1XUFA

Trypsin-babim-zn+2, ph 8.2
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
molecule tags Serine protease
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xufA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xufA02
2O8WA 1TNGA 1NFUA 3VPKA 1SOTA 1O5DH 3E1XB 1TLDA 6CHAC 2XCNA 3ZZ5A 3PLPA 1O3DA 4ZROA 3HGNA 4DW2U 1DT2A 1HBTH 2PKAB 3P17H 1D6WA 1Y3UA 4FVBA 1OSSA 1PPFE 2F9BH 1X7AC 1VGCB 1BITA 1JIRA 1GI7B 5T6FA 3UUZA 1ANDA 1TRNA 1K1OA 1KDQA 2F91A 3Q3KA 1AKSB 1FQ3A 4AN7A 2BX4A 3TJUA 1MZAA 3PO1C 2G5VA 1YPJH 1CA0B 2WPKS 2M5TA 2ZI2H 3MYWA 4FUGA 1LVMA 5ABWA 1S84A 1VITH 1THRH 1Y5BT 3A7TA 2UUYA 8ESTE 3RXJA 3HK6B 4I33A 4B1TA 2H9TH 5HYOA 1P2IA 4KTUA 1O30A 1KDQB 1Z8IB 2PR3A 1S0QA 5LPRA 1O2XA 5C1UA 2B5TB 2C8ZB 1UVTH 3GDUA 2ZGHA 2HOBA 2P59A 8GCHG 3TJVA 2BLOA 4MNYA 4HTCH 4I8KA 1ANCA 2GZ9A 4X6PA 3UNRA 3ZVDA 1MCVA 4AZ2B 3LGVA 2BXUH 4XBDA 1Z7KA 2LPRA 1AO5A 1ZJDA 3WY8A 3KN2A 3QX5H 1D4PB 3LGUA 3T29A 4BNRA 4ASHA 3LIWA 4KKDA 4I8LA 1XUIA 4ABGA 1G36A 2WPLS 2WYGA 3I77A 3ZV8A 2ODQA 1KLJH 1T8OA 1THPB 1PQ8A 2NU1E 4RKJB 4H42U 4BXSA 3UIRA 3LT3A 3IG6B 4AFUA 2GDEH 1SGTA 2GV6A 1BRUP 5EODA 1FAXA 3LGYA 2GV7A 1YLCA 1NN6A 2ZGJA 3QLPH 1ELEE 1O34A 1IQEA 1GJ5H 3RC5A 2WV5A 1C5QA 1OP8A 2RA3A 1FY4A 2PGBB 5C1YA 1WV7H 1KXFA 4HI3A 4KP0A 3ATLA 4IC5A 4YT7H 1QHRB 2BOHB 3RC6A 1SG8B 2KAIB 4JZEH 3V12A 1XXFA 2Z7FE 3GCTF 7ESTE 2FODA 3TH2H 4DGJA 3DD2H 3P8OA 1S5SA 2J94A 3SV9A 1JIMA 2EI7A 2A4OA 1XUKA 4O3TA 1EXFA 1MD8A 1YCPK 3Q77A 3EA9A 1S82A 4CRBA 1K1LA 4JZDH 2JKHA 1ELDE 2BZAA 2EEKA 2H9HA 1GVZA 2PSYA 1S81A 3A80A 4TWWA 1BTPA 2VIQA 3F9HA 4LZ1H 1IQLA 1ELVA 1ORFA 1GBFA 4DY7B 1IQMA 2A2XH 1P01A 1BT7A 3DFJA 1W13U 1TA6A 3RLYH 1JBUH 1EASA 3QTVH 1E37B 5A8ZA 2BD8A 1GBMA 3RXIA 1CU1A 1O3FA 1HNEE 1ZMNA 1MMJN 1MU6B 4DT7B 1BRAA 2R0LA 1E38B 3P8NA 3BTWE 7GCHG 1JOUB 1XMNB 2O8MA 1RJXB 4ABEA 2SGQE 3B9FH 1C5LH 1BJUA 1IQJA 4ABHA 2W3IA 3B8JA 1O2ZA 1YBWA 5E2PA 2ZU3A 2FWWA 2ZU2A 1ZHPA 2BVRH 3C1KA 4MNXA 5I46H 2GCHG 2XNIA 1GGDB 1XUHA 3RXTA 5AHGH 4X8UH 3MO3A 3A8CA 5FX5A 1P2QA 1TNIA 1KXCA 1FAKH 1S0RA 1A3BH 1FIWA 1ZPZA 1GCDA 4NSVA 5DP9A 2F9VA 4X8TH 1INCA 1EOLA 1NU7B 2FOBA 3UQOA 1T8MA 4Y10E 1HJAB 1YPLH 1OX1A 4LOYH 1GDNA 1GBDA 2FPZA 4FUBA 1DY8A 2P8OB 3U1IB 3EYDA 4MPUA 3SORA 1ABJH 1BHXB 1GI8B 1EB1H 1QQUA 1O5BB 4X8VH 3S7KB 1XVMA 3BG4C 3E16B 1TPSA 1IOEA 4FXGH 1CHGA 4I31A 4BAKB 3UQVA 4MTBA 1C2GA 2VVVA 2PUXB 1C1QA 1O5EH 1Q31A 8GCHF 2C3SA 3M35A 3NPSA 3TIUA 4BOHA 1FPCH 2QV1A 2BY5X 1Z1IA 3R3GB 1AB9C 2G8TA 4MG3A 1H8IH 1EX3A 2O8TA 1EPTC 2XWAA 1LPZB 1A2CH 2OCVB 2WPHS 3ZVEA 2A7CA 1UK2A 1GHBG 4NA8A 1TPOA 3ZZ3A 3URCA 1L1JA 3ZZBA 1P2JA 2A5KA 3MFJA 3SN8A 1ESBA 1ETSH 1QL8A 2ZA5A 1MKXK 4X6NA 2FM2A 1HAGE 1DWBH 4F49A 2ZCLP 5ESBA 4ISNA 2THFB 5JB8S 4YLQH 3NZIA 3R0FA 1L1NA 5FX6A 3V0XA 3RXOA 5EW2H 1UTNA 1WUNH 1ZHRA 3A87A 2BVXH 2HPPH 3RMMH 2VIWA 1EZSC 1FJSA 1P05A 3GOVB 1RTLA 3UY9A 2Z9KA 1KIGH 1BRBE 2Q6FA 3IITA 1VJ9U 1HB0B 5CE1A 4ZXXH 2ZWLH 1AFQC 5B6OA 1C5PA 5F8ZA 4ABIA 4D76A 2Y81A 2Y80A 4CR5A 1WTGH 1FY1A 4IGDA 4B2CA 3BEFB 3T5FH 1XM1A 1Z8JB 2FX4A 4WMEA 1O2QA 2ZTYA 1BJVA 2BY8X 3A83A 4X1PU 1C2KA 2GVFA 5DKMA 5FBEA 4OS5A 1W10U 1Y8TA 4A5TS 1YGCH 2SNVA 1P11E 4HGCA 3PTBA 1KLIH 2CXVA 2ZO3H 1O2VA 3STJA 5A0CA 2RCEA 1TX6A 3CP7A 5BPEA 2C8WB 4NIYA 5JYIA 2CHAC 3DT0H 1NU9A 1O35A 2W7UA 5DP4A 3BTHE 3KF2A 4INLA 5BRRE 4K2YA 2GDDA 3CENA 1NFYA 3T2NA 1HRTH 2AFQB 2EA3A 5AF9H 4ZUHA 4ABAA 1T4VH 3K2UA 1WQSA 4KGAA 1AN1E 2GCHF 1WQVH 2ZDLA 4INKA 1OWIA 2ZU5A 3LGTA 3SU2A 1GPZA 4X1SU 4ISLA 4SGAE 4X2XA 2F9UA 1ELAA 2O8LA 4A6LA 2A4RA 1Q2WA 1KY9A 1C1NA 2JH5D 1GCTC 2H9EH 1IQFA 1FY3A 1TNKA 2VB0A 5CHAC 4D7GA 4D9QA 1HGTH 3UOUA 1A61H 3TH3H 3OYPA 1C5RA 3QGNB 2PGQB 4YM9A 1TNJA 3HK3B 1VITF 4AYVB 2PTNA 1O2OA 2J92A 3PLBA 1O0DH 4JYVH 1L4ZA 4XOJA 4GCHG 5TCAA 4O3UA 2P93A 5AVDA 1ETTH 1HFDA 3QGJA 4KTCA 1PYTC 4FU9A 2VGCB 2UUFB 4ESTE 3BF6H 4O9VA 4JCNA 1DANH 1D3DB 1PFXC 2FOGA 2D8WA 3E6PH 4TPYA 4MNVA 4Y8ZA 2FDAA 1GI0A 2OC1A 2XC5A 2ZFFH 2FP7B 1GMCG 3ZVBA 4NA7A 3RC4A 1UVUH 1NRPH 3OX7U 3SNDA 1TMUH 4DVAU 1O3KA 3K6YA 4ISOA 4MQAA 4BXWA 2BLWA 1YCPM 4AB9A 4NIVA 3EDXB 3MH7A 2G4UA 1ZGVA 4AG1A 2R3UA 3ATMA 3ATKA 1P2KA 1B5GH 2H1UA 3LJJA 1NT1A 1AFEH 4UFEH 5ETXA 1N8OC 4ZHLU 2D2DA 4TPIZ 1DSUA 1ZLRA 2FZZA 1LQEA 3BTKE 1MBQA 3M5MA 3BIVH 4B75A 1GJ9B 1GBLA 4DURA 3GY3A 1P57B 1EP5A 1P06A 4IMQA 3SQHE 3U69H 1AY6H 1V2UT 2BXTH 2XWBI 4CRFA 1XX9A 4J1YA 1UTPA 2W5EA 1G3DA 5GJ4B 3RXUA 1ZSLA 1YCPH 1FMGA 3RXMA 1SGIB 1RGQA 3UREA 3RM0H 1RS0A 4B73A 1CQQA 1JMOH 1QBOA 2A1DB 1TE0A 4CH8B 3KEEA 2GT8A 1XXDA 3E90B 1VZQH 4GVUA 5CMXH 3UNSA 1EZXC 1F0SA 3MI4A 3ZZ9A 1AWFH 2EI8A 2VU8E 4ZKSU 3A81A 2PUQH 1K28D 2GGVB 1MUEB 1ELFA 1CGJE 1N6YA 3UTUH 5K7RA 2ANKH 1SMFE 1AVWA 1OWDA 3ZZCA 3PB1E 1TGNA 5F03A 1T8LA 2BD9A 3KGPA 2ZU1A 1GMDG 1QJ6B 3U8TH 1TOMH 4I7YH 1P03A 2GP9B 3U8RH 2BMGB 1ESAA 1PPCE 1HYLA 2ZGXH 4OS6A 2ZP0H 2ZFSA 1YLDA 1GJCB 1J8AA 1V2WT 2GCTB 4CHAC 2ODYB 5IYTA 1SVPA 2GZ8A 1DS2E 1P3CA 1C2HA 4WH6A 1Y3XA 5G4BA 3VFEA 1P04A 4ZKOU 1YPKH 1GHVH 1O3HA 4K69A 4YZUA 1O3AA 2BDGA 2FO9A 3F6UH 3Q3YA 1DLKB 3OY6U 