2ZQ1A

Exploring trypsin s3 pocket
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Congeneric but still distinct: how closely related trypsin ligands exhibit different thermodynamic and structural properties
pubmed doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 55
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2008-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zq1A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2zq1A02
3O8BA 8ESTE 1FPHH 2BZ6H 1GBIA 2D26C 4UONA 1RS0A 2A5IA 1AE8H 1P8VC 3BG4C 1SHYA 2FTMA 1GVLA 2ZDKA 2AGIX 3SHAH 4A92A 2QV1A 1EQ9A 1O5DH 1O2HA 2Y82A 4AFZA 3MO6A 4B2BA 1HFDA 2PTNA 2HGTH 1SGRE 2B5TB 4Y11E 5EPYA 2ZPQA 5T3HA 4CRGA 2J4IA 5FX6A 4FUIA 1PQ5A 3D23A 1OXGA 1EZXC 2FEQH 1A2CH 1Q31A 4DIIH 1J14A 1K1OA 1MQ5A 5EPNA 1O2TA 1F0SA 2RDLA 4AG1A 2A1DB 1G30B 1V2QT 2PSXA 3RC6A 1XX9A 3GYMA 4DG4A 3UR6A 1DICA 1V2TT 2Z3EA 3FFGA 2TGTA 1CQQA 1TFXA 4TY6A 3F9FA 3RUOA 3KIDU 4IW4E 1QBVH 2M5TA 1UK4A 1QRZA 1P2QA 5CE1A 1QHRB 3GDSA 3TK9A 1EXFA 1SL3A 1BRBE 2PV9B 1MCTA 2HALA 4I31A 4MTBA 3SJKA 1KTTB 3SOSA 1TGNA 1WSSH 1KXCA 4GUXA 4ABBA 3MTYA 1N8OB 2TRMA 1P2NA 1K22H 2O8WA 1S82A 2CHAC 1OWJA 3E6PH 1JXPA 2A2QH 1P57B 3QGNB 3KL6A 1BZXE 1NPMA 1O2RA 1UVTH 2XXLA 3U98H 1C1SA 1CHOF 2D8WA 1C1VH 4FUGA 1ZTKA 1ESAA 2RCEA 1GHZA 2XC5A 1DWDH 2C93B 1P2JA 4E7RG 4AB8A 4NIXA 2UWPA 2TBSA 1ZOMA 3SV7A 1HLTH 1O2QA 1C1UH 4K8YA 3LIWA 4IMZA 1GJDB 1QA0A 3ZZ9A 3BTQE 4LZ4B 2XW9A 4ASHA 3AAUA 1KLTA 2FESH 1E0FD 1O2LA 1SGPE 4YOJA 4H4FA 3V0XA 3SJIA 2Y5GA 5DPAA 1TNJA 2BLWA 2F9NA 3SU1A 4NZQA 3QO6A 4FUBA 2XWAA 1GDNA 4I8KA 2PKAA 4Y0ZE 1XUKA 3PWCA 1KDQA 2BQ7B 5FXLA 1O3EA 1ZSKA 5DP4A 2GDDA 5FAHA 3SU0A 4LZ1H 3ZVFA 1YC0A 4NIWA 4RN6A 3TGKE 1WYKA 4AORA 5DO4H 1M9UA 2J2UA 4X1RU 2QAAA 3B8JA 2CHAB 2ZFTA 1UCYK 3F1SB 1TONA 1IQKA 1L1GA 5LPFA 1O3AA 9ESTA 4UFDH 1HJ8A 1IAUA 2VH0A 2B7DH 2DE8A 1GBBA 1T7CA 3F9EA 1HJAB 5DG6A 2JH6D 5T6FA 3MNBA 3AAVA 3SZNA 2VB0A 1QL7A 5EQSA 1TBQH 3A8AA 3ATLA 1DWBH 3ZZDA 4CR9A 3NZIA 1IOEA 3PWBA 4X8SH 3ZZCA 2P59A 4JZDH 4FVDA 1G3BA 3OTJE 4MLFB 1C4U2 1ID5H 1O5GH 2PKAB 2IPHA 3P8NA 2A7CA 5HGGA 1KDQB 1GG6C 5GXPA 1W10U 1AHTH 2RA0A 5AFZH 1C5NH 1FLEE 2Y5HA 1GBJA 2ZCHP 1SC8U 1SGTA 2BVSH 4ABEA 2BY9X 1EJNA 1A0JA 3SU3A 5J4SA 2Z6BD 1IQFA 1TB6H 3BTHE 2XCFA 5AF9H 3PLBA 1OOKB 1BTHH 5E8EH 1VITG 2FTLE 5A2MH 2FYRA 4RKJB 3SV2H 1SGNE 3LGUA 1BRAA 2V35A 1C1MA 4ABJA 3A83A 1A4WH 5FPTA 1N1LA 1C5MD 5AHGH 1O2KA 5DKMA 3Q3XA 4MPXA 2PUQH 1C1NA 2CGAA 2XNIA 3SQHE 1YLCA 4JZFH 1JIMA 3T27A 1VCQA 3A87A 2O8TA 3RXUA 1YPMH 5GCHF 4CHAC 3ZVBA 1CHOG 1ZYOA 1SOZA 2Z94A 5C1UA 2OLGA 2HPPH 1C2MA 1ELDE 3KNXA 2ALVA 2ZTZA 1D3PB 2SNWA 4HGCA 2ODPA 4Y0YE 1AKSA 5K0HA 5LPRA 2H9HA 3H5CB 1O3NA 4O9VA 3URDA 4NG9H 2WPJS 4X6MA 1KLJH 2HRVA 2STBE 1BMNH 3MNCA 1JBUH 1GG6B 2FXRA 3A7VA 4B71A 1GL1A 1DDJA 2P3UB 4YT7H 1V2JT 2ANYA 3HGNA 4K60A 3RLWH 1HV7A 2QC2A 2GP9B 4ZH8A 1W13U 1NRSH 1O38A 1GJ7B 1T4UH 1AE5A 2Q1JA 3LGTA 1BT7A 1HAVB 2BD9A 1RTFB 1DVAH 3A85A 1C5XB 5GIBA 3S9BA 1GBTA 1WTGH 3BTWE 3N7OA 8GCHG 1G32B 1HAYB 1O2SA 3M3SA 3EDXB 4X0WU 1DUAA 1AD8H 2VWOA 1JMOH 2ZDLA 3DFJA 2UUYA 4Y8ZA 2VWLA 3MO3A 3U8OH 1LHCH 1WQSA 1MAYA 4Z6AH 2A2XH 5A0AE 2P94A 3Q3YA 4OS7A 2SGEE 2GV6A 1W0ZU 2BLVA 1K1IA 2VIQA 3EE0B 1AKSB 4ZAEA 1ZHPA 4PROA 1XXDA 1HAPH 1P03A 2VWMA 1O3HA 2ZFSA 3ZZ3A 1Q2WA 1GVZA 2QY0B 4A1XA 1HYLA 2IN2A 4K5ZA 1WOFA 3PO1C 1O2IA 1CT4E 1WBGB 3TGIE 1LHFH 1EJMA 1S6FA 1SB1H 1MZDA 1GJ5H 1NT1A 3RXTA 4OS5A 1TGSZ 4X1NU 2ZKSA 1PYTC 1O39A 1XKBC 2BDGA 2OBQA 3SN8A 2A5KA 1LTOA 4XE4A 5A0CA 1UHBB 2FZZA 2VIWA 1UTOA 1TX6A 2ASUB 1UTMA 3GYLB 5F8XA 4RKOB 4WMEA 1ARCA 3B23B 4ZHAA 4GAWA 3D62A 1P12E 2BDAA 3CP7A 1V2UT 5BPEA 3ZZ5A 1Z8GA 2C90B 3SGQE 1UVSH 3E91A 1C4Y2 1MAXA 2FS9A 4UD9H 3TU7H 3UR9A 2HNTE 1AFQC 1T8MA 1YPEH 1KXFA 2BDBA 1CU1A 1EAUA 3RP2A 4CRFA 1SFQB 1O33A 3ZVGA 3LGIA 1MTSA 3LJJA 2AIQA 1ZJDA 1ANCA 4FUCA 2CF8H 1O3MA 4INKA 5JBBS 1NU9A 1C5TA 1QFKH 1HXEH 1PQ8A 4NFEA 2JKHA 1GHVH 1O5EH 3LGYA 1A5HA 2ZDAH 1MTUA 1UVPA 1YCPH 3U9AH 4AGJA 3A80A 3T5FH 1GI4A 3M35A 3SI3H 2SGFE 3BEUA 3SO3A 5CHAC 2YNAA 1C5QA 1GHYH 4BAMB 1O5AB 1MH0A 1RRKA 2J9NA 5DP8A 4AOQA 4BAQB 2HOBA 1WCZA 1PPEE 4ISOA 3BEFB 1H8DH 1PJPA 1UTNA 5DJ7A 1VR1H 2FI4E 2NWNA 1TX7A 1Y3VA 2WPMS 4BNRA 1LMWB 1UTPA 3U69H 2CN0H 1B7XB 3LJOA 1G2LA 1S85A 1XXFA 5JBCS 4Q2KA 3M7QA 3P17H 3M5MA 1GHWH 4BAOB 2BOKA 1LCYA 4Y8XA 1ANEA 4WMDA 3PYHA 1GMCG 4CBOA 2XBVA 3MH5A 4JMYA 1W0YH 2OBOA 1ZTJA 3QN7A 2VIDA 3RXHA 1SPJA 3DHKH 1THPB 3MO9A 3M5NA 3SGAE 1CVWH 1O3GA 2UWOA 1EATA 1INCA 1DY9A 4BTUB 3FP6E 2WINI 5E0GA 1DANH 1D6WA 1GHXH 3HATH 1A5GH 2UUFB 3GOVB 2XC0A 4CRBA 1EX3A 3S0NA 5F8ZA 3T28A 2NU0E 2QYIA 4XBDA 3GCOA 3TJUA 1G3DA 1AN1E 2JH5D 3PB1E 2CV3A 2FO9A 4B75A 1P01A 1TPSA 5CHAB 2OC0A 3FZZA 4I32A 4WF8A 3SORA 4JZEH 1SR5C 1SLUB 1J9CH 3IG6B 2C8WB 4XOJA 1GJ6A 1GBHA 3UTUH 4X1QU 3A81A 1P3CA 3LU9B 3SNBA 2QA9E 1Y3UA 3P92A 2QN5T 1ESBA 3RXQA 1UK3A 4AB9A 2SGAA 1HCGA 5DP3A 4CREA 1EPTC 2F91A 7GCHG 1YM0A 2CMYA 2WYJA 4GHQA 1QR3E 2W3IA 4H6TA 2ZECA 3MU4A 1WV7H 2XRCA 1BBRE 1TQ0B 5FPSA 3HK6B 1C5VA 2FOHA 1K1PA 3L3TA 3LONA 3E3TA 1SGQE 1ELCA 