIZ 2Z6BD 4U30A 1RRKA 5AVDA 2P8OB 1YGCH 4DT4A 4DCDA 1OX1A 1NC6A 2Z9GA 4K8YA 1O5FH 4OS2A 1V2NT 5L2YH 2K0QA 1UK2A 1C1OA 1EZSC 1WV7H 1SGCA 3D65E 1HCGA 5FBEA 2QF4A 3SU6A 1QJ6B 2GGVB 1S85A 2ZU2A 4MPWA 1QA0A 3RMMH 4NA9H 4ZH8A 2WPJS 1T8MA 2A4OA 1H9IE 3SORA 3VFEA 1YY3A 1A5IA 1AE8H 4GUXA 3UQVA 1BMLA 2A32A 1EX3A 1HAZB 2OC7A 2W5EA 2ULLA 2BD5A 1CGHA 1MTSA 1GHAG 1FUJA 1H8HD 1G3DA 1L1NA 4O3TA 5C0UA 3KQBA 5JB9S 2K1QA 4FOUC 5E0HA 3VXEH 1Q3XA 1ZMLA 1SQTA 2XC5A 3URCA 1UTOA 1O2ZA 3DD2H 1FLEE 1C2MA 5HM2A 4IN1A 3LGVA 5ESBA 3SV9A 2F9NA 2F4LA 1GI3A 3LH3A 2FOEA 1C5VA 1P8VC 1PQAA 3KYFA 3A8CA 1O2WA 2PP6A 4Y6DA 1O3NA 2VWLA 1W14U 1C1NA 1T31A 2PKSC 3LKWA 4ZROA 4I8LA 4WMDA 5A8ZA 1F5KU 3RXPA 1C5YB 1G3BA 3KF2A 4B6FA 1P57B 1MQ6A 2ZDKA 3SUDA 1VCWA 2GCHG 2R0LA 5SGAE 4O97A 3AASA 2QY0B 4Y0YE 1NU7B 2BD3A 2SFAA 1W12U 4O9VA 4R0IA 3UY9A 1UVSH 5A0BA 2GZ9A 2ZFQH 4AYVB 1CA8B 1SI5H 1XM1A 1YP9A 4O03A 1HAXB 1A7SA 1O2GH 1QRZA 3SU4A 4YXWD 3SU1A 1XUIA 4K60A 1TGCA 3BEUA 2ZWLH 1O2OA 1J15A 4D7FA 4D9RA 2HLCA 3SV6A 1IQHA 1NBME 1O2TA 1V6DA 2BMGB 1BRBE 1DITH 3RXBA 2FOHA 3LT3A 1H4WA 1FAKH 2A5KA 1XUHA 3MI4A 2D8WA 4YZUA 2FI4E 3SU2A 1YPGH 1BB0B 1SBWA 4B2AA 1EQ9A 2IJOB 2FOAA 2WV9A 2VH6A 1MCTA 2ZTYA 1HBTH 1WDIA 5DJ7A 4GVUA 1HB0B 1S6HA 3LJOA 5DGJA 1C5WB 1DWBH 5JB8S 5C1XA 1GBFA 1CO7E 1P2OA 3FO8D 3MU5A 3ODDA 4JZDH 2XCNA 2UUKB 1A5HA 2VIWA 1VZQH 5E8EH 2Z7FE 3DT0H 1GJAB 1LDTT 1T8NA 2GV6A 1E35B 5DP4A 4A7IB 4P02A 2BOHB 3T25A 2GDDA 1AZ8A 3HGPA 3MFJA 4WXVA 2J38A 1RTFB 1D3QB 1ZHRA 3GCHC 3RXQA 1F92A 2XOKD 3MU1A 1RTKA 3MNXA 3UREA 1DUAA 4X8TH 1NRQH 3RXAA 3W94A 2VH0A 1A0LA 1EJNA 1O31A 2F9VA 1ZRBA 3KYGA 1AN1E 4UDWH 5A09A 3HKJB 2FOGA 5L6NH 1O0DH 4DJZB 1SGFG 3SGQE 4YT7H 4ZKOU 1BTWA 1QGFA 2P94A 4GCHF 3ZV8A 1NS3A 1UTQA 3ZVCA 2M5TA 3W95A 3BF6H 1KY9A 1YCPM 3S9BA 3QO6A 5EW2H 1QBOA 2W3IA 2IJD1 3KEEA 2J5UA 4BTUB 2VGCB 3M7UA 1LHFH 4H42U 1ZLRA 4NSYA 2H9HA 3RXTA 2QYIA 4RKJB 3GY8A 5EXMA 4LXBH 1QL8A 1LQDB 2A2XH 1XKBC 1KLTA 1CT4E 4MNVA 2FM2A 4FUFA 5FXLA 1C2DA 1C1WH 5FAHA 2SGDE 5C17A 1NTPA 3DHKH 2WV5A 1ZTKA 1TFXA 4ABGA 2ZECA 1BTXA 4F48B 5GCHF 4ZHLU 1MTUA 3A7XA 1BRAA 3QN7A 4JCNA 4MNWA 2BYAX 1C5UA 1VGCB 4TY7A 1QQUA 1TNJA 7GCHF 3O8RA 4ABEA 1OWEA 1TPPA 1N6XA 4ABAA 1PFXC 1Q2WA 5FPSA 3ZVDA 1P3CA 3EE7A 1K1PA 1RXPA 1XMNB 1IQIA 3V0XA 1BA8B 1NESE 4X2XA 1AUTC 2VBCA 5L30H 1C1RA 3DSGA 3MH5A 1M9UA 5EOKA 4JYUH 1P3EA 4JYVH 3TK6A 5GPIB 4Z6AH 4GHQA 3M7TA 4NFEA 1ANCA 3UIRA 4UD9H 5HM9A 2XNIA 1C1UH 2OP9A 3GOVB 3TITA 4ISHH 1EAWA 2CN0H 1BRCE 