1BDAA 4FUCA 2FOFA 1O37A 1A7SA 2ZZUH 1FONA 1D3QB 3RXSA 1O2IA 1O2UA 4X0WU 3L3TA 1OOKB 1SC8U 4ISIH 2W26A 3O8RA 4D7FA 4E05H 1IQNA 1BMAA 5DPAA 3AAUA 3FAOA 4M7GA 3SU1A 2BLQA 1QGFA 4GAWA 2FYRA 1KTTB 4NFEA 3A82A 5EW1H 4BTUB 2QXIA 1D6RA 3PMAB 3SUGA 1O2RA 2W3KA 1YYY1 2FOMB 1LKBA 1OYQA 2G4TA 2PKSC 5EQRA 5C5OA 2IJOB 2IOTA 1QJ7B 1Z6EA 2XC4A 1OWKA 1ZJKA 5EPYA 1GMCF 1C2LA 1O2HA 2AIPA 1K1JA 1LQDB 8KME2 4XBCA 3M3TA 3CS7A 4NFFA 2WYJA 3MTYA 2HGTH 1HAVB 2A0QB 4YOIA 1V2OT 4WY3A 3VB4A 3FP6E 3LKWA 1SGRE 3SW2B 1SQOA 1OWEA 4WWYA 1PPHE 4WH8A 1O31A 3MO6A 3MWIU 1NFXA 1C5MD 2AH4X 2OD3B 4ABDA 5J4SA 3SV2H 4X1QU 1LHDH 1EAIA 1TPPA 4NWKA 1GBEA 1TFXA 3SUFA 5L2YH 3SGQE 3O8BA 4Y8XA 3ZVAA 1Y3WA 4OGYA 3I29A 3E0PB 2WPJS 4OS7A 3ZZAA 1O3BA 1O3GA 1NRQH 1NTPA 2FESH 3VB6A 4X1RU 1TB6H 1BBRK 1NRNH 1QRWA 1DSTA 2ANYA 1GJ4H 1MQ6A 3PV4A 3QK1A 4WXIA 4BANB 3SV8A 1EZUC 1TMTH 4I8JA 1GGDC 1YC0A 2ULLA 1MBMA 1C4U2 2DE8A 1LHGH 1UVSH 1SOZA 2FS9A 3ELAH 1GHYH 4AFQA 3E0NB 1GVLA 1BB0B 1QJ1B 1F92A 1GHXH 1SLWB 1BTXA 1C4Y2 5A09A 3GISB 1HJAC 5A0AE 2V3OH 2FTMA 4FU8A 4DJZB 1P3EA 1A0HB 4AGKA 2V3HH 1W3CA 6LPRA 2KAIA 2JETC 1GMDF 2TGDA 2R0KA 1AZZA 4UONA 4E7RG 3BTTE 2UUKB 1NO9H 1Z8RA 2ZPQA 4Q7XA 2CMYA 1GDUA 1TBZH 5FBIA 4A92A 1MTVA 2QF0A 4UD9H 3OTJE 3RLWH 1SGPE 2F3CE 1ZSJA 1D9IA 2C90B 3GCNA 2NU4E 1C5WB 3S69A 3MNCA 4X6OA 2BD3A 3OU0A 4K3JA 4XDEA 5DJ7A 1O2LA 2JH0D 1AD8H 1TRMA 2ZHFH 3QWCH 2ZTZA 3RMLH 4MPWA 1GI6A 3ESTA 2ZHDA 2ZQ2A 3KQCA 4B76A 1G3BA 2Z3EA 5JB9S 2BY6X 5C67A 2QIQA 2ZG0H 3RMNH 3ATIA 3SU5A 1J14A 1Z71A 3E3TA 2O9QA 4FU7A 1GBBA 1V2PT 1BA8B 1IQIA 5C20A 3RXVA 1LCYA 2G5NA 1LHFH 2Q6DA 2UWPA 1FY8E 2G55A 2BLVA 3PMJA 2YNBA 2Q1JA 3BTDE 1DICA 2PW8H 5GWZA 4A1XA 1QB6A 5JDUB 1OP2A 1TOCB 3T26A 1C2DA 3TK6A 1LKAA 5C5NA 2J38A 3TGIE 4GSOA 3A7YA 2P16A 2C8XB 3A84A 2Y82A 3OSYA 1TPAE 1G3EA 1H4WA 1FN8A 3MO9A 1LVOA 4JZIA 4FUEA 1QURH 2B0FA 2AYWA 1L2EA 4UDWH 2D1JA 1KLTA 4NA9H 1OKXA 3BIUH 1SGFA 4Q7YA 1HXFH 1N6XA 3IWMA 2ZHQH 2TRMA 3MU1A 1O2JA 2SGEE 3D49H 3QO6A 1IQGA 3PLKA 2TPIZ 5HGGA 1WOFA 1VCWA 2VIVA 3EGKH 1AMHA 1CGIE 6GCHG 2STBE 3GCOA 1GBIA 1TGCA 4A1VA 1UMAH 1BTUA 1EAXA 1SLUB 5DO4H 1K2I1 1O33A 3EA8A 1FV9A 1GI4A 1A0LA 3PM3A 1GI5A 1OYTH 1K1IA 1DOJA 1H9HE 3PROA 4BAHB 4NGAH 4MNWA 3ZZ7A 1QL9A 2BY7X 3P8FA 3MNXA 5LH8A 1F0RA 2UWLA 4IN1A 2QA9E 1IQHA 4WF8A 4O97A 3LOXA 1O39A 2YNAA 3BSQA 3LONA 3RU4D 3BV9B 4Y0ZE 2PV9B 1KXBA 2BVSH 2BDCA 1A5HA 4GUXA 4TWYA 3N7OA 4X2WA 4NCYA 5TJXA 4F4OC 1L4DA 2QCYA 4LZ4B 3S9AA 2ZIQH 2H5DA 2ZDMA 4MPXA 3RM2H 1C2IA 3SJ9A 2QXGA 5E0GA 1YPHE 3NK8A 1B0FA 4IN2A 4AGJA 1C1SA 2V0BA 3GDVA 3SHCH 4A7IB 2BQWB 3RXEA 4NZLA 1DM4B 3MU4A 2FS8A 3PWBA 5EXMA 2OLGA 2VGCC 3SJKA 1H9IE 3SNAA 3O8DA 1T7CA 3NUMA 1P9UA 1FDPA 3RDZA 1A5GH 5DP3A 1KXAA 1HAXB 5GPIB 2A7JA 1WAYB 1ZYOA 2BYAX 2VWLA 3F9EA 1TALA 2BDYA 5L30H 4K1SA 2OBOA 1CT0E 2ZFQH 2H5CA 4ZH8A 1C5VA 1PPEE 1P2OA 2R2WU 4OGXA 1HV7A 3GY8A 1GI2A 1WTHD 1NFWA 2G81E 1BZXE 3B23B 3BTME 2A45B 1ZTJA 2AMPA 3T27A 1YPHC 4H4FA 3VB5A 2XBVA 4DIIH 4AORA 1EATA 1FPHH 4Y7AA 4K1TA 1XVOA 1YPEH 2HLCA 1GL1A 1WCZA 3OY5U 1O3CA 1BTYA 2P95A 3P6ZB 5K0HA 3MMGA 1W8BH 3T62A 2Y7ZA 1MTWA 2OQUA 1NRRH 4X6MA 1CBWC 1O2SA 1P09A 1RTKA 4YLUA 1IHTH 3JZ1B 1G30B 3P92A 2Z9IA 1Y5AT 2OC7A 7GCHF 4THNH 2WPIS 1F7ZA 2D26C 1ACBE 2WV4A 1O3IA 1IAUA 2ZCKP 2ZDAH 2Y6TA 2ZKSA 4ZHMU 2J2UA 1VR1H 3W94A 1QA0A 1GWAA 4K5ZA 1T8NA 3SU3A 4CREA 1YM0A 4RN6A 4NG9H 1AWHB 1CT2E 1SGFG 3F9GA 4ZKNU 1QTFA 1V2NT 1C5SA 1KTSB 5FHTA 2ZDNA 1C5OH 2AIQA 4CR9A 3SUEA 3PYHA 5E0HA 2FXRA 1TWXB 1IQKA 1BBRH 3M3SA 1KSNA 1TNHA 2UWOA 4LXBH 2VVCA 3P95A 3TGKE 4MLFB 3FZZA 3TLOA 4FUFA 2G52A 1CSOE 4FUIA 1ELCA 1O38A 1HJ8A 3SNBA 1TX7A 1AB9B 2RA0A 1C1MA 1QB1A 1NPMA 2QGRA 1MU8B 4SGBE 1EPTB 2QXJA 1TMBH 3FP7E 3GY6A 1BMMH 3K9XB 2XCFA 1S83A 1SFQB 2FI3E 1RD3B 2BOKA 5EGMA 1SGNE 2AMDA 1O3NA 3FVFB 4KTSA 1G37A 4Z6AH 3SJOA 1GHBF 1SGQE 2FLBH 3LJOA 3MU5A 3PWCA 4I8HA 1N1LA 1XUGA 3RXPA 3A7ZA 2V6NA 1S6FA 2R9PA 1PJPA 3I78A 4U30A 3SU0A 1TYNA 3UWIA 2VIOA 2Z94A 4DIHH 1C1PA 2FLRH 3KHVA 3PMHB 4K8BA 5DP5A 1V2QT 2XBYA 3A7VA 4NSYA 1GL0E 1A3EH 1BTWA 2TIOA 1C5TA 1GBTA 1GG6C 4YESB 5J4QA 4BAQB 1TQ0B 2BDIA 3HGPA 4Y7BA 3TH4H 1MTUA 2H6MA 7KMEH 2Y5FA 3LH3A 4K8YA 2F83A 4HZHA 2VWNA 3MU0A 3RXDA 3C27B 1H8DH 5DG6A 1DXWA 3A8AA 1DX5M 1GJDB 2A4QA 1WYKA 2C8YB 3BG8A 1K22H 1J9CH 3GCHB 4TY6A 3TPIZ 2GD4B 1J16A 2VWMA 1VGCC 1A4WH 1Z8GA 5FPTA 1K1MA 2ZGBH 4U32A 1NZQH 1HXEH 1GHZA 2PFEA 5HM9A 4AYYB 1W11U 1GI1A 3BEUA 1S85A 1V2ST 1WBGB 5IDKA 1EB2A 1SFIA 1YKTA 1E0FD 1CA0C 1VJAU 4U01A 2Z6BD 3MH5A 4ZHAA 3M7UA 1BUIA 2OINA 4YT6H 1V2RT 2DUCA 1J15A 5F8XA 2K1QA 2AMQA 3M36A 3ZYEA 1C1OA 2ZHEH 1C1WH 2FEQH 1AUTC 3H7OA 2BD2A 1B7XB 4NIWA 3RXGA 1WSSH 3VB7A 3V7TA 3ZVGA 5JBCS 4AOQA 1QBVH 3RXRA 2OTVA 1MQ5A 2XC0A 4B2BA 2W7SA 1C2JA 4E06H 2A7HA 4Y6DA 3BEIB 1O2TA 4X2VA 1E35B 1SQAA 2DE9A 1V2LT 1LDTT 1V3XA 2Z9GA 3U9AH 3FZDA 1BHXF 1TX8A 1GCTB 3M61U 2F9OA 1O2WA 4YOGA 2Q6GA 4RSPA 4Q80A 4GLYA 4YOJA 1RIWB 1UTMA 2XXLA 2NWNA 4JZ1A 3TJOA 2AGIX 1OWHA 1W12U 3TJNA 1MAYA 1OXGA 3LGWA 3A8DA 3RXLA 4VGCB 3UNQA 1PQ5A 2ZDVH 4ZXYH 1G3CA 1U6QA 3MNSA 