2ZQ1A

Exploring trypsin s3 pocket
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2008-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zq1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zq1A02
2WPMS 1Z8IB 1LVOA 3ZYDA 3GISB 1SC8U 4ZKRU 1P04A 5J4QA 3HATH 2RA0A 1KIGH 1HRTH 1NO9H 5CHAC 3TNTA 2A7HA 1K1NA 3RXUA 3LOXA 1XKAC 1P06A 3GDSA 3BN9A 1J8AA 1G3CA 1J15A 1TMBH 4K2YA 1ELFA 1K1LA 1GI0A 1QFKH 4MDSA 3SV7A 3TH4H 3LDXH 1L1GA 3ATLA 1NFWA 6ESTA 2G4TA 1DXPA 2SGQE 1YLCA 4B2BA 4UD9H 1E0FD 1ZRBA 1KXEA 1HIAB 6LPRA 1DT2A 1C2JA 1JMOH 1P2MA 2PTNA 2G51A 5DJ7A 1UK3A 1YP9A 4Y71A 1O2XA 1EZSC 3M7QA 3SUDA 1TNLA 3TJOA 3SUFA 2BQ6B 5EG4A 2Z7FE 4JZFH 1P01A 1PPEE 4XBBA 1GI3A 1XX9A 1TRNA 3NKKA 2JH6D 1P57B 1ABJH 3QLPH 1AB9B 2OTVA 3R3GB 4Y11E 5EQQA 1THRH 1QJ6B 1E38B 2FOFA 4BANB 1IOEA 4A5TS 4ABBA 4Y10E 1W7GH 1GHWH 2QXIA 2G5VA 2Y6TA 5C1YA 4CBOA 5EQSA 4MQAA 1Y5AT 2BM2A 3ZV8A 1HCGA 2A2QH 1P2IA 3GCHC 1TGTA 1UTOA 4AG2A 2B8OH 1JXPA 1ZPBA 3QDZB 1PQ8A 5E0HA 3TLOA 3GY5A 1O3KA 1GVLA 1FY4A 5EXNA 2EEKA 1QQUA 3GDUA 3PB1E 1Y3YA 1BCUH 3RXCA 2AMDA 1FY1A 4K69A 4A1XA 6CHAC 3SN8A 1OP8A 1IQFA 2QYIA 1EP5A 2Z9IA 1C4Y2 1C2DA 1HJAB 2VWOA 2WPKS 1HYLA 2WPIS 2ZHWH 3KHVA 4Z6AH 4ZKSU 1ZGVA 4DG4A 7ESTE 1DWEH 2V3OH 6GCHG 1LPGB 3LGIA 1K1IA 4OS6A 4ZKOU 4WVPE 3SU5A 5LPEA 2FP7B 4D7FA 1N1LA 3SJIA 2ANMH 1O3DA 1FXYA 1LQDB 1EB1H 1F5LA 1YLDA 1Q31A 1BIOA 3UQOA 1ZHPA 2A45B 1OWIA 2FTMA 4O97A 3SORA 3AW1A 3ITIA 4NIVA 1Z8GA 1JWTA 1GI6A 1LO6A 1GJCB 1ZSLA 1C5OH 1O3GA 3VEQB 1C1SA 1MBQA 1P02A 3Q00A 1KTSB 1OWJA 5C67A 2Z3DA 1O2YA 4UONA 1O3FA 1GMHF 1Z6EA 4E7RG 4OGXA 4WWYA 3A8AA 2BXTH 1FPCH 8LPRA 2G55A 1CE5A 1C1NA 2GT8A 1TA6A 5F8XA 1J9CH 2LPRA 1FY3A 1BRCE 4WH6A 2ODPA 1ESTA 1LHFH 1TONA 3GCTG 1TLDA 1AZ8A 3VB7A 1VGCC 4E05H 3ATWA 1C1OA 3NWUA 5GWZA 1MTWA 1GCTC 2VVVA 4X8VH 4AB9A 3S7HB 1KTTB 1TYNA 1C4V2 1VJAU 1HFDA 1SQOA 3V7TA 1EJAA 3T29A 3U1IB 2A32A 3M35A 3MMGA 1H9LB 1BTPA 1O0DH 2GX4A 1CA0C 4H6SB 1DE7H 4CHAB 3QO6A 1S81A 1TB6H 2VINA 4B73A 3SW2B 1HXEH 3BIUH 2G5NA 1GBEA 1XKBC 2R2MB 1W0ZU 5LPFA 3F9HA 3MU4A 1VCPA 1NFUA 3I77A 5JBAS 1IQJA 2P94A 3A7YA 1ZTKA 2QAAA 5DPAA 1ZOMA 3K65B 3BTME 3ZV9A 5BRRE 1YCPH 3UY9A 8GCHF 3JZ2B 2ZDNA 3ODDA 5CMXH 3LGWA 1C1WH 4K5ZA 1GGDB 2V3HH 2TGAA 3VB5A 1A1RA 1ZZZA 1LCYA 1ETTH 1O2IA 1SGFA 4MNXA 1KXBA 2WV5A 5T3HA 1HDTH 2B7DH 4M7GA 1ESAA 2OC8A 1WSSH 3KIDU 1VCQA 1CT0E 4Q7XA 3E91A 1FLEE 2BD4A 5F8TA 3LJJA 3U8TH 1EAIA 1A0LA 1C2FA 1S84A 1TIOA 1O3PB 4MPUA 1TNKA 3HKJB 5G4BA 3RM2H 5DP9A 1SR5C 1O3LA 4GUXA 1W11U 1MKXH 2UWLA 4ZHLU 2J2UA 1C5XB 1Q3XA 2GD4B 1O2ZA 5A09A 1GI5A 1LPZB 1KXCA 3E90B 3SJ8A 2AGIX 4Y6DA 2PGQB 1QJ7B 3MO6A 1C2IA 1SHYA 1KLIH 1QB1A 3K2UA 2JETC 4ZKNU 4ASHA 1MH0A 3PMAB 2F83A 3VFEA 3VGCB 1EOLA 4K1SA 2GV6A 1BOQA 1O3JA 2FO9A 1V2QT 1Y3VA 2A4QA 1O30A 1UCYK 4TWWA 1BHXF 2O8UA 1AUJA 5DP8A 3ZVFA 1K1MA 1C5VA 1GMHG 2A5AA 1CT2E 3ZZ5A 1V2RT 5E0GA 1SB1H 3MNCA 4X1PU 2ZQ1A 4RKOB 4A7IB 1TGNA 4Y7BA 1GJ5H 4WMFA 1BHXB 1C5WB 2WPHS 5E0JA 3A87A 5ESTE 3U1JB 3ZZ6A 3SGAE 3U9AH 1LDTT 3SNEA 4NZQA 2R9PA 1LHEH 3RLYH 1C5UA 2ANKH 1GVKB 4YO9A 3ZVEA 1RFNA 1ZPCA 1AVWA 1S6HA 3TJVA 1GCDA 1G2LA 2ZU2A 4X0WU 5FX5A 1INCA 1SLVB 1T8NA 1C1PA 5CHAB 1DXWA 1BQYA 1UHBB 4D8NA 1NPMA 4UFDH 1K22H 3M5LA 3ATIA 4WXIA 3VB6A 2Z6BD 2EA3A 5FHTA 2C4FH 2I6SA 4Y0ZE 4D7GA 3ZVAA 1AUTC 1VITG 2J94A 2P16A 2Q1JA 4X6OA 3OYPA 1F0SA 1QR3E 2A5KA 4KTSA 1OPHB 4YLQH 3V13A 2PFEA 1S82A 2FI3E 4NSYA 2BDIA 1UTNA 3QGJA 8GCHG 1TOMH 1DY9A 1TE0A 4DY7B 1AU8A 3S0NA 1DSUA 2VB0A 3F9GA 1T8LA 3SU1A 3ZVBA 1TPAE 3MTYA 4BXSA 1YPJH 3RXHA 2CV3A 1LTOA 1AE5A 3IG6B 3EA9A 3RMLH 2DE9A 3SU6A 3PWCA 5T6FA 2XXLA 1XXDA 3BTFE 4FU8A 4ISOA 2R3YA 5K7RA 3FZDA 1C1RA 3KEEA 1ELCA 1BTWA 1MAYA 3RXAA 2ZPQA 1K1JA 3UQVA 2UUJB 3EE0B 2RG3A 5JBBS 5L6NH 4IMQA 2ILNA 1AKSA 2BY9X 1T7CA 2VGCC 1MQ6A 1LPKB 1SGCA 1TX6A 1UCYE 3SJOA 3M36A 4AYYB 1HGTH 3ZVGA 1PPFE 3GCHB 3KQCA 4UEHH 4GAWA 1MUEB 4BNRA 2ZGHA 1A3BH 1EKBB 1AWFH 2VWMA 4XSKU 1HBTH 1QRXA 2OUAA 2QY0B 4IC5A 3QX5H 2EI7A 3TGKE 2ZCHP 4IW4E 4WXVA 4IN2A 6CHAB 1ARBA 3RLWH 1RTKA 2EI6A 1SGQE 4B74A 1MTUA 5K0HA 2WYJA 3MU0A 5F03A 2YNBA 3T27A 1XVOA 4FU7A 3LIWA 1CBWC 3FFGA 5C5NA 2ZU5A 4FUCA 1CSOE 1E37B 1C4U2 1TNIA 1C2LA 3A7WA 3F6UH 3MOCA 1K1PA 4NWLA 5HM2A 1V6DA 5DP3A 1ZSKA 3T2NA 1RD3B 3A83A 1O3EA 1UMAH 1MTSA 1L4DA 2FYQA 2ZDKA 1CA8B 3PLPA 1GI7B 1V2NT 2C8WB 4OGYA 1QRZA 1S0RA 1GJ9B 1YF4A 1K2I1 4JK5A 3PTNA 1BJUA 2QF0A 4VGCC 4D76A 2ESTE 1ANEA 3GY2A 1RRKA 3SJ9A 1QIXB 1TQ7B 3P8NA 2W7SA 2ZF0H 1GBJA 3H5CB 2ZFPH 2PV9B 5EXMA 1VGCB 3A89A 1OWKA 4J2YB 4DVAU 3A7TA 4I31A 1UK4A 2ZI2H 1ZPZA 5EQRA 1DM4B 2UWPA 1YPEH 1TRMA 1VCWA 4X1SU 3PM3A 2FTLE 3LKWA 3SU0A 1WQVH 4TY6A 4UFEH 1CA0B 2SNVA 4OS2A 1VZQH 2Z9KA 3RXPA 1FY5A 1DS2E 4O9VA 4OS1A 3OY6U 3RM0H 4D9RA 3A8CA 1TPPA 3NK8A 2FXRA 1QNJA 4U01A 1C1QA 4BAHB 1IQKA 3BTTE 1P3CA 1S5SA 1ZLRA 6GCHF 1TOCB 1W7XH 3FAOA 1V2ST 2CGAA 4Y8ZA 2OINA 2Q6FA 1CT4E 3GY4A 1O3NA 3MH5A 2V6NA 2UUYA 3P17H 3T26A 1MCVA 1KXAA 1Y3WA 1TGCA 3CS7A 1SG8B 1F0RA 2F9BH 3S9AA 2GKVE 1HAYB 2FMJA 1SVPA 4AN7A 2QA9E 1MBMA 1OYQA 1P2KA 1F7ZA 3KGPA 1SOZA 