1XUFA

Trypsin-babim-zn+2, ph 8.2
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
molecule tags Serine protease
publication title Design of potent selective zinc-mediated serine protease inhibitors.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1997-10-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xufA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1xufA02
2RDLA 2BDIA 1CGJE 1OP8A 1C1VH 3M3VA 4KTUA 3TH2H 2FOCA 5AFYH 1MAXA 2BDGA 4NIVA 2PGBB 1O3MA 4MNVA 3ZVBA 1MTNB 4AFZA 3MH6A 2RA3A 3ELAH 4JYVH 5DP6A 2B5TB 3UPEA 2ZTXA 4ABBA 1HAOH 1F0RA 1YM0A 1HLTH 1TFXA 3P8OA 1D4PB 2BQ6B 1UVOA 4Z6AH 1F0SA 1DWBH 2O8MA 3IITA 3O8CA 1OPHB 1GI2A 1HAVB 1D6RA 3GISB 4K2YA 1E0FD 1YC0A 3LGYA 1N6YA 3A83A 1GBBA 1L2EA 2VVUA 3C27B 5GDSH 3PM3A 2ZEBA 4DURA 2GVFA 1IQFA 1BCUH 4ZHAA 1P03A 1GBFA 2ZTYA 4FUBA 1MKWK 1KTTB 1O2HA 4BAQB 3GCHB 1ELAA 1LHGH 1W3CA 1YPJH 2IPHA 2CF9H 3PLBA 1ZMJA 1DUEA 4D9QA 4YOGA 4O3UA 4NIYA 1FNIA 4MDSA 3GCHC 2R0KA 4XOJA 5EXMA 1KXBA 2AERH 1SGFG 4IGDA 1CHOG 3Q00A 1EB1H 2W26A 1GMHF 2A31A 3RXVA 1UO6A 4AYVB 1JXPA 1SQAA 4JK5A 1ZPZA 1LPGB 2FI5E 3A7ZA 3HATH 1YKTA 3UR6A 5K7RA 3TJNA 1INCA 1G37A 1O2KA 1TGNA 3SHAH 4GAWA 3LH1A 1UTJA 3UQVA 2WPMS 5SGAE 2OXSA 2PTCE 1QB6A 2P93A 5JB8S 3ZVAA 3IG6B 1V2PT 1HJAB 1VZQH 1YPEH 2EC9H 3GY2A 3I29A 4DIHH 1FPHH 2Y7XA 4JZ1A 3ENSB 4H6SB 1Q3XA 2J94A 4PROA 2F9UA 5DP8A 1AB9B 1C2IA 1H8IH 1AD8H 1ZR0A 1W10U 1GHBG 3E6PH 4CRDA 2RCEA 2ZF0H 2GDDA 1QB1A 5C67A 1C1SA 1DPOA 3GY6A 3A7VA 2EI6A 2ZDKA 2FOAA 5TJXA 3RDZA 3VB3A 1Z8RA 4WH6A 1BQYA 1Y3UA 2BD4A 2BHGA 1ZOMA 1GCDA 2XBXA 1C2DA 2G81E 3A86A 1GL1A 5CHAC 1AVGH 1FZZA 1F92A 1BA8B 3FFGA 3RXHA 5HM9A 4JZFH 3QGJA 4BOHA 1LTOA 1K1MA 1RTLA 4XBCA 1Y5BT 4F4OC 2BQ7B 2HNTC 3LC5A 2SGFE 1P12E 1HAPH 4ABDA 1K1LA 1IQGA 1GL0E 1J16A 2ZDMA 3U98H 5DP5A 2BLWA 1GGDC 4X2XA 2P3UB 1BBRH 4HZHA 1GBMA 1G3CA 3BTKE 4A7IB 2AS9A 2FM2A 2SGEE 1HDTH 3E8LA 4RSPA 3LGVA 1GHWH 2CXVA 3K9XB 2ANWA 2BD7A 2V6NA 4I7YH 2IOTA 7GCHF 1D9IA 5EGMA 4XE4A 4D76A 3VPKA 4A6LA 5AHGH 9ESTA 4Q2KA 2Y6TA 1HB0B 2ZU5A 4UD9H 5CMXH 4ISOA 1DLKB 1V6DA 3EGKH 1F2SE 2ZFSA 1QURH 4VGCC 2ZTZA 3S7KB 4D9RA 5E0HA 1RTFB 3V3MA 5TCCA 4FUIA 1MD7A 1D3TB 2WYGA 3A89A 1DITH 2FODA 2A4QA 3RXLA 1TNHA 2ALPA 2GCHF 1V2MT 4X6NA 3T27A 1BB0B 1OSSA 1WQSA 4Y8YA 4VGCB 1DY9A 1QA7A 4IBLH 1CQQA 2TPIZ 4X6PA 5EXLA 4ABJA 1TGBA 1Z8JB 3SBKA 1F0TA 2LNCA 4MNWA 1O3CA 2PTNA 1G3EA 1QHRB 5FHTA 3K6ZA 3MU0A 3K65B 4OS5A 4DG4A 1IAUA 4B2AA 1F7ZA 4AG2A 1A5HA 4I31A 3U1JB 4H4FA 5FPSA 4GLYA 1C1QA 2RA0A 1C9PA 2ZDVH 2AYWA 5DJ7A 2OBOA 1GG6C 1CA0B 3MU5A 1ELTA 2PKSC 1KXAA 2G8TA 2Y80A 2VVCA 1P10A 2O8UA 2WV5A 3SUDA 3LGIA 1GJ8B 2GCTC 2R2WU 5FBEA 3ZZ6A 1O3DA 1GG6B 1OWKA 3GDSA 4IC5A 5JBCS 4A1VA 1TPPA 2Z9JA 1BRBE 1GMDF 4KGAA 1SGFA 4NFEA 4XSKU 3SORA 3M7QA 2XNIA 4CBNA 2J9NA 3SNBA 4CHAB 3KL6A 2ZDAH 2BXTH 4MPVA 2PKAB 4JMYA 3DFLA 1HIAA 2BOHB 4FUFA 3SU1A 3RU4E 1DVAH 4XDEA 1TPAE 4B74A 1YPGH 2ZCLP 4ZH8A 1TBRH 3V13A 1BTHH 1KXEA 3HPTB 3N7OA 2BQWB 2O8LA 3M35A 1C2KA 1AE5A 1DANH 1ZPBA 3ZZ8A 2XBYA 1UTMA 3RXIA 4INLA 1SL3A 4X8SH 4CRFA 3TNTA 4AB9A 1TNKA 2B0FA 2ZHWH 5E8EH 4BAMB 4NCYA 4AFQA 2HRVA 3B8JA 4XFQA 2O8WA 1GJDB 2PWXA 4IW4E 4UFGH 3L33A 4THNH 4GUXA 2YOLA 5C1UA 3GY5A 1NRRH 2BDHA 3H7TA 2UUJB 1QRXA 2WINI 3P92A 3ZV8A 1SI5H 1EJAA 3LDXH 1GI4A 2VIQA 4HFPB 1HAIH 2DUCA 4WJG2 1ZGIA 2Q6DA 2TGDA 3QO6A 3H5CB 2PGQB 2SNWA 2ULLA 1CGIE 1LPKB 1TPOA 1XUHA 1QRWA 1P01A 3T5FH 4R8TB 1DWCH 1A46H 3RXSA 4DOQA 1QL9A 3VXEH 3A8BA 4K1EA 3GY4A 2R0LA 1NM6A 1HJ9A 1HV7A 4IN1A 1AHTH 1BT7A 4CH2B 1GJ7B 1OOKB 3A7WA 5ETXA 3UTUH 2AGEX 2K1QA 2W3KA 1JWTA 3Q3YA 2CJIA 1PPBH 1MQ6A 1Z8IB 3MO6A 4A92A 1C5WB 2OQ5A 4K1SA 4NG9H 3Q3XA 5LGOA 1C2JA 3ZZ9A 5ESTE 1EZSC 4Y11E 2ANKH 5C5OA 4NWKA 4TYDA 1HFDA 1TGTA 1FAXA 1CVWH 4D7GA 2AMDA 4TWWA 1QCPA 1T8MA 3GCNA 3DUXH 3SQHE 1O31A 2VVVA 4RKOB 1IQEA 3SGAE 2GKVE 2PSYA 5EPNA 3UR9A 1O2QA 4AORA 1TGCA 2WPIS 3ZVCA 4Y79A 2Y7ZA 5DP9A 5T3HA 2VIWA 1MAYA 3FZZA 3RXRA 1ANEA 2C8ZB 4NSVA 4Y7BA 2ZPRA 1QB9A 1CT0E 1J9CH 2B7DH 2TRMA 4J1YA 3ATIA 3A84A 1C5OH 3RMLH 1P2NA 1ELBA 2GZ7A 8GCHG 1YCPK 4KP0A 1KLJH 1UVPA 3VB4A 1MU6B 2G51A 2IJOB 1XX9A 3D23A 1XXFA 5C1YA 2QXIA 1VCQA 4TWYA 1HXFH 2FYQA 1O5AB 3URDA 1N1LA 1HAYB 3ATMA 1T31A 1BRAA 3IWMA 3RXOA 2P59A 1ELFA 1WOFA 2XTTB 3BTEE 1MQ5A 1O3EA 4OGXA 4I8KA 2ZKSA 2GTBA 4O3TA 1T4UH 1B0FA 2CHAC 4FUHA 1UMAH 2SFAA 3HKJB 2ZDLA 4X8UH 2FXRA 3D49H 5DP3A 5FAHA 1O3FA 1EB2A 1VITG 2V35A 2C8YB 4D7FA 3OY6U 1P3CA 4FU9A 1FLEE 1MU8B 2PR3A 2FLRH 1K1IA 2ZQ1A 1ZTLA 2Z9IA 1GHAF 1FIWA 1OKXA 2OCVB 3NPSA 1GBJA 1K1NA 1C5RA 1GMDG 4NWLA 1MZAA 1QFKH 1XUGA 1DX5M 1AUTC 1V2UT 3EDXB 7KMEH 3M5OA 1AKSA 2AIPA 5T6DA 1FY8E 1O2UA 4CBOA 3BEFB 4K8YA 3BTHE 2Q1JA 3ZZAA 1S6FA 3URCA 1TBQH 4O9VA 2XXLA 5GCHF 1GBKA 1MKXH 1UHBA 5F6MA 3BTFE 1GWAA 3R3GB 5A2MH 3F9GA 3SUFA 5T6FA 1UVTH 3SOSA 1O36A 1EAIA 3TPIZ 4Y8XA 5G4BA 5HMAA 3BEIB 2W7UA 1BRUP 2XC4A 1C5XB 1V2VT 1C1TA 1W12U 2ZNKH 3LKWA 2BDCA 2HNTE 1FIZA 4ZXYH 2Z3CA 5AF9H 3E0NB 2STBE 1VR1H 3A81A 1PYTD 1ELGA 4YT6H 5EOKA 1FN6A 3GY3A 2C93B 3DA9B 4BTTB 5B6OA 2VIPA 3M3TA 5GPIB 3FP8E 4FVDA 3PMAB 2OLGA 