3NK8A

Trypsin in complex with fluorine-containing fragment
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Combined use of computational chemistry, NMR screening, and X-ray crystallography for identification and characterization of fluorophilic protein environments.
pubmed doi rcsb
molecule tags Hydrolase
total genus 61
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nk8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nk8A02
1P2QA 1NM6A 2BD5A 3M61U 4X2YA 4ISNA 2ANKH 4ZAEA 3BTQE 3S0NA 4IGDA 4A1TA 5FBIA 4UFEH 2ZDKA 3SN8A 4WF8A 3VXEH 1O3HA 1H8DH 1F92A 5LPEA 1B0EA 1THRH 1EP5A 3U8RH 1UO6A 2R3UA 4ABDA 4AFSA 1HAOH 1S84A 3QUMP 1T8LA 3EQ0H 3Q3YA 4GUXA 2PKAB 1OYTH 5I46H 1IQIA 5HGGA 1HAYB 1P2MA 1QGFA 2QAAA 1AFQC 4XBDA 1N6XA 1N1LA 4FUGA 2FPZA 5EPNA 1KXEA 1TMTH 4YM9A 2F9UA 5TJXA 1BMAA 2GCTB 2H2ZA 1MU6B 2LNCA 4YOGA 2RCEA 1JOUB 2IPHA 2TGPZ 1O3JA 2KAIB 3TIUA 1NN6A 4B74A 1Y59T 1JRTA 2BDAA 1QY6A 1MCVA 3BG4B 2B8OH 3NKKA 3UNSA 5FAHA 1MQ6A 4B73A 3ODDA 4JZFH 4CRGA 1GI7B 1ZJDA 2IJOB 5HM2A 1HV7A 1NROH 1P09A 1MKXK 4AFQA 4U30A 7GCHG 1EZSC 3TJNA 5LPFA 5FPTA 1J17T 1ELTA 1DPOA 2ANYA 1GBJA 2UUYA 2VWNA 2TGDA 3SJ9A 4ABAA 1TA6A 2BD8A 3FVFB 3MU8A 3OTJE 4D9RA 1C5UA 1MZAA 3A82A 2BY8X 5AFZH 2R2WU 1A2CH 1ORFA 4CHAB 1SGDE 3BV9B 1GBDA 1TE0A 1VGCC 1P2JA 1FZZA 2C8XB 4NG9H 1SGQE 3QDZB 4ABGA 2VH6A 1SGCA 4X8TH 1EJNA 1PJPA 2Z9IA 2ZQ1A 1YGCH 4I8JA 1MUEB 4ZKSU 4WJG2 3GY6A 2SFAA 1ZSJA 4ZROA 1VR1H 1EB2A 1QIXB 4AX9H 1DWBH 3ODFA 3E91A 1DLKB 2BD3A 1HNEE 2BDYA 1ESTA 3ZYEA 5F8ZA 3D23A 1SSXA 3FAOA 4KP0A 1C1OA 1AVWA 3PV4A 3T28A 1SVPA 2OC8A 2Y5GA 1W0ZU 2A32A 1K9OE 4I8LA 2H9EH 4CRCA 1GJ4H 4MDSA 3ZYDA 4Y76A 1C5YB 1UVUH 1TBQH 1XUGA 2VB0A 5CMXH 1EXFA 1P01A 3PLBA 1SB1H 1K22H 3O8CA 1SGFA 5FHTA 2A4OA 1GI5A 2G8TA 2ZKSA 1OWHA 2TIOA 1GBMA 2ZTYA 1BT7A 1ETTH 2SGPE 1KLJH 5FPYA 2BOKA 1CT4E 1KYNA 1UK4A 3VB4A 4BXSA 1KXFA 2Q6DA 1GJAB 3F9GA 3BSQA 2GX4A 5A8YA 2QXJA 4MNWA 3SU5A 2FEQH 1FXYA 4RSPA 1AO5A 3GOVB 1BTXA 3Q00A 3E1XB 2A2QH 1XVOA 2P8OC 1D9IA 1RXPA 5L6NH 3P8FA 2XC4A 1IQFA 1HXFH 2F91A 3F9HA 3ZZ7A 4BAQB 4R0IA 1H1BA 4HI3A 5CE1A 2HALA 3QGNB 2H6MA 3L3TA 1CT2E 2OXSA 1UTMA 4B75A 3BTGE 1F5RA 4FXGH 1WYKA 2FYQA 3S9CA 4DOQA 5JPMH 1MD8A 1RTKA 3VB5A 3SO3A 1ABIH 5GDSH 1AFEH 2G51A 3VB3A 3GCNA 1UK3A 4K8BA 1LCYA 4Y8XA 1HLTH 2XBXA 1SLWB 1TX6A 1PPZA 3A8AA 4BAKB 1DS2E 1LKAA 1J15A 4B71A 2AYWA 4FU9A 4TY6A 1ID5H 3IWMA 5AHGH 2STAE 1SGRE 1IQJA 1KXBA 4X2VA 3RMOH 4XBCA 1O2KA 4CR9A 1TYNA 1W7XH 1GL1A 1KY9A 3TNSA 7ESTE 3RXMA 1MQ5A 2H5DA 4DIHH 4BAOB 3W94A 4U01A 1CSOE 2ZEBA 1A0LA 1GI8B 3M5LA 4K1EA 1V2UT 4NIYA 3EYDA 1O3LA 1V2OT 3PLPA 4INHA 3IITA 4TWYA 4GLYA 2GCTC 3JZ2B 4AFUA 1J8AA 2CHAB 3DA9B 3VGCC 1YPLH 2BZAA 1DY9A 3G01A 3GCHB 2G5NA 1F2SE 2YOLA 4GHQA 4IBLH 1TLDA 5JBBS 1TPSA 1GHYH 1MTSA 1UTOA 4U2WA 1CA0B 1Z8GA 1E38B 1XUIA 1LHDH 1AZZA 3SORA 1O3BA 1UTLM 1GBLA 8KME2 3PMBB 1MD7A 4CRBA 3BTKE 4GSOA 1YF4A 1BCUH 4RN6A 2EI8A 1AKSB 4Z0KA 3F68H 3SU6A 2VWLA 2PSYA 4Y8ZA 1GMCF 2ZGCA 1KDQB 1UVSH 3E0PB 1Y3VA 1SL3A 1ZHMA 2ODYB 1FY1A 1RGQA 2ANWA 1GBCA 1MKWH 3KEEA 4TY7A 5L30H 1GGDB 1FY3A 2Z3CA 3ZZAA 1P3CA 1HBTH 1CGHA 3BG8A 1AB9B 1FY8E 3V0XA 1FI8A 2I6SA 3Q3KA 1K2I1 3RMMH 1DE7H 4D76A 1UCYK 3A7YA 1AUJA 1YCPK 4Q7ZA 3PB1E 3VPKA 1WQSA 4TPIZ 1ZYOA 4ABIA 1AY6H 2GCHF 4OS6A 5HXFA 1IQMA 4NGAH 2OTVA 3RP2A 1EUFA 1UVPA 2OC0A 4WMEA 2ANMH 3U98H 3SGBE 3SQHE 2VWOA 3M5NA 1O2JA 1AN1E 1TGTA 4FUEA 1IQEA 2Z9JA 5C5OA 1FAXA 1O2MA 4CBOA 1EB1H 4FUBA 1FMGA 1YPJH 4UDWH 4IW4E 2ZC9H 2ZU5A 1TB6H 4I8KA 2VIPA 1D3QB 1D6RA 1DOJA 4ZXYH 3GY3A 2OC7A 5LGOA 2QV1A 1RS0A 2O8MA 2SNWA 5G4BA 1QB9A 3QLPH 2XW9A 4XDEA 2ZFFH 5EQQA 2OLGA 4FVBA 1DLEA 3F1SB 1GJ9B 3W95A 1AVXA 4NA9H 2Z94A 5C20A 3VEQB 1Z8IB 4WH6A 2GTBA 1TGBA 1NESE 1DITH 2JETB 4FU8A 2THFB 3QK1A 1GHBF 2B0FA 2VVVA 3TK6A 1VITH 4MLFB 1AD8H 5JB9S 1EPTC 2CF9H 3A85A 3K6YA 2A4GA 4JK6A 2Y81A 3SNEA 3A87A 1OWJA 2SNVA 2BDBA 2Z9GA 1CHOF 3M7QA 1HJAC 3ELAH 3RM2H 5C2ZA 1ELDE 3AW1A 1T32A 3RXPA 2BB4A 4IN1A 2PR3A 4O3UA 4B76A 1V2TT 3HGNA 3QGJA 2ZGBH 4ZHMU 2KAIA 5A8XA 3KGPA 2VGCC 1BBRK 2GZ8A 2ZPRA 1FLEE 2PSXA 2P3TB 3RDZA 1UHBB 1CA8B 3UOPA 1DANH 1C1WH 3T2NA 4SGBE 1NFUA 2J2UA 3K2UA 4FUJA 3ZVDA 2Z3DA 1O2GH 2OQ5A 1VCPA 1LPZB 4O97A 4XE4A 1ANDA 1W14U 4ISIH 1GVZA 1NRQH 3OYPA 3BTWE 3T25A 5HYOA 1A7SA 4KELA 1OP0A 1ZTLA 1S83A 1T31A 2QYIA 1DX5M 1LHEH 5AFYH 1FUJA 1PQ5A 3GY5A 1O32A 1GI6A 3LIWA 4F49A 5DKMA 2PKSB 2ZIQH 3EAJA 4XFQA 2HOBA 3D49H 1ZGIA 3RLWH 2ZDLA 2ZHDA 2AGGX 1MTUA 2O8WA 4BTIB 1JXPA 1QA0A 1TX8A 2O9QA 2J4IA 1BOQA 1NRNH 3M7UA 1CU1A 1H9HE 3RXGA 3R0FA 1TNHA 1GMCG 1XUFA 2EA3A 1M9UA 7GCHF 1LHFH 4UFDH 5H4IB 1V2KT 2XC0A 2FOBA 4LXBH 3ATLA 2BXTH 2V6NA 3OSYA 4ZMAH 1TFXA 4QT8C 4X2XA 1EZUC 2DUCA 2FS8A 1BHXB 2FOEA 2O8TA 2P3FH 1B7XB 1P04A 1LPKB 3DFLA 1TPOA 3ENSB 3RUOA 1YBWA 3RXIA 3A7ZA 6LPRA 1EAUA 2AEIH 2ZDVH 4NA7A 4I8HA 3U1JB 1GL0E 3DUXH 2GCHG 2TRMA 4VGCB 3JZ1B 1YPMH 5FX6A 4AGJA 2A7CA 4GCHF 3ZVAA 3U1IB 1THSH 2VNTA 4FVDA 1OX1A 5GCHF 4JYTA 8ESTE 1W7GH 1HAPH 1TMUH 1PPGE 2V0BA 4WMDA 1IOEA 2SGEE 1HJ9A 2WUBA 2BVSH 3MWIU 2VJ1A 2HWLB 1FAKH 1C9PA 3ZV8A 3QZRA 5A0CA 