1XUFA

Trypsin-babim-zn+2, ph 8.2
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Serine protease
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xufA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xufA02
2QA9E 1QY6A 2RDLA 1T32A 4D7FA 3MU1A 3M5LA 4CHAB 1TGBA 4Y8XA 4INKA 1O3IA 5IYTA 1GBFA 2IJOB 3BTDE 1GJBB 1W0ZU 4AFUA 4LZ4B 5EQSA 2ZGHA 1MTNC 1AFQB 3U98H 1OWEA 3L33A 3HPTB 3DUXH 1UTKA 2O9QA 1T4VH 3MFJA 3LGTA 4UE7H 3RM0H 3L3TA 1MCTA 4AORA 4F4OC 2BZAA 1A4WH 1T8OA 1GMHF 3A7TA 3E1XB 1DVAH 1T31A 2Z94A 1SLWB 1TNHA 1GI9B 2GCTB 1NRSH 2XBYA 3NUMA 2QIQA 4OS5A 1DANH 1TIOA 1JMOH 1GVKB 1MKWK 2QXIA 5GIBA 1GPZA 1BTPA 5A8XA 1GBEA 4YOGA 1F2SE 4H4FA 1C9PA 4ISOA 2ZDAH 1BHXB 2R3UA 2ZHDA 1O3GA 3M5NA 3BTKE 5A2MH 1KXCA 2Y5HA 2KAIB 5DK1A 1AU8A 1HJAC 4R0IA 1HB0B 1ZJDA 5DGJA 1GI7B 1Y3YA 1ELEE 3ZYEA 2UUYA 3A89A 1SGQE 3M3VA 1OP0A 3OY5U 3A8BA 1TPAE 3IITA 3BIVH 2Z6BD 3RXDA 1H8IH 1YKTA 2ZGBH 4O9VA 2PHBA 3RXAA 5TCCA 2XWBI 3SJOA 1XVMA 3RUOA 2ZNKH 1QQUA 1YPLH 1TLDA 3ENSB 2XRCA 2NU1E 2OQ5A 4CREA 1AQ7A 1IQFA 1IQNA 3A81A 4ZUHA 3SUEA 3MHWU 1GBCA 2ZGXH 3GY2A 1SVPA 4X1NU 1TNLA 3RXMA 4X8VH 3H7OA 1J16A 1EZUC 3QUMP 1A3BH 1WYKA 4D76A 1EAXA 1Z6JH 3Q77A 6CHAC 1TRYA 1YBWA 3MH6A 3A7VA 1SSXA 1D3QB 1HV7A 1RFNA 4OS1A 1F7ZA 4TPIZ 2FS9A 6ESTA 1MTVA 4WMFA 2BY9X 1Z8RA 1TBRH 4IMZA 2B0FA 3E90B 2VWMA 4E05H 1SPJA 1G9IE 1ORFA 2RA0A 3EA7A 1GVLA 1LHDH 1RRKA 1TX7A 2J38A 1J8AA 2PUQH 2PR3A 1XKBC 1TRNA 2NU3E 1BRUP 3SNCA 1AVGH 1K22H 1N6XA 4U01A 1G3CA 1DWCH 1NFUA 2BLWA 3RMOH 3RXBA 4AB8A 1EPTA 1B7XB 5DP5A 1C5ZB 2PKSC 3CS7A 1MAXA 1MTSA 4FUIA 3V13A 4LK4A 3Q3XA 1O2ZA 1TX6A 2VB0A 3EE0B 1U6QA 1FAKH 2V3OH 1C9TA 1QJ6B 2GDEH 1BITA 2LPRA 3AASA 3QK1A 4KTUA 5EW2H 1IOEA 1O2GH 2VIPA 4M7GA 4MNVA 1P11E 1A5HA 5EPNA 3T26A 1YCPH 1BBRK 1Q2WA 2OTVA 3E6PH 3MH4A 3RU4D 2ZTXA 2CGAA 1J14A 1O2IA 1VITG 2FEQH 1O2HA 3NPSA 4WF8A 2BVRH 2I6QA 1NS3A 2RA3A 4H6TA 3ZV8A 4CRBA 4K69A 1ESTA 1C4V2 5AFYH 4NIVA 1YLDA 2ZI2H 1O3PB 4I32A 2BLQA 1V2OT 1HPGA 1LKAA 3UQOA 1C5PA 1DLEA 2HALA 1AN1E 1O2TA 4RN6A 5AVDA 1LTOA 5DO4H 3RXTA 2FESH 1QIXB 2CF9H 1JRSA 1MH0A 1OOKB 1GHAF 2VIQA 3P8GA 2WPHS 2ALPA 4FU7A 4NA8A 2EI8A 1YCPM 1HJ9A 2PKAB 1KTSB 1XUIA 3C1KA 1TOCB 4J2YB 2BVSH 1HCGA 4WH8A 2B7DH 2QXGA 2ZHEH 3A84A 1EQ9A 1JBUH 3S9BA 1C5MD 1XUGA 2JETB 4WVPE 2A7HA 2A4QA 3PYHA 3O8BA 4X1QU 1GHYH 1QTFA 2BQWB 1GI6A 4MPWA 4ISIH 3SJIA 1SQAA 4FXGH 1FPCH 1SGNE 2C4FH 4CRDA 2OD3B 1AKSB 1LO6A 1C2GA 3QTOH 1INCA 2ZO3H 2HNTE 1Q31A 1ELBA 1BHXF 4MNXA 3LGWA 4GCHF 3ZZDA 1ZHRA 3SV2H 3KN2A 1GMCG 1KSNA 1O34A 3P8FA 1G2MA 3LT3A 3SOSA 1AZZA 3UQVA 3RXKA 3TH4H 1N1LA 2PWXA 2VH6A 5DKMA 1DS2E 3QDZB 3ZZ9A 1TMUH 2C8WB 3MNBA 3E0PB 1W0YH 2BY6X 4BXWA 1JXPA 3NK8A 3UR6A 1CQQA 4WXIA 3BN9A 1UVSH 3DA9B 4ZKOU 1WTGH 4KGAA 1FONA 3GOVB 1GI5A 1PQAA 3BTHE 1S81A 1TNIA 2FXRA 3KQBA 1SG8B 3TJUA 2FI4E 2TBSA 1C2HA 1C2LA 1GHAG 2UUFB 4Z6AH 1BJUA 2FOFA 1E35B 2BX3A 4QT8C 2HPQH 2G5VA 3ODFA 4ZAEA 2Z9KA 1ZSJA 2J92A 3P92A 2TGTA 4AGJA 1SGIB 3SW2B 1QB6A 3HKJB 3NXPA 4JCNA 4I7YH 2H6MA 4UFDH 4ZXXH 3MTYA 3TK6A 3SUGA 2GMTC 4ZXYH 1GDUA 1XUHA 1P8VC 2BD4A 3PMBB 4E7RG 1EJNA 1GCTC 1FIZA 1TOMH 1YPGH 1LVBA 1MBMA 2A7JA 5ESBA 1Y8TA 3RXOA 3MU8A 1D3TB 1EASA 5DG6A 2P8OC 1UK4A 1G37A 1P3EA 1TNJA 3MI4A 2ZCKP 2SNWA 4CH8B 1K21H 5EOKA 4YO9A 4GAWA 4B2CA 3P70B 2V35A 1P0SH 1FNIA 1LQEA 3QTVH 2WPKS 4ZH8A 4ESTE 1XM1A 5JB8S 3A7WA 1AB9C 1ELDE 4I33A 3O8RA 2SGFE 1P2JA 2PLXA 1ZGIA 2P3UB 2CV3A 3TH2H 1BTWA 3BTFE 6GCHF 1V2ST 3ATKA 1HUTH 1T8LA 8GCHF 2WYJA 2M5TA 2AIQA 3RXJA 1RTLA 2PSYA 1NRQH 1BUIA 1QA7A 1C5WB 4D9QA 5FX5A 1HAVA 3A7XA 5E8EH 2HNTF 4U2WA 1VCPA 3T25A 1CT2E 4GHTA 1XUJA 1O3EA 2ODQA 3RLYH 4ASHA 1H8DH 2AMDA 2VIWA 2G55A 1O5BB 5L2YH 1MTUA 3A7YA 3ZVFA 4LZ1H 1TPSA 2AGGX 4DCDA 4Q2KA 1FLEE 3STJA 4X6NA 1HXEH 1MU8B 2ZU1A 3KL6A 3DFJA 4NZQA 1AKSA 2GZ7A 4FU9A 2JH6D 2OP9A 5C20A 1H9LB 4A1VA 3PV4A 1Z6EA 1O2LA 4HTCH 3VXFH 2VWOA 1LHGH 4UEHH 2BZ6H 1P3CA 3O8DA 2H2ZA 1QNJA 1DWBH 5TCAA 2C8XB 2ANKH 3QGJA 2G5NA 1J17T 3E3TA 1P03A 1NC6A 1F5RA 3A8DA 4CRGA 1FJSA 5FCKA 1C5QA 1SB1H 1YPHE 4FVDA 1FY4A 2BQ7B 2EA3A 2FTMA 1NY22 1GJ7B 1ARBA 1UJ1A 1ELTA 1HAOH 1BQYA 4ZMAH 1SGRE 3TIUA 2F9VA 2VGCB 3K9XB 3SZNA 3UOPA 4Y0ZE 3T28A 1K1OA 3A83A 1TMTH 1O5AB 3LGYA 1PQ5A 1O2QA 3HGPA 7GCHG 1C1RA 5TJXA 1LVMA 2A2QH 4Y76A 4Q80A 1EX3A 1ANCA 3BV9B 3RU4E 4AGKA 1DPOA 5G4BA 2CHAC 5H4IB 1VITH 1BTZA 3NWUA 3SHAH 2A31A 1YP9A 1O3FA 3STIA 4KTCA 1JIRA 1QURH 1QR3E 3FZZA 2GD4B 1GBMA 4J1YA 2BVXH 3E91A 2ZGCA 3CENA 2V6NA 2Y80A 1MKWH 4NA9H 1GCDA 3RP2A 1RTKA 3RMLH 2GCHG 2ZU4A 1V2LT 4OGYA 3S9AA 2QXJA 2BXUH 2FLRH 3QN7A 3RC5A 1DOJA 1HAXB 3RM2H 3V0XA 1AY6H 3GY6A 1MZDA 1RD3B 1GJ5H 3HKIB 5GCHG 2C8ZB 3MH7A 2OLGA 4JZEH 1O5CB 3S9CA 1A0LA 4NFFA 3BG4B 1C1TA 1DWDH 4MPVA 4YT7H 1ETRH 1TQ7B 4MNWA 4JMYA 2FWWA 1VJ9U 4JYUH 3VB7A 4IN2A 4CHAC 4WXVA 3A88A 3A87A 1V2QT 2H5DA 1QL8A 1TA6A 2BY8X 3KCGH 1GI4A 1SC8U 2UWLA 5HM9A 1SQTA 2AMPA 1BCUH 1AFQC 2BDCA 1W2KH 2BDBA 5FPSA 3SU0A 3LJJA 3H7TA 3ZZBA 1EKBB 1GJ6A 1C5LH 5DP6A 3OYPA 2TGAA 4AB9A 4UD9H 3DD2H 2FOEA 3E0NB 2AIPA 2PTNA 3G01A 4O97A 4IMQA 3VFEA 1P9UA 