2ZGXH 3O8RA 3RUOA 1C5VA 1TOCB 4DW2U 1C2LA 1Y3VA 5DPAA 2JH6D 5DK1A 1GJ5H 2NU0E 4UFFH 4WXIA 2F9VA 1DFPA 1S82A 4CRAA 4NZLA 1TB6H 2A32A 1BHXF 1YGCH 2F9OA 1KYNA 3MH4A 1TX8A 3U8OH 1CA0C 1F0UA 3ZVFA 5JBTA 5EPYA 3VXFH 3P8NA 2ZFRH 3BG8A 1C5ZB 1RTKA 1THSH 3E90B 1NRPH 4I8JA 3NCLA 3STJA 3U69H 3PV4A 3QTOH 2HWLB 2ODPA 5L6NH 1SSXA 3A8CA 4AZ2B 4X2WA 4ESTE 4X1NU 3A82A 1Z1IA 2BVSH 4XBDA 3VB7A 1HIAB 1AZ8A 2ZCHP 3A8DA 2THFB 1ELCA 4ISLA 4JYTA 8GCHF 1QBVH 1DXWA 1BTXA 1THRH 1GHVH 4HGCA 1TRYA 2OC7A 1OWEA 2ZU4A 2AGGX 1TRMA 1GI9B 3A7XA 1GVKB 2VNTA 1BTYA 1SOTA 2YNAA 3B9FH 4X2YA 5JBBS 5EW2H 5EQRA 3KIDU 3KNXA 1SLXB 1C4U2 2Z9KA 3ZVGA 1ZJDA 3Q76A 5A0BA 3TK5A 3RXEA 2QY0B 1AIXH 1LHFH 4WWYA 3F9EA 1Q2WA 1YF4A 1BJVA 2H5CA 4FU8A 1EZUC 1MCTA 3SV2H 1EP5A 2D2DA 1KLIH 1GBAA 3QTVH 4MPUA 5JB9S 1FPCH 4MPWA 1DLEA 3S0NA 1TQ0B 4JCNA 2PFEA 2XWBI 5TCAA 7LPRA 5FXLA 4I8GA 1ZMNA 1BTUA 2Z9GA 1TPSA 4ZKNU 3SNCA 3BTGE 1HJAC 4ABHA 3SGBE 1EZXC 2PKSB 3SN8A 1VGCC 1GJ9B 2AMPA 3TK6A 5FX6A 1GGDB 1TA2A 1GJ6A 1T4VH 1QJ6B 3MHWU 5EQSA 2GZ8A 2ZFQH 4JZEH 3LH3A 3GYLB 4LZ1H 1ELEE 2J95A 1TOMH 3M5NA 2OQUA 1J14A 3MO9A 4IC6A 3HKIB 2ZFPH 3S69A 4HTCH 1V3XA 3PLPA 5A09A 1P9SA 1ZRKA 3U8RH 3ATWA 1PPZA 2AH4X 4UFDH 5L2YH 4NIWA 1C5QA 1V2RT 5HXFA 1ZPCA 2EI8A 1QGFA 4YESB 1V2TT 1WTGH 1JMOH 3MOCA 5EXNA 4AOQA 4GVUA 1BJUA 1ACBE 5BRRE 2KAIB 1DT2A 1S0QA 1YCPM 3SU3A 2F83A 1MBQA 1Z71A 1JIRA 4WMEA 4MPXA 5C3NA 2SGAA 4K5ZA 2FX6A 1O2YA 2A7CA 3SV6A 3AAUA 1MTUA 3UNSA 8KME2 1P2JA 1O3IA 1NRQH 2FS8A 2BY5X 3NWUA 4ZKOU 1VITF 5C20A 2BD9A 3AAVA 1O2GH 2UUKB 1TMUH 1UCYE 3TH4H 1TX6A 4GSOA 1GCTB 1NY22 3V7TA 2TGTA 2VWLA 2Y5HA 1GBEA 3F1SB 3FP7E 2OD3B 1KXDA 1SGNE 2R9PA 1K2I1 2FESH 2PV9B 5DKMA 2SGDE 2JETB 4IMZA 1OP0A 2VJ1A 2GT7A 1P2KA 4LK4A 1ZMLA 1YLCA 3KN2A 3RLWH 5FX5A 2BVXH 4KKDA 1PJPA 1P04A 1HAXB 1L0ZA 4KELA 4NIXA 3MH7A 5HYOA 3OSYA 3VFEA 1H9HE 1P2MA 3OY5U 3M61U 1OWHA 4TPIZ 4AGJA 2GV7A 3LIWA 3NKKA 1HCGA 1O3AA 1SLWB 2BLOA 1O2WA 1SBWA 2GD4B 3TLOA 1A7SA 2ZGJA 3DFJA 1V2KT 1AVXA 3STIA 3S9CA 1VITH 4Y6DA 1GI8B 1NRNH 2P94A 1CBWB 3UWIA 2A2QH 4OS4A 1KXCA 3PMJA 5GCHG 2BTCE 3A85A 2UUYA 2ZHDA 1ZTKA 1AFEH 1THPB 3BN9A 3SO3A 4YLUA 1MZDA 1CE5A 3QGNB 4CHAC 1N8OB 3EQ0H 1SGEE 3A87A 3GY8A 3TGJE 5A8ZA 1YPKH 1IQKA 2FPZA 3U8TH 3TJVA 1AMHA 1A2CH 5F8ZA 5A8XA 2BD5A 1LVMA 1BMNH 1BBRE 1UHBB 1VCPA 2OP9A 1W0ZU 1T8OA 2FZZA 3RC4A 5LPRA 3ZZDA 1SPJA 1O2PA 5LPEA 1P2IA 2G55A 1C2GA 1SGTA 3PLKA 2BLVA 2Z3EA 2ZGCA 1GI3A 1DM4B 3UNQA 2XWAA 1C5YB 5C1XA 3BTTE 4MQAA 1KIGH 1ELDE 4OS7A 1HAHH 1C1PA 1O3LA 2NU3E 1B0EA 1A5GH 2BD3A 3SJ9A 1DDJA 1CGHA 2IN2A 2NU1E 4X6OA 3RXAA 2BM2A 2BX4A 2BDAA 4MTBA 1GJAB 4UONA 2FTMA 1EZQA 1QQ4A 2GDEH 1GCTC 2PUQH 1FY5A 1GBTA 1EJNA 4FUEA 2XBWA 1RGQA 4KTSA 1ANDA 1VJ9U 3TK9A 3LT3A 4ABGA 1G3BA 1O5GH 5K0HA 2P8OC 2BDYA 2H9HA 4E7RG 1V2LT 1O3PB 1H1BA 1EAUA 4NA8A 2FMJA 2J38A 1BTPA 2A5IA 2SGQE 3M7TA 1FY4A 1AZZA 4Y7AA 1YYY1 1UK4A 5DG6A 2FLBH 2GV6A 3F9FA 2ESTE 4I33A 1MTVA 3UY9A 1UCYH 3LU9B 1P2QA 1TGSZ 4UEHH 4AG1A 1YLDA 4NSYA 3TIUA 2A45B 2AFQB 2G4TA 1P05A 5GJ4B 3BIVH 1S0RA 2TIOA 1RFNA 5F03A 4QT8C 1NT1A 2VIOA 5GWZA 4B75A 1W8BH 1LKAA 2ZHQH 4I32A 1L1JA 4K60A 2XRCA 4Z0KA 1LVBA 1BITA 3BTQE 4ZAEA 3SHCH 3LPRA 3WY8A 4YLQH 3U1IB 1WCZA 1D3QB 4M7GA 5E0GA 5JBAS 2ZHEH 4NA9H 4X8VH 6ESTA 1QR3E 1IQIA 4FUDA 3SNAA 3SU2A 3FVFB 1NO9H 2XC0A 1WAYB 1EJMA 3ZZBA 1O34A 1UTLM 3FAOA 1BTWA 2BVRH 3HK3B 4NGAH 3EAJA 2TBSA 4WMDA 2OC1A 1SGCA 2ZPSA 1OWIA 2FI4E 2Y5GA 1VGCB 3A7YA 4ABEA 3W94A 3QX5H 1EUFA 2VINA 1V2QT 3O8DA 4INKA 1RRKA 1ZRBA 1L1NA 1LHEH 4BXWA 1OWJA 4WXVA 1AY6H 1GJ4H 1EOJA 2G5NA 5T6GA 4Y0YE 1HPGA 1BHXB 1JIMA 1OX1A 3TNSA 1Y3YA 1O30A 4D8NA 2WPJS 1H8DH 2EI7A 2R3YA 3FANA 3M37A 1O38A 1DWDH 2FOHA 4ZMAH 5FPYA 2J2UA 6CHAC 3UOUA 1SGIB 3GDUA 1P09A 1TONA 2LPRA 1T8NA 3KF2A 1Q31A 1GVZA 3RLYH 3ATKA 2ZQ2A 1ABJH 3RU4D 3PMBB 4FU7A 5JPMH 2VWNA 2UUFB 1PPFE 1SFQB 4AFSA 4Y8ZA 2XC5A 2J34A 1W13U 4Y10E 2GCHG 2OUAA 2VGCC 1O37A 1WTHD 1KSNA 3CP7A 1AU8A 1ELVA 3MO3A 3RXDA 1DE7H 1HUTH 3PWBA 1W0YH 1SVPA 2H1UA 4ZUHA 3BIUH 1C1NA 3UWJH 2ANMH 3M7UA 1PQ7A 3GYMA 5DO4H 1O3JA 1C5LH 5DP7A 1BMLA 4BAKB 2QC2A 3EE0B 7ESTE 3MNSA 1G36A 1NFWA 2GZ9A 1Z6EA 1BMAA 1WYKA 3ZZ3A 3KEEA 1G9IE 2ZGHA 2RG3A 3LOXA 3TJUA 2CMYA 2ODQA 1PQ8A 7GCHG 3E16B 4CR9A 5CE1A 1O2RA 1FUJA 1Z8GA 4ZHLU 1O3BA 3JZ2B 3MU8A 1DOJA 1TNIA 2HALA 2ZIQH 5GIBA 3FP6E 5BPEA 3RMMH 1E37B 3TITA 1DXPA 3RXBA 3SU6A 3AASA 1UTQA 2VIVA 3AW1A 2FTLE 4TY7A 4K69A 3S9BA 5LPFA 4FUCA 1GDUA 5E2PA 5C2ZA 1ZGVA 2ZG0H 2QV1A 4SGBE 1MD8A 1C4Y2 2ZFTA 2P3FH 2ZU1A 1TQ7B 3SZNA 5CHAB 2H9EH 4B71A 3M3SA 1SMFE 4K1TA 1O2TA 1UTNA 2F9PA 1NS3A 1XUFA 2SGPE 3UUZA 4X8TH 1P2OA 4TPYA 1GHZA 1DSTA 4BAHB 1JBUH 4ZKSU 1BZXE 1AUJA 1PPCE 3MTYA 5FBIA 4E05H 2V3HH 2GT8A 3RXMA 3BTME 1C1RA 1AB9C 2M5TA 1O2MA 1O2SA 1V2NT 1JRTA 4X0WU 1MUEB 2ZZUH 3NZIA 1GHAG 2YNBA 1K9OE 1P3EA 2A5AA 4WVPE 4X1RU 1TBZH 2A2XH 3RXUA 1AO5A 3RXQA 3F9HA 1E35B 3QDZB 3VGCC 2HPQH 4KTCA 1O32A 1A1RA 3MU4A 4FUGA 3BF6H 2FIRH 4B1TA 2A5KA 3TGKE 2ALVA 2G5VA 2QXHA 1AWFH 1K28D 2H5DA 3U9AH 5EU8A 1IOEA 1AKSB 4AX9H 1LPZB 4U2WA 3ZVEA 2BYAX 4ISNA 2BZ6H 5I46H 4JZIA 1QJ1B 