2ZQ1A

Exploring trypsin s3 pocket
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2008-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zq1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zq1A02
3RXQA 1HAHH 2BQ6B 1NROH 4JK5A 2ANMH 4NG9H 1TYNA 3QO6A 2AYWA 1MD8A 3PMAB 1FY3A 2PGBB 5EU8A 1RTLA 3H7TA 1BT7A 1IQGA 1ANCA 1KLJH 5FXLA 1EAXA 2V3OH 1DWDH 1O31A 4AX9H 1T31A 2P3TB 1T7CA 3LGUA 1BMAA 3SI3H 2CJIA 1MTNB 1OP8A 2M5TA 2D1JA 1DY9A 5E0JA 1ZSJA 2O8WA 2QXGA 1GVKB 2ZECA 3GY3A 4INHA 4Y10E 1BJVA 3SUFA 3ENSB 1A3EH 1J9CH 2TRMA 1ELEE 1Z8RA 1EJAA 1GBBA 5FBIA 5I25A 4Y8XA 1TMUH 1AU8A 1NU7B 4BTUB 1FUJA 3UNRA 1YC0A 4CR9A 2Y81A 3GICB 5GJ4B 3RMNH 3S9AA 4O97A 3ZVGA 2EC9H 5L30H 1TFXA 4X2WA 1O2LA 2PLXA 4E05H 1T8MA 2GZ9A 4HGCA 3T2NA 5E2OA 1OSSA 1N6XA 1CO7E 2H5CA 3TNTA 2AMPA 4O9VA 1OXGA 1OOKB 3MHWU 2FZZA 2FIRH 2D26C 2P3UB 1ZPBA 2G5NA 4AFUA 3E91A 1ZJDA 1EZXC 3F9GA 4MG3A 1G2MA 3HATH 5EOKA 4BXWA 1FXYA 2VIPA 4CRBA 2ZDMA 1QBNA 1C1TA 1J8AA 4JZIA 3A83A 1QR3E 1P12E 3NKKA 2P8OC 3A8DA 1Y5UT 3M3TA 1TNHA 3BTEE 1HNEE 1P10A 3MU8A 2GCTC 1ZR0A 2H1UA 3L6PA 1O2TA 1Y3VA 2HOBA 1W12U 4Y8ZA 2VWLA 2VU8E 3KN2A 3V13A 1TMTH 4PROA 4NFEA 1TALA 3ZVFA 4K5ZA 2SGEE 1YM0A 5FAHA 2J95A 1OKXA 2AIPA 1GI6A 3MU4A 5K0HA 4D7GA 1GDNA 3MH7A 5BRRE 1C9PA 1UCYE 1T8NA 4X2VA 2PKAB 3E6PH 4MTBA 2Z3EA 1G9IE 4DIIH 2ZFRH 1LCYA 4I8HA 2XCNA 1MTNC 3MO9A 3RXPA 1CVWH 2QCYA 2ULLA 4ABHA 1BTWA 1CGJE 2GCHF 1C5WB 1ZLRA 3TGIE 1AFQB 2Y5GA 4UFEH 2WINI 4B74A 1TAWA 2P59A 1NN6A 1FJSA 2GT7A 1O3JA 1E37B 1O5FH 2KAIA 2ZC9H 1GBAA 1V2UT 1BZXE 3SOSA 1EPTB 1IQKA 4ZROA 4MQAA 1SGFG 4BANB 1GCTC 1Z1IA 4AOQA 4QT8C 1XX9A 2QN5T 2ZZUH 1BIOA 4R0IA 2DE8A 1A5HA 2VIQA 2BD7A 1FV9A 1ZGIA 4SGBE 3F68H 1GL0E 4E7RG 1FMGA 1QBOA 5A8ZA 4GPGA 4NA8A 4WVPE 4X8UH 2ZHFH 1ETTH 3KEEA 4HZHA 1F0TA 3LC3A 3QX5H 4FUFA 1EP6A 1DT2A 1F5RA 1HLTH 2ANKH 1MTSA 3O8DA 1C1MA 1AUJA 1UTKA 5AFYH 1A0LA 1EUFA 1T4UH 2STAE 3ZZDA 2XC0A 1TRNA 2QXHA 2OD3B 2SGFE 3RC5A 5JBAS 1WBGB 1XM1A 4WWYA 1TGTA 3U9AH 1GI1A 1TNLA 3EA7A 5JBCS 1V2LT 4BAMB 3O8CA 2SFAA 3RDZA 1GMDF 1TGBA 2VIOA 3RXHA 1EPTA 1L4DA 1SLUB 4R8TB 2WPHS 4BAOB 3MI4A 4BAQB 4TPYA 1K1JA 4X1QU 1QA0A 4NWLA 3VXFH 1H9LB 3VGCB 1C5TA 2SGDE 4FUGA 4XFQA 2IPHA 3B9FH 4CREA 4DCDA 3HK3B 3MU0A 1LHFH 1OP2A 3ATLA 4Q7XA 1DE7H 2UWPA 2HNTE 5EW1H 3UTUH 4JK6A 1MAYA 2GTBA 5JPMH 4WXVA 1AD8H 4X1SU 2ZGCA 1SQTA 3M36A 2EI7A 1SGIB 2XCFA 5LGOA 1HXEH 2OTVA 1MTWA 2BTCE 3RLYH 1H9HE 2BD9A 5T6FA 1WV7H 3TLOA 1TNGA 2FOGA 2FDAA 4A92A 5HM2A 2LNCA 3RP2A 1F0UA 4ZMAH 1AFQC 4CR5A 1BQYA 1O3KA 1RTFB 1TBRH 3KCGH 3MU5A 5HM9A 2W7SA 2QY0B 1HAYB 2ZDVH 3JZ1B 1EKBB 4NWKA 3RC6A 1TOMH 3FZDA 2IOTA 4BOHA 1AIXH 1ABIH 1NRNH 1SLXB 1ZMNA 4ISOA 2ZO3H 3TJUA 4IC6A 4WJG2 1BTPA 1HV7A 1O5BB 5B6OA 1FAXA 2ZFPH 4H6TA 1UCYK 3FANA 1IOEA 1DICA 2OINA 2FX6A 1K28D 2W3KA 2OBQA 4KTSA 1T8OA 1GBJA 2WPIS 4B73A 1KXEA 1BTXA 2SNVA 1HUTH 1UO6A 3BIUH 4Y11E 1DSTA 2VIDA 1ZMLA 2R0KA 3MU1A 2D8WA 3A7WA 4FUEA 1GDUA 4ISLA 4B71A 1GCDA 1C4U2 1MQ6A 3M61U 3PLPA 2Z9GA 5G4BA 1TIOA 1BJUA 2F3CE 3GCOA 3A7YA 1H8DH 1TBQH 3GY7A 1GI3A 1TQ0B 5T3HA 2VIVA 3BN9A 1A5GH 3D62A 1FQ3A 3SI4H 4XBCA 3M7TA 5C3NA 4K8YA 1RXPA 3A86A 3UNQA 1D3QB 1O37A 1Y3WA 1TGNA 2FPZA 5L6NH 4UEHH 2TGDA 4CRCA 5GCHG 3UOUA 1AE8H 4Y0ZE 3LU9B 1MUEB 1TPAE 1ZPZA 2ANWA 3MH5A 1EAIA 4ABJA 1D9IA 1B0EA 1OWHA 2BVRH 5FCKA 6GCHF 5F6MA 3CP7A 1GVZA 3CENA 1O3MA 2W3IA 2ZDKA 3M3SA 2F91A 3CS0A 4UFDH 4UFGH 2ILNA 1O5AB 2GZ7A 1BTHH 1EB2A 1GMCG 3LONA 4YOIA 2BXTH 1JIRA 1O2ZA 3TH4H 1C1RA 1VITG 1SLWB 1IAUA 3PO1B 1C2JA 3ZZCA 1P2QA 3SHAH 4XSKU 5JBBS 3MFJA 4FUBA 5FCRA 3BIVH 1KIGH 1L4ZA 2FTMA 1ZOMA 1LO6A 2D2DA 2B9LA 5F8ZA 2A2QH 1P05A 2W5EA 5HMAA 1O3HA 5E0HA 4ZHMU 2FI5E 1QJ1B 1WQSA 1GHWH 2GT8A 1NRPH 4KP0A 3MNXA 2UUJB 1YP9A 1AWHB 3SZNA 2BLQA 1UMAH 3M5MA 2OXSA 5ETXA 2V3HH 1VCWA 1ANBA 3LDXH 4I8GA 3VB5A 1UHBB 2HNTF 3U8OH 3RU4E 1VITH 2XC5A 2QGRA 4FU8A 1SHYA 2DE9A 4JYVH 1GJBB 2AMQA 2G4TA 2GGVB 4FVBA 2TGPZ 1YPHC 3RXOA 3SUDA 3RM2H 3P8NA 1GI4A 1Q2WA 3G01A 5C1UA 1KXAA 1J14A 1F7ZA 5E2PA 5JDUB 1E35B 4YLQH 2PKSC 3ESTA 2XBWA 3P8GA 1HJ9A 3K2UA 2HWLB 3GCTG 1SQOA 1TA6A 1NZQH 4A5TS 4Z0KA 3EYDA 2BY8X 3BTQE 1SFIA 1S0QA 1MBQA 1P02A 2ANYA 3LKWA 3RXCA 1U6QA 1FNIA 1O3IA 2OP9A 1C1NA 1C2IA 4I7YH 1AI8H 1BRCE 3OYPA 1SGFA 3BTME 3Q3YA 4RKOB 2A45B 3RUOA 1C1VH 1AZ8A 2H5DA 3SQEE 3SBKA 2TPIZ 2B5TB 3LGYA 5TJXA 3MNCA 1GVLA 2V0BA 3E3TA 2SGPE 1BMLA 3UY9A 4D7FA 3GY8A 4YT7H 1OWEA 4HFPB 4LOYH 1ETSH 3QK1A 5GIBA 1GJ4H 4ZH8A 2EI8A 1W7XH 1RS0A 2ZHWH 5JYIA 1GHAG 2WV5A 1F92A 4X1PU 2Y7ZA 2C4FH 1O5CB 1YGCH 1HJAC 1WAYB 3KGPA 1NFYA 1KYNA 2NWNA 8KME2 5DP3A 2J9NA 2VGCC 3TNSA 3TJOA 1TPPA 3PO1C 2ZKSA 4THNH 2ZGXH 1BA8B 4FUCA 1LVBA 2WV4A 5EPNA 1C4V2 1XUIA 3A85A 3PROA 1DSUA 1TGSZ 2HPQH 1ZYOA 3TITA 1O2WA 1DM4B 3TGKE 1MMJN 1TRMA 4A6LA 1ELGA 4I33A 1O2JA 3T27A 3GCHC 1BUIA 2AGGX 4UONA 4IMQA 4DY7B 3RXEA 1ZHRA 8LPRA 1GL1A 4ABBA 1QQ4A 2Y6TA 1Z1JA 2PSYA 4ASHA 3RMLH 2J94A 1LHCH 2STBE 2QV1A 3M7UA 3O8RA 1IQEA 1XUFA 2FEQH 2AGEX 3VXEH 2BQWB 1FY8E 4GHQA 4MPWA 2BOKA 2P16A 2IN2A 2ZFSA 1AGJA 1P2IA 3MNBA 3BTHE 3ZZ8A 1EAWA 