1JRTA 2OQUA 4VGCB 1YC0A 1EPTB 1KTTB 1CHOF 5CMXH 2GCTC 5JBBS 2BDYA 4XBCA 1BB0B 3UWIA 1P12E 4KTSA 1MUEB 1SLXB 1D6RA 4NZLA 2GDDA 5HGGA 1Q3XA 3ZVEA 1TFXA 3AW1A 1G36A 2ZF0H 1V3XA 2F9NA 4KP0A 5EXMA 1ZR0A 1FI8A 1FPHH 4WWYA 2YOLA 4B1TA 4TWYA 4X1PU 1SGPE 1J15A 3RXUA 4AG2A 1A5IA 1K1IA 2YNBA 1TE0A 4SGAE 2OBOA 3UPEA 4ABFA 2ZFRH 2ZFTA 1DLKB 4MQAA 3GDSA 1X7AC 3K6ZA 2VIOA 3SORA 3MH5A 3FVFB 1JWTA 3AW0A 1FV9A 3GCOA 3BSQA 3MNSA 1PPFE 2FMJA 1O2WA 1P06A 4DW2U 5L2ZH 1FN6A 1NN6A 3CP7A 1K1MA 4Y8YA 1BBRH 1ZMJA 3M36A 3D62A 1O2UA 2GX4A 4YOIA 1EATA 3K2UA 1RS0A 2FYRA 1PPZA 1QBOA 2XWAA 4A1XA 4FUHA 1SLVB 3VB3A 1GJ8B 3RU4T 3PO1B 1WTHD 2H5CA 4ZKSU 3BEUA 1UHBA 1HAHH 1HIAB 1O3AA 3VB5A 7LPRA 2ZPSA 1C1SA 1GL1A 1WUNH 4OS4A 1A3EH 1GHWH 1KDQB 1CU1A 1A2CH 1ACBE 5DP7A 1PYTC 1CHOG 2G4UA 1F5KU 1MMJN 3TVJB 1LKBA 3F9FA 5GDSH 2ZQ2A 2VINA 1TA2A 1MZAA 3VGCB 1CVWH 1V2TT 4ABJA 3SN8A 2FX6A 3U8OH 1GHBG 1C5VA 3TLOA 3PM3A 3A8AA 1BZXE 1TYNA 4GSOA 1O33A 1TABE 2SNVA 2W26A 4AFSA 1MU6B 1ELCA 1GBDA 3LU9B 3SQEE 1LQDB 1Y5BT 3ATWA 4D9RA 4FUBA 2Y7XA 3M7TA 2Q1JA 1G30B 2F91A 4X2YA 1VITF 2Z3DA 4K3JA 1C5XB 2ZHWH 1YPJH 3RC4A 4O3TA 2C93B 3UNSA 4D7GA 3EGKH 4IGDA 2D8WA 5JBTA 4Q7ZA 1HAIH 4FUJA 4NIWA 5AF9H 1ANDA 1BBRE 1DDJA 1AIXH 2FOMB 4NSYA 4XBBA 2OCVB 2Q6FA 3H5CB 1OYQA 3SV8A 1SGEE 1L1JA 3F6UH 3RMMH 1Z1IA 5C1XA 1V2UT 4FUCA 3SNBA 1SLUB 4Q7YA 3ZVGA 4TY7A 4FUEA 4CRCA 2AEIH 3T5FH 2AS9A 4BAQB 5DP9A 1V2VT 1CO7E 3ATLA 1UO6A 3MU4A 2ZU2A 2H9HA 3ZV9A 3KNXA 1QBNA 1L2EA 1CE5A 1K1PA 2PFEA 1ZGVA 1AUTC 5K7RA 1UTJA 3DHKH 1NESE 1AE8H 1Y3XA 2BXTH 3RXCA 1ZTJA 1HJAB 3SU6A 4JK6A 1TBQH 1DICA 2QYIA 1EB1H 3QLPH 5DPAA 4X6PA 1TGTA 3EQ0H 1WCZA 1V2NT 1C1NA 4BNRA 4BANB 1EAIA 3ZZ6A 4A1TA 1KXEA 3ZZCA 1HAYB 1P02A 4U32A 1XMNB 1EJAA 3MO9A 2F83A 2H9TH 1VGCB 1GG6B 4O03A 3OY6U 4I8JA 2VIDA 3VEQB 2JETC 4DURA 2NU2E 4FUFA 1GMCF 4KKDA 1HLTH 5EODA 2J95A 2ZFFH 3LDXH 1FUJA 1ANEA 2VVCA 3RXFA 1C5SA 3OU0A 1UK2A 4ABHA 1PQ8A 4AFQA 3LC5A 4CR5A 1AWFH 1O3NA 3V3MA 1GVZA 5PTPA 1IQLA 4K8BA 1C5TA 2Y6TA 2G00A 2ZHFH 1N8OB 4MPUA 1HGTH 4WMEA 3RXHA 1Y5UT 3QO6A 5C1YA 1UVTH 2XC4A 4H42U 1DSUA 1FDPA 1DXPA 3VPKA 1LVOA 3TU7H 3SV7A 3BTTE 2UWOA 4FU8A 1G3EA 3OSYA 4UFFH 1OWHA 3MWIU 1GBKA 3ZZ3A 4JYVH 1O3CA 2WINI 1UMAH 2HLCA 2JKHA 1P10A 1GBHA 1HIAA 2J4IA 2Z9GA 5JB9S 2ZFQH 2XBXA 1HAVB 3GY7A 2ANYA 1C5UA 1SGTA 3KEEA 1KDQA 1HDTH 3WY8A 2B5TB 4ABDA 1MBQA 1TONA 2TIOA 3C27B 3D23A 1QCPA 1W7GH 1ZPCA 2ZU5A 1ETSH 5HXFA 1AUJA 2G8TA 1NFWA 1N6YA 3ATMA 1DITH 5C3NA 2GT8A 4NA7A 2BD7A 2XBWA 3KIDU 2BYAX 1F0RA 5F8ZA 1DSTA 1FMGA 3SV9A 1IQMA 1GI3A 4CBNA 3PMAB 5L30H 5F6MA 2VNTA 1RGQA 4Y6DA 1PJPA 5HYOA 2W7SA 1W11U 1B0FA 4WJG2 2VWLA 7KMEH 4IS5A 1GHZA 2ZFPH 3PROA 1V2KT 2JH0D 4YT6H 2XYAA 4O3UA 5AHGH 2ILNA 1QFKH 1D3DB 1EOJA 1O2RA 1A5GH 4X2VA 3IG6B 3V12A 1GJ9B 1KXBA 1OKXA 3HK6B 1C2DA 2WPIS 1SGDE 2Y7ZA 2SFAA 1FAXA 5LPRA 4X8UH 3S7HB 1D3PB 2BLOA 2SGEE 2ZDNA 1S83A 2VJ1A 4X1RU 4E06H 5T6DA 5A8ZA 4UFEH 4GHQA 4NSVA 1TNKA 2BM2A 1WQVH 3NKKA 5FPYA 1ELAA 1EZQA 2Q6DA 1OWKA 1FN8A 3SV6A 2ZIQH 4AX9H 1L4DA 5BRRE 3PTBA 1BA8B 1TAWA 2OC7A 2O8TA 4ZHMU 3VXEH 4YZUA 2Z9LA 1SFQB 2D1JA 4K5ZA 3OTJE 2ZTZA 4IC6A 4TPYA 2P93A 2EI6A 1ZZZA 4GUXA 1Z71A 1O38A 3P8NA 2TGPZ 3W95A 1EZXC 1OWIA 2ZWLH 1OSSA 1XXDA 2A5IA 1Y3WA 1Y3UA 1TNGA 2P3FH 3MOCA 2ZFSA 1O36A 5EXLA 1K9OE 1S82A 1NRRH 3SHCH 5EW1H 1GJAB 2EC9H 1NFXA 4XOJA 5EQQA 1D6WA 4NFEA 2SGPE 2VVUA 4ISLA 4THNH 2BX4A 1P04A 4WMDA 3DT0H 1S0RA 4X6OA 1BIOA 1F92A 1H4WA 3S69A 3R3GB 1XXFA 3LOXA 3RXPA 2ZP0H 1SBWA 4DY7B 1O2KA 4CRAA 1S85A 1GHVH 4OS7A 1EZSC 3QZRA 2BDGA 2Z7FE 4Q7XA 2D2DA 1V6DA 3D49H 4RKOB 1ZSKA 5FX6A 1Z7KA 3LC3A 2QXHA 3I78A 4UFGH 1LPZB 3U8TH 1DE7H 1BTYA 2QV1A 2XW9A 2ZPQA 2Z3EA 6LPRA 1NO9H 3TK5A 2V3HH 3P6ZB 3GCTG 4A5TS 2STAE 3BIUH 4B75A 2AFQB 2AERH 3P95A 3F9GA 3LJOA 3PLPA 1ZRKA 3SJ9A 2K1QA 2AYWA 7GCHF 4Y10E 2PGQB 1BRBE 4MLFB 3UOUA 1V2MT 4NGAH 5GWZA 2HRVA 3MYWA 2FOBA 1O3MA 1OXGA 4Y79A 3T2NA 4BAHB 4ZHAA 1SMFE 2TRMA 8ESTE 3HGNA 2AGIX 2VGCC 2VU8E 1BJVA 1TX8A 3LIWA 1GMDG 1TRMA 3ATIA 5EXNA 1O2YA 1NT1A 1OWDA 5T3HA 1ZTKA 1G2LA 1NZQH 2CF8H 1C1WH 5FBIA 1OP8A 3A86A 5ABWA 2GCHF 5J4QA 4X8TH 2IOTA 1UTNA 4YLQH 1O3JA 2ASUB 2Z3CA 1W10U 1F0UA 1NTPA 3ZVAA 1ZOMA 1GI0A 3EYDA 3M7QA 3SI3H 2J2UA 3U9AH 5GCHF 2ODYB 4Z0KA 3ZZAA 1H9IE 4E7NA 1SHYA 2R2WU 1P2MA 1QL7A 2FZZA 1K1LA 1FY3A 1UTOA 3TGIE 1VCWA 2PV9B 1ZPZA 3M37A 1TMBH 4ISNA 1BRCE 4NCYA 3M5OA 3ZZ8A 4MDSA 5E2PA 2BB4A 2XNIA 1KLIH 3ZVCA 1AVXA 1UCYE 3PWCA 1CHGA 1EAWA 2A7CA 2ANMH 3RXRA 9ESTA 3BTQE 1TPPA 3BG4C 3UREA 1PFXC 1TBZH 5SGAE 4BXSA 1C2KA 1CSOE 1OYTH 1IQKA 2WUCA 1O0DH 3QZQA 1T7CA 2QCYA 1MKXK 1E36B 1P2IA 1S84A 1HNEE 3TK9A 3PB1E 1BT7A 4DIIH 2NU4E 3KGPA 1HYLA 5A09A 1SHHB 1W3CA 3M3TA 2ZCHP 5BPEA 1UHBB 1A61H 1TGSZ 1RTFB 3SU3A 1EAUA 3F9EA 4CR9A 3EA9A 3SU1A 3GCHB 1S0QA 1HAGE 1K28D 2DE8A 1GGDC 1EUFA 1E0FD 2A4RA 1P01A 4U30A 3LGUA 3LKWA 2BQ6B 4GLYA 1C5YB 5DP4A 1PYTD 5EGMA 1GBBA 1GBIA 4TYDA 3SU4A 3BTGE 4B2AA 1MCVA 1UTQA 3KHVA 3RXLA 2NU0E 1EJMA 1ZTLA 4VGCC 1XX9A 2FO9A 1TPOA 1EPTC 1YF4A 4XE4A 3A80A 3UY9A 3W94A 4PROA 3EAJA 1O3OA 1WOFA 1Z1JA 