1O5EH 3RC5A 1QRZA 1WQVH 2TGPZ 3PB1E 4IMQA 1P06A 4YOIA 1O3OA 3KQDA 1QY6A 4YOJA 1ZJKA 2D1JA 4YO9A 2F9NA 1O33A 1QBOA 3GY7A 3E91A 1CO7E 1SLUB 1WU1A 1CHOF 1JOUB 4OS6A 1G32B 3T2NA 4OS2A 2P16A 2OC8A 1TYNA 3OU0A 1S5SA 1MCVA 3VEQB 2WUBA 1DS2E 1EASA 4Y76A 4ZHMU 1W11U 3RXCA 3ZYEA 1H9IE 1MH0A 1O0DH 4AGKA 3T62A 2R2MB 3RXGA 4LXBH 4AB8A 3SQEE 3HGPA 5AFZH 4A1TA 3SW2B 1Y5UT 5DGJA 4DVAU 3M5LA 3GCTF 1UCYK 1A5IA 1C5TA 3EA8A 3VGCB 3PMHB 4RN6A 1QTFA 1YPMH 3ODDA 2HGTH 3TGIE 3AW0A 1P57B 4H6TA 1CT2E 1T8LA 1L1GA 2C3SA 2F91A 1XKBC 2QAAA 4ABIA 1DWEH 3ZZ4A 4B73A 1EX3A 2A0QB 1B5GH 2A1DB 2PSXA 3T29A 2Z94A 2FO9A 1C9TA 1TABE 1RD3B 4MNYA 2H9TH 3GCTG 1S85A 1ZTJA 2NU2E 1Y59T 1A3BH 1K1PA 1AI8H 1BMMH 2ZU2A 5JYIA 2HNTF 1BRCE 1LHCH 2AIQA 3MNCA 3ZYDA 1WBGB 1AN1E 3MMGA 3LGUA 3UQOA 3K6YA 1LMWB 4CRBA 1ZSLA 3P8FA 1OP2A 2BXUH 5L2ZH 3D62A 2D26C 2Y81A 4R0IA 1GPZA 1C5NH 5A0CA 1TRNA 3V0XA 1QL8A 1GI0A 1GJBB 4OGYA 3K2UA 3G01A 1EKBB 5HGGA 1ARCA 1XUKA 2WPLS 3ZVDA 1AVWA 1P8VC 1GMHG 1YPHC 3SU0A 3SUGA 1L4DA 5EW1H 2P95A 1D3DB 1HRTH 1O2ZA 2HLCA 1K1OA 3S7HB 2GCTB 2Z3DA 3ZZ5A 5J4QA 4JYUH 3CS0A 1NU9A 2JH0D 2BD8A 2WYJA 2WV4A 2BOKA 1ETRH 1N6XA 1SB1H 1MKWH 3RXKA 1CSOE 3P70B 2Y5FA 2ZFFH 3ODFA 2AGIX 2D8WA 2STAE 2ZGBH 3ITIA 2I6QA 1YP9A 1FN8A 1B7XB 8LPRA 1W14U 1QNJA 8ESTE 1OWDA 3RMNH 3I77A 4B76A 2ZDNA 1T32A 5J4SA 1XVOA 1K1JA 1HGTH 3BG4C 2QCYA 4IN2A 3QZRA 2O9QA 2FOBA 1UTPA 4Q7ZA 2A4GA 1GI6A 2VIDA 1C5UA 2VGCB 4X6MA 3LJOA 3ZZ7A 3NK8A 3DHKH 1C5PA 1E34B 3RXTA 3RXPA 1W2KH 4E06H 1X7AC 1QIXB 5JDUB 2DE8A 1XKAC 1MMJN 3T28A 4ASHA 4X1QU 1L4ZA 4X1PU 1SGYE 2B8OH 1NN6A 1O5BB 4UE7H 1EPTC 1ANBA 4WH8A 1D6WA 4LOYH 5PTPA 4GHQA 1ESTA 4NFFA 2BY7X 1IQMA 2NWNA 2VU8E 1TNGA 4ABFA 5L30H 2ZO3H 1OYQA 3O8BA 2V0BA 2FOEA 3RXJA 3AVZA 3OYPA 2UWPA 5FCRA 5EODA 2W5EA 1S83A 2QIQA 1LHDH 2P3TB 1RXPA 4YZUA 1KTSB 1QJ7B 1O5DH 3RM2H 3BTDE 1K21H 4CREA 5EG4A 2FOFA 2DE9A 4MNXA 3BG4B 1QBNA 2FWWA 5E2OA 1NFYA 3UOPA 1LCYA 3HK6B 2ODYB 2ZA5A 3BEUA 1KDQA 4J2YB 1SGDE 3SGQE 1NFXA 4DT7B 2A7JA 1IQHA 3TH3H 4AYYB 3PROA 2EEKA 2GMTB 1FI8A 3BTWE 1GJCB 1WSSH 2CN0H 4BAOB 3BSQA 3MI4A 1A0HB 1GMCG 5IYTA 4A1XA 1FXYA 3KCGH 4DY7B 1GBLA 3QK1A 3MNXA 4Q80A 1S6HA 2FYRA 4B2CA 1XMNB 2CHAB 2FP7B 2WPKS 1FV9A 1Z7KA 2A4OA 2BD2A 1GBCA 1MBMA 4BNRA 1S84A 3D65E 3W95A 4Q7XA 2VH6A 5IDKA 5C5NA 1A3EH 1XUJA 3E3TA 4H42U 1EXFA 3SNEA 2ZP0H 4X2VA 6LPRA 1LQDB 2Q6GA 1TX7A 1VCWA 1HNEE 2BZAA 2C90B 1O2XA 4OS1A 3P95A 1SR5C 3A88A 1GI5A 2A4RA 5A8YA 2QYIA 3ESTA 3DD2H 1G3DA 1GDQA 4CH8B 1EAXA 1ZHMA 1BTZA 3SJ8A 1CU1A 3LGTA 2ZECA 4INHA 1Z1JA 2QF0A 1FJSA 2GGVB 2FOMB 4I8LA 2VB0A 4LZ4B 1CHGA 1FY3A 2FS9A 2PUXB 1SLVB 2BLQA 2C8WB 3RU4T 1FONA 3TVJB 4U32A 2ASUB 3EA7A 4MG3A 1EATA 4FVBA 1H4WA 3PO1C 1QA0A 1S81A 2ILNA 4B2BA 5LH8A 2BX3A 2CGAA 3PWCA 5HM2A 3E1XB 4YT7H 1PQAA 1ABIH 3A8AA 2A7HA 1FQ3A 1RJXB 3SV8A 1BUIA 2BY9X 2XCNA 3V12A 1NFUA 1NU7B 1ORFA 4GPGA 4YM9A 3PO1B 1TNJA 1ZSKA 2UWLA 1O2LA 3SUEA 1HJ8A 5EQQA 1OYTH 2G00A 4K8BA 3UIRA 4GCHG 4FUJA 3OX7U 1C1UH 1SHHB 1GBHA 2Z7FE 2G52A 3QZQA 2GX4A 3CENA 5I25A 1SOZA 2QXJA 2XBVA 1C1OA 1O3HA 3FZDA 1F5KU 1ZSJA 2B9LA 3NUMA 1T7CA 2QXGA 1VJAU 4GHTA 2ZWLH 1GVLA 4GCHF 1GI1A 1F5RA 3RP2A 5ESBA 1DICA 1SGQE 2Q6FA 3LONA 1SQTA 5E0JA 3SV7A 4YTAA 1SG8B 4DJZB 1RIWC 1SGRE 3RXFA 1MTSA 3PTBA 4Q7YA 2QA9E 1ID5H 1W7GH 1YCPH 2F3CE 1O2NA 2OC0A 2WUCA 2ZI2H 2V3OH 1TAWA 1SC8U 2JETC 5AVDA 1ESAA 1EOLA 2BY6X 4K3JA 1C4V2 5ABWA 3F68H 2H2ZA 4E7NA 1DSUA 1P0SH 1IQLA 4BTIB 2QGRA 5H4IB 1C2MA 1PPHE 1HAVA 2JKHA 1JRSA 1Y3WA 4CR5A 1HAGE 3VB6A 3P17H 2OTVA 1MTNC 3GCOA 2HVXA 1EQ9A 1ETTH 2PLXA 3KHVA 1UTOA 1EP6A 1TMBH 2XW9A 1XXDA 2W3IA 2PKAA 2H6MA 3MFJA 1ANCA 3SU5A 9LPRA 4BANB 3P6ZB 1M9UA 1TIOA 1W7XH 1A4WH 2QF3A 2FOGA 1HBTH 1NESE 4WF8A 3ZZCA 1PQ5A 1ESBA 1V2OT 4UDWH 4A5TS 2ZHFH 3KQBA 4FXGH 3KQEA 1P9UA 3MWIU 1N8OC 3P8GA 1NROH 1J17T 2AMQA 1K22H 2EA3A 2ZCKP 4DIIH 4CRCA 1YPHE 1J8AA 3B23B 1NTPA 2CV3A 3R0FA 4BXSA 1FDPA 1MTWA 3UREA 4AFUA 2ZPQA 4DCDA 1O5FH 1LO6A 1KXFA 5FCKA 2XYAA 2J4IA 3PTNA 2FEQH 3L6PA 3H7OA 1WV7H 2O8TA 1RIWB 1TE0A 3RC6A 3MU1A 4F49A 1Y8TA 2HOBA 3GICB 1Y5AT 1LQEA 3GOVB 1DY8A 1ARBA 1C1MA 1IHTH 3OTJE 4BTUB 1A61H 2W7SA 1H9LB 1FAKH 1UK2A 2BB4A 4IS5A 1BBRK 1C2HA 1ETSH 3JZ1B 2GMTC 1FY1A 1UVSH 2WPHS 4Y71A 2CF8H 1E36B 1G2MA 3A80A 1V2JT 1O2OA 4AN7A 1BIOA 1C5MD 1C2FA 4MVNA 1TALA 2FDAA 3RM0H 1ZZZA 1SQOA 3SNDA 1AGJA 2XCFA 3Q77A 5A0AE 4WY3A 4ISIH 1LVYA 3ZV9A 1UVUH 4RKJB 1KLTA 1UTKA 1BOQA 1AQ7A 4ZROA 1XM1A 3MYWA 3TJOA 2ANYA 2Z6BD 2Y82A 3QLPH 1AWHB 2BDBA 1DUAA 2VWOA 5F8TA 1FMGA 4NA7A 5DP4A 4JZDH 2Z9LA 2VWMA 1UK3A 3VB5A 1O2JA 3LJJA 3SJKA 4HI3A 4ABAA 3M5MA 3KQCA 4X1SU 3SV9A 5GXPA 4ZXXH 1BDAA 1Y3XA 5F8XA 3C1KA 2UWOA 3T26A 3M36A 3A7TA 4JK6A 1NPMA 1TNLA 1YPLH 1QL7A 1GHYH 3F6UH 3NXPA 3CS7A 1G30B 3EYDA 1GHBF 1D3PB 2HPPH 1CA8B 1HAZB 1NZQH 3BV9B 4SGAE 3RMOH 4TY6A 1IQJA 1GDNA 3T25A 1O2VA 1KDQB 2BMGB 3SJOA 3LC3A 2P8OB 2BY8X 4XBBA 1U6QA 1HXEH 1OXGA 6GCHG 1EPTB 1AFQB 1LVOA 1C2EA 1F5LA 1C1WH 3L3TA 2C8XB 1O35A 4ISHH 1ZLRA 5FPTA 3KGPA 1AE8H 1PYTC 1PPEE 1O5CB 3EA9A 1HYLA 2F9BH 1WUNH 4DGJA 1LKBA 3UFAA 3E0PB 2OINA 1TLDA 4O03A 1C5SA 2PHBA 1UJ1A 1CT4E 2AEIH 1EPTA 2R3UA 3TU7H 1E38B 6GCHF 1O3GA 1O3KA 4MLFB 2NU4E 3LGWA 2JH5D 1G2LA 1P02A 1A0JA 1PPGE 3PYHA 1AFQC 1TA6A 4U01A 6CHAB 1ZHPA 2OBQA 3SI4H 1Z6JH 3GDVA 3ATLA 1NRSH 2ZU3A 2FI3E 2G4UA 1IQNA 2GP9B 1EAWA 3HGNA 3MNBA 4CRGA 1O3NA 2J92A 1SFIA 3UNRA 3SI3H 1GMCF 2PW8H 3Q3KA 1J15A 1MKXK 3QN7A 1GHXH 1ZHRA 1OS8A 1TMTH 2I6SA 1NC6A 1ZYOA 1XVMA 1SHYA 4UFEH 1TWXB 4Y0ZE 4U30A 1CBWC 1P11E 3QUMP 1RS0A 2C4FH 4NZQA 1V2ST 2QN5T 4I8HA 2ZC9H 2VH0A 1O39A 1GBDA 1V2WT 3MH5A 1LDTT 2TGAA 1A0LA 1XUIA 3QWCH 4WMFA 1QQUA 3SU4A 1KY9A 1GBIA 1IHSH 3S9AA 4ZKRU 1SGPE 1O2IA 2KAIA 1GI7B 3I78A 2SNVA 3DT0H 4O97A 2FX4A 1YBWA 3SJIA 1PFXC
