3NK8A

Trypsin in complex with fluorine-containing fragment
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title Combined use of computational chemistry, NMR screening, and X-ray crystallography for identification and characterization of fluorophilic protein environments.
pubmed doi rcsb
total genus 61
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-06-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nk8A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3nk8A02
1EZUC 3K9XB 1TMBH 1BBRK 1PPBH 1S0RA 1T8MA 5GPIB 3ZV9A 4CRBA 2GDEH 5F8XA 1FLEE 2XNIA 1O2HA 1GMCF 2WPJS 6LPRA 3M36A 4I8GA 1THSH 1JWTA 5EXMA 1SPJA 4X0WU 1D3PB 2ZA5A 4MNYA 1C1NA 5DP8A 1XVOA 1DT2A 2R2WU 3STIA 1BA8B 1IOEA 1XKAC 1RJXB 3MHWU 1RXPA 2A5IA 2FS8A 1LKBA 2Y6TA 2F9OA 2G52A 1K1OA 5I46H 1GI9B 1ORFA 2C4FH 3M37A 1UTJA 2OTVA 2PKSB 4UDWH 2TGDA 4CRGA 3E6PH 2ZHFH 3KQBA 4FU9A 2QYIA 2O8LA 1AIXH 3M61U 3FZZA 1T4UH 1HPGA 3M7QA 3V12A 1HV7A 3UQVA 2VGCB 1ZHPA 1O39A 2VWOA 1GG6B 1EPTB 4M7GA 1EKBB 2EI6A 2XWBI 1GL0E 1EQ9A 3ZZAA 5DP4A 3P8NA 1EP6A 1GI0A 5TJXA 3L33A 2LPRA 4R8TB 5CHAB 1FI8A 4XBDA 2BD7A 3ZZ9A 2CXVA 1C4Y2 1EZQA 1C1PA 1C5MD 4NFFA 2GP9B 4LK4A 1KY9A 1VGCB 1C4V2 3UOUA 1GJ5H 1BTZA 1WV7H 5E8EH 4JZDH 2ZFQH 2OLGA 2QXIA 3NK8A 1H9LB 4ISHH 1FIZA 1V2RT 2HPPH 2OCVB 1KLJH 1A5IA 5E2OA 4Z0KA 3SGBE 4B2BA 1IQJA 4BAKB 1G37A 3ZVDA 1C4U2 3LH3A 4Y11E 2ZDKA 1D3QB 4JZFH 2BVSH 3MNCA 1IQHA 3VGCC 3P92A 2R3YA 2Z6BD 3KIDU 2VNTA 1C1TA 1LHCH 1GI6A 1ELEE 3U8OH 4IMQA 2ZNKH 2XRCA 1O3CA 2G8TA 8LPRA 1SBWA 2OBOA 2ZIQH 4WXVA 1GWAA 4AFSA 2BLQA 1AVGH 1NT1A 1P02A 1QURH 2A0QB 1GJ4H 4Y8ZA 4IW4E 1BRCE 1D9IA 2ZC9H 1HJ8A 5DP7A 4CBNA 2BLOA 5AF9H 1VCPA 3RXDA 1DPOA 2ILNA 3R3GB 5EQQA 2WPHS 1BBRH 3A83A 2ZEBA 2TGAA 4F49A 2ZHQH 1EASA 9ESTA 1E37B 4O3UA 1NFWA 1W3CA 2Y5HA 1DWCH 1HAHH 1C2FA 1GJCB 3P6ZB 1ZMNA 1NROH 2FO9A 2HLCA 2YNBA 1WYKA 1C1WH 2ANMH 1A0JA 3MH5A 5EOKA 1LPGB 3IG6B 2PLXA 4JZEH 4Y10E 2UWPA 2C93B 1AFEH 5J4QA 3QZQA 1GJ9B 1C2KA 1GDQA 3BTDE 1P57B 1A2CH 2WV4A 4NIYA 3QGNB 5E2PA 2OINA 4A92A 7GCHF 4Y7BA 2FOHA 1AUTC 1G3EA 1V2MT 2ZU3A 3MTYA 2G51A 3B9FH 1YCPK 3QGJA 1PQAA 1CSOE 3ENSB 3ZZ4A 3SJ8A 3RM2H 1P03A 1ZR0A 1P11E 1TX6A 1SGFA 1ZYOA 4FUCA 1BT7A 1P3EA 2GZ7A 3MI4A 3PTNA 1BRUP 2ZECA 2EEKA 3UUZA 4NWLA 2GMTC 8ESTE 4CH2B 2PWXA 1C1UH 3RLYH 3ATIA 3NWUA 1VITG 4BXSA 3FP8E 1N8OC 4YESB 3U69H 4YOGA 2BZ6H 3EA8A 1ZRBA 1E36B 1HB0B 3E3TA 1FY4A 1C1SA 1GMDF 1XMNB 1E34B 5A8XA 3M3SA 1KLTA 9LPRA 1SQOA 1BHXF 1KTSB 2AH4X 4RKJB 2ZQ1A 5JBTA 1VCQA 4NIXA 4INLA 1C2LA 3SJOA 3TJVA 3TK6A 3BG4C 5LH8A 2W3IA 1FAKH 2ZF0H 1GBBA 1VJ9U 4NSYA 1B0EA 1IHTH 1GI3A 1JIMA 5EGMA 2FYRA 2P93A 3VB3A 1W8BH 1DOJA 2FTMA 1AB9B 3RXFA 1NRNH 2BOHB 2P8OC 1SOTA 2GX4A 1KDQB 3BF6H 1OWJA 3T26A 1AO5A 1TMUH 2F9NA 5DPAA 3ODFA 1UK4A 1GJBB 1F2SE 1V2ST 4NZLA 2FI4E 4WVPE 1UVPA 2VIDA 2ZFFH 4DURA 4X2VA 1GVZA 4DT7B 3OY6U 1TALA 2GV6A 4IMZA 3RXGA 5H4IB 4ABGA 2GV7A 1SG8B 1EPTA 1P04A 1YP9A 5FBEA 2HGTH 1GHAF 1LVBA 1A3BH 1O32A 1QHRB 1SGRE 2Y82A 5F6MA 1DSUA 2O8TA 2B7DH 3SUDA 1P01A 1FY1A 1S5SA 5DO4H 1OYTH 2BY9X 3SV2H 1KXAA 2AMDA 2GVFA 1UTQA 1GBMA 1NY22 1P2JA 5T6FA 3SUFA 1B5GH 1MZDA 4YT6H 1EJAA 2BZAA 1GBCA 1ANCA 3MU1A 1FUJA 3DFJA 1YPGH 1ZPCA 1F0SA 1SGTA 4AG2A 3B23B 1GI5A 1A4WH 4INKA 1AUJA 1SC8U 2RDLA 4A6LA 2XC0A 1A0LA 2H9HA 3ZZCA 2GCHF 2FOMB 1QIXB 3SNAA 1Y5UT 4GAWA 3A8CA 1TBQH 3M35A 1LHEH 3RXAA 1V2UT 1O3HA 4AX9H 6ESTA 1V2NT 1DY9A 4UD9H 2YOLA 1E0FD 1C5WB 1WU1A 1YPHC 4B75A 1LVMA 1WBGB 3BEUA 1J8AA 3PB1E 3L6PA 1GHZA 1O2SA 4WMDA 2QCYA 2TIOA 1EUFA 3PLBA 1EJNA 3R0FA 1NFXA 1TMTH 2ZDAH 4OS2A 1ANDA 3SV9A 2VIWA 4TY7A 2VJ1A 3EAJA 4K1SA 3PMJA 1TRYA 1O2PA 3MWIU 1GMCG 1TQ0B 1Y5AT 4XSKU 3LGVA 3ZVEA 2PUXB 4B74A 1BMNH 3AASA 1TNGA 5FXLA 4JK5A 1N1LA 3TH3H 1LQDB 1CBWB 5EG4A 4I8HA 2ZTZA 4U32A 3AAUA 1H8IH 2CF8H 5L2YH 4CHAC 1GCTC 3A80A 1BTWA 4Y71A 1AE5A 1DUAA 1XM1A 2FLBH 5IYTA 3UNQA 2GZ9A 1FJSA 1UO6A 3D65E 1DITH 4E7RG 1ZLRA 4BAHB 5L2ZH 4X8SH 3O8CA 3A86A 1TBRH 2O9QA 1S82A 1C2GA 1DUEA 2EI8A 3GCNA 1DXPA 2PKSC 1CA0B 1OWEA 2BTCE 3E0PB 1A1RA 4X1SU 2H2ZA 1W13U 2GCTB 2Z9LA 3E8LA 4HZHA 5FX6A 4BTTB 1H9HE 1P09A 4Y76A 4A1TA 5HXFA 2FLRH 2QXHA 4TYDA 1K2I1 3UQOA 2HOBA 4LZ1H 1SGPE 1V2TT 3VB7A 1GBFA 1WTGH 1GG6C 3N7OA 2FYQA 1O3JA 3RMMH 1HIAA 3RU4T 4UONA 1AHTH 1FN6A 3ESTA 1AQ7A 1OP8A 1UJ1A 4TWYA 1K9OE 1W0ZU 1O2VA 4UE7H 1OPHB 4AYYB 3MU5A 3BTTE 1IQKA 4AFQA 3U98H 2OC1A 3F68H 3BIVH 3MU4A 5EQSA 2J95A 1B7XB 1IQMA 3CP7A 4NIWA 1INCA 3QDZB 1A7SA 1O2IA 3PWCA 4X6MA 5GDSH 3GCHB 3RMNH 1NESE 1TOMH 2WINI 4Y0ZE 1HCGA 1IQNA 1QY6A 2Z9GA 3SU2A 1HYLA 1PPCE 4LZ4B 1GDUA 1TGTA 4B2CA 2PV9B 1Y3UA 5C1XA 1EX3A 1Y5BT 4OS7A 4Y6DA 1GI1A 1OWDA 2ODPA 1QL7A 1UTLM 2HNTC 4X2XA 2AS9A 4H42U 5JYIA 2FOAA 3T62A 3HGPA 2W3KA 2SGDE 1TPPA 5HM9A 1EAXA 2OQ5A 4Y79A 1F5LA 3DA9B 3M3TA 3PLKA 3MH4A 1AKSB 3T27A 1A3EH 