3UIRA 1EASA 2GKVE 1MBMA 1O3JA 4IBLH 4KTCA 3SUGA 3TK5A 4R0IA 1C2HA 3FAOA 2ZDVH 2EEKA 4K1EA 2FPZA 1WQVH 1O2UA 1C5PA 4AFUA 1OYQA 3BIUH 1NRPH 2FOFA 3EA7A 1GDQA 1EP5A 1NTPA 2ZHFH 5F8TA 3UREA 4SGBE 4YOIA 1TALA 1SQTA 5A09A 1OPHB 1SG8B 3H7TA 1CA8B 1P09A 1OWEA 1RIWB 4CR5A 1YBWA 4Y7BA 3RXIA 1LHEH 3QZQA 2O8MA 2YOLA 4INHA 2AMQA 3RMNH 1BJUA 3RU4T 4NWLA 1HPGA 1UVUH 4Y6DA 4DURA 1ABJH 1CT2E 1SFIA 1ELFA 1O3LA 1WU1A 1AVGH 2AEIH 3SV9A 3PV4A 3TITA 2FODA 3RXBA 1CT0E 1TYNA 4X8VH 4YO9A 3GY3A 3GY4A 4AFSA 1Q3XA 3SJ8A 3OYPA 4D7GA 1NN6A 1HJ9A 3EGKH 2B9LA 1KTSB 5DP6A 1ZHMA 4X1SU 3RXLA 1K9OE 1CGIE 4AG2A 1T8NA 1ETTH 1XUIA 2GCHF 1XUGA 3PROA 4F49A 1C5RA 1O2NA 3GY5A 1MQ6A 1S0QA 1O5BB 2TIOA 2ANKH 4X6PA 3KN2A 4D9QA 1SVPA 2BY5X 4MG3A 2FX6A 6CHAB 1ESTA 2TPIZ 3ZZ7A 3GY6A 3TH4H 2ZFRH 5AVDA 2G81E 5EU8A 1CBWB 1UK2A 1S6HA 2O8LA 3GY7A 2ZWLH 3RM2H 4DW2U 1TNHA 2AGEX 4E05H 1TBRH 1G36A 1O30A 4ABHA 1OSSA 4X2YA 2J94A 1G9IE 2WUBA 1JRSA 1YP9A 4FUJA 2THFB 1IHTH 1SI5H 3KQCA 2Y7ZA 1C1OA 2ZGCA 2G4UA 3SHCH 3LC5A 2ZQ1A 1W2KH 1G37A 2O8UA 1BMLA 1EB2A 1VITF 1LVOA 2FOBA 4FUHA 3VEQB 3ZV8A 2BX4A 1EZSC 4E7NA 2BTCE 1OKXA 4X2XA 2OQ5A 1AUJA 1F5RA 1J8AA 3MH4A 5EQRA 5DP9A 4HI3A 1AQ7A 3MH7A 1W12U 4BAHB 4K1SA 1UMAH 2Y80A 3Q00A 1YKTA 3RM0H 2ZF0H 3BG4B 3GY8A 2WV4A 2BD4A 3GCTG 2ZGJA 4ZROA 1V2VT 4AX9H 4JK5A 1E37B 3RXDA 5JDUB 3BG8A 5EXLA 2BD5A 5ABWA 1YPGH 2H5DA 1QJ7B 3QTOH 4CH8B 4HFPB 4NCYA 1C5LH 2ODYB 1TAWA 3KHVA 4A5TS 2FYQA 1PPCE 2O9QA 1W11U 1GCDA 4DVAU 4Z0KA 1CE5A 1WAYB 2ANWA 2VVUA 4DOQA 3ZZ4A 1BBRH 5C20A 2SGQE 4ISLA 1TQ7B 1AU8A 4YZUA 2LPRA 2BOHB 1L1NA 4CRDA 4I8LA 4YTAA 4ABGA 8GCHF 1JRTA 3I29A 2R0KA 1NFXA 4IGDA 2ZP0H 1SGEE 1UCYE 4MPVA 2NU1E 8KME2 5HMAA 4XBBA 2XCNA 4O3TA 2AYWA 1ANBA 1MD8A 2W3KA 3E90B 1L2EA 4Y79A 1TPAE 2ESTE 3PMHB 1S0RA 2GCHG 1O2ZA 1SMFE 2BD2A 2P3FH 4F4OC 1V2WT 2BY7X 2WPHS 2ZU3A 1FIWA 3S9AA 3NKKA 1GJBB 1YCPM 1AWHB 2PGBB 5L2YH 4IN1A 1GBEA 3V3MA 2Z9JA 3P8GA 3S7HB 3TJNA 3P6ZB 2GZ8A 4ZKNU 1GBAA 1FJSA 3RXVA 6GCHG 2QXIA 1P06A 3QZRA 1QB6A 1TNIA 2BQ6B 2B0FA 4DCDA 2OXSA 5HYOA 1P0SH 1IQIA 1QRWA 1TPPA 4BANB 1DITH 1T8LA 1Z6JH 3A82A 3MFJA 1AFEH 1OX1A 1W8BH 1BA8B 4FUFA 3RXKA 1S81A 5GWZA 1MKWK 1QJ1B 1AB9C 4IMQA 5L6NH 2HWLB 2Y81A 3DA9B 3KCGH 2EA3A 1HAXB 1ZMJA 3ZZ6A 2HNTC 1FIZA 3RU4E 2VJ1A 1MU6B 1C1TA 1FQ3A 5A8XA 3UY9A 1E35B 1HB0B 2ZPSA 1NRNH 1YPLH 1HAVA 1O2PA 3UFAA 4D8NA 1V2RT 4J2YB 3RXPA 1V2LT 4KGAA 3ZYDA 2AH4X 1KXAA 2ZHWH 3M5LA 4U2WA 2Z9IA 2R2WU 2PTCE 4AZ2B 4B2CA 1OWIA 4TYDA 1ZTLA 2XBYA 1MD7A 1SQAA 5A0BA 1F0UA 4Y7AA 4NSYA 3QGJA 1BRUP 3K9XB 3TPIZ 2QGRA 1C2DA 4Q80A 2XBXA 3OY6U 3SV8A 1ELEE 3HK3B 3T62A 4ABFA 1C2KA 2ZU1A 1MCVA 3A8DA 1N6YA 3ATWA 4GSOA 1TWXB 3UNSA 3V13A 3ZZBA 1ELTA 1D6RA 4Y76A 5FCRA 2A7JA 1BTPA 1B0FA 1TLDA 4M7GA 1PYTD 1O36A 4XSKU 1EB1H 3HKIB 1ZLRA 3A88A 5EGMA 2QF0A 1QIXB 3LH3A 1O32A 3LPRA 4AN7A 5A8ZA 1GMCF 1QRXA 2ZU2A 2PWXA 2HNTF 2WPLS 1O35A 2H9TH 4YM9A 4IS5A 2R3YA 3KF2A 2PR3A 1UHBA 2P93A 1LHDH 1PQ7A 4YESB 3CS7A 6LPRA 1O34A 3EA9A 1UO6A 1JWTA 1D9IA 3F9HA 3M3VA 3VB4A 3KQBA 1BDAA 3DT0H 1EJAA 3BN9A 1ZPBA 1O0DH 3VXEH 5C2ZA 3I77A 2ANMH 4CRAA 1GI1A 2FIRH 3SJ9A 1Z8JB 4E06H 4JZIA 2W5EA 1FAKH 1ZMLA 4CHAB 1DWEH 1P2OA 4B76A 1DXWA 1LPKB 1A3BH 2PKSC 2SFAA 4O3UA 1YYY1 3HGPA 2A4GA 1K1JA 1XUFA 3MHWU 1RXPA 3PMBB 1W7GH 1LPZB 2GVFA 1P2MA 4ISIH 1UCYH 1A7SA 2LNCA 2BLQA 3A7TA 3SQEE 4CBNA 1VITH 3T26A 1LKAA 1Z6EA 2ZPRA 1P2KA 2VH6A 4ZHLU 2H1UA 2ZU4A 1NESE 5HM9A 3F68H 2FI5E 1L4DA 5HXFA 1GJ8B 2GT8A 2VVCA 4OS4A 2H6MA 1H9IE 3UQVA 7GCHF 3RMLH 1HAGE 1MKXK 3S7KB 1FY8E 1JOUB 4ABIA 1O3PB 2GZ7A 2ZNKH 2W7UA 2ZTYA 4D76A 1F0RA 3T25A 1T8OA 2GGVB 1SGFA 1IQJA 1S5SA 1LHGH 3OSYA 3BTKE 2VU8E 4QT8C 3MMGA 3LT3A 4MDSA 2VNTA 3RXCA 2ZHEH 3S9CA 2BY6X 7ESTE 2BVRH 4X6OA 1C2LA 1BMMH 1Y5UT 4MQAA 3PO1B 2XBWA 2Q6DA 3UNQA 4WH6A 1C9TA 3G01A 1QTFA 3TJOA 4AYYB 1TMUH 1W14U 3BTGE 1CGHA 5FCKA 2FOGA 3DUXH 5LGOA 1NRRH 2FI3E 5FBIA 4I7YH 3D65E 1QCPA 1O2JA 2BM2A 2DE9A 1B5GH 2GZ9A 3BTME 3P8OA 1EAIA 1TX8A 2ZFFH 2H9EH 1P02A 3MU1A 1EAWA 1AWFH 1K1NA 2ZA5A 1QL9A 2ZIQH 2WPKS 4MPUA 1MMJN 1G3CA 2R2MB 1IQNA 1XUHA 3ZVAA 1U6QA 2ZGXH 4LXBH 1AVWA 3U1JB 3NPSA 3K6YA 2KAIA 3OU0A 1AFQB 3U8TH 1AVXA 3UUZA 1GGDC 1O5CB 2FS8A 3E16B 2BB4A 1O2OA 5DP5A 4Y10E 5C1XA 2Y5FA 1DWCH 1TGBA 4GPGA 1BUIA 3E0PB 3JZ2B 3SV6A 2W7SA 3UOUA 2NU4E 1PQAA 1DT2A 1HAHH 1V2NT 4I33A 2V6NA 3AW1A 3MYWA 5DGJA 2NU3E 1A1RA 1A46H 3BEIB 4X1PU 3K2UA 2FLRH 1GCTC 1BTYA 4RSPA 3VGCC 1C1RA 2QXJA 1MU8B 1OP0A 1QQ4A 4XBCA 8LPRA 1H1BA 2Z7FE 3U1IB 1OWKA 3A7WA 2UUKB 1TA6A 1MTNC 3TH3H 1ZPCA 2G4TA 1LDTT 1NROH 5TCAA 2KAIB 2PW8H 1C5OH 1HUTH 4NFFA 1BCUH 2R9PA 4THNH 2FOEA 4OS1A 3SU5A 1Y59T 4BOHA 1O3KA 5JBAS 4XFQA 2OC7A 4DY7B 2XWBI 3O8RA 1OWDA 5C3NA 3QX5H 4OGYA 2FM2A 1ARBA 3VB6A 3SNAA 1RJXB 1ORFA 1BOQA 1GGDB 1AGJA 2G00A 4MNVA 3GCTF 2BD7A 2YNBA 1H4WA 3LC3A 1TGTA 2VIOA 3FVFB 1BITA 1RGQA 1A0LA 1EPTA 4FU8A 2EI8A 1HAOH 1UJ1A 2I6QA 2QF3A 4Q7XA 3ZVCA 3RXFA 3SUFA 3GCHC 3NWUA 1ZMNA 1ACBE 4KP0A 2ZGBH 1QGFA 1W3CA 1PPZA 3P70B 3M7TA 1GBCA 2CF9H 3UWIA 2D2DA 2ZDNA 5HM2A 1C1QA 1C9PA 2F83A 4FXGH 4MNXA 4MPWA 1P2IA 1F2SE 1GBLA 1GI9B 3ENSB 4H42U 