2HLCA 1N8OB 3CS7A 3RXAA 1GJCB 5F8TA 3BV9B 2C8YB 1O39A 4ZHAA 1NTPA 1TA2A 3OU0A 3URCA 1Y59T 1KDQA 5DO4H 1W8BH 2BDHA 2BDCA 2I6SA 1ESTA 1WTGH 5JBTA 3VFEA 3B8JA 1YCPK 2ZEBA 3SHCH 1GHBG 1EASA 1N6YA 3NCLA 2OCVB 1O33A 2ZU3A 1Y3YA 3E16B 2A4RA 1O2KA 1Q31A 1K21H 3M5LA 1H4WA 1LMWB 2WUBA 3HKIB 5FHTA 5DP9A 1SGRE 3QTVH 2QA9E 2VWMA 4UFFH 1MKXH 2SGQE 2VB0A 2BDAA 3BEFB 1TNJA 1D3PB 1ZSLA 2J92A 4ABGA 5C1YA 2AERH 1SGNE 1F5LA 3A7ZA 2FM2A 3A88A 3KNXA 4I31A 5HYOA 1LHEH 5DG6A 1EZUC 1IQLA 3A7XA 2Z6BD 4Y6DA 2NU4E 1QHRB 3M5OA 2ZHDA 1ZGVA 1QJ7B 4Y8YA 4FVDA 2G51A 4WMEA 2Q6FA 4BAHB 3UFAA 1UTLM 2YNBA 1AMHA 2VJ1A 1S84A 2BD8A 2AEIH 1QBVH 2HVXA 3BTTE 5E0GA 1E38B 1OP0A 3SNDA 1V2QT 1QFKH 4LK4A 4ABDA 2UWOA 2BM2A 2PSXA 4E7NA 4O3UA 4UE7H 1D6RA 4AG2A 1TABE 7ESTE 3KL6A 1K1MA 4NIVA 1GG6C 3PTBA 1SGTA 4A7IB 1KY9A 4AYYB 1GJ7B 5DP7A 1DX5M 1JIMA 3LGIA 2ZTXA 4DGJA 2TIOA 1GMHG 3SJOA 2FLBH 1PPEE 2GV6A 1SMFE 5E8EH 1O2YA 3LH1A 3M5NA 2EEKA 1P3EA 2BD2A 1EAUA 4X2YA 2ESTE 2VVUA 1EZQA 1LPGB 4OS5A 2OQUA 2BY6X 2ALVA 1BITA 5CE1A 2FTLE 3S0NA 1F0RA 1HIAB 1EATA 1ANEA 3ATWA 3MWIU 1P2NA 1HCGA 1AY6H 1EJNA 1O2PA 1G3EA 2KAIB 1RJXB 1K1LA 5C1XA 1Q3XA 2DUCA 4DW2U 5A8XA 4OS6A 3UWJH 3TJVA 1C2DA 3F9FA 3WY8A 1DWBH 1YPJH 5SGAE 3AASA 5GCHF 2ZHEH 1QB1A 1Z6JH 2CF9H 1LKAA 1CBWB 1LQDB 3Q3XA 5A0AE 5CMXH 3VB3A 1QRWA 2RA0A 3U1JB 2VWOA 1J15A 4J1YA 1SR5C 2FS9A 2WPKS 2RG3A 4I8JA 1ID5H 4X1NU 4AFSA 2ZFFH 1A0JA 1QTFA 2WYGA 4U01A 4FUJA 3TGJE 3UR9A 2BX3A 1GGDB 2FP7B 1WSSH 4ZKNU 1QL7A 2ZDAH 1HIAA 2VWNA 2FO9A 1P0SH 2Z9KA 4GSOA 4J2YB 4ZUHA 1VITF 1W10U 2Z3CA 2ODYB 1AWFH 2VIWA 1YPEH 3R0FA 1QIXB 2FOAA 1O35A 3E90B 1G30B 5LH8A 2PUXB 1YPMH 2EA3A 1IHTH 4TWWA 1A2CH 4JZEH 3F6UH 4MDSA 3DFJA 3VB6A 1C2MA 1DDJA 3FP6E 1E36B 3SNBA 3FP7E 2JH6D 3RU4T 4CHAB 1H8IH 3SJIA 4WF8A 1O2XA 3RXSA 1KLTA 4OS1A 1TOCB 2SNWA 4Q2KA 3PWCA 3SGQE 2FOBA 5DP4A 1MH0A 2O8LA 1JRSA 2CF8H 1HAIH 3AW0A 3TH2H 2RA3A 1FLEE 2FLRH 3TPIZ 4BAKB 2NU3E 2F9OA 4MNVA 4Y76A 4Y79A 1IHSH 2WPLS 4X8VH 7LPRA 3LGVA 2FYRA 3P6ZB 4DVAU 2AMDA 4WXIA 2PUQH 4ZHLU 1EX3A 2ZHQH 3RXJA 1KTTB 2ZDNA 4I32A 3QWCH 1EQ9A 1WQVH 1K22H 1UK4A 1W0YH 4LZ4B 1XUKA 1DWCH 3N7OA 1P2MA 3T25A 1EZSC 3GY4A 3ZVBA 3GDSA 1SVPA 1O3LA 3F9EA 1CBWC 5JB9S 1MKWK 2XBVA 1DXWA 1WU1A 1HAXB 3RXLA 3AAVA 1FIZA 1H1BA 3FZZA 1Y3XA 3ZV8A 1SSXA 1DXPA 3TIUA 1XXDA 2C8WB 3PMHB 3DD2H 2YOLA 1OYQA 4ISIH 1P9SA 2O9QA 2K1QA 1OWDA 3A7TA 1C2HA 2BD3A 4AB8A 5PTPA 3QZRA 4K3JA 1LVOA 2BQ7B 2O8MA 3A8AA 3LIWA 1QRXA 1GHAF 1GGDC 3V12A 2A32A 2F83A 1HBTH 1C1PA 2F9BH 3U69H 1RIWB 1HRTH 3BTGE 4ABAA 3P92A 2ZU2A 1THSH 1VJ9U 3ATMA 1BRBE 4ISHH 1G37A 1T4VH 4I8LA 3R3GB 3TK5A 1EPTC 4TY6A 1GBCA 1LPZB 2AGIX 5T6DA 5H4IB 5DP6A 1MU6B 2FOCA 5JB8S 1KTSB 4DT7B 4SGAE 4NIXA 4GLYA 3D49H 1AE5A 4TPIZ 4GCHG 2BZ6H 1YLDA 2O8UA 7GCHG 4MPXA 1P3CA 2XWBI 3MYWA 4JYTA 4CHAC 3SV6A 3AAUA 5FBEA 1CGIE 1SHHB 2PTNA 5TCCA 2PV9B 2ZFTA 3T5FH 4GUXA 2A0QB 1SGYE 3V0XA 5C20A 2QF0A 2GD4B 4DG4A 1CHOF 1O3CA 4Q80A 1NFUA 2G52A 4KTUA 2FOMB 1JXPA 1KXFA 5DK1A 1NPMA 3NZIA 5F03A 2JKHA 1O38A 1QB6A 3ZZ3A 4WMDA 4IW4E 2ZPRA 3EAJA 1AVXA 1Z8JB 3RXDA 4CH8B 4YO9A 1L1GA 4GAWA 3TK9A 1AKSB 2R3UA 2BYAX 4M7GA 1TX7A 2SGAA 3SU1A 5EQQA 1INCA 3NPSA 4UDWH 4IN1A 1C1QA 1DUEA 2BY7X 4NFFA 4UD9H 3VGCC 2VH6A 3QGNB 3HK6B 1M9UA 2GVFA 3LPRA 4XE4A 1FY1A 2OUAA 1GJ5H 4AB9A 1C5RA 1O3BA 1XKBC 1PJPA 5FPYA 4X2XA 1YPKH 4CBNA 1YCPM 2JETB 3FAOA 1GWAA 4ZXXH 3H7OA 1W7GH 1UTMA 3RXRA 2G4UA 2QYIA 2ZI2H 1O0DH 1SFQB 1XKAC 1AQ7A 1BB0B 2BXUH 3ODFA 1GBTA 1P57B 2H9EH 1UVSH 1TONA 5EXMA 2ZU5A 2Q1JA 4ESTE 3H5CB 1CT0E 3T62A 4YOGA 1VJAU 2R2WU 4CRGA 2HGTH 4DOQA 5HXFA 3P70B 4DURA 3SW2B 1GPZA 1JOUB 1AKSA 1TX6A 1SQAA 2HNTC 5J4SA 2I6QA 1QNJA 1HAGE 4FUIA 2V35A 1NFXA 3SNCA 5EXLA 1D4PB 3KIDU 1ELAA 5EPYA 1WUNH 3S9BA 2ZU1A 1TBZH 3EQ0H 2R0LA 5A09A 2A7JA 3UOPA 3UREA 1EOJA 1GBIA 1TMBH 3TU7H 1CT2E 3K9XB 1PPFE 2BDIA 3SU0A 3GY2A 4D9RA 4BNRA 5AHGH 3QN7A 1MTVA 2Y5HA 4XDEA 3BEIB 1QJ6B 4XBDA 2Y5FA 1GI8B 1GJDB 1N1LA 1MZAA 3I29A 3OSYA 1O36A 1S0RA 3SV9A 2FWWA 3MTYA 1O3NA 3SNEA 4AG1A 3EA8A 1DPOA 2GV7A 4NA7A 2PGQB 2PHBA 4H6SB 2H2ZA 5EODA 3ZZ4A 1XUGA 1C5PA 3OY5U 1P01A 2GP9B 1NC6A 3A81A 2LPRA 5ABWA 3UQVA 1GHVH 4A1XA 3ZZ7A 3DHKH 3ODDA 2BMGB 3KQCA 5LPFA 2XWAA 1K1PA 1ZRBA 2XBXA 1GMHF 2XYAA 2BLOA 4MNWA 3SU6A 4X6PA 1ABJH 1O2NA 1LTOA 1ZHPA 1PPCE 1T32A 3PLKA 1BHXB 3I77A 1SL3A 3TJNA 1ZJKA 2AFQB 1NRRH 2ZP0H 3GOVB 1L2EA 2THFB 4ZKSU 2Z3DA 3RLWH 4JZDH 1F2SE 2GMTB 3RXFA 2JETC 2BVXH 1G3DA 1LKBA 3S69A 1AUTC 2A31A 1BCUH 4D8NA 1O5EH 1FN6A 2CHAB 1MQ5A 1O3FA 2BZAA 3BG4B 3TH3H 1GI7B 5K7RA 2A7CA 9ESTA 2NU0E 3SJKA 1C5LH 3NXPA 2ALPA 1UK3A 2AH4X 1V2OT 1FPHH 1KXDA 3ZZ6A 1BDAA 1GJ9B 1K2I1 3FVFB 4CRAA 4WY3A 1GJ6A 1AB9B 4B76A 2A5AA 3M3VA 1PQAA 4FUHA 1C5UA 1O2HA 4IS5A 1SB1H 2VVCA 1S81A 3ZVEA 1O2VA 1W11U 4HTCH 3GYMA 8GCHG 3D65E 4D76A 1E0FD 1TGCA 4VGCB 4F4OC 3U8RH 1S6FA 1KDQB 1D3TB 3HKJB 1JRTA 3A8BA 2NU1E 1L1JA 3W94A 1KSNA 1OX1A 1C2LA 3ZVAA 1QL9A 4B2BA 2A5IA 1UVOA 1PYTC 2VH0A 1C5VA 1O2IA 2QIQA 3SGBE 4F49A 2OLGA 1CSOE 4X0WU 3LGWA 4INLA 1GI5A 1SGCA 3IG6B 1AVWA 2OBOA 5C5NA 1C2FA 1SGDE 1ZPCA 