1GI2A 4CH8B 1L1GA 4MTBA 1DANH 2ZDLA 5LPFA 1A0HB 1HAOH 1S81A 1TRNA 3HK6B 2V35A 4DOQA 2JETB 5TCCA 2FMJA 1DE7H 2BD5A 5A09A 3H7TA 2AEIH 3GDVA 3JZ1B 3OYPA 1MTSA 1C2EA 1PPEE 3T5FH 1D3TB 1GHVH 1RIWB 3BTFE 4B73A 1EOJA 4J1YA 3HKJB 1AMHA 2CHAB 3MH7A 4WMFA 1MUEB 1D3DB 3GYLB 3P8FA 1O2JA 4MPXA 2F9PA 3ZZ6A 4ABHA 1KSNA 1YM0A 2ZKSA 1RTFB 1JRSA 4A1VA 1C5XB 2P3TB 2A45B 3UTUH 1HDTH 4O9VA 3RC5A 2AMQA 2ZTYA 1P3CA 2ZGCA 2NU0E 1MTUA 2HPQH 7GCHG 2BX3A 4K60A 1GBAA 1QB1A 2ANKH 3A8AA 3PMAB 1IQGA 1L0ZA 1ZJKA 2VVUA 1Z7KA 1GL1A 4ZXYH 4YLUA 3M7TA 3FZDA 5FCRA 1C5SA 1LPKB 3BTKE 1GHWH 1CGIE 1G3DA 4K1EA 1TNLA 1K1PA 4D7GA 4H6TA 4Y8XA 1AGJA 5ESTE 4B1TA 4CRFA 1TPOA 2R0LA 2C90B 1FNIA 3VFEA 1MKWK 2XC4A 4ZUHA 2TPIZ 2QGRA 3UIRA 4RKOB 2V0BA 2G55A 3LGTA 2IPHA 2BMGB 1KXCA 1MQ5A 3MO3A 4D9RA 2YNAA 1MAXA 2FOFA 5AVDA 2BDAA 2PR3A 3GY5A 3LGUA 4QT8C 4BOHA 3OX7U 5F8TA 1XUGA 3TITA 2G4UA 2JH5D 1K22H 1C2DA 1UK3A 2ZTXA 3DHKH 5DJ7A 1V2VT 4X6OA 4FVBA 1FZZA 1GBHA 1W7GH 4GCHG 2ZI2H 4OGYA 3E0NB 3Q3KA 5E0HA 4K69A 1BBRE 1GPZA 1SGYE 1Z6EA 2CMYA 3V7TA 3K6ZA 2KAIB 1BOQA 2ALPA 3LGIA 4LXBH 4O03A 5DK1A 1V2JT 3TJUA 4LOYH 1NU7B 1AFQC 1GHYH 1TFXA 2EA3A 4JZIA 3U8RH 3ZZ3A 1Y3XA 3PO1B 2WPIS 2GZ8A 1O3FA 1O5BB 1J9CH 2F9UA 3A7TA 1GHAG 5ABWA 4AYVB 1Y3YA 5DP3A 2H6MA 4NA9H 2GKVE 3NKKA 1DWDH 2HVXA 2R0KA 8KME2 3BN9A 3STJA 1YC0A 4CRDA 3SHCH 1NO9H 4ZHMU 3RXVA 4I8LA 2RA3A 4U30A 3UR9A 5EW2H 1S6HA 3PROA 2VIQA 2ZGXH 2VVCA 1GMHF 3M5MA 4GPGA 4MNWA 4AB9A 3BTQE 5FHTA 4D8NA 5HYOA 1UCYK 1F5KU 1SMFE 4DW2U 5A0BA 4X6PA 1OX1A 1ANBA 1FMGA 1O0DH 1SGEE 1QJ1B 1C9TA 1H8DH 1GBDA 3NCLA 2DUCA 3A85A 1HAVB 2GCHG 1A5GH 1O2UA 2AMPA 2ASUB 2H9EH 3Q76A 4AGKA 4ZKNU 4BAMB 4K1TA 3VB4A 1Z6JH 1P2OA 2H5DA 1RS0A 2Y5FA 2J38A 1OWKA 2SFAA 5FPTA 2P16A 1G30B 1BMMH 1T7CA 2Z3DA 3SNCA 4FVDA 3SORA 3NZIA 4A7IB 1EB2A 3LONA 4BAOB 3A8BA 1RFNA 3PM3A 2WUBA 1BIOA 1HAXB 1JBUH 2VH0A 2W7UA 1AKSA 2NWNA 1O5DH 4JYUH 1UTNA 1NFUA 3GY2A 1D6RA 1TX8A 3TU7H 1CT2E 3SV8A 2FOEA 1P2MA 5C67A 1HAYB 3MYWA 1O38A 1O3NA 1XUKA 3U1JB 3SU1A 2Y80A 4FUGA 1C2IA 5EU8A 2K1QA 1UVSH 5K7RA 4FUEA 1J17T 1V2LT 1J15A 4WWYA 3QTVH 3QN7A 1BMAA 1OOKB 3KCGH 3BEIB 5AHGH 2A32A 3ZVAA 1NRQH 4FUHA 3KN2A 2XBVA 3S9AA 5C1UA 3ITIA 4FUFA 1W7XH 1C5LH 2R3UA 5JBBS 2OP9A 2OC0A 1W14U 4RN6A 3W95A 1MTNC 1ELDE 2XBWA 1WCZA 4B76A 5A8ZA 5B6OA 1BUIA 3BG8A 3SU0A 3GCTF 4YO9A 4AGJA 4XFQA 3S7HB 3PMBB 1PJPA 4ABAA 3EGKH 1YPKH 1PPHE 1QB6A 2FIRH 2Y81A 3BV9B 5T6GA 1ESTA 1GCDA 1O2NA 4I32A 1ARBA 4DG4A 1KXEA 3T25A 2V3OH 3C27B 1WUNH 3U9AH 3M5OA 3O8DA 1JXPA 1MZAA 4AFZA 3EA9A 2ODQA 1V2PT 2Z3EA 3OTJE 3RXCA 1XXFA 2VB0A 2XCNA 3F9FA 1A46H 4A5TS 4K2YA 1NRRH 1BTYA 4JK6A 4H6SB 3AW1A 2BD9A 1E38B 2QA9E 3WY8A 3RXIA 4I33A 1S84A 1UCYH 1AZZA 1C1RA 3RXUA 4MPUA 3S0NA 1C2HA 1G3BA 1T4VH 1D4PB 1TQ7B 5GJ4B 3HPTB 4Q2KA 3VEQB 1DWEH 5EPYA 2OUAA 1C5QA 2Q6FA 4OS4A 4U01A 3P8OA 1GVKB 4AFUA 1DLKB 2BY6X 2PKAB 5EW1H 2UUFB 1UVTH 1X7AC 3F9GA 1S83A 3V13A 3TH2H 3M7UA 4B71A 5LGOA 1O5EH 2KAIA 1A5HA 1F5RA 3SUGA 3V0XA 4ABFA 1RD3B 3E1XB 1GDNA 2XWAA 1HLTH 2FX6A 3S69A 1Z8IB 1T8NA 4Q7XA 4MDSA 4XDEA 1C5VA 3QO6A 3SU5A 1ZMLA 3U8TH 2FDAA 3MMGA 2I6QA 3UFAA 1CHOG 4TY6A 4CRCA 4MNVA 1C2JA 1K1NA 1Z71A 4GCHF 2VWMA 2HNTF 4Y8YA 1GGDB 1IHSH 1O36A 1ZMJA 1Y3VA 1P0SH 2XTTB 3MH6A 1ZTJA 1YF4A 1NM6A 2VWNA 2WYGA 1VCWA 4HFPB 1O3GA 4K8YA 4JCNA 1GBIA 1HRTH 1EOLA 1ESAA 1SLVB 3LJJA 3T29A 2OBQA 2D26C 3BTWE 1PPFE 1UHBB 1JIRA 3UOPA 1CGJE 2BB4A 3TVJB 1LHFH 1AU8A 4X8TH 1QB9A 1UTKA 4UFDH 2GDDA 3MU0A 4K5ZA 4FUDA 1O2XA 4YTAA 4D9QA 1YLDA 2P3UB 4YLQH 1ANEA 3VB5A 3SZNA 3PLPA 4FU7A 1WQSA 3EE0B 3SI3H 1HAVA 2XC5A 3E90B 1O34A 1FY8E 1AY6H 1ZHMA 1ZGIA 1CE5A 5FAHA 1O2OA 2NU2E 4KTCA 3SV7A 4SGAE 1HJAB 2A5AA 5SGAE 1IQLA 2PFEA 1PQ8A 2VU8E 2A4OA 3P17H 3M5LA 1RRKA 2ZFTA 1OP0A 1C5OH 1MQ6A 4MPWA 2ZGHA 2QF0A 2GT7A 3I78A 1OYQA 2D8WA 2ZFSA 3FAOA 3BIUH 1QNJA 4WY3A 5JDUB 3QUMP 1PQ5A 1YCPH 1ID5H 2FP7B 3GOVB 2A2XH 2QC2A 1DICA 4NG9H 4NZQA 3URCA 3OY5U 2G5NA 2B8OH 5F03A 2J2UA 2CN0H 2FODA 1PYTC 2A5KA 4ZHLU 4K8BA 4JYVH 1MCTA 2JH6D 1QR3E 2BDGA 1SGDE 1NZQH 3ATLA 2G4TA 3LU9B 2XYAA 5LPEA 3EA7A 1W0YH 5JPMH 4IN1A 2PTCE 3A87A 3P95A 1VZQH 5LPRA 2AIPA 1TNJA 3D23A 3GY8A 2TRMA 1IAUA 4ZKSU 1UVUH 5C5OA 2H1UA 1TLDA 4FUBA 4XBBA 4KTSA 4U2WA 3KF2A 1ZHRA 2CGAA 1TBZH 5TCAA 3FFGA 4UFFH 2JH0D 1DX5M 4NA8A 4X1RU 4KTUA 1ABIH 1TPAE 4AG1A 1O2QA 1VJAU 2FESH 2VINA 1PFXC 3GYMA 1BTHH 1L4ZA 2IOTA 1ETTH 1CT4E 1O5CB 1Q3XA 1W10U 4R0IA 3A82A 3PYHA 7ESTE 5IDKA 1C5RA 5JB9S 5EQRA 2QXGA 1Y3WA 4ABBA 4DCDA 1DFPA 1BRAA 1TWXB 3H5CB 1TNKA 3LPRA 1F0UA 4TPYA 2F3CE 2STAE 1LHGH 2FOBA 1BMLA 1GMHG 1Q31A 1ELFA 1C5ZB 2VGCC 4WXIA 1EPTC 3KQCA 3ZYEA 3I29A 2C8YB 4AB8A 1MCVA 3KGPA 1XVMA 5ETXA 1OWHA 8GCHF 2BD4A 5BRRE 7LPRA 1IQIA 4THNH 5CHAC 1IQFA 3B8JA 3H7OA 4E06H 1KLIH 3BTGE 1NRSH 3S9CA 1RTLA 2ODYB 1VGCC 2A31A 3AW0A 3SV6A 3U1IB 1J14A 