4UDWH 5JYIA 3AW0A 1Y5BT 2F9UA 1Y3WA 3VGCB 1GCTB 1GMDF 2OTVA 1MTVA 1K1LA 4U30A 1LVYA 3VB5A 1OS8A 2OCVB 1J16A 1K2I1 2PFEA 4X6NA 1XMNB 5LH8A 1BTZA 1SHHB 2CJIA 2SGPE 1BTUA 5BRRE 2QXHA 1MBQA 3S69A 4AFQA 3UPEA 1KSNA 3A84A 1C5YB 5EODA 4GCHF 2FDAA 1S83A 5TCCA 4GHTA 1VJ9U 5F03A 1GJ4H 1K21H 1ABIH 1ETRH 4JCNA 1UTLM 2BDIA 1OWHA 2XTTB 1EPTB 1QJ6B 5G4BA 5EQQA 5C1YA 1EAXA 3SJOA 1A61H 1SQOA 3LGVA 3V7TA 1C5UA 4WMFA 9LPRA 5F6MA 2JETC 3SI4H 3TNTA 2FP7B 2ZZUH 1GBDA 3ZVDA 3W94A 1RD3B 1XVMA 3EA8A 4OGXA 4MVNA 3NCLA 5GDSH 5SGAE 5JPMH 1ELBA 1VGCC 2ZGHA 1FY5A 1KYNA 3RC4A 2GCTC 3O8DA 1BJVA 2IJOB 5EOKA 2UUJB 6GCHF 1LKBA 2XYAA 3B9FH 4U01A 1ELAA 4ZKRU 4B1TA 2QXGA 1GBKA 1SSXA 4YLQH 5EXNA 1TA2A 4KELA 4U32A 2JH0D 1EKBB 2GX4A 1GMHG 2ALPA 3ATKA 2Z3CA 4CRCA 1T31A 1CHGA 4O97A 1V6DA 3PTNA 1O3BA 4WXVA 3TLOA 1OP2A 4Y8YA 1ZRBA 1HNEE 1P9SA 1AI8H 3EAJA 3BV9B 1EOJA 1F5LA 2AGGX 2RG3A 1UTQA 2Y7XA 4HTCH 4MNWA 1BTWA 3A89A 1GBMA 4INLA 1KXEA 1LQEA 1QB1A 1WTHD 1IQHA 2EI6A 1VZQH 4BAKB 5DK1A 2GTBA 2HLCA 3C1KA 3KEEA 4HZHA 5JB9S 3SGBE 2ZQ2A 1Z7KA 2JETB 3MNXA 3R0FA 2FWWA 2GDEH 3I78A 1GWAA 1ZZZA 1E34B 3HPTB 1TMTH 3PMAB 3MI4A 4ZXYH 1GHAF 1F7ZA 2Z3DA 2ZI2H 2ZG0H 4Q7YA 1SGCA 1IQGA 3UQOA 4ZHMU 3K6ZA 1VGCB 2NU2E 5FHTA 1G3EA 2GCTB 2PUXB 2G51A 3BTEE 1C2JA 1DE7H 4UFEH 3M61U 4GLYA 3IWMA 1H9LB 1FONA 1P11E 2VVVA 4GVUA 1HJAC 3PMJA 4VGCC 3GDVA 1A0HB 1GPZA 5I25A 2PLXA 1GMDG 2HVXA 3ESTA 4WVPE 3LKWA 2B8OH 5GJ4B 2C8ZB 3M37A 3VB7A 4TWWA 4ZKSU 4FU7A 5C67A 1YPHE 2J38A 4A7IB 1GJ9B 1XVOA 2BDHA 1DSUA 4GCHG 1FI8A 1O37A 4WY3A 2OC1A 1GHBG 4I8JA 3ZZ8A 1XKAC 2C4FH 1NFYA 3Q3KA 1ZHRA 3F6UH 1IHSH 4FUDA 1NO9H 1K1MA 2F3CE 2FLBH 3SW2B 4FU9A 4DT7B 1KXBA 2ZFQH 3SBKA 1O2WA 1THSH 1YF4A 2G5NA 1AIXH 5EW2H 4ZXXH 1TE0A 3T29A 4TPYA 1C2GA 3RXJA 3Q77A 4BXWA 2W26A 4KTUA 1LQDB 4ISHH 3LOXA 1NC6A 3RMOH 1DOJA 4IC5A 1DUEA 3MNSA 2I6SA 1XUJA 3R3GB 4TPIZ 3RXGA 2WV5A 1QB9A 4VGCB 1V2MT 1P04A 1QNJA 5JB8S 1BHXF 2V3OH 2BX3A 2STAE 3PLPA 2VIPA 2BVXH 1SBWA 3MU5A 4JYVH 1L0ZA 1BHXB 4BTTB 5JBTA 3O8CA 2BDCA 4AGKA 4NIVA 1O31A 4SGAE 1O3IA 3BTFE 4NGAH 1GL0E 2VIVA 1GJAB 3LDXH 1HXFH 1KY9A 1Z8IB 1FN8A 1ANDA 2GT7A 1PPHE 4ZKOU 1AUTC 2ZC9H 4H6SB 1TMBH 4IC6A 1BTXA 3UWJH 4K3JA 1HIAA 5J4QA 1Y3YA 5C5OA 3SU4A 4MNYA 2J34A 2ILNA 1O3DA 1QQUA 4LK4A 1AZ8A 1CO7E 1Z71A 5EW1H 1YCPK 2C8YB 1NFUA 4NZLA 2F9VA 3ATIA 3EYDA 1DFPA 4ABAA 1GI5A 2A45B 1TRYA 5E2PA 1HDTH 1Z1JA 2ZHDA 3M3TA 4NIYA 1GHAG 1B0EA 2D1JA 3AASA 2Z9GA 2HPQH 3KQEA 3E0NB 3JZ1B 4ZUHA 2G52A 1HRTH 1GI2A 1PPGE 3SUEA 1MUEB 3A86A 1ZSLA 1O2XA 5AFYH 1TNKA 1EZQA 5H4IB 1LVMA 4WXIA 1FNIA 1YLDA 1TNGA 1FV9A 5IYTA 2AIPA 2ZFPH 1HIAB 4UFGH 1TOCB 3FP8E 2UWLA 4K69A 4ESTE 5LPEA 4UEHH 1V3XA 2A4OA 4KKDA 4KTSA 1GI0A 1AB9B 2ODQA 2BY8X 4UE7H 1OP8A 3ZV9A 1RTKA 2Z9LA 3VPKA 2BQWB 1UTJA 3ZYEA 2FOMB 3QUMP 2G5VA 3A7ZA 3A8BA 3BF6H 1C2IA 2QIQA 3M5OA 3A7XA 3E8LA 3BSQA 1TIOA 2BXTH 2FX4A 1O2GH 4X8UH 1OYTH 3ODDA 1IQMA 1C2FA 4WH8A 3SNDA 3CENA 1NRQH 2BXUH 3QTVH 2Y6TA 1TBZH 2SGDE 3GY2A 2BLOA 1ZGIA 3URCA 3VXFH 1UTKA 4I8GA 3MWIU 4DJZB 2FMJA 5PTPA 4YT6H 1V2OT 5E2OA 1O2MA 3GICB 1D3DB 4XDEA 1IQLA 1QBNA 2AMPA 1BIOA 2OC8A 1J15A 1FY1A 3DFLA 2A4RA 2V0BA 2ZCLP 4ZMAH 4TY7A 5FBEA 2J95A 2G55A 3RXMA 1EOLA 1ZGVA 2A4QA 2Z9KA 2H2ZA 3BIVH 1X7AC 4WWYA 3V12A 1HAIH 2BD8A 4LOYH 1C1PA 2XC4A 4K8BA 1ELVA 1YPKH 1RTLA 3MOCA 1GI6A 1IQEA 1BB0B 2F9PA 1GI8B 4D9RA 3TJVA 2TGAA 3BTTE 1E36B 3PTBA 3QWCH 2P8OC 3FP7E 5A8YA 3A7YA 1L4ZA 3PLKA 1ELGA 3M7UA 4A1TA 3A8CA 3VFEA 1LPGB 5ESBA 3RMMH 1SLXB 4BXSA 2R3UA 1DM4B 3RC5A 2PSYA 2ZTXA 1THRH 1F0TA 1XM1A 1K28D 1O3FA 3GCNA 1P9UA 1FY3A 1MKWH 1DXPA 2WPIS 3PM3A 3GISB 2PKSB 2OP9A 1V2PT 3STIA 1Z8RA 3MH6A 2EC9H 1SOTA 1TOMH 1KIGH 1HGTH 1BQYA 2FOCA 2TGDA 3F9GA 1FDPA 1PPBH 1PFXC 4NA8A 5EG4A 3TVJB 1DLKB 2VINA 2PGQB 3HKJB 1NM6A 1EP6A 1Y8TA 7LPRA 5T6GA 1CSOE 1YPJH 2OQUA 4B73A 1O5FH 2DUCA 4CH2B 1D3TB 2J92A 4TWYA 2R0LA 5GCHG 5FX5A 2TGPZ 1AZZA 2F9OA 5ESTE 1Y3XA 3E1XB 3VB3A 2OUAA 1WUNH 3KGPA 1CGJE 2WUCA 1NY22 1FPCH 1SGDE 2A7HA 3OX7U 1C5SA 3QLPH 1GI3A 1HBTH 2A5AA 2OINA 2GV7A 2C3SA 2P8OB 3ZZAA 2ZEBA 2G8TA 3FANA 1ETSH 3QDZB 1AY6H 1CA0C 1NZQH 1BMAA 1FN6A 3NXPA 1C5WB 5FPYA 3TH2H 4AYVB 1O2VA 2GMTC 1GJCB 4K2YA 2ULLA 1H9HE 5E0HA 1UVOA 1ZPZA 5B6OA 4JK6A 2P3TB 1GBFA 4O03A 1Z1IA 3ATMA 4Q7ZA 3UOPA 1AMHA 1MZAA 1YGCH 3SUDA 2BYAX 4Y71A 2CXVA 4IN2A 1W7XH 4A1VA 2ZU5A 1DX5M 1TRNA 3P95A 3IITA 4JYTA 4X2WA 5E0JA 3RXOA 3UNRA 1QY6A 1TABE 5EXMA 5TJXA 4DGJA 3NK8A 3AVZA 2BDYA 1P05A 4FVBA 2BHGA 3ZVEA 3RXSA 3NUMA 2Q6GA 1ZRKA 2H5CA 1GMHF 4ISNA 4JYUH 3TK6A 1LVBA 3TNSA 2V3HH 6ESTA 2VGCC 1Y5AT 1ZR0A 1T4VH 3RXAA 5ETXA 2VWNA 1VCWA 1GDUA 1A5IA 3WY8A 4DIHH 2PHBA 4D7FA 1KLIH 1FAXA 1P10A 4ABDA 3BTDE 4JZ1A 1L1JA 1EZUC 3CS0A 3ITIA 2A0QB 2ZO3H 1ZSJA 1RIWC 2A31A 3RDZA 1DLEA 1QURH 3EQ0H 1LO6A 3L6PA 1EUFA 4BTIB 2Q6FA 2GD4B 3W95A 1C2EA 1N6XA 1QA7A 1FZZA 5GPIB 5L30H 2AMDA 7KMEH 3TIUA 2K1QA 1FUJA 2C8XB 5T6DA 1GI7B 3SU6A 1CA0B 4NSVA 1DY8A 2SNVA 2FOAA 2GMTB 1SGIB 2IOTA 1TNLA 1FY4A 1T32A 3LGWA 1MTWA 1NU7B 4J1YA 1NFWA 1HAZB 2A32A 3L33A 3QK1A 3K65B 4WJG2 4FUEA 1VCPA 1C5ZB 1SLVB 4OS2A 3ODFA 3U8RH 1C4V2 1FXYA 4X2VA 3FZDA 5C5NA 3C27B 2AERH 1MKXH 1TGCA 3TGJE 2AFQB 2BMGB 1BBRK 1SLWB 3DD2H 1JIRA 1E38B 2WYGA 3T2NA 4B2AA 3MU0A 1F5KU 2RA3A 3ELAH 3GDUA 1H8IH 5I46H 1D3QB 4NA7A 1BRCE 3OY5U 1PPFE 2VGCB 4NWKA 3RLYH 1V2KT 3Q76A 6CHAC 5IDKA 2P95A 1P3EA 2OD3B 3KQDA 1RFNA 1S84A 2BZAA 4YOGA 3D49H 3RXEA 1A3EH 1J17T 1KXDA 3RXRA 3SNEA 1O3CA 1MTNB 3LH1A 1CBWC 1YPHC 5L2ZH 4R8TB 1AO5A 4K1TA 2QCYA 4NA9H 1ZJKA 4YLUA 2ZCKP 3SNCA 1NS3A 4I8HA 4X8TH 4UFFH 1GHBF 1TPOA 1TRMA 4A6LA 3RU4D 2ZDMA 1V2ST 1F92A 2AS9A 1GVKB 2BD3A 4OS6A 1FMGA 5DP7A 1QL8A 2EI7A 5K7RA 1C1WH 1O2YA 1D4PB 1G2MA 2P16A 3P8FA 3STJA 1O3OA 3H7OA 4B74A 1SGFG 2ZHQH 1DSTA 5CMXH 3SU2A 1DPOA 2F9BH 3M36A 3MU8A 1N8OC 3GCHB 1VJAU 1SGYE 1QBOA 1DS2E