3MO3A 1DANH 4TYDA 3T29A 1VCQA 4NSVA 5AVDA 3BF6H 3LGTA 9LPRA 1K1NA 2FMJA 3MOCA 1GBKA 1Y5BT 3LT3A 1EJMA 3OX7U 4YESB 1C2EA 2BDGA 3KF2A 4DIHH 3LOXA 2XC4A 5DGJA 3K6YA 2OC8A 3PWBA 1UVTH 2XNIA 1GBFA 1VCPA 3SN8A 4CRFA 1ZMJA 1IQHA 3SUEA 1L1NA 1HPGA 4AFZA 2ODQA 1PYTD 1W2KH 1PQ8A 1SBWA 3GY5A 3PTNA 4GHTA 4K69A 1SOTA 5FX5A 5EG4A 2FODA 3NWUA 1V2JT 2Y82A 1YLCA 2GMTC 2G55A 2H6MA 4LZ1H 2XRCA 1W14U 3T28A 2UUKB 1YPGH 1ORFA 2HALA 3RXMA 1JBUH 4FU7A 3Q77A 1AZZA 1UCYH 4ABFA 1ELBA 2CHAC 4AYVB 1PPGE 4OS7A 1HDTH 1DWEH 1UTJA 1YKTA 3IWMA 4TWYA 2P8OB 3LJJA 1EOLA 1BHXF 1O2QA 1FPCH 1GI2A 2C90B 4A1TA 1DVAH 2QXJA 4U2WA 4ZXYH 1P9UA 4ABEA 3RU4D 2OQ5A 1P2KA 1G32B 1AO5A 1ARCA 1FI8A 1AB9C 2Y80A 1OWJA 1ZTJA 2UUYA 1CQQA 1ZTLA 2BD4A 1EP5A 3BTFE 1LHGH 2Z9LA 1UTNA 1YYY1 3SQHE 5AFZH 4Y7AA 1EB1H 3S7HB 1C2GA 2A5KA 4IMZA 1C5XB 4XOJA 2PWXA 4VGCC 4JZFH 1XMNB 2VINA 1YBWA 2BX4A 1B7XB 1G36A 3HGNA 4X8SH 1A61H 4ZKOU 5A0BA 4I8KA 1GBMA 1NS3A 1IQFA 1NRQH 1XXFA 2FXRA 1BBRH 1PPHE 2RDLA 4RSPA 2A7HA 7KMEH 1Z71A 3ZVCA 3UPEA 2R2MB 1EXFA 1GJ8B 3ZVDA 5LPEA 1C4Y2 1E34B 1XUJA 2PW8H 6ESTA 2IJOB 2OC7A 1P06A 2A2XH 1A0HB 2GDDA 1HYLA 5HGGA 3BEUA 1C9TA 1FIWA 3QUMP 1TWXB 4KTCA 5J4QA 1X7AC 4H42U 3URDA 1WTHD 1HFDA 2VVVA 1C5OH 5DJ7A 5L2YH 1N8OC 1HAZB 1ZSKA 2F9NA 3IITA 4GCHF 1GCTB 4D9QA 4YTAA 4K1EA 3KQEA 1SC8U 7GCHF 5EW2H 2FI3E 4AN7A 1AFEH 1TNIA 2Z7FE 3UNSA 1C5SA 1MTUA 1XUHA 3MNSA 2EI6A 4RN6A 1GI0A 2JH0D 3M7QA 3MH4A 1V6DA 3T26A 1MCVA 3A82A 3EE0B 1GHYH 1UK2A 4NGAH 5L2ZH 1F0SA 3MO6A 1A5IA 1IQMA 4WMFA 3SU4A 3RXGA 5C67A 1SGPE 3P8OA 3NUMA 1L0ZA 4CBOA 2C8XB 1SG8B 1O3GA 3B23B 2ZCKP 1VR1H 1TRYA 3PYHA 1GHXH 1P04A 4MNYA 4NZQA 3BTDE 1LHDH 3QTOH 4AZ2B 1CGHA 1S82A 4X6NA 1D6WA 3KHVA 3LJOA 1W3CA 3PM3A 3S7KB 1MZDA 4B2AA 1PFXC 4RKJB 3C1KA 4X1RU 2H9TH 3O8BA 3M37A 4CH2B 3ZZAA 2W26A 2ZGHA 3F9HA 1LDTT 1OS8A 5EQRA 5A2MH 2G8TA 1DLKB 3GISB 1O3DA 2ZFQH 4KGAA 3ZZBA 1GMCF 2ZGJA 3EDXB 1J17T 2XW9A 3P17H 2BD5A 1ELDE 1XVMA 1ESBA 3U1IB 3ZZ5A 1UTOA 2J4IA 3M35A 3UQOA 1KXBA 1P2JA 2ZA5A 1C1WH 3MMGA 4IGDA 2B8OH 1MBMA 1FN8A 1SLVB 1WOFA 3PB1E 2W7UA 1O3PB 2XBYA 3GYLB 2BOHB 3STIA 2ZWLH 3KQBA 4YT6H 2ZU4A 3GDVA 3SO3A 4MPUA 1C5QA 3A80A 2F9UA 1FDPA 1VGCB 5EGMA 1OYTH 1C1OA 2FESH 1UTPA 3DA9B 1NU9A 1UVUH 4K1TA 1C1UH 1OWIA 2BDYA 1LQEA 1FY4A 1HAOH 1BBRE 3QLPH 1O32A 1ZRKA 3W95A 1HB0B 1BRAA 5DP8A 1H9IE 2PKAA 3Q3KA 3GY6A 4FU9A 3EA9A 4BTIB 5EXNA 1HJ8A 2OC1A 4O03A 3OY6U 3GCTF 2FYQA 1TLDA 4AFQA 3V7TA 2WPMS 4YLUA 2O8TA 1QQUA 2GX4A 3DUXH 3A7VA 2J34A 1LVMA 1FONA 1CA0B 1Z6EA 2A4QA 2ODPA 2ZGBH 3HGPA 2R9PA 5T6GA 3I78A 2BY5X 5FX6A 2P93A 1ELFA 4OGXA 1S5SA 1A4WH 4K8BA 2ZPQA 1BMMH 4Q7YA 1QB9A 2Y7XA 1TPOA 1JMOH 4NIYA 2TGTA 2H9HA 3SV8A 2ZCLP 1A3BH 2A4GA 2BY9X 2Z9IA 3SUGA 2HPPH 4A1VA 1SGEE 2G00A 3QZQA 4WH6A 1C1SA 2GZ8A 1ANDA 2ZQ2A 4B2CA 5A0CA 2FOFA 1TNKA 2QC2A 1QCPA 1NFWA 1C2KA 5LPRA 2BB4A 1C5ZB 4AGJA 1O2OA 1YCPH 1THRH 2ZDLA 1QURH 3PMBB 5CHAB 3GCNA 3BTKE 1HAVB 3UR6A 1RD3B 1THPB 3A89A 8GCHF 2FOEA 1YPHE 2TBSA 3A8CA 5GXPA 3L33A 1DITH 1MAXA 2V6NA 1SI5H 1V2ST 2FS8A 2YNAA 4OS2A 1VGCC 1O2GH 2UUFB 4IC5A 4OGYA 4JYUH 5F8XA 3AVZA 3ZV9A 1DOJA 3E8LA 1BTYA 3S9CA 1A46H 2J38A 3DFLA 3P8FA 3MH6A 2JH5D 1MKXK 1XVOA 2CN0H 3QDZB 1V2PT 1NY22 3D23A 1S85A 1TPSA 4X6MA 1TE0A 1RFNA 3RXKA 2ZCHP 1AHTH 2QXIA 4LXBH 4Y7BA 5TCAA 1S83A 3NK8A 1O2SA 4H4FA 3FP8E 3ZZ9A 3P95A 1HAVA 4X8TH 2PKSB 2OC0A 1PPBH 4CRDA 4GVUA 1QA7A 1PQ5A 2QAAA 4FUDA 1CA0C 2VNTA 3QGJA 1K9OE 4MLFB 2BLVA 3RXVA 2B0FA 6CHAB 1BMNH 2C3SA 1BRUP 1V3XA 4U30A 1W13U 5ESBA 1K1IA 3UIRA 3ZYDA 3ITIA 1ELVA 1DFPA 5GDSH 1WYKA 1BBRK 1V2MT 4X6OA 5A8YA 4U32A 1PPZA 2ZIQH 1GHBF 2C93B 3RM0H 3VB7A 1WCZA 4Q7ZA 3KQDA 2ZG0H 2C8ZB 1MD7A 6LPRA 2CV3A 1MU8B 1RIWC 2GCHG 2ZQ1A 1DS2E 4ZKRU 1ZZZA 2A4OA 3A87A 1HJAB 1KXCA 3LC5A 3SORA 4AGKA 1O3AA 1A7SA 2VGCB 3GDUA 1O3OA 2WUCA 1CE5A 1YF4A 3U8TH 2CMYA 1S6HA 5GPIB 4JCNA 5CHAC 1DLEA 4TY7A 1C5YB 1Z8GA 1NM6A 3L3TA 3RXUA 2ZNKH 1O34A 1QGFA 1UTQA 1ELCA 1V2WT 1NESE 1ETRH 3E0PB 4KKDA 2PR3A 2ZTZA 4IBLH 1IQJA 2P94A 2HRVA 1FY5A 1OWKA 2XXLA 1ZTKA 3BTWE 1NO9H 1GDQA 3DT0H 1CHGA 2RCEA 2B7DH 3RMOH 1GBDA 1O2MA 3SU5A 2P3FH 1O30A 1P8VC 1VZQH 2G81E 3VPKA 1YPLH 1CT4E 5I46H 4Y0YE 3RXBA 1O2RA 2F9VA 1SPJA 3GCHB 1B5GH 1AVGH 2Q6DA 1SOZA 3VEQB 3EGKH 3SJ9A 1IQIA 1CA8B 1T8LA 1MCTA 1V2KT 4HI3A 1RGQA 2GKVE 2WPJS 4INKA 4B1TA 1QL8A 1TQ7B 3SV7A 2R3YA 5DKMA 3K6ZA 2Z94A 1DUAA 1GMDG 1BOQA 1ACBE 4FXGH 2FI4E 2FOHA 4E06H 4ZAEA 1Y8TA 1C5NH 1ZHMA 1Y3UA 2PFEA 5EQSA 2GDEH 1D3DB 5FPSA 3SGAE 4Y71A 6CHAC 4K2YA 1DY8A 4NSYA 1GHZA 1K1OA 3SU2A 3JZ2B 4MNXA 1NRSH 1P03A 4MPVA 4NZLA 2ASUB 3AW1A 3RXIA 5BPEA 4DJZB 3F1SB 4NA9H 1P11E 1NT1A 1LPKB 2AS9A 3SU3A 1B0FA 2J2UA 3OTJE 1UHBA 1V2RT 1Z7KA 5C5OA 1A1RA 1W0ZU 2WYJA 2Z9JA 2TGAA 3Q00A 3FFGA 1G3BA 4O3TA 4MVNA 2NU2E 1JWTA 3E1XB 5ESTE 1FZZA 4WH8A 1TX8A 4BXSA 2AIQA 3SV2H 4NCYA 3ATKA 3STJA 1TB6H 3LH3A 3K65B 1G3CA 5AF9H 2G5VA 1F5KU 2XTTB 3BSQA 2BLWA 1UJ1A 1GBLA 1RTKA 3C27B 4JZ1A 1G2LA 1J16A 4ISNA 1V2VT 2CXVA 3UUZA 1C5MD 3ELAH 5IDKA 4OS4A 1MKWH 1V2TT 3ZYEA 1GBEA 3PMJA 4K1SA 3HPTB 2CGAA 2F9PA 4Z6AH 3RC4A 2ZF0H 1CHOG 1GBHA 3SJ8A 3ATIA 4JMYA 2UWLA 4NIWA 1V2NT 3RMMH 3RXTA 3UWIA 2PTCE 3PLBA 4ABIA 1GG6B 2BHGA 5C2ZA 1GI9B 1IQNA 1CU1A 4B75A 1O5DH 4YM9A 2Q6GA 2BDBA 1QRZA 5DPAA 2A1DB 4IN2A 1BTZA 1HGTH 1O3EA 3VB4A 5IYTA 1GJAB 8ESTE 1OPHB 4AORA 3Q76A 1HAPH 2QF3A 1RRKA 1SGQE 6GCHG 4K60A 1KLIH 1HXFH 4XBBA 1ESAA 3BG8A 1PQ7A 5GWZA 3BG4C 1P09A 5DP5A 1FAKH 1P2OA 1ELTA 1UVPA 2FX4A 4YZUA 1O5GH 3V3MA 2ZPSA 3A84A 1O2UA 2GCTB 1Y5AT 3U98H 2ZTYA 4BTTB 2P95A 1LVYA 5FPTA 3E0NB 3TVJB 4KELA 1Z8IB 1QY6A 1AN1E 3PV4A 1BTUA 3TK6A 2BVSH 4YOJA 3SNAA 1ARBA