3RXJA 1ZTLA 1YCPM 2QV1A 1O3DA 3ZYDA 2A2QH 3EQ0H 4DGJA 3SJKA 2PKAA 3A7ZA 1O5GH 1ZSJA 5DG6A 2A7CA 2IJOB 3IITA 1TE0A 1C1MA 4NWKA 1CGHA 2ALVA 3SUEA 1GVLA 4YM9A 4MQAA 2I6SA 1XUHA 2ZWLH 1O2LA 4ABIA 5AFZH 4ISLA 1O2RA 2NU3E 2UUJB 4D76A 2PGBB 3RXQA 2BY8X 1O3EA 2SNVA 4JYTA 1QA7A 2Y7XA 2JKHA 1GI4A 1EJMA 4MPVA 3MNXA 3RXRA 3UPEA 1KDQA 5EPNA 1U6QA 2PGQB 4VGCB 1SFQB 1N8OB 1Z1JA 3GY3A 1FV9A 2GD4B 1YBWA 1SB1H 4J2YB 1P8VC 2AERH 1UHBA 2VH6A 1CHOF 1GBKA 1ZSKA 1S85A 2FOGA 4ABEA 3ELAH 1AZ8A 2V6NA 5JB8S 2FI3E 2FOCA 1QTFA 4RSPA 3SQEE 4MLFB 1QRWA 3GCTG 2OQUA 5CE1A 2ZGJA 1GJAB 2AGIX 3EYDA 1BTPA 3A84A 1EP5A 3QTOH 4ISOA 1ETRH 1P10A 3PV4A 3NUMA 2ULLA 3LKWA 5DGJA 2QY0B 1GI8B 2ZG0H 5FBIA 2BY7X 4Q7YA 2Q6DA 4OGXA 1BCUH 1CVWH 2BX4A 4YOJA 2SGPE 1TA2A 3ZVFA 3RXEA 2SNWA 2GTBA 1ELBA 1N6XA 3ZVBA 1QQUA 1W11U 1THRH 1P12E 1ZPZA 4YZUA 1P06A 5JBAS 1DWBH 3SGQE 1TONA 1QBVH 1P9UA 2ZDVH 3A8DA 2P94A 3FP7E 2ZPQA 5GCHF 3MNBA 4OS6A 1XKBC 2A1DB 2CJIA 2EC9H 2H9TH 4CRAA 2WPLS 4ISIH 1LVYA 2ZFRH 1HNEE 1C1VH 3GDSA 3MNSA 2ZCKP 1GHXH 3TH4H 5FPYA 2XW9A 1QJ7B 3PMHB 1F0RA 2J94A 3HKIB 5C1YA 1GJ6A 1FY3A 2BQWB 1M9UA 2W7SA 3KQEA 1OXGA 4JZ1A 1O33A 3I77A 1HAZB 1L4DA 3A88A 2ZPRA 1EAWA 3GICB 4JMYA 1O2MA 4IC6A 2FXRA 1BB0B 1E35B 1HXEH 3TJNA 3QZRA 3RDZA 1F0TA 3ZZBA 2BYAX 2D1JA 5A0AE 1EATA 3NXPA 1CA8B 1AB9C 3F1SB 3VXFH 1EAIA 3LOXA 3T2NA 3KHVA 3QX5H 4FUJA 1GI7B 3IWMA 1QA0A 4X1NU 2EI7A 1HXFH 1NU9A 3SNDA 4GVUA 2CF9H 2WYJA 5A8YA 3BSQA 4FUIA 1AVXA 1K28D 3DT0H 3BTHE 1FDPA 1TYNA 2DE9A 3SJIA 1DSTA 3HGNA 1HAIH 1HGTH 1AN1E 5DP9A 4I31A 2XBXA 3T28A 1ZOMA 1Z1IA 2ZHEH 1H1BA 1YGCH 2ANWA 4X6NA 4CHAB 1GCTB 2WUCA 4HTCH 1JRTA 1YPHE 4D7FA 1BJVA 1LQEA 4FU8A 5GWZA 1LCYA 3FANA 5FX5A 1BDAA 1G2LA 1O3KA 1FIWA 1QBNA 4WMEA 1SHHB 5E0GA 2XXLA 3SHAH 1SQTA 1UTMA 3LT3A 4HI3A 3SU4A 4AZ2B 5L6NH 3Q00A 2UWOA 2F9BH 3KL6A 4GHQA 2QIQA 1TB6H 1BJUA 1HJAC 1QRXA 1K1MA 1MTVA 2BLVA 4OS5A 3ZZ8A 1WAYB 1UCYE 1GJ8B 5HM2A 1OP2A 2PTNA 3RC4A 4O3TA 3UNRA 1XUIA 1HBTH 1SOZA 1C5UA 1G3CA 3TPIZ 2A4GA 4KGAA 1ZJDA 2ZCHP 4H4FA 2GGVB 1TGBA 2G5VA 1TRMA 4K3JA 2A4RA 1EAUA 3RM0H 2FX4A 2Q6GA 1AD8H 2TBSA 2F91A 3VB6A 1C1QA 1MBMA 1SFIA 3TJOA 1O3MA 2RG3A 2Z94A 5F8ZA 2BDHA 4BANB 3ATKA 5PTPA 1LHDH 2DE8A 2WPKS 3SU6A 3GISB 1MKWH 1PPZA 3LIWA 1BHXB 1O3OA 2SGFE 1ELTA 1SGNE 3KQDA 1O2KA 1GBJA 3K2UA 2ZGBH 2PSYA 3LGYA 2C8WB 1CBWC 4KELA 5GXPA 2C8XB 4ISNA 2J34A 3TGIE 1MBQA 1SSXA 2FWWA 1KXBA 1K1JA 3PWBA 3OSYA 2B0FA 2ZU2A 3SNEA 3UWIA 3CS0A 1TGCA 1XUJA 5E0JA 1WOFA 3K65B 3LJOA 1V2KT 1ZZZA 1GJDB 1O31A 1WTHD 1SGCA 1ELGA 1YPMH 1UMAH 1BTUA 1C5NH 3JZ2B 4Z6AH 2SGQE 3HATH 1H9IE 1K1LA 1GHBF 1QBOA 1CA0C 2BQ6B 4X1QU 1CO7E 1TGSZ 2P95A 2GCTC 4WJG2 5DP5A 1YLCA 1GBLA 2BVRH 3NPSA 6GCHF 2AYWA 6CHAB 3RP2A 3SGAE 1ABJH 1YKTA 4Y0YE 1YPEH 1MKXK 1O3BA 8GCHG 3DFLA 2CV3A 1O3IA 4X2WA 2FM2A 2HNTE 4HGCA 1TPSA 1T8OA 3A7WA 1OKXA 1QFKH 2Z7FE 2LNCA 4KP0A 3OU0A 2ZFPH 3HK3B 2PUQH 1L1JA 2Y7ZA 4CR9A 1OS8A 2ZQ2A 1AE8H 2G81E 1HFDA 1S0QA 1NC6A 2BVXH 2B5TB 3D62A 3RMLH 5L30H 3PTBA 1ELAA 1DXWA 1DY8A 5C3NA 3LDXH 1XXDA 2VIPA 3F6UH 3GCHC 2STBE 2VWLA 1ZPBA 4WH6A 4GUXA 4X1PU 1AWHB 2ZPSA 1UVOA 1O2GH 4IS5A 2PSXA 3LC3A 2AIQA 2NU1E 5BPEA 1QRZA 1AVWA 1GJ7B 1QQ4A 1T8LA 2P59A 5I25A 2Q1JA 3O8RA 2O8MA 2BDIA 2TGTA 1LO6A 1HIAB 2HRVA 1CT0E 3TNSA 1DVAH 2HALA 2WV5A 1O35A 4UFGH 2QN5T 2B9LA 1EXFA 1LTOA 3ATWA 1ZRKA 1G9IE 1K1IA 1O3LA 4KKDA 4VGCC 1TX7A 3KEEA 4F4OC 1P2QA 2O8UA 1FAXA 4CR5A 1HUTH 1NFYA 1KTTB 4TWWA 1TNIA 1SR5C 1O30A 1YPJH 2JETC 4OS1A 5FCKA 1L2EA 3Q77A 3O8BA 1BZXE 1YPLH 4IGDA 4X2YA 3VXEH 3QLPH 3RXTA 1V2OT 2BDCA 1IQEA 2ZDMA 3TK9A 1S6FA 4SGBE 4ABDA 1RGQA 2IN2A 1RIWC 1FPCH 4WF8A 3KNXA 4I8KA 1HAPH 1PYTD 2Z3CA 2CHAC 2V3HH 4Q7ZA 3S9BA 1C5PA 3ZVCA 1ELVA 4INHA 1KXDA 2P3FH 3SOSA 1Q2WA 1MTWA 1TIOA 1MAYA 3UR6A 1TNHA 1Z8GA 3D49H 1AFQB 1B0FA 3ZZDA 4ZH8A 1HJ9A 5C20A 2G00A 4XE4A 2ZCLP 3E91A 1FQ3A 2ZZUH 2SGEE 1T31A 1Y8TA 3ODDA 3QK1A 4MVNA 3P70B 4GLYA 3RXBA 1DLEA 2VIVA 1T32A 4NSVA 3MO9A 4ZROA 3RXKA 3TNTA 1NS3A 3LC5A 4IC5A 4BTUB 2Z9KA 1C9PA 2VVVA 5C2ZA 2NU4E 4UEHH 5GCHG 1MKXH 1YYY1 4B2AA 3RXHA 4E05H 2F83A 2WPMS 5K0HA 1SLXB 5DKMA 1N6YA 1ZSLA 1LVOA 3MOCA 1AI8H 1P05A 1QL9A 3LGWA 3ZZ7A 3RXOA 3RMOH 1L1NA 3P8GA 2W5EA 3SU3A 2BLWA 4NFEA 3DUXH 4I7YH 3A89A 1O2ZA 1J16A 3MO6A 1XUFA 3QWCH 3BEFB 4NIVA 1JMOH 3SN8A 3UWJH 4CBOA 1SLWB 3F9EA 2UWLA 4A1XA 2BM2A 5T3HA 3RUOA 1F92A 1P2KA 2PW8H 3Q3XA 3DD2H 2QAAA 1W12U 2ESTE 2FS9A 3MU8A 3BTEE 1FPHH 2BY5X 4Q80A 5A2MH 1PQ7A 1ETSH 1LPZB 1FY5A 5J4SA 4DIHH 2VIOA 3UY9A 1MH0A 1VR1H 1NTPA 4BNRA 1UTOA 5HMAA 1P2IA 3VGCB 3A7VA 1MD8A 4BAQB 2OXSA 3PO1C 3TIUA 1V6DA 1G32B 2RCEA 3RU4E 3UNSA 1LMWB 3L3TA 2AGEX 3GDUA 1ELCA 1ZGVA 1G36A 3MFJA 2BXUH 3RXSA 5EXLA 1NRPH 3SJ9A 2J9NA 5JBCS 3SI4H 3SO3A 4ASHA 1ACBE 3RXPA 2ZU4A 1O2YA 4GSOA 2BOKA 1Z8JB 2TGPZ 1O3PB 1NN6A 1EB1H 5HGGA 1ESBA 3AVZA 5DP6A 