3Q3XA 2EC9H 3VGCB 1UTQA 1F0TA 2SNWA 3VXEH 5T6GA 3LH1A 3D65E 1AGJA 4ABBA 3MU8A 1EP6A 1O5CB 4GCHF 1IHSH 2XYAA 1C2MA 1HAVA 3P70B 1W7XH 1UTKA 1SLVB 1HDTH 2ESTE 1NY22 3F68H 3TVJB 1QQ4A 1PQAA 1LTOA 2HRVA 4J2YB 3U8OH 1SHYA 1O32A 1W0YH 2GMTB 1BTHH 4IMZA 4UFGH 1CT4E 1AE8H 1J17T 1LHEH 3F1SB 4R0IA 1DWEH 1PPGE 2TGPZ 3GY5A 4AB8A 2ZDKA 1OP0A 1EJAA 1GJAB 1G9IE 1CA8B 4Y79A 3RUOA 2EI6A 3BTGE 1N8OB 2AGGX 1QBNA 1UTJA 1ELBA 1RTFB 1O2KA 1QB9A 2P3TB 1G2LA 5DP8A 5I25A 1DY9A 1MAXA 2ZC9H 3SHAH 3TNSA 2GKVE 1MKWH 1Y3VA 1EQ9A 2PHBA 5T6DA 5L6NH 2HWLB 1A0JA 3O8CA 2VIDA 9ESTA 3SBKA 1UVOA 1JWTA 2HVXA 4I8GA 4Q7ZA 1PPZA 1Z6JH 1W7GH 5DK1A 5E2OA 2ALVA 2AGEX 5FXLA 4B2AA 1V2TT 2GTBA 1A1RA 1BRCE 3KQDA 3A8BA 2NU0E 1HIAA 2P3FH 1AI8H 2FYQA 3QZQA 5PTPA 1ZRKA 3LC5A 1T32A 1YF4A 1P8VC 2NU3E 2F9NA 1MCTA 4GHQA 4RKOB 4ABFA 3SNCA 2SGFE 4WXVA 1C5ZB 4CBOA 5GDSH 2C4FH 3V13A 4XFQA 4IC6A 1PYTD 1GJ7B 1VCPA 2J4IA 5C1XA 3EE0B 4Y71A 2FOEA 1ELTA 1DDJA 2P8OC 1HIAB 1P10A 2HNTF 1O3JA 1QCPA 4IBLH 1GJ8B 1QL7A 1W0ZU 1EJNA 4CHAB 4NZQA 3F9FA 1UVPA 2WINI 5LPFA 2FOHA 2BD7A 1C5NH 2OC0A 1ANEA 3K6ZA 1NM6A 2ANMH 4Y0YE 1AZ8A 3G01A 1C1TA 3GYMA 1TGBA 2QYIA 4LK4A 1VCQA 1MTNB 1BQYA 2ZPRA 4Y76A 3T28A 3TGJE 1CGHA 3E91A 1YP9A 1ID5H 1SHHB 2V35A 1EAUA 1DWDH 1C5XB 2VH6A 1TBQH 1CVWH 5JBAS 5DGJA 3AW0A 2XTTB 1C1VH 1ARBA 2BDBA 1GJBB 1SPJA 5EXNA 2QN5T 2TGAA 1OPHB 4K1EA 1O3LA 2C93B 4YTAA 1L0ZA 2ZF0H 5EXLA 3FP8E 3RXBA 3MH4A 5HM2A 2ZFPH 1UTOA 4UFFH 3RU4T 4B74A 4JMYA 1P0SH 5H4IB 3UPEA 1LPGB 4H6SB 5L2ZH 3BTEE 1SGDE 3VXFH 1QFKH 3JZ2B 1UCYH 1ZSKA 3SNEA 1SSXA 2PKSB 3A85A 2BB4A 4XSKU 2J95A 1DFPA 1JRTA 1O5AB 2GX4A 2B7DH 5GCHG 3LC3A 1TABE 1TBRH 4NIXA 3VB3A 1O36A 1BTZA 3RXQA 6CHAB 2TGTA 2CJIA 1SLXB 1GBCA 2A5AA 1UJ1A 4TYDA 3MNBA 4MVNA 1AHTH 1QY6A 1A5IA 1G32B 5EOKA 1GHAG 2A2QH 1HAPH 2VIPA 2HNTE 1O3OA 3SI4H 1DVAH 1HCGA 3M5OA 2VNTA 3PO1B 3L6PA 3S9CA 1K21H 1DLEA 1TA2A 1UTLM 1P2MA 3GY4A 4Q2KA 5JPMH 2HALA 3DFLA 5GXPA 3GICB 1SL3A 1C5UA 2OXSA 4B71A 3SO3A 2A5IA 3ODDA 4UFDH 1O5FH 1ZTLA 1AVXA 1QA7A 2BHGA 3T25A 3RXAA 3TK5A 4GPGA 1HUTH 4AX9H 5T3HA 2XW9A 5LGOA 3SU4A 3KQEA 2HNTC 1AU8A 2B8OH 1LMWB 3KL6A 5DP7A 1BBRE 2ZPSA 2XBWA 3M5NA 3A7XA 2LNCA 4IW4E 4U2WA 3SI3H 2FOCA 3M3VA 1DITH 3KQBA 1GBJA 1CHOG 1OS8A 4ABJA 2JETB 1VITG 1MH0A 1QRZA 2R3YA 2BQ7B 3GY7A 3CS0A 1V2JT 5LPEA 2TBSA 1SGYE 3E8LA 1RRKA 5E0JA 5FCRA 3QTOH 1E36B 3UOPA 2BZ6H 3SV7A 2BY9X 2ILNA 4OS4A 7LPRA 1LPKB 2YOLA 1KXEA 3URDA 3ZZ4A 2Z9LA 2PSXA 2ZCHP 2ZU4A 4E7NA 3RXHA 4GHTA 4CRCA 3A86A 2I6QA 1FXYA 3SU6A 2OC8A 4CRDA 2R2MB 5A0BA 2PLXA 3DHKH 3TU7H 4DOQA 3M7QA 1HAIH 4JK5A 2UUJB 3HPTB 2QF3A 4K60A 3BTQE 2G51A 1MZDA 4WMDA 2ZEBA 1MKWK 4WVPE 3FANA 1GI9B 4D9RA 1S6HA 1FIZA 1O3MA 1K9OE 1CE5A 1ZR0A 5A2MH 1D3PB 1F2SE 1ZPCA 1RXPA 4CRGA 1EJMA 1C9TA 4FVDA 3ZYDA 3Q00A 1XKBC 3KNXA 1O2GH 3BTFE 5DP6A 2WPMS 5FPYA 3UR6A 5A8XA 2H2ZA 3HATH 2ASUB 3DUXH 1TAWA 6ESTA 1Y5UT 1ZMJA 2FTLE 2ZECA 4OS1A 2XRCA 1T31A 1FZZA 3FFGA 2ZTXA 1ZRBA 2CGAA 5GCHF 1V2VT 3GY2A 2AS9A 1KYNA 1LHCH 1HAOH 1THSH 4O03A 4AFSA 1AVGH 1C1UH 2PWXA 1NS3A 3LPRA 2ALPA 1V2MT 2BDHA 1FUJA 2F9PA 3GCHC 3U1JB 1ABIH 1O3EA 1Y59T 1HAYB 9LPRA 1RFNA 4XE4A 2QY0B 1GHAF 3QN7A 3PMBB 5FPSA 2FI4E 1XUJA 4BTTB 2FMJA 1C4V2 4A1TA 3PTNA 1FNIA 1GMHG 3SGAE 1F5RA 5HMAA 3VEQB 3MOCA 5SGAE 5EQSA 5F6MA 3QUMP 1EPTA 6GCHF 3SJIA 1L1GA 1H1BA 1ZTKA 3ZVFA 2CF8H 1K1PA 1BMNH 1E34B 1O2NA 4BAMB 1TIOA 3BG4B 5AFZH 4CBNA 4JZFH 1HPGA 4HFPB 1LVYA 2QAAA 2Z9JA 1UK4A 4YO9A 1YPGH 3RXCA 2VJ1A 1SBWA 5EPNA 2GCTC 2OBQA 1TONA 2FOAA 1TRYA 1BIOA 1W2KH 3EQ0H 2SGPE 4Z0KA 1GI3A 3RP2A 1GVKB 2AERH 1WU1A 3ZVCA 4WMFA 3KIDU 2OUAA 2SGAA 1RIWC 1Y3YA 2A32A 1UCYK 1CHOF 1DPOA 2J9NA 5JBBS 1DUAA 1GBKA 2STAE 4INHA 3M5LA 3GYLB 4VGCC 3ENSB 3ZZDA 3HKIB 1TGTA 3KCGH 4Y11E 3MH6A 3MHWU 3SUDA 2WUBA 5ESTE 2IPHA 1DE7H 3VGCC 4KELA 2FIRH 4FUDA 2BQ6B 2Y5HA 3D23A 3TITA 2FI5E 2GT7A 4IS5A 2BX3A 1C5YB 2SGDE 3LGIA 3V3MA 1P2NA 1GBHA 1UHBA 1GJ6A 1K1NA 1OWJA 2HPQH 1D3TB 3LU9B 1TNLA 4DCDA 1G2MA 3TK9A 2Y5GA 4I32A 4ZMAH 1NROH 3TNTA 2QC2A 2ZHWH 2Z3CA 1Q3XA 1AE5A 4AG2A 3H7TA 3QDZB 2GMTC 1HJ9A 1SQTA 1SI5H 1YPMH 1ZZZA 1NC6A 2P94A 3D62A 1FY5A 1AFQB 1EAWA 2A4GA 1C2FA 2VH0A 2ZGCA 1FI8A 3EA7A 4JK6A 5A8YA 2B9LA 2CN0H 3SOSA 1DXPA 1UHBB 4MDSA 2RDLA 3ZZ8A 3A7WA 3SV6A 1ELGA 1SR5C 1AIXH 3M7TA 3U98H 4R8TB 2PTCE 5FAHA 1P12E 4DG4A 4X2YA 2ZFTA 1ZGIA 5GIBA 2VWOA 5JBTA 4UEHH 3W95A 1SGEE 4FUJA 4CH2B 4JYUH 1C1RA 1CBWB 1M9UA 4WJG2 3AVZA 3RXFA 1AUJA 2ODPA 3SGBE 1TQ7B 3ITIA 3NCLA 3UR9A 1HAHH 2BD4A 1DUEA 1Z1JA 2CHAB 1ESTA 1LO6A 1O2YA 1W14U 4D8NA 1FLEE 1HAZB 3P8GA 1MD7A 2AEIH 4UE7H 1QNJA 1P02A 1A46H 3SZNA 4BAOB 1ANBA 2OP9A 1ZPBA 3ATWA 1ETRH 3NXPA 4QT8C 5C2ZA 2I6SA 3S9BA 3H5CB 3ZV9A 1BCUH 3SJ8A 4FUHA 1H9LB 4PROA 1B0EA 2SFAA 1C2EA 4CRAA 5F8TA 2NU2E 1NRSH 2P3UB 4X8SH 2ANWA 1GBAA 2FX6A 2BD5A 1QIXB 1BOQA 1MTSA 1AQ7A 3BN9A 5EG4A 3DA9B 4ZAEA 3SQEE 1KXDA 8LPRA 1O3PB 2BDAA 3STIA 4ZKRU 1GMHF 1TGSZ 1JXPA 5C3NA 2JH6D 5E8EH 1XUFA 3S0NA 3AW1A 5CHAB 3M37A 2ZQ1A 1O5GH 2CF9H 4H6TA 1V6DA 4OS2A 5EQQA 3RU4E 1QR3E 1HLTH 1FN6A 1UK3A 3AAVA 1F5KU 2ZNKH 1LVBA 2CV3A 1P9SA 3RMOH 3A88A 3HKJB 2OQ5A 1GHWH 2O8UA 3NWUA 1JRSA 1QRXA 1O2MA 3Q76A 1MTNC 3GCTG 2WUCA 5FCKA 1PPBH 2IN2A 2VVUA 3RXKA 3GDSA 5HXFA 3UFAA 1EKBB 1F0UA 3A89A 3L33A 1PQ7A 1V2KT 4X1NU 3S7HB 2Z3DA 4Y8YA 2QXHA 1F5LA 2GZ7A 1ARCA 3NKKA 2RG3A 2A31A 1XKAC 2J34A 1GDQA 1ZHMA 1T4UH 2BM2A 1CO7E 1C9PA 4TY7A 5TCCA 1UCYE 1NESE 1SGCA 1DWCH 1BMLA 1EUFA 3UWJH 5EU8A 4MPVA 3ODFA 1EOJA 1EZQA 2ZFRH 4BTIB 1UO6A 2PKAA 4AFZA 1O2PA 2Y7XA 3ZZ6A 4XBBA 1ZMLA 3EAJA 2VINA 1GG6B 3QZRA 2G00A 1SB1H 4JYTA 3LDXH 3K65B 1ZOMA 1AKSA 5AFYH 1MKXH 2XBXA 2BTCE 4ISHH 4NWLA 3AASA