chains in the Genus database with same CATH superfamily
3O8BA 8ESTE 1FPHH 2BZ6H 1GBIA 2D26C 1WXRA 4UONA 1RS0A 2A5IA 2XNDD 1AE8H 1P8VC 2W6JD 3BG4C 1SHYA 2FTMA 1GVLA 2ZDKA 2AGIX 3SHAH 4A92A 2QV1A 1EQ9A 1O5DH 1O2HA 2Y82A 4AFZA 3MO6A 4B2BA 1HFDA 2PTNA 2HGTH 1SGRE 2B5TB 4Y11E 5EPYA 2ZPQA 5T3HA 4CRGA 2J4IA 5FX6A 4FUIA 1PQ5A 3D23A 1OXGA 1EZXC 2FEQH 1A2CH 1Q31A 4DIIH 1J14A 1K1OA 1MQ5A 5EPNA 1O2TA 1F0SA 2RDLA 4AG1A 2A1DB 1G30B 1V2QT 2PSXA 3RC6A 4FETA 1XX9A 3GYMA 4DG4A 3UR6A 1DICA 1V2TT 2Z3EA 3FFGA 2TGTA 1CQQA 1TFXA 4TY6A 3F9FA 3RUOA 3KIDU 4IW4E 1QBVH 2M5TA 1UK4A 1QRZA 1P2QA 5CE1A 1QHRB 3GDSA 3TK9A 1EXFA 1SL3A 1BRBE 2PV9B 1MCTA 2HALA 4I31A 4MTBA 3SJKA 1KTTB 3SOSA 1TGNA 1WSSH 5HIZA 1KXCA 4GUXA 4ABBA 3MTYA 1N8OB 2TRMA 1P2NA 1K22H 2O8WA 1S82A 2CHAC 1OWJA 3E6PH 1YLNA 1JXPA 2A2QH 1P57B 3QGNB 5C94A 3KL6A 1BZXE 4FOUC 1NPMA 4Q4LA 1O2RA 1UVTH 2XXLA 3U98H 1C1SA 1CHOF 2D8WA 1C1VH 2KCYA 1ZTKA 4FUGA 1ESAA 2RCEA 1GHZA 2XC5A 1DWDH 2C93B 1P2JA 4E7RG 2V3MA 3F0OA 4AB8A 4NIXA 2UWPA 2TBSA 1ZOMA 3SV7A 1HLTH 1O2QA 4ACAA 1C1UH 4K8YA 3LIWA 2JJ2D 4M9FA 4IMZA 1GJDB 1QA0A 3ZZ9A 3BTQE 4LZ4B 2XW9A 4ASHA 3AAUA 1KLTA 2FESH 1E0FD 1O2LA 1SGPE 4YOJA 4H4FA 2KCPA 3V0XA 3SJIA 2Y5GA 5DPAA 5GNDA 1TNJA 2BLWA 2F9NA 3SU1A 4NZQA 3QO6A 4FUBA 2XWAA 2PP6A 1GDNA 4I8KA 2PKAA 4Y0ZE 1XUKA 3PWCA 2KR7A 1KDQA 2BQ7B 4ACBA 3N99A 5FXLA 1O3EA 1ZSKA 5DP4A 2GDDA 5FAHA 3SU0A 4LZ1H 3ZVFA 1YC0A 4NIWA 4RN6A 3TGKE 1WYKA 4AORA 5DO4H 1M9UA 2J2UA 4X1RU 2QAAA 3B8JA 2CHAB 2ZFTA 1UCYK 3F1SB 1TONA 1IQKA 1L1GA 5LPFA 1O3AA 9ESTA 4UFDH 1HJ8A 1IAUA 2VH0A 2B7DH 2DE8A 1GBBA 1T7CA 3F9EA 1HJAB 5DG6A 2JH6D 5T6FA 3MNBA 3AAVA 3SZNA 2VB0A 1QL7A 5EQSA 1TBQH 3A8AA 3ATLA 1DWBH 3ZZDA 2WZQA 4CR9A 3NZIA 1IOEA 3PWBA 4X8SH 3ZZCA 2P59A 4JZDH 4FVDA 1G3BA 3OTJE 4MLFB 1C4U2 1ID5H 1O5GH 5DSFA 2PKAB 2IPHA 3P8NA 4I86A 4Z1MD 2A7CA 5HGGA 1KDQB 1GG6C 5GXPA 1W10U 1AHTH 2RA0A 5AFZH 1C5NH 1FLEE 2Y5HA 1GBJA 3DSOA 2ZCHP 1SC8U 1SGTA 2BVSH 4ABEA 5C0UA 2BY9X 1EJNA 1A0JA 2WV9A 3SU3A 5J4SA 2Z6BD 1IQFA 1TB6H 3BTHE 2XCFA 5AF9H 3PLBA 1OOKB 1BTHH 5E8EH 1VITG 2FTLE 5A2MH 2FYRA 4RKJB 3SV2H 1SGNE 3LGUA 1BRAA 2V35A 1C1MA 4ABJA 3A83A 1A4WH 5FPTA 1N1LA 1C5MD 5AHGH 1O2KA 5DKMA 1E79D 3Q3XA 4MPXA 2PUQH 1C1NA 2CGAA 2XNIA 3SQHE 1YLCA 4JZFH 1JIMA 3T27A 1VCQA 3A87A 2O8TA 3RXUA 1YPMH 5GCHF 4CHAC 3ZVBA 1CHOG 1ZYOA 1SOZA 2Z94A 5C1UA 2OLGA 2HPPH 4P00A 1C2MA 1ELDE 3KNXA 2ALVA 2ZTZA 1D3PB 2SNWA 4HGCA 2ODPA 4Y0YE 1AKSA 5K0HA 5LPRA 2H9HA 3H5CB 1O3NA 4O9VA 3URDA 4NG9H 2WPJS 2RDEA 4X6MA 1KLJH 2HRVA 2STBE 1BMNH 3MNCA 1JBUH 1GG6B 2FXRA 3A7VA 4B71A 1GL1A 4ZCNA 1DDJA 2P3UB 4YT7H 1V2JT 2ANYA 3HGNA 4K60A 3RLWH 1HV7A 2QC2A 2GP9B 4ZH8A 1W13U 1NRSH 1O38A 1GJ7B 1T4UH 1AE5A 2Q1JA 2YMSC 3LGTA 1BT7A 1HAVB 2BD9A 1RTFB 1DVAH 1E1QD 1C5XB 3A85A 3OE7D 5GIBA 3S9BA 1GBTA 1WTGH 3BTWE 3N7OA 8GCHG 1G32B 1HAYB 1O2SA 3M3SA 3EDXB 4X0WU 5KECA 1DUAA 2L74A 1AD8H 2VWOA 1JMOH 2ZDLA 3DFJA 2UUYA 4Y8ZA 2VWLA 3MO3A 5DN6D 3U8OH 1LHCH 1WQSA 1MAYA 4XRNA 4Z6AH 2A2XH 5A0AE 2P94A 3Q3YA 4OS7A 2SGEE 2GV6A 5EJZA 1W0ZU 2BLVA 1K1IA 2VIQA 3EE0B 1AKSB 4ZAEA 1ZHPA 4PROA 1XXDA 1HAPH 1P03A 2VWMA 1O3HA 2ZFSA 3ZZ3A 1Q2WA 1GVZA 2EY4C 2QY0B 4A1XA 1HYLA 2IN2A 2IJD1 4K5ZA 1WOFA 3PO1C 1O2IA 1CT4E 1WBGB 3TGIE 1LHFH 3WWFA 1EJMA 1S6FA 1SB1H 1MZDA 1GJ5H 1NT1A 2K0QA 3RXTA 4OS5A 1TGSZ 4X1NU 2ZKSA 1PYTC 1O39A 1XKBC 2BDGA 2OBQA 3SN8A 2A5KA 1LTOA 4XE4A 5A0CA 1UHBB 2FZZA 2VIWA 1UTOA 1TX6A 2ASUB 1UTMA 3GYLB 5F8XA 4RKOB 4WMEA 1ARCA 3B23B 4ZHAA 1YWUA 2YMSB 4GAWA 3D62A 1P12E 2BDAA 3CP7A 1V2UT 5BPEA 3ZZ5A 1Z8GA 2C90B 3SGQE 1UVSH 3E91A 1C4Y2 1MAXA 2FS9A 4UD9H 3TU7H 3UR9A 2HNTE 1AFQC 1T8MA 1YPEH 1KXFA 2BDBA 1CU1A 1EAUA 3RP2A 4CRFA 1SFQB 1O33A 3ZVGA 3LGIA 1MTSA 3LJJA 2AIQA 1BMFD 1ZJDA 1ANCA 4FUCA 2CF8H 1O3MA 4INKA 5JBBS 1NU9A 1C5TA 1QFKH 1HXEH 1PQ8A 4NFEA 2JKHA 1GHVH 1O5EH 3LGYA 1A5HA 2ZDAH 1MTUA 1UVPA 1YCPH 3U9AH 4AGJA 2JIZD 3A80A 3T5FH 1GI4A 3M35A 3SI3H 2SGFE 3BEUA 3SO3A 5CHAC 2YNAA 1C5QA 1GHYH 4BAMB 1O5AB 1MH0A 1RRKA 2J9NA 5DP8A 4AOQA 4BAQB 2HOBA 1WCZA 2KZ4A 1PPEE 4ISOA 3BEFB 1H8DH 1PJPA 1UTNA 5DJ7A 1VR1H 2FI4E 2NWNA 1TX7A 1Y3VA 2WPMS 4BNRA 1LMWB 1UTPA 3U69H 2CN0H 1B7XB 3LJOA 1G2LA 1S85A 1XXFA 5JBCS 4Q2KA 3M7QA 3P17H 3M5MA 1GHWH 4BAOB 2BOKA 1LCYA 4Y8XA 1ANEA 3SYJA 4WMDA 3PYHA 1GMCG 4CBOA 2XBVA 3MH5A 4JMYA 1W0YH 2OBOA 1ZTJA 3QN7A 2VIDA 3MQKC 3RXHA 1SPJA 3DHKH 1THPB 3MO9A 3M5NA 