chains in the Genus database with same CATH superfamily
3RXQA 3PV5A 1HAHH 2BQ6B 1NROH 4JK5A 2ANMH 4NG9H 1TYNA 3QO6A 2AYWA 1MD8A 3PMAB 1FY3A 2PGBB 5EU8A 1RTLA 3H7TA 1BT7A 1IQGA 1ANCA 1KLJH 3F0OA 5FXLA 1EAXA 2V3OH 1DWDH 1O31A 2VBCA 4AX9H 1T31A 2P3TB 1T7CA 3LGUA 1BMAA 3SI3H 2CJIA 1MTNB 1OP8A 2M5TA 2D1JA 1DY9A 5E0JA 1ZSJA 2O8WA 2QXGA 1GVKB 2ZECA 3GY3A 4INHA 4Y10E 1BJVA 3SUFA 5EJLA 3ENSB 1A3EH 1J9CH 2TRMA 1ELEE 1Z8RA 1EJAA 3F3BA 1GBBA 3N7EA 5FBIA 5I25A 4Y8XA 1TMUH 1AU8A 1NU7B 4BTUB 1FUJA 3UNRA 1YC0A 4CR9A 2Y81A 3GICB 5GJ4B 3RMNH 3S9AA 3PV2A 4O97A 3ZVGA 2EC9H 4DT4A 5L30H 1TFXA 4X2WA 1O2LA 2PLXA 4E05H 1T8MA 2GZ9A 4HGCA 3T2NA 4FOUC 5E2OA 1OSSA 1N6XA 1CO7E 2H5CA 3TNTA 2AMPA 4O9VA 1OXGA 1OOKB 3MHWU 2FZZA 2FIRH 2D26C 2P3UB 1ZPBA 2G5NA 3F2GA 4AFUA 3E91A 1ZJDA 1EZXC 3F9GA 4F48B 4MG3A 1G2MA 3HATH 5EOKA 4BXWA 1FXYA 2VIPA 4CRBA 2ZDMA 1QBNA 1C1TA 1J8AA 4JZIA 3A83A 1QR3E 1P12E 3NKKA 2P8OC 2CK3D 3A8DA 1Y5UT 3M3TA 5C17A 1TNHA 1OHHD 3BTEE 1HNEE 1P10A 3MU8A 2GCTC 1ZR0A 2H1UA 3L6PA 1O2TA 3DSOA 1Y3VA 2HOBA 1W12U 4Y8ZA 2VWLA 3SYJA 2VU8E 3KN2A 3W1EA 3V13A 1TMTH 3KYFA 4NFEA 4PROA 1TALA 3ZVFA 4K5ZA 2SGEE 1YM0A 5FAHA 2J95A 1OKXA 2AIPA 1GI6A 3MU4A 5K0HA 4D7GA 1GDNA 3MH7A 5BRRE 3GS9A 1C9PA 1UCYE 1T8NA 4X2VA 2PKAB 3E6PH 4MTBA 2Z3EA 1G9IE 4DIIH 2ZFRH 1LCYA 4I8HA 2XCNA 1MTNC 3MO9A 3RXPA 1CVWH 2QCYA 2ULLA 4ABHA 1BTWA 1CGJE 2GCHF 1C5WB 7KMEH 1ZLRA 3TGIE 1AFQB 2Y5GA 4UFEH 2WINI 4B74A 2F43B 1TAWA 2P59A 1NN6A 1FJSA 2GT7A 1O3JA 1E37B 1O5FH 2KAIA 2ZC9H 1GBAA 1V2UT 1BZXE 3SOSA 1EPTB 1IQKA 4ZROA 4MQAA 1SGFG 4BANB 1GCTC 1Z1IA 4AOQA 4QT8C 1XX9A 2QN5T 2ZZUH 1BIOA 4R0IA 2DE8A 1A5HA 2VIQA 2BD7A 1FV9A 1ZGIA 4SGBE 3F68H 1GL0E 4ASUD 4E7RG 1FMGA 1QBOA 5A8ZA 4GPGA 4NA8A 4WVPE 2WPDD 4X8UH 2ZHFH 1ETTH 3KEEA 4HZHA 1F0TA 3LC3A 3QX5H 4FUFA 1EP6A 1DT2A 1F5RA 1HLTH 2ANKH 1MTSA 3O8DA 1C1MA 1AUJA 1UTKA 5AFYH 1A0LA 1EUFA 1T4UH 2STAE 3ZZDA 2XC0A 1TRNA 2QXHA 2OD3B 2SGFE 3RC5A 5JBAS 1WBGB 1XM1A 4WWYA 1TGTA 3U9AH 1GI1A 1TNLA 3EA7A 5JBCS 1V2LT 4BAMB 3O8CA 2SFAA 3RDZA 1GMDF 1TGBA 2VIOA 3RXHA 1EPTA 1L4DA 1SLUB 4R8TB 2WPHS 4BAOB 3MI4A 4BAQB 4TPYA 1K1JA 4X1QU 1QA0A 4NWLA 3VXFH 1H9LB 2XOKD 3VGCB 1C5TA 2SGDE 4FUGA 4XFQA 2IPHA 3B9FH 4CREA 4DCDA 3HK3B 3MU0A 1LHFH 1OP2A 3ATLA 4Q7XA 1DE7H 2UWPA 2HNTE 5EW1H 3UTUH 4JK6A 1MAYA 2GTBA 5JPMH 4WXVA 1AD8H 4X1SU 2RFKC 2ZGCA 1SQTA 3M36A 2EI7A 1SGIB 2J98B 2XCFA 1COWD 5LGOA 1HXEH 2OTVA 1MTWA 2BTCE 3RLYH 1H9HE 2BD9A 5T6FA 1WV7H 3TLOA 1TNGA 2FOGA 2FDAA 4A92A 5HM2A 2LNCA 3RP2A 1F0UA 4ZMAH 1AFQC 4CR5A 1BQYA 1O3KA 1RTFB 1TBRH 3KCGH 3MU5A 5HM9A 2W7SA 3OAAD 2QY0B 1HAYB 2ZDVH 3JZ1B 1EKBB 4NWKA 3RC6A 1TOMH 3FZDA 2IOTA 4BOHA 2M2AA 1AIXH 1ABIH 1NRNH 1SLXB 1ZMNA 4ISOA 2ZO3H 3TJUA 4IC6A 4WJG2 1BTPA 1HV7A 1O5BB 5B6OA 1FAXA 2ZFPH 4H6TA 1UCYK 3FANA 3N7DA 1IOEA 1DICA 2OINA 2FX6A 1K28D 2W3KA 2J98A 2OBQA 4KTSA 1T8OA 1GBJA 2WPIS 4B73A 1KXEA 1BTXA 2SNVA 2KM0A 1UO6A 5HIZA 1HUTH 3BIUH 4Y11E 1DSTA 2VIDA 1ZMLA 2R0KA 3MU1A 2D8WA 3A7WA 1NBMD 1GDUA 4FUEA 4ISLA 4B71A 1GCDA 1C4U2 1MQ6A 3M61U 3PLPA 2Z9GA 5G4BA 1TIOA 1BJUA 2F3CE 3GCOA 3A7YA 1H8DH 1TBQH 3GY7A 1GI3A 1TQ0B 5T3HA 2VIVA 3BN9A 1A5GH 3D62A 1FQ3A 3SI4H 4XBCA 3M7TA 5C3NA 4K8YA 1RXPA 5FL7D 3A86A 3UNQA 1D3QB 1O37A 1Y3WA 1TGNA 2FPZA 5L6NH 4UEHH 2TGDA 4CRCA 5GCHG 3UOUA 1AE8H 4Y0ZE 3LU9B 2L6OA 1YY3A 1MUEB 1TPAE 1ZPZA 2ANWA 3MH5A 1EAIA 4ABJA 1D9IA 1B0EA 1OWHA 2BVRH 4B6EA 5FCKA 3PRDA 6GCHF 5F6MA 3CP7A 1GVZA 3CENA 2PP6A 1O3MA 2W3IA 2ZDKA 3M3SA 2F91A 3CS0A 4UFDH 1H8ED 4UFGH 2ILNA 1O5AB 2GZ7A 1BTHH 1EB2A 1GMCG 3LONA 4YOIA 2BXTH 1JIRA 2W6JD 1O2ZA 3TH4H 1MABB 1C1RA 1VITG 1SLWB 1IAUA 4XD7D 3PO1B 1C2JA 3ZZCA 1P2QA 2AHME 4XSKU 3SHAH 5JBBS 3MFJA 4FUBA 5FCRA 3BIVH 1KIGH 1L4ZA 2FTMA 1ZOMA 1LO6A 2D2DA 2B9LA 5F8ZA 2A2QH 1P05A 2W5EA 5HMAA 1O3HA 5E0HA 4ZHMU 2FI5E 1QJ1B 1WQSA 1GHWH 2GT8A 1NRPH 4KP0A 3MNXA 2UUJB 1YP9A 4ACAA 1AWHB 3SZNA 2BLQA 1UMAH 3M5MA 2OXSA 5ETXA 2V3HH 1VCWA 1ANBA 3LDXH 4I8GA 3VB5A 1UHBB 2HNTF 3U8OH 3RU4E 1VITH 2XC5A 2QGRA 4FU8A 1SHYA 2DE9A 4JYVH 1GJBB 2AMQA 2G4TA 2GGVB 4FVBA 2TGPZ 1YPHC 3RXOA 3SUDA 3RM2H 3P8NA 1GI4A 1Q2WA 3G01A 5C1UA 1KXAA 1J14A 1F7ZA 5E2PA 5JDUB 1E35B 4YLQH 2PKSC 3ESTA 2XBWA 3P8GA 1HJ9A 3K2UA 2HWLB 3GCTG 1SQOA 1TA6A 1NZQH 4I86A 4A5TS 4Z0KA 3EYDA 2BY8X 3BTQE 1SFIA 1S0QA 1MBQA 1P02A 2ANYA 3LKWA 3RXCA 1U6QA 1FNIA 1O3IA 2OP9A 1C1NA 1C2IA 4I7YH 1AI8H 1BRCE 3DSPA 3OYPA 1SGFA 3BTME 3Q3YA 4HG6A 2A45B 4RKOB 5DSFA 3RUOA 1C1VH 1AZ8A 2H5DA 3SQEE 3SBKA 2TPIZ 2B5TB 3LGYA 5TJXA 3MNCA 1GVLA 3CNRA 