1O3KA 1FN6A 1V6DA 1C5XB 4JCNA 5FCKA 1YPKH 3EA8A 3SZNA 4I33A 1O2RA 1VCQA 5DP5A 1EAWA 4X8SH 3S7KB 2GV6A 1BA8B 3ZZ3A 2C93B 1P57B 2HNTE 3OU0A 1GHBG 1B5GH 1DDJA 1TPAE 2EEKA 2V3OH 4KGAA 1S0QA 5DP7A 2BDHA 3OY5U 4ISLA 1WUNH 3GY2A 3CENA 3SUGA 3PYHA 1XXFA 3SNDA 1AGJA 1CHOG 1OP8A 2FESH 3A89A 1ZR0A 1AQ7A 4H4FA 1PPHE 2TBSA 1SC8U 3E0NB 4BANB 3TGIE 3ZVCA 1O3CA 1BTPA 2CN0H 1UTNA 2QXIA 4K1SA 1GI1A 1HAVB 4FUFA 1TRMA 1D3DB 1V2VT 1ZGVA 3M35A 1BRUP 3V7TA 4SGAE 3A7WA 3UNRA 2G00A 1GMHF 3MOCA 3QN7A 3SNBA 1DUEA 1UCYH 3SJOA 1LDTT 1UVTH 2G81E 1P2IA 2BQ6B 4K69A 3RU4E 1QL8A 2AS9A 1NS3A 3A80A 4JZDH 1G3EA 1C5QA 2G4TA 4MG3A 5EXMA 1ELAA 2A5KA 1V2QT 1K1MA 4ASHA 1RJXB 1Z8JB 1SGTA 4X1RU 1HPGA 3RXSA 3MU1A 3QX5H 1O2VA 4KTCA 2EC9H 2GZ9A 3RXHA 2QY0B 1N8OC 2A1DB 5A0BA 1HYLA 3PO1B 4I7YH 1FY4A 1GG6B 3VB6A 2Z3EA 2WPKS 2XC5A 3GY8A 4BOHA 1ZLRA 1KXCA 1P2NA 3U8OH 1Z6JH 1K21H 2D1JA 2TPIZ 2WV4A 4H42U 4TPYA 1AKSA 2Q6GA 1O2PA 1F0SA 2R0KA 3BTME 1VJAU 2B7DH 3GCOA 3SI4H 1IQGA 1A5HA 5CHAB 2PUQH 1P8VC 1O2WA 1WU1A 4CREA 2BD4A 2GKVE 1SGFG 1TX7A 1Q2WA 3DD2H 3NXPA 3PM3A 1UJ1A 5T6GA 2GMTB 1NPMA 3SU3A 3CS0A 2ZP0H 2BD2A 2WYGA 1MZDA 1YC0A 1EAIA 2BD7A 1SHHB 3PMAB 3HK3B 1GVLA 4ZKNU 1G2MA 4ABEA 1C1TA 2WPLS 1L1GA 1O0DH 1TALA 4MPXA 1Z7KA 1NFXA 1NFWA 1K1LA 1QL7A 3RU4D 4GCHG 3PMHB 2H1UA 3UQOA 2R3YA 3P8OA 3BIVH 4YOIA 1GDQA 3BEFB 4JZ1A 3SOSA 3C27B 3MYWA 4GAWA 5GCHG 1BMMH 2WPJS 4WXIA 2BM2A 1GHWH 1BDAA 3LH3A 4BNRA 5EODA 1O2TA 4Q2KA 1HAZB 1DSTA 1P10A 1ZRKA 1O5AB 3NZIA 2OP9A 3D65E 4OS7A 1K1NA 4B2AA 5EW2H 1GCTB 1TWXB 2BYAX 2ZGJA 5C67A 3BTFE 4DG4A 5T6FA 2GT7A 3SJKA 5DG6A 4ZKRU 1TQ7B 2FI5E 1O2IA 2BQWB 1VITF 2Z9KA 3B23B 1GDUA 1P9SA 5F8XA 3MFJA 3E90B 1V2JT 1V3XA 4UEHH 1IHTH 3MNXA 1GJ8B 3GDVA 1PPEE 3KN2A 1SLXB 4IC6A 1CBWB 4K3JA 2ZA5A 1QBNA 4VGCC 1GHAF 3STJA 1S81A 2ZHEH 1Q3XA 3PLKA 1G37A 1ZMLA 1SI5H 3LKWA 5JBTA 5HM9A 1DT2A 1ANEA 3KL6A 3M3VA 4MPUA 2OQUA 4BXWA 4I8GA 3LU9B 4HTCH 1C5PA 1C2JA 1MTNC 1C2DA 1O5CB 2W7UA 1SBWA 2XBWA 2FODA 2AGEX 3ZZCA 5SGAE 1KSNA 1NU7B 1BMLA 1RIWC 3R3GB 1CE5A 2G52A 1PFXC 2GD4B 4NA8A 3A88A 3O8DA 2OUAA 2NU1E 1DWDH 1GMHG 1C2EA 1HFDA 1QRWA 1GI0A 1NRPH 4BAMB 4CH2B 5E2OA 1AIXH 2HGTH 3EDXB 4CRAA 1G9IE 3NUMA 1BTUA 4THNH 1HXEH 1MCTA 2NU0E 1L0ZA 5A0AE 3ATMA 1C5SA 1WV7H 1LKBA 3TNTA 1JIMA 1THPB 2PTCE 1ZMJA 1O30A 2HRVA 5F03A 1D3PB 2ZFPH 2PTNA 1PQ8A 3URDA 4A6LA 2XRCA 3SV8A 1QBVH 4Y7BA 2CXVA 4OGYA 3BTHE 1A61H 1O2ZA 1QB1A 1GBEA 3FZZA 4PROA 2HNTC 4UFGH 1CVWH 1UCYE 4TWWA 3Q76A 2Y7XA 4I31A 2XCFA 4MVNA 1O38A 1QA7A 1KIGH 1C5ZB 2BHGA 3S7HB 2BX4A 2JKHA 2I6QA 3M3TA 1O39A 1GJBB 5DPAA 4AN7A 1O3FA 3UTUH 1F0RA 1OS8A 3QO6A 1ZSLA 4ZXXH 5EU8A 1ANBA 1LVBA 1QTFA 4DIIH 2VVUA 8LPRA 2ODPA 1JBUH 3TJVA 1A5IA 1FIWA 2HLCA 3MO6A 1QQ4A 4IN2A 3L33A 3MHWU 4X6MA 3LGUA 5K0HA 1XM1A 3QZQA 4O3TA 3SGQE 3TH2H 1V2ST 4ZH8A 3RXCA 3S9AA 1BJUA 3BG4C 3N7OA 5A2MH 2F9VA 1ACBE 2GV7A 3P92A 1Y3UA 1HAHH 2OINA 2BDIA 2QGRA 1TRNA 4Y0ZE 4Y7AA 1SGEE 3FANA 2OBOA 2WPHS 4X1SU 5F8TA 3SUFA 3RXOA 2ILNA 1ZZZA 1O2SA 3E16B 1PPBH 3F6UH 2ZCKP 4X6OA 3LPRA 1QR3E 1IQNA 1ZTJA 2ZU1A 1S5SA 3GICB 5C1XA 4MNVA 3RMNH 1GBKA 3VB7A 2Q1JA 2R0LA 4FUIA 1VITG 1BZXE 2UUJB 2BMGB 2FDAA 2PW8H 4NSYA 2STBE 4Q80A 2D26C 5GJ4B 4CHAC 1HGTH 4NWKA 1HCGA 4O03A 3F9FA 2ZF0H 4A1VA 1GHAG 3RXAA 2PLXA 1IQHA 2FO9A 2WUCA 1BRAA 3RXDA 1G2LA 3S9BA 2UWLA 2BZ6H 3SV9A 3BTTE 1ELGA 1TNKA 4ZUHA 3ZZ9A 1NT1A 3LJJA 5E2PA 3SHCH 4F4OC 2QC2A 1ESBA 2GVFA 1C2KA 1EASA 1UTKA 3BF6H 4JK5A 5DP8A 1C5OH 1O2HA 1QURH 2FOAA 2WINI 1GI2A 2OBQA 1V2PT 1MKXH 4DVAU 3ZZ6A 1NFYA 1ELFA 1GMDG 4BAHB 2A45B 1GCTC 2G55A 2GT8A 3UIRA 1QQUA 1LTOA 5GXPA 1QJ7B 1CT0E 2CF8H 1OKXA 2Y82A 4NIWA 2SGDE 4Y8YA 1O3DA 2PKAA 2F9BH 1SLUB 5DK1A 1NZQH 4E7NA 4A7IB 1YM0A 2UUFB 2ZO3H 3P6ZB 1GHVH 2BLVA 1C2IA 3NK8A 3BTEE 6CHAB 1QHRB 2BDCA 5ABWA 3P17H 2AMDA 1C1UH 1TGSZ 4LOYH 1OP2A 2W5EA 3LGIA 3V13A 1F0TA 6ESTA 2P93A 1NRSH 3NPSA 2C8WB 3STIA 1P2KA 4YESB 1ZOMA 2NU4E 2C4FH 1SOTA 2C8ZB 1AVGH 3T26A 1V2WT 3RM0H 1RRKA 2SGAA 2PUXB 5L2YH 1NC6A 1T4UH 1SPJA 1AFQB 3Q77A 2ZU4A 3HKIB 1OWDA 1LMWB 4H6TA 2FLRH 2BX3A 1QJ6B 3RU4T 4IC5A 1TNLA 1QNJA 3VXFH 2ZTXA 2QF0A 4INKA 1W2KH 3SNAA 3MU4A 4M7GA 1QRZA 5GIBA 1O2LA 4OS5A 3URCA 3RXKA 4X0WU 5LH8A 3GY4A 1NRRH 1UTJA 1EOJA 4NWLA 1X7AC 1C4Y2 3SW2B 3LONA 4WVPE 1SGPE 1ELCA 1EAXA 1S0RA 3RXLA 1O5FH 1C5RA 3A86A 1GJ6A 2OC1A 1YYY1 4YT6H 2C90B 1UTQA 1W10U 1CQQA 2H9TH 1AHTH 4ABBA 3MH6A 3VFEA 4CBNA 2P3UB 3GCTF 2BTCE 2LPRA 3TH4H 3SV6A 2M5TA 1ETSH 1HJ8A 1VCWA 2P16A 3RXJA 3T27A 3IG6B 4AB9A 5A8ZA 1O2QA 1SQTA 3RXEA 5C5NA 2BY9X 1HB0B 3LGYA 4Y10E 5BPEA 2Q6FA 3M37A 1XMNB 1A3BH 3U9AH 3E3TA 4NZQA 4XBBA 3TJUA 5EG4A 4E05H 2XTTB 4DURA 2PHBA 3RXTA 3OX7U 3KQDA 2Y5FA 4AYYB 2HVXA 1AE5A 3A81A 3DHKH 1TNGA 1D6WA 3MH7A 2A31A 4AB8A 4CRDA 1VGCB 1P06A 1LQEA 3ZZ8A 2XBYA 2ZQ2A 3MO3A 2NU2E 4Y71A 4X6PA 1ELBA 1MAXA 1O2NA 2CGAA 3NCLA 1LVYA 2AIQA 4Q7XA 2FZZA 2A4QA 2BLQA 1P03A 1MTVA 2CHAC 3P8GA 5DP9A 4Y79A 2ZCLP 3B9FH 3PTNA 3GCHC 3O8RA 3ZVGA 1BTZA 1O3OA 1YPEH 5C3NA 1BTYA 4HFPB 1AZ8A 5T6DA 5DGJA 3PTBA 1Y3WA 1BB0B 2BQ7B 1CA0C 4BTTB 1SQAA 3D62A 4ESTE 5TCAA 1KTTB 1YLDA 2G5VA 3TGKE 1D4PB 