3SGAE 1CVWH 1O3GA 2UWOA 1EATA 1INCA 1DY9A 4BTUB 3FP6E 2WINI 5E0GA 1DANH 1D6WA 1GHXH 3HATH 1A5GH 3F2HA 2UUFB 3GOVB 2XC0A 3N7DA 4CRBA 1EX3A 3S0NA 5F8ZA 3T28A 3UAIC 2NU0E 2QYIA 4XBDA 3GCOA 3TJUA 1G3DA 1AN1E 2JH5D 3PB1E 2CV3A 2FO9A 4B75A 1P01A 1TPSA 5CHAB 2OC0A 3FZZA 4I32A 1H8HD 4WF8A 3SORA 4JZEH 1SR5C 1SLUB 1J9CH 3IG6B 2C8WB 4XOJA 1GJ6A 1GBHA 3UTUH 4X1QU 3A81A 1P3CA 3LU9B 3SNBA 2QA9E 1Y3UA 3P92A 2QN5T 1ESBA 3RXQA 1EFRD 1UK3A 4AB9A 2SGAA 1HCGA 5DP3A 4CREA 3F2FA 1EPTC 2F91A 7GCHG 1YM0A 2CMYA 2WYJA 4GHQA 1QR3E 2LP6A 2W3IA 4H6TA 2ZECA 3MU4A 1WV7H 2XRCA 1BBRE 1TQ0B 5FPSA 3HK6B 1C5VA 2FOHA 1K1PA 3L3TA 3LONA 3E3TA 1SGQE 1ELCA 3UIRA 2W6ID 1EASA 2GKVE 1MBMA 1O3JA 4IBLH 4KTCA 3SUGA 3TK5A 4R0IA 1C2HA 3FAOA 2ZDVH 2EEKA 4K1EA 2FPZA 3PRBA 1WQVH 1O2UA 1OHHD 1C5PA 4AFUA 1OYQA 3BIUH 1NRPH 2FOFA 3EA7A 1GDQA 1EP5A 1NTPA 2ZHFH 5F8TA 5FL7D 3UREA 4SGBE 4YOIA 1TALA 1SQTA 5A09A 1OPHB 1SG8B 3H7TA 1CA8B 1P09A 1OWEA 1RIWB 4CR5A 1YBWA 4Y7BA 3RXIA 4ASUD 1LHEH 3QZQA 5EIYA 2O8MA 2YOLA 4INHA 2AMQA 3RMNH 1BJUA 3NRLA 3RU4T 4NWLA 1HPGA 3KYFA 1UVUH 4Y6DA 4DURA 1ABJH 1CT2E 1SFIA 1ELFA 1O3LA 1WU1A 1AVGH 2AEIH 3SV9A 3PV4A 3TITA 2FODA 3RXBA 1CT0E 1TYNA 4X8VH 4YO9A 3GY3A 3GY4A 4AFSA 1Q3XA 3SJ8A 3OYPA 4B6EA 4D7GA 1NN6A 1HJ9A 3EGKH 2B9LA 1KTSB 5DP6A 1ZHMA 2GJGA 4X1SU 1K9OE 1CGIE 3RXLA 4AG2A 1T8NA 1ETTH 1XUIA 2GCHF 1XUGA 3PROA 4F49A 1C5RA 1O2NA 3GY5A 1MQ6A 1S0QA 1O5BB 2TIOA 2ANKH 4X6PA 3UB0A 3KN2A 4D9QA 1SVPA 2BY5X 2KCAA 2FX6A 4MG3A 6CHAB 1ESTA 2TPIZ 3ZZ7A 3GY6A 3TH4H 2ZFRH 5AVDA 2G81E 5EU8A 1CBWB 1UK2A 1S6HA 2O8LA 3GY7A 2ZWLH 3RM2H 4DW2U 1TNHA 2AGEX 4E05H 1TBRH 1G36A 1O30A 4ABHA 1OSSA 4X2YA 2J94A 1G9IE 2WUBA 1JRSA 1YP9A 4FUJA 2THFB 1IHTH 1SI5H 3KQCA 2Y7ZA 5C17A 1C1OA 2ZGCA 2G4UA 3SHCH 3LC5A 2ZQ1A 1W2KH 1G37A 2HLDD 2O8UA 1BMLA 1EB2A 1VITF 1LVOA 2FOBA 4FUHA 3VEQB 3ZV8A 1SQRA 2BX4A 1EZSC 4E7NA 2BTCE 1OKXA 4X2XA 2OQ5A 1AUJA 1F5RA 1J8AA 3MH4A 5EQRA 5DP9A 4HI3A 1AQ7A 3MH7A 1W12U 4BAHB 4K1SA 1UMAH 2Y80A 3Q00A 4TT3D 1YKTA 3RM0H 2ZF0H 3BG4B 3GY8A 2WV4A 2BD4A 3GCTG 2ZGJA 4ZROA 1V2VT 4AX9H 4JK5A 1E37B 3RXDA 5JDUB 3BG8A 5EXLA 2BD5A 5ABWA 1YPGH 3GS9A 2H5DA 1QJ7B 3QTOH 4CH8B 4HFPB 4NCYA 1C5LH 2ODYB 1TAWA 3KHVA 4A5TS 2FYQA 1PPCE 2O9QA 1W11U 1GCDA 4DVAU 4Z0KA 1CE5A 1WAYB 2ANWA 2VVUA 4DOQA 3ZZ4A 1BBRH 5C20A 2SGQE 4ISLA 1TQ7B 1AU8A 4YZUA 2LPRA 2BOHB 1L1NA 4CRDA 4I8LA 4YTAA 4ABGA 8GCHF 1NBME 1JRTA 3I29A 2R0KA 1NFXA 4IGDA 2ZP0H 1SGEE 1UCYE 4MPVA 2NU1E 8KME2 5HMAA 4XBBA 2XCNA 4O3TA 2AYWA 1ANBA 1MD8A 2W3KA 3E90B 1L2EA 4Y79A 1TPAE 2ESTE 3PMHB 1S0RA 2GCHG 1O2ZA 3PV5A 1SMFE 2BD2A 2P3FH 4F4OC 1V2WT 2BY7X 2WPHS 2ZU3A 1FIWA 3S9AA 3NKKA 1GJBB 1YCPM 1AWHB 1YY3A 2PGBB 5KEDA 5L2YH 4IN1A 1GBEA 3V3MA 2Z9JA 3P8GA 3S7HB 3TJNA 3P6ZB 2GZ8A 4ZKNU 1GBAA 1FJSA 3RXVA 6GCHG 1SKYE 2QXIA 2XOKD 1P06A 3QZRA 1QB6A 1TNIA 2BQ6B 2B0FA 4DCDA 2OXSA 5HYOA 1P0SH 1IQIA 1QRWA 1TPPA 4BANB 1DITH 1T8LA 1Z6JH 3A82A 3MFJA 1AFEH 1OX1A 1W8BH 1BA8B 4FUFA 3RXKA 1S81A 5GWZA 1MKWK 1QJ1B 1AB9C 2YMSD 4IMQA 5L6NH 2HWLB 2Y81A 3DA9B 3KCGH 2EA3A 1HAXB 1ZMJA 3ZZ6A 2HNTC 1FIZA 3RU4E 2VJ1A 1MU6B 4RT0A 1C1TA 1FQ3A 5A8XA 3UY9A 1E35B 1HB0B 1FX0B 2ZPSA 1NRNH 1YPLH 1HAVA 1O2PA 3UFAA 4D8NA 1V2RT 4J2YB 3RXPA 1V2LT 4KGAA 3ZYDA 2AH4X 1KXAA 2ZHWH 3M5LA 4U2WA 2Z9IA 2R2WU 3PV2A 2PTCE 4AZ2B 4B2CA 1OWIA 4TYDA 1ZTLA 2XBYA 1MD7A 1SQAA 5A0BA 1F0UA 4Y7AA 4NSYA 3QGJA 1BRUP 3K9XB 3TPIZ 2QGRA 1C2DA 4Q80A 2XBXA 3OY6U 3SV8A 1ELEE 3HK3B 3DSGA 3T62A 4ABFA 1C2KA 1KMHB 2ZU1A 1MCVA 3A8DA 1N6YA 3ATWA 4GSOA 1TWXB 3UNSA 3V13A 3ZZBA 1ELTA 1D6RA 4Y76A 5FCRA 2A7JA 1BTPA 1B0FA 1TLDA 4M7GA 1PYTD 1O36A 4XSKU 1EB1H 3HKIB 1ZLRA 3A88A 5EGMA 2QF0A 1QIXB 3LH3A 1O32A 3LPRA 4AN7A 5A8ZA 1GMCF 1QRXA 2ZU2A 2PWXA 2HNTF 2KX4A 2QF5A 2WPLS 1O35A 2H9TH 5KGOA 4YM9A 4IS5A 2R3YA 3KF2A 2PR3A 1UHBA 2P93A 1LHDH 1PQ7A 4YESB 3CS7A 6LPRA 1O34A 3EA9A 1UO6A 3ZIAD 1JWTA 3F0PA 1D9IA 3F9HA 3M3VA 3VB4A 3KQBA 5B6LA 1BDAA 3DT0H 1EJAA 3BN9A 1ZPBA 1O0DH 3VXEH 5C2ZA 3I77A 2ANMH 4CRAA 1GI1A 2FIRH 3SJ9A 1Z8JB 4E06H 4JZIA 2W5EA 1FAKH 1ZMLA 4CHAB 1DWEH 1P2OA 4B76A 1DXWA 1LPKB 1A3BH 2PKSC 2SFAA 4O3UA 1YYY1 3HGPA 2A4GA 1K1JA 1XUFA 3MHWU 1RXPA 2J98A 3PMBB 1W7GH 1LPZB 2GVFA 1P2MA 3OFND 4ISIH 1UCYH 1A7SA 2LNCA 2BLQA 3A7TA 3SQEE 4CBNA 1VITH 3T26A 1LKAA 1Z6EA 2ZPRA 4DT4A 3F3BA 1P2KA 2VH6A 4ZHLU 2H1UA 2ZU4A 1NESE 5HM9A 3F68H 2FI5E 1L4DA 5HXFA 1GJ8B 2GT8A 2VVCA 4OS4A 2H6MA 1H9IE 3UQVA 7GCHF 3RMLH 1HAGE 1MKXK 3S7KB 1FY8E 1JOUB 4ABIA 1O3PB 2GZ7A 2ZNKH 2W7UA 2ZTYA 4D76A 3VG8A 1F0RA 3T25A 1T8OA 2GGVB 1SGFA 1IQJA 1S5SA 1LHGH 2J98B 3OSYA 3BTKE 5F53A 2VU8E 4QT8C 3MMGA 3LT3A 4MDSA 2VNTA 3RXCA 2ZHEH 3S9CA 2BY6X 7ESTE 2BVRH 4X6OA 1C2LA 1BMMH 3KQ5A 1Y5UT 4MQAA 2QE7D 3PO1B 2XBWA 2Q6DA 3UNQA 4WH6A 1C9TA 3G01A 1QTFA 3TJOA 4AYYB 1TMUH 1W14U 3BTGE 1CGHA 5FCKA 2FOGA 3DUXH 5LGOA 1NRRH 2FI3E 5FBIA 4I7YH 3D65E 1QCPA 1O2JA 2BM2A 2DE9A 1B5GH 2GZ9A 3BTME 3P8OA 1EAIA 1TX8A 2ZFFH 2H9EH 1P02A 3MU1A 1EAWA 1AWFH 1K1NA 2ZA5A 1QL9A 2ZIQH 2WPKS 4MPUA 1MMJN 1G3CA 2R2MB 1IQNA 1XUHA 3ZVAA 1U6QA 2ZGXH 4LXBH 1AVWA 3U1JB 3NPSA 3K6YA 2KAIA 3OU0A 1AFQB 3U8TH 1AVXA 