3H7TA 2ZCKP 1ACBE 1AFQB 2FOMB 4MNYA 5ABWA 1D3QB 3PROA 2QXHA 1BMAA 3MYWA 2F9NA 4YM9A 1D6RA 2FZZA 1AKSB 1OWHA 1O3HA 1NRQH 4QT8C 1ZTJA 3A7VA 5HYOA 1W10U 1TNJA 2FODA 1IQEA 1MZAA 4RKJB 2D26C 4HFPB 4K3JA 1O2QA 4X8SH 2XW9A 2J4IA 3GCTF 3RXTA 1HV7A 5H4IB 1TMUH 1FI8A 3DFJA 1C5SA 1VITH 1Y8TA 3E0PB 2XBWA 3E1XB 1QURH 2OD3B 3MU5A 3P70B 1OS8A 2WUCA 4LK4A 3ZZBA 4K1EA 2ZCLP 3GOVB 1MMJN 1O5EH 3I29A 1WTGH 2F3CE 1EQ9A 1O34A 3NCLA 4R0IA 2FEQH 5LH8A 2ZFTA 7LPRA 3ATKA 1F5KU 1BMLA 1H9IE 3NUMA 1GBHA 1EP6A 1V2KT 2UUFB 2ZGJA 3RXDA 3IWMA 4U2WA 2OQ5A 1HPGA 1EAXA 2JETB 5A0CA 5JYIA 2Y5GA 4I8LA 1P2JA 1IQIA 5C2ZA 4OS4A 2OQUA 5I25A 3A86A 4WJG2 3S9BA 5JDUB 2GDEH 4NIYA 4I8GA 3CS0A 1KY9A 5JB8S 4IGDA 5DO4H 3KF2A 1M9UA 1C5NH 3EAJA 1CHOG 1RTFB 7GCHG 1UTPA 2D8WA 2B9LA 2PKSC 2ZO3H 5GJ4B 2QXJA 1O38A 1L0ZA 2HLCA 1GBAA 1TGSZ 2TGDA 5FAHA 2J9NA 5DG6A 2ZDMA 1C2EA 1O31A 3WY8A 4X8UH 1DFPA 4X2YA 3EA8A 1L1NA 5TCAA 1PYTC 1L4ZA 2CJIA 3O8RA 3MU1A 1GJ8B 4ABFA 3AASA 1PPBH 3MH4A 3SV6A 1AHTH 1H8IH 3URDA 2ZFSA 1KDQA 3SUGA 3EYDA 3SHCH 1BTYA 1HJ8A 5PTPA 1C2MA 3QK1A 3A8DA 2H5DA 3BTGE 5DP7A 3VPKA 1NN6A 1NFXA 1BITA 2BDYA 7KMEH 5J4SA 2G52A 1CU1A 3P95A 3LGUA 2A2XH 3MWIU 3M5MA 4TYDA 4ABHA 3TIUA 4XBDA 5GPIB 2RDLA 3ZZ9A 1Y3UA 2BDGA 3RXVA 1C5YB 3T62A 3RU4E 2AMPA 2IN2A 1EJMA 3SJKA 4A1VA 3FP8E 1V2VT 2C8ZB 2VWLA 1GPZA 5E8EH 4BTIB 4U32A 2A0QB 2TIOA 5AVDA 2ZU4A 4NZLA 1ABIH 1BRAA 3H7OA 2Y81A 3UNSA 4ZMAH 1UTLM 2CF9H 4A6LA 4LZ1H 5FX6A 3SQHE 1ETSH 1P3EA 1BRUP 1QJ1B 1KSNA 1ZMNA 2UWOA 2ODYB 4JZEH 3RMMH 3ZZAA 1QGFA 3F9FA 3UNRA 1WOFA 1HUTH 3SBKA 3M7TA 3Q3KA 1CGHA 2P93A 2R3UA 3MI4A 4IBLH 2A5IA 5GIBA 3VXEH 1BTUA 2ZGXH 4NGAH 2OC1A 3F1SB 3SNDA 1O2SA 1X7AC 1NT1A 1V2JT 2ZIQH 1N8OC 1OOKB 2H9TH 1QL9A 3KQEA 3GCOA 2NU0E 1HAXB 8ESTE 4YTAA 2VGCB 1RS0A 1NROH 3PLKA 4YZUA 2PKAA 1ORFA 4F49A 1EAWA 1UHBA 1ZTLA 2YNAA 4FUFA 3U69H 2Y82A 2OC7A 3E6PH 3LH1A 1UCYH 3T5FH 1IQNA 1NRPH 3B8JA 1PQAA 1VITF 4FUGA 5F8ZA 3ODFA 1LVMA 3OU0A 1P10A 5A2MH 2HOBA 1P0SH 1O2MA 1ANBA 1JRTA 1SFQB 2AIPA 1EB2A 2FOCA 2VH0A 4JZ1A 5EGMA 1AD8H 3PV4A 3HK6B 3EA7A 3PMHB 3RXKA 3A81A 1UVUH 1H4WA 4MNWA 1CBWB 1LHDH 1UTQA 3F68H 5HM9A 4TWYA 4DW2U 3MO3A 1ZMLA 1GBKA 1GVZA 1K9OE 2FOBA 4X1NU 1BMMH 1HAVA 1HAOH 3LH3A 1GHZA 3RXLA 3A85A 2CF8H 3SUEA 2W7UA 1O36A 2GGVB 1UTKA 1O5AB 4NFEA 1WU1A 3ELAH 1RGQA 1GDUA 1KDQB 2PGBB 3RXQA 3BG4B 3TGJE 1TALA 1G3EA 1DICA 1PQ7A 4VGCB 1SGRE 4X6PA 3ZZDA 4HTCH 1O5CB 2ANWA 1O2KA 1RTLA 3KNXA 3PWBA 3BEIB 4NCYA 2PHBA 1ELDE 2V35A 2FIRH 2GVFA 4B2AA 1HAIH 4NWKA 4BAQB 5C1UA 2PTCE 1FQ3A 1FUJA 1BJVA 1AQ7A 3DFLA 2GCTC 5EW1H 1G37A 5ETXA 1P9SA 4LZ4B 1T4VH 2F9VA 5DP6A 1ELBA 1G9IE 1GBTA 1O2VA 3ATMA 4O03A 1QQ4A 1A0JA 1QCPA 2TBSA 1HNEE 3RMNH 3RU4D 1ESBA 1A0HB 2XC4A 2GZ8A 3ZZ7A 1LHGH 1C5RA 1AIXH 3FVFB 1C1VH 4CRAA 4Q2KA 1AZZA 1EOJA 3LT3A 1MD7A 1LQEA 2CMYA 1Z8JB 4K1TA 1OWEA 1P8VC 1TBRH 4LOYH 1FAXA 4UFFH 5C20A 1OP2A 1GJ4H 1IQGA 1P2OA 1EUFA 3HKIB 1H9HE 4FXGH 1GBLA 1D3DB 1XVMA 2WYGA 1DVAH 1NTPA 1O35A 1J16A 3UR6A 4CRBA 1FZZA 1MTNC 1DY8A 2P95A 3BV9B 3FANA 5JPMH 2BLQA 3L33A 1AB9C 4ISNA 3U8RH 3M61U 1V2OT 1O2HA 3M37A 3D49H 1W8BH 2AIQA 2GTBA 4YT6H 1SGTA 4Y8XA 1ELGA 2OCVB 2BZ6H 2BY5X 2TGTA 3UUZA 4AX9H 2XBYA 1V2MT 4HGCA 2IJOB 1JOUB 1O5FH 4OS7A 3JZ1B 2VIPA 1EASA 2PKAB 3A7XA 3GY7A 2OXSA 1IHTH 1CGIE 1XUFA 3W94A 5L2YH 2A4RA 4I32A 2FM2A 2ZEBA 3VXFH 3M5NA 1O3IA 4JYUH 1GBCA 4K8BA 3PO1C 3SO3A 1NM6A 1NY22 1QA7A 1SFIA 1FN8A 1L2EA 2ZHEH 5TCCA 4WMDA 3N7OA 3A7ZA 4FUHA 1PPCE 2A31A 1WQSA 2P3TB 4JMYA 2BX4A 2ZKSA 3SV2H 1DUEA 4CR9A 1V2UT 5CE1A 3HK3B 2STBE 1A5IA 1FONA 1C5LH 4AFUA 1V2PT 2TPIZ 1A46H 4ABAA 1SGPE 3PTBA 4JYVH 3GCNA 3RXSA 3HGPA 2QC2A 4CH2B 5C5OA 5E2OA 1GJDB 1KXFA 1LKBA 4INKA 5AF9H 2BX3A 2WV4A 5A0BA 1HAVB 3LC3A 1TFXA 1Y5UT 2PUQH 2GDDA 4BXWA 1B5GH 1W0YH 1AN1E 2GT7A 2A4OA 2FLBH 2VIQA 3TK5A 2CHAC 3DUXH 5IYTA 4PROA 1NC6A 2BOHB 4H4FA 1GHXH 4TY7A 1AE8H 3QTOH 1BTXA 1P12E 1Q2WA 2P8OC 2Y7ZA 2BY8X 5AHGH 1GJBB 1G3DA 2ZU3A 2PSYA 1EZQA 2BY6X 2C90B 1LMWB 3B9FH 2PKSB 4ZAEA 3D65E 3TGIE 2J92A 1O2OA 2FS9A 1G2MA 1QA0A 2VJ1A 3EQ0H 4GCHF 4UFGH 2Z9LA 3M3SA 1HAPH 3ZYEA 5FCRA 2AERH 1J17T 4ABGA 1GI8B 4BAOB 1A7SA 4WH8A 3UREA 1TAWA 3MH6A 1EPTC 1FPHH 1F2SE 1SMFE 3BIVH 1TPSA 1SI5H 1F0TA 3QWCH 1MAXA 3U98H 3LU9B 3A8BA 1GI9B 3TK6A 1CQQA 1O2UA 3ZZ8A 2BZAA 1SPJA 2O8TA 1C5QA 4NSVA 3Q3YA 2BD8A 1SOTA 1N6XA 1AWHB 2VU8E 4ABIA 1MKWK 1C9PA 1EAUA 2SFAA 1MQ5A 4X2WA 2TRMA 1QL8A 2BLVA 1C5ZB 4DIIH 1GJ6A 3SGBE 1TGBA 1OX1A 2G81E 2C8YB 1YM0A 3SNBA 1D3TB 1CHOF 7GCHF 1ZR0A 1T8OA 2PUXB 2Z3EA 3BG8A 3M3VA 1XM1A 1TX7A 1YPKH 2THFB 2BB4A 3UOUA 3RXGA 2G8TA 4ABDA 3M5OA 3E0NB 5DP4A 1DPOA 2ZWLH 3OSYA 2BOKA 1C2KA 3D62A 4AOQA 1ZRKA 1CHGA 4YLUA 1GCTB 2Z9JA 1BTHH 1ELEE 2QXGA 3BF6H 1E35B 4ISHH 3URCA 3S9CA 3E8LA 1N8OB 2XYAA 3QZRA 4MLFB 3STJA 1G30B 3SU2A 2PWXA 1Z6JH 2SGEE 3K9XB 5FPSA 4BTTB 5ESBA 1DLKB 1FMGA 2O9QA 2PLXA 2ZDLA 4X1QU 1K1OA 1NU7B 3RUOA 1YKTA 3QZQA 1EX3A 3ESTA 2Y80A 1EZUC 1FV9A 1T8MA 2ASUB 1P9UA 3QN7A 4I8HA 2SGFE 1RIWC 3L3TA 2NU4E 2QN5T 4ZROA 2O8LA 1DWDH 3BSQA 2J38A 1Y5BT 2QIQA 3RXFA 4HZHA 4X6NA 2AH4X 4E7NA 