2D8WA 3TVJB 2RG3A 1C2GA 1NTPA 4UONA 1Y5BT 1FV9A 1C1MA 3RXVA 5E8EH 1JRSA 1EZQA 3E6PH 4LZ4B 3LOXA 1C5VA 4Y6DA 4X8VH 1O3EA 1O37A 3SUEA 1LQDB 5TCCA 2FI4E 1C1PA 3P95A 3ZV9A 3RXRA 1GGDC 3A7XA 4D8NA 2W3IA 1AUTC 2BLWA 1AB9C 1A3EH 4MNYA 2PFEA 1TMBH 5EXNA 3K6ZA 1P9UA 4INLA 1FDPA 3C1KA 1GI9B 1HAXB 1XUKA 4HZHA 3QTVH 2J34A 4KTSA 1L4DA 3H7OA 4UE7H 3SBKA 3P70B 5C1YA 2J95A 1KTSB 1FY5A 2XCNA 4K8YA 1DXPA 2AMQA 1BMNH 1TGCA 2J94A 3LT3A 1GJ5H 1K1IA 2ESTE 1G3DA 5IYTA 1P02A 2DE8A 3UNQA 2ODQA 1LVOA 1OYQA 2BY7X 3LGTA 2V35A 4YTAA 4ZHAA 1KXAA 3BN9A 2GGVB 3RXQA 2FX4A 2XXLA 4DGJA 2P8OB 3UOUA 1H9IE 4E7RG 3RXUA 3ZVBA 2ZNKH 4X1NU 5BRRE 1UMAH 4IMZA 1SLVB 2A4RA 3MO9A 2DE9A 5FBEA 1AWHB 1SR5C 1BHXF 4WWYA 3T5FH 2CJIA 1OWIA 4RKJB 1RTFB 4D7FA 4AZ2B 4NSVA 1V2NT 2BD9A 1EQ9A 3ZZ5A 4X8UH 1NY22 2F9PA 3A84A 1EP6A 3K65B 1FN8A 1LPGB 1S6FA 1TOMH 1E0FD 1T7CA 1YCPH 3ATKA 5EQRA 2JETC 1TNJA 3ZVFA 4CRFA 6CHAC 3M5MA 1UK2A 1A5GH 4YLQH 3SI3H 2ZFRH 3KQBA 1W0YH 3GCTG 1MH0A 4YLUA 1W3CA 2ZDAH 3O8BA 1BRCE 1W8BH 1O35A 3NWUA 2ALVA 1GWAA 4J2YB 1ZHPA 1DY8A 3HATH 5JYIA 1MKWK 2QCYA 2FOCA 1T8OA 1YLCA 1ELVA 1W13U 2VIDA 2VWMA 1Z8RA 1PPCE 3QTOH 5DP6A 3SJ8A 3A8CA 1OWKA 3MNCA 3CP7A 3Q3XA 4O9VA 1GBFA 5J4QA 1SMFE 2F9OA 4UFFH 1S82A 3VGCB 2A5AA 3MNSA 1GJCB 3V12A 2VIVA 3UFAA 1O5GH 2FTMA 4CR5A 1EJMA 1KDQA 1S85A 1BTWA 1QCPA 2OCVB 3ZZDA 1GJ7B 1MBQA 2YNBA 4I32A 4R8TB 1YPGH 1G30B 3EGKH 2AFQB 1OXGA 2R2MB 3RC6A 2BY6X 3UY9A 4JZIA 4WXVA 4B1TA 1O3PB 1V2LT 2PV9B 1BQYA 3TGJE 4X6NA 4TYDA 1SGYE 4NIXA 3S69A 3ZZ4A 4CH8B 2HNTF 1F5LA 1FNIA 2XYAA 2PKSC 3M36A 1PQAA 2J38A 3LC3A 1BUIA 3GYMA 1DUAA 2C8YB 3TK5A 2FOGA 1VJ9U 1BBRH 5IDKA 2ZPQA 5JDUB 3RXFA 1TIOA 3I78A 1P0SH 3SUDA 3HGPA 3LGVA 1Y3XA 1C1SA 1N6YA 2UWOA 5L2ZH 1T4VH 1XKAC 2Y6TA 4K60A 4LZ1H 1ARCA 3QWCH 1BRBE 1O3GA 2VU8E 7LPRA 3HPTB 2P95A 1YKTA 2ULLA 1HUTH 1GPZA 2W3KA 3WY8A 2ASUB 2HPQH 4E06H 4H6SB 3TJOA 1ZTKA 2NU3E 1F0UA 2AGIX 4JYUH 3RC5A 1HIAB 2ZDNA 2XWBI 3KQCA 1L1JA 3UUZA 1A1RA 1VZQH 2QN5T 3SJIA 3RMLH 1ZMNA 2XNIA 5C1UA 4ISHH 2O8LA 1GI3A 1C2LA 4K1TA 1E35B 1NU9A 1A4WH 1T8NA 1YCPM 1P12E 1BTHH 1Q31A 2Z6BD 3PWBA 1Z71A 1TNIA 1XUJA 2ZTZA 1PYTC 2ZPSA 4AGKA 1C5MD 1WBGB 2EI7A 3A7VA 5FXLA 1C1NA 3F9EA 2Y5HA 2Y7ZA 1EPTB 2VH0A 2FXRA 1GMDF 4HGCA 1Z1JA 3MU5A 2YNAA 4MPWA 1DWCH 3PMJA 3KHVA 2IOTA 2H9HA 3KF2A 1XVMA 2FOMB 5K7RA 1Y3YA 2F9NA 2FLBH 4MTBA 1HJAB 1TRYA 1UHBA 1QRXA 1DSUA 1WQVH 2JH0D 3BEUA 4GVUA 1P11E 2FWWA 3ATWA 2F3CE 1RD3B 5JBCS 1MU8B 3UREA 1C1RA 2BY5X 3UQVA 3PROA 3V3MA 1Y5AT 4NCYA 4MQAA 1TA2A 3AW0A 1UVOA 2VGCB 3LJOA 1O34A 4K5ZA 2AIPA 6GCHF 3U8TH 1FPHH 5EW1H 1GHXH 5E0GA 2QXHA 1K1PA 3SV7A 1AMHA 4NFFA 4OGXA 5EPYA 3M3SA 2G4UA 4BTUB 4XOJA 1A46H 4DCDA 2QA9E 2ZFSA 2WV5A 2C3SA 5PTPA 2FOFA 3HKJB 4A5TS 2Y80A 5EQSA 5FX5A 1SHYA 4K2YA 2ZFQH 1C2FA 4JZEH 4RKOB 3RC4A 1PQ7A 5DP3A 3MMGA 1A0JA 3H7TA 1GBAA 3M7TA 1O31A 1ETRH 2PGQB 2ZFTA 3T62A 5B6OA 1J16A 4A92A 4LK4A 3LC5A 1FQ3A 1ZSKA 3TLOA 4ABJA 1C5LH 1QFKH 2QIQA 1O3MA 2FM2A 5AVDA 3SNCA 5F6MA 3RLYH 1AI8H 3AAUA 4NFEA 3UWIA 4FUHA 1INCA 1CO7E 1MAYA 3RXBA 3B8JA 1GBIA 1W11U 1XX9A 1E34B 4IS5A 4YZUA 2W26A 1C4V2 2TGTA 3KNXA 2QXGA 2RA3A 4D9QA 1XKBC 3PWCA 1EZXC 1WSSH 2ZHQH 5E0HA 4X2WA 4Q7YA 1O2XA 2D2DA 3MTYA 2B9LA 1FONA 3PO1C 1GG6C 2ZU3A 5JB8S 2ZG0H 2CV3A 4AOQA 2A7JA 2OD3B 1C4U2 1G32B 1F7ZA 2GDDA 1C1QA 3FP6E 3FZDA 4Z6AH 2SGQE 5FCRA 1C5NH 3FP7E 1Y8TA 1J9CH 1DXWA 1LVMA 5CHAC 1KLTA 1FJSA 5ESTE 4AFZA 5HMAA 1GDNA 1BITA 3K9XB 3TK9A 2ZI2H 1TGNA 2ZECA 2A7HA 2V3HH 1H8IH 2HPPH 1TABE 3SU0A 3GDUA 2GMTC 4X1QU 1S6HA 3DFJA 3BEIB 3A83A 2FI3E 1O2OA 2W7SA 1CGJE 2PGBB 1CHGA 2CMYA 3ESTA 1JMOH 1C5TA 4GHTA 1YPHE 1O33A 2FYRA 1BBRE 4ABHA 1RFNA 4NZLA 3EE0B 1ANCA 5I25A 3H5CB 1K28D 3BTDE 1QB6A 4JMYA 3MU0A 3ZZBA 2BVRH 1G3CA 1SFIA 1H4WA 5LPRA 5DO4H 1GJDB 1KXDA 1JIRA 1WCZA 1O5BB 3CS7A 1DICA 2VINA 1E36B 1LO6A 2ZHFH 1P2OA 4AORA 1LHCH 8GCHF 2VIQA 1TONA 3KIDU 1OOKB 2IN2A 1HAVA 3LDXH 2BLOA 2BVXH 3SHAH 5FPSA 5GPIB 4AYVB 4U32A 1A0HB 3UR6A 2BXUH 2J9NA 1TBZH 3ITIA 2XWAA 2O8UA 4KTUA 1JWTA 3TITA 3EA9A 1GVKB 1GI4A 1TAWA 3A8BA 1OSSA 2QF3A 3A8DA 5J4SA 1C9TA 1TQ0B 2FOHA 1CBWC 5ESBA 3FP8E 1ZHRA 2B5TB 6GCHG 1GCDA 1TPPA 2J92A 2P59A 4ZKOU 1O5DH 1HRTH 1EATA 1ZRBA 1D3TB 1IAUA 1C2MA 1XUHA 1ZPZA 1EJAA 4IMQA 2ZGHA 3I77A 1C2HA 1SOZA 1GBTA 5EXLA 1DFPA 1L2EA 1MMJN 2R9PA 4WMFA 1W12U 2ZDMA 1CGIE 1MBMA 4B2CA 1SGNE 4KKDA 1GHZA 5T3HA 1F5KU 1HAIH 4WH8A 5DJ7A 2XBVA 1AU8A 1TOCB 3U69H 2H5CA 1GBBA 1RTLA 4D7GA 1PPFE 1NO9H 1WAYB 1ZJKA 1QL9A 1IQKA 4WY3A 1FIZA 1LHGH 2SGFE 3OY6U 2VVCA 3SQEE 1HAGE 1N8OB 1WOFA 2FS9A 2ZCHP 1HDTH 1P3EA 1Z6EA 3TPIZ 3P8NA 3GISB 5E0JA 1AWFH 5ETXA 1O2UA 1ESAA 4XSKU 4Y0YE 2VIOA 5AF9H 4AG1A 1WTHD 2RA0A 3ZVEA 1MTWA 1O3AA 2WYJA 1OPHB 4GPGA 1K1OA 1UTPA 3TU7H 1TBRH 5GWZA 1K1JA 3AVZA 9LPRA 1G36A 1EX3A 1QJ1B 4OS1A 4MNXA 2TGAA 3GY7A 2FIRH 3TH3H 3GYLB 1DM4B 3LH1A 4FUDA 3UPEA 3EA7A 2GZ7A 1SG8B 2F83A 4FUCA 4J1YA 1V2RT 2A2XH 4ZHLU 2EI6A 1O3IA 3SU2A 3MH5A 3UR9A 2UUKB 2JH6D 3L6PA 3MI4A 3BIUH 4FU7A 5DP4A 2FX6A 3M5OA 4DT7B 3KCGH 2ZU2A 2WPMS 1L1NA 3T29A 1L4ZA 3LGWA 3AASA 3ATIA 1V2MT 1BIOA 1SGIB 3A7TA 2FP7B 1O5EH 2Z9LA 5EOKA 4B2BA 2AH4X 1SFQB 2ZGXH 1HIAA 1U6QA 1P05A 1IHSH 1AE8H 1Y5UT 2UWPA 1EKBB 2K1QA 4A1XA 4DJZB 1ZPCA 2GDEH 2AMPA 2PWXA 1SQOA 1DWEH 1DVAH 1O36A 2FTLE 3E8LA 4DY7B 7KMEH 5A09A 4X1PU 3SU1A 2ZZUH 5JBAS 1O2YA 1T8MA 3GDSA 8GCHG 2AERH 4AG2A 2A5IA 1H9LB 1QBOA 2P94A 2WPIS 2NWNA 3DT0H 4ABFA 5EGMA 3MH4A 3SU4A 1EPTA 4YOJA 1EOLA 4JYVH 2ALPA 9ESTA 2JH5D 1MTNB 2GP9B 3UWJH 1YP9A 1GBHA 4YO9A 2Z7FE 2BDGA 1RIWB 3I29A 1J14A 1E37B 3SV2H 3HK6B 4DW2U 4Y11E 1O3NA 2FMJA 1ARBA 3SGAE 2ZHWH 4ISOA 4OS2A 4NIVA 1PYTD 2A0QB 1G3BA 1OWEA 1IQLA 4MPVA 1C1VH 2VIWA 2RDLA 1ELEE 1KLIH 4OS4A 1B0FA 1BJVA 1ABJH 1WTGH 3FFGA 1YPHC 2ZWLH 1FPCH 1Z1IA 3MNBA 1XXDA 3KQEA 1C5WB 3AAVA 4YT7H 4UD9H 2BOHB 1ZPBA