4Y11E 3E90B 3ZVEA 3A89A 1BQYA 1CHGA 3QTVH 2GD4B 3O8BA 1T7CA 1UK3A 2JJ1D 5A8YA 2B7DH 1MTWA 1ANEA 1GHYH 4AX9H 3Q76A 1C9PA 2BVXH 3TK9A 4F49A 3MQKC 4X1QU 3M3TA 1THRH 3EQ0H 4MNXA 3ZZ9A 2GMTB 4RSPA 1V2VT 3ATWA 3RUOA 3STJA 1VJ9U 1S81A 3BEFB 1FPCH 4YOIA 1QA7A 2BY8X 2VU8E 3FN8A 3L3TA 3NK8A 4D76A 4UFEH 3HGNA 3LOXA 1TRMA 4ACAA 3GYMA 5DO4H 2EEKA 1TPSA 2AH4X 4FVDA 4M7GA 1S5SA 1FIZA 3E0PB 3GCOA 1LCYA 6ESTA 1DX5M 1QL9A 3BSQA 4P00A 2AGIX 1C5QA 2TIOA 3ATLA 2ZCKP 1TGNA 1TX6A 1Y5BT 3GDSA 1D4PB 1MH0A 1G9IE 3UNQA 4CH8B 4B73A 1ZGVA 4AGKA 4SGBE 3K6YA 1JRSA 3KCGH 1J8AA 2BDHA 2CHAB 1TE0A 1G2MA 1EOLA 2DE9A 3A7ZA 2ZHWH 4BAQB 1BBRE 1ZJKA 1P03A 2FS9A 2XW9A 1LVMA 4AB9A 1ZSLA 2PR3A 4TSFD 3FOAA 1FMGA 1O5EH 1MU6B 1YLDA 2B5TB 5AFYH 3T5FH 4IS5A 1W7GH 1P09A 2ZPRA 1TGSZ 4FU7A 1KLIH 3P8NA 1ZHPA 4J1YA 5BPEA 1EB2A 4WMFA 4J2YB 4H6TA 2OBQA 2V3MA 1A3EH 1FY3A 1C2JA 2XCFA 3A88A 1LVOA 4B2BA 3TU7H 1XX9A 1S83A 4YO9A 8ESTE 3ZZ5A 1O2RA 3IWMA 1A1RA 5DP5A 3WY8A 2A45B 1O3AA 3WW7A 1GBTA 1BTHH 2OQ5A 2BDGA 1P02A 5CE1A 2QAAA 3ODFA 3PWCA 1D3TB 2OC8A 4MG3A 3LC5A 2GCTC 2BDIA 2GT7A 4X6NA 1HAHH 1HAIH 1TNGA 2VWMA 1EAIA 2UUJB 5DP7A 1EOJA 2BB4A 1FN6A 1TMUH 1ZPBA 3OEHD 4JK6A 3LU9B 2GP9B 1GHBG 3RLWH 3DA9B 1DLEA 1H8IH 5DP8A 3ATIA 4NWKA 3ZZ7A 3O8DA 3O8CA 1O3CA 2D2DA 2A5AA 2JETB 1S84A 3GY7A 1O37A 2V3HH 4FUBA 2FTMA 3F68H 1KTTB 2JIZD 3QLPH 2D26C 3WWFA 1C5RA 1GI5A 3T27A 1OP0A 4AOQA 6CHAC 2PKAA 5EG4A 4CRFA 1DY8A 1SGYE 2WINI 4ZMAH 1D3PB 1YYY1 2GZ7A 2BY9X 2ZA5A 4DW2U 5C67A 1IQEA 1ZMJA 2XC4A 2Q6FA 3TGKE 2RDLA 1Q31A 1FX0B 1FV9A 1PPFE 2IPQX 2PKAB 1F2SE 1V2PT 1WTGH 3VPKA 1EAXA 4Y8ZA 5EXLA 1O2KA 4OS6A 4WY3A 3QZRA 2WSSD 3E16B 3UWIA 1KXEA 2VWOA 1H9LB 1GDUA 1O2SA 1T4VH 2BLOA 2ALVA 1AY6H 5J4QA 4K3JA 1OWHA 5I25A 1ZJDA 3ZYDA 2OQUA 5HIZA 2R3YA 2OCVB 3NCLA 2PTCE 1V2RT 1RD3B 1D9IA 1DY9A 2EI7A 2TGAA 1GMCG 3MWIU 8GCHG 1SQRA 3A82A 2V35A 4DGJA 4FXGH 2BLQA 3P92A 1O2VA 1DS2E 1HNEE 1HFDA 1GJBB 1UTPA 5FL7D 3TH3H 1HAGE 3F9GA 1CVWH 1XUGA 1ZGIA 1ELBA 5F8XA 1PYTD 1ELGA 1VCQA 1Y5UT 2Z3CA 1DWEH 2G4TA 3SNAA 1PPCE 3RLYH 1C4V2 3HPTB 2BDAA 1QB6A 1IOEA 1ARBA 1ELTA 3CS0A 1DFPA 1CHOF 1SGIB 1A2CH 1RIWC 1BCUH 1QNJA 1C5OH 3RDZA 3UQOA 2KAIA 1UJ1A 1XUKA 2G4UA 4O3UA 4X8SH 1ZPCA 5FHTA 1FAXA 4X2YA 4NIYA 1BDAA 2KAIB 3T2NA 2FOBA 3NKKA 3I78A 2ZPSA 1A61H 1AU8A 4FUCA 1Z8JB 1QRWA 3ITIA 1O2PA 5C5OA 1FZZA 1C2HA 1ELDE 1QL7A 5F03A 2AMDA 4WF8A 7ESTE 1SGQE 5KECA 4X6MA 2VJ1A 1UTLM 5AFZH 1FONA 2UWPA 1S6FA 2V7QD 4ABJA 1GBJA 4Q80A 3ZZDA 2FLRH 3C27B 3PLKA 1YPJH 