chains in the Genus database with same CATH superfamily
2O8WA 1TNGA 1NFUA 3VPKA 1SOTA 1O5DH 3E1XB 1TLDA 6CHAC 2XCNA 3ZZ5A 3PLPA 1O3DA 4ZROA 3HGNA 4DW2U 1DT2A 1HBTH 2PKAB 3P17H 1D6WA 1Y3UA 4FVBA 1OSSA 1PPFE 2F9BH 1X7AC 1VGCB 1BITA 1JIRA 1GI7B 5T6FA 3UUZA 1ANDA 1TRNA 1K1OA 1KDQA 2F91A 3Q3KA 1AKSB 1FQ3A 4AN7A 2BX4A 3TJUA 1MZAA 3PO1C 2G5VA 1YPJH 1CA0B 2WPKS 2M5TA 2ZI2H 3MYWA 4FUGA 1LVMA 4TSFD 5ABWA 1S84A 1VITH 1THRH 1Y5BT 3A7TA 2UUYA 8ESTE 3RXJA 3HK6B 4I33A 4B1TA 2H9TH 5HYOA 1P2IA 4KTUA 1O30A 1KDQB 1Z8IB 2LELA 2PR3A 1S0QA 5LPRA 1O2XA 5C1UA 2B5TB 2C8ZB 1UVTH 3GDUA 2ZGHA 2HOBA 2P59A 8GCHG 3TJVA 2BLOA 4MNYA 4HTCH 4I8KA 1ANCA 2GZ9A 4X6PA 3UNRA 3ZVDA 1MCVA 4AZ2B 3LGVA 2BXUH 4XBDA 1BMFD 1Z7KA 2LPRA 1AO5A 1ZJDA 3WY8A 3KN2A 3QX5H 1D4PB 3LGUA 3T29A 4BNRA 4ASHA 3LIWA 4KKDA 4I8LA 1XUIA 4ABGA 1G36A 2WPLS 2WYGA 3I77A 3ZV8A 2ODQA 1KLJH 1T8OA 1THPB 1PQ8A 2NU1E 4RKJB 5CDFE 3N7EA 4H42U 4XRNA 4BXSA 3UIRA 3LT3A 3IG6B 4AFUA 2GDEH 1SGTA 2GV6A 2RDEA 1BRUP 5DN6D 4FOUC 5EODA 1FAXA 3LGYA 2GV7A 1YLCA 2W6ID 1NN6A 2ZGJA 3QLPH 1ELEE 1O34A 1IQEA 1GJ5H 3RC5A 2WV5A 1C5QA 1OP8A 2RA3A 1FY4A 2PGBB 5C1YA 5EJZA 1WV7H 1KXFA 4HI3A 4KP0A 3ATLA 4IC5A 4YT7H 1QHRB 2BOHB 3RC6A 1SG8B 2KAIB 2WSSD 4JZEH 3V12A 1XXFA 2Z7FE 3GCTF 7ESTE 2FODA 3TH2H 4DGJA 3DD2H 3OTPA 3P8OA 1S5SA 2J94A 3SV9A 1JIMA 2EI7A 2A4OA 1XUKA 4O3TA 1EXFA 1MD8A 1YCPK 3Q77A 3EA9A 1S82A 4CRBA 1K1LA 4JZDH 2JKHA 1ELDE 2BZAA 2EEKA 2H9HA 1GVZA 2PSYA 1S81A 3A80A 4TWWA 1BTPA 2VIQA 3F9HA 4LZ1H 1IQLA 1ELVA 1ORFA 1GBFA 4DY7B 1IQMA 2A2XH 1P01A 1BT7A 3PV2A 3DFJA 1W13U 1TA6A 3RLYH 1JBUH 1EASA 2KFWA 3QTVH 1E37B 5A8ZA 2BD8A 1GBMA 3RXIA 1CU1A 1O3FA 1HNEE 1ZMNA 1MMJN 1MU6B 4DT7B 1BRAA 2R0LA 1E38B 3P8NA 3BTWE 7GCHG 1JOUB 1XMNB 2O8MA 1RJXB 4ABEA 2SGQE 3B9FH 1C5LH 1BJUA 1IQJA 4ABHA 2W3IA 3B8JA 1O2ZA 1YBWA 5E2PA 2ZU3A 2FWWA 2ZU2A 1ZHPA 2BVRH 3C1KA 4MNXA 5I46H 2GCHG 2XNIA 1GGDB 1XUHA 3RXTA 5AHGH 4X8UH 3MO3A 3A8CA 5FX5A 1P2QA 1TNIA 1KXCA 1FAKH 1S0RA 1A3BH 1FIWA 1ZPZA 1GCDA 2J5UA 4NSVA 5DP9A 2F9VA 4X8TH 1INCA 3MQKC 1EOLA 1NU7B 2FOBA 3UQOA 1T8MA 4Y10E 1HJAB 1YPLH 1OX1A 4LOYH 1GDNA 1GBDA 2FPZA 4FUBA 1DY8A 2P8OB 3U1IB 4XD7D 3EYDA 4MPUA 3SORA 1ABJH 1BHXB 1GI8B 1EB1H 1QQUA 4ACBA 1O5BB 4B6FA 4X8VH 3S7KB 1XVMA 3BG4C 3E16B 1TPSA 1IOEA 4FXGH 1CHGA 4I31A 4BAKB 3UQVA 4MTBA 1C2GA 2VVVA 2PUXB 1C1QA 1O5EH 1Q31A 8GCHF 2C3SA 3M35A 3NPSA 3TIUA 4BOHA 1SQRA 1FPCH 2QV1A 2BY5X 1Z1IA 2KZ4A 3R3GB 1AB9C 2G8TA 5T1VA 4MG3A 1H8IH 1EX3A 2O8TA 1EPTC 3N7DA 2XWAA 1LPZB 3F2GA 1A2CH 2OCVB 2WPHS 3ZVEA 2A7CA 1UK2A 1GHBG 4NA8A 1TPOA 3ZZ3A 3URCA 1L1JA 3ZZBA 1P2JA 2A5KA 3MFJA 3SN8A 1ESBA 1ETSH 1QL8A 2ZA5A 1MKXK 1K0HA 4X6NA 2FM2A 1HAGE 1DWBH 4F49A 2ZCLP 5ESBA 4ISNA 2THFB 5JB8S 4YLQH 3NZIA 3R0FA 1L1NA 5FX6A 2XBXA 3V0XA 3RXOA 5EW2H 1UTNA 1WUNH 1ZHRA 4RT0A 3A87A 2BVXH 2HPPH 3RMMH 2VIWA 1EZSC 1FJSA 1P05A 3GOVB 1RTLA 3UY9A 2Z9KA 1KIGH 1BRBE 2Q6FA 3IITA 1VJ9U 1HB0B 5CE1A 4ZXXH 2ZWLH 1AFQC 5B6OA 1C5PA 5F8ZA 4ABIA 4D76A 2Y81A 2Y80A 3U28C 4CR5A 1WTGH 1FY1A 4IGDA 4B2CA 3BEFB 3T5FH 1XM1A 1Z8JB 2FX4A 4WMEA 1O2QA 2ZTYA 1BJVA 2BY8X 3A83A 4X1PU 1C2KA 2GVFA 5DKMA 5FBEA 4ACAA 4OS5A 1W10U 1Y8TA 4A5TS 1YGCH 2SNVA 1P11E 4HGCA 3FN8A 3PTBA 1KLIH 2CXVA 2ZO3H 1O2VA 3STJA 5A0CA 2RCEA 1TX6A 3CP7A 5BPEA 2C8WB 4NIYA 5JYIA 2CHAC 4I86A 3DT0H 1NU9A 1O35A 2W7UA 5DP4A 4F48B 3BTHE 3KF2A 4INLA 5BRRE 4K2YA 2GDDA 3CENA 1NFYA 3T2NA 1HRTH 2AFQB 2EA3A 5AF9H 4ZUHA 5B6LA 4ABAA 1T4VH 3K2UA 1WQSA 4KGAA 1AN1E 2GCHF 1WQVH 2ZDLA 4INKA 2QE7D 1OWIA 2ZU5A 3LGTA 3SU2A 1W0KD 1GPZA 4X1SU 4ISLA 4SGAE 4X2XA 2F9UA 1ELAA 2O8LA 4A6LA 2A4RA 1Q2WA 1KY9A 1C1NA 2JH5D 1GCTC 2H9EH 1IQFA 1FY3A 1TNKA 2VB0A 5CHAC 4D7GA 4D9QA 1HGTH 3UOUA 1A61H 3TH3H 3OYPA 1C5RA 3QGNB 2PGQB 4YM9A 1TNJA 3HK3B 1S6LA 1VITF 4AYVB 2PTNA 1O2OA 2J92A 3PLBA 1O0DH 4JYVH 1L4ZA 4XOJA 4GCHG 5TCAA 4O3UA 2P93A 5AVDA 2F43B 1ETTH 1HFDA 3QGJA 4KTCA 1PYTC 4FU9A 2VGCB 2UUFB 4ESTE 3BF6H 4O9VA 4JCNA 1DANH 1D3DB 1PFXC 2FOGA 2D8WA 3E6PH 3EE7A 4TPYA 4MNVA 2XOKD 2FDAA 4Y8ZA 1GI0A 2OC1A 2XC5A 2ZFFH 2FP7B 1GMCG 3ZVBA 4NA7A 3RC4A 1UVUH 1NRPH 3OX7U 3SNDA 1TMUH 4DVAU 1O3KA 3K6YA 4ISOA 4MQAA 4BXWA 2BLWA 1YCPM 4AB9A 4NIVA 3EDXB 3DCLA 3MH7A 2G4UA 1ZGVA 4AG1A 2R3UA 3ATMA 3ATKA 1P2KA 1B5GH 2H1UA 3LJJA 1NT1A 1AFEH 4UFEH 5ETXA 1N8OC 4ZHLU 2D2DA 4TPIZ 1DSUA 1ZLRA 2FZZA 1LQEA 3BTKE 1MBQA 3M5MA 3BIVH 4B75A 1GJ9B 1GBLA 4DURA 3GY3A 1P57B 1EP5A 1P06A 4IMQA 3SQHE 3U69H 1AY6H 1V2UT 2BXTH 2XWBI 4CRFA 1XX9A 4J1YA 1UTPA 2W5EA 1G3DA 5GJ4B 3RXUA 1ZSLA 