4GHTA 4XOJA 3RLWH 1MTNB 3ZVGA 2O8WA 3RC6A 3VPKA 1BITA 4O97A 2SGAA 2D2DA 2A4QA 3M5NA 4YOIA 3AAVA 2ZHDA 1GBTA 2C3SA 5FPSA 1KIGH 1KXFA 3SNBA 1SQAA 1LKAA 3A7YA 3GY4A 1TA6A 2H5CA 1WSSH 3UREA 5EODA 3TK5A 1K21H 4NCYA 1SGIB 1F7ZA 2M5TA 3CS7A 3ZV8A 1O5FH 3S7KB 1V3XA 5GIBA 4AOQA 3GY7A 3GCOA 2XBYA 2W26A 1G2MA 2OC7A 1W2KH 1SHYA 1PPGE 4Y7AA 2RA0A 2OD3B 4IN2A 1DDJA 2HWLB 5ESBA 2FI5E 1P9SA 1SGFG 1SGQE 2GMTB 5EXNA 1C5TA 3E16B 3ZZ5A 1OSSA 2J92A 2ZO3H 4I8JA 2Z9IA 4X8VH 2AFQB 1VITF 1TABE 3F9HA 1LDTT 2THFB 4ABJA 4E7NA 4CREA 1DM4B 1FONA 3Q3YA 3URDA 2QF3A 1O5AB 2XCFA 2BD8A 4YT7H 3EDXB 3RXLA 1ARCA 1H4WA 5CMXH 4ZKOU 1KYNA 1V2WT 2ZHWH 5T6DA 3BG4B 7KMEH 4TPIZ 1GHBG 1BRBE 4IBLH 1WQVH 2ZDNA 3G01A 1QJ6B 1XX9A 1A61H 4AORA 1O2WA 3A7XA 4UFEH 4ZKRU 4DY7B 2BDBA 1O2TA 2AGGX 4DJZB 2P8OB 6GCHG 1QGFA 2PHBA 4WH8A 3A81A 3TLOA 3ATMA 1UK2A 4ESTE 3CENA 6CHAC 4ZMAH 1O37A 1JOUB 3FP6E 4DIIH 1UTPA 1CHGA 1SL3A 1VITH 4NA7A 1MMJN 1NPMA 2A7JA 1QL8A 3RXMA 2R9PA 1MD7A 1C1OA 5G4BA 3BTME 2GT8A 4PROA 1Z8RA 2ZU5A 3SW2B 3FVFB 4XBCA 1MU6B 1CQQA 4X8UH 1P2NA 1RTKA 4BTIB 3W94A 1EZSC 2BD2A 2Z9JA 5AFYH 3LH1A 1SI5H 1BTXA 2F9VA 2ZP0H 1QCPA 2FEQH 2R2MB 3TGKE 1V2QT 4AN7A 2Y5GA 3SQHE 2UUYA 2FPZA 2A7HA 2BQ7B 1MU8B 1TAWA 2C8ZB 1C5YB 4NGAH 1FN8A 1OWIA 2FZZA 5A0CA 1AWFH 2ANYA 1DS2E 5C5NA 1C2MA 4FXGH 2QXJA 2BDYA 2UUKB 2BHGA 4MNXA 3SBKA 1BQYA 1SLUB 1O3AA 1CU1A 4ZAEA 2OC8A 4DVAU 1HAGE 1EZXC 1GMDG 2BXTH 1FXYA 1Y59T 1TOCB 1SVPA 1TGNA 1THPB 4MG3A 2BD3A 4ZXXH 3RU4D 1GBEA 2ZU1A 1D6WA 4BXWA 4ZHAA 3C1KA 3M3VA 3V3MA 1GGDC 3TGJE 3GY6A 3K6YA 2FTLE 2J4IA 1ZTKA
chains in the Genus database with same CATH superfamily
1EZUC 3K9XB 2YMSB 1TMBH 3DSOA 1BBRK 1PPBH 1S0RA 1T8MA 5GPIB 3ZV9A 4CRBA 2GDEH 5F8XA 1FLEE 2XNIA 1O2HA 1GMCF 2WPJS 6LPRA 3M36A 4I8GA 1THSH 1JWTA 5EXMA 1SPJA 4X0WU 1D3PB 2ZA5A 4MNYA 1C1NA 5DP8A 1XVOA 1DT2A 2R2WU 3STIA 1BA8B 1IOEA 1XKAC 1RJXB 3MHWU 1RXPA 2A5IA 2FS8A 1E1RD 1LKBA 2Y6TA 2F9OA 2G52A 1K1OA 3OFND 5I46H 1GI9B 1ORFA 2C4FH 2KX4A 3M37A 1UTJA 3FKSD 2OTVA 2PKSB 4UDWH 2TGDA 4CRGA 3E6PH 2ZHFH 3KQBA 3WW7A 4FU9A 2QYIA 3FO8D 2O8LA 1AIXH 3M61U 3FZZA 1T4UH 1HPGA 3M7QA 3V12A 1HV7A 3UQVA 2VGCB 1ZHPA 1O39A 2VWOA 5IK2D 1GG6B 1EPTB 4M7GA 1EKBB 2EI6A 2XWBI 1GL0E 1EQ9A 3ZZAA 5DP4A 3P8NA 1EP6A 1GI0A 4OM9A 5KGOA 5TJXA 3L33A 2LPRA 4R8TB 5CHAB 1FI8A 4XBDA 2BD7A 3ZZ9A 2CXVA 2W6ID 1C4Y2 1EZQA 1C1PA 1C5MD 4NFFA 2GP9B 4LK4A 1KY9A 1MABB 1VGCB 1C4V2 3UOUA 1GJ5H 1BTZA 1WV7H 5E8EH 4JZDH 2ZFQH 2OLGA 5CHBA 2QXIA 3NK8A 1H9LB 4ISHH 1FIZA 1V2RT 2HPPH 2OCVB 1KLJH 1A5IA 5E2OA 4Z0KA 3SGBE 4B2BA 1IQJA 4BAKB 1G37A 3ZVDA 3H09A 1C4U2 3LH3A 4Y11E 2ZDKA 1D3QB 4JZFH 2BVSH 3MNCA 1IQHA 3VGCC 3P92A 2R3YA 2Z6BD 3KIDU 2VNTA 5CDFE 2J97A 1UW7A 2M2AA 1C1TA 1LHCH 2WPDD 1GI6A 1ELEE 3U8OH 2W6JD 4IMQA 2ZNKH 2XRCA 1O3CA 2G8TA 8LPRA 1SBWA 2OBOA 2ZIQH 4WXVA 1GWAA 4AFSA 2BLQA 1AVGH 1NT1A 1P02A 1QURH 2A0QB 1GJ4H 4Y8ZA 4IW4E 1BRCE 1D9IA 2ZC9H 1HJ8A 5DP7A 4CBNA 2BLOA 5AF9H 1VCPA 3RXDA 1DPOA 2ILNA 3R3GB 5EQQA 2WPHS 1BBRH 3A83A 2ZEBA 2TGAA 4F49A 2ZHQH 1EASA 9ESTA 1E37B 4O3UA 1NFWA 1W3CA 2Y5HA 1DWCH 1HAHH 1C2FA 1GJCB 3P6ZB 1ZMNA 1NROH 2FO9A 2HLCA 2YNBA 1WYKA 1C1WH 2ANMH 1A0JA 3MH5A 5EOKA 1LPGB 3IG6B 2PLXA 4JZEH 4Y10E 2UWPA 2C93B 1AFEH 5J4QA 3QZQA 1GJ9B 1C2KA 1GDQA 3BTDE 1P57B 1A2CH 2WV4A 4NIYA 3QGNB 5E2PA 2OINA 4A92A 7GCHF 4Y7BA 2FOHA 1AUTC 2EY4C 1G3EA 1V2MT 2ZU3A 3MTYA 2G51A 3B9FH 1YCPK 3QGJA 1PQAA 1CSOE 3ENSB 3ZZ4A 3SJ8A 3RM2H 1P03A 1ZR0A 1P11E 1TX6A 1SGFA 1ZYOA 4FUCA 1BT7A 1P3EA 2GZ7A 3MI4A 3PTNA 1BRUP 2ZECA 2EEKA 3UUZA 4NWLA 2GMTC 8ESTE 4CH2B 2PWXA 1C1UH 3RLYH 3ATIA 3NWUA 1VITG 4BXSA 3FP8E 1N8OC 4YESB 3U69H 4YOGA 2BZ6H 3EA8A 1ZRBA 1E36B 1HB0B 3E3TA 1FY4A 1C1SA 1GMDF 1XMNB 1E34B 5A8XA 3M3SA 1KLTA 9LPRA 1SQOA 1BHXF 2AHME 1KTSB 2AH4X 4RKJB 2ZQ1A 5JBTA 1VCQA 4NIXA 4INLA 1C2LA 3SJOA 3TJVA 3TK6A 3BG4C 5LH8A 2W3IA 1FAKH 2ZF0H 1GBBA 1VJ9U 4NSYA 1B0EA 1IHTH 1GI3A 1JIMA 5EGMA 2FYRA 2P93A 3VB3A 1W8BH 1DOJA 2KM0A 2FTMA 1AB9B 3RXFA 1NRNH 2BOHB 2P8OC 1SOTA 2GX4A 1KDQB 3BF6H 3F2HA 1OWJA 3T26A 1AO5A 1TMUH 2F9NA 5DPAA 3ODFA 1UK4A 1GJBB 1F2SE 1V2ST 4NZLA 2FI4E 4WVPE 1UVPA 2VIDA 2ZFFH 4DURA 4X2VA 1GVZA 4DT7B 3OY6U 1TALA 2GV6A 4IMZA 3RXGA 5H4IB 4ABGA 2GV7A 1SG8B 1EPTA 1P04A 1YP9A 5FBEA 2HGTH 1GHAF 1LVBA 1A3BH 1O32A 1QHRB 1SGRE 2Y82A 5F6MA 1DSUA 2O8TA 2B7DH 3SUDA 4P00A 1P01A 1FY1A 1S5SA 5DO4H 1OYTH 1SKYE 2BY9X 3SV2H 1KXAA 2AMDA 2GVFA 1UTQA 1GBMA 1NY22 1P2JA 5T6FA 3SUFA 1B5GH 1MZDA 4YT6H 4Z1MD 1EJAA 2BZAA 1GBCA 1ANCA 3MU1A 1FUJA 3DFJA 3OEED 1YPGH 1ZPCA 1F0SA 1SGTA 4AG2A 3B23B 1GI5A 1A4WH 4INKA 1AUJA 1SC8U 2RDLA 4A6LA 2XC0A 1A0LA 2H9HA 3ZZCA 2GCHF 2FOMB 1QIXB 3SNAA 1Y5UT 4GAWA 3A8CA 1TBQH 3M35A 1LHEH 3RXAA 1V2UT 1O3HA 4AX9H 6ESTA 1V2NT 1DY9A 4UD9H 2YOLA 1E0FD 1C5WB 1WU1A 1YPHC 4B75A 1LVMA 1WBGB 3BEUA 1J8AA 1FX0B 3PB1E 