1O2JA 2ZDVH 4HTCH 1ZHMA 1O5AB 1O5BB 4IW4E 3PV4A 4RT1A 3RC4A 2F9PA 1MU8B 1W0JD 2A4QA 3RXUA 1ELEE 2HPQH 4CRDA 4I31A 3Q3YA 5LH8A 1ETTH 3OFND 4ZKSU 3MU8A 3U8OH 2G8TA 3T28A 3V7TA 1COWD 2ZHEH 5I46H 2XNDD 4UFFH 1O3LA 4ASHA 1EFRD 1C1PA 1P9SA 1FXYA 2VIVA 7KMEH 2R0KA 2OD3B 1XUFA 1A46H 2ILNA 1HJAC 1DANH 1HAVA 1W0YH 1C5XB 4XBCA 1NM6A 1PPGE 1BRUP 4VGCB 1GMDF 1D6WA 3FP8E 3KNXA 3OX7U 2BY5X 1DICA 1HAVB 2BTCE 1C1MA 2OC0A 1QTFA 1Y3XA 1V2LT 4CRAA 4KGAA 1CQQA 1OWIA 2BZAA 3RXFA 2FZZA 2KFWA 5GXPA 1L2EA 4RKOB 1AVXA 1CSOE 2BDBA 4A92A 1K1MA 1Z8IB 1IHSH 5FPYA 3GCTF 4AORA 1GMHF 4CHAC 4D7GA 1V3XA 3SNCA 1UCYE 1MKXH 2KX4A 3ZZBA 5EQQA 1SVPA 5A0CA 4ZXYH 1E1QD 3SGAE 3E91A 3U8RH 2FTLE 2W26A 3RXGA 3RU4T 1KXAA 1TNIA 2PKSB 1HAYB 1GVZA 1N8OC 1Z1JA 5LPRA 1EUFA 2QV1A 3GS9A 2OLGA 2H9EH 4INKA 1F0SA 1N6YA 1S6LA 1F0RA 2XYAA 2FOMB 3LJJA 2GV7A 2GVFA 3CNRA 3EAJA 4XRNA 3BG8A 3SV7A 2NU0E 2F9UA 2FO9A 4UONA 2O8TA 4ABHA 3GY5A 5EODA 1ZPZA 2NU4E 5C1UA 5CMXH 1W8BH 3Q77A 2WYGA 4MNYA 3VGCC 1ELCA 2H2ZA 3ZVAA 3SU5A 2FPZA 4ISIH 1K22H 1MABB 2TGPZ 4IBLH 2WPMS 2Q1JA 1NFWA 3LGTA 2F9BH 1UK4A 1X7AC 1ZZZA 1ORFA 2L74A 4BNRA 2I6QA 1EATA 3I29A 1JRTA 1ABJH 1NU9A 1CA0C 1ESBA 2M2AA 3RP2A 1MKXK 3SUGA 2FMJA 1QZ8A 2BQ7B 3QUMP 1IQJA 2HALA 4E06H 1TONA 3KGPA 2KCYA 1FPHH 1QFKH 2A7JA 3GY2A 4A5TS 3ZZ8A 1FN8A 3T62A 1VITH 1V2TT 4MQAA 1V2WT 1AGJA 5CHAC 3SBKA 5BRRE 1F5RA 1TRYA 1FDPA 2Z9KA 1RTLA 3ZV9A 4FVBA 4ABFA 3A80A 2Q6GA 1Y3UA 3S7HB 2CGAA 4NA7A 1K0HA 1TMBH 1SPJA 4JZIA 2R3UA 4D9QA 1T4UH 1Y3VA 1AMHA 1GG6C 1UTKA 1LHCH 1PPEE 5C20A 1TOCB 2AGGX 4Y10E 4AB8A 1EPTC 3TIUA 1TPOA 3GY4A 3A7YA 1AVWA 2ZC9H 1TMTH 4LOYH 1SFQB 3RXDA 2ZP0H 2PSXA 3PLBA 3L6PA 1TABE 1LPGB 2VINA 3KQCA 2QF0A 4Y76A 2W6JD 1OP2A 3U1JB 1NRNH 3MOCA 3SZEA 5PTPA 4CREA 4ZKRU 4AN7A 3OU0A 2R2WU 1KXDA 2P8OC 1O33A 1MUEB 1TNLA 4DURA 2GT8A 2PFEA 1FJSA 1HGTH 2QGRA 3GDVA 5T6GA 4ISLA 1J16A 2ZZUH 3H7TA 1J14A 2R9PA 2V6NA 5T1VA 3S7KB 2EC9H 3TVJB 3H7OA 3UNSA 1IHTH 2CV3A 2KZ4A 3HATH 4I8HA 2FOCA 2ZQ1A 1P2KA 3MU4A 1CGJE 1P0SH 4R8TB 2Y7ZA 1GJ9B 1YWUA 3G01A 1AE5A 1FNIA 4INLA 2P3TB 1W2KH 1C1TA 3SJOA 3OE7D 5H4IB 1TWXB 3RXKA 1C2IA 4AG2A 1L1JA 4Y8XA 3K65B 4ACBA 4KTUA 1F0TA 5ABWA 2TRMA 2GDEH 3H09A 4MLFB 2BX3A 3F6UH 1AI8H 1O3JA 1F5LA 1TAWA 2H6MA 1O3DA 2QF5A 3ZVGA 4HG6A 3SZNA 1UVPA 1C4Y2 4KELA 1YKTA 1KXCA 5JYIA 1O3MA 2PUXB 5EXNA 1ELAA 1F7ZA 2ZFRH 1O3EA 4XDEA 4B74A 4NZQA 2AMQA 5EU8A 3VG8A 3RC6A 1ESAA 3ATKA 2ZKSA 4JMYA 3OSYA 1NZQH 1L0ZA 2W7SA 4WWYA 1HJ9A 2BXUH 1TBQH 1B0EA 2G55A 