1YCPH 1FMGA 3RXMA 1SGIB 1RGQA 3UREA 3RM0H 1RS0A 4B73A 1CQQA 1JMOH 1QBOA 2A1DB 1TE0A 4CH8B 3KEEA 2GT8A 1XXDA 3E90B 1VZQH 4GVUA 1H8ED 5CMXH 3UNSA 1EZXC 1F0SA 3MI4A 3ZZ9A 1AWFH 2EI8A 2VU8E 4ZKSU 3A81A 2PUQH 1K28D 2GGVB 1MUEB 1ELFA 1CGJE 1N6YA 3OE7D 3UTUH 2ANKH 5K7RA 1SMFE 1AVWA 1OWDA 3ZZCA 3PB1E 1TGNA 4OM9A 5F03A 3PV5A 1T8LA 2BD9A 3KGPA 2ZU1A 1GMDG 1QJ6B 3U8TH 1TOMH 4I7YH 1P03A 2GP9B 3U8RH 2BMGB 1ESAA 1PPCE 1HYLA 2ZGXH 4OS6A 2ZP0H 3FKSD 2ZFSA 1YLDA 1GJCB 1J8AA 1V2WT 2GCTB 4CHAC 2ODYB 5IYTA 1SVPA 2YMSC 3WW7A 2GZ8A 1DS2E 1P3CA 1C2HA 5HIYA 4WH6A 1Y3XA 5G4BA 3VFEA 2KCYA 1P04A 4ZKOU 2VBCA 1YPKH 1GHVH 1O3HA 4K69A 4YZUA 1O3AA 2BDGA 2FO9A 3F6UH 3Q3YA 1DLKB 3OY6U 1BDAA 4FUCA 2FOFA 3N99A 1O37A 1A7SA 2ZZUH 1FONA 1D3QB 3RXSA 1O2IA 1O2UA 4X0WU 3L3TA 1OOKB 1SC8U 4ISIH 2W26A 3O8RA 4D7FA 4E05H 1IQNA 1BMAA 5DPAA 3AAUA 3FAOA 4M7GA 3SU1A 2BLQA 1QGFA 4GAWA 2K8IA 2FYRA 1KTTB 4NFEA 3A82A 5EW1H 4BTUB 2QXIA 1D6RA 3PMAB 3SUGA 1O2RA 2W3KA 1YYY1 2IJD1 2J97A 2FOMB 1LKBA 1OYQA 2G4TA 2PKSC 5EQRA 5C5OA 2IJOB 2IOTA 1QJ7B 1Z6EA 2XC4A 2KR7A 1OWKA 3DSPA 1ZJKA 5EPYA 1GMCF 1C2LA 1O2HA 2AIPA 1K1JA 1LQDB 8KME2 4XBCA 3M3TA 3CS7A 4NFFA 2WYJA 3MTYA 2HGTH 1HAVB 2A0QB 4YOIA 1V2OT 4WY3A 3VB4A 3FP6E 3LKWA 1SGRE 3SW2B 1SQOA 1OWEA 4WWYA 1PPHE 4WH8A 1O31A 3MO6A 2V7QD 3MWIU 1NFXA 1C5MD 2AH4X 2OD3B 4ABDA 5J4SA 3SV2H 4X1QU 1LHDH 1EAIA 1TPPA 4NWKA 1GBEA 1TFXA 3SUFA 5L2YH 3SGQE 3O8BA 4Y8XA 3ZVAA 1Y3WA 4OGYA 3I29A 3E0PB 2WPJS 4OS7A 3ZZAA 1O3BA 1O3GA 1NRQH 1NTPA 2FESH 3VB6A 4X1RU 1TB6H 1BBRK 1NRNH 1QRWA 1DSTA 2ANYA 1GJ4H 1MQ6A 3PV4A 1NBME 3QK1A 4WXIA 3SV8A 4BANB 1EZUC 1TMTH 4I8JA 1GGDC 1YC0A 2ULLA 1MBMA 1C4U2 2DE8A 1LHGH 1UVSH 1SOZA 2FS9A 3ELAH 1GHYH 4AFQA 4Z1MD 3E0NB 1GVLA 1BB0B 1QJ1B 1YLNA 1F92A 1GHXH 1SLWB 1BTXA 1C4Y2 5A09A 3GISB 1HJAC 5A0AE 2V3OH 2FTMA 4FU8A 4DJZB 1P3EA 1A0HB 4AGKA 2V3HH 1W3CA 2M2AA 6LPRA 2KAIA 2JETC 1GMDF 2TGDA 2R0KA 1AZZA 1WDIA 4UONA 4E7RG 3BTTE 2UUKB 1NO9H 1Z8RA 2ZPQA 4Q7XA 2CMYA 1GDUA 1TBZH 5FBIA 4A92A 1MTVA 1YY3A 2QF0A 4UD9H 3OTJE 3RLWH 1SGPE 2F3CE 1ZSJA 1D9IA 2C90B 3GCNA 2NU4E 1C5WB 3S69A 3MNCA 4X6OA 2BD3A 3OU0A 4K3JA 4XDEA 4RI0A 5DJ7A 1O2LA 2JH0D 1AD8H 1TRMA 2ZHFH 3QWCH 2ZTZA 3SYJA 3RMLH 4MPWA 1GI6A 3ESTA 2ZHDA 2IPQX 2ZQ2A 3KQCA 4B76A 1G3BA 2Z3EA 5JB9S 2BY6X 4P02A 5C67A 2QIQA 2ZG0H 3RMNH 3ATIA 3SU5A 1J14A 1Z71A 3E3TA 2O9QA 4FU7A 1GBBA 1V2PT 1BA8B 1IQIA 5C20A 3RXVA 1LCYA 2G5NA 1LHFH 2Q6DA 2UWPA 1FY8E 1EFRD 2G55A 2BLVA 3PMJA 2YNBA 2Q1JA 3BTDE 1DICA 2PW8H 5GWZA 4A1XA 1QB6A 5JDUB 1OP2A 1TOCB 1KMHB 3T26A 1C2DA 3TK6A 1LKAA 5C5NA 2J38A 3TGIE 4GSOA 3A7YA 2EQNA 2P16A 2C8XB 3A84A 2Y82A 3OSYA 1TPAE 1G3EA 1H4WA 1FN8A 3MO9A 1LVOA 4JZIA 4FUEA 1QURH 2B0FA 2AYWA 1L2EA 4UDWH 2D1JA 1KLTA 4NA9H 1OKXA 3BIUH 1SGFA 4Q7YA 1HXFH 1N6XA 3IWMA 2ZHQH 2TRMA 3MU1A 1O2JA 2SGEE 3D49H 3QO6A 1IQGA 3PLKA 2TPIZ 5HGGA 2PP6A 1WOFA 1VCWA 2VIVA 3EGKH 1AMHA 1CGIE 6GCHG 2STBE 3GCOA 1GBIA 1TGCA 4A1VA 1UMAH 1BTUA 1EAXA 1SLUB 5DO4H 1K2I1 1O33A 3EA8A 1FV9A 1GI4A 1A0LA 3PM3A 3DSGA 1GI5A 1OYTH 1K1IA 1DOJA 1H9HE 3PROA 4BAHB 4NGAH 4MNWA 3ZZ7A 1QL9A 2LP6A 2BY7X 3P8FA 3MNXA 5LH8A 1F0RA 2UWLA 4IN1A 2QA9E 1IQHA 4WF8A 4O97A 3LOXA 1O39A 2YNAA 3BSQA 3LONA 3RU4D 3BV9B 4Y0ZE 2PV9B 1KXBA 2BVSH 2BDCA 1A5HA 4GUXA 4TWYA 3N7OA 4X2WA 4RT1A 2JJ1D 4NCYA 5TJXA 4F4OC 1L4DA 2QCYA 4LZ4B 1H8HD 3S9AA 2ZIQH 2H5DA 2ZDMA 3F0OA 4MPXA 3RM2H 3WWFA 3OFND 1C2IA 3SJ9A 2QXGA 5E0GA 1YPHE 3NK8A 1B0FA 4IN2A 4AGJA 1C1SA 2V0BA 3GDVA 3SHCH 4A7IB 2BQWB 3RXEA 3GS9A 4NZLA 1DM4B 3MU4A 2FS8A 3PWBA 5EXMA 2OLGA 2VGCC 3SJKA 1H9IE 5EJLA 2OK5A 3SNAA 3O8DA 3F2HA 5CHBA 1T7CA 3NUMA 1P9UA 1FDPA 3RDZA 1A5GH 5DP3A 1KXAA 1HAXB 5GPIB 2A7JA 1WAYB 1ZYOA 2BYAX 2VWLA 3KYFA 3F9EA 1TALA 2BDYA 5L30H 4K1SA 2OBOA 1CT0E 2ZFQH 2H5CA 4ZH8A 1C5VA 1PPEE 1P2OA 2R2WU 4OGXA 1HV7A 3GY8A 1GI2A 1WTHD 1NFWA 2G81E 1BZXE 3B23B 3BTME 2A45B 1ZTJA 2AMPA 3OAAD 3T27A 1YPHC 4H4FA 3VB5A 2XBVA 4DIIH 5C0UA 4AORA 5C17A 1EATA 1FPHH 4Y7AA 4K1TA 1XVOA 1YPEH 2HLCA 1GL1A 1WCZA 3OY5U 1O3CA 1BTYA 2P95A 3P6ZB 5K0HA 3MMGA 1W8BH 3T62A 2Y7ZA 1MTWA 2OQUA 1NRRH 5KEDA 2QF4A 4X6MA 1CBWC 1O2SA 1P09A 2K0QA 1RTKA 4YLUA 1IHTH 3JZ1B 1G30B 2KCPA 3P92A 2Z9IA 3FOAA 1Y5AT 1COWD 2OC7A 7GCHF 4THNH 2WPIS 1F7ZA 2D26C 1ACBE 2WV4A 1O3IA 1IAUA 2ZCKP 2ZDAH 2Y6TA 2ZKSA 3F2FA 4ZHMU 2J2UA 1VR1H 3W94A 1QA0A 1GWAA 4K5ZA 1T8NA 3SU3A 4CREA 1YM0A 4RN6A 4NG9H 1AWHB 1CT2E 1SGFG 3F9GA 4ZKNU 1QTFA 1V2NT 1C5SA 1KTSB 5FHTA 2ZDNA 5C94A 1C5OH 2AIQA 4CR9A 3SUEA 3PYHA 5E0HA 2FXRA 3KQ5A 2QF5A 1TWXB 1IQKA 1BBRH 3M3SA 1KSNA 1TNHA 2UWOA 4LXBH 2VVCA 3P95A 3TGKE 4MLFB 3FZZA 1OHHD 3TLOA 4FUFA 2G52A 1CSOE 4FUIA 3PRBA 1ELCA 1O38A 1HJ8A 3SNBA 1TX7A 1AB9B 2RA0A 1C1MA 1QB1A 1NPMA 2QGRA 1MU8B 4SGBE 1EPTB 2QXJA 1TMBH 3FP7E 3GY6A 1BMMH 3K9XB 2XCFA 1S83A 1SFQB 3OEHD 2FI3E 1RD3B 2BOKA 5EGMA 1SGNE 3CNRA 2AMDA 1O3NA 3FO8D 3FVFB 4KTSA 1G37A 4Z6AH 3WWBA 3SJOA 1GHBF 1SGQE 2FLBH 3LJOA 3MU5A 3PWCA 4I8HA 1N1LA 1XUGA 3RXPA 3A7ZA 2V6NA 1S6FA 2J98B 2R9PA 1PJPA 3I78A 4U30A 3SU0A 1TYNA 3UWIA 2VIOA 2Z94A 4DIHH 1C1PA 2FLRH 3KHVA 3PMHB 4K8BA 5DP5A 