4RT0A 2V0BA 3E3TA 2SGPE 1BMLA 3UY9A 4D7FA 3GY8A 4YT7H 1OWEA 4HFPB 4LOYH 1ETSH 3QK1A 5GIBA 1GJ4H 4ZH8A 2EI8A 1W7XH 1RS0A 1KMHB 2ZHWH 3UAIC 5JYIA 1GHAG 2WV5A 1F92A 4X1PU 2Y7ZA 2C4FH 1O5CB 1YGCH 1HJAC 1WAYB 3KGPA 1NFYA 1KYNA 2NWNA 3FO8D 8KME2 5DP3A 2J9NA 2VGCC 3TNSA 3TJOA 1TPPA 3PO1C 2ZKSA 4THNH 2ZGXH 2KX4A 1BA8B 4FUCA 1LVBA 2WV4A 5EPNA 1C4V2 1XUIA 2IJD1 3A85A 3PRBA 3PROA 1DSUA 1TGSZ 2HPQH 1ZYOA 3TITA 1O2WA 1DM4B 3TGKE 1MMJN 1TRMA 4Z1MD 4A6LA 1ELGA 4I33A 1O2JA 3T27A 3GCHC 1BUIA 2AGGX 4UONA 4IMQA 4DY7B 3RXEA 1ZHRA 8LPRA 1GL1A 4ABBA 1QQ4A 3EE7A 2Y6TA 1Z1JA 2PSYA 4ASHA 3RMLH 2J94A 1LHCH 2STBE 2QV1A 3M7UA 5GNDA 3O8RA 1IQEA 1XUFA 2FEQH 2AGEX 3VXEH 2BQWB 1FY8E 4GHQA 4MPWA 2BOKA 2P16A 2IN2A 2ZFSA 1AGJA 1E1RD 1P2IA 3MNBA 3BTHE 3ZZ8A 1EAWA 2HLCA 1N8OB 3CS7A 3RXAA 1GJCB 5F8TA 3BV9B 2C8YB 1O39A 3ZIAD 5KECA 1SQRA 1NTPA 1TA2A 3OU0A 4ZHAA 3URCA 1Y59T 2KZ4A 1KDQA 5DO4H 1W8BH 2BDHA 2KR7A 2BDCA 2I6SA 5IK2D 1ESTA 1WTGH 5JBTA 3VFEA 3B8JA 1YCPK 2ZEBA 3SHCH 1GHBG 1EASA 1N6YA 3NCLA 4RT1A 2OCVB 1O33A 2ZU3A 1Y3YA 3E16B 2A4RA 1O2KA 1Q31A 1K21H 3M5LA 1H4WA 1LMWB 2WUBA 3HKIB 5FHTA 5DP9A 1SGRE 3QTVH 2QA9E 2VWMA 4UFFH 1MKXH 2SGQE 2VB0A 2BDAA 3BEFB 1TNJA 1D3PB 1ZSLA 2J92A 2JJ2D 4ABGA 3FOAA 5C1YA 2AERH 1SGNE 1F5LA 3A7ZA 2FM2A 3A88A 3KNXA 4I31A 5HYOA 1LHEH 5DG6A 1EZUC 1IQLA 3A7XA 2Z6BD 4Y6DA 2NU4E 1QHRB 3M5OA 5B6LA 1YLNA 2ZHDA 1ZGVA 1QJ7B 4Y8YA 4FVDA 2G51A 4WMEA 2Q6FA 4BAHB 3UFAA 1UTLM 2YNBA 1AMHA 2VJ1A 1S84A 2BD8A 2AEIH 1QBVH 2HVXA 3BTTE 5E0GA 1E38B 1OP0A 2LELA 3SNDA 1V2QT 1QFKH 4LK4A 4ABDA 2UWOA 2BM2A 2PSXA 4E7NA 4O3UA 4UE7H 1D6RA 4AG2A 1TABE 7ESTE 5HKKD 3KL6A 1K1MA 4NIVA 1GG6C 3PTBA 1SGTA 4A7IB 1KY9A 4AYYB 1GJ7B 5DP7A 1DX5M 1JIMA 3LGIA 2ZTXA 4DGJA 2TIOA 1GMHG 3SJOA 2HVYB 2FLBH 1PPEE 2GV6A 1SMFE 5E8EH 1O2YA 2RDEA 3LH1A 3M5NA 2EEKA 1P3EA 2BD2A 1EAUA 4X2YA 2ESTE 2VVUA 1EZQA 1LPGB 1K0HA 4OS5A 2OQUA 2BY6X 2ALVA 1BITA 5CE1A 2FTLE 3S0NA 1F0RA 1HIAB 5EIYA 1EATA 1ANEA 1H8HD 3ATWA 2V7QD 3MWIU 1P2NA 2HLDD 1HCGA 1AY6H 1EJNA 1O2PA 1G3EA 2KAIB 1RJXB 1K1LA 5C1XA 1Q3XA 2DUCA 4DW2U 5A8XA 4OS6A 3UWJH 3TJVA 1C2DA 3F9FA 2JIZD 3WY8A 1DWBH 1YPJH 5SGAE 3AASA 5GCHF 2ZHEH 1QB1A 1Z6JH 2CF9H 1LKAA 1CBWB 1LQDB 3Q3XA 5A0AE 2JDID 5CMXH 3VB3A 1QRWA 2RA0A 3U1JB 2VWOA 1J15A 4J1YA 1SR5C 2FS9A 1NBME 2WPKS 2RG3A 4I8JA 1ID5H 4X1NU 4AFSA 2ZFFH 1A0JA 1QTFA 2WYGA 4U01A 4FUJA 3TGJE 3UR9A 2BX3A 1GGDB 2FP7B 1WSSH 4ZKNU 1QL7A 2ZDAH 1WDIA 1HIAA 2VWNA 2FO9A 1P0SH 2Z9KA 4GSOA 4J2YB 4ZUHA 1VITF 1W10U 2Z3CA 2ODYB 1AWFH 2VIWA 1YPEH 3R0FA 1QIXB 2FOAA 1O35A 3E90B 1G30B 5LH8A 2PUXB 1YPMH 2EA3A 1IHTH 4TWWA 1A2CH 4JZEH 3F6UH 4MDSA 3DFJA 3VB6A 2IPQX 1C2MA 1DDJA 3FP6E 1E36B 3SNBA 3FP7E 2JH6D 4M9FA 3RU4T 4CHAB 2QF4A 1H8IH 3SJIA 4WF8A 1O2XA 3RXSA 1KLTA 4OS1A 1TOCB 2SNWA 4Q2KA 3PWCA 3SGQE 2FOBA 5DP4A 1MH0A 2O8LA 1JRSA 2CF8H 1HAIH 3DSGA 3AW0A 3TH2H 2RA3A 1FLEE 2FLRH 3TPIZ 4BAKB 2NU3E 2F9OA 4MNVA 4Y76A 4Y79A 1IHSH 5CHBA 2WPLS 4X8VH 7LPRA 3LGVA 2FYRA 3P6ZB 4DVAU 2AMDA 4WXIA 2PUQH 4ZHLU 1EX3A 2ZHQH 3RXJA 1KTTB 2ZDNA 4I32A 3QWCH 1EQ9A 1WQVH 1K22H 1UK4A 1W0YH 4LZ4B 1XUKA 1DWCH 3N7OA 1P2MA 3T25A 1EZSC 3GY4A 3ZVBA 3GDSA 1SVPA 1O3LA 3F9EA 1CBWC 5JB9S 1MKWK 2XBVA 1DXWA 1WU1A 4FETA 1HAXB 3RXLA 3AAVA 4RI0A 1FIZA 1H1BA 3FZZA 1Y3XA 3ZV8A 2KCAA 1SSXA 1DXPA 3TIUA 1XXDA 2C8WB 3PMHB 3DD2H 2YOLA 1OYQA 4ISIH 1P9SA 2O9QA 2K1QA 1OWDA 3A7TA 1C2HA 2BD3A 4AB8A 5PTPA 3QZRA 4K3JA 1LVOA 2BQ7B 2O8MA 3A8AA 3LIWA 1QRXA 1GHAF 1GGDC 3V12A 2A32A 2F83A 1HBTH 1C1PA 2F9BH 3U69H 1RIWB 1HRTH 3F2HA 3BTGE 5T1VA 4ABAA 3P92A 2ZU2A 1THSH 1VJ9U 3ATMA 1BRBE 4ISHH 1G37A 1T4VH 4I8LA 3R3GB 3TK5A 1EPTC 4TY6A 1GBCA 1LPZB 2AGIX 5T6DA 5H4IB 5DP6A 1MU6B 2FOCA 5JB8S 1KTSB 4DT7B 4SGAE 4NIXA 2XNDD 4GLYA 3D49H 1AE5A 4TPIZ 4GCHG 2BZ6H 1YLDA 2O8UA 7GCHG 4MPXA 1P3CA 2XWBI 3MYWA 4JYTA 2LP6A 4CHAC 3SV6A 1E79D 3AAUA 5FBEA 2WHXA 1CGIE 1SHHB 2PTNA 5TCCA 2PV9B 2ZFTA 2EY4C 4GUXA 3T5FH 2A0QB 1SGYE 1S6LA 3V0XA 2QF0A 5C20A 2GD4B 4DG4A 1CHOF 1O3CA 4Q80A 1NFUA 2G52A 4KTUA 2FOMB 1JXPA 1KXFA 5DK1A 4TSFD 1NPMA 3NZIA 5F03A 2JKHA 1O38A 1QB6A 3ZZ3A 4WMDA 4IW4E 2ZPRA 3EAJA 1AVXA 1Z8JB 3RXDA 4CH8B 4YO9A 1L1GA 4GAWA 3TK9A 1AKSB 2R3UA 2BYAX 4M7GA 1TX7A 2SGAA 3SU1A 5EQQA 1INCA 3NPSA 4UDWH 4IN1A 1C1QA 1DUEA 5EJZA 2BY7X 4NFFA 4UD9H 3VGCC 2VH6A 3QGNB 3HK6B 1M9UA 2GVFA 3LPRA 4XE4A 1FY1A 2OUAA 1GJ5H 4AB9A 1C5RA 1O3BA 1XKBC 1PJPA 4YXWD 5FPYA 4X2XA 1YPKH 4CBNA 1YCPM 2JETB 3FAOA 1GWAA 4ZXXH 3H7OA 1W7GH 1UTMA 3RXRA 2G4UA 2QYIA 2ZI2H 1O0DH 1SFQB 1XKAC 1AQ7A 1BB0B 2BXUH 3ODFA 1GBTA 1P57B 2H9EH 1UVSH 1TONA 5EXMA 2ZU5A 2Q1JA 4ESTE 3H5CB 1CT0E 2WSSD 3NRLA 3T62A 4YOGA 1VJAU 2R2WU 4CRGA 2HGTH 4DOQA 5HXFA 3P70B 4DURA 3SW2B 1GPZA 1JOUB 1AKSA 1TX6A 1SQAA 2HNTC 5J4SA 2I6QA 1QNJA 1HAGE 4FUIA 2V35A 1NFXA 2W6ID 3SNCA 5EXLA 1D4PB 3KIDU 1ELAA 5EPYA 1WUNH 3S9BA 2ZU1A 1TBZH 3EQ0H 2R0LA 5A09A 2K0QA 2A7JA 3UOPA 3UREA 1EOJA 1GBIA 1TMBH 3TU7H 1CT2E 3K9XB 1PPFE 2BDIA 3SU0A 1QZ8A 3GY2A 4D9RA 4BNRA 5AHGH 3QN7A 4F55A 2J97A 1MTVA 2Y5HA 4XDEA 3BEIB 1QJ6B 4XBDA 2Y5FA 1GI8B 1GJDB 1N1LA 1MZAA 3I29A 3OSYA 