1LPKB 1UCYK 1KXDA 1ZJKA 2ULLA 1P2NA 1DXWA 1TGNA 2F9OA 1JIMA 4WY3A 1DY8A 2J34A 2FOCA 1YYY1 2XCFA 3I29A 1C4Y2 4NG9H 3UWJH 2WV4A 1O39A 1Y59T 2BD3A 1P2OA 3PMHB 2F9BH 5F03A 1ELGA 1V2PT 3TPIZ 2BDAA 4INHA 3JZ1B 4WH6A 3Q76A 2A4OA 3URCA 1RIWB 4AYVB 2C3SA 3TITA 3SUDA 1IQHA 4K1EA 1MAYA 5AFZH 1O5EH 1AI8H 2C8YB 4A92A 1L0ZA 3RMNH 1SOTA 4K1TA 2Z9IA 3BF6H 5E0HA 5A0CA 2ZEBA 4Y7AA 1SI5H 2JH5D 4YESB 1SL3A 3BTWE 2BHGA 3M7UA 4I8HA 4Y71A 5GJ4B 1PPGE 5A8YA 5F8TA 1C2EA 1MQ5A 1C1UH 1GHBF 3PO1C 1C1QA 1BMMH 1UTMA 2A32A 4TWWA 2I6SA 5FXLA 3A85A 3PMJA 1O35A 5DP8A 1QA0A 1CGIE 5B6OA 1NU9A 4NIYA 1QB9A 2Y5FA 3I77A 5CHAB 1MTWA 3OX7U 1CBWB 1EOLA 4ZROA 3GY4A 1V2RT 3VGCC 1CA0B 2FI5E 2OXSA 3Q3KA 2DUCA 4B2BA 3SGBE 4BOHA 2B9LA 2Y5GA 1AFEH 2A1DB 4FUDA 5EG4A 2FLBH 1A46H 1S5SA 1EP6A 1ABIH 1M9UA 1XUFA 2FTLE 4HGCA 1GJ4H 4ISHH 9LPRA 2QC2A 5I25A 3LH1A 3NZIA 2XBVA 4GPGA 2ZGJA 4ABIA 4DVAU 1ABJH 2ESTE 1SGYE 2P94A 3SGAE 2O8MA 2A4GA 1DFPA 1ETTH 1EXFA 2BDIA 1PPHE 1WU1A 4F49A 5LGOA 1OPHB 5E0JA 3TJNA 1G32B 2IN2A 3BTEE 1SFIA 3BEIB 5A0BA 2AGEX 3L6PA 1GI8B 2AMQA 4BAOB 2BMGB 2ZKSA 3RXSA 1DWEH 2G52A 1ELFA 1J9CH 5DP3A 4AOQA 1SR5C 1D9IA 4A7IB 1O3HA 3BG8A 1SQOA 2GV6A 1QRWA 3MU5A 2GKVE 3Q3YA 1CA8B 1DM4B 4MNYA 4I8LA 2HVXA 3M35A 1D4PB 4JYTA 2BOKA 4AYYB 4K60A 1T8MA 1TQ0B 1QJ7B 2TPIZ 2PSXA 1ESBA 4NWKA 1MTNB 3QWCH 3IWMA 2FIRH 3S0NA 1O2NA 3ZVBA 4YLUA 1YLCA 2FS8A 4HI3A 3RC6A 5FPTA 2FM2A 1SGCA 4HZHA 5J4SA 2CMYA 1LHCH 3MNXA 2EEKA 1C1OA 3FP7E 3K65B 1TGCA 3BTME 1AD8H 1BMNH 3U8RH 1VGCC 1GG6C 3V7TA 3PTNA 2FOHA 4LXBH 3UFAA 1PPCE 3LONA 5FHTA 2GGVB 5L6NH 3KQEA 4OS6A 3GICB 3B8JA 1NM6A 1K2I1 4UDWH 2GTBA 4JZFH 3SNDA 5T6GA 1HAPH 3GY3A 1C2FA 2BD5A 3RDZA 1OX1A 1YGCH 5E0GA 3SI4H 2HNTC 4AG1A 4ABGA 1NPMA 7ESTE 2ZQ1A 2XCNA 1GMHG 1FQ3A 1UTPA 2UUJB 1O2PA 2C90B 4CBOA 3FZDA 4OGXA 5F8XA 1ARCA 1GDNA 1O2VA 3LGVA 2WV5A 1C2JA 1L1GA 1AMHA 1F0SA 1TWXB 1N8OC 2ZTYA 3RXIA 2QAAA 1P2QA 3AVZA 5HM2A 2QGRA 3CS0A 5LH8A 3FFGA 1GDQA 1WV7H 2P3TB 2BD2A 1ZHMA 3SNEA 1LDTT 2HWLB 4MG3A 1VCQA 3VB4A 3ZYDA 1C2MA 3ODDA 4MPXA 3QGNB 5JBAS 2G4TA 2P95A 1VZQH 1ZYOA 2B8OH 4X8SH 3FP8E 1HBTH 2G51A 3SJ8A 1O5GH 1O37A 1O3KA 2Y81A 5GXPA 1WAYB 3UTUH 1AWHB 5GPIB 1AE5A 3SNAA 4ZKNU 2QN5T 3M3SA 6CHAB 3UUZA 4YTAA 2EI7A 5C5NA 2WUBA 4TY6A 3U69H 3ITIA 4ZKRU 1T8NA 1OS8A 1QRXA 3B23B 3TGJE 2FDAA 1NROH 2BDHA 1A0JA 4NIXA 2GT7A 1A7SA 4SGBE 2ZHQH 1O5FH 2YNAA 4LOYH 1WQSA 1THPB 1AVWA 3NCLA 2FI3E 5CE1A 2P16A 2RCEA 2PKSB 1C1MA 5C2ZA 2UUKB 2FYQA 1NFYA 2ZECA 2FX4A 3GY8A 1UVOA 1BDAA 4FUGA 1BMLA 1F0TA 2ZA5A 3AAVA 1P57B 1W12U 1DUAA 5C1UA 1DT2A 3KF2A 4K2YA 2H1UA 1GWAA 1YPKH 3UR9A 2KAIA 4AZ2B 1HXFH 3A8CA 2CJIA 2OC1A 1Z8IB 1L1NA 3QX5H 4ABAA 2D26C 4JZIA 3D65E 4OS2A 4BAKB 1C2IA 2O8WA 1AGJA 2VWNA 3ESTA 4ABEA 3VB6A 1HJ8A 4XSKU 4X6MA 2XC5A 5T6FA 3KQCA 1LMWB 4ZHLU 2FP7B 2PW8H 2OC0A 3EDXB 1KLJH 1O2SA 1O2MA 2QY0B 5A0AE 1B5GH 1ZRBA 4B76A 1NRNH 1LCYA 1Z8JB 1C5RA 2PUXB 2STBE 4DG4A 4DGJA 1A1RA 1S6HA 1CGHA 2WPMS 3RLWH 1O3BA 4RKJB 3TH3H 1MQ6A 2WYGA 3GCTF 5HMAA 2UWPA 2XC0A 2A2XH 1P05A 1SGFA 3MNCA 1ID5H 5FAHA 4UONA 3Q00A 2F3CE 2A45B 1W7XH 3RXVA 1LVYA 3ZZ4A 4BTIB 1KLTA 3M61U 2Z9JA 2ZZUH 4FVBA 1GHXH 2Y82A 1P2KA 3TNTA 4Y0YE 1EP5A 1VR1H 1IQGA 1THRH 4IN1A 2ALVA 2BY5X 3R0FA 2OINA 4A6LA 1H1BA 2GZ9A 3FANA 5EPYA 4DOQA 1PQ7A 1CT4E 4B71A 4YOJA 4GVUA 3ELAH 1E34B 1YPHC 1GMDF 2DE9A 4XDEA 4BTUB 1IHSH 1UTLM 4X2WA 1BOQA 1GBJA 1V2WT 1MKXH 1L4ZA 4X0WU 2P59A 4JZDH 3TJVA 2ZDLA 3MMGA 1XVOA 2ZPRA 3SU5A 3TJOA 1YCPK 1IHTH 2SGDE 2W3KA 3M5MA 1P09A 4Y11E 1BTUA 1HAZB 1ZMLA 1KIGH 4INLA 2R9PA 1QHRB 1W8BH 2W3IA 1C5NH 1JOUB 1KXAA 1UK3A 1BMAA 3PLBA 5IDKA 2ODPA 3U1JB 3P8OA 3MO6A 4ABBA 2FODA 2R2MB 2PTCE 4H6SB 1ZPBA 1NU7B 4GCHG 3JZ2B 4YM9A 1XUKA 2BOHB 1O3LA 2QF0A 5ETXA 1UVPA 4KELA 1E38B 1W14U 1K1NA 1S6FA 1YM0A 4NWLA 1GL0E 1IAUA 1LHFH 3GISB 1IQIA 3ZZ7A 1A0HB 1UCYH 5K0HA 4IBLH 3T29A 3N7OA 4K1SA 8LPRA 1XKAC 4DIHH 5LPFA 2AH4X 3LPRA 2O8UA 1LHEH 3TGKE 1V2JT 1Y3VA 3A82A 2OBQA 4I8KA 2IPHA 2BTCE 1HRTH 4K8YA 2TGDA 2VIVA 3U1IB 2GMTB 2ANWA 4D8NA 1GCTB 2PKAA 3RXEA 2ZG0H 1SGFG 3GDVA 1O31A 4BTTB 2GV7A 3GYMA 3A7ZA 3P17H 1Z8GA 2FPZA 2BY7X 4CRFA 2SGQE 2P8OB 2FOGA 2O8LA 2J94A 3FP6E 3LGIA 4Y8ZA 2V0BA 1GI2A 3E16B 4IC5A 3SU2A 1TALA 1MD7A 1Y5AT 3GCHC 3T27A 4AFZA 2ZCLP 1IQEA 1FY5A 1T4UH 5FCRA 1ZLRA 2PGBB 1DX5M 1FXYA 1AB9B 1G3BA 1LPGB 3PLKA 1MD8A 2GP9B 1FIWA 5JDUB 3KQDA 1O3DA 4R8TB 4JZ1A 2HGTH 1QQ4A 4DT7B 1YPMH 1TB6H 2H9EH 2W7UA 3SQHE 5E2OA 1THSH 1ZMNA 5JBCS 1QRZA 3GY5A 5FBEA 2LNCA 2HOBA 4MVNA 5DJ7A 1FY1A 1RJXB 4B73A 2F9UA 4X1SU 4RSPA 2CXVA 1B0EA 1W13U 1F5LA 1G3DA 1FZZA 1EB2A 6GCHG 2ZU3A 3O8CA 8GCHG 2A5KA 3URDA 1ANBA 2G81E 3F9HA 5EU8A 1GJDB 1GBTA 1BRAA 1C5OH 3ZZ5A 1RIWC 1PPBH 4I8GA 4CH2B 5ESTE 4Y7BA 1IQJA 1PPEE 1RXPA 2QF3A 2ZDKA 3DFLA 4MTBA 1BTXA 2J9NA 2ZDMA 1K1JA 4XBDA 2Q6GA 1O2XA 2RG3A 1QB1A 2CN0H 3UNQA 1KXFA 4B74A 3RXQA 1GBLA 2WPJS 1QBVH 1O30A 5C67A 3UNRA 1SOZA 2VH0A 3HATH 1C4U2 2GVFA 3SBKA 2BD9A 2BD8A 3T62A 2XXLA 5LPEA 1KYNA 4JK5A 3GDUA 3GYLB 4DJZB 1P9SA 3FAOA 1BTHH 1CGJE 3B9FH 1KY9A 2BLVA 1GI1A 5C5OA 2A0QB 1O2JA 1ELVA 2F9PA 1UVUH 3LH3A 2THFB 1O32A 2ZC9H 5JPMH 2R3YA 3EA8A 1OP2A 1H9HE 1ZSLA 4XFQA 5CHAC 8KME2 1O2OA 1CBWC 3ZVDA 1QGFA 1GBAA 4AN7A 1CA0C 1GJCB 3F68H 2WPLS 3SJKA 2CHAB 1O5DH 1NRPH 5JYIA 3S7KB 1DY9A 1CT0E 4X2XA 2GZ8A 1ZHPA 1HFDA 2FOAA 3MO3A 3SUFA 3SO3A 2W5EA 1C1VH 3K6YA 1AHTH 2R0LA 1E37B 2VVVA 1ESAA 3HK3B 3PWBA 4IW4E 1DUEA 1WBGB 1WSSH 1GGDB 1AZ8A 1QL9A 1YPEH 3F1SB 1AO5A 2OC8A 2SGAA 3GCNA 3UIRA 1QJ1B 3SGQE 3E8LA 5EQRA 2HPPH 1VJAU 1FY8E 3TNSA 2A5AA 2R0KA 3RXGA 2NWNA 3MU0A 2ZDVH 4I31A 2OUAA 1C1PA 4HFPB 5I46H 3AAUA 2XTTB 3BEFB 4BAMB 1OWJA