1V2QT 2XBYA 3A7VA 4NSYA 1GL0E 3PRDA 1A3EH 1BTWA 2TIOA 1C5TA 1GBTA 1GG6C 4YESB 5J4QA 4BAQB 1TQ0B 2BDIA 3HGPA 4Y7BA 3TH4H 1MTUA 2H6MA 7KMEH 2Y5FA 3LH3A 4K8YA 2F83A 4HZHA 2VWNA 3MU0A 3RXDA 3C27B 1H8DH 5DG6A 1DXWA 3A8AA 1DX5M 1GJDB 2A4QA 1WYKA 2C8YB 3BG8A 4YXWD 1K22H 2WPDD 1J9CH 3GCHB 4TY6A 3TPIZ 2GD4B 1J16A 2VWMA 1VGCC 1A4WH 1Z8GA 5FPTA 1K1MA 2ZGBH 4U32A 1NZQH 1HXEH 1GHZA 2PFEA 5HM9A 4AYYB 1W11U 1GI1A 3BEUA 1S85A 1V2ST 1WBGB 5IDKA 1EB2A 1SFIA 1YKTA 1E0FD 3UB0A 1CA0C 2W6JD 1VJAU 2WV9A 5HKKD 4U01A 2Z6BD 3MH5A 4ZHAA 3M7UA 1BUIA 2OINA 4YT6H 1V2RT 2DUCA 1J15A 5F8XA 2K1QA 2AMQA 3M36A 3ZYEA 1C1OA 2ZHEH 1C1WH 2FEQH 1AUTC 3H7OA 2BD2A 1B7XB 4NIWA 3RXGA 1WSSH 3VB7A 3V7TA 3ZVGA 5JBCS 4AOQA 1QBVH 3RXRA 2OTVA 1MQ5A 2XC0A 4B2BA 2W7SA 5F53A 1C2JA 4E06H 2A7HA 4Y6DA 3BEIB 1O2TA 4X2VA 1E35B 1SQAA 2DE9A 1V2LT 1LDTT 1V3XA 2Z9GA 3U9AH 3FZDA 1BHXF 1TX8A 1GCTB 3M61U 2F9OA 1O2WA 4YOGA 2Q6GA 4RSPA 4Q80A 4GLYA 5FL7D 4YOJA 1RIWB 1UTMA 2XXLA 2NWNA 4JZ1A 3TJOA 2AGIX 1OWHA 1W12U 3TJNA 5EIYA 1MAYA 1OXGA 3LGWA 3A8DA 3RXLA 4VGCB 3UNQA 2KCOA 1PQ5A 2ZDVH 3OEED 4ZXYH 1G3CA 1U6QA 3MNSA 3Q3XA 2EC9H 3VGCB 1UTQA 1F0TA 2SNWA 3VXEH 5T6GA 3LH1A 3D65E 1AGJA 4ABBA 3MU8A 1EP6A 1O5CB 1VKYA 4GCHF 1IHSH 2XYAA 1C2MA 1HAVA 3P70B 1W7XH 1UTKA 1SLVB 3ZIAD 1HDTH 2ESTE 1NY22 3F68H 3TVJB 4ZCNA 1QQ4A 1PQAA 1LTOA 2HRVA 1E1RD 4J2YB 3U8OH 1SHYA 1O32A 1W0YH 2GMTB 1BTHH 4IMZA 4UFGH 1CT4E 3H09A 1AE8H 1J17T 1LHEH 3F1SB 4R0IA 1DWEH 1PPGE 2TGPZ 3GY5A 4AB8A 2ZDKA 1OP0A 1EJAA 1GJAB 1G9IE 1CA8B 4Y79A 3RUOA 2EI6A 3BTGE 1N8OB 4AC9A 2AGGX 1QBNA 1UTJA 1ELBA 1RTFB 1O2KA 1QB9A 2P3TB 1G2LA 5DP8A 3AK5A 5I25A 1DY9A 1MAXA 2ZC9H 3SHAH 3TNSA 2GKVE 1MKWH 1Y3VA 1EQ9A 2PHBA 5T6DA 1FX0B 5L6NH 2HWLB 1A0JA 3O8CA 2VIDA 9ESTA 3SBKA 1UVOA 1JWTA 5DSFA 2HVXA 4I8GA 5IK2D 3NRLA 4Q7ZA 1PPZA 2WHXA 1Z6JH 1W7GH 5DK1A 5E2OA 2ALVA 2AGEX 5FXLA 4B2AA 1V2TT 2GTBA 1A1RA 1BRCE 3KQDA 3A8BA 2NU0E 1HIAA 2P3FH 1AI8H 4P00A 2FYQA 3QZQA 5PTPA 1ZRKA 3LC5A 1T32A 1YF4A 1P8VC 2NU3E 2F9NA 1MCTA 4GHQA 4RKOB 4ABFA 3SNCA 2SGFE 4WXVA 1C5ZB 4CBOA 5GDSH 2C4FH 3V13A 4XFQA 4IC6A 1PYTD 1GJ7B 1VCPA 2J4IA 5C1XA 3EE0B 4Y71A 2FOEA 1ELTA 1DDJA 2P8OC 1HIAB 1P10A 2HNTF 1O3JA 1QCPA 4IBLH 4ASUD 1GJ8B 1QL7A 1W0ZU 1EJNA 4CHAB 2YMSB 4NZQA 3F9FA 1UVPA 2WINI 4M9FA 4B6EA 5LPFA 2FOHA 2BD7A 1C5NH 2OC0A 1ANEA 3K6ZA 1NM6A 2ANMH 4Y0YE 1AZ8A 3G01A 1C1TA 3GYMA 1TGBA 2QYIA 4LK4A 1VCQA 1MTNB 3UAIC 1BQYA 2ZPRA 4Y76A 3T28A 3TGJE 1CGHA 3E91A 1YP9A 1ID5H 4TT3D 1SHHB 2V35A 1EAUA 1DWDH 1C5XB 2VH6A 1TBQH 1CVWH 5JBAS 5DGJA 3AW0A 2XTTB 1C1VH 1ARBA 2BDBA 1GJBB 1SPJA 1UW7A 5EXNA 2QN5T 2TGAA 1OPHB 4K1EA 1O3LA 2C93B 4YTAA 1L0ZA 2ZF0H 5EXLA 3FP8E 3RXBA 3MH4A 5HM2A 2ZFPH 1UTOA 4UFFH 3RU4T 4B74A 4JMYA 1P0SH 5H4IB 3UPEA 1LPGB 4H6SB 5L2ZH 3BTEE 1SGDE 3VXFH 1QFKH 3JZ2B 1UCYH 1ZSKA 3SNEA 1SSXA 2PKSB 3A85A 2BB4A 1SKYE 4XSKU 2J95A 1DFPA 1JRTA 1O5AB 2GX4A 2B7DH 5GCHG 3VG8A 5KECA 4FETA 3LC3A 1TABE 1TBRH 4NIXA 3VB3A 1O36A 1BTZA 3RXQA 6CHAB 2TGTA 2CJIA 1SLXB 1GBCA 4F55A 2KX4A 2A5AA 1UJ1A 4TYDA 3MNBA 4MVNA 1AHTH 1QY6A 1A5IA 1G32B 5EOKA 1GHAG 2A2QH 1HAPH 2VIPA 2HNTE 1O3OA 3SI4H 1DVAH 1HCGA 3M5OA 2VNTA 3PO1B 3L6PA 3S9CA 1K21H 1W0JD 1DLEA 2YMSD 1TA2A 1UTLM 1P2MA 3DSOA 3GY4A 4Q2KA 4Q4LA 5JPMH 2HALA 3DFLA 5GXPA 1MABB 3GICB 2WZQA 1SL3A 1C5UA 2OXSA 4B71A 3SO3A 2A5IA 3ODDA 4UFDH 1O5FH 1ZTLA 1AVXA 1QA7A 2BHGA 3T25A 3RXAA 3TK5A 2JJ2D 4GPGA 1HUTH 4AX9H 5T3HA 2XW9A 5LGOA 3SU4A 5KGOA 3KQEA 2HNTC 1AU8A 2B8OH 1LMWB 3KL6A 5DP7A 1BBRE 2ZPSA 2XBWA 3M5NA 3A7XA 2LNCA 4DT4A 4IW4E 4U2WA 3SI3H 2FOCA 3M3VA 1DITH 3KQBA 1GBJA 1CHOG 1OS8A 4ABJA 2JETB 2AHME 1VITG 1MH0A 1QRZA 5C0TA 2R3YA 2BQ7B 3GY7A 4Q63A 3CS0A 1V2JT 5LPEA 2TBSA 1SGYE 3E8LA 1RRKA 5E0JA 5FCRA 3QTOH 1E36B 3UOPA 2BZ6H 3SV7A 2BY9X 2ILNA 4OS4A 7LPRA 1LPKB 2YOLA 1KXEA 3URDA 3ZZ4A 2Z9LA 2PSXA 2ZCHP 2ZU4A 4E7NA 3RXHA 4GHTA 4CRCA 3A86A 2I6QA 3SZEA 1FXYA 3F3BA 3SU6A 2OC8A 4CRDA 2R2MB 5A0BA 2PLXA 3DHKH 3TU7H 4DOQA 3M7QA 1HAIH 4JK5A 2UUJB 3HPTB 2QF3A 4K60A 3BTQE 2G51A 1MZDA 4WMDA 2ZEBA 1MKWK 4WVPE 3FANA 1GI9B 4D9RA 1S6HA 1FIZA 1O3MA 1K9OE 1WXRA 1CE5A 1ZR0A 5A2MH 1D3PB 1F2SE 1ZPCA 1RXPA 4CRGA 1EJMA 1C9TA 4FVDA 3ZYDA 3Q00A 1XKBC 3KNXA 1O2GH 3BTFE 5DP6A 2WPMS 5FPYA 3UR6A 5A8XA 2H2ZA 3HATH 2ASUB 3DUXH 1TAWA 6ESTA 2EY4C 1Y5UT 1ZMJA 2FTLE 2ZECA 4OS1A 2XRCA 1T31A 1FZZA 3FFGA 1YWUA 2ZTXA 1ZRBA 2CGAA 3F0PA 5GCHF 1V2VT 2L6OA 3GY2A 2AS9A 1KYNA 1LHCH 1HAOH 1THSH 5HIZA 4O03A 4AFSA 1AVGH 1C1UH 2PWXA 1NS3A 3LPRA 3KYGA 2ALPA 1V2MT 2BDHA 1FUJA 2F9PA 3GCHC 3U1JB 1ABIH 1O3EA 1Y59T 1HAYB 9LPRA 1RFNA 4XE4A 2QY0B 1GHAF 3QN7A 3PMBB 2GJGA 5FPSA 2FI4E 5EJ1A 1XUJA 4BTTB 2FMJA 1C4V2 4A1TA 3PTNA 1NBMD 1FNIA 1GMHG 3SGAE 1F5RA 2JIZD 5HMAA 3VEQB 3MOCA 5SGAE 5EQSA 5F6MA 3QUMP 1EPTA 6GCHF 3SJIA 1L1GA 1H1BA 1ZTKA 3ZVFA 2CF8H 1K1PA 1BMNH 1E34B 1O2NA 4BAMB 1TIOA 3BG4B 5AFZH 4CBNA 4JZFH 2HVYB 1HPGA 4HFPB 1LVYA 2QAAA 2Z9JA 1UK4A 4YO9A 1YPGH 3RXCA 2VJ1A 1SBWA 2HLDD 5EPNA 2GCTC 2OBQA 1TONA 2FOAA 1TRYA 1BIOA 1W2KH 3EQ0H 2SGPE 4Z0KA 1GI3A 3RP2A 1GVKB 2J98A 2AERH 1WU1A 3ZVCA 4WMFA 3KIDU 