3L6PA 1GHZA 1O2SA 4WMDA 3KQ5A 4ACAA 2QCYA 2TIOA 1EUFA 3PLBA 1EJNA 3R0FA 1NFXA 1TMTH 2ZDAH 4OS2A 1ANDA 3SV9A 2VIWA 4TY7A 2VJ1A 3EAJA 4K1SA 3PMJA 1TRYA 1O2PA 3MWIU 1GMCG 1TQ0B 1Y5AT 4XSKU 3LGVA 3ZVEA 2PUXB 4B74A 1BMNH 3KYGA 3AASA 1OHHD 1TNGA 5FXLA 4JK5A 1N1LA 3TH3H 1LQDB 1CBWB 5EG4A 4I8HA 2ZTZA 4U32A 3AAUA 1H8IH 2CF8H 5L2YH 4CHAC 1GCTC 1W0JD 3A80A 1BTWA 4Y71A 3OAAD 1AE5A 1DUAA 1XM1A 2FLBH 5IYTA 3UNQA 2GZ9A 1FJSA 1UO6A 3D65E 1DITH 4E7RG 1ZLRA 4BAHB 5L2ZH 4X8SH 3O8CA 3A86A 1TBRH 2O9QA 1S82A 1C2GA 1DUEA 2EI8A 3GCNA 1DXPA 2PKSC 1CA0B 1OWEA 2BTCE 3E0PB 1A1RA 4X1SU 2H2ZA 1W13U 2GCTB 2Z9LA 3E8LA 4HZHA 5FX6A 4BTTB 1H9HE 1P09A 4Y76A 4A1TA 5HXFA 2FLRH 2QXHA 4TYDA 1K2I1 3UQOA 2HOBA 4LZ1H 1SGPE 1V2TT 3VB7A 1GBFA 1WTGH 1GG6C 3N7OA 2FYQA 1O3JA 3RMMH 1HIAA 3RU4T 4UONA 1AHTH 1FN6A 3ESTA 1AQ7A 1OP8A 1UJ1A 4TWYA 1K9OE 1W0ZU 1O2VA 4UE7H 1OPHB 4AYYB 3MU5A 3BTTE 1IQKA 4AFQA 3U98H 2OC1A 2WZQA 3F68H 3BIVH 3MU4A 5EQSA 2J95A 1B7XB 1IQMA 3CP7A 4NIWA 1INCA 3QDZB 1A7SA 1O2IA 3PWCA 4X6MA 5GDSH 3GCHB 3RMNH 1NESE 1TOMH 2WINI 4Y0ZE 5KECA 1HCGA 1IQNA 1QY6A 2Z9GA 3SU2A 1HYLA 1NBME 1PPCE 4LZ4B 1GDUA 1TGTA 2V3MA 4B2CA 2PV9B 1Y3UA 5C1XA 1EX3A 1Y5BT 4TSFD 4OS7A 4Y6DA 1GI1A 1OWDA 2ODPA 1QL7A 1UTLM 2HNTC 4X2XA 2AS9A 4H42U 3UB0A 5JYIA 2V7QD 2FOAA 3T62A 3HGPA 2W3KA 2SGDE 1TPPA 5HM9A 1EAXA 2OQ5A 4Y79A 1F5LA 3DA9B 3M3TA 3PLKA 3MH4A 1AKSB 3T27A 1A3EH 1GI2A 4CH8B 1L1GA 4MTBA 1DANH 2ZDLA 5LPFA 1A0HB 1HAOH 1S81A 1TRNA 3HK6B 2V35A 4DOQA 2JETB 5TCCA 2FMJA 1DE7H 2BD5A 5A09A 3H7TA 2AEIH 3GDVA 3JZ1B 3OYPA 1MTSA 1C2EA 1PPEE 3T5FH 1D3TB 1GHVH 1RIWB 3BTFE 4B73A 1EOJA 4J1YA 3HKJB 1AMHA 2IPQX 2CHAB 3MH7A 4Q63A 4WMFA 1MUEB 1D3DB 3GYLB 3P8FA 1O2JA 4MPXA 2F9PA 3ZZ6A 4ABHA 5T1VA 1KSNA 1YM0A 2ZKSA 1RTFB 1JRSA 4A1VA 1C5XB 2P3TB 2A45B 3UTUH 1HDTH 4O9VA 3RC5A 2AMQA 2ZTYA 1P3CA 2ZGCA 2NU0E 1MTUA 2HPQH 7GCHG 2BX3A 4K60A 1GBAA 1QB1A 2ANKH 3A8AA 3PMAB 1IQGA 1L0ZA 1ZJKA 1H8HD 2VVUA 1Z7KA 1GL1A 4ZXYH 4YLUA 3M7TA 3FZDA 5FCRA 1C5SA 1LPKB 3BTKE 1GHWH 1CGIE 1G3DA 4K1EA 1TNLA 1K1PA 4D7GA 4H6TA 4Y8XA 1AGJA 5ESTE 4B1TA 4CRFA 1TPOA 2R0LA 1E79D 2C90B 1FNIA 3VFEA 1MKWK 2XC4A 4ZUHA 2TPIZ 2QGRA 3UIRA 4RKOB 2V0BA 2G55A 3LGTA 2IPHA 2BMGB 1KXCA 1MQ5A 3MO3A 4D9RA 2YNAA 1MAXA 2FOFA 5AVDA 2BDAA 2PR3A 3GY5A 3LGUA 4QT8C 4BOHA 5C17A 3OX7U 5F8TA 1XUGA 3TITA 2G4UA 2JH5D 1K22H 1C2DA 1UK3A 2ZTXA 3DHKH 5DJ7A 1V2VT 4X6OA 4FVBA 1FZZA 1GBHA 1W7GH 3NRLA 4GCHG 2ZI2H 4OGYA 3E0NB 3Q3KA 5E0HA 4K69A 1BBRE 1GPZA 1SGYE 1Z6EA 2CMYA 3V7TA 3K6ZA 2KAIB 1BOQA 2ALPA 3LGIA 4LXBH 4O03A 5DK1A 1V2JT 3TJUA 4LOYH 1NU7B 1AFQC 1GHYH 1TFXA 2EA3A 4JZIA 3U8RH 3ZZ3A 1Y3XA 3PO1B 2WPIS 2GZ8A 1O3FA 1O5BB 1J9CH 5GNDA 2F9UA 2WV9A 3A7TA 1WXRA 1GHAG 5ABWA 4AYVB 1Y3YA 5DP3A 2H6MA 4NA9H 2GKVE 3NKKA 1DWDH 2HVXA 2R0KA 8KME2 3BN9A 1YY3A 3STJA 1YC0A 4CRDA 3SHCH 1NO9H 4ZHMU 3RXVA 4I8LA 2RA3A 4U30A 3UR9A 5EW2H 1S6HA 3PROA 2VIQA 2ZGXH 2VVCA 1GMHF 3M5MA 4GPGA 4MNWA 4AB9A 1WDIA 3BTQE 5FHTA 4D8NA 5HKKD 5HYOA 1UCYK 1F5KU 1SMFE 4DW2U 5A0BA 4X6PA 1OX1A 1ANBA 1FMGA 1O0DH 1SGEE 1QJ1B 1C9TA 1H8DH 1GBDA 3NCLA 2DUCA 3A85A 1HAVB 2GCHG 1A5GH 1O2UA 2AMPA 2ASUB 2H9EH 3Q76A 1NBMD 4AGKA 4ZKNU 4BAMB 4K1TA 3VB4A 1Z6JH 1P2OA 2H5DA 1RS0A 2Y5FA 2J38A 1OWKA 2SFAA 5FPTA 2P16A 1G30B 1BMMH 1T7CA 2Z3DA 3SNCA 4FVDA 3SORA 3NZIA 4A7IB 1EB2A 3LONA 4BAOB 3A8BA 1RFNA 3PM3A 2WUBA 1BIOA 1HAXB 1JBUH 2VH0A 2W7UA 4XD7D 2RFKC 1AKSA 2NWNA 1O5DH 4JYUH 1UTNA 3SZEA 1NFUA 3GY2A 1D6RA 1TX8A 3TU7H 1CT2E 3SV8A 2FOEA 1P2MA 5C67A 1HAYB 3MYWA 1O38A 1O3NA 1XUKA 3U1JB 3SU1A 2Y80A 4FUGA 1C2IA 5EU8A 4F48B 2K1QA 1UVSH 5K7RA 4FUEA 1J17T 1V2LT 1J15A 4WWYA 3QTVH 2KFWA 3QN7A 1BMAA 1OOKB 3KCGH 3BEIB 3WWFA 5AHGH 2A32A 3ZVAA 1NRQH 4FUHA 3KN2A 2XBVA 3GS9A 3S9AA 5C1UA 3ITIA 4FUFA 1W7XH 1C5LH 2R3UA 5JBBS 2OP9A 2OC0A 2WSSD 1W14U 4RN6A 3W95A 3UAIC 1MTNC 1ELDE 2XBWA 1WCZA 4B76A 5A8ZA 5B6OA 1BUIA 3BG8A 3SU0A 3GCTF 4YO9A 4AGJA 4XFQA 3S7HB 3PMBB 1PJPA 4ABAA 3EGKH 1YPKH 1PPHE 1QB6A 2FIRH 2Y81A 2KR7A 3BV9B 5T6GA 1ESTA 1GCDA 1O2NA 4I32A 1ARBA 4DG4A 1KXEA 3T25A 2WHXA 2V3OH 3C27B 1WUNH 3U9AH 3M5OA 3O8DA 1JXPA 1MZAA 4XRNA 4AFZA 3EA9A 5KEDA 2ODQA 1V2PT 2Z3EA 3OTJE 3RXCA 1XXFA 2VB0A 2XCNA 3F9FA 1A46H 4A5TS 4K2YA 1NRRH 1BTYA 4JK6A 4H6SB 3AW1A 2BD9A 2IJD1 1E38B 2QA9E 3WY8A 3RXIA 4I33A 1S84A 1UCYH 1AZZA 1C1RA 3RXUA 4MPUA 3S0NA 1C2HA 1G3BA 1T4VH 1D4PB 1TQ7B 5GJ4B 3HPTB 4Q2KA 3VEQB 1DWEH 5EPYA 2OUAA 1C5QA 2Q6FA 3PV2A 4DT4A 4OS4A 4U01A 3P8OA 1GVKB 4AFUA 1DLKB 2BY6X 2PKAB 5EW1H 2UUFB 1UVTH 1X7AC 3F9GA 1S83A 3V13A 3TH2H 3M7UA 4B71A 5LGOA 1O5EH 2KAIA 1A5HA 1F5RA 3SUGA 3V0XA 4ABFA 1RD3B 3E1XB 1GDNA 2K0QA 2XWAA 1HLTH 2FX6A 3S69A 1Z8IB 1T8NA 4Q7XA 4MDSA 4XDEA 1C5VA 3QO6A 3SU5A 1ZMLA 3U8TH 2FDAA 3MMGA 2I6QA 3UFAA 1CHOG 4TY6A 4CRCA 4MNVA 1C2JA 1K1NA 1Z71A 4GCHF 4B6EA 2VWMA 2HNTF 4Y8YA 1GGDB 1IHSH 