chains in the Genus database with same CATH superfamily
2RDLA 2BDIA 1CGJE 1OP8A 1C1VH 3FOAA 3M3VA 4KTUA 3TH2H 2FOCA 5AFYH 1MAXA 2BDGA 4NIVA 2PGBB 1O3MA 4MNVA 3ZVBA 1MTNB 4AFZA 3MH6A 2RA3A 3ELAH 4JYVH 5DP6A 3DSOA 2B5TB 3UPEA 2ZTXA 4ABBA 1HAOH 1F0RA 1YM0A 1HLTH 1TFXA 3P8OA 1D4PB 2BQ6B 5EJZA 1UVOA 4Z6AH 1F0SA 1DWBH 2O8MA 3IITA 3O8CA 1OPHB 1GI2A 1HAVB 1D6RA 3GISB 4K2YA 1E0FD 1YC0A 3LGYA 1N6YA 3A83A 1GBBA 1L2EA 2VVUA 2WV9A 3C27B 5GDSH 3PM3A 2ZEBA 4DURA 2GVFA 1IQFA 1BCUH 4ZHAA 1P03A 1GBFA 1COWD 2ZTYA 4FUBA 1MKWK 1KTTB 1O2HA 4BAQB 3GCHB 3N99A 1ELAA 1LHGH 1W3CA 1YPJH 2IPHA 1SQRA 2CF9H 3PLBA 1ZMJA 1DUEA 4D9QA 4YOGA 4O3UA 4NIYA 1FNIA 4MDSA 3GCHC 2R0KA 4XOJA 5EXMA 1KXBA 2AERH 1SGFG 4IGDA 1CHOG 3Q00A 1EB1H 2W26A 1GMHF 2A31A 3RXVA 1UO6A 4AYVB 1JXPA 1SQAA 4JK5A 1ZPZA 1LPGB 2FI5E 3A7ZA 3HATH 1YKTA 3UR6A 5K7RA 3TJNA 1INCA 1G37A 1O2KA 1TGNA 3SHAH 4GAWA 3LH1A 1UTJA 3UQVA 2WPMS 5SGAE 2OXSA 2PTCE 1QB6A 2P93A 5JB8S 3ZVAA 3IG6B 1V2PT 1HJAB 1VZQH 1YPEH 2EC9H 3GY2A 3I29A 4DIHH 1FPHH 2Y7XA 1E1RD 4JZ1A 3ENSB 4H6SB 1Q3XA 2J94A 4PROA 2F9UA 5DP8A 1AB9B 1C2IA 1H8IH 1AD8H 1ZR0A 1W10U 1GHBG 3E6PH 5C94A 4CRDA 2RCEA 2ZF0H 2GDDA 1QB1A 5C67A 1C1SA 1DPOA 3GY6A 3A7VA 2IJD1 2EI6A 2ZDKA 2FOAA 5TJXA 3RDZA 3VB3A 1Z8RA 4WH6A 1BQYA 1Y3UA 2BD4A 2BHGA 1ZOMA 1GCDA 2XBXA 1C2DA 2G81E 3A86A 1GL1A 5CHAC 1AVGH 1FZZA 1F92A 1BA8B 3FFGA 5C17A 3RXHA 5HM9A 4JZFH 3QGJA 4BOHA 1LTOA 1K1MA 1RTLA 4XBCA 1Y5BT 4F4OC 2BQ7B 2HNTC 3LC5A 2SGFE 1P12E 5EJ1A 1HAPH 4ABDA 1K1LA 1IQGA 1GL0E 4XRNA 1J16A 2ZDMA 3U98H 4ASUD 5DP5A 2BLWA 1GGDC 4X2XA 2P3UB 1BBRH 4HZHA 1GBMA 1G3CA 3BTKE 4A7IB 2AS9A 2FM2A 2K0QA 2SGEE 5KECA 1HDTH 3E8LA 4RSPA 3LGVA 1GHWH 2CXVA 4AC9A 3K9XB 2ANWA 2BD7A 2V6NA 4I7YH 2IOTA 7GCHF 1D9IA 5EGMA 2WSSD 4XE4A 4D76A 3VPKA 2KZ4A 4A6LA 5AHGH 9ESTA 4Q2KA 2Y6TA 1E79D 1HB0B 2ZU5A 4UD9H 5CMXH 4ISOA 3FO8D 3KYFA 1DLKB 1V6DA 3EGKH 1F2SE 2ZFSA 1QURH 4Q4LA 2ZTZA 4VGCC 3S7KB 4D9RA 5E0HA 2F43B 1RTFB 3V3MA 2LELA 5TCCA 4FUIA 5FL7D 1MD7A 1D3TB 2WYGA 3A89A 1DITH 2FODA 2A4QA 3RXLA 4ZCNA 1TNHA 2ALPA 2GCHF 1V2MT 4X6NA 3T27A 1BB0B 1OSSA 1WQSA 4Y8YA 4VGCB 1DY9A 1QA7A 4IBLH 1CQQA 2TPIZ 4X6PA 5EXLA 4ABJA 1TGBA 1Z8JB 3SBKA 1F0TA 2LNCA 4MNWA 1O3CA 2PTNA 1G3EA 1QHRB 5FHTA 3K6ZA 3MU0A 3K65B 4OS5A 4DG4A 1IAUA 4B2AA 1F7ZA 4AG2A 1A5HA 4I31A 3U1JB 4H4FA 5FPSA 4GLYA 1C1QA 2RA0A 1C9PA 2ZDVH 2AYWA 5DJ7A 2OBOA 1GG6C 1CA0B 3MU5A 1ELTA 2PKSC 1KXAA 2G8TA 2Y80A 2VVCA 1P10A 2O8UA 2WV5A 3SUDA 3LGIA 1GJ8B 2GCTC 2R2WU 2KCAA 5FBEA 1O3DA 3ZZ6A 2M2AA 1GG6B 1OWKA 3GDSA 4IC5A 5JBCS 4A1VA 2YMSD 1TPPA 2Z9JA 5HKKD 1BRBE 1GMDF 4KGAA 1SGFA 2RDEA 4NFEA 4DT4A 4XSKU 3SORA 3M7QA 2XNIA 4CBNA 2J9NA 3SNBA 4CHAB 3KL6A 2ZDAH 2BXTH 4MPVA 2PKAB 4JMYA 3DFLA 1HIAA 2BOHB 4FUFA 3SU1A 3RU4E 1DVAH 4XDEA 1TPAE 4B74A 1YPGH 2ZCLP 4ZH8A 1TBRH 3V13A 1BTHH 1KXEA 3HPTB 3N7OA 2BQWB 2O8LA 3M35A 1C2KA 1AE5A 1DANH 1ZPBA 3ZZ8A 2XBYA 1UTMA 3RXIA 4INLA 1SL3A 4X8SH 4CRFA 3TNTA 4AB9A 1TNKA 2B0FA 2ZHWH 5E8EH 4BAMB 4NCYA 4AFQA 2HRVA 3B8JA 4XFQA 2O8WA 1GJDB 2PWXA 4IW4E 4UFGH 3L33A 4THNH 4GUXA 2YOLA 5C1UA 1S6LA 3GY5A 1NRRH 2BDHA 3H7TA 2UUJB 1QRXA 2WINI 3P92A 3ZV8A 1SI5H 1EJAA 3LDXH 5CDFE 1GI4A 2VIQA 3H09A 4XD7D 4HFPB 1HAIH 2DUCA 4WJG2 1ZGIA 2Q6DA 2TGDA 3QO6A 3H5CB 2PGQB 2SNWA 2ULLA 1CGIE 1LPKB 1TPOA 1XUHA 1QRWA 1P01A 3T5FH 4R8TB 1DWCH 1A46H 3RXSA 4DOQA 1QL9A 3VXEH 3A8BA 4K1EA 3GY4A 2R0LA 1NM6A 1HJ9A 1HV7A 3SYJA 4IN1A 1AHTH 1BT7A 4CH2B 1GJ7B 1OOKB 3A7WA 5ETXA 3UTUH 2JIZD 2AGEX 2K1QA 2W3KA 1JWTA 3Q3YA 2CJIA 1PPBH 1MQ6A 1Z8IB 3MO6A 4A92A 1C5WB 1W0KD 2OQ5A 4K1SA 4NG9H 3Q3XA 5LGOA 3OAAD 1C2JA 3ZZ9A 5ESTE 1EZSC 4Y11E 2ANKH 5C5OA 4NWKA 4TYDA 1HFDA 1TGTA 1FAXA 1CVWH 4D7GA 2AMDA 4TWWA 1QCPA 1T8MA 3GCNA 3DUXH 3SQHE 1O31A 2VVVA 4RKOB 1IQEA 3SGAE 2GKVE 2PSYA 5EPNA 3UR9A 1O2QA 3N7EA 4AORA 1TGCA 2WPIS 3ZVCA 4Y79A 2Y7ZA 5DP9A 5T3HA 2VIWA 1MAYA 3FZZA 3RXRA 1ANEA 2C8ZB 4NSVA 4Y7BA 2ZPRA 1QB9A 1CT0E 1J9CH 2B7DH 2TRMA 4J1YA 3ATIA 3A84A 1C5OH 3RMLH 1P2NA 1ELBA 2GZ7A 8GCHG 1YCPK 4KP0A 1KLJH 1UVPA 3VB4A 1MU6B 2G51A 4P00A 2IJOB 2KR7A 1XX9A 3D23A 1XXFA 5C1YA 2QXIA 1VCQA 4TWYA 1HXFH 2FYQA 1O5AB 3URDA 1N1LA 1HAYB 3ATMA 1T31A 1BRAA 3IWMA 3RXOA 2P59A 1ELFA 1WOFA 2XTTB 3BTEE 1MQ5A 1O3EA 4OGXA 4I8KA 2ZKSA 2GTBA 4O3TA 1T4UH 1B0FA 2CHAC 4FUHA 1H8HD 1UMAH 2SFAA 3F2GA 2ZDLA 3HKJB 4X8UH 2FXRA 3D49H 5DP3A 5FAHA 1O3FA 1EB2A 1VITG 2V35A 2C8YB 4D7FA 1YWUA 3OY6U 1P3CA 4FU9A 1FLEE 1MU8B 2PR3A 