2HNTC 3DT0H 4MVNA 4YESB 1IQHA 1SBWA 4WF8A 4X8TH 2A7CA 4SGBE 2ZA5A 1SHHB 1W3CA 4AZ2B 4KTCA 1ELTA 1SGNE 4DOQA 1C5TA 3RC5A 5E2PA 1MCTA 1G32B 4WY3A 4YOJA 1FAKH 4BAKB 1YCPM 2ZECA 1GJ7B 3QUMP 1YPHE 3UTUH 1P11E 2H9HA 4K8YA 1O3MA 4GCHG 5AFYH 3Q3XA 4J1YA 4AFSA 3BTEE 3RXIA 3UR9A 1NU9A 1Z7KA 1JIRA 2ZHFH 1TA2A 3O8DA 4AGJA 2Z9GA 3MU8A 3SV8A 4AGKA 1ANDA 2ZPRA 4JK6A 2KAIB 3TITA 4LXBH 5EW2H 1O3OA 3MNBA 5EPNA 4ZHMU 1OKXA 1V2TT 1PYTD 1AI8H 4Q7YA 3AVZA 2H2ZA 1GI1A 3VB3A 1F0UA 2FI5E 3BTDE 1G36A 1S83A 1IQMA 2HRVA 4JZIA 3UOPA 3BTQE 2GCTB 1ZHRA 1O3BA 4XE4A 1HLTH 2UUKB 4DGJA 2C93B 3BTWE 1C1MA 1AFEH 2ZQ2A 1OSSA 3PLBA 2YOLA 4NA9H 1EPTA 4UDWH 4H42U 1DSTA 4RSPA 2XWAA 2Y7XA 1YPGH 1GHYH 2ZHQH 4UE7H 1FIZA 4B71A 3IITA 4ISLA 2AS9A 2ZTYA 1PPHE 1SGEE 2W5EA 1GMCF 4KP0A 3QGNB 3V3MA 2XCNA 2FYRA 4AFZA 1GHVH 4ABEA 2H6MA 2RA3A 1O2RA 9LPRA 1TNHA 1BUIA 1DDJA 1MTNB 4CRCA 4NA7A 2QF3A 3B23B 1FJSA 1GBMA 1O33A 2QCYA 3E3TA 2ODQA 5EU8A 2ZGBH 3OTJE 1S0QA 1THPB 3TNSA 4XBCA 3MHWU 1CO7E 2DE8A 2HALA 3RP2A 4K60A 5A0AE 5A8XA 3RXBA 1V3XA 1GWAA 4DURA 2TGPZ 4MPXA 1GBFA 1O2GH 1ETRH 4NIXA 1YYY1 1QBVH 4KTUA 4NG9H 5HXFA 4KKDA 2FI4E 4SGAE 2XCFA 4GLYA 2CXVA 2HPQH 3PO1B 4O3TA 2OLGA 1GG6C 3PMJA 3P6ZB 2NU2E 1EJNA 1UVPA 2P59A 4THNH 2VIOA 2Q6GA 1E36B 2SNWA 1ARCA 3FP7E 5C3NA 3O8CA 1ELVA 2XBXA 3LONA 1JBUH 1UK2A 1BBRH 2VVCA 3BEFB 4RN6A 4Y79A 1HAGE 3GY3A 2XC5A 2Z94A 2ZGCA 3RXOA 5T6DA 2AGEX 5EXLA 1T31A 5DK1A 1YPLH 2ZDVH 1UTJA 2ZFQH 3AAVA 3UNQA 2BVRH 2A7JA 1NESE 3SU3A 3U8OH 3MH7A 1UVSH 1C2HA 1DOJA 2SGAA 1BMNH 1G3BA 2BDHA 2JH5D 5EPYA 2J34A 3TU7H 4DIHH 1ELAA 2HGTH 2VIDA 3GY8A 2R0KA 2B0FA 5GCHG 3ZZCA 1H1BA 1ANCA 1PFXC 3KN2A 2F91A 1TMTH 1GHAG 1BTZA 3MNXA 4JYTA 3C1KA 3LJOA 2CHAB 1ZSJA 3T25A 4HI3A 1GMDF 4JCNA 1TRYA 2P8OB 3STIA 4MG3A 1D3PB 2CN0H 1BB0B 2Z3CA 3E16B 4INLA 3KQDA 1UO6A 3MO9A 2P3FH 1GHBF 2M5TA 1EZXC 4A92A 1ZMJA 1GBIA 1ZHMA 2XTTB 1TBQH 2XRCA 1WYKA 2V0BA 1PJPA 3GYMA 3DA9B 2OBQA 3A82A 4GHTA 1GBBA 1Z8RA 1Y3XA 1A4WH 1ZGIA 4XFQA 2G4UA 1IAUA 5IDKA 4NIWA 4FVDA 1D4PB 2BYAX 1WAYB 2GMTC 3P8GA 3V12A 1Z71A 1YGCH 5L2ZH 1EPTB 3RXJA 2ZC9H 4TPYA 3EGKH 1XMNB 5FBIA 1D6WA 1P2QA 1O2JA 1SL3A 3UWJH 1NS3A 2JH0D 2QGRA 2PR3A 1TQ0B 1QBNA 2NU1E 1QRWA 4CREA 4H6TA 1SLWB 1T32A 3BTKE 4NFFA 1SGDE 4I7YH 3L6PA 4JZDH 1O5DH 3F9EA 2XNIA 1YPHC 2NU3E 1C5MD 2H1UA 1GMCG 3SZNA 1XUKA 1JRSA 1O2TA 1ZJDA 3RDZA 2BHGA 5A8ZA 3S69A 4I33A 5EOKA 1O32A 1GDNA 1KLJH 1BBRK 1O2LA 1OXGA 1U6QA 4X6MA 3TJNA 1UVTH 2F9OA 1IQLA 2R2WU 2G00A 2J95A 3SU4A 2WINI 2PW8H 2AGGX 4IC6A 1NZQH 1AFQC 1OWDA 3QTVH 1UTMA 2BDBA 3BEUA 2A4GA 3ENSB 5FPYA 2A1DB 2BD3A 3LGYA 1QBOA 3RXMA 3GICB 1Z1JA 1O39A 1AVXA 1NFYA 2XC0A 4E06H 1AMHA 1Y59T 3UPEA 1GDQA 3K6ZA 1GJAB 1A5GH 3SI4H 5AFZH 4MTBA 3C27B 2Y5FA 1DUAA 3KL6A 1QTFA 1MTVA 1O2WA 2W3KA 2ZU1A 3RXEA 2IPHA 4ZXXH 4DT7B 4ZUHA 3S7KB 4ZXYH 3FP6E 1O3CA 1XUHA 5FBEA 2ZHDA 1PQ5A 3P92A 1GI2A 1IHSH 5HMAA 3Q76A 4DCDA 2VIWA 2ZP0H 1EATA 8KME2 1XUJA 1TPOA 4GSOA 1HAZB 2VWNA 2EI8A 4I8JA 1AVGH 4MPVA 4MPWA 1GL0E 4BOHA 2BMGB 2HNTF 2WPLS 1UVOA 3PYHA 1NRRH 5SGAE 2BVXH 1RIWB 2FLRH 2HWLB 1A3EH 3UWIA 1C1TA 2FOEA 1D9IA 2WPJS 1HJ9A 1C1UH 1T4UH 2VNTA 1NRNH 4GPGA 2BVSH 1NRSH 2C3SA 4B75A 5HGGA 1V2WT 2FOAA 2FESH 2O8MA 2SGDE 4FUJA 1CGJE 1C2GA 3TVJB 4INHA 2BD9A 3P8FA 4FUEA 3EDXB 1B0FA 1JIMA 1GMDG 1WCZA 3TK9A 4AB8A 1BA8B 2BLOA 1DWCH 4FVBA 1RJXB 1O2PA 4AYVB 3KQBA 1YCPK 2HNTE 4WMEA 1GHBG 2Y5HA 2GCHF 2ZZUH 5DP5A 1XUGA 4MNVA 3UFAA 1O3AA 1SLXB 1BRBE 3V0XA 1OYTH 2FOHA 1SQTA 2FX6A 1WTHD 4Q7ZA 1Z1IA 1GBDA 4AORA 3SQEE 4F4OC 4CRFA 2AMQA 1QY6A 1OP0A 3K6YA 4KELA 3DD2H 2F9PA 2ZFRH 2DUCA 3KCGH 1KYNA 4CRDA 4NA8A 2PSXA 4XDEA 5B6OA 2HVXA 4YT7H 2GZ7A 1BBRE 2ZPSA 1W12U 1PPGE 1QL7A 2I6QA 2FPZA 4BTUB 1AGJA 4B76A 1MD8A 3TPIZ 1P03A 1MKWH 5FCKA 5GDSH 3HGNA 4IS5A 1HJAC 2ZDAH 2D2DA 4ESTE 3LC5A 1YC0A 1DANH 1MKXK 4BAMB 5LPRA 1LVYA 2BXUH 1O37A 3MFJA 2P3UB 2ULLA 1FNIA 4CBNA 1QHRB 3G01A 1YBWA 3NXPA 5L30H 2JKHA 4B2CA 1DLEA 3R0FA 2H9EH 3LGTA 1FY8E 3TJUA 3CENA 3OX7U 1C5PA 4TPIZ 1N6YA 1FN6A 3BTHE 4YOGA 2AFQB 4I8KA 1QB6A 1GI4A 1FDPA 2FDAA 4Y7AA 1ZYOA 2GV7A 2NWNA 3ZVCA 1MU6B 3RC4A 1KXDA 1W2KH 3HPTB 5A8YA 1XXFA 5DGJA 2HPPH 5BPEA 2ZTXA 3SNAA 1P05A 3SV9A 5EODA 5JBTA 2O8WA 2C8XB 1E34B 1L1JA 2FWWA 1LVBA 2BDCA 3A84A 4ZH8A 1PPZA 4DJZB 1O2NA 4Z0KA 5JBCS 4ISIH 1AO5A 2BY7X 1HB0B 2BD5A 1ZJKA 4CR5A 3I78A 2BLWA 4CRGA 4XOJA 4CH8B 2GZ9A 1DWBH 2AEIH 2FS8A 3M7UA 4Y8YA 1RXPA 2KAIA 1K21H 2ANYA 4CHAC 1W14U 1O5GH 5GXPA 3VB4A 2GP9B 1AY6H 3RXRA 1WV7H 1J14A 3D23A 1TX8A 1KLTA 2ALPA 2STAE 1K28D 1GG6B 3LPRA 9ESTA 4ZHAA 1P2NA 4X2VA 2H5CA 2Q6DA 4KGAA 1GL1A 1CVWH 1DX5M 1WUNH 1BT7A 3RU4T 1SLUB 1LHCH 2OBOA 1HIAA 2AYWA 1GGDC 4GHQA 4U30A 1P09A 2XWBI 3ZVDA 1A5HA 1S85A 3T28A 2BTCE 3FZZA 1H8DH 3ZZ3A 5LGOA 1HXFH 3GDVA 4A1TA 5I46H 2ALVA 3GY6A 3W95A 2W26A 2GCHG 3Q77A 2ZTZA 3RC6A 1F5RA 4R8TB 2K1QA 5TJXA 3LGVA 2D1JA 1LKAA 3UIRA 2OP9A 1UJ1A 1C9TA 2VVUA 2EC9H 1HAHH 2OC0A 1EXFA 1TWXB 2W3IA 3CP7A 4Y0YE 1MU8B 1B7XB 1TBZH 4Y76A 3OY5U 4GVUA 1F92A 1FIWA 1SQAA 1WBGB 2QV1A 1XUIA 4O3UA 3BG4C 2BQWB 3NPSA 3TH3H 5FXLA 4YOIA 1BZXE 3O8BA 5F6MA 1W13U 3AAUA 4D9QA 1A2CH 1VR1H 4IMZA 1THSH 2VH6A 1BDAA 2LNCA 2F9UA 3NZIA 2R0LA 5DKMA 1SSXA 1TABE 3RMOH 2SGPE 4AFQA 1ID5H 3DHKH 4IN1A 4FUBA 1MZDA 1S6FA 2BQ7B 3SHAH 3GYLB 3SOSA 1V2LT 2GMTB 2IOTA 5FPTA 4B1TA 5C1XA 1SGFG 1VJ9U 3SGQE 1B0EA 4FUDA 3ZZ4A 2ZNKH 4OS5A 4ABJA 2B5TB 3SNCA 4FUIA 5JB9S 1YPMH 3VGCC 2BD2A 4AG1A 3MNSA 1A61H 4X2XA 2XBVA 3M3TA 2ZG0H 3TH2H 1O5BB 3AW0A 2VIVA 2BD7A 4FU9A 1SGIB 2FOGA 3SI3H 2RCEA 2BDAA 2WUBA 3P8OA 1DITH 1TNGA 2FX4A 5T6GA 1QB9A 2ZFFH 3PMBB 3A80A 3A88A 1SGYE 5GCHF 4Q80A 4X1RU 1GHAF