3UUZA 1GGDC 1O5CB 2FS8A 3E16B 2BB4A 1O2OA 2J97A 5DP5A 2KM0A 4Y10E 5C1XA 2Y5FA 1DWCH 1TGBA 4GPGA 1BUIA 3E0PB 3JZ2B 2WHXA 3SV6A 2W7SA 3UOUA 2NU4E 1PQAA 1DT2A 1HAHH 1V2NT 4I33A 5IK2D 2V6NA 3AW1A 3MYWA 5DGJA 4TSFD 1E1RD 2NU3E 1A1RA 1A46H 2F4LA 3BEIB 4X1PU 3K2UA 2FLRH 1GCTC 1BTYA 2VBCA 4RSPA 1C1RA 3VGCC 2QXJA 1MU8B 3OEED 1OP0A 1QQ4A 4XBCA 8LPRA 1H1BA 2Z7FE 3U1IB 1OWKA 3A7WA 2UUKB 1TA6A 1MTNC 3TH3H 1ZPCA 2G4TA 1LDTT 1NROH 5TCAA 2KAIB 2PW8H 1C5OH 1HUTH 4NFFA 1BCUH 2R9PA 4THNH 2FOEA 4OS1A 3SU5A 1Y59T 4BOHA 1O3KA 5JBAS 4XFQA 2OC7A 4DY7B 2HVYB 2XWBI 3O8RA 1OWDA 3F2GA 3QX5H 5C3NA 4OGYA 2FM2A 1ARBA 3VB6A 3SNAA 3SZEA 1RJXB 1ORFA 1BOQA 1GGDB 1AGJA 2G00A 4MNVA 3GCTF 2BD7A 2YNBA 1H4WA 3LC3A 1TGTA 2VIOA 3WWBA 3FVFB 1BITA 1RGQA 3DSPA 1A0LA 1EPTA 4FU8A 2EI8A 1HAOH 5HKKD 1UJ1A 2I6QA 2QF3A 2JDID 4Q7XA 3ZVCA 3RXFA 3SUFA 3GCHC 3NWUA 1ZMNA 1ACBE 4KP0A 2ZGBH 1QGFA 1W3CA 1PPZA 3P70B 3M7TA 1GBCA 2CF9H 3UWIA 2D2DA 2ZDNA 5HM2A 1C1QA 1C9PA 2F83A 4FXGH 4MNXA 4MPWA 1P2IA 1F2SE 1GBLA 3FKSD 1GI9B 3ENSB 4H42U 4UDWH 5JYIA 3AW0A 1Y5BT 3WW7A 2F9UA 1Y3WA 3VGCB 1GCTB 1GMDF 2OTVA 1MTVA 1K1LA 4U30A 1LVYA 3VB5A 1OS8A 2OCVB 1J16A 1K2I1 2PFEA 4X6NA 1XMNB 5LH8A 1BTZA 1SHHB 2CJIA 2SGPE 1BTUA 5BRRE 2QXHA 1MBQA 3S69A 4AFQA 3UPEA 1KSNA 3A84A 1C5YB 4AC9A 5EODA 4GCHF 2FDAA 1S83A 5TCCA 4GHTA 1VJ9U 4F48B 5F03A 1GJ4H 1K21H 1ABIH 1ETRH 4JCNA 1UTLM 2BDIA 1OWHA 2XTTB 1EPTB 1QJ6B 5G4BA 5EQQA 5C1YA 1EAXA 3SJOA 1A61H 1SQOA 3LGVA 3V7TA 1C5UA 4WMFA 9LPRA 5F6MA 2JETC 3SI4H 3FN8A 3TNTA 2FP7B 2ZZUH 1GBDA 3ZVDA 5C0TA 3W94A 1RD3B 1XVMA 3EA8A 4OGXA 3FO8D 4MVNA 3NCLA 5GDSH 5SGAE 5JPMH 1ELBA 1VGCC 2ZGHA 1FY5A 1KYNA 3RC4A 2GCTC 3O8DA 1BJVA 2IJOB 5EOKA 2UUJB 6GCHF 1LKBA 2XYAA 3B9FH 4U01A 1ELAA 4ZKRU 4B1TA 2QXGA 1GBKA 1SSXA 4YLQH 5EXNA 1TA2A 4KELA 4U32A 3EE7A 2JH0D 1EKBB 2GX4A 1GMHG 2ALPA 3W1EA 3ATKA 2Z3CA 4CRCA 1T31A 1CHGA 4O97A 1V6DA 3PTNA 1O3BA 4WXVA 3TLOA 3KYGA 1OP2A 4Y8YA 1ZRBA 1HNEE 1P9SA 1AI8H 3EAJA 3BV9B 1EOJA 1F5LA 2AGGX 2RG3A 1UTQA 2Y7XA 4HTCH 4MNWA 1BTWA 3A89A 1GBMA 2RFKC 4INLA 1KXEA 1LQEA 1QB1A 1WTHD 1IQHA 2EI6A 1VZQH 3OAAD 4BAKB 5EJ1A 5DK1A 2GTBA 2HLCA 3C1KA 3KEEA 4HZHA 5JB9S 3SGBE 2ZQ2A 1Z7KA 2JETB 3MNXA 3R0FA 2FWWA 2GDEH 3I78A 1GWAA 1ZZZA 1E34B 3HPTB 1TMTH 3PMAB 3MI4A 4ZXYH 1GHAF 1F7ZA 2Z3DA 2ZI2H 2ZG0H 4Q7YA 1SGCA 1IQGA 3UQOA 1W0JD 3K6ZA 1VGCB 4ZHMU 2NU2E 5FHTA 1G3EA 2GCTB 2PUXB 2G51A 1DS2E 3BTEE 1C2JA 1DE7H 4UFEH 3M61U 4GLYA 3IWMA 1H9LB 1FONA 1P11E 2VVVA 4GVUA 1HJAC 3PMJA 4VGCC 3GDVA 1A0HB 1GPZA 5I25A 2PLXA 1GMDG 2HVXA 3ESTA 4WVPE 3CNRA 3LKWA 2B8OH 5GJ4B 2C8ZB 3M37A 3VB7A 4TWWA 4ZKSU 4FU7A 5C67A 1YPHE 2J38A 4A7IB 1GJ9B 1XVOA 2BDHA 1DSUA 4GCHG 1FI8A 1O37A 4WY3A 2OC1A 1GHBG 4I8JA 3ZZ8A 1XKAC 2C4FH 1NFYA 3Q3KA 1ZHRA 3F6UH 1IHSH 4FUDA 1NO9H 1K1MA 2F3CE 2FLBH 3SW2B 4FU9A 4DT7B 3PRDA 1KXBA 2ZFQH 2J5UA 3SBKA 1O2WA 1THSH 1YF4A 2G5NA 1AIXH 5EW2H 4ZXXH 1TE0A 3T29A 4TPYA 1C2GA 3RXJA 3Q77A 4BXWA 2W26A 4KTUA 1LQDB 4ISHH 3LOXA 5CDFE 1NC6A 3RMOH 1DOJA 4Q63A 4IC5A 1DUEA 3MNSA 2I6SA 1XUJA 3R3GB 4TPIZ 3RXGA 2WV5A 1QB9A 4VGCB 1V2MT 1P04A 1QNJA 2IPQX 5T1VA 5JB8S 1BHXF 2F43B 2V3OH 2BX3A 2STAE 3PLPA 2VIPA 2BVXH 1SBWA 3FOAA 3MU5A 4JYVH 1L0ZA 1BHXB 4BTTB 5JBTA 3O8CA 2BDCA 4AGKA 4NIVA 1O31A 4SGAE 1O3IA 3BTFE 4NGAH 1GL0E 2VIVA 1GJAB 3LDXH 1HXFH 1KY9A 1Z8IB 1FN8A 1ANDA 2GT7A 1PPHE 4ZKOU 1AUTC 2ZC9H 4H6SB 1TMBH 4IC6A 1BTXA 3UWJH 4K3JA 1HIAA 5J4QA 1Y3YA 5C5OA 3SU4A 4MNYA 2J34A 2ILNA 1O3DA 1QQUA 4LK4A 1K0HA 1AZ8A 1CO7E 1Z71A 5EW1H 1YCPK 2C8YB 1NFUA 4NZLA 2F9VA 3ATIA 3EYDA 4HG6A 1DFPA 4ABAA 1GI5A 2WPDD 2A45B 1TRYA 5E2PA 1HDTH 1Z1JA 2ZHDA 3M3TA 4NIYA 4P02A 1GHAG 1B0EA 2D1JA 3AASA 2Z9GA 2HPQH 3KQEA 3E0NB 3JZ1B 4ZUHA 2G52A 1HRTH 1GI2A 1PPGE 3SUEA 1MUEB 3A86A 1QZ8A 1O2XA 1ZSLA 5AFYH 1TNKA 1EZQA 2CK3D 5H4IB 1LVMA 4WXIA 1FNIA 1YLDA 1TNGA 1FV9A 5IYTA 2LELA 2AIPA 3AK5A 2ZFPH 1HIAB 2M2AA 4UFGH 1TOCB 3FP8E 2UWLA 4K69A 4ESTE 5LPEA 4UEHH 5CHBA 1V3XA 2A4OA 4KKDA 4KTSA 1GI0A 1AB9B 2ODQA 2BY8X 4UE7H 1OP8A 3ZV9A 1RTKA 2Z9LA 3VPKA 2BQWB 1UTJA 3ZYEA 2FOMB 3QUMP 2G5VA 3A7ZA 3A8BA 3BF6H 1C2IA 2QIQA 3M5OA 3A7XA 3E8LA 3BSQA 1TIOA 2BXTH 2FX4A 1O2GH 4X8UH 1OYTH 5EJLA 3ODDA 1MABB 1IQMA 1C2FA 4RI0A 4WH8A 3SNDA 3CENA 1NRQH 2BXUH 3QTVH 2Y6TA 1TBZH 2SGDE 3GY2A 2BLOA 1ZGIA 3URCA 3VXFH 1UTKA 4I8GA 3MWIU 3OTPA 4DJZB 2FMJA 5PTPA 2KFWA 4YT6H 1V2OT 5E2OA 1O2MA 3GICB 1D3DB 4XDEA 1IQLA 1QBNA 2AMPA 1BIOA 2OC8A 1J15A 2AHME 1FY1A 3DFLA 2A4RA 2V0BA 4B6FA 2ZCLP 4ZMAH 4TY7A 5FBEA 2J95A 2G55A 3RXMA 1EOLA 1ZGVA 2A4QA 2Z9KA 4F55A 2H2ZA 2KCOA 3BIVH 4XD7D 1X7AC 4WWYA 3V12A 1HAIH 2BD8A 4LOYH 1C1PA 2XC4A 4K8BA 1ELVA 1YPKH 1RTLA 2V7QD 3MOCA 1GI6A 1IQEA 1BB0B 2F9PA 1GI8B 4D9RA 2L6OA 3TJVA 1H8ED 2TGAA 3BTTE 1E36B 3PTBA 3QWCH 2P8OC 3FP7E 5A8YA 3A7YA 1L4ZA 3PLKA 1ELGA 3M7UA 4A1TA 3A8CA 3VFEA 1LPGB 2K8IA 5ESBA 3RMMH 1SLXB 4BXSA 2WSSD 2R3UA 1DM4B 3RC5A 2PSYA 2ZTXA 1THRH 1F0TA 1XM1A 1K28D 1O3FA 3GCNA 2QF4A 1P9UA 1FY3A 1MKWH 1DXPA 2WPIS 3PM3A 3GISB 2PKSB 2OP9A 1V2PT 3STIA 1Z8RA 3MH6A 2EC9H 1SOTA 1TOMH 1KIGH 1HGTH 1BQYA 2FOCA 2TGDA 3F9GA 1FDPA 1PPBH 1PFXC 4NA8A 5EG4A 