2FLRH 1K1IA 2ZQ1A 1ZTLA 2Z9IA 1GHAF 5GNDA 1FIWA 1OKXA 2OCVB 3NPSA 1GBJA 1K1NA 1C5RA 1GMDG 4NWLA 1MZAA 1QFKH 1XUGA 1DX5M 1AUTC 2IPQX 1V2UT 3EDXB 7KMEH 3M5OA 5IK2D 1AKSA 2AIPA 5T6DA 1FY8E 1MABB 1O2UA 4CBOA 3BEFB 4K8YA 3BTHE 2Q1JA 5KEDA 3ZZAA 1S6FA 3URCA 1TBQH 4O9VA 2XXLA 5GCHF 1GBKA 1MKXH 1UHBA 5F6MA 3BTFE 1GWAA 3R3GB 5A2MH 3F9GA 3SUFA 5T6FA 1UVTH 3SOSA 1O36A 1EAIA 3TPIZ 4Y8XA 5G4BA 5HMAA 3BEIB 1WXRA 2W7UA 1BRUP 2XC4A 1C5XB 1V2VT 1C1TA 1W12U 2ZNKH 3LKWA 5EIYA 2BDCA 2HNTE 1FIZA 4ZXYH 2Z3CA 5AF9H 3E0NB 2STBE 1VR1H 3A81A 1PYTD 1ELGA 4YT6H 5EOKA 1FN6A 3GY3A 2C93B 3DA9B 4BTTB 5B6OA 2VIPA 3M3TA 5GPIB 3FP8E 4FVDA 3PMAB 2OLGA 2ZGXH 3O8RA 3RUOA 1C5VA 1TOCB 4DW2U 1C2LA 1Y3VA 5DPAA 2JH6D 5DK1A 1GJ5H 2NU0E 4UFFH 4WXIA 2F9VA 1DFPA 1S82A 4CRAA 4NZLA 1TB6H 2A32A 1BHXF 1YGCH 2F9OA 1KYNA 3MH4A 1TX8A 3U8OH 2J98A 1CA0C 2CK3D 1F0UA 3ZVFA 5JBTA 5EPYA 3VXFH 3P8NA 2ZFRH 3BG8A 1C5ZB 1RTKA 1THSH 3E90B 1NRPH 4I8JA 3NCLA 3STJA 3U69H 3PV4A 3QTOH 2HWLB 2ODPA 5EJLA 5L6NH 1SSXA 3A8CA 4AZ2B 4X2WA 4F48B 4ESTE 4X1NU 3A82A 1Z1IA 2BVSH 4XBDA 3VG8A 1FX0B 3VB7A 1HIAB 1AZ8A 2ZCHP 2EQNA 3A8DA 2THFB 1ELCA 4ISLA 4JYTA 4P02A 8GCHF 1QBVH 2K8IA 1DXWA 1BTXA 1THRH 1GHVH 4HGCA 1TRYA 2OC7A 1OWEA 2ZU4A 2AGGX 4I86A 1TRMA 1GI9B 3A7XA 1GVKB 2JJ2D 2VNTA 1BTYA 1SOTA 2YNAA 3B9FH 4X2YA 5JBBS 5EW2H 5EQRA 1W0JD 3KIDU 3KNXA 4M9FA 1SLXB 1C4U2 2Z9KA 3ZVGA 1ZJDA 3Q76A 5A0BA 3TK5A 3RXEA 2QY0B 1AIXH 1LHFH 4WWYA 3F9EA 1Q2WA 1YF4A 1BJVA 2H5CA 3GS9A 1EZUC 1MCTA 4FU8A 1H8ED 1EP5A 3SV2H 2D2DA 1KLIH 1GBAA 3QTVH 2V3MA 4MPUA 5JB9S 1FPCH 3OE7D 4RI0A 4MPWA 1DLEA 3S0NA 1TQ0B 4JCNA 2PFEA 2XWBI 3NRLA 5TCAA 7LPRA 5FXLA 4I8GA 1ZMNA 1BTUA 2Z9GA 1TPSA 4ZKNU 3SNCA 2KX4A 1YLNA 3BTGE 1HJAC 4ABHA 3SGBE 1EZXC 2PKSB 3SN8A 1VGCC 1GJ9B 2AMPA 3TK6A 5FX6A 2WZQA 1GGDB 1TA2A 1GJ6A 1T4VH 1QJ6B 3MHWU 5EQSA 2GZ8A 5DSFA 2ZFQH 4JZEH 3LH3A 3GYLB 4LZ1H 1ELEE 2J95A 1TOMH 3M5NA 2OQUA 1J14A 3MO9A 4IC6A 3HKIB 2ZFPH 3S69A 4HTCH 1V3XA 3PLPA 5A09A 1P9SA 1ZRKA 3U8RH 3ATWA 2JJ1D 1PPZA 2AH4X 4UFDH 5L2YH 4NIWA 1C5QA 1V2RT 5HXFA 4Z1MD 1ZPCA 2EI8A 1QGFA 4YESB 1V2TT 1WTGH 1JMOH 3MOCA 5EXNA 4AOQA 4GVUA 1BJUA 1ACBE 5BRRE 2KAIB 1DT2A 1S0QA 1YCPM 3SU3A 2F83A 1MBQA 1Z71A 1JIRA 4WMEA 4MPXA 5C3NA 2SGAA 4K5ZA 2FX6A 1O2YA 2A7CA 3SV6A 3AAUA 1MTUA 3UNSA 8KME2 1P2JA 1O3IA 2QE7D 1NRQH 2FS8A 2BY5X 3NWUA 4ZKOU 1VITF 5C20A 2BD9A 3AAVA 1O2GH 2UUKB 2L74A 1TMUH 1UCYE 3TH4H 1TX6A 4GSOA 1GCTB 1NY22 3V7TA 2TGTA 2VWLA 2Y5HA 1GBEA 3F1SB 3FP7E 2OD3B 3WW7A 1KXDA 1SGNE 2R9PA 1K2I1 2FESH 2PV9B 3FN8A 5DKMA 2SGDE 2JETB 4IMZA 1OP0A 5C0UA 2VJ1A 2GT7A 1P2KA 4LK4A 1ZMLA 2OK5A 1YLCA 3KN2A 3RLWH 5FX5A 2BVXH 4KKDA 1PJPA 1P04A 1HAXB 1L0ZA 4KELA 4NIXA 3MH7A 5HYOA 3OSYA 3VFEA 1H9HE 1P2MA 3OY5U 3M61U 1OWHA 4TPIZ 4AGJA 2GV7A 5F53A 3LIWA 3NKKA 1HCGA 1O3AA 1SLWB 2BLOA 1O2WA 1SBWA 2GD4B 3TLOA 1A7SA 2ZGJA 3DFJA 1V2KT 1AVXA 3STIA 2F4LA 3S9CA 1VITH 4Y6DA 1GI8B 1NRNH 2P94A 1CBWB 5CHBA 3UWIA 2A2QH 4OS4A 1KXCA 3PMJA 5GCHG 2BTCE 3A85A 2UUYA 2ZHDA 1ZTKA 4ACAA 1AFEH 1THPB 3BN9A 3SO3A 4YLUA 1MZDA 1CE5A 3QGNB 4CHAC 1N8OB 3EQ0H 1SGEE 3A87A 3GY8A 3TGJE 5A8ZA 1YPKH 1IQKA 2FPZA 3U8TH 3TJVA 1AMHA 1A2CH 5F8ZA 5A8XA 2BD5A 2KFWA 1LVMA 1BMNH 1BBRE 1UHBB 1VCPA 2YMSC 2OP9A 1W0ZU 1T8OA 2FZZA 3RC4A 5LPRA 3ZZDA 1SPJA 1O2PA 5LPEA 1P2IA 2G55A 1C2GA 1SGTA 3PLKA 2BLVA 2Z3EA 2ZGCA 1GI3A 1DM4B 3UNQA 1C5YB 2XWAA 5C1XA 3BTTE 4MQAA 1KIGH 1ELDE 4OS7A 1HAHH 1C1PA 1O3LA 2NU3E 1B0EA 1A5GH 2BD3A 4TT3D 3SJ9A 1DDJA 1CGHA 2IN2A 2NU1E 4X6OA 3RXAA 2BM2A 2BX4A 2BDAA 4MTBA 1GJAB 4UONA 2FTMA 1EZQA 1QQ4A 2GDEH 1GCTC 2PUQH 1FY5A 1GBTA 1EJNA 4FUEA 2XBWA 1RGQA 4KTSA 1ANDA 1VJ9U 3TK9A 3LT3A 3UB0A 4ABGA 1G3BA 1O5GH 5K0HA 2P8OC 2BDYA 2H9HA 4E7RG 1V2LT 1O3PB 1H1BA 1EAUA 4NA8A 2FMJA 2J38A 1BTPA 2A5IA 2SGQE 3M7TA 1FY4A 1AZZA 4Y7AA 1YYY1 1UK4A 5DG6A 2FLBH 2GV6A 3F9FA 2ESTE 4I33A 1MTVA 3UY9A 1UCYH 3LU9B 1P2QA 1TGSZ 2VBCA 4UEHH 4AG1A 1YLDA 4NSYA 3TIUA 2L6OA 2A45B 2AFQB 2G4TA 1P05A 5GJ4B 3BIVH 1S0RA 2TIOA 1RFNA 5F03A 4QT8C 1NT1A 2VIOA 3ZIAD 5GWZA 4B75A 1W8BH 1LKAA 2ZHQH 4I32A 1L1JA 4K60A 2XRCA 4Z0KA 1LVBA 3UAIC 1BITA 4OM9A 3BTQE 4ZAEA 3SHCH 3LPRA 3WY8A 4YLQH 3U1IB 1WCZA 1D3QB 4M7GA 5E0GA 5JBAS 2ZHEH 4NA9H 4X8VH 6ESTA 1QR3E 1IQIA 4FUDA 3SNAA 3SU2A 3FVFB 1NO9H 2XC0A 1KMHB 1WAYB 1EJMA 3ZZBA 1O34A 1UTLM 3FAOA 1BTWA 2BVRH 3HK3B 4RT1A 4NGAH 3EAJA 2TBSA 4WMDA 2OC1A 1SGCA 2ZPSA 1OWIA 2FI4E 2Y5GA 1VGCB 3A7YA 4ABEA 3W94A 5C0TA 3QX5H 1EUFA 2VINA 1V2QT 3O8DA 4INKA 1RRKA 1ZRBA 1L1NA 1LHEH 4BXWA 1OWJA 3PV5A 4WXVA 1AY6H 1GJ4H 1EOJA 3F0OA 2G5NA 5T6GA 4Y0YE 1HPGA 2XOKD 1BHXB 1JIMA 1OX1A 3TNSA 1Y3YA 1O30A 4D8NA 2WPJS 1H8DH 2EI7A 2R3YA 3FANA 3M37A 1O38A 1DWDH 2FOHA 4ZMAH 5FPYA 2J2UA 6CHAC 3UOUA 1SGIB 3GDUA 1P09A 1TONA 2LPRA 1T8NA 3KF2A 1Q31A 1GVZA 3RLYH 3ATKA 2ZQ2A 1ABJH 3RU4D 3PMBB 4FU7A 5JPMH 2VWNA 2UUFB 1PPFE 1SFQB 4AFSA 4Y8ZA 2XC5A 2J34A 1W13U 2PP6A 3F0PA 4Y10E 2GCHG 2OUAA 2VGCC 1O37A 1WTHD 1KSNA 3CP7A 1AU8A 1ELVA 3MO3A 3N7DA 3RXDA 1DE7H 1HUTH 3PWBA 1W0YH 1SVPA 2H1UA 4ZUHA 3BIUH 2JDID 1C1NA 3UWJH 2ANMH 3M7UA 1PQ7A 3GYMA 5DO4H 1O3JA 1C5LH 5DP7A 1BMLA 