chains in the Genus database with same CATH superfamily
2WPMS 1Z8IB 1LVOA 3ZYDA 3GISB 1SC8U 4ZKRU 2J5UA 1W0KD 1P04A 5J4QA 3HATH 2RA0A 1KIGH 1HRTH 1NO9H 5CHAC 3TNTA 2A7HA 1K1NA 3RXUA 3LOXA 1XKAC 1W0JD 1P06A 3GDSA 3BN9A 1J8AA 1G3CA 1J15A 1TMBH 4K2YA 1ELFA 1K1LA 1GI0A 1QFKH 4MDSA 3SV7A 3TH4H 3LDXH 1L1GA 3ATLA 1NFWA 6ESTA 2G4TA 1DXPA 2SGQE 1YLCA 2KCOA 4B2BA 4UD9H 1E0FD 1ZRBA 1KXEA 1HIAB 6LPRA 1DT2A 1C2JA 1JMOH 1P2MA 2PTNA 3U28C 2G51A 5DJ7A 1UK3A 1YP9A 4Y71A 1O2XA 2KM0A 1EZSC 3M7QA 3UAIC 3SUDA 1TNLA 3TJOA 3SUFA 2BQ6B 5EG4A 2Z7FE 4JZFH 1P01A 1PPEE 4XBBA 1GI3A 1XX9A 1TRNA 3NKKA 2JH6D 1P57B 1ABJH 3QLPH 1AB9B 2OTVA 3R3GB 4Y11E 5EQQA 1THRH 1QJ6B 1E38B 2FOFA 4BANB 1IOEA 4A5TS 4ABBA 4Y10E 1W7GH 1GHWH 2QXIA 2G5VA 2Y6TA 5C1YA 4CBOA 5EQSA 4MQAA 1Y5AT 2BM2A 3ZV8A 1HCGA 2A2QH 3UB0A 1P2IA 3GCHC 1TGTA 1UTOA 4AG2A 2B8OH 1JXPA 1ZPBA 3QDZB 1PQ8A 5E0HA 3TLOA 3GY5A 1O3KA 1GVLA 1FY4A 5EXNA 2EEKA 1QQUA 3GDUA 3PB1E 1Y3YA 1BCUH 3RXCA 2AMDA 1FY1A 4K69A 4A1XA 6CHAC 3SN8A 1OP8A 1IQFA 2QYIA 1EP5A 2Z9IA 1C4Y2 1C2DA 5C0UA 1HJAB 2VWOA 2WPKS 1HYLA 2WPIS 2ZHWH 3KHVA 4Z6AH 4ZKSU 1ZGVA 4DG4A 7ESTE 1DWEH 2V3OH 6GCHG 1LPGB 3LGIA 1K1IA 4OS6A 4ZKOU 4WVPE 3SU5A 5LPEA 2FP7B 4D7FA 1N1LA 3SJIA 2ANMH 1O3DA 1FXYA 1LQDB 1EB1H 1F5LA 1YLDA 1Q31A 1BIOA 3UQOA 1ZHPA 2A45B 1OWIA 2FTMA 4O97A 3SORA 3AW1A 3ITIA 4NIVA 1Z8GA 1JWTA 1GI6A 1LO6A 1GJCB 1ZSLA 2F4LA 2JJ2D 1C5OH 1O3GA 3VEQB 1C1SA 1MBQA 1P02A 3Q00A 1KTSB 1OWJA 5C67A 2Z3DA 1O2YA 3OTPA 3OAAD 4UONA 1O3FA 1GMHF 1Z6EA 4E7RG 1SQRA 4OGXA 4WWYA 3A8AA 2BXTH 1FPCH 8LPRA 2G55A 1CE5A 1C1NA 2GT8A 1TA6A 5F8XA 4Q63A 2QF4A 1J9CH 2LPRA 1FY3A 1BRCE 4WH6A 2ODPA 2WPDD 1ESTA 1LHFH 1TONA 3GCTG 1TLDA 1AZ8A 3VB7A 1VGCC 4E05H 3ATWA 1C1OA 3NWUA 5GWZA 1MTWA 1GCTC 2VVVA 4X8VH 4AB9A 3S7HB 1KTTB 1TYNA 1C4V2 1VJAU 1HFDA 1SQOA 3V7TA 1EJAA 3T29A 3U1IB 2A32A 3M35A 3MMGA 1H9LB 1BTPA 1O0DH 2GX4A 1CA0C 4H6SB 1DE7H 4CHAB 3QO6A 1S81A 1TB6H 2VINA 4B73A 3SW2B 1HXEH 3BIUH 2G5NA 1GBEA 1XKBC 2R2MB 1W0ZU 5LPFA 3F9HA 3MU4A 1VCPA 4ZCNA 1NFUA 3I77A 5JBAS 1IQJA 2P94A 3A7YA 1ZTKA 2QAAA 5DPAA 1ZOMA 3N99A 4RT1A 3K65B 3BTME 3ZV9A 5BRRE 1YCPH 3UY9A 8GCHF 3JZ2B 2ZDNA 3ODDA 5CMXH 3LGWA 1C1WH 4K5ZA 1GGDB 2V3HH 2EQNA 2TGAA 3VB5A 1A1RA 1ZZZA 1LCYA 1ETTH 1O2IA 2JJ1D 1SGFA 4MNXA 1KXBA 2WV5A 5T3HA 1HDTH 2B7DH 4M7GA 1ESAA 2OC8A 1WSSH 3KIDU 1VCQA 1CT0E 4Q7XA 3E91A 1FLEE 2BD4A 5F8TA 3LJJA 3U8TH 1EAIA 5EJLA 1A0LA 1C2FA 1S84A 1TIOA 1O3PB 4MPUA 1TNKA 3HKJB 5G4BA 3RM2H 5DP9A 1SR5C 1O3LA 4GUXA 1W11U 1MKXH 2UWLA 4ZHLU 2J2UA 1C5XB 1Q3XA 2GD4B 1O2ZA 5A09A 1GI5A 1LPZB 2GJGA 1KXCA 3E90B 3SJ8A 2AGIX 4Y6DA 2PGQB 3F2GA 3OFND 1QJ7B 3MO6A 1C2IA 1SHYA 1KLIH 1QB1A 3K2UA 2JETC 4ZKNU 4ASHA 1MH0A 3PMAB 2F83A 5T1VA 3VFEA 3VGCB 1EOLA 4K1SA 2GV6A 1BOQA 1O3JA 2FO9A 1V2QT 1Y3VA 2A4QA 1O30A 1UCYK 4TWWA 1BHXF 2O8UA 1AUJA 5DP8A 3ZVFA 1K1MA 1C5VA 1GMHG 2A5AA 3KYFA 1CT2E 3ZZ5A 1V2RT 5E0GA 1SB1H 3MNCA 4X1PU 2ZQ1A 4RKOB 4A7IB 1TGNA 4Y7BA 1GJ5H 4WMFA 1BHXB 1C5WB 2WPHS 5E0JA 3A87A 5ESTE 3U1JB 3ZZ6A 3SGAE 3U9AH 1LDTT 3SNEA 4DT4A 4NZQA 2R9PA 1LHEH 3RLYH 1C5UA 2ANKH 1GVKB 4YO9A 3ZVEA 1RFNA 1ZPCA 1AVWA 1S6HA 3TJVA 1GCDA 1G2LA 2ZU2A 4X0WU 5FX5A 1INCA 1SLVB 1T8NA 1C1PA 5CHAB 1DXWA 3PV5A 1QZ8A 1BQYA 1UHBB 4D8NA 1NPMA 4UFDH 1K22H 3M5LA 3ATIA 4WXIA 3VB6A 1H8ED 2Z6BD 2EA3A 5FHTA 2C4FH 2I6SA 4Y0ZE 4D7GA 3ZVAA 1AUTC 1VITG 2J94A 2P16A 2Q1JA 4X6OA 3OYPA 1F0SA 1QR3E 2A5KA 4KTSA 1OPHB 4YLQH 3V13A 2OK5A 2PFEA 1S82A 2FI3E 4NSYA 2BDIA 1UTNA 3QGJA 8GCHG 1TOMH 1DY9A 1TE0A 4P00A 4DY7B 1AU8A 3S0NA 1DSUA 2VB0A 3F9GA 1T8LA 3SU1A 3ZVBA 3F2HA 1TPAE 3MTYA 4BXSA 1YPJH 3RXHA 2CV3A 1LTOA 1AE5A 3IG6B 3EA9A 3RMLH 2DE9A 2EY4C 3PWCA 3SU6A 5T6FA 2XXLA 1XXDA 3BTFE 4FU8A 4ISOA 2R3YA 5K7RA 3FZDA 1C1RA 3KEEA 1ELCA 1BTWA 1MAYA 5DN6D 3RXAA 2ZPQA 1K1JA 3F0PA 3UQVA 2UUJB 3EE0B 2RG3A 5JBBS 5L6NH 4IMQA 2ILNA 1AKSA 2BY9X 1T7CA 2VGCC 1MQ6A 1LPKB 1SGCA 1TX6A 1UCYE 3SJOA 3M36A 4AYYB 1HGTH 3ZVGA 1PPFE 3GCHB 3KQCA 4UEHH 4GAWA 1MUEB 4BNRA 2ZGHA 3SYJA 1A3BH 1EKBB 1AWFH 2VWMA 4XSKU 1HBTH 1QRXA 2OUAA 2QY0B 4IC5A 3QX5H 2EI7A 3TGKE 2ZCHP 4IW4E 4WXVA 4FOUC 4IN2A 6CHAB 1ARBA 3RLWH 1RTKA 2EI6A 1SGQE 4B74A 1MTUA 5K0HA 2WYJA 3MU0A 5F03A 2YNBA 3T27A 1XVOA 4FU7A 3LIWA 1CBWC 3FFGA 5C5NA 2ZU5A 4FUCA 1CSOE 1E37B 1C4U2 1TNIA 1C2LA 3A7WA 5C17A 3F6UH 3MOCA 1K1PA 4NWLA 5HM2A 1V6DA 5DP3A 1ZSKA 3T2NA 1RD3B 3A83A 1O3EA 2K0QA 1UMAH 1MTSA 1L4DA 2FYQA 2ZDKA 1CA8B 3PLPA 1GI7B 4M9FA 1V2NT 2C8WB 4OGYA 1QRZA 1S0RA 3OE7D 5GNDA 1GJ9B 1YF4A 1K2I1 4JK5A 3PTNA 1BJUA 