chains in the Genus database with same CATH superfamily
1P2QA 1NM6A 2BD5A 4Z1MD 3M61U 2YMSC 4X2YA 4ISNA 2ANKH 4ZAEA 3BTQE 3S0NA 4IGDA 3EE7A 4A1TA 5FBIA 4UFEH 2ZDKA 3SN8A 4WF8A 3VXEH 1O3HA 1H8DH 1F92A 5LPEA 1B0EA 1THRH 1EP5A 3U8RH 1UO6A 2R3UA 4ABDA 4AFSA 1HAOH 1S84A 3QUMP 1T8LA 3EQ0H 3Q3YA 4GUXA 3CNRA 3F0PA 2PKAB 1OYTH 5I46H 1IQIA 5HGGA 1HAYB 1P2MA 1QGFA 2QAAA 1AFQC 4XBDA 1N6XA 3OTPA 1N1LA 4FUGA 2FPZA 5EPNA 1KXEA 1TMTH 3OFND 4YM9A 2F9UA 5TJXA 1BMAA 2GCTB 2H2ZA 1MU6B 2LNCA 3F2FA 4YOGA 2RCEA 1JOUB 2IPHA 2TGPZ 1O3JA 2KAIB 3TIUA 1NN6A 4B74A 1Y59T 1JRTA 2BDAA 1QY6A 1MCVA 3BG4B 2B8OH 3NKKA 3UNSA 4ACAA 5FAHA 1MQ6A 4B73A 3ODDA 4JZFH 4CRGA 1GI7B 1ZJDA 2GJGA 2IJOB 5HM2A 1HV7A 1NROH 1P09A 1MKXK 4AFQA 3PV2A 4U30A 7GCHG 1EZSC 3TJNA 2KCAA 5LPFA 5FPTA 2KCYA 1J17T 1ELTA 1DPOA 2ANYA 1GBJA 2UUYA 2VWNA 2TGDA 3SJ9A 2KFWA 4ABAA 1TA6A 2BD8A 3FVFB 3MU8A 3OTJE 4D9RA 1C5UA 4YXWD 1MZAA 3A82A 2BY8X 5AFZH 2R2WU 1A2CH 1ORFA 4CHAB 1SGDE 3BV9B 1GBDA 1TE0A 1VGCC 1P2JA 1FZZA 2C8XB 4NG9H 1SGQE 3QDZB 4ABGA 2VH6A 1SGCA 4X8TH 1EJNA 1PJPA 2Z9IA 2ZQ1A 1YGCH 1FX0B 4I8JA 1MUEB 4ZKSU 4WJG2 3OEED 3GY6A 2SFAA 1ZSJA 4ZROA 1VR1H 1EB2A 1QIXB 4AX9H 1DWBH 3ODFA 3E91A 3SYJA 1DLKB 2BD3A 1HNEE 2BDYA 1ESTA 3ZYEA 5F8ZA 3D23A 1SSXA 3FAOA 4KP0A 3F2GA 1C1OA 1AVWA 3PV4A 3T28A 1SVPA 2OC8A 2Y5GA 1NBME 1W0ZU 2A32A 4F48B 1K9OE 4I8LA 3GS9A 2H9EH 4CRCA 1GJ4H 4MDSA 3ZYDA 4Y76A 3F2HA 1C5YB 1UVUH 1TBQH 4P02A 1XUGA 2VB0A 5CMXH 1EXFA 1P01A 3PLBA 1SB1H 1K22H 3O8CA 1SGFA 5FHTA 2A4OA 4F55A 1GI5A 2G8TA 2ZKSA 1OWHA 2TIOA 1GBMA 2ZTYA 1BT7A 1ETTH 2SGPE 2IPQX 1KLJH 5FPYA 2BOKA 1CT4E 1KYNA 1UK4A 3VB4A 4BXSA 1KXFA 2Q6DA 1GJAB 3F9GA 3BSQA 2GX4A 5A8YA 1YLNA 2QXJA 2JDID 4MNWA 3SU5A 2FEQH 1FXYA 4RSPA 1AO5A 2EY4C 3GOVB 2HLDD 1BTXA 3Q00A 3E1XB 2A2QH 1XVOA 2P8OC 1D9IA 1RXPA 5L6NH 3F3BA 3P8FA 2XC4A 1IQFA 1HXFH 2F91A 3F9HA 3ZZ7A 4BAQB 4R0IA 1H1BA 4HI3A 5CE1A 2HALA 3QGNB 2H6MA 3L3TA 1CT2E 2OXSA 1UTMA 4B75A 3BTGE 1F5RA 4FXGH 1WYKA 2FYQA 3S9CA 4DOQA 5JPMH 1MD8A 1RTKA 3VB5A 3SO3A 1ABIH 5GDSH 1AFEH 2G51A 3VB3A 3GCNA 1UK3A 4K8BA 1LCYA 4Y8XA 1HLTH 2XBXA 1SLWB 1TX6A 1PPZA 3A8AA 4BAKB 1DS2E 1LKAA 1J15A 4B71A 2AYWA 4FU9A 4TY6A 1ID5H 3IWMA 5AHGH 2STAE 1SGRE 1IQJA 1KXBA 4X2VA 3RMOH 4XBCA 1O2KA 4CR9A 1TYNA 1W7XH 1GL1A 1KY9A 3TNSA 7ESTE 3RXMA 1MQ5A 2H5DA 4DIHH 4BAOB 2K0QA 3W94A 4U01A 1CSOE 3FKSD 2ZEBA 1A0LA 1GI8B 3M5LA 4K1EA 1V2UT 4NIYA 4AC9A 3EYDA 1O3LA 1V2OT 3PLPA 4INHA 3IITA 4TWYA 4GLYA 2GCTC 3JZ2B 4AFUA 1J8AA 2CHAB 3DA9B 3VGCC 1YPLH 2BZAA 1DY9A 3G01A 3GCHB 2G5NA 1F2SE 2YOLA 4GHQA 4IBLH 1TLDA 5JBBS 1TPSA 3DSOA 1GHYH 1MTSA 4B6EA 1UTOA 4U2WA 1CA0B 1Z8GA 1E38B 1XUIA 1LHDH 1AZZA 3SORA 1O3BA 2RDEA 1UTLM 1GBLA 8KME2 3PMBB 1MD7A 4CRBA 3BTKE 4GSOA 1YF4A 1BCUH 4RN6A 2EI8A 1AKSB 4Z0KA 3F68H 3SU6A 2VWLA 2PSYA 4Y8ZA 1GMCF 2ZGCA 1KDQB 1UVSH 3E0PB 1Y3VA 1SL3A 1ZHMA 2ODYB 1FY1A 1RGQA 2ANWA 1GBCA 1MKWH 3KEEA 4TY7A 5L30H 1GGDB 1FY3A 2Z3CA 3ZZAA 1P3CA 1HBTH 1CGHA 3BG8A 1AB9B 1FY8E 3V0XA 1FI8A 2I6SA 3Q3KA 1K2I1 3RMMH 1DE7H 4D76A 1UCYK 3A7YA 1AUJA 1YCPK 4RI0A 4Q7ZA 3PB1E 3VPKA 1WQSA 4TPIZ 1ZYOA 4ABIA 1AY6H 2GCHF 4OS6A 5HXFA 1IQMA 4NGAH 2OTVA 3RP2A 3N7DA 1EUFA 1UVPA 2OC0A 4WMEA 2ANMH 3U98H 3SGBE 3SQHE 2VWOA 3M5NA 1O2JA 1AN1E 1TGTA 4FUEA 1IQEA 2Z9JA 3WWBA 5C5OA 1FAXA 1O2MA 4CBOA 1EB1H 4FUBA 1FMGA 1YPJH 4UDWH 4IW4E 2ZC9H 2ZU5A 1TB6H 4I8KA 2VIPA 1D3QB 1D6RA 1DOJA 4ZXYH 3GY3A 2OC7A 5LGOA 2QV1A 1RS0A 2O8MA 2SNWA 1H8HD 5G4BA 2V3MA 1QB9A 3QLPH 2XW9A 4XDEA 2ZFFH 5EQQA 2OLGA 4FVBA 1DLEA 3F1SB 1GJ9B 3W95A 1AVXA 5KEDA 4NA9H 2Z94A 5C20A 3VEQB 1Z8IB 4WH6A 2GTBA 1TGBA 1NESE 1DITH 2JETB 4FU8A 2THFB 3QK1A 1GHBF 2B0FA 2VVVA 3TK6A 1VITH 4MLFB 1AD8H 5JB9S 1EPTC 2CF9H 3A85A 3K6YA 2A4GA 4JK6A 2Y81A 3SNEA 3A87A 1OWJA 2SNVA 2BDBA 2Z9GA 1CHOF 3M7QA 1HJAC 3ELAH 3RM2H 5C2ZA 1ELDE 3AW1A 1T32A 3RXPA 2BB4A 4IN1A 2PR3A 4O3UA 4B76A 4FETA 1V2TT 3HGNA 3QGJA 2ZGBH 4ZHMU 2KAIA 5A8XA 3KGPA 2VGCC 1BBRK 2GZ8A 2EQNA 2ZPRA 1FLEE 2PSXA 2P3TB 3RDZA 1UHBB 1CA8B 3UOPA 1DANH 1C1WH 3T2NA 4SGBE 1NFUA 2J2UA 3K2UA 4FUJA 3ZVDA 2Z3DA 1O2GH 2OQ5A 1VCPA 1LPZB 4O97A 4XE4A 1ANDA 1W14U 4ISIH 1GVZA 1NRQH 3OYPA 3BTWE 3T25A 5HYOA 2WZQA 1A7SA 4KELA 1OP0A 1ZTLA 1S83A 5HKKD 1T31A 2QYIA 1DX5M 1LHEH 2LELA 5AFYH 1FUJA 1PQ5A 3GY5A 1O32A 5B6LA 1GI6A 3LIWA 4F49A 5DKMA 2PKSB 4TSFD 2ZIQH 3EAJA 4XFQA 2HOBA 3D49H 1ZGIA 3RLWH 2ZDLA 2ZHDA 2AGGX 1MTUA 2O8WA 