3BIVH 3SQHE 2UWLA 4JZFH 1O3GA 4WVPE 1O5DH 5IYTA 3F9HA 1O38A 2C4FH 1NROH 3MYWA 4WXIA 1THSH 2P3FH 3V12A 1W13U 4AC9A 3U8TH 4BXSA 2J95A 4E7RG 4GCHG 1WAYB 4BAMB 1Y5AT 3AVZA 1BBRK 1Y8TA 1GBMA 2QXJA 1L4DA 2ZG0H 4U32A 2J98A 3FKSD 2BVSH 2Y5GA 3A7TA 1HYLA 4WH6A 5DP3A 3A81A 1SLWB 3KIDU 3BTFE 2LP6A 1CBWB 4GHTA 1EZUC 1MTVA 5T6DA 4B71A 4OS7A 1ZOMA 2J98B 4Y79A 3PRBA 3PTNA 2WV4A 3SGBE 4YLUA 2P59A 2FWWA 2XXLA 3RC5A 4ASUD 4Q63A 1GJCB 1E34B 1ELVA 5GCHG 1TNKA 5JPMH 1MZAA 4KTCA 2G5VA 4YT6H 1P2JA 3M37A 1XKAC 4BANB 1ARCA 2ALPA 1AKSB 1EAUA 3UNRA 4ZAEA 2WUBA 4NA8A 5AF9H 1ZYOA 2J4IA 3NPSA 1DLKB 1QJ7B 1AVGH 1GWAA 3RMLH 2VVCA 4QT8C 1PPZA 2XBVA 3N7DA 1V2JT 1VITF 2RCEA 2Z94A 1AB9C 4TPYA 1TX7A 1BZXE 1GHVH 1YLNA 3HK3B 2SGFE 1U6QA 1FQ3A 1ZSKA 1UVTH 4X6OA 4X6PA 5EJLA 3SYJA 1HIAA 3VB5A 3AK5A 1HAOH 4Q7ZA 1J17T 7LPRA 1O2UA 1HIAB 2C8ZB 1ETSH 3OTPA 3TGIE 3UUZA 2VVUA 4CR5A 3RM0H 3B8JA 2HRVA 1PQ8A 1K9OE 3C1KA 1O3BA 1DUEA 3MTYA 1GHZA 2O9QA 4MVNA 2AIPA 2LNCA 1DWCH 1C4U2 3LC3A 3Q3KA 1EZXC 1QBVH 3MNSA 2EA3A 5DKMA 1BTYA 1O3IA 2FOFA 1J9CH 1GI0A 2FP7B 2UWOA 4KKDA 2H1UA 1O2MA 6CHAB 1EJAA 1GBDA 2Z9IA 3P70B 3SUFA 3QWCH 1THPB 1HAPH 3ZYEA 2H5CA 2SNWA 4NFFA 3FFGA 1AWFH 3KQDA 5HIYA 1NBMD 2HNTF 2FEQH 3RMNH 1TA6A 1YC0A 1VGCC 2ZDLA 2HVXA 4XD7D 2PGBB 1P11E 1NO9H 2Y5HA 3QGNB 4DIIH 2GKVE 1UHBA 5KEDA 2ZEBA 4B75A 1SHYA 2LPRA 1NY22 4CH2B 1DXPA 3BTDE 5C3NA 2CJIA 3CS7A 1DSUA 1ZMNA 2RDEA 1UVUH 2ZGBH 3UR9A 4X1RU 1H9HE 1UHBB 3LH1A 3BTGE 1BMAA 3TJOA 5CHBA 4LZ4B 4UFDH 1HXEH 2BLVA 1K1OA 4F55A 1LKBA 2C90B 5KGOA 3PMAB 2HOBA 3PV2A 2ODPA 2P16A 1C2EA 2ZGHA 3MMGA 1GJ5H 2ZPQA 3PO1B 1INCA 1HJ8A 3SI4H 4Q2KA 1T8LA 2PUQH 2ZQ2A 4I33A 2BX4A 3S9AA 3TH2H 6GCHG 4MDSA 3BTWE 4GSOA 4X1SU 4A1VA 4U01A 3MO9A 3LGUA 4FUHA 2V0BA 1KMHB 1GBBA 2A7HA 4K69A 2GMTC 3D49H 5GIBA 3PMHB 1VJAU 5F53A 5LPEA 1KDQB 1ELFA 1GDQA 4CRBA 2G5NA 4NGAH 2CXVA 1A0HB 3RXIA 3P17H 4AFZA 5CDFE 1AHTH 1T8OA 3GY3A 3UWJH 1NFXA 2QCYA 1ABIH 1K28D 1B0FA 4BAHB 4LK4A 1W10U 3EYDA 5K0HA 4RI0A 4UFGH 3ELAH 3GISB 1ZSJA 3DUXH 2W3KA 5C1YA 2ZU5A 1SOTA 3BG4B 1UVOA 1WCZA 4ESTE 4YLQH 1G32B 3TGJE 1AFEH 3SI3H 1L1GA 3MHWU 2WYJA 4TPIZ 4DIHH 1VR1H 1TALA 1BMMH 2P93A 1QCPA 1GI9B 2KM0A 1CE5A 3E8LA 2GZ8A 3N7EA 5E0JA 4PROA 1DWDH 2ASUB 2XRCA 3CP7A 1KXBA 2EQNA 3BTQE 4B1TA 3U28C 2AIQA 5EPNA 4FU8A 8GCHF 1P2MA 1TA2A 4THNH 5FCKA 9LPRA 1MAYA 3DFJA 1C5NH 6LPRA 1MKWK 4DY7B 3ATMA 3HK6B 2QF3A 2A7CA 2ZI2H 4K1SA 1NFYA 4AG1A 1SGTA 1SGFA 2J97A 1HV7A 3EE0B 5E2PA 1MBMA 2PSYA 3ZIAD 3VEQB 4NIXA 1UCYK 