2QF0A 4VGCC 1WXRA 4D76A 2ESTE 1ANEA 3GY2A 4FETA 1RRKA 3SJ9A 1QIXB 1TQ7B 3P8NA 2W7SA 2ZF0H 1GBJA 3H5CB 2ZFPH 2PV9B 5EXMA 1VGCB 3A89A 5B6LA 1OWKA 4J2YB 4DVAU 1NBME 3A7TA 4I31A 1UK4A 2ZI2H 1ZPZA 5EQRA 1DM4B 2UWPA 1YPEH 1TRMA 1VCWA 4X1SU 3PM3A 2FTLE 3LKWA 3SU0A 1WQVH 4TY6A 4UFEH 1CA0B 2SNVA 4OS2A 1VZQH 2Z9KA 3RXPA 1FY5A 1DS2E 4O9VA 4OS1A 3OY6U 3RM0H 4D9RA 3A8CA 1TPPA 3NK8A 2HVYB 4XRNA 2FXRA 1QNJA 4U01A 1C1QA 4BAHB 1IQKA 2IPQX 3BTTE 1P3CA 1S5SA 1ZLRA 6GCHF 1TOCB 1W7XH 3FAOA 1V2ST 2CGAA 4Y8ZA 2KCPA 2OINA 2Q6FA 1CT4E 3GY4A 1O3NA 3MH5A 3WW7A 2V6NA 2UUYA 3P17H 3T26A 1MCVA 1KXAA 1Y3WA 1TGCA 3CS7A 1SG8B 1F0RA 2F9BH 3S9AA 2GKVE 1HAYB 2FMJA 2WSSD 1SVPA 4AN7A 2QA9E 1MBMA 2L74A 1OYQA 1P2KA 1F7ZA 3KGPA 1SOZA 3H7TA 2ZCKP 1ACBE 1AFQB 2FOMB 4MNYA 5ABWA 1D3QB 3PROA 2QXHA 1BMAA 4RI0A 3MYWA 2F9NA 4YM9A 1D6RA 2FZZA 1AKSB 1OWHA 1O3HA 1NRQH 4QT8C 1ZTJA 3A7VA 5HYOA 1W10U 1TNJA 2FODA 1IQEA 1MZAA 4RKJB 2D26C 4HFPB 4K3JA 1O2QA 4X8SH 2XW9A 2J4IA 3GCTF 3RXTA 1HV7A 5H4IB 1TMUH 1FI8A 3DFJA 1C5SA 1VITH 4HG6A 1Y8TA 3E0PB 5KGOA 2XBWA 3E1XB 1QURH 2OD3B 3MU5A 3P70B 1OS8A 2WUCA 4LK4A 3ZZBA 4K1EA 2ZCLP 3GOVB 1MMJN 1O5EH 3I29A 1WTGH 2F3CE 1EQ9A 1O34A 3NCLA 4R0IA 2FEQH 5LH8A 2ZFTA 7LPRA 3ATKA 1F5KU 1BMLA 1H9IE 3NUMA 1GBHA 1EP6A 1V2KT 2UUFB 2ZGJA 3RXDA 3IWMA 4U2WA 2OQ5A 1HPGA 1EAXA 2JETB 5A0CA 5JYIA 2Y5GA 4I8LA 2LP6A 1P2JA 1IQIA 5C2ZA 4OS4A 2OQUA 5I25A 3A86A 4WJG2 3S9BA 5JDUB 2GDEH 4NIYA 4I8GA 3CS0A 1KY9A 5JB8S 4IGDA 3KYGA 5DO4H 3KF2A 1M9UA 1C5NH 3EAJA 1CHOG 1RTFB 7GCHG 1UTPA 5EJZA 2D8WA 2B9LA 2PKSC 2ZO3H 5GJ4B 2QXJA 1O38A 1L0ZA 2HLCA 3DSPA 3N7EA 1H8HD 1GBAA 1TGSZ 2TGDA 5FAHA 2KFWA 2J9NA 5DG6A 2ZDMA 1C2EA 3FO8D 1O31A 3WY8A 4X8UH 1DFPA 4X2YA 3EA8A 1L1NA 5TCAA 1PYTC 1L4ZA 1NBMD 2CJIA 3O8RA 3MU1A 1GJ8B 4ABFA 1E1QD 3AASA 1PPBH 3MH4A 3SV6A 1AHTH 1H8IH 3URDA 4Z1MD 2ZFSA 1KDQA 2KCYA 3SUGA 3EYDA 3SHCH 1BTYA 1HJ8A 5PTPA 1C2MA 3QK1A 3A8DA 2H5DA 1K0HA 4AC9A 3BTGE 5DP7A 3VPKA 1NN6A 1NFXA 1BITA 2BDYA 7KMEH 5J4SA 2G52A 1CU1A 3P95A 3LGUA 2A2XH 3MWIU 3M5MA 4TYDA 4ABHA 3TIUA 4XBDA 5GPIB 2RDLA 3ZZ9A 1Y3UA 2J97A 2BDGA 3EE7A 1C5YB 3RXVA 3T62A 3RU4E 2AMPA 2IN2A 1EJMA 3SJKA 4A1VA 3FP8E 1V2VT 2C8ZB 2VWLA 3FN8A 1GPZA 5E8EH 4BTIB 4U32A 2A0QB 2TIOA 3F2FA 5AVDA 2ZU4A 4NZLA 1ABIH 1BRAA 3H7OA 2Y81A 3UNSA 4ZMAH 1UTLM 2CF9H 4A6LA 4LZ1H 5FX6A 3SQHE 1ETSH 1P3EA 1BRUP 1QJ1B 1KSNA 1ZMNA 2UWOA 2ODYB 4JZEH 3RMMH 3ZZAA 1QGFA 2RFKC 3F9FA 3UNRA 1WOFA 1HUTH 2VBCA 3SBKA 3M7TA 3Q3KA 1CGHA 2P93A 2R3UA 3MI4A 3NRLA 4IBLH 2A5IA 5GIBA 3VXEH 1BTUA 2ZGXH 4NGAH 2OC1A 3F1SB 3SNDA 1O2SA 2W6ID 1X7AC 1NT1A 1V2JT 2ZIQH 1N8OC 1OOKB 2H9TH 1QL9A 3KQEA 4F48B 3GCOA 2NU0E 1HAXB 8ESTE 4YTAA 2VGCB 1RS0A 1NROH 3PLKA 2WHXA 4YZUA 2PKAA 1ORFA 4F49A 4ASUD 1EAWA 1UHBA 1ZTLA 2YNAA 4FUFA 3U69H 2Y82A 2OC7A 3E6PH 3LH1A 1UCYH 3T5FH 1IQNA 1NRPH 3B8JA 1PQAA 1VITF 4FUGA 5F8ZA 3ODFA 1LVMA 3OU0A 1P10A 5A2MH 2HOBA 1P0SH 1O2MA 1ANBA 1JRTA 1SFQB 2AIPA 1EB2A 2FOCA 2VH0A 4JZ1A 5EGMA 1SKYE 1AD8H 3PV4A 3HK6B 3EA7A 3PMHB 3RXKA 1OHHD 3A81A 1UVUH 1H4WA 4MNWA 1CBWB 1LHDH 1UTQA 3F68H 5HM9A 4TWYA 4DW2U 3MO3A 1ZMLA 1GBKA 1GVZA 1K9OE 2FOBA 4I86A 4X1NU 1KMHB 1BMMH 1HAVA 1HAOH 3LH3A 1GHZA 3RXLA 3A85A 2CF8H 3SUEA 2W7UA 1O36A 2GGVB 1UTKA 1O5AB 4NFEA 1WU1A 3ELAH 1RGQA 1GDUA 1KDQB 2PGBB 3RXQA 3BG4B 3TGJE 1TALA 1G3EA 1DICA 1PQ7A 4Q4LA 4VGCB 1SGRE 4X6PA 3ZZDA 4HTCH 1O5CB 2ANWA 1O2KA 1RTLA 3KNXA 3PWBA 3BEIB 4NCYA 2AHME 2PHBA 1ELDE 2V35A 2FIRH 2GVFA 4B2AA 1HAIH 4NWKA 4BAQB 5C1UA 2PTCE 1FQ3A 1FUJA 1BJVA 1AQ7A 3DFLA 2GCTC 5EW1H 1G37A 5ETXA 1P9SA 4LZ4B 1T4VH 2F9VA 5DP6A 1ELBA 1G9IE 1GBTA 1O2VA 3ATMA 4O03A 1QQ4A 1A0JA 1QCPA 2TBSA 1HNEE 3RMNH 3RU4D 1ESBA 1A0HB 2XC4A 2GZ8A 3ZZ7A 1LHGH 1C5RA 1AIXH 3FVFB 1C1VH 4CRAA 2V7QD 4Q2KA 1AZZA 1EOJA 3LT3A 1MD7A 1LQEA 2CMYA 1Z8JB 4K1TA 1OWEA 1P8VC 1TBRH 4LOYH 5DSFA 1FAXA 4UFFH 5C20A 1OP2A 1GJ4H 1IQGA 1P2OA 1EUFA 3HKIB 1H9HE 4FXGH 1GBLA 1D3DB 1XVMA 2WYGA 3AK5A 1DVAH 1NTPA 1O35A 1J16A 3UR6A 4CRBA 1FZZA 1MTNC 1DY8A 2P95A 3BV9B 3FANA 5JPMH 2BLQA 3L33A 1AB9C 4ISNA 3U8RH 3M61U 1V2OT 1O2HA 3M37A 3D49H 1W8BH 2AIQA 2GTBA 4YT6H 1SGTA 4Y8XA 1ELGA 2OCVB 2BZ6H 2BY5X 2TGTA 3UUZA 4AX9H 2XBYA 1V2MT 4HGCA 2IJOB 1JOUB 1O5FH 4OS7A 3JZ1B 2VIPA 1EASA 2PKAB 3A7XA 3GY7A 2OXSA 1IHTH 1CGIE 1XUFA 3W94A 5L2YH 2A4RA 4I32A 2FM2A 2ZEBA 3VXFH 3M5NA 1O3IA 4JYUH 1GBCA 4K8BA 3PO1C 3SO3A 1NM6A 1NY22 1QA7A 4YXWD 1SFIA 1FN8A 1L2EA 2ZHEH 5TCCA 3MQKC 4WMDA 3N7OA 2YMSD 5EIYA 3A7ZA 4FUHA 1PPCE 2A31A 1WQSA 2P3TB 4JMYA 2BX4A 2ZKSA 3SV2H 1DUEA 4CR9A 1V2UT 5CE1A 3HK3B 2STBE 1A5IA 1FONA 1C5LH 4AFUA 1V2PT 2TPIZ 1A46H 4ABAA 1SGPE 3PTBA 4JYVH 3GCNA 3RXSA 3HGPA 2QC2A 4CH2B 5C5OA 5E2OA 1GJDB 1KXFA 1LKBA 4INKA 5AF9H 2BX3A 2WV4A 5A0BA 1HAVB 3LC3A 5KEDA 1TFXA 1Y5UT 2PUQH 2GDDA 4BXWA 1B5GH 1W0YH 1AN1E 2JDID 2GT7A 2A4OA 2FLBH 2VIQA 3TK5A 2CHAC 3DUXH 5IYTA 4PROA 1NC6A 2BOHB 4H4FA 1GHXH 4TY7A 1AE8H 3QTOH 1BTXA 1P12E 1Q2WA 2P8OC 2Y7ZA 2BY8X 5AHGH 1GJBB 1G3DA 2ZU3A 2PSYA 1EZQA 2BY6X 2C90B 1LMWB 3B9FH 2PKSB 4ZAEA 3D65E 3TGIE 2J92A 1O2OA 2FS9A 2XOKD 2YMSC 1G2MA 1QA0A 