4BAKB 2QC2A 3EE0B 1QZ8A 7ESTE 3MNSA 1G36A 1NFWA 2GZ9A 1Z6EA 1BMAA 1WYKA 3ZZ3A 3KEEA 1G9IE 2ZGHA 2RG3A 3LOXA 3TJUA 2CMYA 2ODQA 1PQ8A 7GCHG 3E16B 4CR9A 5CE1A 1O2RA 1VKYA 1FUJA 1Z8GA 5HIYA 4ZHLU 1O3BA 3JZ2B 3MU8A 1DOJA 1TNIA 2HALA 2ZIQH 5GIBA 3FP6E 5BPEA 3RMMH 1E37B 3TITA 1DXPA 1SKYE 3RXBA 3SU6A 3AASA 1UTQA 2VIVA 3AW1A 2FTLE 4TY7A 4K69A 3S9BA 1YY3A 5LPFA 4FUCA 1GDUA 5E2PA 5C2ZA 1ZGVA 2ZG0H 2QV1A 4SGBE 1MD8A 1C4Y2 2ZFTA 2P3FH 2ZU1A 1TQ7B 3SZNA 5CHAB 2H9EH 4B71A 3M3SA 1SMFE 4K1TA 1O2TA 1UTNA 2F9PA 1NS3A 2GJGA 1XUFA 2SGPE 3UUZA 4X8TH 1P2OA 4TPYA 1DSTA 1GHZA 4BAHB 1JBUH 4ZKSU 1BZXE 1AUJA 1PPCE 3MTYA 5FBIA 1BMFD 4E05H 2V3HH 2GT8A 3RXMA 3BTME 1C1RA 1AB9C 2M5TA 1O2MA 1O2SA 1V2NT 1JRTA 4X0WU 1MUEB 2EY4C 2ZZUH 3NZIA 1GHAG 2YNBA 1K9OE 1P3EA 2A5AA 4WVPE 4X1RU 1TBZH 2A2XH 3RXUA 1AO5A 3RXQA 3F9HA 1E35B 3QDZB 3VGCC 2HPQH 4KTCA 1O32A 1A1RA 3MU4A 4FUGA 2YMSB 3BF6H 2FIRH 4B1TA 2A5KA 3TGKE 2ALVA 2G5VA 2QXHA 1AWFH 1K28D 2H5DA 3U9AH 5EU8A 1IOEA 1AKSB 3F2FA 4AX9H 1LPZB 3PRDA 4U2WA 2BYAX 4ISNA 3ZVEA 2BZ6H 5I46H 4JZIA 1QJ1B 1O5EH 3RC5A 1QRZA 1WQVH 2TGPZ 3PB1E 4IMQA 1P06A 4YOIA 1O3OA 3KQDA 1QY6A 1WDIA 4YOJA 4FOUC 1ZJKA 2D1JA 4YO9A 2F9NA 1O33A 1QBOA 3GY7A 3E91A 1CO7E 1SLUB 1WU1A 1CHOF 1JOUB 4OS6A 1G32B 3T2NA 4OS2A 2P16A 2QF4A 2OC8A 1TYNA 3OU0A 3OTPA 1S5SA 1MCVA 3VEQB 2WUBA 1DS2E 1EASA 4Y76A 4ZHMU 1W11U 3RXCA 3ZYEA 1H9IE 1MH0A 1O0DH 4AGKA 3T62A 2WHXA 2R2MB 3RXGA 4LXBH 4AB8A 3SQEE 3HGPA 5AFZH 4A1TA 3SW2B 1Y5UT 5DGJA 4DVAU 3M5LA 3GCTF 1UCYK 1A5IA 1C5TA 3EA8A 3VGCB 3PMHB 4RN6A 1QTFA 1YPMH 3ODDA 2HGTH 3TGIE 3AW0A 1P57B 4H6TA 1CT2E 1T8LA 1L1GA 2C3SA 2F91A 1XKBC 2QAAA 4ABIA 1DWEH 3ZZ4A 4B73A 1EX3A 2A0QB 1B5GH 2A1DB 2PSXA 3T29A 2Z94A 2FO9A 1C9TA 1TABE 1RD3B 4MNYA 2H9TH 3GCTG 1S85A 1ZTJA 2NU2E 1Y59T 1A3BH 1K1PA 2KCYA 1AI8H 1BMMH 2ZU2A 5JYIA 2HNTF 1BRCE 1LHCH 2AIQA 3MNCA 3ZYDA 1WBGB 3KYGA 1AN1E 3MMGA 3LGUA 3UQOA 3K6YA 1LMWB 4CRBA 1ZSLA 3P8FA 1OP2A 2J5UA 2BXUH 5L2ZH 3D62A 2D26C 2Y81A 4R0IA 1GPZA 1C5NH 5A0CA 1TRNA 3V0XA 1QL8A 1GI0A 1GJBB 4OGYA 3K2UA 3G01A 1EKBB 5HGGA 1ARCA 1XUKA 2WPLS 3ZVDA 1AVWA 1P8VC 1GMHG 1YPHC 3SU0A 3SUGA 1L4DA 5EW1H 2P95A 1D3DB 1HRTH 1O2ZA 2HLCA 1K1OA 4F55A 3S7HB 2GCTB 2Z3DA 3ZZ5A 5J4QA 4JYUH 3CS0A 1NU9A 2JH0D 2BD8A 2WYJA 2WV4A 2BOKA 1ETRH 1N6XA 1SB1H 1MKWH 3RXKA 1CSOE 3P70B 2Y5FA 2ZFFH 3ODFA 2AGIX 2D8WA 2RFKC 2STAE 2ZGBH 3ITIA 2I6QA 1YP9A 2WPDD 1FN8A 1B7XB 8LPRA 1UW7A 1W14U 1QNJA 2QF5A 8ESTE 1OWDA 3RMNH 3I77A 4B76A 2ZDNA 1T32A 5J4SA 1XVOA 1K1JA 1HGTH 3BG4C 2QCYA 4IN2A 3QZRA 2O9QA 2FOBA 1UTPA 4Q7ZA 2A4GA 1GI6A 2VIDA 1C5UA 2VGCB 4X6MA 3LJOA 3ZZ7A 3NK8A 3DHKH 1C5PA 1E34B 3DCLA 3RXTA 3SZEA 3RXPA 1W2KH 4E06H 1X7AC 1QIXB 5JDUB 2DE8A 1XKAC 1MMJN 3T28A 4ASHA 3DSPA 1L4ZA 4X1QU 4X1PU 1SGYE 2B8OH 1NN6A 1O5BB 4UE7H 1EPTC 1ANBA 4WH8A 1D6WA 4LOYH 5PTPA 4GHQA 1ESTA 4NFFA 2BY7X 1IQMA 2NWNA 2VU8E 1TNGA 4ABFA 1NBMD 5L30H 2ZO3H 1OYQA 3O8BA 2V0BA 2FOEA 3RXJA 3AVZA 3OYPA 2UWPA 5FCRA 5EODA 2W5EA 1S83A 3CNRA 2QIQA 1LHDH 2P3TB 1RXPA 4YZUA 1KTSB 1QJ7B 1O5DH 3RM2H 3BTDE 1K21H 4CREA 5EG4A 2FOFA 2DE9A 4MNXA 3BG4B 1QBNA 2FWWA 5E2OA 1NFYA 3UOPA 1LCYA 3HK6B 2ODYB 2ZA5A 3BEUA 1KDQA 4J2YB 1SGDE 3SGQE 1NFXA 4DT7B 2A7JA 1IQHA 3TH3H 4AYYB 3PROA 2EEKA 2GMTB 1FI8A 3BTWE 1GJCB 1WSSH 2CN0H 4BAOB 3BSQA 3MI4A 1A0HB 1GMCG 5IYTA 4A1XA 1FXYA 3KCGH 4DY7B 3U28C 1GBLA 3QK1A 2AHME 3MNXA 4Q80A 1S6HA 2FYRA 4B2CA 1XMNB 2CHAB 2FP7B 3MQKC 2WPKS 3FKSD 1FV9A 1Z7KA 2A4OA 2BD2A 1GBCA 4HG6A 4RT0A 1MBMA 4BNRA 1S84A 3D65E 3W95A 4Q7XA 2VH6A 5IDKA 5C5NA 1A3EH 1XUJA 3E3TA 4H42U 1EXFA 3SNEA 2ZP0H 3OFND 4X2VA 6LPRA 1LQDB 2Q6GA 1TX7A 1VCWA 1HNEE 2BZAA 2C90B 1O2XA 4OS1A 3P95A 1SR5C 3A88A 1GI5A 2A4RA 5A8YA 2QYIA 3ESTA 3DD2H 1G3DA 1GDQA 4CH8B 1EAXA 1ZHMA 3EE7A 1BTZA 3SJ8A 1CU1A 3LGTA 2W6ID 2ZECA 4INHA 1Z1JA 2QF0A 1FJSA 2GGVB 2FOMB 4I8LA 2VB0A 4LZ4B 1CHGA 1FY3A 3DSGA 2FS9A 2PUXB 1SLVB 2BLQA 2C8WB 3RU4T 1FONA 3TVJB 4U32A 2ASUB 3EA7A 4MG3A 1EATA 4FVBA 1H4WA 3PO1C 1QA0A 1S81A 2ILNA 4B2BA 5LH8A 2BX3A 2CGAA 3PWCA 5HM2A 4FETA 3E1XB 4YT7H 1PQAA 1ABIH 3A8AA 2A7HA 1FQ3A 1RJXB 3SV8A 1BUIA 2BY9X 2XCNA 3V12A 1NFUA 1NU7B 1ORFA 4GPGA 4YM9A 3PO1B 1TNJA 1ZSKA 2UWLA 1O2LA 3SUEA 1HJ8A 5EQQA 1OYTH 2G00A 4K8BA 3UIRA 4GCHG 4FUJA 3OX7U 1C1UH 1SHHB 1GBHA 2Z7FE 2G52A 3QZQA 2GX4A 3CENA 5I25A 1SOZA 2QXJA 2XBVA 1C1OA 1O3HA 3FZDA 1F5KU 1ZSJA 2B9LA 3NUMA 1T7CA 2QXGA 1VJAU 4GHTA 2ZWLH 1GVLA 4GCHF 1GI1A 1F5RA 3RP2A 5ESBA 1DICA 1SGQE 2Q6FA 3LONA 1SQTA 5E0JA 3SV7A 4YTAA 1SG8B 4DJZB 1RIWC 2XNDD 1SGRE 3RXFA 1MTSA 3PTBA 4Q7YA 2QA9E 1ID5H 1W7GH 1YCPH 2F3CE 1O2NA 2OC0A 2WUCA 2ZI2H 2V3OH 1TAWA 1SC8U 2JETC 5AVDA 1ESAA 1EOLA 2BY6X 4K3JA 1C4V2 5ABWA 3F68H 2H2ZA 4E7NA 1DSUA 1P0SH 1IQLA 2KCOA 4BTIB 2QGRA 5H4IB 1C2MA 1PPHE 1HAVA 2JKHA 1JRSA 3AK5A 1Y3WA 4CR5A 1HAGE 3VB6A 3P17H 2OTVA 1MTNC 3GCOA 2HVXA 1EQ9A 1ETTH 2PLXA 3KHVA 1UTOA 1EP6A 1TMBH 2XW9A 1XXDA 2W3IA 2PKAA 2H6MA 3MFJA 1ANCA 3SU5A 9LPRA 4BANB 3P6ZB 1M9UA 1TIOA 1W7XH 3F2HA 1A4WH 5B6LA 2QF3A 2FOGA 1HBTH 1NESE 4WF8A 3ZZCA 1PQ5A 1ESBA 1V2OT 4UDWH 4A5TS 2ZHFH 3KQBA 4FXGH 3KQEA 1P9UA 3MWIU 