1GCTB 3GDUA 1TGBA 1C5SA 4HFPB 3PB1E 3AW0A 3M5MA 3MO3A 1UW7A 1IQGA 3ESTA 1WQSA 3TPIZ 1GGDC 3M5OA 2F91A 3TJNA 3TNSA 2SGQE 1TNHA 1K21H 2ODYB 1OYTH 2VIDA 4X8UH 4XBDA 2XBYA 1QJ1B 1XXFA 1JBUH 1IQLA 1LKAA 3M36A 2ZTXA 2QN5T 3OEED 1OSSA 2Y81A 2AHME 1B5GH 2WPIS 3PMBB 4A1XA 3FZDA 1OOKB 1AFQC 2BVRH 5F8TA 2RA3A 5TJXA 1BJUA 3PM3A 2BY6X 2XWBI 2TGDA 2CF9H 3M5NA 3P8OA 1YPHC 1H8ED 3LONA 1TQ7B 3FVFB 1C5ZB 2KCAA 2STAE 2HGTH 2P95A 1QB9A 5JBCS 4I8GA 2HPPH 2IN2A 2OINA 2FLBH 5T3HA 5G4BA 3SUEA 1V2MT 3R3GB 4OM9A 4WJG2 3VGCB 2J9NA 3L33A 1DVAH 2KCPA 3SU3A 1QRXA 3RXJA 1AIXH 1O3PB 4NWLA 1LQEA 3P8FA 2I6SA 1EJMA 1N1LA 3RU4E 3ZVFA 1NRRH 3TLOA 1FIWA 1CA0B 3KN2A 3SJ9A 2FX6A 4FUJA 2VIPA 1W11U 1O5CB 1GI7B 2IOTA 1ESTA 1H1BA 2KCOA 2VVVA 4X2VA 1GBLA 3DSPA 3UPEA 3URDA 1XUJA 1EKBB 4NG9H 1GMDG 2ZF0H 1TGTA 3E3TA 2BLWA 3BTTE 1TPAE 1BTUA 1MTNC 1Y3WA 2J34A 2ZU1A 3EA9A 1BMFD 1S0QA 1CT2E 2VB0A 4Z1MD 2F9OA 3STIA 3SW2B 2Y82A 1GJ6A 4KP0A 5FX5A 2Q6DA 1EPTA 2G00A 3GCTG 4HI3A 5HMAA 1GMHG 5JBBS 3UB0A 1UO6A 1P9UA 1WBGB 1O2IA 4AZ2B 2WHXA 1K1JA 1FY4A 1EPTB 3CENA 1S0RA 1AO5A 4IC6A 1P2IA 1WTHD 2PTNA 3N99A 2WPHS 4I86A 4Q4LA 5JBTA 3W1EA 1OPHB 2K8IA 1O3KA 3OTJE 3ZZ3A 4FUDA 4TYDA 3E0NB 4H6SB 5EQSA 4B76A 3KQ5A 3BIUH 1XVOA 2BD7A 1V2UT 2A31A 2BD4A 1GVKB 3PWBA 4CBNA 4KTSA 1IAUA 2YMSC 3BEIB 3TK5A 1SG8B 1O3OA 1CU1A 3LGYA 2HWLB 5GWZA 1SGRE 3F0PA 1GHXH 1HLTH 1MCVA 3M3VA 3RMOH 2O8LA 3LDXH 5C94A 1GJ4H 2AMPA 2FI3E 3M7QA 1LTOA 4FETA 3GCNA 2CF8H 2GJGA 2OUAA 1TQ0B 3OY5U 1BMNH 4BAOB 3D23A 2EI8A 1GHAF 3GY6A 3MH7A 4XSKU 5FPTA 1V2KT 2ZTZA 5FX6A 4OS1A 1W7XH 1VCPA 2ZHQH 4XOJA 1JOUB 1SLVB 1GI2A 4TWWA 2VNTA 2XWAA 5EW1H 4VGCC 2JKHA 1ACBE 5F8ZA 1OS8A 1WUNH 1P04A 3SHCH 1DSTA 1PYTC 1O2YA 1P06A 1G37A 1O3FA 2O8UA 4TWYA 4XFQA 2A4GA 2TBSA 2O8MA 3OY6U 3PROA 5TCAA 1EASA 3GCHB 1NFUA 1ETRH 2Y80A 3A83A 1TBZH 2HVYB 4UE7H 1E1RD 1HXFH 1O35A 2ODQA 2GCHF 4DT7B 3M61U 2ANWA 2G51A 1K2I1 2FXRA 1GPZA 2H5DA 1ANDA 1MZDA 2XTTB 1BITA 4Y7AA 1Y3YA 4YM9A 2BD9A 5F6MA 1IQKA 5K7RA 1IQNA 1O5GH
chains in the Genus database with same CATH topology
2OBOA 1GL1A 4DVAU 1E0FD 3DFLA 2HNTC 1OWKA 1HPGA 4NIVA 1YPHE 4JK5A 2YOLA 2QXGA 3FZZA 3KQEA 2B0FA 5LPFA 1GJDB 1BJVA 2NWNA 1AQ7A 1E36B 1GBEA 2QIQA 4WMEA 1HDTH 2XBXA 1YBWA 4K2YA 3ZZCA 2FI5E 4GAWA 2BZ6H 2THFB 4Y7BA 1ZR0A 3MH4A 4AFUA 1C5MD 2CMYA 4K1TA 4JYTA 1PQ7A 3HKIB 1SGNE 5J4SA 1BBRH 4ZHMU 1OXGA 1RGQA 1C2GA 2ZCLP 3SO3A 1WSSH 3BTHE 2C8XB 3RXRA 3U9AH 5L2ZH 3OYPA 4AFSA 2H9TH 3RU4D 1BUIA 1XXDA 1YM0A 1MQ5A 