2VJ1A 3EQ0H 4GCHF 4UFGH 2Z9LA 3M3SA 1HAPH 3ZYEA 5FCRA 2AERH 1J17T 4ABGA 1GI8B 4BAOB 1A7SA 4WH8A 3UREA 1TAWA 3MH6A 3DCLA 1EPTC 1FPHH 2CK3D 1F2SE 1SMFE 3BIVH 1TPSA 1SI5H 1F0TA 3QWCH 1MAXA 3U98H 3LU9B 3A8BA 1GI9B 3TK6A 1CQQA 1O2UA 3ZZ8A 2BZAA 1SPJA 2O8TA 1C5QA 4NSVA 3Q3YA 2BD8A 1SOTA 1N6XA 3CNRA 1AWHB 2VU8E 4ABIA 1MKWK 1C9PA 1EAUA 2SFAA 1MQ5A 4X2WA 2TRMA 1QL8A 1YWUA 2BLVA 1C5ZB 4DIIH 1GJ6A 3SGBE 1TGBA 1OX1A 2G81E 3ZIAD 2LELA 2C8YB 1YM0A 3SNBA 1D3TB 1CHOF 7GCHF 1ZR0A 1T8OA 2PUXB 2Z3EA 3BG8A 3M3VA 1XM1A 1TX7A 1YPKH 2THFB 4ACBA 2BB4A 3UOUA 3RXGA 2G8TA 4ABDA 3M5OA 3E0NB 5DP4A 5IK2D 1DPOA 2ZWLH 3OSYA 2BOKA 1C2KA 3D62A 4AOQA 1ZRKA 1CHGA 3PV2A 4YLUA 1GCTB 2Z9JA 1BTHH 1ELEE 2QXGA 3BF6H 1E35B 4ISHH 3URCA 3S9CA 3E8LA 1N8OB 2XYAA 3QZRA 4MLFB 3STJA 1G30B 3SU2A 2PWXA 5C94A 1Z6JH 2SGEE 3K9XB 5FPSA 4BTTB 5ESBA 1DLKB 1FMGA 2O9QA 2PLXA 2ZDLA 4X1QU 1K1OA 1NU7B 3RUOA 1YKTA 3QZQA 1EX3A 3ESTA 2Y80A 1EZUC 1FV9A 1T8MA 2ASUB 1P9UA 3QN7A 4I8HA 2SGFE 1RIWC 3L3TA 2NU4E 3OEED 2QN5T 4ZROA 2O8LA 1DWDH 3BSQA 2J38A 1Y5BT 2QIQA 3RXFA 4HZHA 4X6NA 3WWBA 2AH4X 4E7NA 2HNTC 3DT0H 4MVNA 4YESB 1IQHA 1SBWA 4WF8A 4X8TH 2A7CA 4SGBE 2ZA5A 1SHHB 1W3CA 4AZ2B 4KTCA 1ELTA 1YY3A 1SGNE 4DOQA 1C5TA 3RC5A 5E2PA 1MCTA 1G32B 4WY3A 4YOJA 1FAKH 4BAKB 1YCPM 2ZECA 1GJ7B 4XD7D 3QUMP 1YPHE 3UTUH 1P11E 2H9HA 4K8YA 1O3MA 4GCHG 5AFYH 3Q3XA 4J1YA 4AFSA 3BTEE 3RXIA 3UR9A 1NU9A 1Z7KA 1JIRA 2ZHFH 1TA2A 3O8DA 4AGJA 2Z9GA 3MU8A 3SV8A 4AGKA 1ANDA 2ZPRA 4JK6A 2KAIB 3TITA 4LXBH 5EW2H 1O3OA 3MNBA 3SZEA 5EPNA 4ZHMU 1OKXA 1V2TT 1PYTD 1AI8H 4Q7YA 3AVZA 2H2ZA 1GI1A 3VB3A 1F0UA 2FI5E 1COWD 3BTDE 1G36A 3WWFA 2IJD1 1S83A 2V3MA 1IQMA 2HRVA 4JZIA 3UOPA 5EJ1A 3BTQE 2GCTB 1ZHRA 1O3BA 4XE4A 1HLTH 2UUKB 4DGJA 2C93B 3BTWE 1C1MA 1AFEH 2ZQ2A 1OSSA 3PLBA 2YOLA 4NA9H 1EPTA 4UDWH 4H42U 1DSTA 4RSPA 2XWAA 3VG8A 2Y7XA 2KX4A 1YPGH 1GHYH 2ZHQH 5HKKD 4UE7H 1FIZA 4B71A 3IITA 4ISLA 2AS9A 2ZTYA 1PPHE 1SGEE 2W5EA 1GMCF 4KP0A 3QGNB 3V3MA 2XCNA 2FYRA 4AFZA 1GHVH 4ABEA 2H6MA 2RA3A 1O2RA 9LPRA 1TNHA 1BUIA 3N7DA 1DDJA 1MTNB 4CRCA 4NA7A 2QF3A 3B23B 1FJSA 1GBMA 1O33A 2QCYA 3E3TA 2J98A 2ODQA 5EU8A 2ZGBH 3OTJE 1S0QA 1THPB 3TNSA 4RT0A 1S6LA 4XBCA 3MHWU 1CO7E 2DE8A 2HALA 3RP2A 4K60A 5A0AE 5A8XA 3RXBA 1V3XA 1GWAA 4DURA 2TGPZ 4MPXA 1MABB 1GBFA 2F43B 1O2GH 1ETRH 4NIXA 1YYY1 1QBVH 4KTUA 4NG9H 3OEHD 5HXFA 4KKDA 2FI4E 4SGAE 2XCFA 4GLYA 2CXVA 2HPQH 3PO1B 4O3TA 2OLGA 1GG6C 3PMJA 3P6ZB 2NU2E 3GS9A 1EJNA 1UVPA 2P59A 4THNH 2VIOA 2Q6GA 1E36B 2SNWA 1ARCA 3FP7E 5C3NA 3O8CA 1ELVA 2XBXA 3LONA 1JBUH 1UK2A 1BBRH 2VVCA 3BEFB 4RN6A 4Y79A 1HAGE 3GY3A 2XC5A 2Z94A 2ZGCA 3RXOA 5T6DA 2AGEX 5EXLA 1T31A 5DK1A 1YPLH 2ZDVH 1UTJA 2ZFQH 3AAVA 3UNQA 2BVRH 2A7JA 1NESE 3SU3A 3U8OH 3MH7A 1UVSH 1C2HA 1DOJA 2SGAA 1BMNH 1G3BA 2BDHA 2RDEA 2JH5D 5EPYA 2J34A 3TU7H 4DIHH 1ELAA 2HGTH 2VIDA 3GY8A 2R0KA 2B0FA 3FKSD 5GCHG 3ZZCA 1H1BA 1ANCA 1PFXC 3KN2A 2F91A 1TMTH 1GHAG 2M2AA 1BTZA 3MNXA 4JYTA 3C1KA 3LJOA 2CHAB 1ZSJA 3T25A 4HI3A 1GMDF 4JCNA 1TRYA 2P8OB 3STIA 4MG3A 1D3PB 2CN0H 1BB0B 2Z3CA 3E16B 4INLA 3KQDA 5FL7D 1UO6A 3MO9A 2P3FH 2QE7D 1GHBF 2M5TA 1EZXC 4A92A 1ZMJA 1GBIA 1ZHMA 1VKYA 2XTTB 1TBQH 2XRCA 1WYKA 2V0BA 1PJPA 4OM9A 3GYMA 3DA9B 2OBQA 3A82A 2YMSB 4GHTA 1GBBA 1Z8RA 1Y3XA 1A4WH 1ZGIA 4XFQA 2G4UA 1IAUA 5IDKA 4NIWA 4FVDA 1D4PB 2BYAX 1WAYB 2GMTC 3P8GA 3V12A 1Z71A 1YGCH 5L2ZH 1EPTB 3RXJA 2ZC9H 4TPYA 3EGKH 1XMNB 5FBIA 1D6WA 1P2QA 1O2JA 1SL3A 3UWJH 1NS3A 2JH0D 2QGRA 2PR3A 1TQ0B 1QBNA 2NU1E 1QRWA 4CREA 4H6TA 1SLWB 1T32A 3BTKE 4NFFA 1SGDE 4I7YH 3L6PA 4JZDH 1O5DH 3F9EA 2XNIA 1YPHC 2NU3E 1C5MD 2H1UA 1GMCG 3SZNA 1XUKA 2L6OA 1JRSA 1O2TA 1ZJDA 3RDZA 2BHGA 5A8ZA 3S69A 4I33A 5EOKA 1O32A 1GDNA 1KLJH 1BBRK 1O2LA 1OXGA 1U6QA 4X6MA 3TJNA 1UVTH 2F9OA 1IQLA 2J98B 2R2WU 2G00A 2J95A 3SU4A 2WINI 2PW8H 2AGGX 4IC6A 1NZQH 1AFQC 1OWDA 3QTVH 1UTMA 2BDBA 3BEUA 2A4GA 3ENSB 5FPYA 2A1DB 2BD3A 3DSOA 3F0OA 3LGYA 1QBOA 3RXMA 3GICB 1Z1JA 1O39A 1AVXA 1NFYA 2XC0A 4E06H 1AMHA 1Y59T 3UPEA 1GDQA 3K6ZA 1GJAB 1A5GH 3SI4H 5AFZH 4MTBA 3C27B 2Y5FA 1DUAA 3KL6A 1QTFA 1MTVA 1O2WA 2W3KA 2ZU1A 3RXEA 2IPHA 4ZXXH 4DT7B 4ZUHA 3S7KB 4ZXYH 3FP6E 1O3CA 1XUHA 5FBEA 2ZHDA 1PQ5A 3P92A 1GI2A 1IHSH 5HMAA 3Q76A 4DCDA 2VIWA 2ZP0H 1EATA 3H09A 8KME2 1XUJA 1TPOA 4GSOA 1HAZB 2VWNA 2EI8A 4I8JA 1AVGH 4MPVA 4MPWA 1GL0E 5HIYA 4BOHA 2BMGB 5CHBA 2HNTF 2WPLS 1UVOA 3PYHA 1NRRH 5SGAE 2BVXH 2K8IA 1RIWB 2FLRH 1A3EH 2HWLB 1C1TA 2FOEA 1D9IA 2WPJS 3UWIA 1HJ9A 1C1UH 1T4UH 2VNTA 1NRNH 4GPGA 2BVSH 1NRSH 2C3SA 4B75A 5HGGA 1V2WT 2FOAA 2FESH 2O8MA 2SGDE 4FUJA 1CGJE 1C2GA 3TVJB 4INHA 2BD9A 3P8FA 4FUEA 3EDXB 3FOAA 1B0FA 1JIMA 1GMDG 1WCZA 3TK9A 4AB8A 1BA8B 2BLOA 1DWCH 4FVBA 1RJXB 1O2PA 2QF5A 4AYVB 4TT3D 3KQBA 2HNTE 1YCPK 4WMEA 1GHBG 2Y5HA 2GCHF 2ZZUH 5DP5A 1E1RD 1XUGA 4MNVA 3UFAA 1O3AA 1SLXB 1BRBE 3V0XA 1OYTH 2FOHA 1SQTA 2FX6A 1WTHD 4Q7ZA 1Z1IA 2WV9A 1GBDA 4AORA 3SQEE 4F4OC 2KZ4A 4CRFA 2AMQA 1QY6A 1OP0A 3K6YA 2W6JD 4KELA 3DD2H 2F9PA 2ZFRH 2DUCA 3KCGH 3F3BA 1KYNA 4CRDA 4NA8A 2PSXA 4XDEA 5B6OA 2HVXA 4YT7H 2GZ7A 5HIZA 1BBRE 2ZPSA 1W12U 1PPGE 