1O36A 1S0RA 3SV9A 2FWWA 3MTYA 2YMSB 1O3NA 3SNEA 4AG1A 3EA8A 1DPOA 2GV7A 4NA7A 2PGQB 2PHBA 4H6SB 2H2ZA 4TT3D 5EODA 3ZZ4A 1XUGA 1C5PA 3OY5U 1P01A 2GP9B 1NC6A 3A81A 2LPRA 5ABWA 3UQVA 1GHVH 4A1XA 3ZZ7A 3DHKH 3ODDA 2BMGB 3KQCA 5LPFA 2XWAA 1K1PA 1ZRBA 2XBXA 1GMHF 2XYAA 2BLOA 4MNWA 3SU6A 3WW7A 4X6PA 1ABJH 1O2NA 1LTOA 1ZHPA 1PPCE 1T32A 2OK5A 3PLKA 1BHXB 3I77A 1SL3A 3TJNA 1ZJKA 2AFQB 1NRRH 5DN6D 2ZP0H 3GOVB 1L2EA 2THFB 4ZKSU 2Z3DA 3RLWH 4JZDH 1F2SE 2WZQA 2GMTB 3RXFA 2JETC 2BVXH 1G3DA 1LKBA 3S69A 1AUTC 2A31A 3VG8A 1BCUH 4D8NA 1O5EH 1FN6A 2CHAB 1MQ5A 1O3FA 2BZAA 3BG4B 3TH3H 1GI7B 5K7RA 2A7CA 9ESTA 2NU0E 3SJKA 1C5LH 3NXPA 2ALPA 1UK3A 2AH4X 1V2OT 1FPHH 1KXDA 3ZZ6A 1BDAA 1GJ9B 1K2I1 3FVFB 4CRAA 4WY3A 1GJ6A 1AB9B 4B76A 2A5AA 3M3VA 1PQAA 4FUHA 1C5UA 1O2HA 4IS5A 1SB1H 2VVCA 1S81A 3ZVEA 1O2VA 1W11U 4HTCH 3GYMA 8GCHG 3D65E 4D76A 1E0FD 1TGCA 4VGCB 4F4OC 3U8RH 1S6FA 1KDQB 1D3TB 4ZCNA 3HKJB 1WXRA 1JRTA 3A8BA 2NU1E 1L1JA 3W94A 1KSNA 1OX1A 1C2LA 3ZVAA 1QL9A 4B2BA 2A5IA 1UVOA 1PYTC 2VH0A 1C5VA 1O2IA 2QIQA 3SGBE 4F49A 2OLGA 1CSOE 4X0WU 3LGWA 4INLA 1GI5A 1SGCA 3IG6B 2YMSC 1AVWA 2OBOA 5C5NA 1C2FA 1SGDE 1ZPCA 3MO3A 1DANH 4TYDA 3T29A 1VCQA 4NSVA 5AVDA 3BF6H 3LGTA 9LPRA 1K1NA 2FMJA 3MOCA 1GBKA 1Y5BT 3LT3A 1EJMA 3OX7U 4YESB 1C2EA 2BDGA 3KF2A 4DIHH 3LOXA 2XC4A 5DGJA 3K6YA 2OC8A 3PWBA 1UVTH 2XNIA 1GBFA 1VCPA 3SN8A 4CRFA 1ZMJA 1IQHA 3F0PA 1L1NA 3SUEA 1HPGA 4AFZA 2ODQA 1PYTD 1W2KH 1PQ8A 1SBWA 3GY5A 3PTNA 4GHTA 4K69A 1SOTA 5FX5A 5EG4A 2FODA 3NWUA 1V2JT 2Y82A 1YLCA 2GMTC 2G55A 2YMSD 2H6MA 4LZ1H 2XRCA 1W14U 3T28A 2UUKB 1YPGH 1ORFA 2HALA 3RXMA 1JBUH 4FU7A 3Q77A 1AZZA 1UCYH 4ABFA 1ELBA 2CHAC 3WWFA 4AYVB 1E1QD 1PPGE 4OS7A 1HDTH 1DWEH 3OEED 1UTJA 1YKTA 3IWMA 4TWYA 3SZEA 2P8OB 3LJJA 1EOLA 1BHXF 1O2QA 1FPCH 1GI2A 2C90B 4A1TA 3OTPA 1DVAH 2QXJA 4U2WA 4ZXYH 1P9UA 4ABEA 3RU4D 2OQ5A 1P2KA 1G32B 1AO5A 1ARCA 1FI8A 1AB9C 2Y80A 1OWJA 1ZTJA 2UUYA 1CQQA 1ZTLA 2BD4A 2KCYA 1EP5A 3BTFE 1LHGH 2Z9LA 1UTNA 1YYY1 3SQHE 5AFZH 4Y7AA 1EB1H 3S7HB 1C2GA 2A5KA 4IMZA 1C5XB 4XOJA 2PWXA 4VGCC 4JZFH 1XMNB 5C0UA 2VINA 1YBWA 2BX4A 1B7XB 1G36A 3HGNA 4X8SH 1A61H 4ZKOU 5A0BA 4I8KA 1GBMA 1NS3A 1IQFA 1NRQH 1XXFA 2FXRA 1BBRH 1PPHE 2RDLA 4Q4LA 2A7HA 4RSPA 1Z71A 3ZVCA 3UPEA 2R2MB 1EXFA 1GJ8B 3ZVDA 5LPEA 3F2FA 1C4Y2 1E34B 1XUJA 2PW8H 6ESTA 2IJOB 2OC7A 3U28C 1P06A 2A2XH 1A0HB 2GDDA 1HYLA 5HGGA 3BEUA 1C9TA 3H09A 1FIWA 3QUMP 1TWXB 4KTCA 5J4QA 1X7AC 4H42U 3URDA 1WTHD 1HFDA 2VVVA 1C5OH 5DJ7A 5L2YH 1N8OC 1HAZB 1ZSKA 2F9NA 3IITA 4GCHF 1GCTB 4D9QA 4YTAA 4K1EA 3KQEA 1SC8U 7GCHF 5EW2H 2FI3E 4AN7A 1AFEH 1TNIA 2Z7FE 3UNSA 1C5SA 1MTUA 1XUHA 4ACBA 3MNSA 2EI6A 4RN6A 1GI0A 2KCOA 2JH0D 3M7QA 3MH4A 1V6DA 3T26A 1MCVA 3A82A 3EE0B 1GHYH 1UK2A 4NGAH 5L2ZH 1F0SA 3MO6A 1A5IA 1IQMA 4WMFA 3SU4A 3RXGA 5C67A 1SGPE 3P8OA 3NUMA 1L0ZA 4CBOA 2C8XB 1SG8B 1SKYE 1O3GA 3B23B 3FN8A 2ZCKP 1VR1H 1TRYA 3KYGA 3PYHA 1GHXH 1P04A 4MNYA 4NZQA 3BTDE 1LHDH 3QTOH 4AZ2B 1CGHA 1S82A 4X6NA 1D6WA 3KHVA 3LJOA 1W3CA 3PM3A 3S7KB 1MZDA 4B2AA 1PFXC 4RKJB 3C1KA 4X1RU 2H9TH 3O8BA 3M37A 4CH2B 3ZZAA 2W26A 2ZGHA 3F9HA 1LDTT 1OS8A 5EQRA 5A2MH 2G8TA 1DLKB 2F4LA 3GISB 1O3DA 2ZFQH 4KGAA 3ZZBA 1GMCF 5KEDA 2ZGJA 3EDXB 1J17T 2XW9A 3P17H 2BD5A 1ELDE 1XVMA 1ESBA 3U1IB 4Q63A 3ZZ5A 1UTOA 2J4IA 3M35A 3UQOA 1KXBA 1P2JA 2ZA5A 5CDFE 1C1WH 3MMGA 4IGDA 2B8OH 1MBMA 1FN8A 1SLVB 1WOFA 3PB1E 1FX0B 2W7UA 1O3PB 2XBYA 3GYLB 2BOHB 3STIA 2ZWLH 3KQBA 4YT6H 2ZU4A 4B6FA 3GDVA 3SO3A 4MPUA 1C5QA 3A80A 2F9UA 1FDPA 2K8IA 1VGCB 5EGMA 1OYTH 1C1OA 2FESH 1UTPA 3DA9B 1NU9A 1UVUH 4K1TA 1C1UH 1OWIA 2BDYA 1LQEA 1FY4A 1HAOH 1BBRE 3QLPH 1O32A 1ZRKA 3W95A 1HB0B 1BRAA 5DP8A 1H9IE 2PKAA 3Q3KA 3GY6A 4FU9A 3EA9A 4BTIB 3DCLA 5EXNA 1HJ8A 2OC1A 4O03A 2QE7D 3OY6U 3GCTF 2FYQA 1TLDA 4AFQA 3V7TA 2WPMS 4YLUA 2O8TA 1QQUA 2GX4A 3DUXH 3A7VA 3OEHD 2J34A 1LVMA 1FONA 1CA0B 1Z6EA 2A4QA 2ODPA 2ZGBH 3HGPA 2R9PA 5T6GA 3I78A 2BY5X 5FX6A 2P93A 1ELFA 1BMFD 4OGXA 1S5SA 1A4WH 4K8BA 2ZPQA 1BMMH 5EJ1A 4Q7YA 1QB9A 2Y7XA 1TPOA 1JMOH 4NIYA 2TGTA 3AK5A 2KCPA 2H9HA 3SV8A 2ZCLP 1A3BH 2A4GA 5C94A 2BY9X 2Z9IA 3SUGA 2HPPH 3FKSD 4A1VA 1SGEE 2G00A 3QZQA 4WH6A 1C1SA 2GZ8A 2JJ1D 1ANDA 2ZQ2A 4B2CA 5A0CA 2FOFA 1TNKA 2QC2A 1QCPA 1NFWA 1C2KA 5LPRA 2BB4A 1C5ZB 4AGJA 1O2OA 1YCPH 1THRH 4AC9A 2ZDLA 1QURH 3PMBB 5CHAB 3GCNA 3BTKE 1HAVB 3UR6A 1RD3B 1THPB 3A89A 8GCHF 2FOEA 1YPHE 2TBSA 1VKYA 3A8CA 3OFND 5GXPA 3L33A 1DITH 1MAXA 2V6NA 1SI5H 1V2ST 2KFWA 2FS8A 2YNAA 4OS2A 1VGCC 1O2GH 2UUFB 4IC5A 4OGYA 4JYUH 5F8XA 3AVZA 3ZV9A 1W0JD 2WV9A 1DOJA 3E8LA 1BTYA 3S9CA 1A46H 2J38A 3DFLA 3P8FA 3MH6A 2JH5D 1MKXK 1XVOA 2CN0H 3QDZB 1V2PT 1NY22 3D23A 4P02A 1S85A 1TPSA 4X6MA 1TE0A 1RFNA 3RXKA 2ZCHP 1AHTH 2QXIA 2L74A 4LXBH 4Y7BA 5TCAA 1S83A 3NK8A 1O2SA 4H4FA 3FP8E 3ZZ9A 3P95A 1HAVA 4X8TH 2PKSB 2OC0A 1PPBH 4CRDA 4GVUA 1QA7A 1PQ5A 2QAAA 4FUDA 1CA0C 2VNTA 3QGJA 1K9OE 4MLFB 2BLVA 3RXVA 2B0FA 6CHAB 1BMNH 1YWUA 2C3SA 1BRUP 1V3XA 4U30A 1W13U 5ESBA 1K1IA 3UIRA 3ZYDA 3ITIA 1ELVA 1DFPA 5GDSH 1WYKA 1BBRK 1V2MT 4X6OA 3MQKC 5A8YA 4U32A 1PPZA 2ZIQH 1GHBF 3WWBA 2C93B 