2EI6A 1O34A 2ZDAH 4SGAE 2ZGJA 2Y5FA 5GJ4B 1O2QA 1SGDE 3A86A 3MNBA 2Z9LA 1P05A 3A8AA 2FX4A 1PJPA 1C9TA 5EPYA 3PMJA 3EGKH 2BD2A 1D3DB 2BDYA 1ID5H 2BD8A 1AB9B 4OS4A 3MNCA 1LO6A 1DPOA 1AZZA 1KXFA 1TOMH 2G81E 3P6ZB 5TCCA 3MU0A 2F3CE 1ZTJA 1KSNA 2FYRA 2AERH 2RA0A 1TIOA 4ISNA 1A0JA 4MPXA 5ESTE 2QXHA 1C5LH 2QXIA 3BTEE 4I8KA 4BOHA 3S0NA 1SLXB 2AGEX 4TY6A 1TB6H 2Z9JA 1SGPE 1O30A 5DPAA 3T26A 3A7VA 3B9FH 1ANBA 3R0FA 2ZFTA 4YESB 4LZ1H 4A6LA 2AS9A 2QA9E 1OWJA 1HRTH 3SU0A 1P2QA 4Q7YA 1E38B 3UOPA 1GJ7B 1Z71A 3TJVA 2ANMH 3M3SA 2BY7X 3N7OA 4NSVA 4NCYA 3SNEA 2B8OH 1Z8GA 1K1LA 1RS0A 1TYNA 3EA8A 2ANKH 3RXMA 5JBAS 2PLXA 1OP8A 1BHXB 4FU9A 2ESTE 2RG3A 3A8BA 2Z3DA 1AKSA 1BTZA 4F4OC 2FIRH 1DDJA 3EDXB 2PHBA 7GCHG 4HGCA 2A0QB 1TX8A 4X8VH 2WPKS 1AD8H 1SB1H 3E1XB 1AWHB 1EXFA 5FBIA 1GCDA 4FUEA 1O3HA 3D62A 2PGQB 1GBHA 3K2UA 2FODA 1JIMA 3AAUA 4IMZA 1O32A 1TRNA 3LGIA 1BTPA 2BM2A 1LPZB 3SHAH 3ZZ4A 4X1NU 1DXWA 3FAOA 2FS8A 3F1SB 1ZTLA 2B9LA 4ISOA 1LPKB 4Y8YA 2QC2A 2OTVA 2BHGA 1VITG 2NU2E 3A84A 1SQAA 1MBQA 3JZ1B 4XBBA 1AUJA 4FUGA 2TGTA 1Y59T 1C2LA 2GCTB 1GI6A 1GL0E 1CT0E 3BTME 5DP6A 4CRGA 4DG4A 4ABBA 1C1SA 1T32A 5C5NA 1LVYA 2ZIQH 3RXCA 1SHHB 2F83A 3UR6A 2AYWA 3Q00A 3F9EA 2Z3EA 2VGCC 1KTSB 4AGJA 2VIQA 3QX5H 3NWUA 4JZ1A 1L4ZA 1PPBH 1QB1A 2VWNA 3UFAA 2HNTE 3UTUH 5LGOA 2J92A 5T6FA 1JIRA 1HUTH 4ABDA 2A2QH 1QQ4A 1OYQA 4K5ZA 5DG6A 4IMQA 3TNTA 1PQ5A 1LVBA 3QDZB 4XE4A 1C5TA 5A2MH 5ETXA 5E0GA 1QIXB 1F0UA 2GTBA 1CBWC 8LPRA 1QBNA 2STBE 2ZO3H 3BTKE 5C2ZA 1GBCA 1O2XA 2A1DB 4NZLA 1MD7A 4CR9A 5AHGH 2W7UA 4INHA 4I32A 4ZUHA 3BN9A 1SMFE 1NRPH 1E37B 1PPHE 3Q3XA 1KIGH 1SFIA 2BQ6B 1G30B 4FUIA 1EB1H 5A8XA 1C1QA 1UTMA 8KME2 1D6RA 2ZCHP 1C1VH 1P2NA 3F9FA 3PYHA 5HGGA 1V2QT 4X1PU 1H8DH 4YOJA 4MPUA 4AYYB 3SV8A 2WUCA 3RXHA 1OWDA 2WPLS 2Y6TA 1V2OT 3QZQA 3VB4A 1SC8U 1Z7KA 2VIOA 4U2WA 5HXFA 3KL6A 9ESTA 1WYKA 1SGEE 4DOQA 1IQFA 1BIOA 1O2LA 4K8BA 1TLDA 1G3EA 4BTTB 2SGEE 2DUCA 3FP7E 3LGWA 4X2WA 2DE8A 1DM4B 2ZHFH 4E05H 1JMOH 1GHBF 1KDQA 6GCHF 2FYQA 4X0WU 3UOUA 1RIWB 3E6PH 5E2OA 4E7NA 1NT1A 2JH0D 1FY1A 2UUYA 3RXOA 2ZDMA 2ZU4A 1GHWH 1EP5A 2C3SA 1MKWH 4AFQA 1GGDB 2ZFFH 4H4FA 3PLPA 3ZZAA 1LHDH 1K1NA 5B6OA 1YF4A 4K1EA 4Z0KA 3B23B 1YPLH 1LHGH 1P12E 2XC0A 4ZKNU 1GVLA 3A85A 1A3BH 1UCYH 1DOJA 4A1TA 1TBRH 1WQVH 2OXSA 3QTOH 2ZFPH 2CHAC 1SSXA 3SNDA 5DP9A 1AFQB 3S69A 4UEHH 2YNBA 1MD8A 2BDCA 3SV2H 5GDSH 1YPEH 3TH4H 2Y7XA 2ZNKH 2PW8H 3TJUA 1SLUB 4B2CA 2SNVA 1O36A 5JDUB 4ZXXH 3EA7A 1GMCF 2J94A 1GI1A 3K6ZA 2ZGXH 1XVMA 