1O36A 2CK3D 1ZMJA 1Y3VA 1P0SH 2XTTB 3MH6A 1ZTJA 1YF4A 4FOUC 1NM6A 2VWNA 4Q4LA 2WYGA 1VCWA 4HFPB 1O3GA 4K8YA 4JCNA 1GBIA 1HRTH 1EOLA 1ESAA 1SLVB 3LJJA 3T29A 2OBQA 2D26C 3BTWE 1PPFE 1UHBB 1JIRA 3UOPA 1CGJE 2BB4A 3TVJB 1LHFH 1AU8A 4X8TH 1QB9A 1UTKA 4UFDH 2GDDA 3MU0A 4K5ZA 4FUDA 1O2XA 4YTAA 4D9QA 1YLDA 2P3UB 4YLQH 1ANEA 3VB5A 3SZNA 3PLPA 4FU7A 1WQSA 3EE0B 3SI3H 1HAVA 2XC5A 3E90B 1O34A 1FY8E 3VG8A 1AY6H 1ZHMA 4TT3D 1ZGIA 2XOKD 1CE5A 5FAHA 1O2OA 2NU2E 4KTCA 1W0KD 3SV7A 4SGAE 1HJAB 2A5AA 5SGAE 2J98B 1IQLA 2PFEA 1PQ8A 2VU8E 5C0UA 2A4OA 3P17H 3M5LA 1RRKA 2ZFTA 1OP0A 1EFRD 1C5OH 1MQ6A 4MPWA 2ZGHA 2QF0A 2GT7A 3I78A 1OYQA 5EIYA 2D8WA 2ZFSA 3FAOA 3BIUH 1QNJA 4WY3A 5JDUB 3QUMP 1PQ5A 1YCPH 1ID5H 2FP7B 3GOVB 2A2XH 2HLDD 1DICA 2QC2A 4NG9H 4NZQA 3OY5U 2G5NA 3URCA 2B8OH 5F03A 2J2UA 2CN0H 2FODA 1PYTC 3W1EA 2A5KA 4ZHLU 4K8BA 4JYVH 1MCTA 5EJ1A 2JH6D 1QR3E 2BDGA 1SGDE 1NZQH 3ATLA 2G4TA 3KYFA 3LU9B 2XYAA 5LPEA 3EA7A 1W0YH 2YMSC 5JPMH 4IN1A 3OE7D 2PTCE 3A87A 3P95A 2QE7D 1VZQH 4ACBA 5LPRA 2AIPA 1TNJA 3D23A 3GY8A 2TRMA 1IAUA 3AK5A 4ZKSU 1UVUH 5C5OA 2H1UA 1TLDA 3PV5A 4ASUD 4FUBA 2F4LA 4KTSA 4XBBA 4U2WA 3KF2A 1ZHRA 2CGAA 1TBZH 5TCAA 3FFGA 4UFFH 2JH0D 1DX5M 4NA8A 4X1RU 4KTUA 1ABIH 1TPAE 4AG1A 1O2QA 1VJAU 2FESH 2VINA 1PFXC 3GYMA 2F43B 1BTHH 1L4ZA 2IOTA 1ETTH 1CT4E 1O5CB 1Q3XA 1W10U 4R0IA 3A82A 2KCYA 3F2GA 3PYHA 7ESTE 2JJ2D 5IDKA 1C5RA 5JB9S 5EQRA 2QXGA 1Y3WA 4ABBA 4DCDA 1DFPA 1BRAA 1TWXB 3H5CB 1TNKA 3LPRA 1F0UA 3PRDA 4TPYA 2F3CE 2STAE 1LHGH 2FOBA 1BMLA 2VBCA 1GMHG 1Q31A 1ELFA 1C5ZB 2VGCC 4WXIA 1EPTC 3KQCA 3ZYEA 3I29A 2C8YB 4AB8A 1MCVA 3KGPA 1XVMA 5ETXA 1OWHA 8GCHF 2BD4A 5BRRE 7LPRA 1IQIA 4THNH 5CHAC 1IQFA 3B8JA 3H7OA 4E06H 1KLIH 3BTGE 1NRSH 3S9CA 1YWUA 1RTLA 2ODYB 4F55A 1VGCC 2A31A 3AW0A 3SV6A 3U1IB 1J14A 3RXJA 1ZTLA 1YCPM 2QV1A 1O3DA 3ZYDA 2A2QH 3EQ0H 4DGJA 3SJKA 2PKAA 3A7ZA 1O5GH 1ZSJA 5DG6A 2A7CA 2IJOB 3IITA 1TE0A 1C1MA 4NWKA 1CGHA 2ALVA 3SUEA 1GVLA 4YM9A 4MQAA 2I6SA 1XUHA 2ZWLH 1O2LA 4ABIA 5AFZH 4ISLA 1O2RA 2NU3E 2UUJB 4D76A 2PGBB 3RXQA 2BY8X 3F0OA 1O3EA 2SNVA 4JYTA 1QA7A 2Y7XA 2JKHA 1GI4A 1EJMA 4MPVA 3MNXA 3RXRA 1S6LA 1KDQA 5EPNA 1U6QA 3UPEA 2PGQB 4VGCB 1SFQB 1N8OB 1Z1JA 4AC9A 3GY3A 1FV9A 2GD4B 1YBWA 1SB1H 4J2YB 1P8VC 2AERH 1UHBA 2VH6A 1CHOF 1GBKA 1ZSKA 1S85A 2FOGA 4ABEA 3ELAH 1AZ8A 2V6NA 5JB8S 2FI3E 2FOCA 1QTFA 4RSPA 3SQEE 4MLFB 1QRWA 3GCTG 2OQUA 5CE1A 4YXWD 2ZGJA 4FETA 1GJAB 2AGIX 3EYDA 1BTPA 3A84A 5F53A 1EP5A 3QTOH 4ISOA 1ETRH 1P10A 3PV4A 3NUMA 2ULLA 3LKWA 5DGJA 2QY0B 1GI8B 2J98A 2ZG0H 5FBIA 2BY7X 4Q7YA 2Q6DA 3F3BA 4OGXA 1BCUH 1CVWH 2BX4A 4YOJA 2SGPE 1TA2A 3ZVFA 3RXEA 2SNWA 2GTBA 1ELBA 2KCAA 1N6XA 3ZVBA 1QQUA 1W11U 1THRH 1P12E 1ZPZA 3WWBA 4YZUA 5HIYA 1P06A 5JBAS 1DWBH 3SGQE 1TONA 1QBVH 1P9UA 2ZDVH 2GJGA 3A8DA 2P94A 3FP7E 2ZPQA 5GCHF 3MNBA 4OS6A 1XKBC 2A1DB 2CJIA 2EC9H 2H9TH 4CRAA 2WPLS 4ISIH 1LVYA 2ZFRH 1HNEE 1C1VH 3GDSA 3MNSA 2ZCKP 1GHXH 3TH4H 5FPYA 2XW9A 1QJ7B 3PMHB 1F0RA 2J94A 3HKIB 5C1YA 1GJ6A 1FY3A 1YLNA 1M9UA 2BQWB 2W7SA 3KQEA 1OXGA 4JZ1A 1O33A 3I77A 1HAZB 1L4DA 3A88A 2ZPRA 1EAWA 3GICB 4JMYA 1O2MA 4IC6A 2FXRA 1BB0B 1E35B 1HXEH 3TJNA 3QZRA 3RDZA 1F0TA 3ZZBA 2BYAX 2PP6A 2D1JA 5A0AE 1EATA 3NXPA 1CA8B 1AB9C 3F1SB 3VXFH 1EAIA 3LOXA 3T2NA 3KHVA 3QX5H 4FUJA 1GI7B 3IWMA 3OTPA 1QA0A 4X1NU 2EI7A 1HXFH 1NU9A 3SNDA 4GVUA 2CF9H 2WYJA 5A8YA 3BSQA 2K8IA 4M9FA 4FUIA 1AVXA 1K28D 3DT0H 3BTHE 1FDPA 1E1QD 1TYNA 2DE9A 3SJIA 1DSTA 3HGNA 1HAIH 1HGTH 1AN1E 5DP9A 4I31A 2XBXA 3T28A 1ZOMA 1Z1IA 2ZHEH 1H1BA 1YGCH 2ANWA 4X6NA 4CHAB 1GCTB 2WUCA 4HTCH 1JRTA 1YPHE 4D7FA 1BJVA 1LQEA 1SQRA 4FU8A 5GWZA 1LCYA 3FANA 5FX5A 1BDAA 1G2LA 1O3KA 1FIWA 3DCLA 1QBNA 4WMEA 1SHHB 5E0GA 2XXLA 3SHAH 1SQTA 1UTMA 3LT3A 4HI3A 3SU4A 4AZ2B 5L6NH 3Q00A 2UWOA 2F9BH 3KL6A 4GHQA 2QIQA 1TB6H 1BJUA 1HJAC 1QRXA 1K1MA 1K0HA 1MTVA 2BLVA 4OS5A 3ZZ8A 1WAYB 1UCYE 2KCPA 1GJ8B 5HM2A 3OEHD 1OP2A 2PTNA 3RC4A 4O3TA 3UNRA 1XUIA 1HBTH 1SOZA 1C5UA 1G3CA 3TPIZ 2A4GA 4KGAA 1ZJDA 2ZCHP 4H4FA 2GGVB 1TGBA 2G5VA 1TRMA 4K3JA 2A4RA 1EAUA 3RM0H 2FX4A 2Q6GA 1AD8H 2TBSA 2F91A 3VB6A 1C1QA 1MBMA 1SFIA 2KCOA 3TJOA 1O3MA 2RG3A 2Z94A 5F8ZA 2BDHA 4BANB 3ATKA 5PTPA 1LHDH 2DE8A 2WPKS 3SU6A 3GISB 1MKWH 1PPZA 3LIWA 4RI0A 1BHXB 1O3OA 2SGFE 1ELTA 1SGNE 3KQDA 1O2KA 1GBJA 3K2UA 2ZGBH 2PSYA 3LGYA 2C8WB 1CBWC 4KELA 5EJZA 4HG6A 5GXPA 2C8XB 4ISNA 2J34A 3TGIE 1MBQA 1SSXA 2FWWA 1KXBA 1K1JA 3PWBA 3OSYA 2B0FA 2ZU2A 3SNEA 3UWIA 3CS0A 1TGCA 1XUJA 5EJLA 5E0JA 1WOFA 3K65B 3LJOA 1V2KT 1ZZZA 1GJDB 1O31A 1WTHD 2QF5A 1SGCA 1ELGA 1YPMH 1UMAH 1BMFD 1BTUA 1C5NH 3JZ2B 4Z6AH 2SGQE 3HATH 1H9IE 1K1LA 1GHBF 1QBOA 1CA0C 2BQ6B 4I86A 4X1QU 1CO7E 1TGSZ 2P95A 2GCTC 4WJG2 4P02A 5DP5A 3FN8A 1YLCA 1GBLA 2BVRH 3NPSA 2JJ1D 6GCHF 2AYWA 6CHAB 3RP2A 3SGAE 1ABJH 1YKTA 4Y0YE 5DN6D 1YPEH 1MKXK 5DSFA 1O3BA 2OK5A 8GCHG 