4BTIB 1JXPA 1QA0A 1TX8A 2O9QA 2J4IA 1BOQA 1NRNH 3M7UA 1CU1A 1H9HE 3RXGA 3R0FA 1TNHA 1GMCG 1XUFA 3FN8A 2EA3A 1M9UA 7GCHF 1LHFH 4UFDH 5H4IB 1V2KT 2XC0A 2FOBA 4LXBH 3ATLA 2BXTH 2V6NA 3OSYA 4ZMAH 1TFXA 4QT8C 4X2XA 1EZUC 2DUCA 2FS8A 1BHXB 2FOEA 2O8TA 2P3FH 1B7XB 1P04A 1LPKB 3DFLA 1TPOA 3ENSB 3RUOA 1YBWA 3RXIA 3A7ZA 6LPRA 1EAUA 2AEIH 2ZDVH 4NA7A 4I8HA 3U1JB 1GL0E 3DUXH 2GCHG 2TRMA 4ASUD 4VGCB 3JZ1B 4P00A 1YPMH 5FX6A 4AGJA 2A7CA 4GCHF 3ZVAA 3U1IB 1THSH 2VNTA 4RT1A 4FVDA 1OX1A 5GCHF 4JYTA 8ESTE 1W7GH 1HAPH 1TMUH 1PPGE 2V0BA 4WMDA 1IOEA 2SGEE 1HJ9A 2WUBA 2BVSH 3MWIU 2VJ1A 2HWLB 1FAKH 1C9PA 3ZV8A 3QZRA 5A0CA 1O3KA 1FN6A 1V6DA 1C5XB 4JCNA 5FCKA 1YPKH 3EA8A 3SZNA 4I33A 1O2RA 5FL7D 1VCQA 5DP5A 1EAWA 4X8SH 3S7KB 2GV6A 1BA8B 3ZZ3A 2C93B 1P57B 2HNTE 3OU0A 1GHBG 1B5GH 1DDJA 1TPAE 2EEKA 1OHHD 2V3OH 3PRDA 4KGAA 1S0QA 5DP7A 2BDHA 3OY5U 4ISLA 1WUNH 3GY2A 3CENA 3SUGA 3PYHA 1XXFA 3SNDA 1AGJA 1CHOG 1OP8A 2FESH 3A89A 1ZR0A 1AQ7A 2W6JD 4H4FA 1PPHE 2TBSA 1SC8U 3E0NB 4BANB 3TGIE 3ZVCA 1O3CA 1BTPA 2CN0H 1UTNA 2QXIA 4K1SA 1GI1A 1HAVB 2KX4A 4FUFA 1TRMA 1WDIA 2PP6A 1D3DB 1V2VT 1ZGVA 3M35A 1BRUP 3V7TA 2KCPA 4SGAE 3A7WA 3UNRA 2G00A 1GMHF 3MOCA 3QN7A 3SNBA 1DUEA 1UCYH 3SJOA 1LDTT 1UVTH 2G81E 1P2IA 2BQ6B 2K8IA 4K69A 3RU4E 1QL8A 2AS9A 1NS3A 3A80A 4JZDH 1G3EA 1C5QA 2G4TA 4MG3A 5EXMA 1ELAA 2A5KA 1V2QT 1K1MA 4ASHA 1RJXB 1Z8JB 1SGTA 4X1RU 1HPGA 3RXSA 3MU1A 3QX5H 1O2VA 4KTCA 2EC9H 2GZ9A 3RXHA 2QY0B 1N8OC 2A1DB 5A0BA 2QF5A 3UAIC 5C17A 1HYLA 3PO1B 4I7YH 1FY4A 1BMFD 1GG6B 3VB6A 5EJZA 2Z3EA 2WPKS 2XC5A 3GY8A 4BOHA 5IK2D 1ZLRA 1KXCA 1P2NA 3U8OH 1Z6JH 1K21H 2D1JA 2TPIZ 2WV4A 4H42U 4TPYA 1AKSA 2Q6GA 1O2PA 1F0SA 2R0KA 3BTME 1VJAU 2B7DH 3GCOA 3SI4H 1IQGA 1A5HA 3DCLA 5CHAB 2PUQH 5HIZA 1P8VC 1O2WA 1WU1A 4CREA 2BD4A 2GKVE 1SGFG 1TX7A 3DSPA 1Q2WA 3DD2H 3NXPA 3PM3A 1UJ1A 5T6GA 2GMTB 1NPMA 3SU3A 3CS0A 3FO8D 2ZP0H 2BD2A 2WYGA 1MZDA 1YC0A 1EAIA 2BD7A 1SQRA 1SHHB 3PMAB 3HK3B 1GVLA 4ZKNU 1G2MA 5EJLA 1C1TA 2WPLS 4ABEA 1L1GA 1O0DH 1TALA 4MPXA 1Z7KA 1NFXA 1NFWA 1K1LA 1QL7A 3RU4D 4GCHG 3PMHB 2H1UA 3UQOA 3W1EA 2R3YA 3P8OA 3BIVH 4YOIA 1GDQA 3BEFB 4JZ1A 3SOSA 3C27B 3MYWA 4GAWA 5GCHG 1BMMH 2WPJS 4WXIA 2BM2A 1GHWH 1BDAA 3LH3A 4BNRA 5EODA 1O2TA 4Q2KA 1HAZB 1DSTA 1P10A 1ZRKA 1O5AB 4FOUC 3NZIA 2OP9A 3D65E 4OS7A 1K1NA 4B2AA 5EW2H 1GCTB 1TWXB 2BYAX 2ZGJA 5C67A 3BTFE 4DG4A 5T6FA 2GT7A 3SJKA 5DG6A 4ZKRU 5C0TA 1TQ7B 2FI5E 1O2IA 2BQWB 1VITF 2Z9KA 3B23B 1GDUA 1P9SA 5F8XA 3MFJA 3E90B 1V2JT 1V3XA 4UEHH 1IHTH 3MNXA 1E79D 1GJ8B 3GDVA 4Q63A 1PPEE 3KN2A 3WW7A 1SLXB 4IC6A 1CBWB 4K3JA 2ZA5A 1QBNA 4VGCC 1GHAF 3STJA 1S81A 2ZHEH 1Q3XA 3PLKA 1G37A 1ZMLA 1SI5H 3LKWA 5JBTA 5HM9A 1DT2A 1ANEA 3KL6A 3M3VA 4MPUA 2OQUA 4BXWA 4I8GA 3LU9B 4HTCH 1C5PA 1C2JA 1MTNC 1C2DA 1O5CB 2W7UA 1SBWA 2XBWA 2FODA 1E1RD 2AGEX 3ZZCA 5SGAE 1KSNA 1NU7B 1BMLA 1RIWC 3R3GB 1CE5A 2G52A 1PFXC 2GD4B 4NA8A 3A88A 3O8DA 1WXRA 2OUAA 2NU1E 1DWDH 1GMHG 1C2EA 1HFDA 1QRWA 1GI0A 1NRPH 4BAMB 4CH2B 2QE7D 5E2OA 1AIXH 2HGTH 3EDXB 4CRAA 1G9IE 3NUMA 1BTUA 4THNH 1HXEH 1MCTA 2NU0E 3PV5A 1L0ZA 5A0AE 3ATMA 1C5SA 1WV7H 3AK5A 1LKBA 3TNTA 1JIMA 1THPB 2PTCE 1ZMJA 3KQ5A 3OAAD 1O30A 2HRVA 5F03A 1D3PB 1COWD 2PTNA 2ZFPH 1PQ8A 3URDA 4A6LA 2XRCA 1NBMD 3SV8A 1QBVH 4Y7BA 2CXVA 4OGYA 3BTHE 1A61H 1O2ZA 1QB1A 1GBEA 3FZZA 4PROA 2HNTC 4UFGH 1CVWH 1UCYE 4TWWA 3Q76A 2Y7XA 4I31A 2XCFA 3OE7D 4MVNA 1O38A 1QA7A 1KIGH 1C5ZB 2BHGA 3S7HB 2BX4A 2JKHA 2I6QA 3M3TA 1O39A 1GJBB 5DPAA 4AN7A 1O3FA 3UTUH 1F0RA 1OS8A 3QO6A 1ZSLA 4ZXXH 5EU8A 1ANBA 1LVBA 1QTFA 4DIIH 2VVUA 8LPRA 2ODPA 1JBUH 2V7QD 3TJVA 1A5IA 1FIWA 2HLCA 3MO6A 1QQ4A 4IN2A 3L33A 3MHWU 3N7EA 4X6MA 3LGUA 5K0HA 1XM1A 3QZQA 4O3TA 3SGQE 3TH2H 1V2ST 4ZH8A 3RXCA 3S9AA 1BJUA 3BG4C 3N7OA 5A2MH 2F9VA 1ACBE 2GV7A 3P92A 1Y3UA 1HAHH 2OINA 2BDIA 2QGRA 1TRNA 4Y0ZE 4Y7AA 1SGEE 3FANA 2J98A 2OBOA 2WPHS 4X1SU 5F8TA 3SUFA 3RXOA 2ILNA 1ZZZA 1O2SA 3E16B 1PPBH 3F6UH 2ZCKP 4X6OA 3LPRA 1QR3E 1IQNA 1ZTJA 2ZU1A 1S5SA 3GICB 5C1XA 4MNVA 3RMNH 1GBKA 3VB7A 2Q1JA 2R0LA 4FUIA 1VITG 1BZXE 2UUJB 2BMGB 2FDAA 2PW8H 4NSYA 2STBE 4Q80A 2D26C 5GJ4B 4CHAC 1HGTH 4NWKA 1HCGA 4O03A 3F9FA 2ZF0H 4A1VA 1GHAG 3RXAA 2PLXA 1IQHA 2FO9A 2WUCA 1BRAA 3RXDA 1G2LA 3S9BA 2UWLA 2BZ6H 3SV9A 3BTTE 1ELGA 1TNKA 4ZUHA 3ZZ9A 1NT1A 3LJJA 5E2PA 2XNDD 3SHCH 5CHBA 4F4OC 2QC2A 1ESBA 2GVFA 1C2KA 1EASA 1UTKA 3BF6H 4JK5A 5DP8A 1C5OH 1O2HA 1QURH 2FOAA 2WINI 1GI2A 2OBQA 1V2PT 1MKXH 4DVAU 5DN6D 3ZZ6A 1NFYA 1ELFA 1GMDG 4BAHB 2A45B 1GCTC 2G55A 2GT8A 3UIRA 1QQUA 1LTOA 5GXPA 1QJ7B 1CT0E 2CF8H 2YMSB 1OKXA 2Y82A 4NIWA 2SGDE 4Y8YA 1O3DA 3U28C 2PKAA 2F9BH 1SLUB 5DK1A 1NZQH 4E7NA 4A7IB 1YM0A 2UUFB 2ZO3H 3P6ZB 1GHVH 2BLVA 1C2IA 3NK8A 3BTEE 6CHAB 1QHRB 5C94A 2BDCA 5ABWA 3P17H 2AMDA 1C1UH 1TGSZ 4LOYH 1OP2A 2W5EA 3LGIA 3V13A 1F0TA 6ESTA 2P93A 1NRSH 3NPSA 2C8WB 3STIA 1P2KA 4YESB 1ZOMA 2NU4E 2C4FH 1SOTA 2C8ZB 1AVGH 5KGOA 1V2WT 3RM0H 3T26A 1RRKA 2SGAA 2PUXB 5L2YH 1NC6A 1S6LA 1T4UH 1SPJA 1AFQB 3Q77A 2ZU4A 3HKIB 1OWDA 1LMWB 4H6TA 2FLRH 2BX3A 1QJ6B 3RU4T 4IC5A 1TNLA 1QNJA 3VXFH 2ZTXA 2QF0A 4INKA 1W2KH 3SNAA 3MU4A 4M7GA 1QRZA 1UW7A 