3SN8A 1RJXB 1A5GH 1JXPA 2V3OH 1FY8E 3IITA 4OGYA 4Q7XA 3NZIA 1O2HA 1DE7H 3ZZ6A 3S9CA 2SGAA 2YNAA 5DK1A 1O39A 2D1JA 1HJAB 1Z1IA 1YPMH 1WU1A 1FY5A 5A0AE 1DT2A 1QY6A 2G52A 1MMJN 1SQOA 3RXVA 4HZHA 3V3MA 3PO1C 2ANYA 1QHRB 2ZFSA 3A7WA 4Y0ZE 1O2NA 3V13A 1CHOG 3SNBA 1Z6JH 3T29A 3K9XB 4YOGA 3FP6E 4BTIB 5EGMA 3SJKA 3PTBA 1MTNB 2JETC 3QK1A 3QGJA 1QURH 1QR3E 2JH6D 3ZVBA 5IDKA 3FANA 4CHAB 1YPKH 1KLJH 3P8GA 1BT7A 3LIWA 3A87A 4OS5A 3VB3A 3IG6B 1WOFA 1GDNA 1RFNA 1B7XB 3M5LA 3BV9B 4GLYA 1GI4A 1N8OB 2NU3E 2ZDNA 4WH8A 3RXEA 4IGDA 4I7YH 3H5CB 4ZHAA 3RM2H 3U69H 2P3UB 3SOSA 3LPRA 1P10A 5EQRA 1MAXA 3A8DA 1C5PA 1ZRKA 1K1IA 3BG4C 3VXFH 3SJIA 4CBOA 4Y71A 3NUMA 5HYOA 2ZU3A 3P95A 1GBKA 4OGXA 3RXSA 3JZ2B 1Z8RA 3RXLA 4D8NA 1UTJA 4YTAA 1GJ8B 3MO6A 1LMWB 1G36A 1LHEH 2GX4A 3SJ8A 1SR5C 3GYLB 1A4WH 1IQMA 1EP6A 1G3CA 1BHXF 1YCPH 2BQWB 1GBAA 2BXTH 4JZEH 2FDAA 1G2LA 4CRCA 3AAVA 1KYNA 4RN6A 2FESH 3ENSB 2OC1A 1NRSH 1GI8B 1SL3A 2ZHDA 2XBWA 3VB7A 3I77A 2IPHA 4BAKB 4NIWA 2NU1E 2O8WA 3NXPA 5CHAB 1EZQA 4IN2A 1GCTC 4MPVA 5FCRA 2J2UA 2PWXA 1OKXA 3GICB 2R2MB 1FI8A 1YLCA 1UTNA 3AW1A 2JH5D 1BOQA 1GG6B 1UMAH 3KHVA 1NPMA 1V2ST 3U1IB 3M35A 1C2FA 2A4RA 2AEIH 1P01A 1S82A 1NN6A 3MH6A 4ABIA 4BXWA 4GPGA 2C93B 1YCPK 2BOKA 3U98H 3SQEE 2A5IA 3VB6A 1W3CA 2C8YB 2AFQB 2ZGCA 4MTBA 1W0ZU 1GBIA 1JWTA 2UUFB 1Z6EA 2C8WB 1C2KA 1CGIE 2PV9B 4IC5A 2SGPE 4I8JA 1SOZA 2TPIZ 2Z6BD 4U30A 1RRKA 5AVDA 2P8OB 1YGCH 4DCDA 1OX1A 1NC6A 2Z9GA 4K8YA 1O5FH 4OS2A 1V2NT 5L2YH 1UK2A 1C1OA 1EZSC 1WV7H 1SGCA 3D65E 1HCGA 5FBEA 3SU6A 1QJ6B 2GGVB 1S85A 2ZU2A 4MPWA 1QA0A 3RMMH 4NA9H 4ZH8A 2WPJS 1T8MA 2A4OA 1H9IE 3SORA 3VFEA 1A5IA 1AE8H 4GUXA 3UQVA 1BMLA 2A32A 1EX3A 1HAZB 2OC7A 2W5EA 2ULLA 2BD5A 1CGHA 1MTSA 1GHAG 1FUJA 1G3DA 1L1NA 4O3TA 3KQBA 5JB9S 2K1QA 5E0HA 3VXEH 1Q3XA 1ZMLA 1SQTA 2XC5A 3URCA 1UTOA 1O2ZA 3DD2H 1FLEE 1C2MA 5HM2A 4IN1A 3LGVA 5ESBA 3SV9A 2F9NA 1GI3A 3LH3A 2FOEA 1C5VA 1P8VC 1PQAA 3A8CA 1O2WA 4Y6DA 1O3NA 2VWLA 1W14U 1C1NA 1T31A 2PKSC 3LKWA 4ZROA 4I8LA 4WMDA 5A8ZA 1F5KU 3RXPA 1C5YB 1G3BA 3KF2A 1P57B 1MQ6A 2ZDKA 3SUDA 1VCWA 2GCHG 2R0LA 5SGAE 4O97A 3AASA 2QY0B 4Y0YE 1NU7B 2BD3A 2SFAA 1W12U 4O9VA 4R0IA 3UY9A 1UVSH 5A0BA 2GZ9A 2ZFQH 4AYVB 1CA8B 1SI5H 1XM1A 1YP9A 4O03A 1HAXB 1A7SA 1O2GH 1QRZA 3SU4A 3SU1A 1XUIA 4K60A 1TGCA 3BEUA 2ZWLH 1O2OA 1J15A 4D7FA 4D9RA 2HLCA 3SV6A 1IQHA 1O2TA 1V6DA 2BMGB 1BRBE 1DITH 3RXBA 2FOHA 3LT3A 1H4WA 1FAKH 2A5KA 1XUHA 3MI4A 2D8WA 4YZUA 2FI4E 3SU2A 1YPGH 1BB0B 1SBWA 4B2AA 1EQ9A 2IJOB 