3DFLA 2CV3A 1O3IA 4X2WA 2FM2A 2HNTE 4HGCA 1TPSA 1T8OA 3A7WA 1OKXA 1QFKH 2Z7FE 2LNCA 4KP0A 3OU0A 2ZFPH 3FOAA 3HK3B 2PUQH 1L1JA 2Y7ZA 4CR9A 1OS8A 2ZQ2A 1AE8H 2G81E 1HFDA 1S0QA 1NC6A 2BVXH 2B5TB 3D62A 3RMLH 5L30H 3PTBA 1ELAA 1DXWA 1DY8A 5C3NA 3LDXH 1XXDA 5HIZA 2VIPA 3F6UH 3GCHC 2STBE 2VWLA 1ZPBA 4WH6A 4GUXA 4X1PU 1AWHB 2ZPSA 1UVOA 1O2GH 4IS5A 2PSXA 3LC3A 2AIQA 2NU1E 5BPEA 1QRZA 1AVWA 1GJ7B 1QQ4A 1T8LA 2P59A 5I25A 2Q1JA 3O8RA 2O8MA 2BDIA 2TGTA 1LO6A 1HIAB 2HRVA 1CT0E 5C94A 2J5UA 3TNSA 1DVAH 2HALA 2WV5A 1O35A 4UFGH 2QN5T 2B9LA 1EXFA 4RT1A 1LTOA 3ATWA 1ZRKA 1G9IE 1K1IA 1O3LA 4KKDA 4VGCC 1TX7A 3KEEA 4F4OC 1P2QA 2O8UA 1FAXA 3DSPA 4CR5A 1HUTH 1NFYA 1KTTB 4TWWA 3CNRA 1TNIA 1SR5C 1KMHB 1O30A 1YPJH 2JETC 4OS1A 5FCKA 1L2EA 3Q77A 3O8BA 1BZXE 1YPLH 4IGDA 4X2YA 3VXEH 3QLPH 3RXTA 3EE7A 1V2OT 2BDCA 1IQEA 2ZDMA 3TK9A 1S6FA 4SGBE 4ABDA 1RGQA 2IN2A 1RIWC 1FPCH 4WF8A 3KNXA 4I8KA 1HAPH 1PYTD 2Z3CA 2CHAC 2V3HH 4Q7ZA 3S9BA 1C5PA 3ZVCA 5C0TA 1ELVA 4INHA 1KXDA 2P3FH 3SOSA 1Q2WA 1MTWA 1TIOA 1MAYA 3UR6A 1TNHA 2YMSD 1Z8GA 3D49H 1AFQB 1B0FA 3ZZDA 4ZH8A 1HJ9A 5C20A 2G00A 4XE4A 2ZCLP 3E91A 1FQ3A 2ZZUH 2SGEE 3N7EA 1T31A 1Y8TA 3ODDA 3QK1A 4MVNA 2L74A 3P70B 4GLYA 1DLEA 3RXBA 2VIVA 1T32A 4NSVA 3MO9A 4ZROA 3RXKA 3TNTA 1NS3A 3LC5A 4IC5A 4BTUB 2Z9KA 1C9PA 2VVVA 5C2ZA 2NU4E 4UEHH 5GCHG 1MKXH 1YYY1 4B2AA 3RXHA 4E05H 2F83A 2WPMS 5K0HA 1SLXB 5DKMA 2LELA 1N6YA 1ZSLA 1LVOA 3MOCA 1AI8H 1H8ED 1P05A 1QL9A 3LGWA 3ZZ7A 3RXOA 3RMOH 5B6LA 1L1NA 3P8GA 2W5EA 3SU3A 2BLWA 4NFEA 3DUXH 4I7YH 3A89A 1O2ZA 1J16A 3MO6A 1XUFA 3QWCH 3BEFB 4NIVA 1JMOH 3SN8A 3UWJH 4CBOA 1SLWB 3F9EA 2UWLA 4A1XA 2BM2A 5T3HA 3RUOA 1F92A 1P2KA 2PW8H 3Q3XA 3DD2H 2QAAA 1W12U 2ESTE 2FS9A 3MU8A 3BTEE 2EQNA 1FPHH 2BY5X 4Q80A 5A2MH 1PQ7A 1ETSH 1LPZB 1FY5A 5J4SA 4DIHH 2VIOA 3UY9A 1MH0A 1VR1H 1NTPA 4BNRA 1UTOA 5HMAA 1P2IA 3VGCB 3A7VA 4RT0A 1MD8A 4BAQB 2OXSA 3PO1C 3TIUA 1V6DA 1G32B 2RCEA 3N99A 3RU4E 3UNSA 1LMWB 3L3TA 1VKYA 2AGEX 3GDUA 1ELCA 1ZGVA 1G36A 3MFJA 2BXUH 3RXSA 5EXLA 1NRPH 3SJ9A 2J9NA 5JBCS 3SI4H 3SO3A 4ASHA 1ACBE 3RXPA 2ZU4A 1O2YA 4GSOA 2BOKA 1Z8JB 2TGPZ 1O3PB 1NN6A 1EB1H 5HGGA 2JIZD 1ESBA 3AVZA 5DP6A 4GHTA 4XOJA 3RLWH 1MTNB 3ZVGA 2O8WA 3RC6A 3VPKA 3MQKC 1BITA 4O97A 2SGAA 2D2DA 3U28C 2A4QA 3M5NA 4YOIA 3AAVA 2ZHDA 1GBTA 2C3SA 5FPSA 1KIGH 1KXFA 3SNBA 1SQAA 2XNDD 1LKAA 3A7YA 3GY4A 1TA6A 2H5CA 1WSSH 3UREA 5EODA 2L6OA 3TK5A 1K21H 4NCYA 1SGIB 1F7ZA 2M5TA 3CS7A 3ZV8A 1O5FH 3S7KB 1V3XA 5GIBA 4AOQA 3GY7A 3GCOA 2XBYA 2W26A 1G2MA 2OC7A 1W2KH 1SHYA 1PPGE 4Y7AA 2RA0A 2OD3B 4IN2A 1DDJA 2HWLB 5ESBA 2FI5E 1P9SA 1SGFG 1SGQE 2GMTB 5EXNA 1C5TA 3E16B 3N7DA 1OSSA 2J92A 2ZO3H 3ZZ5A 4I8JA 2Z9IA 4X8VH 2AFQB 1VITF 1TABE 3F9HA 1COWD 1LDTT 2THFB 4ABJA 4E7NA 4CREA 1DM4B 1FONA 4ZCNA 3Q3YA 3URDA 2QF3A 1O5AB 2XCFA 2BD8A 4YT7H 3EDXB 3RXLA 1ARCA 1H4WA 5CMXH 4ZKOU 1KYNA 1V2WT 2ZHWH 5T6DA 3BG4B 7KMEH 4TPIZ 1GHBG 1BRBE 4IBLH 1WQVH 2ZDNA 3G01A 1QJ6B 1XX9A 2LP6A 1A61H 4AORA 1O2WA 3A7XA 4UFEH 4ZKRU 4DY7B 2BDBA 1O2TA 2AGGX 4DJZB 2P8OB 6GCHG 1QGFA 2PHBA 4WH8A 2KZ4A 3A81A 3TLOA 3ATMA 1UK2A 4ESTE 3CENA 6CHAC 3ZIAD 4ZMAH 1O37A 5FL7D 1JOUB 2QF4A 3FP6E 4DIIH 1UTPA 1CHGA 1SL3A 3DSGA 1VITH 4NA7A 1MMJN 1NPMA 2A7JA 2HVYB 1QL8A 3RXMA 2R9PA 1MD7A 1C1OA 1QZ8A 5G4BA 3BTME 2GT8A 3F2FA 4PROA 3SYJA 1Z8RA 2ZU5A 3SW2B 3FVFB 4XBCA 1MU6B 1CQQA 4X8UH 1P2NA 1RTKA 4BTIB 3W94A 1EZSC 2BD2A 2Z9JA 3PRBA 5AFYH 3LH1A 1SI5H 1BTXA 2F9VA 2ZP0H 1QCPA 2FEQH 2R2MB 3TGKE 2JDID 1V2QT 4AN7A 2Y5GA 3SQHE 2UUYA 2FPZA 2A7HA 2BQ7B 1MU8B 1TAWA 2C8ZB 1C5YB 4NGAH 1FN8A 1OWIA 2FZZA 5A0CA 1AWFH 4B6FA 2ANYA 1DS2E 5C5NA 1C2MA 4FXGH 2QXJA 2BDYA 2UUKB 2BHGA 4MNXA 3SBKA 1BQYA 1SLUB 1O3AA 1CU1A 4ZAEA 2OC8A 4DVAU 1HAGE 1EZXC 1GMDG 2BXTH 1FXYA 1Y59T 1TOCB 1SVPA 1TGNA 1THPB 4MG3A 2BD3A 2RDEA 4ZXXH 3RU4D 3F0PA 1GBEA 2ZU1A 1D6WA 4BXWA 4ZHAA 3C1KA 3M3VA 3V3MA 1GGDC 3TGJE 3GY6A 3K6YA 2FTLE 2J4IA 1ZTKA
chains in the Genus database with same CATH topology
1EZUC 3K9XB 1TMBH 1BBRK 1PPBH 1S0RA 1T8MA 5GPIB 3ZV9A 4CRBA 2GDEH 5F8XA 1FLEE 2XNIA 1O2HA 1GMCF 2WPJS 6LPRA 3M36A 4I8GA 1THSH 1JWTA 5EXMA 1SPJA 4X0WU 1D3PB 2ZA5A 4MNYA 1C1NA 5DP8A 1XVOA 1DT2A 2R2WU 3STIA 1BA8B 1IOEA 1XKAC 1RJXB 3MHWU 1RXPA 2A5IA 2FS8A 1LKBA 2Y6TA 2F9OA 2G52A 1K1OA 5I46H 1GI9B 1ORFA 2C4FH 3M37A 1UTJA 2OTVA 2PKSB 4UDWH 2TGDA 4CRGA 3E6PH 2ZHFH 3KQBA 4FU9A 2QYIA 2O8LA 1AIXH 3M61U 3FZZA 1T4UH 1HPGA 3M7QA 3V12A 1HV7A 3UQVA 2VGCB 1ZHPA 1O39A 2VWOA 1GG6B 1EPTB 4M7GA 1EKBB 2EI6A 2XWBI 1GL0E 1EQ9A 3ZZAA 5DP4A 3P8NA 1EP6A 1GI0A 5TJXA 3L33A 2LPRA 4R8TB 5CHAB 1FI8A 4XBDA 2BD7A 3ZZ9A 2CXVA 1C4Y2 1EZQA 1C1PA 1C5MD 4NFFA 2GP9B 4LK4A 1KY9A 1VGCB 1C4V2 3UOUA 1GJ5H 1BTZA 1WV7H 5E8EH 4JZDH 2ZFQH 2OLGA 2QXIA 3NK8A 1H9LB 4ISHH 1FIZA 1V2RT 2HPPH 2OCVB 1KLJH 1A5IA 5E2OA 4Z0KA 3SGBE 4B2BA 1IQJA 4BAKB 1G37A 3ZVDA 