5GIBA 1O2LA 4OS5A 3URCA 3RXKA 4X0WU 5LH8A 3GY4A 1NRRH 1UTJA 1EOJA 4NWLA 1X7AC 1C4Y2 3SW2B 2WPDD 3LONA 4WVPE 1SGPE 1ELCA 1EAXA 1S0RA 3RXLA 1O5FH 1C5RA 3A86A 1GJ6A 2OC1A 1YYY1 4YT6H 2C90B 1UTQA 1W10U 1CQQA 2H9TH 1AHTH 4ABBA 3MH6A 3VFEA 4CBNA 2P3UB 3GCTF 2BTCE 2LPRA 3TH4H 3SV6A 2M5TA 1ETSH 1HJ8A 1VCWA 2P16A 1VKYA 3RXJA 2QF4A 3T27A 3IG6B 4AB9A 5A8ZA 1O2QA 1SQTA 3RXEA 5C5NA 2BY9X 1HB0B 3LGYA 4Y10E 5BPEA 2Q6FA 3M37A 1XMNB 1A3BH 3U9AH 3E3TA 4NZQA 4XBBA 3TJUA 5EG4A 4E05H 2XTTB 4DURA 2PHBA 5HIYA 3RXTA 3OX7U 3KQDA 2Y5FA 4AYYB 2HVXA 1W0JD 3VG8A 1AE5A 3A81A 3DHKH 2XOKD 1TNGA 1D6WA 3MH7A 2A31A 4AB8A 4CRDA 1VGCB 1P06A 1LQEA 3ZZ8A 2XBYA 2ZQ2A 3MO3A 2NU2E 4Y71A 4X6PA 1ELBA 1MAXA 1O2NA 2CGAA 3NCLA 1LVYA 2AIQA 4Q7XA 3OEHD 2FZZA 2A4QA 2KZ4A 2BLQA 1P03A 1MTVA 2CHAC 3P8GA 5DP9A 4Y79A 2ZCLP 3B9FH 3PTNA 3GCHC 3O8RA 3ZVGA 1BTZA 1O3OA 1YPEH 5C3NA 1BTYA 4HFPB 1AZ8A 5T6DA 5DGJA 3PTBA 1Y3WA 1BB0B 2BQ7B 1CA0C 4BTTB 1SQAA 3D62A 4ESTE 2JJ1D 5TCAA 1KTTB 1YLDA 2G5VA 3TGKE 1D4PB 2J5UA 2D8WA 3TVJB 2RG3A 1C2GA 1NTPA 4UONA 1Y5BT 1FV9A 1C1MA 3RXVA 5E8EH 1JRSA 1EZQA 3E6PH 4LZ4B 3LOXA 1C5VA 4Y6DA 4X8VH 1O3EA 1O37A 3SUEA 1LQDB 5TCCA 2FI4E 2JIZD 1C1PA 3P95A 3ZV9A 3RXRA 1GGDC 3A7XA 4D8NA 2W3IA 1AUTC 2BLWA 1AB9C 1A3EH 4MNYA 2PFEA 1TMBH 1H8ED 5EXNA 3K6ZA 1P9UA 4INLA 1FDPA 3C1KA 1GI9B 1HAXB 1XUKA 4HZHA 3QTVH 4XD7D 2J34A 4KTSA 1L4DA 3H7OA 4UE7H 3SBKA 3P70B 5C1YA 2J95A 2OK5A 1KTSB 1FY5A 2XCNA 4K8YA 1DXPA 2AMQA 1BMNH 1TGCA 2J94A 3LT3A 1GJ5H 1MABB 1K1IA 2ESTE 1G3DA 5IYTA 1P02A 2DE8A 3UNQA 1QZ8A 2ODQA 1LVOA 1OYQA 2BY7X 3LGTA 2V35A 4YTAA 4ZHAA 1KXAA 3BN9A 2GGVB 3RXQA 2FX4A 2XXLA 4DGJA 2P8OB 3UOUA 1H9IE 4E7RG 3RXUA 3ZVBA 2ZNKH 4X1NU 5BRRE 2W6ID 1UMAH 4IMZA 1SLVB 2A4RA 3MO9A 2DE9A 5FBEA 1AWHB 1SR5C 1BHXF 4WWYA 3T5FH 2CJIA 1OWIA 4RKJB 1RTFB 4D7FA 4AZ2B 3NRLA 4NSVA 1V2NT 2BD9A 1EQ9A 4RT0A 3ZZ5A 4X8UH 1NY22 2F9PA 3A84A 1EP6A 3K65B 1FN8A 1LPGB 1S6FA 5EIYA 1TOMH 1E0FD 1T7CA 1YCPH 3ATKA 5EQRA 2JETC 1TNJA 3ZVFA 4CRFA 6CHAC 3M5MA 1UK2A 1A5GH 4YLQH 3SI3H 1YY3A 2ZFRH 3KQBA 1W0YH 3GCTG 1MH0A 4YLUA 1W3CA 2ZDAH 3O8BA 2KCOA 1BRCE 1W8BH 1O35A 3NWUA 2ALVA 1GWAA 4J2YB 3DSGA 1ZHPA 1DY8A 3HATH 5JYIA 1MKWK 2QCYA 2FOCA 1T8OA 1YLCA 1ELVA 1W13U 2VIDA 2VWMA 1Z8RA 1PPCE 3QTOH 5DP6A 3SJ8A 3A8CA 1OWKA 3MNCA 3CP7A 3Q3XA 4O9VA 1GBFA 5J4QA 1SMFE 2F9OA 4UFFH 1S82A 3VGCB 2A5AA 3MNSA 1GJCB 3V12A 2VIVA 3UFAA 1O5GH 2FTMA 4CR5A 1EJMA 1KDQA 1SKYE 1S85A 1BTWA 1QCPA 2OCVB 3ZZDA 1GJ7B 1MBQA 2YNBA 4I32A 4R8TB 1YPGH 1G30B 3EGKH 2AFQB 1OXGA 2R2MB 3RC6A 2BY6X 3UY9A 4JZIA 4WXVA 4B1TA 1O3PB 2JJ2D 1V2LT 2PV9B 1BQYA 3TGJE 4X6NA 4TYDA 1SGYE 4NIXA 3S69A 3ZZ4A 4CH8B 2HNTF 1F5LA 1FNIA 2XYAA 2PKSC 3M36A 1PQAA 2J38A 4I86A 3LC3A 1BUIA 3GYMA 1DUAA 2C8YB 4XRNA 3TK5A 2FOGA 1VJ9U 1BBRH 5IDKA 2ZPQA 5JDUB 3RXFA 1TIOA 3I78A 1P0SH 3SUDA 3HGPA 3LGVA 3F0OA 1Y3XA 1C1SA 1N6YA 2UWOA 5L2ZH 1T4VH 1XKAC 2Y6TA 4K60A 4LZ1H 1ARCA 3QWCH 5T1VA 1BRBE 1O3GA 2VU8E 7LPRA 3HPTB 2P95A 1YKTA 2ULLA 3UB0A 1HUTH 1GPZA 2W3KA 3WY8A 2ASUB 2HPQH 4E06H 4H6SB 3TJOA 1ZTKA 2NU3E 1F0UA 2AGIX 4JYUH 3RC5A 1HIAB 2ZDNA 2XWBI 3KQCA 1L1JA 3UUZA 1A1RA 1VZQH 2QN5T 3SJIA 3RMLH 1ZMNA 2XNIA 5C1UA 4ISHH 2O8LA 1GI3A 1C2LA 4K1TA 1E35B 1NU9A 1A4WH 1T8NA 1YCPM 1P12E 1BTHH 1Q31A 2Z6BD 3SZEA 3PWBA 1Z71A 1TNIA 1XUJA 2ZTZA 1PYTC 2ZPSA 4AGKA 1C5MD 1WBGB 2EI7A 3A7VA 5FXLA 1C1NA 3F9EA 2Y5HA 2Y7ZA 3MQKC 1EPTB 2VH0A 2FXRA 1GMDF 4HGCA 1Z1JA 3MU5A 2YNAA 4MPWA 1DWCH 3PMJA 3KHVA 1YWUA 2IOTA 2H9HA 3KF2A 1XVMA 2FOMB 5K7RA 1Y3YA 2F9NA 2FLBH 4MTBA 1HJAB 1TRYA 1UHBA 1QRXA 1DSUA 1WQVH 2JH0D 3BEUA 4GVUA 1P11E 2FWWA 3ATWA 2F3CE 1RD3B 5JBCS 1MU8B 3UREA 1C1RA 2BY5X 3UQVA 3PROA 3V3MA 1Y5AT 4NCYA 4MQAA 1TA2A 3AW0A 1UVOA 2VGCB 3LJOA 1O34A 4K5ZA 2AIPA 6GCHF 3U8TH 1FPHH 5EW1H 1GHXH 5E0GA 2QXHA 1K1PA 3SV7A 1AMHA 4NFFA 4OGXA 5EPYA 5DSFA 3M3SA 2G4UA 2HVYB 4BTUB 4XOJA 1A46H 4DCDA 2QA9E 2ZFSA 2WV5A 2C3SA 5PTPA 2FOFA 3HKJB 4A5TS 2Y80A 1W0KD 5EQSA 4ACBA 5KECA 5FX5A 1SHYA 4K2YA 2ZFQH 1C2FA 4JZEH 4RKOB 3RC4A 1PQ7A 5DP3A 3MMGA 1A0JA 3H7TA 1GBAA 3M7TA 1O31A 1ETRH 2PGQB 2ZFTA 3T62A 5B6OA 1J16A 4ZCNA 4A92A 4LK4A 3LC5A 1FQ3A 1ZSKA 3TLOA 4ABJA 1C5LH 1QFKH 2QIQA 1O3MA 2FM2A 5AVDA 3SNCA 5F6MA 3RLYH 1AI8H 3AAUA 4NFEA 3UWIA 4FUHA 1INCA 1CO7E 1MAYA 2VBCA 3B8JA 3RXBA 1GBIA 1W11U 1XX9A 1E34B 4IS5A 4YZUA 2W26A 1C4V2 2TGTA 3KNXA 2QXGA 2RA3A 4D9QA 1XKBC 3PWCA 1EZXC 1WSSH 2ZHQH 5E0HA 4X2WA 4Q7YA 1O2XA 2D2DA 3MTYA 2B9LA 1FONA 3PO1C 1GG6C 2L6OA 2ZU3A 5JB8S 2ZG0H 2CV3A 4AOQA 2A7JA 2OD3B 1C4U2 1G32B 1F7ZA 2GDDA 1C1QA 3FP6E 3FZDA 4Z6AH 2SGQE 3N99A 5FCRA 2LP6A 1C5NH 3FP7E 1Y8TA 1J9CH 1DXWA 2KR7A 1LVMA 5CHAC 1KLTA 2WHXA 1FJSA 5ESTE 4AFZA 5HMAA 1GDNA 1BITA 3K9XB 3TK9A 2ZI2H 1TGNA 2ZECA 2A7HA 2V3HH 1H8IH 2HPPH 1TABE 3SU0A 3GDUA 2GMTC 4X1QU 1S6HA 3DFJA 3BEIB 3A83A 2FI3E 1O2OA 2W7SA 1CGJE 2PGBB 1CHGA 2CMYA 3ESTA 1JMOH 1C5TA 4GHTA 4HG6A 1YPHE 1O33A 2FYRA 1BBRE 4ABHA 5F53A 1RFNA 4NZLA 3EE0B 1ANCA 5I25A 3H5CB 1K28D 3BTDE 1QB6A 4JMYA 3MU0A 3ZZBA 2BVRH 1G3CA 1SFIA 1H4WA 5LPRA 5DO4H 1GJDB 1KXDA 1JIRA 1WCZA 1O5BB 3CS7A 1DICA 2VINA 1E36B 1LO6A 2L74A 2ZHFH 