1N8OC 3P8GA 1NROH 1J17T 2AMQA 1K22H 2EA3A 2ZCKP 4DIIH 4CRCA 1YPHE 1J8AA 3B23B 1NTPA 2CV3A 3R0FA 4BXSA 1FDPA 1MTWA 3UREA 4AFUA 2ZPQA 4DCDA 1O5FH 1LO6A 1KXFA 1E1QD 5FCKA 2XYAA 2J4IA 3PTNA 2FEQH 3L6PA 3H7OA 1WV7H 2O8TA 1RIWB 1TE0A 3RC6A 3MU1A 4F49A 1NBME 1Y8TA 2HOBA 3GICB 1K0HA 1Y5AT 1LQEA 2J98B 3GOVB 1DY8A 1ARBA 1C1MA 1IHTH 3OTJE 4BTUB 1A61H 2W7SA 1H9LB 1FAKH 1UK2A 2BB4A 4IS5A 1BBRK 1C2HA 1ETSH 3JZ1B 2GMTC 1FY1A 1UVSH 2WPHS 4Y71A 2CF8H 1E36B 1G2MA 3A80A 1V2JT 1O2OA 4AN7A 1BIOA 1C5MD 1C2FA 4MVNA 1TALA 2FDAA 3RM0H 1ZZZA 1SQOA 3SNDA 1AGJA 2XCFA 3Q77A 5A0AE 4WY3A 4ISIH 1LVYA 3ZV9A 1UVUH 4RKJB 1KLTA 1UTKA 3WWFA 1BOQA 1AQ7A 4ZROA 1XM1A 3MYWA 3TJOA 2ANYA 2Z6BD 2Y82A 3QLPH 1AWHB 2BDBA 1DUAA 2VWOA 5F8TA 1FMGA 4NA7A 5DP4A 4JZDH 2Z9LA 2VWMA 1UK3A 3VB5A 1O2JA 3LJJA 3SJKA 4HI3A 4ABAA 3M5MA 3KQCA 4X1SU 3SV9A 5GXPA 4ZXXH 1BDAA 3PV2A 1Y3XA 5F8XA 3C1KA 3PRBA 2UWOA 3T26A 3M36A 3A7TA 4JK6A 1NPMA 1TNLA 1YPLH 1QL7A 1GHYH 3F6UH 4TSFD 3NXPA 3CS7A 1G30B 3EYDA 1GHBF 1D3PB 2HPPH 1CA8B 1HAZB 1NZQH 3BV9B 4SGAE 3RMOH 4TY6A 1IQJA 3W1EA 1GDNA 3T25A 5DN6D 1O2VA 1KDQB 2BMGB 3SJOA 3LC3A 2P8OB 2BY8X 2LP6A 4XBBA 1U6QA 1HXEH 1OXGA 6GCHG 1EPTB 1AFQB 1LVOA 1C2EA 1F5LA 2W6JD 3OEED 1C1WH 3L3TA 2C8XB 1O35A 4ISHH 1ZLRA 5FPTA 3KGPA 1AE8H 4YXWD 1PYTC 1PPEE 1O5CB 3EA9A 1HYLA 2F9BH 1WUNH 4DGJA 1LKBA 4Q63A 3E0PB 3UFAA 2OINA 1TLDA 4O03A 1C5SA 2PHBA 1UJ1A 1CT4E 2AEIH 1EPTA 2R3UA 3TU7H 1E38B 6GCHF 1O3GA 1O3KA 4MLFB 2NU4E 3LGWA 2JH5D 1G2LA 1P02A 1A0JA 1PPGE 3PYHA 1AFQC 1TA6A 4U01A 6CHAB 1ZHPA 5HIZA 3KQ5A 2KCPA 2OBQA 3SI4H 1Z6JH 3GDVA 3ATLA 1NRSH 2ZU3A 2FI3E 2G4UA 1IQNA 5T1VA 2GP9B 1EAWA 3HGNA 3MNBA 4CRGA 1O3NA 2J92A 1SFIA 3UNRA 3SI3H 1GMCF 2PW8H 4B6FA 3Q3KA 1J15A 1MKXK 3QN7A 1GHXH 1ZHRA 1OS8A 1TMTH 2I6SA 1NC6A 1ZYOA 1XVMA 1SHYA 4UFEH 1TWXB 4Y0ZE 4U30A 1CBWC 1P11E 3QUMP 4ACBA 2J97A 1RS0A 2C4FH 3F3BA 1V2ST 4NZQA 2QN5T 4I8HA 2ZC9H 2VH0A 1O39A 1GBDA 1V2WT 3MH5A 1LDTT 1EFRD 2TGAA 1A0LA 1XUIA 4B6EA 3QWCH 4WMFA 1QQUA 2HLDD 2KM0A 3SU4A 1KY9A 3OEHD 1GBIA 1IHSH 3S9AA 4ZKRU 3WWBA 1SGPE 1O2IA 2KAIA 1GI7B 3I78A 1OHHD 5KGOA 2SNVA 2V7QD 3DT0H 4O97A 2HVYB 2FX4A 1YBWA 3SJIA 1PFXC
chains in the Genus database with same CATH topology
2RDLA 2BDIA 1CGJE 1OP8A 1C1VH 3M3VA 4KTUA 3TH2H 2FOCA 5AFYH 1MAXA 2BDGA 4NIVA 2PGBB 1O3MA 4MNVA 3ZVBA 1MTNB 4AFZA 3MH6A 2RA3A 3ELAH 4JYVH 5DP6A 2B5TB 3UPEA 2ZTXA 4ABBA 1HAOH 1F0RA 1YM0A 1HLTH 1TFXA 3P8OA 1D4PB 2BQ6B 1UVOA 4Z6AH 1F0SA 1DWBH 2O8MA 3IITA 3O8CA 1OPHB 1GI2A 1HAVB 1D6RA 3GISB 4K2YA 1E0FD 1YC0A 3LGYA 1N6YA 3A83A 1GBBA 1L2EA 2VVUA 3C27B 5GDSH 3PM3A 2ZEBA 4DURA 2GVFA 1IQFA 1BCUH 4ZHAA 1P03A 1GBFA 2ZTYA 4FUBA 1MKWK 1KTTB 1O2HA 4BAQB 3GCHB 1ELAA 1LHGH 1W3CA 1YPJH 2IPHA 2CF9H 3PLBA 1ZMJA 1DUEA 4D9QA 4YOGA 4O3UA 4NIYA 1FNIA 4MDSA 3GCHC 2R0KA 4XOJA 5EXMA 1KXBA 2AERH 1SGFG 4IGDA 1CHOG 3Q00A 1EB1H 2W26A 1GMHF 2A31A 3RXVA 1UO6A 4AYVB 1JXPA 1SQAA 4JK5A 1ZPZA 1LPGB 2FI5E 3A7ZA 3HATH 1YKTA 3UR6A 5K7RA 3TJNA 1INCA 1G37A 1O2KA 1TGNA 3SHAH 4GAWA 3LH1A 1UTJA 3UQVA 2WPMS 5SGAE 2OXSA 2PTCE 1QB6A 2P93A 5JB8S 3ZVAA 3IG6B 1V2PT 1HJAB 1VZQH 1YPEH 2EC9H 3GY2A 3I29A 4DIHH 1FPHH 2Y7XA 4JZ1A 3ENSB 4H6SB 1Q3XA 2J94A 4PROA 2F9UA 5DP8A 1AB9B 1C2IA 1H8IH 1AD8H 1ZR0A 1W10U 1GHBG 3E6PH 4CRDA 2RCEA 2ZF0H 2GDDA 1QB1A 5C67A 1C1SA 1DPOA 3GY6A 3A7VA 2EI6A 2ZDKA 2FOAA 5TJXA 3RDZA 3VB3A 1Z8RA 4WH6A 1BQYA 1Y3UA 2BD4A 2BHGA 1ZOMA 1GCDA 2XBXA 1C2DA 2G81E 3A86A 1GL1A 5CHAC 1AVGH 1FZZA 1F92A 1BA8B 3FFGA 3RXHA 5HM9A 4JZFH 3QGJA 4BOHA 1LTOA 1K1MA 1RTLA 4XBCA 1Y5BT 4F4OC 2BQ7B 2HNTC 3LC5A 2SGFE 1P12E 1HAPH 4ABDA 1K1LA 1IQGA 1GL0E 1J16A 2ZDMA 3U98H 5DP5A 2BLWA 1GGDC 4X2XA 2P3UB 1BBRH 4HZHA 1GBMA 1G3CA 3BTKE 4A7IB 2AS9A 2FM2A 2SGEE 1HDTH 3E8LA 4RSPA 3LGVA 1GHWH 2CXVA 3K9XB 2ANWA 2BD7A 2V6NA 4I7YH 2IOTA 7GCHF 1D9IA 5EGMA 4XE4A 4D76A 3VPKA 4A6LA 5AHGH 9ESTA 4Q2KA 2Y6TA 1HB0B 2ZU5A 4UD9H 5CMXH 4ISOA 1DLKB 1V6DA 3EGKH 1F2SE 2ZFSA 1QURH 4VGCC 2ZTZA 3S7KB 4D9RA 5E0HA 1RTFB 3V3MA 5TCCA 4FUIA 1MD7A 1D3TB 2WYGA 3A89A 1DITH 2FODA 2A4QA 3RXLA 1TNHA 2ALPA 2GCHF 1V2MT 4X6NA 3T27A 1BB0B 1OSSA 1WQSA 4Y8YA 4VGCB 1DY9A 1QA7A 4IBLH 1CQQA 2TPIZ 4X6PA 5EXLA 4ABJA 1TGBA 1Z8JB 3SBKA 1F0TA 2LNCA 4MNWA 1O3CA 2PTNA 1G3EA 1QHRB 5FHTA 3K6ZA 3MU0A 3K65B 4OS5A 4DG4A 1IAUA 4B2AA 1F7ZA 4AG2A 1A5HA 4I31A 3U1JB 4H4FA 5FPSA 4GLYA 1C1QA 2RA0A 1C9PA 2ZDVH 2AYWA 5DJ7A 2OBOA 1GG6C 1CA0B 3MU5A 1ELTA 2PKSC 1KXAA 2G8TA 2Y80A 2VVCA 1P10A 2O8UA 2WV5A 3SUDA 3LGIA 1GJ8B 2GCTC 2R2WU 5FBEA 3ZZ6A 1O3DA 1GG6B 1OWKA 3GDSA 4IC5A 5JBCS 4A1VA 1TPPA 2Z9JA 1BRBE 1GMDF 4KGAA 1SGFA 4NFEA 4XSKU 3SORA 3M7QA 2XNIA 4CBNA 2J9NA 3SNBA 4CHAB 3KL6A 2ZDAH 2BXTH 4MPVA 2PKAB 4JMYA 3DFLA 1HIAA 2BOHB 4FUFA 3SU1A 3RU4E 1DVAH 4XDEA 1TPAE 4B74A 1YPGH 2ZCLP 4ZH8A 1TBRH 3V13A 1BTHH 1KXEA 3HPTB 3N7OA 2BQWB 2O8LA 3M35A 1C2KA 1AE5A 1DANH 1ZPBA 3ZZ8A 2XBYA 1UTMA 3RXIA 4INLA 1SL3A 4X8SH 4CRFA 3TNTA 4AB9A 1TNKA 2B0FA 2ZHWH 5E8EH 4BAMB 4NCYA 4AFQA 2HRVA 3B8JA 4XFQA 2O8WA 1GJDB 2PWXA 4IW4E 4UFGH 3L33A 4THNH 4GUXA 2YOLA 5C1UA 3GY5A 1NRRH 2BDHA 3H7TA 2UUJB 1QRXA 2WINI 3P92A 3ZV8A 