5KGOA 3RM0H 3VB7A 1WCZA 4Q7ZA 3KQDA 2ZG0H 2C8ZB 1MD7A 6LPRA 2CV3A 1MU8B 1RIWC 2GCHG 2ZQ1A 1DS2E 4ZKRU 1ZZZA 2A4OA 3A87A 1HJAB 1KXCA 3LC5A 3SORA 1UW7A 4AGKA 1O3AA 1A7SA 2VGCB 3GDUA 1O3OA 2WUCA 2QF5A 1CE5A 1YF4A 3U8TH 2CMYA 1S6HA 5GPIB 4JCNA 5CHAC 1DLEA 4TY7A 1C5YB 1Z8GA 1NM6A 3L3TA 3RXUA 2ZNKH 1O34A 1QGFA 1UTQA 1ELCA 1V2WT 1NESE 1ETRH 3E0PB 4KKDA 2PR3A 2ZTZA 4IBLH 1IQJA 2P94A 2HRVA 1FY5A 1OWKA 2XXLA 1ZTKA 3BTWE 1NO9H 1GDQA 3DT0H 1CHGA 2RCEA 2B7DH 3RMOH 1GBDA 1O2MA 3SU5A 2P3FH 1O30A 1P8VC 1VZQH 2G81E 3VPKA 1W0KD 1CT4E 1YPLH 5I46H 4Y0YE 3RXBA 1O2RA 2F9VA 1SPJA 3N99A 3GCHB 1B5GH 1AVGH 2Q6DA 1SOZA 3VEQB 3EGKH 3SJ9A 1IQIA 1CA8B 1T8LA 1MCTA 1V2KT 4HI3A 1RGQA 2GKVE 2WPJS 4INKA 4B1TA 1QL8A 1TQ7B 3SV7A 2R3YA 5DKMA 3K6ZA 1EFRD 2Z94A 1DUAA 1GMDG 1BOQA 1ACBE 4FXGH 2FI4E 2FOHA 4E06H 4XRNA 4ZAEA 1Y8TA 4P00A 3OE7D 5C0TA 1C5NH 1ZHMA 1Y3UA 2PFEA 5EQSA 2GDEH 1D3DB 5FPSA 3SGAE 4Y71A 6CHAC 4K2YA 1DY8A 4NSYA 1GHZA 1K1OA 3SU2A 3JZ2B 4MNXA 3KQ5A 1NRSH 1P03A 4MPVA 4NZLA 2ASUB 3AW1A 3RXIA 5BPEA 4DJZB 3F1SB 4NA9H 1P11E 1NT1A 1LPKB 2AS9A 3SU3A 5F53A 1B0FA 2J2UA 3OTJE 1UHBA 1V2RT 1Z7KA 5C5OA 1A1RA 1W0ZU 2WYJA 2Z9JA 2TGAA 3Q00A 3FFGA 1G3BA 4O3TA 4MVNA 2NU2E 1JWTA 3E1XB 5ESTE 1FZZA 4WH8A 1TX8A 4BXSA 2AIQA 3SV2H 4NCYA 3ATKA 3STJA 1TB6H 3LH3A 3K65B 1G3CA 5AF9H 2G5VA 1F5KU 2XTTB 3BSQA 2BLWA 1UJ1A 1GBLA 1RTKA 3C27B 4OM9A 4JZ1A 1G2LA 1J16A 4ISNA 1V2VT 2CXVA 3UUZA 1C5MD 2V3MA 3UB0A 3ELAH 5IDKA 4OS4A 1MKWH 1V2TT 3ZYEA 1GBEA 3PMJA 4K1SA 2EQNA 3HPTB 2CGAA 2F9PA 4Z6AH 3RC4A 2ZF0H 1CHOG 1GBHA 3SJ8A 3ATIA 4JMYA 2UWLA 4NIWA 1V2NT 3RMMH 3RXTA 3UWIA 2PTCE 3PLBA 4ABIA 1GG6B 2BHGA 5C2ZA 1GI9B 1IQNA 1CU1A 4B75A 1O5DH 4YM9A 2Q6GA 2GJGA 2BDBA 1QRZA 5DPAA 2A1DB 4IN2A 1BTZA 1HGTH 1O3EA 3VB4A 5IYTA 1GJAB 8ESTE 1OPHB 4AORA 3Q76A 1HAPH 2QF3A 1RRKA 1SGQE 6GCHG 4K60A 1KLIH 1HXFH 4XBBA 1ESAA 3BG8A 1PQ7A 5GWZA 3BG4C 1P09A 5DP5A 1FAKH 1P2OA 1ELTA 1UVPA 2FX4A 4YZUA 1O5GH 3V3MA 2ZPSA 3A84A 1O2UA 2GCTB 1Y5AT 3U98H 2ZTYA 4BTTB 2P95A 1LVYA 5FPTA 5HIYA 3E0NB 3TVJB 4KELA 1Z8IB 1QY6A 1AN1E 2J5UA 3PV4A 1BTUA 3TK6A 2BVSH 4YOJA 3SNAA 1ARBA
chains in the Genus database with same CATH topology
3RXQA 1HAHH 2BQ6B 1NROH 4JK5A 2ANMH 4NG9H 1TYNA 3QO6A 2AYWA 1MD8A 3PMAB 1FY3A 2PGBB 5EU8A 1RTLA 3H7TA 1BT7A 1IQGA 1ANCA 1KLJH 5FXLA 1EAXA 2V3OH 1DWDH 1O31A 4AX9H 1T31A 2P3TB 1T7CA 3LGUA 1BMAA 3SI3H 2CJIA 1MTNB 1OP8A 2M5TA 2D1JA 1DY9A 5E0JA 1ZSJA 2O8WA 2QXGA 1GVKB 2ZECA 3GY3A 4INHA 4Y10E 1BJVA 3SUFA 3ENSB 1A3EH 1J9CH 2TRMA 1ELEE 1Z8RA 1EJAA 1GBBA 5FBIA 5I25A 4Y8XA 1TMUH 1AU8A 1NU7B 4BTUB 1FUJA 3UNRA 1YC0A 4CR9A 2Y81A 3GICB 5GJ4B 3RMNH 3S9AA 4O97A 3ZVGA 2EC9H 5L30H 1TFXA 4X2WA 1O2LA 2PLXA 4E05H 1T8MA 2GZ9A 4HGCA 3T2NA 5E2OA 1OSSA 1N6XA 1CO7E 2H5CA 3TNTA 2AMPA 4O9VA 1OXGA 1OOKB 3MHWU 2FZZA 2FIRH 2D26C 2P3UB 1ZPBA 2G5NA 4AFUA 3E91A 1ZJDA 1EZXC 3F9GA 4MG3A 1G2MA 3HATH 5EOKA 4BXWA 1FXYA 2VIPA 4CRBA 2ZDMA 1QBNA 1C1TA 1J8AA 4JZIA 3A83A 1QR3E 1P12E 3NKKA 2P8OC 3A8DA 1Y5UT 3M3TA 1TNHA 3BTEE 1HNEE 1P10A 3MU8A 2GCTC 1ZR0A 2H1UA 3L6PA 1O2TA 1Y3VA 2HOBA 1W12U 4Y8ZA 2VWLA 2VU8E 3KN2A 3V13A 1TMTH 4PROA 4NFEA 1TALA 3ZVFA 4K5ZA 2SGEE 1YM0A 5FAHA 2J95A 1OKXA 2AIPA 1GI6A 3MU4A 5K0HA 4D7GA 1GDNA 3MH7A 5BRRE 1C9PA 1UCYE 1T8NA 4X2VA 2PKAB 3E6PH 4MTBA 2Z3EA 1G9IE 4DIIH 2ZFRH 1LCYA 4I8HA 2XCNA 1MTNC 3MO9A 3RXPA 1CVWH 2QCYA 2ULLA 4ABHA 1BTWA 1CGJE 2GCHF 1C5WB 1ZLRA 3TGIE 1AFQB 2Y5GA 4UFEH 2WINI 4B74A 1TAWA 2P59A 1NN6A 1FJSA 2GT7A 1O3JA 1E37B 1O5FH 2KAIA 2ZC9H 1GBAA 1V2UT 1BZXE 3SOSA 1EPTB 1IQKA 4ZROA 4MQAA 1SGFG 4BANB 1GCTC 1Z1IA 4AOQA 4QT8C 1XX9A 2QN5T 2ZZUH 1BIOA 4R0IA 2DE8A 1A5HA 2VIQA 2BD7A 1FV9A 1ZGIA 4SGBE 3F68H 1GL0E 4E7RG 1FMGA 1QBOA 5A8ZA 4GPGA 4NA8A 4WVPE 4X8UH 2ZHFH 1ETTH 3KEEA 4HZHA 1F0TA 3LC3A 3QX5H 4FUFA 1EP6A 1DT2A 1F5RA 1HLTH 2ANKH 1MTSA 3O8DA 1C1MA 1AUJA 1UTKA 5AFYH 1A0LA 1EUFA 1T4UH 2STAE 3ZZDA 2XC0A 1TRNA 2QXHA 2OD3B 2SGFE 3RC5A 5JBAS 1WBGB 1XM1A 4WWYA 1TGTA 3U9AH 1GI1A 1TNLA 3EA7A 5JBCS 1V2LT 4BAMB 3O8CA 2SFAA 3RDZA 1GMDF 1TGBA 2VIOA 3RXHA 1EPTA 1L4DA 1SLUB 4R8TB 2WPHS 4BAOB 3MI4A 4BAQB 4TPYA 1K1JA 4X1QU 1QA0A 4NWLA 3VXFH 1H9LB 3VGCB 1C5TA 2SGDE 4FUGA 4XFQA 2IPHA 3B9FH 4CREA 4DCDA 3HK3B 3MU0A 1LHFH 1OP2A 3ATLA 4Q7XA 1DE7H 2UWPA 2HNTE 5EW1H 3UTUH 4JK6A 1MAYA 2GTBA 5JPMH 4WXVA 1AD8H 4X1SU 2ZGCA 1SQTA 3M36A 2EI7A 1SGIB 2XCFA 5LGOA 1HXEH 2OTVA 1MTWA 2BTCE 3RLYH 1H9HE 2BD9A 5T6FA 1WV7H 3TLOA 1TNGA 2FOGA 2FDAA 4A92A 5HM2A 2LNCA 3RP2A 1F0UA 4ZMAH 1AFQC 4CR5A 1BQYA 1O3KA 1RTFB 1TBRH 3KCGH 3MU5A 5HM9A 2W7SA 2QY0B 1HAYB 2ZDVH 3JZ1B 1EKBB 4NWKA 3RC6A 1TOMH 3FZDA 2IOTA 4BOHA 1AIXH 1ABIH 1NRNH 1SLXB 1ZMNA 4ISOA 2ZO3H 3TJUA 4IC6A 4WJG2 1BTPA 1HV7A 1O5BB 5B6OA 1FAXA 2ZFPH 4H6TA 1UCYK 3FANA 1IOEA 1DICA 2OINA 2FX6A 1K28D 2W3KA 2OBQA 4KTSA 1T8OA 1GBJA 2WPIS 4B73A 1KXEA 1BTXA 2SNVA 1HUTH 1UO6A 3BIUH 4Y11E 1DSTA 2VIDA 1ZMLA 2R0KA 3MU1A 2D8WA 3A7WA 4FUEA 1GDUA 4ISLA 4B71A 1GCDA 1C4U2 1MQ6A 3M61U 3PLPA 2Z9GA 5G4BA 1TIOA 1BJUA 2F3CE 3GCOA 3A7YA 1H8DH 1TBQH 3GY7A 1GI3A 1TQ0B 5T3HA 2VIVA 3BN9A 1A5GH 3D62A 