1P2OA 4AORA 1LHCH 8GCHF 2VIQA 1K0HA 1TONA 3KIDU 1OOKB 2IN2A 1HAVA 3LDXH 2BLOA 2BVXH 3SHAH 5FPSA 5GPIB 4AYVB 4U32A 1A0HB 3UR6A 2BXUH 2J9NA 1TBZH 3ITIA 2XWAA 5EJ1A 2O8UA 4KTUA 1JWTA 2WV9A 3TITA 3EA9A 1GVKB 1GI4A 1TAWA 5C0UA 2WSSD 3A8BA 1OSSA 2QF3A 3A8DA 5J4SA 1C9TA 1TQ0B 2FOHA 1CBWC 5CDFE 5ESBA 3FP8E 1ZHRA 2B5TB 6GCHG 1GCDA 1TPPA 3WWFA 2J92A 2P59A 4ZKOU 1O5DH 1HRTH 1EATA 1ZRBA 1D3TB 1IAUA 3FOAA 1C2MA 1XUHA 1ZPZA 1EJAA 4IMQA 2ZGHA 2RFKC 4Q4LA 3I77A 1C2HA 1SOZA 1GBTA 5EXLA 2J97A 1DFPA 1L2EA 1MMJN 2IJD1 2R9PA 4WMFA 1W12U 2F43B 2ZDMA 1CGIE 1MBMA 4B2CA 1SGNE 4KKDA 1GHZA 2YMSD 5T3HA 1F5KU 1HAIH 4WH8A 5DJ7A 2XBVA 1AU8A 1TOCB 3U69H 2H5CA 1GBBA 1RTLA 4D7GA 1PPFE 1NO9H 1WAYB 1ZJKA 1QL9A 1IQKA 4WY3A 1FIZA 3KYFA 1LHGH 2SGFE 3OY6U 2VVCA 3SQEE 1HAGE 1N8OB 1WOFA 2FS9A 2ZCHP 1HDTH 1P3EA 1Z6EA 3TPIZ 3P8NA 3GISB 5E0JA 1AWFH 5ETXA 1O2UA 1ESAA 4XSKU 4M9FA 4Y0YE 2VIOA 5AF9H 4AG1A 1WTHD 2RA0A 3ZVEA 1MTWA 1O3AA 2WYJA 1OPHB 4GPGA 1K1OA 1UTPA 3TU7H 1TBRH 5GWZA 1EFRD 1K1JA 3AVZA 9LPRA 1G36A 1EX3A 1QJ1B 4OS1A 4MNXA 2TGAA 3GY7A 2FIRH 3TH3H 3GYLB 1DM4B 3LH1A 2M2AA 4FUDA 3UPEA 3EA7A 2GZ7A 1SG8B 2F83A 4FUCA 4J1YA 1V2RT 2A2XH 4ZHLU 2EI6A 1O3IA 3SU2A 3MH5A 3UR9A 2UUKB 2JH6D 3L6PA 3MI4A 3BIUH 4FU7A 2KM0A 5DP4A 2FX6A 3M5OA 4DT7B 3KCGH 2ZU2A 2WPMS 1L1NA 3T29A 1L4ZA 3LGWA 3AASA 3ATIA 1V2MT 1BIOA 1SGIB 3A7TA 4OM9A 5GNDA 2FP7B 1O5EH 3ZIAD 2Z9LA 5EOKA 4B2BA 2AH4X 1SFQB 2ZGXH 1HIAA 1U6QA 1P05A 1IHSH 4TT3D 1AE8H 1Y5UT 2UWPA 1EKBB 2K1QA 4A1XA 4DJZB 1ZPCA 2GDEH 2AMPA 2PWXA 2CK3D 1SQOA 1DWEH 1DVAH 1O36A 2FTLE 3E8LA 4DY7B 7KMEH 5A09A 4X1PU 3SU1A 2ZZUH 5JBAS 2AHME 1KMHB 1O2YA 1T8MA 3GDSA 8GCHG 2AERH 4AG2A 2A5IA 1H9LB 1QBOA 2P94A 2WPIS 3H09A 2NWNA 3DT0H 3PRBA 5EGMA 4ABFA 3MH4A 3SU4A 1EPTA 4YOJA 1EOLA 4JYVH 2J98B 2ALPA 9ESTA 2JH5D 1MTNB 2GP9B 3UWJH 1YP9A 1GBHA 4YO9A 2Z7FE 2BDGA 1RIWB 3I29A 2F4LA 1J14A 1E37B 3SV2H 3HK6B 4DW2U 4Y11E 1O3NA 2FMJA 1ARBA 3SGAE 2ZHWH 4B6FA 4ISOA 4OS2A 4NIVA 1PYTD 2A0QB 1G3BA 1OWEA 1IQLA 4MPVA 1E1QD 1C1VH 2VIWA 2RDLA 1ELEE 1KLIH 4DT4A 4OS4A 1B0FA 1BJVA 1ABJH 1WTGH 3FFGA 1YPHC 2ZWLH 1FPCH 1Z1IA 3MNBA 1XXDA 3KQEA 1C5WB 3AAVA 3KYGA 4YT7H 4UD9H 2BOHB 1ZPBA
chains in the Genus database with same CATH topology
1P2QA 1NM6A 2BD5A 3M61U 4X2YA 4ISNA 2ANKH 4ZAEA 3BTQE 3S0NA 4IGDA 4A1TA 5FBIA 4UFEH 2ZDKA 3SN8A 4WF8A 3VXEH 1O3HA 1H8DH 1F92A 5LPEA 1B0EA 1THRH 1EP5A 3U8RH 1UO6A 2R3UA 4ABDA 4AFSA 1HAOH 1S84A 3QUMP 1T8LA 3EQ0H 3Q3YA 4GUXA 2PKAB 1OYTH 5I46H 1IQIA 5HGGA 1HAYB 1P2MA 1QGFA 2QAAA 1AFQC 4XBDA 1N6XA 1N1LA 4FUGA 2FPZA 5EPNA 1KXEA 1TMTH 4YM9A 2F9UA 5TJXA 1BMAA 2GCTB 2H2ZA 1MU6B 2LNCA 4YOGA 2RCEA 1JOUB 2IPHA 2TGPZ 1O3JA 2KAIB 3TIUA 1NN6A 4B74A 1Y59T 1JRTA 2BDAA 1QY6A 1MCVA 3BG4B 2B8OH 3NKKA 3UNSA 5FAHA 1MQ6A 4B73A 3ODDA 4JZFH 4CRGA 1GI7B 1ZJDA 2IJOB 5HM2A 1HV7A 1NROH 1P09A 1MKXK 4AFQA 4U30A 7GCHG 1EZSC 3TJNA 5LPFA 5FPTA 1J17T 1ELTA 1DPOA 2ANYA 1GBJA 2UUYA 2VWNA 2TGDA 3SJ9A 4ABAA 1TA6A 2BD8A 3FVFB 3MU8A 3OTJE 4D9RA 1C5UA 1MZAA 3A82A 2BY8X 5AFZH 2R2WU 1A2CH 1ORFA 4CHAB 1SGDE 3BV9B 1GBDA 1TE0A 1VGCC 1P2JA 1FZZA 2C8XB 4NG9H 1SGQE 3QDZB 4ABGA 2VH6A 1SGCA 4X8TH 1EJNA 1PJPA 2Z9IA 2ZQ1A 1YGCH 4I8JA 1MUEB 4ZKSU 4WJG2 3GY6A 2SFAA 1ZSJA 4ZROA 1VR1H 1EB2A 1QIXB 4AX9H 1DWBH 3ODFA 3E91A 1DLKB 2BD3A 1HNEE 2BDYA 1ESTA 3ZYEA 5F8ZA 3D23A 1SSXA 3FAOA 4KP0A 1C1OA 1AVWA 3PV4A 3T28A 1SVPA 2OC8A 2Y5GA 1W0ZU 2A32A 1K9OE 4I8LA 2H9EH 4CRCA 1GJ4H 4MDSA 3ZYDA 4Y76A 1C5YB 1UVUH 1TBQH 1XUGA 2VB0A 5CMXH 1EXFA 1P01A 3PLBA 1SB1H 1K22H 3O8CA 1SGFA 5FHTA 2A4OA 1GI5A 2G8TA 2ZKSA 1OWHA 2TIOA 1GBMA 2ZTYA 1BT7A 1ETTH 2SGPE 1KLJH 5FPYA 2BOKA 1CT4E 1KYNA 1UK4A 3VB4A 4BXSA 1KXFA 2Q6DA 1GJAB 3F9GA 3BSQA 2GX4A 5A8YA 2QXJA 4MNWA 3SU5A 2FEQH 1FXYA 4RSPA 1AO5A 3GOVB 1BTXA 3Q00A 3E1XB 2A2QH 1XVOA 2P8OC 1D9IA 1RXPA 5L6NH 3P8FA 2XC4A 1IQFA 1HXFH 2F91A 3F9HA 3ZZ7A 4BAQB 4R0IA 1H1BA 4HI3A 5CE1A 2HALA 3QGNB 2H6MA 3L3TA 1CT2E 2OXSA 1UTMA 4B75A 3BTGE 1F5RA 4FXGH 1WYKA 2FYQA 3S9CA 4DOQA 5JPMH 1MD8A 1RTKA 3VB5A 3SO3A 1ABIH 5GDSH 1AFEH 2G51A 3VB3A 3GCNA 1UK3A 4K8BA 1LCYA 4Y8XA 1HLTH 2XBXA 1SLWB 1TX6A 1PPZA 3A8AA 4BAKB 1DS2E 1LKAA 1J15A 4B71A 2AYWA 4FU9A 4TY6A 1ID5H 3IWMA 5AHGH 2STAE 1SGRE 1IQJA 1KXBA 4X2VA 3RMOH 4XBCA 1O2KA 4CR9A 1TYNA 1W7XH 1GL1A 1KY9A 3TNSA 7ESTE 3RXMA 1MQ5A 2H5DA 4DIHH 4BAOB 3W94A 4U01A 1CSOE 2ZEBA 1A0LA 1GI8B 3M5LA 4K1EA 1V2UT 4NIYA 3EYDA 1O3LA 1V2OT 3PLPA 4INHA 3IITA 4TWYA 4GLYA 2GCTC 3JZ2B 4AFUA 1J8AA 2CHAB 3DA9B 3VGCC 1YPLH 2BZAA 1DY9A 3G01A 3GCHB 2G5NA 1F2SE 2YOLA 4GHQA 4IBLH 1TLDA 5JBBS 1TPSA 1GHYH 1MTSA 1UTOA 4U2WA 1CA0B 1Z8GA 1E38B 1XUIA 1LHDH 1AZZA 3SORA 1O3BA 1UTLM 1GBLA 8KME2 3PMBB 1MD7A 4CRBA 3BTKE 4GSOA 1YF4A 1BCUH 4RN6A 2EI8A 1AKSB 4Z0KA 3F68H 3SU6A 2VWLA 2PSYA 4Y8ZA 1GMCF 2ZGCA 1KDQB 1UVSH 3E0PB 1Y3VA 1SL3A 1ZHMA 2ODYB 1FY1A 1RGQA 2ANWA 1GBCA 1MKWH 3KEEA 4TY7A 5L30H 1GGDB 1FY3A 2Z3CA 3ZZAA 1P3CA 1HBTH 1CGHA 3BG8A 1AB9B 1FY8E 3V0XA 1FI8A 2I6SA 3Q3KA 1K2I1 3RMMH 1DE7H 4D76A 1UCYK 3A7YA 1AUJA 1YCPK 4Q7ZA 3PB1E 3VPKA 1WQSA 4TPIZ 1ZYOA 4ABIA 1AY6H 2GCHF 4OS6A 5HXFA 1IQMA 4NGAH 2OTVA 