3TVJB 1DLKB 2VINA 2PGQB 3HKJB 1NM6A 1EP6A 1Y8TA 7LPRA 5T6GA 1CSOE 1YPJH 2OQUA 4B73A 1O5FH 2DUCA 4CH2B 1D3TB 2J92A 4TWYA 2R0LA 5GCHG 5FX5A 2TGPZ 1AZZA 2F9OA 5ESTE 1Y3XA 4YXWD 3E1XB 3VB3A 2OUAA 1COWD 1WUNH 3KGPA 1CGJE 2WUCA 1NY22 1FPCH 1SGDE 2A7HA 3OX7U 1C5SA 3QLPH 1GI3A 1HBTH 2A5AA 2OINA 2GV7A 2C3SA 3N7EA 2P8OB 3ZZAA 2ZEBA 2G8TA 3FANA 1WDIA 1ETSH 3QDZB 1AY6H 1CA0C 1NZQH 1BMAA 1FN6A 3NXPA 1C5WB 5FPYA 3TH2H 4AYVB 2GMTC 1O2VA 1GJCB 4K2YA 2ULLA 1H9HE 5E0HA 1UVOA 1ZPZA 5B6OA 4JK6A 2P3TB 1GBFA 4O03A 1Z1IA 3ATMA 4Q7ZA 3UOPA 1AMHA 1MZAA 1YGCH 3SUDA 2BYAX 4Y71A 2CXVA 4IN2A 1W7XH 4A1VA 2ZU5A 1DX5M 1TRNA 3P95A 3IITA 4JYTA 4X2WA 5E0JA 3RXOA 3UNRA 1QY6A 1TABE 5EXMA 3OEHD 5TJXA 4DGJA 3H09A 3NK8A 3AVZA 2BDYA 1P05A 4FVBA 2BHGA 3ZVEA 3RXSA 3NUMA 2Q6GA 1ZRKA 2H5CA 1GMHF 4ISNA 4JYUH 3TK6A 1LVBA 3TNSA 2V3HH 1W0KD 6ESTA 2VGCC 1Y5AT 1ZR0A 1T4VH 3RXAA 5ETXA 2VWNA 1VCWA 1GDUA 1A5IA 3WY8A 4DIHH 2PHBA 4D7FA 1KLIH 1FAXA 1P10A 4ABDA 3BTDE 4JZ1A 1L1JA 1EZUC 3CS0A 3ITIA 1NBMD 2A0QB 2ZO3H 1ZSJA 1RIWC 2A31A 3RDZA 1DLEA 1QURH 3EQ0H 1LO6A 3L6PA 1EUFA 4BTIB 2Q6FA 2GD4B 3W95A 1C2EA 1N6XA 1QA7A 4RT1A 1FZZA 5GPIB 5L30H 2AMDA 7KMEH 3TIUA 2K1QA 1FUJA 2C8XB 5T6DA 1GI7B 3SU6A 1CA0B 4NSVA 1DY8A 2SNVA 4OM9A 2FOAA 2GMTB 1SGIB 2IOTA 1TNLA 1FY4A 1T32A 3LGWA 1MTWA 3DCLA 1NU7B 4J1YA 1NFWA 1HAZB 2A32A 3L33A 3QK1A 3K65B 4WJG2 4FUEA 1VCPA 1C5ZB 3U28C 1SLVB 4OS2A 3ODFA 3U8RH 1C4V2 1FXYA 4X2VA 3FZDA 5C5NA 3C27B 2AERH 1MKXH 1TGCA 3TGJE 2AFQB 2BMGB 1BBRK 1SLWB 3DD2H 1JIRA 5HIYA 1E38B 2WYGA 3T2NA 4B2AA 3MU0A 2JJ1D 1F5KU 2RA3A 3ELAH 3GDUA 1H8IH 5I46H 1D3QB 4NA7A 1BRCE 3OY5U 1PPFE 2VGCB 4NWKA 3RLYH 1V2KT 3Q76A 6CHAC 5IDKA 2P95A 1P3EA 2OD3B 3KQDA 1RFNA 1S84A 2BZAA 4YOGA 3D49H 3RXEA 1A3EH 1J17T 1KXDA 3RXRA 3SNEA 1O3CA 1MTNB 3LH1A 1CBWC 1YPHC 5L2ZH 4R8TB 1AO5A 4K1TA 2QCYA 4NA9H 1ZJKA 4YLUA 2ZCKP 3SNCA 1NS3A 4I8HA 4X8TH 4UFFH 1GHBF 1TPOA 1TRMA 4A6LA 3RU4D 2ZDMA 1V2ST 1F92A 2AS9A 2OK5A 1GVKB 2BD3A 4OS6A 1FMGA 5DP7A 1S6LA 1QL8A 2EI7A 5K7RA 1C1WH 1O2YA 1D4PB 1G2MA 2EQNA 2P16A 3P8FA 3STJA 1O3OA 3H7OA 4B74A 1SGFG 2ZHQH 1DSTA 5CMXH 3SU2A 1DPOA 2F9BH 3M36A 3MU8A 1N8OC 3GCHB 1UW7A 1SGYE 1QBOA 1VJAU 1VKYA
chains in the Genus database with same CATH topology
3O8BA 8ESTE 1FPHH 2BZ6H 1GBIA 2D26C 4UONA 1RS0A 2A5IA 1AE8H 1P8VC 3BG4C 1SHYA 2FTMA 1GVLA 2ZDKA 2AGIX 3SHAH 4A92A 2QV1A 1EQ9A 1O5DH 1O2HA 2Y82A 4AFZA 3MO6A 4B2BA 1HFDA 2PTNA 2HGTH 1SGRE 2B5TB 4Y11E 5EPYA 2ZPQA 5T3HA 4CRGA 2J4IA 5FX6A 4FUIA 1PQ5A 3D23A 1OXGA 1EZXC 2FEQH 1A2CH 1Q31A 4DIIH 1J14A 1K1OA 1MQ5A 5EPNA 1O2TA 1F0SA 2RDLA 4AG1A 2A1DB 1G30B 1V2QT 2PSXA 3RC6A 1XX9A 3GYMA 4DG4A 3UR6A 1DICA 1V2TT 2Z3EA 3FFGA 2TGTA 1CQQA 1TFXA 4TY6A 3F9FA 3RUOA 3KIDU 4IW4E 1QBVH 2M5TA 1UK4A 1QRZA 1P2QA 5CE1A 1QHRB 3GDSA 3TK9A 1EXFA 1SL3A 1BRBE 2PV9B 1MCTA 2HALA 4I31A 4MTBA 3SJKA 1KTTB 3SOSA 1TGNA 1WSSH 1KXCA 4GUXA 4ABBA 3MTYA 1N8OB 2TRMA 1P2NA 1K22H 2O8WA 1S82A 2CHAC 1OWJA 3E6PH 1JXPA 2A2QH 1P57B 3QGNB 3KL6A 1BZXE 1NPMA 1O2RA 1UVTH 2XXLA 3U98H 1C1SA 1CHOF 2D8WA 1C1VH 4FUGA 1ZTKA 1ESAA 2RCEA 1GHZA 2XC5A 1DWDH 2C93B 1P2JA 4E7RG 4AB8A 4NIXA 2UWPA 2TBSA 1ZOMA 3SV7A 1HLTH 1O2QA 1C1UH 4K8YA 3LIWA 4IMZA 1GJDB 1QA0A 3ZZ9A 3BTQE 4LZ4B 2XW9A 4ASHA 3AAUA 1KLTA 2FESH 1E0FD 1O2LA 1SGPE 4YOJA 4H4FA 3V0XA 3SJIA 2Y5GA 5DPAA 1TNJA 2BLWA 2F9NA 3SU1A 4NZQA 3QO6A 4FUBA 2XWAA 1GDNA 4I8KA 2PKAA 4Y0ZE 1XUKA 3PWCA 1KDQA 2BQ7B 5FXLA 1O3EA 1ZSKA 5DP4A 2GDDA 5FAHA 3SU0A 4LZ1H 3ZVFA 1YC0A 4NIWA 4RN6A 3TGKE 1WYKA 4AORA 5DO4H 1M9UA 2J2UA 4X1RU 2QAAA 3B8JA 2CHAB 2ZFTA 1UCYK 3F1SB 1TONA 1IQKA 1L1GA 5LPFA 1O3AA 9ESTA 4UFDH 1HJ8A 1IAUA 2VH0A 2B7DH 2DE8A 1GBBA 1T7CA 3F9EA 1HJAB 5DG6A 2JH6D 5T6FA 3MNBA 3AAVA 3SZNA 2VB0A 1QL7A 5EQSA 1TBQH 3A8AA 3ATLA 1DWBH 3ZZDA 4CR9A 3NZIA 1IOEA 3PWBA 4X8SH 3ZZCA 2P59A 4JZDH 4FVDA 1G3BA 3OTJE 4MLFB 1C4U2 1ID5H 1O5GH 2PKAB 2IPHA 3P8NA 2A7CA 5HGGA 1KDQB 1GG6C 5GXPA 1W10U 1AHTH 2RA0A 5AFZH 1C5NH 1FLEE 2Y5HA 1GBJA 2ZCHP 1SC8U 1SGTA 2BVSH 4ABEA 2BY9X 1EJNA 1A0JA 3SU3A 5J4SA 2Z6BD 1IQFA 1TB6H 3BTHE 2XCFA 5AF9H 3PLBA 1OOKB 1BTHH 5E8EH 1VITG 2FTLE 5A2MH 2FYRA 4RKJB 3SV2H 1SGNE 3LGUA 1BRAA 2V35A 1C1MA 4ABJA 3A83A 1A4WH 5FPTA 1N1LA 1C5MD 5AHGH 1O2KA 5DKMA 3Q3XA 4MPXA 2PUQH 1C1NA 2CGAA 2XNIA 3SQHE 1YLCA 4JZFH 1JIMA 3T27A 1VCQA 3A87A 2O8TA 3RXUA 1YPMH 5GCHF 4CHAC 3ZVBA 1CHOG 1ZYOA 1SOZA 2Z94A 5C1UA 2OLGA 2HPPH 1C2MA 1ELDE 3KNXA 2ALVA 2ZTZA 1D3PB 2SNWA 4HGCA 2ODPA 4Y0YE 1AKSA 5K0HA 5LPRA 2H9HA 3H5CB 1O3NA 4O9VA 3URDA 4NG9H 2WPJS 4X6MA 1KLJH 2HRVA 2STBE 1BMNH 3MNCA 1JBUH 1GG6B 2FXRA 3A7VA 4B71A 1GL1A 1DDJA 2P3UB 4YT7H 1V2JT 2ANYA 3HGNA 4K60A 3RLWH 1HV7A 2QC2A 2GP9B 4ZH8A 1W13U 1NRSH 1O38A 1GJ7B 1T4UH 1AE5A 2Q1JA 3LGTA 1BT7A 1HAVB 2BD9A 1RTFB 1DVAH 3A85A 1C5XB 5GIBA 3S9BA 1GBTA 1WTGH 3BTWE 3N7OA 8GCHG 1G32B 1HAYB 1O2SA 3M3SA 3EDXB 4X0WU 1DUAA 1AD8H 2VWOA 1JMOH 2ZDLA 3DFJA 2UUYA 4Y8ZA 2VWLA 3MO3A 3U8OH 1LHCH 1WQSA 1MAYA 4Z6AH 2A2XH 5A0AE 2P94A 3Q3YA 4OS7A 2SGEE 2GV6A 1W0ZU 2BLVA 1K1IA 2VIQA 3EE0B 1AKSB 4ZAEA 1ZHPA 4PROA 1XXDA 1HAPH 1P03A 2VWMA 1O3HA 2ZFSA 3ZZ3A 1Q2WA 1GVZA 2QY0B 