2OUAA 2SGAA 1RIWC 1Y3YA 2A32A 1UCYK 1CHOF 1DPOA 2J9NA 5JBBS 1DUAA 1GBKA 2STAE 4INHA 3M5LA 3GYLB 4VGCC 3ENSB 3ZZDA 3HKIB 1TGTA 3KCGH 4Y11E 3MH6A 3MHWU 3SUDA 2WUBA 5ESTE 2IPHA 1DE7H 3VGCC 4KELA 2FIRH 4FUDA 2BQ6B 2Y5HA 3D23A 3TITA 2FI5E 2GT7A 4IS5A 2BX3A 1C5YB 2SGDE 3LGIA 3V3MA 1P2NA 2CK3D 1GBHA 1UHBA 1GJ6A 1K1NA 1OWJA 2HPQH 1D3TB 3LU9B 1TNLA 4DCDA 1G2MA 3TK9A 2Y5GA 4I32A 4ZMAH 1NROH 3TNTA 2QC2A 2ZHWH 2Z3CA 4HG6A 1Q3XA 1AE5A 4AG2A 3H7TA 3QDZB 2GMTC 1HJ9A 1SQTA 1SI5H 1YPMH 1ZZZA 1NC6A 2P94A 3D62A 1FY5A 1AFQB 1EAWA 2A4GA 1C2FA 2VH0A 2ZGCA 1FI8A 3EA7A 4JK6A 5A8YA 2B9LA 2CN0H 3SOSA 1DXPA 1UHBB 4MDSA 2RDLA 3ZZ8A 3A7WA 3SV6A 1ELGA 1SR5C 1AIXH 3M7TA 3U98H 4R8TB 2PTCE 5FAHA 1E79D 1P12E 4DG4A 4X2YA 2XNDD 1QZ8A 2ZFTA 1ZGIA 5GIBA 2VWOA 5JBTA 4UEHH 3W95A 1SGEE 4FUJA 4CH2B 4JYUH 1C1RA 1CBWB 1M9UA 4WJG2 3AVZA 3RXFA 1AUJA 2ODPA 3SGBE 1TQ7B 3ITIA 3NCLA 3UR9A 1HAHH 2BD4A 1DUEA 1Z1JA 2CHAB 1ESTA 1LO6A 1O2YA 1W14U 4D8NA 1FLEE 1HAZB 3P8GA 1MD7A 2AEIH 4UE7H 1QNJA 1P02A 1A46H 3SZNA 4BAOB 1ANBA 2KCAA 2OP9A 1ZPBA 3ATWA 1ETRH 3NXPA 4QT8C 5C2ZA 2I6SA 3S9BA 3H5CB 3ZV9A 1BCUH 3SJ8A 4FUHA 1H9LB 4PROA 1B0EA 2SFAA 1C2EA 4CRAA 5F8TA 2NU2E 1NRSH 2P3UB 2JDID 4X8SH 2ANWA 1GBAA 2FX6A 2BD5A 1QIXB 1BOQA 1MTSA 1AQ7A 3BN9A 5EG4A 3DA9B 4ZAEA 3SQEE 1KXDA 8LPRA 1O3PB 2BDAA 3W1EA 3STIA 2F4LA 4ZKRU 1GMHF 1TGSZ 1JXPA 5C3NA 2JH6D 5E8EH 1XUFA 3S0NA 3AW1A 5CHAB 3M37A 2ZQ1A 1O5GH 2CF9H 4H6TA 1V6DA 4OS2A 5EQQA 3RU4E 1QR3E 2RFKC 1HLTH 1FN6A 1UK3A 1E1QD 3AAVA 1F5KU 2ZNKH 1LVBA 2CV3A 1P9SA 3RMOH 3A88A 3HKJB 2L74A 2OQ5A 1GHWH 2O8UA 3NWUA 1JRSA 1QRXA 1O2MA 3Q76A 1MTNC 3GCTG 2WUCA 5FCKA 1PPBH 2IN2A 2VVUA 3RXKA 3GDSA 5HXFA 3UFAA 1EKBB 1F0UA 3A89A 3L33A 1PQ7A 1V2KT 4X1NU 3S7HB 2Z3DA 4Y8YA 2QXHA 5GNDA 1F5LA 2GZ7A 1ARCA 3NKKA 2RG3A 2A31A 1XKAC 2J34A 1GDQA 1ZHMA 1T4UH 2BM2A 1CO7E 1C9PA 4TY7A 5TCCA 1UCYE 1NESE 1SGCA 1DWCH 1BMLA 1EUFA 3UWJH 5EU8A 4MPVA 3ODFA 1EOJA 1EZQA 2ZFRH 4BTIB 1UO6A 2PKAA 4AFZA 1O2PA 2V3MA 2Y7XA 3ZZ6A 4XBBA 1ZMLA 3EAJA 2VINA 1GG6B 3QZRA 2G00A 1SB1H 4JYTA 3LDXH 3K65B 1ZOMA 1AKSA 5AFYH 1MKXH 2KM0A 2BTCE 4ISHH 4NWLA 3AASA
chains in the Genus database with same CATH topology
2O8WA 1TNGA 1NFUA 3VPKA 1SOTA 1O5DH 3E1XB 1TLDA 6CHAC 2XCNA 3ZZ5A 3PLPA 1O3DA 4ZROA 3HGNA 4DW2U 1DT2A 1HBTH 2PKAB 3P17H 1D6WA 1Y3UA 4FVBA 1OSSA 1PPFE 2F9BH 1X7AC 1VGCB 1BITA 1JIRA 1GI7B 5T6FA 3UUZA 1ANDA 1TRNA 1K1OA 1KDQA 2F91A 3Q3KA 1AKSB 1FQ3A 4AN7A 2BX4A 3TJUA 1MZAA 3PO1C 2G5VA 1YPJH 1CA0B 2WPKS 2M5TA 2ZI2H 3MYWA 4FUGA 1LVMA 5ABWA 1S84A 1VITH 1THRH 1Y5BT 3A7TA 2UUYA 8ESTE 3RXJA 3HK6B 4I33A 4B1TA 2H9TH 5HYOA 1P2IA 4KTUA 1O30A 1KDQB 1Z8IB 2PR3A 1S0QA 5LPRA 1O2XA 5C1UA 2B5TB 2C8ZB 1UVTH 3GDUA 2ZGHA 2HOBA 2P59A 8GCHG 3TJVA 2BLOA 4MNYA 4HTCH 4I8KA 1ANCA 2GZ9A 4X6PA 3UNRA 3ZVDA 1MCVA 4AZ2B 3LGVA 2BXUH 4XBDA 1Z7KA 2LPRA 1AO5A 1ZJDA 3WY8A 3KN2A 3QX5H 1D4PB 3LGUA 3T29A 4BNRA 4ASHA 3LIWA 4KKDA 4I8LA 1XUIA 4ABGA 1G36A 2WPLS 2WYGA 3I77A 3ZV8A 2ODQA 1KLJH 1T8OA 1THPB 1PQ8A 2NU1E 4RKJB 4H42U 4BXSA 3UIRA 3LT3A 3IG6B 4AFUA 2GDEH 1SGTA 2GV6A 1BRUP 5EODA 1FAXA 3LGYA 2GV7A 1YLCA 1NN6A 2ZGJA 3QLPH 1ELEE 1O34A 1IQEA 1GJ5H 3RC5A 2WV5A 1C5QA 1OP8A 2RA3A 1FY4A 2PGBB 5C1YA 1WV7H 1KXFA 4HI3A 4KP0A 3ATLA 4IC5A 4YT7H 1QHRB 2BOHB 3RC6A 1SG8B 2KAIB 4JZEH 3V12A 1XXFA 2Z7FE 3GCTF 7ESTE 2FODA 3TH2H 4DGJA 3DD2H 3P8OA 1S5SA 2J94A 3SV9A 1JIMA 2EI7A 2A4OA 1XUKA 4O3TA 1EXFA 1MD8A 1YCPK 3Q77A 3EA9A 1S82A 4CRBA 1K1LA 4JZDH 2JKHA 1ELDE 2BZAA 2EEKA 2H9HA 1GVZA 2PSYA 1S81A 3A80A 4TWWA 1BTPA 2VIQA 3F9HA 4LZ1H 1IQLA 1ELVA 1ORFA 1GBFA 4DY7B 1IQMA 2A2XH 1P01A 1BT7A 3DFJA 1W13U 1TA6A 3RLYH 1JBUH 1EASA 3QTVH 1E37B 5A8ZA 2BD8A 1GBMA 3RXIA 1CU1A 1O3FA 1HNEE 1ZMNA 1MMJN 1MU6B 4DT7B 1BRAA 2R0LA 1E38B 3P8NA 3BTWE 7GCHG 1JOUB 1XMNB 2O8MA 1RJXB 4ABEA 2SGQE 3B9FH 1C5LH 1BJUA 1IQJA 4ABHA 2W3IA 3B8JA 1O2ZA 1YBWA 5E2PA 2ZU3A 2FWWA 2ZU2A 1ZHPA 2BVRH 3C1KA 4MNXA 5I46H 2GCHG 2XNIA 1GGDB 1XUHA 3RXTA 5AHGH 4X8UH 3MO3A 3A8CA 5FX5A 1P2QA 1TNIA 1KXCA 1FAKH 1S0RA 1A3BH 1FIWA 1ZPZA 1GCDA 4NSVA 5DP9A 2F9VA 4X8TH 1INCA 1EOLA 1NU7B 2FOBA 3UQOA 1T8MA 4Y10E 1HJAB 1YPLH 1OX1A 4LOYH 1GDNA 1GBDA 2FPZA 4FUBA 1DY8A 2P8OB 3U1IB 3EYDA 4MPUA 3SORA 1ABJH 1BHXB 1GI8B 1EB1H 1QQUA 1O5BB 4X8VH 3S7KB 1XVMA 3BG4C 3E16B 1TPSA 1IOEA 4FXGH 1CHGA 4I31A 4BAKB 3UQVA 4MTBA 1C2GA 2VVVA 2PUXB 1C1QA 1O5EH 1Q31A 8GCHF 2C3SA 3M35A 3NPSA 3TIUA 4BOHA 1FPCH 2QV1A 2BY5X 1Z1IA 3R3GB 1AB9C 2G8TA 4MG3A 1H8IH 1EX3A 2O8TA 1EPTC 2XWAA 1LPZB 1A2CH 2OCVB 2WPHS 3ZVEA 2A7CA 1UK2A 1GHBG 4NA8A 1TPOA 3ZZ3A 3URCA 1L1JA 3ZZBA 1P2JA 2A5KA 3MFJA 3SN8A 1ESBA 1ETSH 1QL8A 2ZA5A 1MKXK 4X6NA 2FM2A 1HAGE 1DWBH 4F49A 2ZCLP 5ESBA 4ISNA 2THFB 5JB8S 4YLQH 3NZIA 3R0FA 1L1NA 5FX6A 3V0XA 3RXOA 5EW2H 1UTNA 1WUNH 1ZHRA 3A87A 2BVXH 2HPPH 3RMMH 2VIWA 1EZSC 1FJSA 1P05A 3GOVB 1RTLA 3UY9A 2Z9KA 1KIGH 1BRBE 2Q6FA 3IITA 1VJ9U 1HB0B 5CE1A 4ZXXH 2ZWLH 1AFQC 5B6OA 1C5PA 5F8ZA 4ABIA 4D76A 2Y81A 2Y80A 4CR5A 1WTGH 1FY1A 4IGDA 4B2CA 3BEFB 3T5FH 1XM1A 1Z8JB 2FX4A 4WMEA 1O2QA 2ZTYA 1BJVA 2BY8X 3A83A 4X1PU 1C2KA 2GVFA 5DKMA 