1SI5H 1EJAA 3LDXH 1GI4A 2VIQA 4HFPB 1HAIH 2DUCA 4WJG2 1ZGIA 2Q6DA 2TGDA 3QO6A 3H5CB 2PGQB 2SNWA 2ULLA 1CGIE 1LPKB 1TPOA 1XUHA 1QRWA 1P01A 3T5FH 4R8TB 1DWCH 1A46H 3RXSA 4DOQA 1QL9A 3VXEH 3A8BA 4K1EA 3GY4A 2R0LA 1NM6A 1HJ9A 1HV7A 4IN1A 1AHTH 1BT7A 4CH2B 1GJ7B 1OOKB 3A7WA 5ETXA 3UTUH 2AGEX 2K1QA 2W3KA 1JWTA 3Q3YA 2CJIA 1PPBH 1MQ6A 1Z8IB 3MO6A 4A92A 1C5WB 2OQ5A 4K1SA 4NG9H 3Q3XA 5LGOA 1C2JA 3ZZ9A 5ESTE 1EZSC 4Y11E 2ANKH 5C5OA 4NWKA 4TYDA 1HFDA 1TGTA 1FAXA 1CVWH 4D7GA 2AMDA 4TWWA 1QCPA 1T8MA 3GCNA 3DUXH 3SQHE 1O31A 2VVVA 4RKOB 1IQEA 3SGAE 2GKVE 2PSYA 5EPNA 3UR9A 1O2QA 4AORA 1TGCA 2WPIS 3ZVCA 4Y79A 2Y7ZA 5DP9A 5T3HA 2VIWA 1MAYA 3FZZA 3RXRA 1ANEA 2C8ZB 4NSVA 4Y7BA 2ZPRA 1QB9A 1CT0E 1J9CH 2B7DH 2TRMA 4J1YA 3ATIA 3A84A 1C5OH 3RMLH 1P2NA 1ELBA 2GZ7A 8GCHG 1YCPK 4KP0A 1KLJH 1UVPA 3VB4A 1MU6B 2G51A 2IJOB 1XX9A 3D23A 1XXFA 5C1YA 2QXIA 1VCQA 4TWYA 1HXFH 2FYQA 1O5AB 3URDA 1N1LA 1HAYB 3ATMA 1T31A 1BRAA 3IWMA 3RXOA 2P59A 1ELFA 1WOFA 2XTTB 3BTEE 1MQ5A 1O3EA 4OGXA 4I8KA 2ZKSA 2GTBA 4O3TA 1T4UH 1B0FA 2CHAC 4FUHA 1UMAH 2SFAA 3HKJB 2ZDLA 4X8UH 2FXRA 3D49H 5DP3A 5FAHA 1O3FA 1EB2A 1VITG 2V35A 2C8YB 4D7FA 3OY6U 1P3CA 4FU9A 1FLEE 1MU8B 2PR3A 2FLRH 1K1IA 2ZQ1A 1ZTLA 2Z9IA 1GHAF 1FIWA 1OKXA 2OCVB 3NPSA 1GBJA 1K1NA 1C5RA 1GMDG 4NWLA 1MZAA 1QFKH 1XUGA 1DX5M 1AUTC 1V2UT 3EDXB 7KMEH 3M5OA 1AKSA 2AIPA 5T6DA 1FY8E 1O2UA 4CBOA 3BEFB 4K8YA 3BTHE 2Q1JA 3ZZAA 1S6FA 3URCA 1TBQH 4O9VA 2XXLA 5GCHF 1GBKA 1MKXH 1UHBA 5F6MA 3BTFE 1GWAA 3R3GB 5A2MH 3F9GA 3SUFA 5T6FA 1UVTH 3SOSA 1O36A 1EAIA 3TPIZ 4Y8XA 5G4BA 5HMAA 3BEIB 2W7UA 1BRUP 2XC4A 1C5XB 1V2VT 1C1TA 1W12U 2ZNKH 3LKWA 2BDCA 2HNTE 1FIZA 4ZXYH 2Z3CA 5AF9H 3E0NB 2STBE 1VR1H 3A81A 1PYTD 1ELGA 4YT6H 5EOKA 1FN6A 3GY3A 2C93B 3DA9B 4BTTB 5B6OA 2VIPA 3M3TA 5GPIB 3FP8E 4FVDA 3PMAB 2OLGA 2ZGXH 3O8RA 3RUOA 1C5VA 1TOCB 4DW2U 1C2LA 1Y3VA 5DPAA 2JH6D 5DK1A 1GJ5H 2NU0E 4UFFH 4WXIA 2F9VA 1DFPA 1S82A 4CRAA 4NZLA 1TB6H 2A32A 1BHXF 1YGCH 2F9OA 1KYNA 3MH4A 1TX8A 3U8OH 1CA0C 1F0UA 3ZVFA 5JBTA 5EPYA 3VXFH 3P8NA 2ZFRH 3BG8A 1C5ZB 1RTKA 1THSH 3E90B 1NRPH 4I8JA 3NCLA 3STJA 3U69H 3PV4A 3QTOH 2HWLB 2ODPA 5L6NH 1SSXA 3A8CA 4AZ2B 4X2WA 4ESTE 4X1NU 3A82A 1Z1IA 2BVSH 4XBDA 3VB7A 1HIAB 1AZ8A 2ZCHP 3A8DA 2THFB 1ELCA 4ISLA 4JYTA 8GCHF 1QBVH 1DXWA 1BTXA 1THRH 1GHVH 4HGCA 1TRYA 2OC7A 1OWEA 2ZU4A 2AGGX 1TRMA 1GI9B 3A7XA 1GVKB 2VNTA 1BTYA 1SOTA 2YNAA 3B9FH 4X2YA 5JBBS 5EW2H 5EQRA 3KIDU 3KNXA 1SLXB 1C4U2 2Z9KA 3ZVGA 1ZJDA 3Q76A 5A0BA 3TK5A 3RXEA 2QY0B 1AIXH 1LHFH 4WWYA 3F9EA 1Q2WA 1YF4A 1BJVA 2H5CA 4FU8A 1EZUC 1MCTA 3SV2H 1EP5A 2D2DA 1KLIH 1GBAA 3QTVH 4MPUA 5JB9S 1FPCH 4MPWA 1DLEA 3S0NA 1TQ0B 4JCNA 2PFEA 2XWBI 5TCAA 7LPRA 5FXLA 4I8GA 1ZMNA 1BTUA 2Z9GA 1TPSA 4ZKNU 3SNCA 3BTGE 1HJAC 4ABHA 3SGBE 1EZXC 2PKSB 3SN8A 1VGCC 1GJ9B 2AMPA 3TK6A 5FX6A 1GGDB 1TA2A 1GJ6A 1T4VH 1QJ6B 3MHWU 5EQSA 2GZ8A 2ZFQH 4JZEH 3LH3A 3GYLB 4LZ1H 1ELEE 2J95A 1TOMH 3M5NA 2OQUA 1J14A 3MO9A 4IC6A 3HKIB 2ZFPH 3S69A 4HTCH 1V3XA 3PLPA 5A09A 1P9SA 1ZRKA 3U8RH 3ATWA 1PPZA 2AH4X 4UFDH 5L2YH 4NIWA 1C5QA 1V2RT 5HXFA 1ZPCA 2EI8A 1QGFA 4YESB 1V2TT 1WTGH 1JMOH 3MOCA 5EXNA 4AOQA 4GVUA 1BJUA 1ACBE 5BRRE 2KAIB 1DT2A 1S0QA 1YCPM 3SU3A 2F83A 1MBQA 1Z71A 1JIRA 4WMEA 4MPXA 5C3NA 2SGAA 4K5ZA 2FX6A 1O2YA 2A7CA 3SV6A 3AAUA 1MTUA 3UNSA 8KME2 1P2JA 1O3IA 1NRQH 2FS8A 2BY5X 3NWUA 4ZKOU 1VITF 5C20A 2BD9A 3AAVA 1O2GH 2UUKB 1TMUH 1UCYE 3TH4H 1TX6A 4GSOA 1GCTB 1NY22 3V7TA 2TGTA 2VWLA 2Y5HA 1GBEA 3F1SB 3FP7E 2OD3B 1KXDA 1SGNE 2R9PA 1K2I1 2FESH 2PV9B 5DKMA 2SGDE 2JETB 4IMZA 1OP0A 2VJ1A 2GT7A 1P2KA 4LK4A 1ZMLA 1YLCA 3KN2A 3RLWH 5FX5A 2BVXH 4KKDA 1PJPA 1P04A 1HAXB 1L0ZA 4KELA 4NIXA 3MH7A 5HYOA 3OSYA 3VFEA 1H9HE 1P2MA 3OY5U 3M61U 1OWHA 4TPIZ 4AGJA 2GV7A 3LIWA 3NKKA 1HCGA 1O3AA 1SLWB 2BLOA 1O2WA 1SBWA 2GD4B 3TLOA 1A7SA 2ZGJA 3DFJA 1V2KT 1AVXA 3STIA 3S9CA 1VITH 4Y6DA 1GI8B 1NRNH 2P94A 1CBWB 3UWIA 2A2QH 4OS4A 1KXCA 3PMJA 5GCHG 2BTCE 3A85A 2UUYA 2ZHDA 1ZTKA 1AFEH 1THPB 3BN9A 3SO3A 4YLUA 1MZDA 1CE5A 3QGNB 4CHAC 1N8OB 3EQ0H 1SGEE 3A87A 3GY8A 3TGJE 5A8ZA 1YPKH 1IQKA 2FPZA 3U8TH 3TJVA 1AMHA 1A2CH 5F8ZA 5A8XA 2BD5A 1LVMA 1BMNH 1BBRE 1UHBB 1VCPA 2OP9A 1W0ZU 1T8OA 2FZZA 3RC4A 5LPRA 3ZZDA 1SPJA 1O2PA 5LPEA 1P2IA 2G55A 1C2GA 1SGTA 3PLKA 2BLVA 2Z3EA 2ZGCA 1GI3A 1DM4B 3UNQA 2XWAA 1C5YB 5C1XA 3BTTE 4MQAA 1KIGH 1ELDE 4OS7A 1HAHH 1C1PA 1O3LA 2NU3E 1B0EA 1A5GH 2BD3A 3SJ9A 1DDJA 1CGHA 2IN2A 2NU1E 4X6OA 3RXAA 2BM2A 2BX4A 2BDAA 4MTBA 1GJAB 4UONA 2FTMA 1EZQA 1QQ4A 2GDEH 1GCTC 2PUQH 1FY5A 1GBTA 1EJNA 4FUEA 2XBWA 1RGQA 4KTSA 1ANDA 1VJ9U 3TK9A 3LT3A 4ABGA 1G3BA 1O5GH 5K0HA 2P8OC 2BDYA 2H9HA 4E7RG 1V2LT 1O3PB 1H1BA 1EAUA 4NA8A 2FMJA 2J38A 1BTPA 2A5IA 2SGQE 3M7TA 1FY4A 1AZZA 4Y7AA 1YYY1 1UK4A 5DG6A 2FLBH 2GV6A 3F9FA 2ESTE 4I33A 1MTVA 3UY9A 1UCYH 3LU9B 1P2QA 1TGSZ 4UEHH 4AG1A 1YLDA 4NSYA 3TIUA 2A45B 2AFQB 2G4TA 1P05A 5GJ4B 3BIVH 1S0RA 2TIOA 1RFNA 5F03A 4QT8C 1NT1A 2VIOA 5GWZA 4B75A 1W8BH 1LKAA 2ZHQH 4I32A 1L1JA 4K60A 2XRCA 4Z0KA 1LVBA 1BITA 3BTQE 4ZAEA 3SHCH 3LPRA 3WY8A 4YLQH 3U1IB 1WCZA 1D3QB 4M7GA 5E0GA 5JBAS 2ZHEH 4NA9H 4X8VH 6ESTA 1QR3E<