4A1XA 1HYLA 2IN2A 4K5ZA 1WOFA 3PO1C 1O2IA 1CT4E 1WBGB 3TGIE 1LHFH 1EJMA 1S6FA 1SB1H 1MZDA 1GJ5H 1NT1A 3RXTA 4OS5A 1TGSZ 4X1NU 2ZKSA 1PYTC 1O39A 1XKBC 2BDGA 2OBQA 3SN8A 2A5KA 1LTOA 4XE4A 5A0CA 1UHBB 2FZZA 2VIWA 1UTOA 1TX6A 2ASUB 1UTMA 3GYLB 5F8XA 4RKOB 4WMEA 1ARCA 3B23B 4ZHAA 4GAWA 3D62A 1P12E 2BDAA 3CP7A 1V2UT 5BPEA 3ZZ5A 1Z8GA 2C90B 3SGQE 1UVSH 3E91A 1C4Y2 1MAXA 2FS9A 4UD9H 3TU7H 3UR9A 2HNTE 1AFQC 1T8MA 1YPEH 1KXFA 2BDBA 1CU1A 1EAUA 3RP2A 4CRFA 1SFQB 1O33A 3ZVGA 3LGIA 1MTSA 3LJJA 2AIQA 1ZJDA 1ANCA 4FUCA 2CF8H 1O3MA 4INKA 5JBBS 1NU9A 1C5TA 1QFKH 1HXEH 1PQ8A 4NFEA 2JKHA 1GHVH 1O5EH 3LGYA 1A5HA 2ZDAH 1MTUA 1UVPA 1YCPH 3U9AH 4AGJA 3A80A 3T5FH 1GI4A 3M35A 3SI3H 2SGFE 3BEUA 3SO3A 5CHAC 2YNAA 1C5QA 1GHYH 4BAMB 1O5AB 1MH0A 1RRKA 2J9NA 5DP8A 4AOQA 4BAQB 2HOBA 1WCZA 1PPEE 4ISOA 3BEFB 1H8DH 1PJPA 1UTNA 5DJ7A 1VR1H 2FI4E 2NWNA 1TX7A 1Y3VA 2WPMS 4BNRA 1LMWB 1UTPA 3U69H 2CN0H 1B7XB 3LJOA 1G2LA 1S85A 1XXFA 5JBCS 4Q2KA 3M7QA 3P17H 3M5MA 1GHWH 4BAOB 2BOKA 1LCYA 4Y8XA 1ANEA 4WMDA 3PYHA 1GMCG 4CBOA 2XBVA 3MH5A 4JMYA 1W0YH 2OBOA 1ZTJA 3QN7A 2VIDA 3RXHA 1SPJA 3DHKH 1THPB 3MO9A 3M5NA 3SGAE 1CVWH 1O3GA 2UWOA 1EATA 1INCA 1DY9A 4BTUB 3FP6E 2WINI 5E0GA 1DANH 1D6WA 1GHXH 3HATH 1A5GH 2UUFB 3GOVB 2XC0A 4CRBA 1EX3A 3S0NA 5F8ZA 3T28A 2NU0E 2QYIA 4XBDA 3GCOA 3TJUA 1G3DA 1AN1E 2JH5D 3PB1E 2CV3A 2FO9A 4B75A 1P01A 1TPSA 5CHAB 2OC0A 3FZZA 4I32A 4WF8A 3SORA 4JZEH 1SR5C 1SLUB 1J9CH 3IG6B 2C8WB 4XOJA 1GJ6A 1GBHA 3UTUH 4X1QU 3A81A 1P3CA 3LU9B 3SNBA 2QA9E 1Y3UA 3P92A 2QN5T 1ESBA 3RXQA 1UK3A 4AB9A 2SGAA 1HCGA 5DP3A 4CREA 1EPTC 2F91A 7GCHG 1YM0A 2CMYA 2WYJA 4GHQA 1QR3E 2W3IA 4H6TA 2ZECA 3MU4A 1WV7H 2XRCA 1BBRE 1TQ0B 5FPSA 3HK6B 1C5VA 2FOHA 1K1PA 3L3TA 3LONA 3E3TA 1SGQE 1ELCA 3UIRA 1EASA 2GKVE 1MBMA 1O3JA 4IBLH 4KTCA 3SUGA 3TK5A 4R0IA 1C2HA 3FAOA 2ZDVH 2EEKA 4K1EA 2FPZA 1WQVH 1O2UA 1C5PA 4AFUA 1OYQA 3BIUH 1NRPH 2FOFA 3EA7A 1GDQA 1EP5A 1NTPA 2ZHFH 5F8TA 3UREA 4SGBE 4YOIA 1TALA 1SQTA 5A09A 1OPHB 1SG8B 3H7TA 1CA8B 1P09A 1OWEA 1RIWB 4CR5A 1YBWA 4Y7BA 3RXIA 1LHEH 3QZQA 2O8MA 2YOLA 4INHA 2AMQA 3RMNH 1BJUA 3RU4T 4NWLA 1HPGA 1UVUH 4Y6DA 4DURA 1ABJH 1CT2E 1SFIA 1ELFA 1O3LA 1WU1A 1AVGH 2AEIH 3SV9A 3PV4A 3TITA 2FODA 3RXBA 1CT0E 1TYNA 4X8VH 4YO9A 3GY3A 3GY4A 4AFSA 1Q3XA 3SJ8A 3OYPA 4D7GA 1NN6A 1HJ9A 3EGKH 2B9LA 1KTSB 5DP6A 1ZHMA 4X1SU 3RXLA 1K9OE 1CGIE 4AG2A 1T8NA 1ETTH 1XUIA 2GCHF 1XUGA 3PROA 4F49A 1C5RA 1O2NA 3GY5A 1MQ6A 1S0QA 1O5BB 2TIOA 2ANKH 4X6PA 3KN2A 4D9QA 1SVPA 2BY5X 4MG3A 2FX6A 6CHAB 1ESTA 2TPIZ 3ZZ7A 3GY6A 3TH4H 2ZFRH 5AVDA 2G81E 5EU8A 1CBWB 1UK2A 1S6HA 2O8LA 3GY7A 2ZWLH 3RM2H 4DW2U 1TNHA 2AGEX 4E05H 1TBRH 1G36A 1O30A 4ABHA 1OSSA 4X2YA 2J94A 1G9IE 2WUBA 1JRSA 1YP9A 4FUJA 2THFB 1IHTH 1SI5H 3KQCA 2Y7ZA 1C1OA 2ZGCA 2G4UA 3SHCH 3LC5A 2ZQ1A 1W2KH 1G37A 2O8UA 1BMLA 1EB2A 1VITF 1LVOA 2FOBA 4FUHA 3VEQB 3ZV8A 2BX4A 1EZSC 4E7NA 2BTCE 1OKXA 4X2XA 2OQ5A 1AUJA 1F5RA 1J8AA 3MH4A 5EQRA 5DP9A 4HI3A 1AQ7A 3MH7A 1W12U 4BAHB 4K1SA 1UMAH 2Y80A 3Q00A 1YKTA 3RM0H 2ZF0H 3BG4B 3GY8A 2WV4A 2BD4A 3GCTG 2ZGJA 4ZROA 1V2VT 4AX9H 4JK5A 1E37B 3RXDA 5JDUB 3BG8A 5EXLA 2BD5A 5ABWA 1YPGH 2H5DA 1QJ7B 3QTOH 4CH8B 4HFPB 4NCYA 1C5LH 2ODYB 1TAWA 3KHVA 4A5TS 2FYQA 1PPCE 2O9QA 1W11U 1GCDA 4DVAU 4Z0KA 1CE5A 1WAYB 2ANWA 2VVUA 4DOQA 3ZZ4A 1BBRH 5C20A 2SGQE 4ISLA 1TQ7B 1AU8A 4YZUA 2LPRA 2BOHB 1L1NA 4CRDA 4I8LA 4YTAA 4ABGA 8GCHF 1JRTA 3I29A 2R0KA 1NFXA 4IGDA 2ZP0H 1SGEE 1UCYE 4MPVA 2NU1E 8KME2 5HMAA 4XBBA 2XCNA 4O3TA 2AYWA 1ANBA 1MD8A 2W3KA 3E90B 1L2EA 4Y79A 1TPAE 2ESTE 3PMHB 1S0RA 2GCHG 1O2ZA 1SMFE 2BD2A 2P3FH 4F4OC 1V2WT 2BY7X 2WPHS 2ZU3A 1FIWA 3S9AA 3NKKA 1GJBB 1YCPM 1AWHB 2PGBB 5L2YH 4IN1A 1GBEA 3V3MA 2Z9JA 3P8GA 3S7HB 3TJNA 3P6ZB 2GZ8A 4ZKNU 1GBAA 1FJSA 3RXVA 6GCHG 2QXIA 1P06A 3QZRA 1QB6A 1TNIA 2BQ6B 2B0FA 4DCDA 2OXSA 5HYOA 1P0SH 1IQIA 1QRWA 1TPPA 4BANB 1DITH 1T8LA 1Z6JH 3A82A 3MFJA 1AFEH 1OX1A 1W8BH 1BA8B 4FUFA 3RXKA 1S81A 5GWZA 1MKWK 1QJ1B 1AB9C 4IMQA 5L6NH 2HWLB 2Y81A 3DA9B 3KCGH 2EA3A 1HAXB 1ZMJA 3ZZ6A 2HNTC 1FIZA 3RU4E 2VJ1A 1MU6B 1C1TA 1FQ3A 5A8XA 3UY9A 1E35B 1HB0B 2ZPSA 1NRNH 1YPLH 1HAVA 1O2PA 3UFAA 4D8NA 1V2RT 4J2YB 3RXPA 1V2LT 4KGAA 3ZYDA 2AH4X 1KXAA 2ZHWH 3M5LA 4U2WA 2Z9IA 2R2WU 2PTCE 4AZ2B 4B2CA 1OWIA 4TYDA 1ZTLA 2XBYA 1MD7A 1SQAA 5A0BA 1F0UA 4Y7AA 4NSYA 3QGJA 1BRUP 3K9XB 3TPIZ 2QGRA 1C2DA 4Q80A 2XBXA 3OY6U 3SV8A 1ELEE 3HK3B 3T62A 4ABFA 1C2KA 2ZU1A 1MCVA 3A8DA 1N6YA 3ATWA 4GSOA 1TWXB 3UNSA 3V13A 3ZZBA 1ELTA 1D6RA 4Y76A 5FCRA 2A7JA 1BTPA 1B0FA 1TLDA 4M7GA 1PYTD 1O36A 4XSKU 1EB1H 3HKIB 1ZLRA 3A88A 5EGMA 2QF0A 1QIXB 3LH3A 1O32A 3LPRA 4AN7A 5A8ZA 1GMCF 1QRXA 2ZU2A 2PWXA 2HNTF 2WPLS 1O35A 2H9TH 4YM9A 4IS5A 2R3YA 3KF2A 2PR3A 1UHBA 2P93A 1LHDH 1PQ7A 4YESB 3CS7A 6LPRA 1O34A 3EA9A 1UO6A 1JWTA 1D9IA 3F9HA 3M3VA 3VB4A 3KQBA 1BDAA 3DT0H 1EJAA 3BN9A 1ZPBA 1O0DH 3VXEH 5C2ZA 3I77A 2ANMH 4CRAA 1GI1A 2FIRH 3SJ9A 1Z8JB 4E06H 4JZIA 2W5EA 1FAKH 1ZMLA 4CHAB 1DWEH 1P2OA 4B76A 1DXWA 1LPKB 1A3BH 2PKSC 2SFAA 4O3UA 1YYY1 3HGPA 2A4GA 1K1JA 1XUFA 3MHWU 1RXPA 3PMBB 1W7GH 1LPZB 2GVFA 1P2MA 4ISIH 1UCYH 1A7SA 2LNCA 2BLQA 3A7TA