chains in the Genus database with same CATH superfamily
2QA9E 1QY6A 2RDLA 1T32A 4D7FA 3MU1A 3M5LA 4CHAB 1TGBA 4Y8XA 4INKA 1O3IA 5IYTA 1GBFA 2IJOB 3BTDE 1GJBB 1W0ZU 4AFUA 4LZ4B 5EQSA 2ZGHA 1MTNC 1AFQB 3U98H 1OWEA 3L33A 3HPTB 3DUXH 1UTKA 2O9QA 1T4VH 3MFJA 3LGTA 4UE7H 3RM0H 3L3TA 1MCTA 4AORA 4F4OC 2BZAA 1A4WH 1T8OA 1GMHF 3A7TA 3E1XB 3SYJA 1DVAH 1T31A 2Z94A 1SLWB 1TNHA 1GI9B 2GCTB 1NRSH 2XBYA 3NUMA 2QIQA 4OS5A 1DANH 1TIOA 1JMOH 1GVKB 1MKWK 2QXIA 5GIBA 5F53A 1GPZA 1BTPA 5A8XA 1GBEA 4YOGA 1F2SE 4H4FA 1C9PA 4ISOA 2ZDAH 1BHXB 2R3UA 2ZHDA 1O3GA 3M5NA 3BTKE 5A2MH 1KXCA 2Y5HA 1YLNA 3UB0A 2KAIB 5DK1A 1AU8A 1HJAC 4R0IA 1HB0B 1ZJDA 2KCAA 5DGJA 1GI7B 1Y3YA 1ELEE 3ZYEA 2UUYA 3A89A 1SGQE 3M3VA 1OP0A 3OY5U 3A8BA 1TPAE 3IITA 3BIVH 2Z6BD 3RXDA 1H8IH 1YKTA 2ZGBH 4O9VA 2PHBA 3RXAA 5TCCA 2XWBI 3SJOA 4ACAA 1XVMA 3RUOA 2LELA 2ZNKH 1QQUA 3WWFA 1YPLH 1TLDA 3ENSB 2XRCA 2NU1E 2OQ5A 4CREA 1AQ7A 1IQFA 1IQNA 3A81A 4ZUHA 3SUEA 3MHWU 1GBCA 2ZGXH 3GY2A 1SVPA 4X1NU 1TNLA 3RXMA 4X8VH 3H7OA 1J16A 1EZUC 2QE7D 3QUMP 1A3BH 1WYKA 4D76A 1EAXA 1Z6JH 3Q77A 6CHAC 1TRYA 1YBWA 3MH6A 3A7VA 1SSXA 1D3QB 1HV7A 1RFNA 4OS1A 1F7ZA 4TPIZ 2FS9A 6ESTA 3OFND 1MTVA 4WMFA 2BY9X 1Z8RA 1TBRH 4IMZA 2B0FA 3E90B 2VWMA 4E05H 1SPJA 1G9IE 1ORFA 2RA0A 3EA7A 1E1QD 1GVLA 1LHDH 1RRKA 1TX7A 2J38A 1J8AA 2PUQH 2PR3A 1XKBC 1TRNA 2NU3E 1BRUP 3SNCA 2L74A 1AVGH 1K22H 1N6XA 4U01A 2WSSD 1G3CA 1DWCH 1NFUA 2BLWA 3RMOH 3RXBA 4AB8A 1EPTA 1B7XB 5DP5A 1C5ZB 2PKSC 3CS7A 1MAXA 1MTSA 4FUIA 3V13A 4LK4A 3Q3XA 1O2ZA 1TX6A 2VB0A 3EE0B 1U6QA 1FAKH 2V3OH 1C9TA 1QJ6B 2GDEH 1BITA 2LPRA 3AASA 3QK1A 4KTUA 5EW2H 1IOEA 1O2GH 2VIPA 4M7GA 4MNVA 1P11E 1A5HA 5EPNA 3T26A 1YCPH 1BBRK 1Q2WA 2OTVA 3E6PH 3MH4A 3RU4D 2ZTXA 2CGAA 2L6OA 1J14A 1O2IA 1VITG 2FEQH 2IPQX 1O2HA 3NPSA 4WF8A 2BVRH 2PP6A 2I6QA 1NS3A 2RA3A 4H6TA 3ZV8A 4CRBA 4K69A 1ESTA 1C4V2 5AFYH 4NIVA 1YLDA 2ZI2H 4I86A 1O3PB 3MQKC 4I32A 2BLQA 1V2OT 1HPGA 1LKAA 3UQOA 1C5PA 3UAIC 1DLEA 2HALA 1AN1E 1O2TA 4RN6A 5AVDA 1LTOA 5DO4H 3RXTA 2FESH 1QIXB 2CF9H 1JRSA 1MH0A 1OOKB 1GHAF 2VIQA 3P8GA 2WPHS 2ALPA 4FU7A 4NA8A 2EI8A 1YCPM 1HJ9A 2PKAB 1KTSB 1XUIA 3C1KA 1TOCB 4J2YB 2BVSH 1HCGA 4WH8A 2B7DH 2QXGA 2ZHEH 3A84A 1EQ9A 1JBUH 3S9BA 4F55A 1C5MD 1XUGA 2JETB 4WVPE 2A7HA 2A4QA 3PYHA 3O8BA 4X1QU 2F4LA 1GHYH 1QTFA 2BQWB 1GI6A 4MPWA 4ISIH 3SJIA 1SQAA 4FXGH 1FPCH 1SGNE 1OHHD 2C4FH 4CRDA 2OD3B 1AKSB 1LO6A 1C2GA 4RT1A 3QTOH 1INCA 2ZO3H 2HNTE 1Q31A 1ELBA 1BHXF 4OM9A 4MNXA 1K0HA 3LGWA 4GCHF 3ZZDA 1ZHRA 3SV2H 3KN2A 1GMCG 1KSNA 1O34A 3P8FA 1G2MA 3LT3A 3SOSA 1AZZA 3UQVA 4ASUD 3RXKA 3TH4H 1N1LA 2PWXA 2VH6A 5DKMA 1DS2E 3QDZB 3ZZ9A 1TMUH 2C8WB 3MNBA 3E0PB 1W0YH 2BY6X 4BXWA 1JXPA 3NK8A 3UR6A 1CQQA 2V7QD 4WXIA 3BN9A 1UVSH 3DA9B 3PV5A 4ZKOU 1WTGH 5C94A 4KGAA 1FONA 3GOVB 1GI5A 1PQAA 3BTHE 1S81A 1TNIA 2FXRA 3KQBA 1SG8B 3TJUA 2FI4E 2TBSA 1C2HA 1C2LA 1GHAG 2UUFB 4Z6AH 1BJUA 2FOFA 1E35B 2BX3A 3F2FA 4QT8C 2HPQH 2G5VA 1S6LA 3ODFA 4ZAEA 2Z9KA 1ZSJA 2J92A 3P92A 2TGTA 4AGJA 1SGIB 3SW2B 1QB6A 3HKJB 3NXPA 4JCNA 4I7YH 2H6MA 4TSFD 4UFDH 4ZXXH 3MTYA 3TK6A 3SUGA 2GMTC 4ZXYH 1GDUA 1XUHA 1P8VC 2BD4A 3PMBB 4E7RG 1EJNA 1GCTC 1FIZA 1TOMH 1YPGH 1LVBA 1MBMA 2A7JA 5ESBA 1Y8TA 3RXOA 3MU8A 1D3TB 1EASA 5DG6A 2P8OC 1UK4A 1G37A 1P3EA 1TNJA 2JDID 3MI4A 2ZCKP 2SNWA 4CH8B 1K21H 5EOKA 4YO9A 4GAWA 4B2CA 3P70B 2V35A 1P0SH 1FNIA 4HG6A 5DN6D 1LQEA 3QTVH 2WPKS 4ZH8A 4ESTE 1XM1A 5JB8S 3A7WA 1AB9C 1ELDE 4I33A 4P02A 2SGFE 3O8RA 1P2JA 2PLXA 1ZGIA 2P3UB 2CV3A 3TH2H 1BTWA 3BTFE 6GCHF 1V2ST 3ATKA 1HUTH 1T8LA 2KM0A 8GCHF 2WYJA 2M5TA 4B6EA 2AIQA 3RXJA 1RTLA 2PSYA 1NRQH 1BUIA 1QA7A 1C5WB 4D9QA 5FX5A 1HAVA 3A7XA 5E8EH 2HNTF 4U2WA 1VCPA 2RDEA 3T25A 1CT2E 4GHTA 1SQRA 1XUJA 1O3EA 2ODQA 3FN8A 3RLYH 4ASHA 1H8DH 2AMDA 2VIWA 2G55A 1O5BB 5L2YH 1MTUA 3A7YA 3ZVFA 4LZ1H 1TPSA 2AGGX 4DCDA 4Q2KA 1FLEE 3STJA 4X6NA 1HXEH 1MU8B 2ZU1A 3KL6A 3DFJA 4NZQA 1AKSA 2GZ7A 4FU9A 2JH6D 2OP9A 5C20A 1H9LB 4A1VA 3PV4A 1Z6EA 1O2LA 4HTCH 3VXFH 2VWOA 1LHGH 4UEHH 2BZ6H 1P3CA 3O8DA 2H2ZA 1QNJA 1DWBH 5TCAA 2C8XB 2ANKH 3QGJA 2G5NA 1J17T 3E3TA 1P03A 1NC6A 1F5RA 3A8DA 2KCPA 4CRGA 1FJSA 5FCKA 1C5QA 1SB1H 1YPHE 4FVDA 1FY4A 2BQ7B 2EA3A 2FTMA 1NY22 1GJ7B 1ARBA 1UJ1A 1ELTA 1HAOH 1BQYA 4ZMAH 1SGRE 3TIUA 2F9VA 2VGCB 3K9XB 3SZNA 3UOPA 4Y0ZE 3T28A 1K1OA 3A83A 1TMTH 1O5AB 3LGYA 1PQ5A 1O2QA 3HGPA 7GCHG 1C1RA 5TJXA 1LVMA 2A2QH 4Y76A 1WDIA 4Q80A 1EX3A 1ANCA 3BV9B 3RU4E 4AGKA 1DPOA 5G4BA 2CHAC 5H4IB 1VITH 1BTZA 3F2HA 3NWUA 3SHAH 2A31A 1YP9A 1O3FA 3STIA 1W0JD 4KTCA 