1FQ3A 3SI4H 4XBCA 3M7TA 5C3NA 4K8YA 1RXPA 3A86A 3UNQA 1D3QB 1O37A 1Y3WA 1TGNA 2FPZA 5L6NH 4UEHH 2TGDA 4CRCA 5GCHG 3UOUA 1AE8H 4Y0ZE 3LU9B 1MUEB 1TPAE 1ZPZA 2ANWA 3MH5A 1EAIA 4ABJA 1D9IA 1B0EA 1OWHA 2BVRH 5FCKA 6GCHF 5F6MA 3CP7A 1GVZA 3CENA 1O3MA 2W3IA 2ZDKA 3M3SA 2F91A 3CS0A 4UFDH 4UFGH 2ILNA 1O5AB 2GZ7A 1BTHH 1EB2A 1GMCG 3LONA 4YOIA 2BXTH 1JIRA 1O2ZA 3TH4H 1C1RA 1VITG 1SLWB 1IAUA 3PO1B 1C2JA 3ZZCA 1P2QA 3SHAH 4XSKU 5JBBS 3MFJA 4FUBA 5FCRA 3BIVH 1KIGH 1L4ZA 2FTMA 1ZOMA 1LO6A 2D2DA 2B9LA 5F8ZA 2A2QH 1P05A 2W5EA 5HMAA 1O3HA 5E0HA 4ZHMU 2FI5E 1QJ1B 1WQSA 1GHWH 2GT8A 1NRPH 4KP0A 3MNXA 2UUJB 1YP9A 1AWHB 3SZNA 2BLQA 1UMAH 3M5MA 2OXSA 5ETXA 2V3HH 1VCWA 1ANBA 3LDXH 4I8GA 3VB5A 1UHBB 2HNTF 3U8OH 3RU4E 1VITH 2XC5A 2QGRA 4FU8A 1SHYA 2DE9A 4JYVH 1GJBB 2AMQA 2G4TA 2GGVB 4FVBA 2TGPZ 1YPHC 3RXOA 3SUDA 3RM2H 3P8NA 1GI4A 1Q2WA 3G01A 5C1UA 1KXAA 1J14A 1F7ZA 5E2PA 5JDUB 1E35B 4YLQH 2PKSC 3ESTA 2XBWA 3P8GA 1HJ9A 3K2UA 2HWLB 3GCTG 1SQOA 1TA6A 1NZQH 4A5TS 4Z0KA 3EYDA 2BY8X 3BTQE 1SFIA 1S0QA 1MBQA 1P02A 2ANYA 3LKWA 3RXCA 1U6QA 1FNIA 1O3IA 2OP9A 1C1NA 1C2IA 4I7YH 1AI8H 1BRCE 3OYPA 1SGFA 3BTME 3Q3YA 4RKOB 2A45B 3RUOA 1C1VH 1AZ8A 2H5DA 3SQEE 3SBKA 2TPIZ 2B5TB 3LGYA 5TJXA 3MNCA 1GVLA 2V0BA 3E3TA 2SGPE 1BMLA 3UY9A 4D7FA 3GY8A 4YT7H 1OWEA 4HFPB 4LOYH 1ETSH 3QK1A 5GIBA 1GJ4H 4ZH8A 2EI8A 1W7XH 1RS0A 2ZHWH 5JYIA 1GHAG 2WV5A 1F92A 4X1PU 2Y7ZA 2C4FH 1O5CB 1YGCH 1HJAC 1WAYB 3KGPA 1NFYA 1KYNA 2NWNA 8KME2 5DP3A 2J9NA 2VGCC 3TNSA 3TJOA 1TPPA 3PO1C 2ZKSA 4THNH 2ZGXH 1BA8B 4FUCA 1LVBA 2WV4A 5EPNA 1C4V2 1XUIA 3A85A 3PROA 1DSUA 1TGSZ 2HPQH 1ZYOA 3TITA 1O2WA 1DM4B 3TGKE 1MMJN 1TRMA 4A6LA 1ELGA 4I33A 1O2JA 3T27A 3GCHC 1BUIA 2AGGX 4UONA 4IMQA 4DY7B 3RXEA 1ZHRA 8LPRA 1GL1A 4ABBA 1QQ4A 2Y6TA 1Z1JA 2PSYA 4ASHA 3RMLH 2J94A 1LHCH 2STBE 2QV1A 3M7UA 3O8RA 1IQEA 1XUFA 2FEQH 2AGEX 3VXEH 2BQWB 1FY8E 4GHQA 4MPWA 2BOKA 2P16A 2IN2A 2ZFSA 1AGJA 1P2IA 3MNBA 3BTHE 3ZZ8A 1EAWA 2HLCA 1N8OB 3CS7A 3RXAA 1GJCB 5F8TA 3BV9B 2C8YB 1O39A 4ZHAA 1NTPA 1TA2A 3OU0A 3URCA 1Y59T 1KDQA 5DO4H 1W8BH 2BDHA 2BDCA 2I6SA 1ESTA 1WTGH 5JBTA 3VFEA 3B8JA 1YCPK 2ZEBA 3SHCH 1GHBG 1EASA 1N6YA 3NCLA 2OCVB 1O33A 2ZU3A 1Y3YA 3E16B 2A4RA 1O2KA 1Q31A 1K21H 3M5LA 1H4WA 1LMWB 2WUBA 3HKIB 5FHTA 5DP9A 1SGRE 3QTVH 2QA9E 2VWMA 4UFFH 1MKXH 2SGQE 2VB0A 2BDAA 3BEFB 1TNJA 1D3PB 1ZSLA 2J92A 4ABGA 5C1YA 2AERH 1SGNE 1F5LA 3A7ZA 2FM2A 3A88A 3KNXA 4I31A 5HYOA 1LHEH 5DG6A 1EZUC 1IQLA 3A7XA 2Z6BD 4Y6DA 2NU4E 1QHRB 3M5OA 2ZHDA 1ZGVA 1QJ7B 4Y8YA 4FVDA 2G51A 4WMEA 2Q6FA 4BAHB 3UFAA 1UTLM 2YNBA 1AMHA 2VJ1A 1S84A 2BD8A 2AEIH 1QBVH 2HVXA 3BTTE 5E0GA 1E38B 1OP0A 3SNDA 1V2QT 1QFKH 4LK4A 4ABDA 2UWOA 2BM2A 2PSXA 4E7NA 4O3UA 4UE7H 1D6RA 4AG2A 1TABE 7ESTE 3KL6A 1K1MA 4NIVA 1GG6C 3PTBA 1SGTA 4A7IB 1KY9A 4AYYB 1GJ7B 5DP7A 1DX5M 1JIMA 3LGIA 2ZTXA 4DGJA 2TIOA 1GMHG 3SJOA 2FLBH 1PPEE 2GV6A 1SMFE 5E8EH 1O2YA 3LH1A 3M5NA 2EEKA 1P3EA 2BD2A 1EAUA 4X2YA 2ESTE 2VVUA 1EZQA 1LPGB 4OS5A 2OQUA 2BY6X 2ALVA 1BITA 5CE1A 2FTLE 3S0NA 1F0RA 1HIAB 1EATA 1ANEA 3ATWA 3MWIU 1P2NA 1HCGA 1AY6H 1EJNA 1O2PA 1G3EA 2KAIB 1RJXB 1K1LA 5C1XA 1Q3XA 2DUCA 4DW2U 5A8XA 4OS6A 3UWJH 3TJVA 1C2DA 3F9FA 3WY8A 1DWBH 1YPJH 5SGAE 3AASA 5GCHF 2ZHEH 1QB1A 1Z6JH 2CF9H 1LKAA 1CBWB 1LQDB 3Q3XA 5A0AE 5CMXH 3VB3A 1QRWA 2RA0A 3U1JB 2VWOA 1J15A 4J1YA 1SR5C 2FS9A 2WPKS 2RG3A 4I8JA 1ID5H 4X1NU 4AFSA 2ZFFH 1A0JA 1QTFA 2WYGA 4U01A 4FUJA 3TGJE 3UR9A 2BX3A 1GGDB 2FP7B 1WSSH 4ZKNU 1QL7A 2ZDAH 1HIAA 2VWNA 2FO9A 1P0SH 2Z9KA 4GSOA 4J2YB 4ZUHA 1VITF 1W10U 2Z3CA 2ODYB 1AWFH 2VIWA 1YPEH 3R0FA 1QIXB 2FOAA 1O35A 3E90B 1G30B 5LH8A 2PUXB 1YPMH 2EA3A 1IHTH 4TWWA 1A2CH 4JZEH 3F6UH 4MDSA 3DFJA 3VB6A 1C2MA 1DDJA 3FP6E 1E36B 3SNBA 3FP7E 2JH6D 3RU4T 4CHAB 1H8IH 3SJIA 4WF8A 1O2XA 3RXSA 1KLTA 4OS1A 1TOCB 2SNWA 4Q2KA 3PWCA 3SGQE 2FOBA 5DP4A 1MH0A 2O8LA 1JRSA 2CF8H 1HAIH 3AW0A 3TH2H 2RA3A 1FLEE 2FLRH 3TPIZ 4BAKB 2NU3E 2F9OA 4MNVA 4Y76A 4Y79A 1IHSH 2WPLS 4X8VH 7LPRA 3LGVA 2FYRA 3P6ZB 4DVAU 2AMDA 4WXIA 2PUQH 4ZHLU 1EX3A 2ZHQH 3RXJA 1KTTB 2ZDNA 4I32A 3QWCH 1EQ9A 1WQVH 1K22H 1UK4A 1W0YH 4LZ4B 1XUKA 1DWCH 3N7OA 1P2MA 3T25A 1EZSC 3GY4A 3ZVBA 3GDSA 1SVPA 1O3LA 3F9EA 1CBWC 5JB9S 1MKWK 2XBVA 1DXWA 1WU1A 1HAXB 3RXLA 3AAVA 1FIZA 1H1BA 3FZZA 1Y3XA 3ZV8A 1SSXA 1DXPA 3TIUA 1XXDA 2C8WB 3PMHB 3DD2H 2YOLA 1OYQA 4ISIH 1P9SA 2O9QA 2K1QA 1OWDA 3A7TA 1C2HA 2BD3A 4AB8A 5PTPA 3QZRA 4K3JA 1LVOA 2BQ7B 2O8MA 3A8AA 3LIWA 1QRXA 1GHAF 1GGDC 3V12A 2A32A 2F83A 1HBTH 1C1PA 2F9BH 3U69H 1RIWB 1HRTH 3BTGE 4ABAA 3P92A 2ZU2A 1THSH 1VJ9U 3ATMA 1BRBE 4ISHH 1G37A 1T4VH 4I8LA 3R3GB 3TK5A 1EPTC 4TY6A 1GBCA 1LPZB 2AGIX 5T6DA 5H4IB 5DP6A 1MU6B 2FOCA 5JB8S 1KTSB 4DT7B 4SGAE 4NIXA 4GLYA 3D49H 1AE5A 4TPIZ 4GCHG 2BZ6H 1YLDA 2O8UA 7GCHG 4MPXA 1P3CA 2XWBI 3MYWA 4JYTA 4CHAC 3SV6A 3AAUA 5FBEA 1CGIE 1SHHB 2PTNA 5TCCA 2PV9B 2ZFTA 3T5FH 4GUXA 2A0QB 1SGYE 3V0XA 5C20A 2QF0A 2GD4B 4DG4A 1CHOF 1O3CA 4Q80A 1NFUA 2G52A 4KTUA 2FOMB 1JXPA 1KXFA 5DK1A 1NPMA 3NZIA 5F03A 2JKHA 1O38A 1QB6A 3ZZ3A 4WMDA 4IW4E 2ZPRA 3EAJA 1AVXA 1Z8JB 3RXDA 4CH8B 4YO9A 1L1GA 4GAWA