5FBEA 4OS5A 1W10U 1Y8TA 4A5TS 1YGCH 2SNVA 1P11E 4HGCA 3PTBA 1KLIH 2CXVA 2ZO3H 1O2VA 3STJA 5A0CA 2RCEA 1TX6A 3CP7A 5BPEA 2C8WB 4NIYA 5JYIA 2CHAC 3DT0H 1NU9A 1O35A 2W7UA 5DP4A 3BTHE 3KF2A 4INLA 5BRRE 4K2YA 2GDDA 3CENA 1NFYA 3T2NA 1HRTH 2AFQB 2EA3A 5AF9H 4ZUHA 4ABAA 1T4VH 3K2UA 1WQSA 4KGAA 1AN1E 2GCHF 1WQVH 2ZDLA 4INKA 1OWIA 2ZU5A 3LGTA 3SU2A 1GPZA 4X1SU 4ISLA 4SGAE 4X2XA 2F9UA 1ELAA 2O8LA 4A6LA 2A4RA 1Q2WA 1KY9A 1C1NA 2JH5D 1GCTC 2H9EH 1IQFA 1FY3A 1TNKA 2VB0A 5CHAC 4D7GA 4D9QA 1HGTH 3UOUA 1A61H 3TH3H 3OYPA 1C5RA 3QGNB 2PGQB 4YM9A 1TNJA 3HK3B 1VITF 4AYVB 2PTNA 1O2OA 2J92A 3PLBA 1O0DH 4JYVH 1L4ZA 4XOJA 4GCHG 5TCAA 4O3UA 2P93A 5AVDA 1ETTH 1HFDA 3QGJA 4KTCA 1PYTC 4FU9A 2VGCB 2UUFB 4ESTE 3BF6H 4O9VA 4JCNA 1DANH 1D3DB 1PFXC 2FOGA 2D8WA 3E6PH 4TPYA 4MNVA 4Y8ZA 2FDAA 1GI0A 2OC1A 2XC5A 2ZFFH 2FP7B 1GMCG 3ZVBA 4NA7A 3RC4A 1UVUH 1NRPH 3OX7U 3SNDA 1TMUH 4DVAU 1O3KA 3K6YA 4ISOA 4MQAA 4BXWA 2BLWA 1YCPM 4AB9A 4NIVA 3EDXB 3MH7A 2G4UA 1ZGVA 4AG1A 2R3UA 3ATMA 3ATKA 1P2KA 1B5GH 2H1UA 3LJJA 1NT1A 1AFEH 4UFEH 5ETXA 1N8OC 4ZHLU 2D2DA 4TPIZ 1DSUA 1ZLRA 2FZZA 1LQEA 3BTKE 1MBQA 3M5MA 3BIVH 4B75A 1GJ9B 1GBLA 4DURA 3GY3A 1P57B 1EP5A 1P06A 4IMQA 3SQHE 3U69H 1AY6H 1V2UT 2BXTH 2XWBI 4CRFA 1XX9A 4J1YA 1UTPA 2W5EA 1G3DA 5GJ4B 3RXUA 1ZSLA 1YCPH 1FMGA 3RXMA 1SGIB 1RGQA 3UREA 3RM0H 1RS0A 4B73A 1CQQA 1JMOH 1QBOA 2A1DB 1TE0A 4CH8B 3KEEA 2GT8A 1XXDA 3E90B 1VZQH 4GVUA 5CMXH 3UNSA 1EZXC 1F0SA 3MI4A 3ZZ9A 1AWFH 2EI8A 2VU8E 4ZKSU 3A81A 2PUQH 1K28D 2GGVB 1MUEB 1ELFA 1CGJE 1N6YA 3UTUH 5K7RA 2ANKH 1SMFE 1AVWA 1OWDA 3ZZCA 3PB1E 1TGNA 5F03A 1T8LA 2BD9A 3KGPA 2ZU1A 1GMDG 1QJ6B 3U8TH 1TOMH 4I7YH 1P03A 2GP9B 3U8RH 2BMGB 1ESAA 1PPCE 1HYLA 2ZGXH 4OS6A 2ZP0H 2ZFSA 1YLDA 1GJCB 1J8AA 1V2WT 2GCTB 4CHAC 2ODYB 5IYTA 1SVPA 2GZ8A 1DS2E 1P3CA 1C2HA 4WH6A 1Y3XA 5G4BA 3VFEA 1P04A 4ZKOU 1YPKH 1GHVH 1O3HA 4K69A 4YZUA 1O3AA 2BDGA 2FO9A 3F6UH 3Q3YA 1DLKB 3OY6U 1BDAA 4FUCA 2FOFA 1O37A 1A7SA 2ZZUH 1FONA 1D3QB 3RXSA 1O2IA 1O2UA 4X0WU 3L3TA 1OOKB 1SC8U 4ISIH 2W26A 3O8RA 4D7FA 4E05H 1IQNA 1BMAA 5DPAA 3AAUA 3FAOA 4M7GA 3SU1A 2BLQA 1QGFA 4GAWA 2FYRA 1KTTB 4NFEA 3A82A 5EW1H 4BTUB 2QXIA 1D6RA 3PMAB 3SUGA 1O2RA 2W3KA 1YYY1 2FOMB 1LKBA 1OYQA 2G4TA 2PKSC 5EQRA 5C5OA 2IJOB 2IOTA 1QJ7B 1Z6EA 2XC4A 1OWKA 1ZJKA 5EPYA 1GMCF 1C2LA 1O2HA 2AIPA 1K1JA 1LQDB 8KME2 4XBCA 3M3TA 3CS7A 4NFFA 2WYJA 3MTYA 2HGTH 1HAVB 2A0QB 4YOIA 1V2OT 4WY3A 3VB4A 3FP6E 3LKWA 1SGRE 3SW2B 1SQOA 1OWEA 4WWYA 1PPHE 4WH8A 1O31A 3MO6A 3MWIU 1NFXA 1C5MD 2AH4X 2OD3B 4ABDA 5J4SA 3SV2H 4X1QU 1LHDH 1EAIA 1TPPA 4NWKA 1GBEA 1TFXA 3SUFA 5L2YH 3SGQE 3O8BA 4Y8XA 3ZVAA 1Y3WA 4OGYA 3I29A 3E0PB 2WPJS 4OS7A 3ZZAA 1O3BA 1O3GA 1NRQH 1NTPA 2FESH 3VB6A 4X1RU 1TB6H 1BBRK 1NRNH 1QRWA 1DSTA 2ANYA 1GJ4H 1MQ6A 3PV4A 3QK1A 4WXIA 4BANB 3SV8A 1EZUC 1TMTH 4I8JA 1GGDC 1YC0A 2ULLA 1MBMA 1C4U2 2DE8A 1LHGH 1UVSH 1SOZA 2FS9A 3ELAH 1GHYH 4AFQA 3E0NB 1GVLA 1BB0B 1QJ1B 1F92A 1GHXH 1SLWB 1BTXA 1C4Y2 5A09A 3GISB 1HJAC 5A0AE 2V3OH 2FTMA 4FU8A 4DJZB 1P3EA 1A0HB 4AGKA 2V3HH 1W3CA 6LPRA 2KAIA 2JETC 1GMDF 2TGDA 2R0KA 1AZZA 4UONA 4E7RG 3BTTE 2UUKB 1NO9H 1Z8RA 2ZPQA 4Q7XA 2CMYA 1GDUA 1TBZH 5FBIA 4A92A 1MTVA 2QF0A 4UD9H 3OTJE 3RLWH 1SGPE 2F3CE 1ZSJA 1D9IA 2C90B 3GCNA 2NU4E 1C5WB 3S69A 3MNCA 4X6OA 2BD3A 3OU0A 4K3JA 4XDEA 5DJ7A 1O2LA 2JH0D 1AD8H 1TRMA 2ZHFH 3QWCH 2ZTZA 3RMLH 4MPWA 1GI6A 3ESTA 2ZHDA 2ZQ2A 3KQCA 4B76A 1G3BA 2Z3EA 5JB9S 2BY6X 5C67A 2QIQA 2ZG0H 3RMNH 3ATIA 3SU5A 1J14A 1Z71A 3E3TA 2O9QA 4FU7A 1GBBA 1V2PT 1BA8B 1IQIA 5C20A 3RXVA 1LCYA 2G5NA 1LHFH 2Q6DA 2UWPA 1FY8E 2G55A 2BLVA 3PMJA 2YNBA 2Q1JA 3BTDE 1DICA 2PW8H 5GWZA 4A1XA 1QB6A 5JDUB 1OP2A 1TOCB 3T26A 1C2DA 3TK6A 1LKAA 5C5NA 2J38A 3TGIE 4GSOA 3A7YA 2P16A 2C8XB 3A84A 2Y82A 3OSYA 1TPAE 1G3EA 1H4WA 1FN8A 3MO9A 1LVOA 4JZIA 4FUEA 1QURH 2B0FA 2AYWA 1L2EA 4UDWH 2D1JA 1KLTA 4NA9H 1OKXA 3BIUH 1SGFA 4Q7YA 1HXFH 1N6XA 3IWMA 2ZHQH 2TRMA 3MU1A 1O2JA 2SGEE 3D49H 3QO6A 1IQGA 3PLKA 2TPIZ 5HGGA 1WOFA 1VCWA 2VIVA 3EGKH 1AMHA 1CGIE 6GCHG 2STBE 3GCOA 1GBIA 1TGCA 4A1VA 1UMAH 1BTUA 1EAXA 1SLUB 5DO4H 1K2I1 1O33A 3EA8A 1FV9A 1GI4A 1A0LA 3PM3A 1GI5A 1OYTH 1K1IA 1DOJA 1H9HE 3PROA 4BAHB 4NGAH 4MNWA 3ZZ7A 1QL9A 2BY7X 3P8FA 3MNXA 5LH8A 1F0RA 2UWLA 4IN1A 2QA9E 1IQHA 4WF8A 4O97A 3LOXA 1O39A 2YNAA 3BSQA 3LONA 3RU4D 3BV9B 4Y0ZE 2PV9B 1KXBA 2BVSH 2BDCA 1A5HA 4GUXA 4TWYA 3N7OA 4X2WA 4NCYA 5TJXA 4F4OC 1L4DA 2QCYA 4LZ4B 3S9AA 2ZIQH 2H5DA 2ZDMA 4MPXA 3RM2H 1C2IA 3SJ9A 2QXGA 5E0GA 1YPHE 3NK8A 1B0FA 4IN2A 4AGJA 1C1SA 2V0BA 3GDVA 3SHCH 4A7IB 2BQWB 3RXEA 4NZLA 1DM4B 3MU4A 2FS8A 3PWBA 5EXMA 2OLGA 2VGCC 3SJKA 1H9IE 3SNAA 3O8DA 1T7CA 3NUMA 1P9UA 1FDPA 3RDZA 1A5GH 5DP3A 1KXAA 1HAXB 5GPIB 2A7JA 1WAYB 1ZYOA 2BYAX 2VWLA 3F9EA 1TALA 2BDYA 5L30H 4K1SA 2OBOA 1CT0E 2ZFQH 2H5CA 4ZH8A 1C5VA 1PPEE 1P2OA 2R2WU 4OGXA 1HV7A 3GY8A 1GI2A 1WTHD 1NFWA 2G81E 1BZXE 3B23B 3BTME 2A45B 1ZTJA 2AMPA 3T27A 1YPHC 4H4FA 3VB5A 2XBVA 4DIIH 4AORA 1EATA 1FPHH 4Y7AA 4K1TA 1XVOA 1YPEH 2HLCA 1GL1A 1WCZA 3OY5U 1O3CA 1BTYA 2P95A 3P6ZB 5K0HA 3MMGA 1W8BH 3T62A 2Y7ZA 1MTWA 2OQUA 1NRRH