1JIRA 1QURH 1QR3E 3FZZA 2GD4B 1GBMA 4J1YA 2BVXH 2QF4A 3E91A 2ZGCA 3CENA 1SKYE 2V6NA 1MKWH 2Y80A 2YMSB 4NA9H 1GCDA 3RP2A 1RTKA 3RMLH 2GCHG 2ZU4A 1V2LT 4OGYA 3S9AA 2QXJA 2BXUH 2FLRH 3QN7A 2KCYA 3RC5A 1DOJA 1HAXB 3RM2H 3V0XA 1AY6H 3GY6A 1MZDA 1RD3B 1GJ5H 3HKIB 5GCHG 2C8ZB 3MH7A 2OLGA 4JZEH 1O5CB 3S9CA 1A0LA 4NFFA 3BG4B 1C1TA 1DWDH 4MPVA 4YT7H 1ETRH 1TQ7B 4MNWA 4JMYA 2WZQA 4F48B 2FWWA 1VJ9U 4JYUH 3VB7A 4IN2A 4CHAC 4WXVA 3A88A 3A87A 1V2QT 2H5DA 1QL8A 1TA6A 2BY8X 3KCGH 1GI4A 1SC8U 2UWLA 5HM9A 1SQTA 2AMPA 1BCUH 1AFQC 2BDCA 5EIYA 1W2KH 2BDBA 5FPSA 3SU0A 2K8IA 3LJJA 3H7TA 3ZZBA 1EKBB 2J97A 1GJ6A 1C5LH 5DP6A 3OYPA 2TGAA 4AB9A 4UD9H 3DD2H 2FOEA 3E0NB 2AIPA 2PTNA 3G01A 4O97A 2W6ID 4IMQA 3VFEA 1P9UA 1JRTA 2OQUA 4VGCB 1YC0A 1EPTB 1KTTB 1CHOF 1QZ8A 5CMXH 2GCTC 5JBBS 2BDYA 4XBCA 1BB0B 3UWIA 1P12E 4KTSA 1MUEB 1SLXB 1D6RA 4NZLA 2GDDA 5HGGA 1Q3XA 3ZVEA 1TFXA 3AW1A 1G36A 2ZF0H 1V3XA 2F9NA 4KP0A 4TT3D 5EXMA 1ZR0A 1FI8A 1FPHH 4WWYA 2YOLA 4B1TA 4TWYA 4X1PU 1SGPE 1J15A 3RXUA 2XNDD 1A5IA 4AG2A 1K1IA 2YNBA 1TE0A 4SGAE 2OBOA 3UPEA 4ABFA 1VKYA 2ZFRH 2ZFTA 5HIZA 1DLKB 4MQAA 3GDSA 1X7AC 3K6ZA 2VIOA 3SORA 3MH5A 3FVFB 1JWTA 3AW0A 1FV9A 3GCOA 3BSQA 3MNSA 1PPFE 2FMJA 1O2WA 1P06A 4DW2U 5L2ZH 1FN6A 1NN6A 3CP7A 1K1MA 4Y8YA 1BBRH 1ZMJA 3M36A 3D62A 1O2UA 2GX4A 4YOIA 1EATA 3K2UA 1RS0A 2FYRA 1PPZA 1QBOA 2XWAA 4A1XA 4FUHA 1SLVB 3VB3A 1GJ8B 3RU4T 3PO1B 1WTHD 2H5CA 4ZKSU 3BEUA 1UHBA 1HAHH 1HIAB 3PRDA 1O3AA 3VB5A 7LPRA 2ZPSA 1C1SA 5KECA 1GL1A 1WUNH 4OS4A 1A3EH 1GHWH 1KDQB 1CU1A 1A2CH 1ACBE 5DP7A 1PYTC 1CHOG 1YWUA 1F5KU 2G4UA 1MMJN 3TVJB 1LKBA 3F9FA 5GDSH 2ZQ2A 2VINA 1TA2A 1MZAA 3VGCB 1CVWH 1V2TT 4ABJA 3SN8A 2FX6A 3U8OH 1GHBG 2J98A 2KX4A 1C5VA 3TLOA 3PM3A 3A8AA 1BZXE 1TYNA 4GSOA 1O33A 1TABE 2SNVA 2W26A 4AFSA 1MU6B 1ELCA 1GBDA 3LU9B 3SQEE 1LQDB 1Y5BT 3ATWA 4D9RA 4FUBA 2Y7XA 3M7TA 2M2AA 2Q1JA 1G30B 2F91A 2W6JD 4X2YA 1VITF 2Z3DA 4K3JA 1C5XB 2ZHWH 5T1VA 1YPJH 3RC4A 4O3TA 2F43B 2C93B 3UNSA 4D7GA 3EGKH 4IGDA 2D8WA 5JBTA 4Q7ZA 1HAIH 4FUJA 4NIWA 5AF9H 1ANDA 1BBRE 1DDJA 1AIXH 2FOMB 4NSYA 4XBBA 2OCVB 2Q6FA 3H5CB 1OYQA 3SV8A 1SGEE 1L1JA 3F6UH 3RMMH 1Z1IA 2KCOA 5C1XA 1V2UT 4FUCA 3SNBA 1SLUB 4Q7YA 3ZVGA 4TY7A 4FUEA 4CRCA 2AEIH 3T5FH 2AS9A 4BAQB 5DP9A 1V2VT 1CO7E 3ATLA 1UO6A 3MU4A 2ZU2A 2H9HA 3ZV9A 3KNXA 1QBNA 1L2EA 1CE5A 1K1PA 2PFEA 1ZGVA 1AUTC 5K7RA 1UTJA 3DHKH 1NESE 1AE8H 1Y3XA 2BXTH 3RXCA 1ZTJA 1HJAB 3SU6A 4JK6A 1TBQH 1DICA 2QYIA 1EB1H 3QLPH 5DPAA 4X6PA 1TGTA 3EQ0H 1WCZA 1V2NT 1C1NA 4BNRA 4BANB 1EAIA 3ZZ6A 3W1EA 4A1TA 1KXEA 3ZZCA 1HAYB 1P02A 4U32A 4AC9A 1XMNB 1EJAA 3MO9A 2F83A 2H9TH 1VGCB 1GG6B 4O03A 3OY6U 4I8JA 2VIDA 3VEQB 2JETC 4DURA 2NU2E 4FUFA 1GMCF 4KKDA 1HLTH 5EODA 2J95A 2ZFFH 3LDXH 1FUJA 1ANEA 2VVCA 3RXFA 1C5SA 3OU0A 1UK2A 4ABHA 1PQ8A 4AFQA 3DSOA 3LC5A 3PV2A 1MABB 4XD7D 4CR5A 1AWFH 1O3NA 3V3MA 1GVZA 5PTPA 1IQLA 4K8BA 1C5TA 2Y6TA 2G00A 2ZHFH 1N8OB 4MPUA 1HGTH 4WMEA 3RXHA 1Y5UT 3QO6A 5C1YA 1UVTH 2XC4A 4H42U 1DSUA 1FDPA 1DXPA 3VPKA 1LVOA 3TU7H 3SV7A 3BTTE 2UWOA 4FU8A 1G3EA 3OSYA 4UFFH 1OWHA 3MWIU 1GBKA 3ZZ3A 2RFKC 4JYVH 1O3CA 2WINI 1UMAH 2HLCA 2JKHA 1P10A 1GBHA 1HIAA 2J4IA 2Z9GA 5JB9S 2ZFQH 2XBXA 1HAVB 3GY7A 2ANYA 1C5UA 1SGTA 3KEEA 1KDQA 1HDTH 3WY8A 2B5TB 4ABDA 1MBQA 1TONA 2TIOA 3C27B 4ACBA 3D23A 1QCPA 1W7GH 1ZPCA 2ZU5A 1ETSH 5HXFA 1AUJA 2G8TA 1NFWA 1N6YA 3ATMA 5HKKD 1DITH 2WV9A 5C3NA 2GT8A 4NA7A 2BD7A 2XBWA 3KIDU 2BYAX 1F0RA 5F8ZA 1DSTA 3DSGA 1FMGA 3SV9A 1IQMA 1GI3A 3N99A 3PMAB 3ZIAD 4CBNA 5F6MA 5L30H 2VNTA 1RGQA 4Y6DA 1PJPA 5HYOA 2W7SA 1W11U 1B0FA 4Q63A 2VWLA 4WJG2 7KMEH 4IS5A 1GHZA 2ZFPH 3OAAD 3PROA 1V2KT 2JH0D 4YT6H 2XYAA 4O3UA 5AHGH 2ILNA 1QFKH 1D3DB 1EOJA 1O2RA 1A5GH 4X2VA 3IG6B 3V12A 1GJ9B 1KXBA 1OKXA 3HK6B 1C2DA 2WPIS 1SGDE 2Y7ZA 2SFAA 1FAXA 5LPRA 4X8UH 3S7HB 1D3PB 2BLOA 2SGEE 2ZDNA 1S83A 2VJ1A 4X1RU 4E06H 5T6DA 5A8ZA 4UFEH 4GHQA 5EJ1A 4NSVA 1TNKA 2BM2A 2EY4C 1WQVH 3NKKA 2JJ2D 5FPYA 1ELAA 1EZQA 2Q6DA 1OWKA 1FN8A 3SV6A 2ZIQH 4AX9H 1L4DA 5BRRE 3PTBA 1BA8B 1TAWA 2OC7A 2O8TA 4ZHMU 3VXEH 4YZUA 2Z9LA 1SFQB 2D1JA 4K5ZA 3OTJE 2ZTZA 4IC6A 4TPYA 2P93A 2EI6A 1ZZZA 4GUXA 1Z71A 1O38A 3P8NA 2TGPZ 3W95A 3CNRA 1EZXC 1OWIA 2ZWLH 1OSSA 1XXDA 2A5IA 1Y3WA 1Y3UA 1TNGA 2P3FH 2K0QA 2VBCA 3MOCA 2ZFSA 1O36A 5DSFA 5EXLA 1K9OE 1S82A 1NRRH 3SHCH 5EW1H 1GJAB 2EC9H 1NFXA 4XOJA 1E79D 5C17A 5EQQA 1D6WA 4NFEA 2SGPE 2VVUA 4ISLA 4THNH 2BX4A 1P04A 4WMDA 3DT0H 1S0RA 4X6OA 1BIOA 1F92A 1H4WA 3S69A 3R3GB 1XXFA 3LOXA 3RXPA 2ZP0H 1SBWA 4DY7B 1O2KA 1YY3A 4CRAA 1S85A 1GHVH 4OS7A 1EZSC 3QZRA 2BDGA 2Z7FE 4Q7XA 2V3MA 2D2DA 1V6DA 3D49H 4RKOB 1ZSKA 5FX6A 1Z7KA 3LC3A 2QXHA 3I78A 4UFGH 1LPZB 3U8TH 4B6FA 1DE7H 1BTYA 2QV1A 2XW9A 5HIYA 2ZPQA 2Z3EA 6LPRA 1NO9H 3TK5A 4YXWD 2V3HH 3P6ZB 1WXRA 3GCTG 4A5TS 2STAE 3BIUH 4B75A 2AFQB 2AERH 3P95A 3F9GA 3LJOA 3PLPA 1ZRKA 3SJ9A 2K1QA 2AYWA 7GCHF 4Y10E 2PGQB 1BRBE 4MLFB 3UOUA 1V2MT 4NGAH 5GWZA 2HRVA 3MYWA 2FOBA 1O3MA 1OXGA 1COWD 4Y79A 3T2NA 4Z1MD 4BAHB 4ZHAA 1SMFE 2TRMA 8ESTE 3HGNA 2AGIX 2VGCC 2VU8E 1BJVA 1TX8A 3LIWA 1GMDG 1TRMA 3ATIA 5EXNA 1O2YA 1NT1A 1OWDA 