3RP2A 1EUFA 1UVPA 2OC0A 4WMEA 2ANMH 3U98H 3SGBE 3SQHE 2VWOA 3M5NA 1O2JA 1AN1E 1TGTA 4FUEA 1IQEA 2Z9JA 5C5OA 1FAXA 1O2MA 4CBOA 1EB1H 4FUBA 1FMGA 1YPJH 4UDWH 4IW4E 2ZC9H 2ZU5A 1TB6H 4I8KA 2VIPA 1D3QB 1D6RA 1DOJA 4ZXYH 3GY3A 2OC7A 5LGOA 2QV1A 1RS0A 2O8MA 2SNWA 5G4BA 1QB9A 3QLPH 2XW9A 4XDEA 2ZFFH 5EQQA 2OLGA 4FVBA 1DLEA 3F1SB 1GJ9B 3W95A 1AVXA 4NA9H 2Z94A 5C20A 3VEQB 1Z8IB 4WH6A 2GTBA 1TGBA 1NESE 1DITH 2JETB 4FU8A 2THFB 3QK1A 1GHBF 2B0FA 2VVVA 3TK6A 1VITH 4MLFB 1AD8H 5JB9S 1EPTC 2CF9H 3A85A 3K6YA 2A4GA 4JK6A 2Y81A 3SNEA 3A87A 1OWJA 2SNVA 2BDBA 2Z9GA 1CHOF 3M7QA 1HJAC 3ELAH 3RM2H 5C2ZA 1ELDE 3AW1A 1T32A 3RXPA 2BB4A 4IN1A 2PR3A 4O3UA 4B76A 1V2TT 3HGNA 3QGJA 2ZGBH 4ZHMU 2KAIA 5A8XA 3KGPA 2VGCC 1BBRK 2GZ8A 2ZPRA 1FLEE 2PSXA 2P3TB 3RDZA 1UHBB 1CA8B 3UOPA 1DANH 1C1WH 3T2NA 4SGBE 1NFUA 2J2UA 3K2UA 4FUJA 3ZVDA 2Z3DA 1O2GH 2OQ5A 1VCPA 1LPZB 4O97A 4XE4A 1ANDA 1W14U 4ISIH 1GVZA 1NRQH 3OYPA 3BTWE 3T25A 5HYOA 1A7SA 4KELA 1OP0A 1ZTLA 1S83A 1T31A 2QYIA 1DX5M 1LHEH 5AFYH 1FUJA 1PQ5A 3GY5A 1O32A 1GI6A 3LIWA 4F49A 5DKMA 2PKSB 2ZIQH 3EAJA 4XFQA 2HOBA 3D49H 1ZGIA 3RLWH 2ZDLA 2ZHDA 2AGGX 1MTUA 2O8WA 4BTIB 1JXPA 1QA0A 1TX8A 2O9QA 2J4IA 1BOQA 1NRNH 3M7UA 1CU1A 1H9HE 3RXGA 3R0FA 1TNHA 1GMCG 1XUFA 2EA3A 1M9UA 7GCHF 1LHFH 4UFDH 5H4IB 1V2KT 2XC0A 2FOBA 4LXBH 3ATLA 2BXTH 2V6NA 3OSYA 4ZMAH 1TFXA 4QT8C 4X2XA 1EZUC 2DUCA 2FS8A 1BHXB 2FOEA 2O8TA 2P3FH 1B7XB 1P04A 1LPKB 3DFLA 1TPOA 3ENSB 3RUOA 1YBWA 3RXIA 3A7ZA 6LPRA 1EAUA 2AEIH 2ZDVH 4NA7A 4I8HA 3U1JB 1GL0E 3DUXH 2GCHG 2TRMA 4VGCB 3JZ1B 1YPMH 5FX6A 4AGJA 2A7CA 4GCHF 3ZVAA 3U1IB 1THSH 2VNTA 4FVDA 1OX1A 5GCHF 4JYTA 8ESTE 1W7GH 1HAPH 1TMUH 1PPGE 2V0BA 4WMDA 1IOEA 2SGEE 1HJ9A 2WUBA 2BVSH 3MWIU 2VJ1A 2HWLB 1FAKH 1C9PA 3ZV8A 3QZRA 5A0CA 1O3KA 1FN6A 1V6DA 1C5XB 4JCNA 5FCKA 1YPKH 3EA8A 3SZNA 4I33A 1O2RA 1VCQA 5DP5A 1EAWA 4X8SH 3S7KB 2GV6A 1BA8B 3ZZ3A 2C93B 1P57B 2HNTE 3OU0A 1GHBG 1B5GH 1DDJA 1TPAE 2EEKA 2V3OH 4KGAA 1S0QA 5DP7A 2BDHA 3OY5U 4ISLA 1WUNH 3GY2A 3CENA 3SUGA 3PYHA 1XXFA 3SNDA 1AGJA 1CHOG 1OP8A 2FESH 3A89A 1ZR0A 1AQ7A 4H4FA 1PPHE 2TBSA 1SC8U 3E0NB 4BANB 3TGIE 3ZVCA 1O3CA 1BTPA 2CN0H 1UTNA 2QXIA 4K1SA 1GI1A 1HAVB 4FUFA 1TRMA 1D3DB 1V2VT 1ZGVA 3M35A 1BRUP 3V7TA 4SGAE 3A7WA 3UNRA 2G00A 1GMHF 3MOCA 3QN7A 3SNBA 1DUEA 1UCYH 3SJOA 1LDTT 1UVTH 2G81E 1P2IA 2BQ6B 4K69A 3RU4E 1QL8A 2AS9A 1NS3A 3A80A 4JZDH 1G3EA 1C5QA 2G4TA 4MG3A 5EXMA 1ELAA 2A5KA 1V2QT 1K1MA 4ASHA 1RJXB 1Z8JB 1SGTA 4X1RU 1HPGA 3RXSA 3MU1A 3QX5H 1O2VA 4KTCA 2EC9H 2GZ9A 3RXHA 2QY0B 1N8OC 2A1DB 5A0BA 1HYLA 3PO1B 4I7YH 1FY4A 1GG6B 3VB6A 2Z3EA 2WPKS 2XC5A 3GY8A 4BOHA 1ZLRA 1KXCA 1P2NA 3U8OH 1Z6JH 1K21H 2D1JA 2TPIZ 2WV4A 4H42U 4TPYA 1AKSA 2Q6GA 1O2PA 1F0SA 2R0KA 3BTME 1VJAU 2B7DH 3GCOA 3SI4H 1IQGA 1A5HA 5CHAB 2PUQH 1P8VC 1O2WA 1WU1A 4CREA 2BD4A 2GKVE 1SGFG 1TX7A 1Q2WA 3DD2H 3NXPA 3PM3A 1UJ1A 5T6GA 2GMTB 1NPMA 3SU3A 3CS0A 2ZP0H 2BD2A 2WYGA 1MZDA 1YC0A 1EAIA 2BD7A 1SHHB 3PMAB 3HK3B 1GVLA 4ZKNU 1G2MA 4ABEA 1C1TA 2WPLS 1L1GA 1O0DH 1TALA 4MPXA 1Z7KA 1NFXA 1NFWA 1K1LA 1QL7A 3RU4D 4GCHG 3PMHB 2H1UA 3UQOA 2R3YA 3P8OA 3BIVH 4YOIA 1GDQA 3BEFB 4JZ1A 3SOSA 3C27B 3MYWA 4GAWA 5GCHG 1BMMH 2WPJS 4WXIA 2BM2A 1GHWH 1BDAA 3LH3A 4BNRA 5EODA 1O2TA 4Q2KA 1HAZB 1DSTA 1P10A 1ZRKA 1O5AB 3NZIA 2OP9A 3D65E 4OS7A 1K1NA 4B2AA 5EW2H 1GCTB 1TWXB 2BYAX 2ZGJA 5C67A 3BTFE 4DG4A 5T6FA 2GT7A 3SJKA 5DG6A 4ZKRU 1TQ7B 2FI5E 1O2IA 2BQWB 1VITF 2Z9KA 3B23B 1GDUA 1P9SA 5F8XA 3MFJA 3E90B 1V2JT 1V3XA 4UEHH 1IHTH 3MNXA 1GJ8B 3GDVA 1PPEE 3KN2A 1SLXB 4IC6A 1CBWB 4K3JA 2ZA5A 1QBNA 4VGCC 1GHAF 3STJA 1S81A 2ZHEH 1Q3XA 3PLKA 1G37A 1ZMLA 1SI5H 3LKWA 5JBTA 5HM9A 1DT2A 1ANEA 3KL6A 3M3VA 4MPUA 2OQUA 4BXWA 4I8GA 3LU9B 4HTCH 1C5PA 1C2JA 1MTNC 1C2DA 1O5CB 2W7UA 1SBWA 2XBWA 2FODA 2AGEX 3ZZCA 5SGAE 1KSNA 1NU7B 1BMLA 1RIWC 3R3GB 1CE5A 2G52A 1PFXC 2GD4B 4NA8A 3A88A 3O8DA 2OUAA 2NU1E 1DWDH 1GMHG 1C2EA 1HFDA 1QRWA 1GI0A 1NRPH 4BAMB 4CH2B 5E2OA 1AIXH 2HGTH 3EDXB 4CRAA 1G9IE 3NUMA 1BTUA 4THNH 1HXEH 1MCTA 2NU0E 1L0ZA 5A0AE 3ATMA 1C5SA 1WV7H 1LKBA 3TNTA 1JIMA 1THPB 2PTCE 1ZMJA 1O30A 2HRVA 5F03A 1D3PB 2ZFPH 2PTNA 1PQ8A 3URDA 4A6LA 2XRCA 3SV8A 1QBVH 4Y7BA 2CXVA 4OGYA 3BTHE 1A61H 1O2ZA 1QB1A 1GBEA 3FZZA 4PROA 2HNTC 4UFGH 1CVWH 1UCYE 4TWWA 3Q76A 2Y7XA 4I31A 2XCFA 4MVNA 1O38A 1QA7A 1KIGH 1C5ZB 2BHGA 3S7HB 2BX4A 2JKHA 2I6QA 3M3TA 1O39A 1GJBB 5DPAA 4AN7A 1O3FA 3UTUH 1F0RA 1OS8A 3QO6A 1ZSLA 4ZXXH 5EU8A 1ANBA 1LVBA 1QTFA 4DIIH 2VVUA 8LPRA 2ODPA 1JBUH 3TJVA 1A5IA 1FIWA 2HLCA 3MO6A 1QQ4A 4IN2A 3L33A 3MHWU 4X6MA 3LGUA 5K0HA 1XM1A 3QZQA 4O3TA 3SGQE 3TH2H 1V2ST 4ZH8A 3RXCA 3S9AA 1BJUA 3BG4C 3N7OA 5A2MH 2F9VA 1ACBE 2GV7A 3P92A 1Y3UA 1HAHH 2OINA 2BDIA 2QGRA 1TRNA 4Y0ZE 4Y7AA 1SGEE 3FANA 2OBOA 2WPHS 4X1SU 5F8TA 3SUFA 3RXOA 2ILNA 1ZZZA 1O2SA 3E16B 1PPBH 3F6UH 2ZCKP 4X6OA 3LPRA 1QR3E 1IQNA 1ZTJA 2ZU1A 1S5SA 3GICB 5C1XA 4MNVA 3RMNH 1GBKA 3VB7A 2Q1JA 2R0LA 4FUIA 1VITG 1BZXE 2UUJB 2BMGB 2FDAA 2PW8H 4NSYA 2STBE 4Q80A 2D26C 5GJ4B 4CHAC 1HGTH 4NWKA 1HCGA 4O03A 3F9FA 2ZF0H 4A1VA 1GHAG 3RXAA 2PLXA 1IQHA 2FO9A 2WUCA 1BRAA 3RXDA 1G2LA 3S9BA 2UWLA 2BZ6H