1QL7A 2I6QA 2FPZA 4BTUB 1AGJA 4B76A 2JIZD 1MD8A 3TPIZ 1P03A 1MKWH 5FCKA 5GDSH 3HGNA 4IS5A 1HJAC 1BMFD 2ZDAH 2D2DA 4ESTE 3LC5A 1YC0A 1DANH 1MKXK 4BAMB 5LPRA 1LVYA 2BXUH 1O37A 3MFJA 4B6FA 2P3UB 2ULLA 1FNIA 4CBNA 1QHRB 3G01A 1YBWA 2WZQA 3NXPA 5L30H 2JKHA 4B2CA 1DLEA 3R0FA 2H9EH 3LGTA 1FY8E 3TJUA 3CENA 2HLDD 3OX7U 1C5PA 4TPIZ 1N6YA 1FN6A 3BTHE 4YOGA 2AFQB 4I8KA 1QB6A 1GI4A 1FDPA 2FDAA 1EFRD 4Y7AA 1ZYOA 2GV7A 2NWNA 3ZVCA 4ACAA 1MU6B 3RC4A 1KXDA 1W2KH 3HPTB 5A8YA 1XXFA 5DGJA 2HPPH 4P02A 5BPEA 2ZTXA 3SNAA 1P05A 3SV9A 5EODA 5JBTA 3KQ5A 2O8WA 2C8XB 1E34B 1L1JA 2FWWA 1LVBA 2BDCA 3A84A 4ZH8A 1PPZA 4DJZB 1O2NA 4Z0KA 5JBCS 4ISIH 1AO5A 2BY7X 1WDIA 1HB0B 2BD5A 1ZJKA 4CR5A 3I78A 2BLWA 4CRGA 4XOJA 4CH8B 2GZ9A 1DWBH 2AEIH 2FS8A 2PP6A 3M7UA 4Y8YA 1RXPA 2KAIA 1K21H 2ANYA 4CHAC 1W14U 1O5GH 5GXPA 3VB4A 4TSFD 2GP9B 4F55A 2XNDD 1AY6H 3RXRA 1WV7H 1J14A 3D23A 1YLNA 1TX8A 1KLTA 2ALPA 2STAE 1K28D 1GG6B 3LPRA 9ESTA 4ZHAA 5CDFE 1P2NA 4X2VA 2H5CA 2Q6DA 4KGAA 1GL1A 1CVWH 1DX5M 1WUNH 2KCAA 1BT7A 3RU4T 1SLUB 1LHCH 2OBOA 1HIAA 2AYWA 1GGDC 4GHQA 4U30A 1P09A 2XWBI 3ZVDA 1A5HA 1S85A 3T28A 4B6EA 2BTCE 3FZZA 1H8DH 3ZZ3A 5LGOA 1HXFH 3GDVA 4A1TA 5I46H 2ALVA 3GY6A 3W95A 2W26A 2GCHG 3Q77A 2ZTZA 3RC6A 1F5RA 4R8TB 5F53A 2K1QA 5TJXA 3LGVA 2D1JA 1LKAA 3UIRA 1UW7A 1UJ1A 2OP9A 1C9TA 2VVUA 2EC9H 1HAHH 2OC0A 1EXFA 1TWXB 2W3IA 3CP7A 4Y0YE 1MU8B 1B7XB 1TBZH 4Y76A 3OY5U 4GVUA 1F92A 1FIWA 1SQAA 1WBGB 2QV1A 1XUIA 4O3UA 3BG4C 2BQWB 3NPSA 3TH3H 5FXLA 4YOIA 1BZXE 3O8BA 5F6MA 5C0TA 1W13U 3AAUA 4D9QA 1A2CH 1VR1H 4IMZA 1THSH 2VH6A 1BDAA 2LNCA 2F9UA 3NZIA 3PRBA 2R0LA 5DKMA 1SSXA 1TABE 3RMOH 2SGPE 4AFQA 1ID5H 3DHKH 4IN1A 4FUBA 1MZDA 1S6FA 2BQ7B 3SHAH 3GYLB 3SOSA 3W1EA 1V2LT 2GMTB 2IOTA 5FPTA 4B1TA 5C1XA 1SGFG 1VJ9U 3SGQE 1B0EA 4FUDA 3ZZ4A 1E79D 2ZNKH 4OS5A 4ABJA 2B5TB 3SNCA 4FUIA 5JB9S 1YPMH 3VGCC 2BD2A 4AG1A 1FX0B 3MNSA 1A61H 4X2XA 2XBVA 3M3TA 2ZG0H 3TH2H 1O5BB 3DSGA 3AW0A 2VIVA 2BD7A 4FU9A 1SGIB 2FOGA 5KECA 3SI3H 2RCEA 2BDAA 3PRDA 2WUBA 3P8OA 1DITH 1TNGA 2FX4A 5T6GA 1QB9A 2KR7A 2ZFFH 3PMBB 3A80A 3A88A 1SGYE 5GCHF 4Q80A 4X1RU 1GHAF
chains in the Genus database with same CATH topology
2WPMS 1Z8IB 1LVOA 3ZYDA 3GISB 1SC8U 4ZKRU 1P04A 5J4QA 3HATH 2RA0A 1KIGH 1HRTH 1NO9H 5CHAC 3TNTA 2A7HA 1K1NA 3RXUA 3LOXA 1XKAC 1P06A 3GDSA 3BN9A 1J8AA 1G3CA 1J15A 1TMBH 4K2YA 1ELFA 1K1LA 1GI0A 1QFKH 4MDSA 3SV7A 3TH4H 3LDXH 1L1GA 3ATLA 1NFWA 6ESTA 2G4TA 1DXPA 2SGQE 1YLCA 4B2BA 4UD9H 1E0FD 1ZRBA 1KXEA 1HIAB 6LPRA 1DT2A 1C2JA 1JMOH 1P2MA 2PTNA 2G51A 5DJ7A 1UK3A 1YP9A 4Y71A 1O2XA 1EZSC 3M7QA 3SUDA 1TNLA 3TJOA 3SUFA 2BQ6B 5EG4A 2Z7FE 4JZFH 1P01A 1PPEE 4XBBA 1GI3A 1XX9A 1TRNA 3NKKA 2JH6D 1P57B 1ABJH 3QLPH 1AB9B 2OTVA 3R3GB 4Y11E 5EQQA 1THRH 1QJ6B 1E38B 2FOFA 4BANB 1IOEA 4A5TS 4ABBA 4Y10E 1W7GH 1GHWH 2QXIA 2G5VA 2Y6TA 5C1YA 4CBOA 5EQSA 4MQAA 1Y5AT 2BM2A 3ZV8A 1HCGA 2A2QH 1P2IA 3GCHC 1TGTA 1UTOA 4AG2A 2B8OH 1JXPA 1ZPBA 3QDZB 1PQ8A 5E0HA 3TLOA 3GY5A 1O3KA 1GVLA 1FY4A 5EXNA 2EEKA 1QQUA 3GDUA 3PB1E 1Y3YA 1BCUH 3RXCA 2AMDA 1FY1A 4K69A 4A1XA 6CHAC 3SN8A 1OP8A 1IQFA 2QYIA 1EP5A 2Z9IA 1C4Y2 1C2DA 1HJAB 2VWOA 2WPKS 1HYLA 2WPIS 2ZHWH 3KHVA 4Z6AH 4ZKSU 1ZGVA 4DG4A 7ESTE 1DWEH 2V3OH 6GCHG 1LPGB 3LGIA 1K1IA 4OS6A 4ZKOU 4WVPE 3SU5A 5LPEA 2FP7B 4D7FA 1N1LA 3SJIA 2ANMH 1O3DA 1FXYA 1LQDB 1EB1H 1F5LA 1YLDA 1Q31A 1BIOA 3UQOA 1ZHPA 2A45B 1OWIA 2FTMA 4O97A 3SORA 3AW1A 3ITIA 4NIVA 1Z8GA 1JWTA 1GI6A 1LO6A 1GJCB 1ZSLA 1C5OH 1O3GA 3VEQB 1C1SA 1MBQA 1P02A 3Q00A 1KTSB 1OWJA 5C67A 2Z3DA 1O2YA 4UONA 1O3FA 1GMHF 1Z6EA 4E7RG 4OGXA 4WWYA 3A8AA 2BXTH 1FPCH 8LPRA 2G55A 1CE5A 1C1NA 2GT8A 1TA6A 5F8XA 1J9CH 2LPRA 1FY3A 1BRCE 4WH6A 2ODPA 1ESTA 1LHFH 1TONA 3GCTG 1TLDA 1AZ8A 3VB7A 1VGCC 4E05H 3ATWA 1C1OA 3NWUA 5GWZA 1MTWA 1GCTC 2VVVA 4X8VH 4AB9A 3S7HB 1KTTB 1TYNA 1C4V2 1VJAU 1HFDA 1SQOA 3V7TA 1EJAA 3T29A 3U1IB 2A32A 3M35A 3MMGA 1H9LB 1BTPA 1O0DH 2GX4A 1CA0C 4H6SB 1DE7H 4CHAB 3QO6A 1S81A 1TB6H 2VINA 4B73A 3SW2B 1HXEH 3BIUH 2G5NA 1GBEA 1XKBC 2R2MB 1W0ZU 5LPFA 3F9HA 3MU4A 1VCPA 1NFUA 3I77A 5JBAS 1IQJA 2P94A 3A7YA 1ZTKA 2QAAA 5DPAA 1ZOMA 3K65B 3BTME 3ZV9A 5BRRE 1YCPH 3UY9A 8GCHF 3JZ2B 2ZDNA 3ODDA 5CMXH 3LGWA 1C1WH 4K5ZA 1GGDB 2V3HH 2TGAA 3VB5A 1A1RA 1ZZZA 1LCYA 1ETTH 1O2IA 1SGFA 4MNXA 1KXBA 2WV5A 5T3HA 1HDTH 2B7DH 4M7GA 1ESAA 2OC8A 1WSSH 3KIDU 1VCQA 1CT0E 4Q7XA 3E91A 1FLEE 2BD4A 5F8TA 3LJJA 3U8TH 1EAIA 1A0LA 1C2FA 1S84A 1TIOA 1O3PB 4MPUA 1TNKA 3HKJB 5G4BA 3RM2H 5DP9A 1SR5C 1O3LA 4GUXA 1W11U 1MKXH 2UWLA 4ZHLU 2J2UA 1C5XB 1Q3XA 2GD4B 1O2ZA 5A09A 1GI5A 1LPZB 1KXCA 3E90B 3SJ8A 2AGIX 4Y6DA 2PGQB 1QJ7B 3MO6A 1C2IA 1SHYA 1KLIH 1QB1A 3K2UA 2JETC 4ZKNU 4ASHA 1MH0A 3PMAB 2F83A 3VFEA 3VGCB 1EOLA 4K1SA 2GV6A 1BOQA 1O3JA 2FO9A 1V2QT 1Y3VA 2A4QA 1O30A 1UCYK 4TWWA 1BHXF 2O8UA 1AUJA 5DP8A 3ZVFA 1K1MA 1C5VA 1GMHG 2A5AA 1CT2E 3ZZ5A 1V2RT 5E0GA 1SB1H 3MNCA 4X1PU 2ZQ1A 4RKOB 4A7IB 1TGNA 4Y7BA 1GJ5H 4WMFA 1BHXB 1C5WB 2WPHS 5E0JA 3A87A 5ESTE 3U1JB 3ZZ6A 3SGAE 3U9AH 1LDTT 3SNEA 4NZQA 2R9PA 1LHEH 3RLYH 1C5UA 2ANKH 1GVKB 4YO9A 3ZVEA 1RFNA 1ZPCA 1AVWA 