4DT4A 2AHME 1ZTKA 1G2LA 1NZQH 2CF8H 1C1WH 2LP6A 5FBIA 5T3HA 1OP8A 3A86A 5ABWA 2GCHF 5J4QA 1E1RD 4X8TH 2IOTA 1UTNA 2WPDD 4YLQH 1O3JA 2ASUB 2Z3CA 2HVYB 1W10U 1F0UA 1NTPA 3ZVAA 1ZOMA 1GI0A 3EYDA 3M7QA 3SI3H 3F2GA 2J2UA 3U9AH 5GCHF 2ODYB 4Z0KA 3ZZAA 1H9IE 4E7NA 1SHYA 2R2WU 1P2MA 1QL7A 2FZZA 1K1LA 1FY3A 2YMSC 1UTOA 3TGIE 1VCWA 2PV9B 1ZPZA 3M37A 1TMBH 4ISNA 1BRCE 4NCYA 3M5OA 3ZZ8A 4MDSA 5E2PA 1NBMD 2BB4A 2XNIA 1KLIH 3ZVCA 1AVXA 1UCYE 3PWCA 1CHGA 1EAWA 2A7CA 2ANMH 3RXRA 9ESTA 3BTQE 1TPPA 3BG4C 3UREA 1PFXC 1TBZH 5SGAE 4BXSA 1C2KA 1CSOE 1OYTH 1IQKA 5C0UA 2WUCA 5KGOA 2OK5A 1O0DH 3QZQA 1T7CA 2QCYA 4RT0A 1MKXK 1E36B 1P2IA 5EJLA 1S84A 1HNEE 3TK9A 3PB1E 1BT7A 4DIIH 2NU4E 3KGPA 1HYLA 5A09A 1SHHB 1W3CA 3M3TA 2ZCHP 5BPEA 1UHBB 1A61H 3DSPA 1TGSZ 1RTFB 3SU3A 3WWBA 1EAUA 3F9EA 4CR9A 3EA9A 3SU1A 3GCHB 1S0QA 1HAGE 3U28C 1K28D 2DE8A 1GGDC 2KZ4A 1EUFA 1E0FD 2A4RA 1P01A 4U30A 3KQ5A 3SZEA 3LGUA 3LKWA 2J98B 2BQ6B 4GLYA 3OE7D 1C5YB 5DP4A 1PYTD 5EGMA 1GBBA 1GBIA 4TYDA 3SU4A 3BTGE 4B2AA 1MCVA 1UTQA 3KHVA 3RXLA 1EJMA 2NU0E 1ZTLA 3OEED 4VGCC 1XX9A 2FO9A 1TPOA 1EPTC 1YF4A 4XE4A 3A80A 3UY9A 3W94A 2WHXA 4PROA 3EAJA 1O3OA 1WOFA 2QF5A 1Z1JA 1LPKB 1UCYK 1KXDA 1ZJKA 2ULLA 1P2NA 2HLDD 3GS9A 1DXWA 1TGNA 2F9OA 2EQNA 1JIMA 4WY3A 1DY8A 2J34A 2FOCA 1YYY1 2XCFA 3I29A 1C4Y2 4NG9H 3UWJH 2WV4A 1O39A 1Y59T 2BD3A 1P2OA 3PMHB 2F9BH 5F03A 1ELGA 1V2PT 3TPIZ 2BDAA 4INHA 3JZ1B 4WH6A 3Q76A 2A4OA 3URCA 1RIWB 4AYVB 2C3SA 3TITA 3SUDA 1IQHA 4K1EA 1MAYA 5AFZH 1O5EH 1AI8H 2C8YB 4A92A 1L0ZA 3RMNH 1SOTA 4K1TA 2Z9IA 3BF6H 5E0HA 5A0CA 2ZEBA 4Y7AA 1SI5H 2JH5D 4YESB 1SL3A 3VG8A 3BTWE 2BHGA 3M7UA 4I8HA 4Y71A 5GJ4B 5FL7D 1PPGE 5A8YA 5F8TA 1C2EA 1MQ5A 1C1UH 1GHBF 3PO1C 1C1QA 1BMMH 1UTMA 2A32A 4TWWA 2I6SA 5FXLA 3A85A 1W0KD 3PMJA 4RI0A 4Q4LA 1O35A 5DP8A 1QA0A 1CGIE 5B6OA 1NU9A 4NIYA 1QB9A 2Y5FA 3I77A 5CHAB 1MTWA 3OX7U 1CBWB 1EOLA 4ZROA 3GY4A 1V2RT 3VGCC 1CA0B 2FI5E 2OXSA 3Q3KA 2DUCA 3NRLA 4B2BA 3SGBE 4BOHA 2B9LA 2Y5GA 1AFEH 2A1DB 4FUDA 5EG4A 2FLBH 1A46H 1S5SA 1EP6A 1ABIH 1M9UA 1XUFA 2FTLE 4HGCA 1GJ4H 4ISHH 9LPRA 2QC2A 5I25A 3LH1A 3NZIA 2XBVA 4GPGA 2ZGJA 4ABIA 4DVAU 1ABJH 2ESTE 1SGYE 2P94A 3N7DA 2O8MA 3SGAE 2A4GA 1DFPA 1ETTH 1EXFA 2BDIA 1PPHE 1WU1A 4F49A 5LGOA 1OPHB 5E0JA 3TJNA 1G32B 2IN2A 3BTEE 1SFIA 3BEIB 5A0BA 2AGEX 3L6PA 1GI8B 2AMQA 4BAOB 2BMGB 2ZKSA 3RXSA 1DWEH 2G52A 1ELFA 3PRBA 1J9CH 5DP3A 4AOQA 1SR5C 1D9IA 4A7IB 1O3HA 3BG8A 1SQOA 2GV6A 1QRWA 3MU5A 2GKVE 3Q3YA 1CA8B 1DM4B 4MNYA 4I8LA 2HVXA 3M35A 1D4PB 4JYTA 2BOKA 5GNDA 4AYYB 4K60A 1T8MA 1TQ0B 1QJ7B 2TPIZ 2PSXA 1ESBA 4NWKA 1MTNB 3QWCH 3IWMA 2FIRH 3S0NA 1O2NA 3ZVBA 4YLUA 1YLCA 2FS8A 4HI3A 3RC6A 5FPTA 2FM2A 1SGCA 4HZHA 5J4SA 2CMYA 1LHCH 3MNXA 2EEKA 1C1OA 3FP7E 4P00A 3K65B 1TGCA 3BTME 1AD8H 2JIZD 1BMNH 3U8RH 1VGCC 1GG6C 3V7TA 3PTNA 2FOHA 4LXBH 3UFAA 1PPCE 3LONA 5FHTA 2GGVB 5L6NH 3KQEA 4OS6A 3GICB 3B8JA 1NM6A 1K2I1 3F0OA 4UDWH 2GTBA 4JZFH 3SNDA 5T6GA 1HAPH 3GY3A 1C2FA 2BD5A 3RDZA 1OX1A 1YGCH 5E0GA 3SI4H 2HNTC 4AG1A 4ABGA 1NPMA 7ESTE 2ZQ1A 2XCNA 1GMHG 1FQ3A 1UTPA 2UUJB 1O2PA 2C90B 4CBOA 3FZDA 4OGXA 5F8XA 1ARCA 1GDNA 1O2VA 5EJZA 3LGVA 2WV5A 1C2JA 1L1GA 1AMHA 1F0SA 1TWXB 1N8OC 2ZTYA 3RXIA 1EFRD 2QAAA 1P2QA 3AVZA 5HM2A 2QGRA 3CS0A 1NBME 3EE7A 5LH8A 3FFGA 2J5UA 1GDQA 1WV7H 2P3TB 2BD2A 1ZHMA 3SNEA 1LDTT 2HWLB 4MG3A 5CHBA 1VCQA 3VB4A 3ZYDA 1C2MA 3ODDA 4MPXA 3QGNB 5JBAS 2G4TA 2P95A 1VZQH 1ZYOA 2B8OH 4X8SH 3FP8E 5KEDA 1HBTH 2G51A 3SJ8A 1O5GH 1O37A 1O3KA 2Y81A 5GXPA 1WAYB 3UTUH 1AWHB 5GPIB 1AE5A 3SNAA 4ZKNU 2QN5T 3M3SA 6CHAB 3UUZA 4YTAA 2EI7A 5C5NA 2WUBA 4TY6A 3U69H 3ITIA 4ZKRU 1T8NA 1OS8A 1QRXA 3B23B 3TGJE 2FDAA 1NROH 2BDHA 3KYGA 1A0JA 4NIXA 1KMHB 2CK3D 2GT7A 1A7SA 4SGBE 2ZHQH 1O5FH 2YNAA 4LOYH 1WQSA 1THPB 1AVWA 3NCLA 3FO8D 2FI3E 5CE1A 2P16A 2RCEA 2PKSB 1C1MA 2GJGA 5C2ZA 2UUKB 2FYQA 1NFYA 2ZECA 2FX4A 3GY8A 1UVOA 1BDAA 4FUGA 1BMLA 1F0TA 2ZA5A 3AAVA 1P57B 1W12U 1DUAA 5C1UA 1DT2A 3KF2A 4K2YA 2H1UA 1GWAA 1YPKH 3UR9A 2KAIA 4AZ2B 1HXFH 3A8CA 2CJIA 2OC1A 1Z8IB 1L1NA 3QX5H 4ABAA 2D26C 4JZIA 3D65E 4OS2A 4BAKB 1C2IA 2O8WA 1AGJA 2VWNA 3ESTA 4ABEA 3VB6A 1HJ8A 4XSKU 4X6MA 2XC5A 5T6FA 3KQCA 1LMWB 4ZHLU 2FP7B 2PW8H 2OC0A 3EDXB 5IK2D 1KLJH 1O2SA 3OEHD 1O2MA 2QY0B 5A0AE 1B5GH 1ZRBA 4B76A 1NRNH 1LCYA 1Z8JB 1C5RA 2PUXB 2STBE 4DG4A 4DGJA 1A1RA 1S6HA 1CGHA 2WPMS 3RLWH 4XRNA 1O3BA 4RKJB 1UW7A 3TH3H 1MQ6A 2WYGA 3GCTF 5HMAA 2YMSD 2UWPA 2XC0A 2A2XH 1FX0B 1P05A 1SGFA 3MNCA 1ID5H 5FAHA 4UONA 2XOKD 3Q00A 2F3CE 2A45B 1W7XH 3RXVA 1LVYA 3ZZ4A 4BTIB 1KLTA 3M61U 2Z9JA 2ZZUH 4FVBA 1GHXH 2Y82A 1P2KA 3TNTA 4Y0YE 1EP5A 1VR1H 3DCLA 1IQGA 1THRH 4IN1A 2ALVA 2BY5X 3R0FA 2OINA 4A6LA 1H1BA 2GZ9A 3FANA 5EPYA 4DOQA 1PQ7A 5CDFE 1CT4E 4B71A 4YOJA 4GVUA 3ELAH 1E34B 1YPHC 1GMDF 2DE9A 4XDEA 4BTUB 1IHSH 1UTLM 4X2WA 1BOQA 1GBJA 1V2WT 1MKXH 1L4ZA 4X0WU 2P59A 4JZDH 3TJVA 2ZDLA 3MMGA 1XVOA 2ZPRA 3SU5A 3TJOA 1YCPK 1IHTH 2SGDE 2W3KA 3M5MA 1P09A 4Y11E 1BTUA 1HAZB 1ZMLA 1KIGH 4INLA 2R9PA 1QHRB 1W8BH 2W3IA 1C5NH 1JOUB 1KXAA 1UK3A 1BMAA 3PLBA 5IDKA 2ODPA 3U1JB 3P8OA 3MO6A 4ABBA 2FODA 