2FOAA 2VH6A 1MCTA 2ZTYA 1HBTH 5DJ7A 4GVUA 1HB0B 1S6HA 3LJOA 5DGJA 1C5WB 1DWBH 5JB8S 5C1XA 1GBFA 1CO7E 1P2OA 3MU5A 3ODDA 4JZDH 2XCNA 2UUKB 1A5HA 2VIWA 1VZQH 5E8EH 2Z7FE 3DT0H 1GJAB 1LDTT 1T8NA 2GV6A 1E35B 5DP4A 4A7IB 2BOHB 3T25A 2GDDA 1AZ8A 3HGPA 3MFJA 4WXVA 2J38A 1RTFB 1D3QB 1ZHRA 3GCHC 3RXQA 1F92A 3MU1A 1RTKA 3MNXA 3UREA 1DUAA 4X8TH 1NRQH 3RXAA 3W94A 2VH0A 1A0LA 1EJNA 1O31A 2F9VA 1ZRBA 4UDWH 1AN1E 5A09A 3HKJB 2FOGA 5L6NH 1O0DH 4DJZB 1SGFG 3SGQE 4YT7H 4ZKOU 1BTWA 1QGFA 2P94A 4GCHF 3ZV8A 1NS3A 1UTQA 3ZVCA 2M5TA 3W95A 3BF6H 1KY9A 1YCPM 3S9BA 3QO6A 5EW2H 1QBOA 2W3IA 3KEEA 4BTUB 2VGCB 3M7UA 1LHFH 4H42U 1ZLRA 4NSYA 2H9HA 3RXTA 2QYIA 4RKJB 3GY8A 5EXMA 4LXBH 1QL8A 1LQDB 1XKBC 2A2XH 1KLTA 1CT4E 4MNVA 2FM2A 4FUFA 5FXLA 1C2DA 1C1WH 5FAHA 2SGDE 1NTPA 3DHKH 2WV5A 1ZTKA 1TFXA 4ABGA 2ZECA 1BTXA 5GCHF 4ZHLU 1MTUA 3A7XA 1BRAA 3QN7A 4JCNA 4MNWA 2BYAX 1C5UA 1VGCB 4TY7A 1QQUA 1TNJA 7GCHF 3O8RA 4ABEA 1OWEA 1TPPA 1N6XA 4ABAA 1PFXC 1Q2WA 5FPSA 3ZVDA 1P3CA 1K1PA 1RXPA 1XMNB 1IQIA 3V0XA 1BA8B 1NESE 4X2XA 1AUTC 5L30H 1C1RA 3MH5A 1M9UA 5EOKA 4JYUH 1P3EA 4JYVH 3TK6A 5GPIB 4Z6AH 4GHQA 3M7TA 4NFEA 1ANCA 3UIRA 4UD9H 5HM9A 2XNIA 1C1UH 2OP9A 3GOVB 3TITA 4ISHH 1EAWA 2CN0H 1BRCE 4Y11E 3E90B 3ZVEA 3A89A 1BQYA 1CHGA 3QTVH 2GD4B 3O8BA 1T7CA 1UK3A 5A8YA 2B7DH 1MTWA 1ANEA 1GHYH 4AX9H 3Q76A 1C9PA 2BVXH 3TK9A 4F49A 4X1QU 3M3TA 1THRH 3EQ0H 4MNXA 3ZZ9A 2GMTB 4RSPA 1V2VT 3ATWA 3RUOA 3STJA 1VJ9U 1S81A 3BEFB 1FPCH 4YOIA 1QA7A 2BY8X 2VU8E 3L3TA 3NK8A 4D76A 4UFEH 3HGNA 3LOXA 1TRMA 3GYMA 5DO4H 2EEKA 1TPSA 2AH4X 4FVDA 4M7GA 1S5SA 1FIZA 3E0PB 3GCOA 1LCYA 6ESTA 1DX5M 1QL9A 3BSQA 2AGIX 1C5QA 2TIOA 3ATLA 2ZCKP 1TGNA 1TX6A 1Y5BT 3GDSA 1D4PB 1MH0A 1G9IE 3UNQA 4CH8B 4B73A 1ZGVA 4AGKA 4SGBE 3K6YA 1JRSA 3KCGH 1J8AA 2BDHA 2CHAB 1TE0A 1G2MA 1EOLA 2DE9A 3A7ZA 2ZHWH 4BAQB 1BBRE 1ZJKA 1P03A 2FS9A 2XW9A 1LVMA 4AB9A 1ZSLA 2PR3A 5AFYH 1FMGA 1O5EH 1MU6B 1YLDA 2B5TB 3T5FH 4IS5A 1W7GH 1P09A 2ZPRA 1TGSZ 4FU7A 1KLIH 3P8NA 1ZHPA 4J1YA 5BPEA 1EB2A 4WMFA 4J2YB 4H6TA 2OBQA 1A3EH 1FY3A 1C2JA 2XCFA 3A88A 1LVOA 4B2BA 3TU7H 1XX9A 1S83A 4YO9A 8ESTE 3ZZ5A 1O2RA 3IWMA 1A1RA 5DP5A 3WY8A 2A45B 1O3AA 1GBTA 1BTHH 2OQ5A 2BDGA 1P02A 5CE1A 2QAAA 3ODFA 3PWCA 1D3TB 2OC8A 4MG3A 3LC5A 2GCTC 2BDIA 2GT7A 4X6NA 1HAHH 1HAIH 1TNGA 2VWMA 1EAIA 2UUJB 5DP7A 1EOJA 2BB4A 1FN6A 1TMUH 1ZPBA 4JK6A 3LU9B 2GP9B 1GHBG 3RLWH 3DA9B 1DLEA 1H8IH 5DP8A 3ATIA 4NWKA 3ZZ7A 3O8DA 3O8CA 1O3CA 2D2DA 2A5AA 2JETB 1S84A 3GY7A 1O37A 2V3HH 4FUBA 2FTMA