1S6HA 3TJVA 1GCDA 1G2LA 2ZU2A 4X0WU 5FX5A 1INCA 1SLVB 1T8NA 1C1PA 5CHAB 1DXWA 1BQYA 1UHBB 4D8NA 1NPMA 4UFDH 1K22H 3M5LA 3ATIA 4WXIA 3VB6A 2Z6BD 2EA3A 5FHTA 2C4FH 2I6SA 4Y0ZE 4D7GA 3ZVAA 1AUTC 1VITG 2J94A 2P16A 2Q1JA 4X6OA 3OYPA 1F0SA 1QR3E 2A5KA 4KTSA 1OPHB 4YLQH 3V13A 2PFEA 1S82A 2FI3E 4NSYA 2BDIA 1UTNA 3QGJA 8GCHG 1TOMH 1DY9A 1TE0A 4DY7B 1AU8A 3S0NA 1DSUA 2VB0A 3F9GA 1T8LA 3SU1A 3ZVBA 1TPAE 3MTYA 4BXSA 1YPJH 3RXHA 2CV3A 1LTOA 1AE5A 3IG6B 3EA9A 3RMLH 2DE9A 3SU6A 3PWCA 5T6FA 2XXLA 1XXDA 3BTFE 4FU8A 4ISOA 2R3YA 5K7RA 3FZDA 1C1RA 3KEEA 1ELCA 1BTWA 1MAYA 3RXAA 2ZPQA 1K1JA 3UQVA 2UUJB 3EE0B 2RG3A 5JBBS 5L6NH 4IMQA 2ILNA 1AKSA 2BY9X 1T7CA 2VGCC 1MQ6A 1LPKB 1SGCA 1TX6A 1UCYE 3SJOA 3M36A 4AYYB 1HGTH 3ZVGA 1PPFE 3GCHB 3KQCA 4UEHH 4GAWA 1MUEB 4BNRA 2ZGHA 1A3BH 1EKBB 1AWFH 2VWMA 4XSKU 1HBTH 1QRXA 2OUAA 2QY0B 4IC5A 3QX5H 2EI7A 3TGKE 2ZCHP 4IW4E 4WXVA 4IN2A 6CHAB 1ARBA 3RLWH 1RTKA 2EI6A 1SGQE 4B74A 1MTUA 5K0HA 2WYJA 3MU0A 5F03A 2YNBA 3T27A 1XVOA 4FU7A 3LIWA 1CBWC 3FFGA 5C5NA 2ZU5A 4FUCA 1CSOE 1E37B 1C4U2 1TNIA 1C2LA 3A7WA 3F6UH 3MOCA 1K1PA 4NWLA 5HM2A 1V6DA 5DP3A 1ZSKA 3T2NA 1RD3B 3A83A 1O3EA 1UMAH 1MTSA 1L4DA 2FYQA 2ZDKA 1CA8B 3PLPA 1GI7B 1V2NT 2C8WB 4OGYA 1QRZA 1S0RA 1GJ9B 1YF4A 1K2I1 4JK5A 3PTNA 1BJUA 2QF0A 4VGCC 4D76A 2ESTE 1ANEA 3GY2A 1RRKA 3SJ9A 1QIXB 1TQ7B 3P8NA 2W7SA 2ZF0H 1GBJA 3H5CB 2ZFPH 2PV9B 5EXMA 1VGCB 3A89A 1OWKA 4J2YB 4DVAU 3A7TA 4I31A 1UK4A 2ZI2H 1ZPZA 5EQRA 1DM4B 2UWPA 1YPEH 1TRMA 1VCWA 4X1SU 3PM3A 2FTLE 3LKWA 3SU0A 1WQVH 4TY6A 4UFEH 1CA0B 2SNVA 4OS2A 1VZQH 2Z9KA 3RXPA 1FY5A 1DS2E 4O9VA 4OS1A 3OY6U 3RM0H 4D9RA 3A8CA 1TPPA 3NK8A 2FXRA 1QNJA 4U01A 1C1QA 4BAHB 1IQKA 3BTTE 1P3CA 1S5SA 1ZLRA 6GCHF 1TOCB 1W7XH 3FAOA 1V2ST 2CGAA 4Y8ZA 2OINA 2Q6FA 1CT4E 3GY4A 1O3NA 3MH5A 2V6NA 2UUYA 3P17H 3T26A 1MCVA 1KXAA 1Y3WA 1TGCA 3CS7A 1SG8B 1F0RA 2F9BH 3S9AA 2GKVE 1HAYB 2FMJA 1SVPA 4AN7A 2QA9E 1MBMA 1OYQA 1P2KA 1F7ZA 3KGPA 1SOZA 3H7TA 2ZCKP 1ACBE 1AFQB 2FOMB 4MNYA 5ABWA 1D3QB 3PROA 2QXHA 1BMAA 3MYWA 2F9NA 4YM9A 1D6RA 2FZZA 1AKSB 1OWHA 1O3HA 1NRQH 4QT8C 1ZTJA 3A7VA 5HYOA 1W10U 1TNJA 2FODA 1IQEA 1MZAA 4RKJB 2D26C 4HFPB 4K3JA 1O2QA 4X8SH 2XW9A 2J4IA 3GCTF 3RXTA 1HV7A 5H4IB 1TMUH 1FI8A 3DFJA 1C5SA 1VITH 1Y8TA 3E0PB 2XBWA 3E1XB 1QURH 2OD3B 3MU5A 3P70B 1OS8A 2WUCA 4LK4A 3ZZBA 4K1EA 2ZCLP 3GOVB 1MMJN 1O5EH 3I29A 1WTGH 2F3CE 1EQ9A 1O34A 3NCLA 4R0IA 2FEQH 5LH8A 2ZFTA 7LPRA 3ATKA 1F5KU 1BMLA 1H9IE 3NUMA 1GBHA 1EP6A 1V2KT 2UUFB 2ZGJA 3RXDA 3IWMA 4U2WA 2OQ5A 1HPGA 1EAXA 2JETB 5A0CA 5JYIA 2Y5GA 4I8LA 1P2JA 1IQIA 5C2ZA 4OS4A 2OQUA 5I25A 3A86A 4WJG2 3S9BA 5JDUB 2GDEH 4NIYA 4I8GA 3CS0A 1KY9A 5JB8S 4IGDA 5DO4H 3KF2A 1M9UA 1C5NH 3EAJA 1CHOG 1RTFB 7GCHG 1UTPA 2D8WA 2B9LA 2PKSC 2ZO3H 5GJ4B 2QXJA 1O38A 1L0ZA 2HLCA 1GBAA 1TGSZ 2TGDA 5FAHA 2J9NA 5DG6A 2ZDMA 1C2EA 1O31A 3WY8A 4X8UH 1DFPA 4X2YA 3EA8A 1L1NA 5TCAA 1PYTC 1L4ZA 2CJIA 3O8RA 3MU1A 1GJ8B 4ABFA 3AASA 1PPBH 3MH4A 3SV6A 1AHTH 1H8IH 3URDA 2ZFSA 1KDQA 3SUGA 3EYDA 3SHCH 1BTYA 1HJ8A 5PTPA 1C2MA 3QK1A 3A8DA 2H5DA 3BTGE 5DP7A 3VPKA 1NN6A 1NFXA 1BITA 2BDYA 7KMEH 5J4SA 2G52A 1CU1A 3P95A 3LGUA 2A2XH 3MWIU 3M5MA 4TYDA 4ABHA 3TIUA 4XBDA 5GPIB 2RDLA 3ZZ9A 1Y3UA 2BDGA 3RXVA 1C5YB 3T62A 3RU4E 2AMPA 2IN2A 1EJMA 3SJKA 4A1VA 3FP8E 1V2VT 2C8ZB 2VWLA 1GPZA 5E8EH 4BTIB 4U32A 2A0QB 2TIOA 5AVDA 2ZU4A 4NZLA 1ABIH 1BRAA 3H7OA 2Y81A 3UNSA 4ZMAH 1UTLM 2CF9H 4A6LA 4LZ1H 5FX6A 3SQHE 1ETSH 1P3EA 1BRUP 1QJ1B 1KSNA 1ZMNA 2UWOA 2ODYB 4JZEH 3RMMH 3ZZAA 1QGFA 3F9FA 3UNRA 1WOFA 1HUTH 3SBKA 3M7TA 3Q3KA 1CGHA 2P93A 2R3UA 3MI4A 4IBLH 2A5IA 5GIBA 3VXEH 1BTUA 2ZGXH 4NGAH 2OC1A 3F1SB 3SNDA 1O2SA 1X7AC 1NT1A 1V2JT 2ZIQH 1N8OC 1OOKB 2H9TH 1QL9A 3KQEA 3GCOA 2NU0E 1HAXB 8ESTE 4YTAA 2VGCB 1RS0A 1NROH 3PLKA 4YZUA 2PKAA 1ORFA 4F49A 1EAWA 1UHBA 1ZTLA 2YNAA 4FUFA 3U69H 2Y82A 2OC7A 3E6PH 3LH1A 1UCYH 3T5FH 1IQNA 1NRPH 3B8JA 1PQAA 1VITF 4FUGA 5F8ZA 3ODFA 1LVMA 3OU0A 1P10A 5A2MH 2HOBA 1P0SH 1O2MA 1ANBA 1JRTA 1SFQB 2AIPA 1EB2A 2FOCA 2VH0A 4JZ1A 5EGMA 1AD8H 3PV4A 3HK6B 3EA7A 3PMHB 3RXKA 3A81A 1UVUH 1H4WA 4MNWA 1CBWB 1LHDH 1UTQA 3F68H 5HM9A 4TWYA 4DW2U 3MO3A 1ZMLA 1GBKA 1GVZA 1K9OE 2FOBA 4X1NU 1BMMH 1HAVA 1HAOH 3LH3A 1GHZA 3RXLA 3A85A 2CF8H 3SUEA 2W7UA 1O36A 2GGVB 1UTKA 1O5AB 4NFEA 1WU1A 3ELAH 1RGQA 1GDUA 1KDQB 2PGBB 3RXQA 3BG4B 3TGJE 1TALA 1G3EA 1DICA 1PQ7A 4VGCB 1SGRE 4X6PA 3ZZDA 4HTCH 1O5CB 2ANWA 1O2KA 1RTLA 3KNXA 3PWBA 3BEIB 4NCYA 2PHBA 1ELDE 2V35A 2FIRH 2GVFA 4B2AA 1HAIH 4NWKA 4BAQB 5C1UA 2PTCE 1FQ3A 1FUJA 1BJVA 1AQ7A 3DFLA 2GCTC 5EW1H 1G37A 5ETXA 1P9SA 4LZ4B 1T4VH 2F9VA 5DP6A 1ELBA 1G9IE 1GBTA 1O2VA 3ATMA 4O03A 1QQ4A 1A0JA 1QCPA 2TBSA 1HNEE 3RMNH 3RU4D 1ESBA 1A0HB 2XC4A 2GZ8A 3ZZ7A 1LHGH 1C5RA 1AIXH 3FVFB 1C1VH 4CRAA 4Q2KA 1AZZA 1EOJA 3LT3A 1MD7A 1LQEA 2CMYA 1Z8JB 4K1TA 1OWEA 1P8VC 1TBRH 4LOYH 1FAXA 4UFFH 5C20A 1OP2A 1GJ4H 1IQGA 1P2OA 1EUFA 3HKIB 1H9HE 4FXGH 1GBLA 1D3DB 1XVMA 2WYGA 1DVAH 1NTPA 1O35A 1J16A 3UR6A 4CRBA 1FZZA 1MTNC 1DY8A 2P95A 3BV9B 3FANA 5JPMH 2BLQA 3L33A 1AB9C 4ISNA 3U8RH 3M61U 1V2OT 1O2HA 3M37A 3D49H 1W8BH