2R2MB 2PTCE 4H6SB 1ZPBA 1NU7B 4GCHG 3JZ2B 4YM9A 1XUKA 2BOHB 1O3LA 2QF0A 5ETXA 2KR7A 1UVPA 4KELA 1E38B 1W14U 1K1NA 1S6FA 1YM0A 4NWLA 1GL0E 1IAUA 1LHFH 3GISB 1IQIA 3ZZ7A 1A0HB 1UCYH 5K0HA 4IBLH 3T29A 3N7OA 4K1SA 8LPRA 1XKAC 4DIHH 5LPFA 5B6LA 2AH4X 3LPRA 2O8UA 3N7EA 1LHEH 3TGKE 1V2JT 1Y3VA 3A82A 2OBQA 4I8KA 2IPHA 2BTCE 1HRTH 4K8YA 2TGDA 2VIVA 3U1IB 2GMTB 2ANWA 4D8NA 3F3BA 1GCTB 3FOAA 2PKAA 3RXEA 2ZG0H 1SGFG 3GDVA 1O31A 4BTTB 2GV7A 3GYMA 3A7ZA 3P17H 1Z8GA 2FPZA 2BY7X 4CRFA 2SGQE 2P8OB 2FOGA 3WW7A 2O8LA 2J94A 3FP6E 3LGIA 4Y8ZA 2V0BA 1GI2A 3KYFA 3E16B 4IC5A 3SU2A 1TALA 1MD7A 1Y5AT 3GCHC 3T27A 4AFZA 2ZCLP 1IQEA 1FY5A 5C0TA 1T4UH 5FCRA 1ZLRA 2PGBB 1DX5M 1FXYA 1AB9B 1G3BA 1LPGB 3PLKA 1MD8A 2GP9B 1FIWA 2IJD1 5JDUB 3KQDA 3H09A 1O3DA 4R8TB 4JZ1A 2HGTH 1QQ4A 4DT7B 3F0PA 1YPMH 1TB6H 4FOUC 2JJ1D 2H9EH 2W7UA 3SQHE 5E2OA 1THSH 1ZMNA 5JBCS 1QRZA 3GY5A 1H8ED 5FBEA 2LNCA 2HOBA 4MVNA 5DJ7A 1FY1A 1RJXB 4B73A 2F9UA 4X1SU 4RSPA 2CXVA 2KFWA 1B0EA 1W13U 1F5LA 1G3DA 1FZZA 1EB2A 6GCHG 2ZU3A 3O8CA 8GCHG 2A5KA 3URDA 1ANBA 2G81E 3F9HA 4FETA 5EU8A 1GJDB 1GBTA 1BRAA 1C5OH 3ZZ5A 1RIWC 1PPBH 4I8GA 4CH2B 5ESTE 4Y7BA 4ZCNA 1IQJA 1PPEE 1RXPA 2QF3A 2ZDKA 3DFLA 4MTBA 1BTXA 2J9NA 2ZDMA 1K1JA 4XBDA 2Q6GA 1O2XA 2RG3A 1QB1A 2CN0H 3UNQA 1KXFA 4B74A 3RXQA 1GBLA 2WPJS 1QBVH 1O30A 5C67A 3UNRA 3AK5A 1SOZA 2VH0A 3HATH 1C4U2 2GVFA 3SBKA 2BD9A 2BD8A 3T62A 2XXLA 5LPEA 1KYNA 4JK5A 3GDUA 3GYLB 4DJZB 1P9SA 3FAOA 1BTHH 1CGJE 3B9FH 1KY9A 2BLVA 1GI1A 5C5OA 2A0QB 1O2JA 1ELVA 2F9PA 1UVUH 3LH3A 2THFB 1O32A 2ZC9H 5JPMH 2R3YA 3EA8A 3OTPA 1OP2A 1H9HE 1ZSLA 4M9FA 4XFQA 5CHAC 8KME2 1O2OA 1CBWC 3FKSD 1H8HD 1QGFA 1GBAA 3ZVDA 4AN7A 1CA0C 1GJCB 3F68H 2WPLS 3SJKA 2CHAB 1O5DH 1NRPH 5JYIA 3S7KB 1DY9A 1CT0E 4X2XA 2GZ8A 1ZHPA 1HFDA 2FOAA 3MO3A 3SUFA 3SO3A 2W5EA 1C1VH 3K6YA 1AHTH 2R0LA 1E37B 2VVVA 1ESAA 3HK3B 3PWBA 4IW4E 1DUEA 1WBGB 1WSSH 1GGDB 1AZ8A 1QL9A 1YPEH 3F1SB 1AO5A 2OC8A 2SGAA 3GCNA 3UIRA 1QJ1B 3SGQE 3E8LA 5EQRA 2HPPH 1VJAU 1FY8E 3TNSA 2A5AA 2R0KA 3RXGA 1BMFD 2NWNA 3MU0A 2ZDVH 4I31A 2OUAA 1C1PA 4HFPB 5I46H 3AAUA 2XTTB 3BEFB 4BAMB 1OWJA
chains in the Genus database with same CATH topology
2QA9E 1QY6A 2RDLA 1T32A 4D7FA 3MU1A 3M5LA 4CHAB 1TGBA 4Y8XA 4INKA 1O3IA 5IYTA 1GBFA 2IJOB 3BTDE 1GJBB 1W0ZU 4AFUA 4LZ4B 5EQSA 2ZGHA 1MTNC 1AFQB 3U98H 1OWEA 3L33A 3HPTB 3DUXH 1UTKA 2O9QA 1T4VH 3MFJA 3LGTA 4UE7H 3RM0H 3L3TA 1MCTA 4AORA 4F4OC 2BZAA 1A4WH 1T8OA 1GMHF 3A7TA 3E1XB 1DVAH 1T31A 2Z94A 1SLWB 1TNHA 1GI9B 2GCTB 1NRSH 2XBYA 3NUMA 2QIQA 4OS5A 1DANH 1TIOA 1JMOH 1GVKB 1MKWK 2QXIA 5GIBA 1GPZA 1BTPA 5A8XA 1GBEA 4YOGA 1F2SE 4H4FA 1C9PA 4ISOA 2ZDAH 1BHXB 2R3UA 2ZHDA 1O3GA 3M5NA 3BTKE 5A2MH 1KXCA 2Y5HA 2KAIB 5DK1A 1AU8A 1HJAC 4R0IA 1HB0B 1ZJDA 5DGJA 1GI7B 1Y3YA 1ELEE 3ZYEA 2UUYA 3A89A 1SGQE 3M3VA 1OP0A 3OY5U 3A8BA 1TPAE 3IITA 3BIVH 2Z6BD 3RXDA 1H8IH 1YKTA 2ZGBH 4O9VA 2PHBA 3RXAA 5TCCA 2XWBI 3SJOA 1XVMA 3RUOA 2ZNKH 1QQUA 1YPLH 1TLDA 3ENSB 2XRCA 2NU1E 2OQ5A 4CREA 1AQ7A 1IQFA 1IQNA 3A81A 4ZUHA 3SUEA 3MHWU 1GBCA 2ZGXH 3GY2A 1SVPA 4X1NU 1TNLA 3RXMA 4X8VH 3H7OA 1J16A 1EZUC 3QUMP 1A3BH 1WYKA 4D76A 1EAXA 1Z6JH 3Q77A 6CHAC 1TRYA 1YBWA 3MH6A 3A7VA 1SSXA 1D3QB 1HV7A 1RFNA 4OS1A 1F7ZA 4TPIZ 2FS9A 6ESTA 1MTVA 4WMFA 2BY9X 1Z8RA 1TBRH 4IMZA 2B0FA 3E90B 2VWMA 4E05H 1SPJA 1G9IE 1ORFA 2RA0A 3EA7A 1GVLA 1LHDH 1RRKA 1TX7A 2J38A 1J8AA 2PUQH 2PR3A 1XKBC 1TRNA 2NU3E 1BRUP 3SNCA 1AVGH 1K22H 1N6XA 4U01A 1G3CA 1DWCH 1NFUA 2BLWA 3RMOH 3RXBA 4AB8A 1EPTA 1B7XB 5DP5A 1C5ZB 2PKSC 3CS7A 1MAXA 1MTSA 4FUIA 3V13A 4LK4A 3Q3XA 1O2ZA 1TX6A 2VB0A 3EE0B 1U6QA 1FAKH 2V3OH 1C9TA 1QJ6B 2GDEH 1BITA 2LPRA 3AASA 3QK1A 4KTUA 5EW2H 1IOEA 1O2GH 2VIPA 4M7GA 4MNVA 1P11E 1A5HA 5EPNA 3T26A 1YCPH 1BBRK 1Q2WA 2OTVA 3E6PH 3MH4A 3RU4D 2ZTXA 2CGAA 1J14A 1O2IA 1VITG 2FEQH 1O2HA 3NPSA 4WF8A 2BVRH 2I6QA 1NS3A 2RA3A 4H6TA 3ZV8A 4CRBA 4K69A 1ESTA 1C4V2 5AFYH 4NIVA 1YLDA 2ZI2H 1O3PB 4I32A 2BLQA 1V2OT 1HPGA 1LKAA 3UQOA 1C5PA 1DLEA 2HALA 1AN1E 1O2TA 4RN6A 5AVDA 1LTOA 5DO4H 3RXTA 2FESH 1QIXB 2CF9H 1JRSA 1MH0A 1OOKB 1GHAF 2VIQA 3P8GA 2WPHS 2ALPA 4FU7A 4NA8A 2EI8A 1YCPM 1HJ9A 2PKAB 1KTSB 1XUIA 3C1KA 1TOCB 4J2YB 2BVSH 1HCGA 4WH8A 2B7DH 2QXGA 2ZHEH 3A84A 1EQ9A 1JBUH 3S9BA 1C5MD 1XUGA 2JETB 4WVPE 2A7HA 2A4QA 3PYHA 3O8BA 4X1QU 1GHYH 1QTFA 2BQWB 1GI6A 4MPWA 4ISIH 3SJIA 1SQAA 4FXGH 1FPCH 1SGNE 2C4FH 4CRDA 2OD3B 1AKSB 1LO6A 1C2GA 3QTOH 1INCA 2ZO3H 2HNTE 1Q31A 1ELBA 1BHXF 4MNXA 3LGWA 4GCHF 3ZZDA 1ZHRA 3SV2H 3KN2A 1GMCG 1KSNA 1O34A 3P8FA 1G2MA 3LT3A 3SOSA 1AZZA 3UQVA 3RXKA 3TH4H 1N1LA 2PWXA 2VH6A 5DKMA 1DS2E 3QDZB 3ZZ9A 1TMUH 2C8WB 3MNBA 3E0PB 1W0YH 2BY6X 4BXWA 1JXPA 3NK8A 3UR6A 1CQQA 4WXIA 3BN9A 1UVSH 3DA9B 4ZKOU 1WTGH 4KGAA 1FONA 3GOVB 1GI5A 1PQAA 3BTHE 1S81A 1TNIA 2FXRA 3KQBA 1SG8B 3TJUA 2FI4E 2TBSA 1C2HA 1C2LA 1GHAG 2UUFB 4Z6AH 1BJUA 2FOFA 1E35B 2BX3A 4QT8C 2HPQH 2G5VA 3ODFA 4ZAEA 2Z9KA 1ZSJA 2J92A 3P92A 2TGTA 4AGJA 1SGIB 3SW2B 1QB6A 3HKJB 3NXPA 4JCNA 4I7YH 2H6MA 4UFDH 4ZXXH 3MTYA 3TK6A 3SUGA 2GMTC 4ZXYH 1GDUA 1XUHA 1P8VC 2BD4A 3PMBB 4E7RG 1EJNA 1GCTC 1FIZA 1TOMH 1YPGH 1LVBA 1MBMA 2A7JA 5ESBA 1Y8TA 3RXOA 3MU8A 1D3TB 1EASA 5DG6A 2P8OC 1UK4A 1G37A 1P3EA 1TNJA 3MI4A 2ZCKP 2SNWA 4CH8B 1K21H 5EOKA 4YO9A 4GAWA 4B2CA 3P70B 2V35A 1P0SH 1FNIA 1LQEA 3QTVH 2WPKS 4ZH8A 4ESTE 1XM1A 5JB8S 3A7WA 1AB9C 1ELDE 4I33A 3O8RA 2SGFE 1P2JA 2PLXA 1ZGIA 2P3UB 2CV3A 3TH2H 1BTWA 3BTFE 6GCHF 1V2ST 3ATKA 1HUTH 1T8LA 8GCHF 2WYJA 2M5TA 2AIQA 3RXJA 1RTLA 2PSYA 1NRQH 1BUIA 1QA7A 1C5WB 4D9QA 5FX5A 1HAVA 3A7XA 5E8EH 2HNTF 4U2WA 1VCPA 3T25A 1CT2E 4GHTA 1XUJA 1O3EA 2ODQA 3RLYH 4ASHA 1H8DH 2AMDA 2VIWA 2G55A 1O5BB 5L2YH 1MTUA 3A7YA 3ZVFA 4LZ1H 1TPSA 2AGGX 4DCDA 4Q2KA 1FLEE 3STJA 4X6NA 1HXEH 1MU8B 2ZU1A 3KL6A 3DFJA 4NZQA 1AKSA 2GZ7A 4FU9A 2JH6D 2OP9A 5C20A 1H9LB 4A1VA 3PV4A 1Z6EA 1O2LA 4HTCH 3VXFH 2VWOA 1LHGH 4UEHH 2BZ6H 1P3CA 3O8DA 2H2ZA 1QNJA 1DWBH 5TCAA 2C8XB 2ANKH 3QGJA 2G5NA 1J17T 3E3TA 1P03A 1NC6A 1F5RA 3A8DA 4CRGA 1FJSA 5FCKA 1C5QA 1SB1H 1YPHE 4FVDA 1FY4A 2BQ7B 2EA3A 2FTMA 1NY22 1GJ7B 1ARBA 1UJ1A 1ELTA 1HAOH 1BQYA 4ZMAH 1SGRE 3TIUA 2F9VA 2VGCB 3K9XB 3SZNA 3UOPA 4Y0ZE 3T28A 1K1OA 3A83A 1TMTH 1O5AB 3LGYA 1PQ5A 1O2QA 3HGPA 7GCHG 1C1RA 5TJXA 1LVMA 2A2QH 4Y76A 4Q80A 1EX3A 1ANCA 3BV9B 3RU4E 4AGKA 1DPOA 5G4BA 2CHAC 5H4IB 1VITH 1BTZA 3NWUA 3SHAH 2A31A 1YP9A 1O3FA 3STIA 4KTCA 1JIRA 1QURH 1QR3E 3FZZA 2GD4B 1GBMA 4J1YA 2BVXH 3E91A 2ZGCA 3CENA 2V6NA 2Y80A 1MKWH 4NA9H 1GCDA 3RP2A 1RTKA 3RMLH 2GCHG 2ZU4A 1V2LT 4OGYA 3S9AA 2QXJA 2BXUH 2FLRH 3QN7A 3RC5A 1DOJA 1HAXB 3RM2H 3V0XA 1AY6H 3GY6A 1MZDA 1RD3B 1GJ5H 3HKIB 5GCHG 2C8ZB 3MH7A 2OLGA 4JZEH 1O5CB 3S9CA 1A0LA 4NFFA 3BG4B 1C1TA 1DWDH 4MPVA 4YT7H 1ETRH 1TQ7B 4MNWA 4JMYA 2FWWA 1VJ9U 4JYUH 3VB7A 4IN2A 4CHAC 4WXVA 3A88A 3A87A 1V2QT 2H5DA 1QL8A 1TA6A 2BY8X 3KCGH 1GI4A 1SC8U 2UWLA 5HM9A 1SQTA 2AMPA 1BCUH 1AFQC 2BDCA 1W2KH 2BDBA 5FPSA 3SU0A 3LJJA 3H7TA 3ZZBA 1EKBB 1GJ6A 1C5LH 5DP6A 3OYPA 2TGAA 4AB9A 4UD9H 3DD2H 2FOEA 3E0NB 2AIPA 2PTNA 3G01A 4O97A 4IMQA 3VFEA 1P9UA 1JRTA 2OQUA 4VGCB 1YC0A 1EPTB 1KTTB 1CHOF 5CMXH 2GCTC 5JBBS 2BDYA 4XBCA 1BB0B 3UWIA 1P12E 4KTSA 1MUEB 1SLXB 1D6RA 4NZLA 2GDDA 5HGGA 1Q3XA 3ZVEA 1TFXA 3AW1A 1G36A 2ZF0H 1V3XA 2F9NA 4KP0A 5EXMA 1ZR0A 1FI8A 1FPHH 4WWYA 2YOLA 4B1TA 4TWYA 4X1PU 1SGPE 1J15A 3RXUA 4AG2A 1A5IA 1K1IA 2YNBA 1TE0A 4SGAE 2OBOA 3UPEA 4ABFA 2ZFRH 2ZFTA 1DLKB 4MQAA 3GDSA 1X7AC 3K6ZA 2VIOA 3SORA 3MH5A 3FVFB 1JWTA 3AW0A 1FV9A 3GCOA 3BSQA 3MNSA 1PPFE 2FMJA 1O2WA 1P06A 4DW2U 5L2ZH 1FN6A 1NN6A 3CP7A 1K1MA 4Y8YA 1BBRH 1ZMJA 3M36A 3D62A 1O2UA 2GX4A 4YOIA 1EATA 3K2UA 1RS0A 2FYRA 1PPZA 1QBOA 2XWAA 4A1XA 4FUHA 1SLVB 3VB3A 1GJ8B 3RU4T 3PO1B 1WTHD 2H5CA 4ZKSU 3BEUA 1UHBA 1HAHH 1HIAB 1O3AA 3VB5A 7LPRA 2ZPSA 1C1SA 1GL1A 1WUNH 4OS4A 1A3EH 1GHWH 1KDQB 1CU1A 1A2CH 1ACBE 5DP7A 1PYTC 1CHOG 2G4UA 1F5KU 1MMJN 3TVJB 1LKBA 3F9FA 5GDSH 2ZQ2A 2VINA 1TA2A 1MZAA 3VGCB 1CVWH 1V2TT 4ABJA 3SN8A 2FX6A 3U8OH 1GHBG 1C5VA 3TLOA 3PM3A 3A8AA 1BZXE 1TYNA 4GSOA 1O33A 1TABE 2SNVA 2W26A 4AFSA 1MU6B 1ELCA 1GBDA 3LU9B 3SQEE 1LQDB 1Y5BT 3ATWA 4D9RA 4FUBA 2Y7XA 3M7TA 2Q1JA 1G30B 2F91A 4X2YA 1VITF 2Z3DA 4K3JA 1C5XB 2ZHWH 1YPJH 3RC4A 4O3TA 2C93B 3UNSA 4D7GA 3EGKH 4IGDA 2D8WA 5JBTA 4Q7ZA 1HAIH 4FUJA 4NIWA 5AF9H 1ANDA 1BBRE 1DDJA 1AIXH 2FOMB 4NSYA 4XBBA 2OCVB 2Q6FA 3H5CB 1OYQA 3SV8A 1SGEE 1L1JA 3F6UH 3RMMH 1Z1IA 5C1XA 1V2UT 4FUCA 3SNBA 1SLUB 4Q7YA 3ZVGA 4TY7A 4FUEA 4CRCA 2AEIH 3T5FH 2AS9A 4BAQB 5DP9A 1V2VT 1CO7E 3ATLA 1UO6A 3MU4A 2ZU2A 2H9HA 3ZV9A 3KNXA 1QBNA 1L2EA 1CE5A 1K1PA 2PFEA 1ZGVA 1AUTC 5K7RA 1UTJA 3DHKH 1NESE 1AE8H 1Y3XA 2BXTH 3RXCA 1ZTJA 1HJAB 3SU6A 4JK6A 1TBQH 1DICA 2QYIA 1EB1H 3QLPH 5DPAA 4X6PA 1TGTA 3EQ0H 1WCZA 1V2NT 1C1NA 4BNRA 4BANB 1EAIA 3ZZ6A 4A1TA 1KXEA 3ZZCA 1HAYB 1P02A 4U32A 1XMNB 1EJAA 3MO9A 2F83A 2H9TH 1VGCB 1GG6B 4O03A 3OY6U 4I8JA 2VIDA 3VEQB 2JETC 4DURA 2NU2E 4FUFA 1GMCF 4KKDA 1HLTH 5EODA 2J95A 2ZFFH 3LDXH 1FUJA 1ANEA 2VVCA 3RXFA 1C5SA 3OU0A 1UK2A 4ABHA 1PQ8A 4AFQA 3LC5A 4CR5A 1AWFH 1O3NA 3V3MA 1GVZA 5PTPA 1IQLA 4K8BA 1C5TA 2Y6TA 2G00A 2ZHFH 1N8OB 4MPUA 1HGTH 4WMEA 3RXHA 1Y5UT 3QO6A 5C1YA 1UVTH 2XC4A 4H42U 1DSUA 1FDPA 1DXPA 3VPKA 1LVOA 3TU7H 3SV7A 3BTTE 2UWOA 4FU8A 1G3EA 3OSYA 4UFFH 1OWHA 3MWIU 1GBKA 3ZZ3A 4JYVH 1O3CA 2WINI 1UMAH 2HLCA 2JKHA 1P10A 1GBHA 1HIAA 2J4IA 2Z9GA 5JB9S 2ZFQH 2XBXA 1HAVB 3GY7A 2ANYA 1C5UA 1SGTA 3KEEA 1KDQA 1HDTH 3WY8A 2B5TB 4ABDA 1MBQA 1TONA 2TIOA 3C27B 3D23A 1QCPA 1W7GH 1ZPCA 2ZU5A 1ETSH 5HXFA 1AUJA 2G8TA 1NFWA 1N6YA 3ATMA 1DITH 5C3NA 2GT8A 4NA7A 2BD7A 2XBWA 3KIDU 2BYAX 1F0RA 5F8ZA 1DSTA 1FMGA 3SV9A 1IQMA 1GI3A 4CBNA 3PMAB 5L30H 5F6MA 2VNTA 1RGQA 4Y6DA 1PJPA 5HYOA 2W7SA 1W11U 1B0FA 4WJG2 2VWLA 7KMEH 4IS5A 1GHZA 2ZFPH 3PROA 1V2KT 2JH0D 4YT6H 2XYAA 4O3UA 5AHGH 2ILNA 1QFKH 1D3DB 1EOJA 1O2RA 1A5GH 4X2VA 3IG6B 3V12A 1GJ9B 1KXBA 1OKXA 3HK6B 1C2DA 2WPIS 1SGDE 2Y7ZA 2SFAA 1FAXA 5LPRA 4X8UH 3S7HB 1D3PB 2BLOA 2SGEE 2ZDNA 1S83A 2VJ1A 4X1RU 4E06H 5T6DA 5A8ZA 4UFEH 4GHQA 4NSVA 1TNKA 2BM2A 1WQVH 3NKKA 5FPYA 1ELAA 1EZQA 2Q6DA 1OWKA 1FN8A 3SV6A 2ZIQH 4AX9H 1L4DA 5BRRE 3PTBA 1BA8B 1TAWA 2OC7A 2O8TA 4ZHMU 3VXEH 4YZUA 2Z9LA 1SFQB 2D1JA 4K5ZA</