1C4U2 3LH3A 4Y11E 2ZDKA 1D3QB 4JZFH 2BVSH 3MNCA 1IQHA 3VGCC 3P92A 2R3YA 2Z6BD 3KIDU 2VNTA 1C1TA 1LHCH 1GI6A 1ELEE 3U8OH 4IMQA 2ZNKH 2XRCA 1O3CA 2G8TA 8LPRA 1SBWA 2OBOA 2ZIQH 4WXVA 1GWAA 4AFSA 2BLQA 1AVGH 1NT1A 1P02A 1QURH 2A0QB 1GJ4H 4Y8ZA 4IW4E 1BRCE 1D9IA 2ZC9H 1HJ8A 5DP7A 4CBNA 2BLOA 5AF9H 1VCPA 3RXDA 1DPOA 2ILNA 3R3GB 5EQQA 2WPHS 1BBRH 3A83A 2ZEBA 2TGAA 4F49A 2ZHQH 1EASA 9ESTA 1E37B 4O3UA 1NFWA 1W3CA 2Y5HA 1DWCH 1HAHH 1C2FA 1GJCB 3P6ZB 1ZMNA 1NROH 2FO9A 2HLCA 2YNBA 1WYKA 1C1WH 2ANMH 1A0JA 3MH5A 5EOKA 1LPGB 3IG6B 2PLXA 4JZEH 4Y10E 2UWPA 2C93B 1AFEH 5J4QA 3QZQA 1GJ9B 1C2KA 1GDQA 3BTDE 1P57B 1A2CH 2WV4A 4NIYA 3QGNB 5E2PA 2OINA 4A92A 7GCHF 4Y7BA 2FOHA 1AUTC 1G3EA 1V2MT 2ZU3A 3MTYA 2G51A 3B9FH 1YCPK 3QGJA 1PQAA 1CSOE 3ENSB 3ZZ4A 3SJ8A 3RM2H 1P03A 1ZR0A 1P11E 1TX6A 1SGFA 1ZYOA 4FUCA 1BT7A 1P3EA 2GZ7A 3MI4A 3PTNA 1BRUP 2ZECA 2EEKA 3UUZA 4NWLA 2GMTC 8ESTE 4CH2B 2PWXA 1C1UH 3RLYH 3ATIA 3NWUA 1VITG 4BXSA 3FP8E 1N8OC 4YESB 3U69H 4YOGA 2BZ6H 3EA8A 1ZRBA 1E36B 1HB0B 3E3TA 1FY4A 1C1SA 1GMDF 1XMNB 1E34B 5A8XA 3M3SA 1KLTA 9LPRA 1SQOA 1BHXF 1KTSB 2AH4X 4RKJB 2ZQ1A 5JBTA 1VCQA 4NIXA 4INLA 1C2LA 3SJOA 3TJVA 3TK6A 3BG4C 5LH8A 2W3IA 1FAKH 2ZF0H 1GBBA 1VJ9U 4NSYA 1B0EA 1IHTH 1GI3A 1JIMA 5EGMA 2FYRA 2P93A 3VB3A 1W8BH 1DOJA 2FTMA 1AB9B 3RXFA 1NRNH 2BOHB 2P8OC 1SOTA 2GX4A 1KDQB 3BF6H 1OWJA 3T26A 1AO5A 1TMUH 2F9NA 5DPAA 3ODFA 1UK4A 1GJBB 1F2SE 1V2ST 4NZLA 2FI4E 4WVPE 1UVPA 2VIDA 2ZFFH 4DURA 4X2VA 1GVZA 4DT7B 3OY6U 1TALA 2GV6A 4IMZA 3RXGA 5H4IB 4ABGA 2GV7A 1SG8B 1EPTA 1P04A 1YP9A 5FBEA 2HGTH 1GHAF 1LVBA 1A3BH 1O32A 1QHRB 1SGRE 2Y82A 5F6MA 1DSUA 2O8TA 2B7DH 3SUDA 1P01A 1FY1A 1S5SA 5DO4H 1OYTH 2BY9X 3SV2H 1KXAA 2AMDA 2GVFA 1UTQA 1GBMA 1NY22 1P2JA 5T6FA 3SUFA 1B5GH 1MZDA 4YT6H 1EJAA 2BZAA 1GBCA 1ANCA 3MU1A 1FUJA 3DFJA 1YPGH 1ZPCA 1F0SA 1SGTA 4AG2A 3B23B 1GI5A 1A4WH 4INKA 1AUJA 1SC8U 2RDLA 4A6LA 2XC0A 1A0LA 2H9HA 3ZZCA 2GCHF 2FOMB 1QIXB 3SNAA 1Y5UT 4GAWA 3A8CA 1TBQH 3M35A 1LHEH 3RXAA 1V2UT 1O3HA 4AX9H 6ESTA 1V2NT 1DY9A 4UD9H 2YOLA 1E0FD 1C5WB 1WU1A 1YPHC 4B75A 1LVMA 1WBGB 3BEUA 1J8AA 3PB1E 3L6PA 1GHZA 1O2SA 4WMDA 2QCYA 2TIOA 1EUFA 3PLBA 1EJNA 3R0FA 1NFXA 1TMTH 2ZDAH 4OS2A 1ANDA 3SV9A 2VIWA 4TY7A 2VJ1A 3EAJA 4K1SA 3PMJA 1TRYA 1O2PA 3MWIU 1GMCG 1TQ0B 1Y5AT 4XSKU 3LGVA 3ZVEA 2PUXB 4B74A 1BMNH 3AASA 1TNGA 5FXLA 4JK5A 1N1LA 3TH3H 1LQDB 1CBWB 5EG4A 4I8HA 2ZTZA 4U32A 3AAUA 1H8IH 2CF8H 5L2YH 4CHAC 1GCTC 3A80A 1BTWA 4Y71A 1AE5A 1DUAA 1XM1A 2FLBH 5IYTA 3UNQA 2GZ9A 1FJSA 1UO6A 3D65E 1DITH 4E7RG 1ZLRA 4BAHB 5L2ZH 4X8SH 3O8CA 3A86A 1TBRH 2O9QA 1S82A 1C2GA 1DUEA 2EI8A 3GCNA 1DXPA 2PKSC 1CA0B 1OWEA 2BTCE 3E0PB 1A1RA 4X1SU 2H2ZA 1W13U 2GCTB 2Z9LA 3E8LA 4HZHA 5FX6A 4BTTB 1H9HE 1P09A 4Y76A 4A1TA 5HXFA 2FLRH 2QXHA 4TYDA 1K2I1 3UQOA 2HOBA 4LZ1H 1SGPE 1V2TT 3VB7A 1GBFA 1WTGH 1GG6C 3N7OA 2FYQA 1O3JA 3RMMH 1HIAA 3RU4T 4UONA 1AHTH 1FN6A 3ESTA 1AQ7A 1OP8A 1UJ1A 4TWYA 1K9OE 1W0ZU 1O2VA 4UE7H 1OPHB 4AYYB 3MU5A 3BTTE 1IQKA 4AFQA 3U98H 2OC1A 3F68H 3BIVH 3MU4A 5EQSA 2J95A 1B7XB 1IQMA 3CP7A 4NIWA 1INCA 3QDZB 1A7SA 1O2IA 3PWCA 4X6MA 5GDSH 3GCHB 3RMNH 1NESE 1TOMH 2WINI 4Y0ZE 1HCGA 1IQNA 1QY6A 2Z9GA 3SU2A 1HYLA 1PPCE 4LZ4B 1GDUA 1TGTA 4B2CA 2PV9B 1Y3UA 5C1XA 1EX3A 1Y5BT 4OS7A 4Y6DA 1GI1A 1OWDA 2ODPA 1QL7A 1UTLM 2HNTC 4X2XA 2AS9A 4H42U 5JYIA 2FOAA 3T62A 3HGPA 2W3KA 2SGDE 1TPPA 5HM9A 1EAXA 2OQ5A 4Y79A 1F5LA 3DA9B 3M3TA 3PLKA 3MH4A 1AKSB 3T27A 1A3EH 1GI2A 4CH8B 1L1GA 4MTBA 1DANH 2ZDLA 5LPFA 1A0HB 1HAOH 1S81A 1TRNA 3HK6B 2V35A 4DOQA 2JETB 5TCCA 2FMJA 1DE7H 2BD5A 5A09A 3H7TA 2AEIH 3GDVA 3JZ1B 3OYPA 1MTSA 1C2EA 1PPEE 3T5FH 1D3TB 1GHVH 1RIWB 3BTFE 4B73A 1EOJA 4J1YA 3HKJB 1AMHA 2CHAB 3MH7A 4WMFA 1MUEB 1D3DB 3GYLB 3P8FA 1O2JA 4MPXA 2F9PA 3ZZ6A 4ABHA 1KSNA 1YM0A 2ZKSA 1RTFB 1JRSA 4A1VA 1C5XB 2P3TB 2A45B 3UTUH 1HDTH 4O9VA 3RC5A 2AMQA 2ZTYA 1P3CA 2ZGCA 2NU0E 1MTUA 2HPQH 7GCHG 2BX3A 4K60A 1GBAA 1QB1A 2ANKH 3A8AA 3PMAB 1IQGA 1L0ZA 1ZJKA 2VVUA 1Z7KA 1GL1A 4ZXYH 4YLUA 3M7TA 3FZDA 5FCRA 1C5SA 1LPKB 3BTKE 1GHWH 1CGIE 1G3DA 4K1EA 1TNLA 1K1PA 4D7GA 4H6TA 4Y8XA 1AGJA 5ESTE 4B1TA 4CRFA 1TPOA 2R0LA 2C90B 1FNIA 3VFEA 1MKWK 2XC4A 4ZUHA 2TPIZ 2QGRA 3UIRA 4RKOB 2V0BA 2G55A 3LGTA 2IPHA 2BMGB 1KXCA 1MQ5A 3MO3A 4D9RA 2YNAA 1MAXA 2FOFA 5AVDA 2BDAA 2PR3A 3GY5A 3LGUA 4QT8C 4BOHA 3OX7U 5F8TA 1XUGA 3TITA 2G4UA 2JH5D 1K22H 1C2DA 1UK3A 2ZTXA 3DHKH 5DJ7A 1V2VT 4X6OA 4FVBA 1FZZA 1GBHA 1W7GH 4GCHG 2ZI2H 4OGYA 3E0NB 3Q3KA 5E0HA 4K69A 1BBRE 1GPZA 1SGYE 1Z6EA 2CMYA 3V7TA 3K6ZA 2KAIB 1BOQA 2ALPA 3LGIA 4LXBH 4O03A 5DK1A 1V2JT 3TJUA 4LOYH 1NU7B 1AFQC 1GHYH 1TFXA 2EA3A 4JZIA 3U8RH 3ZZ3A 1Y3XA 3PO1B 2WPIS 2GZ8A 1O3FA 1O5BB 1J9CH 2F9UA 3A7TA 1GHAG 5ABWA 4AYVB 1Y3YA 5DP3A 2H6MA 4NA9H 2GKVE 3NKKA 1DWDH 2HVXA 2R0KA 8KME2 3BN9A 3STJA 1YC0A 4CRDA 3SHCH 1NO9H 4ZHMU 3RXVA 4I8LA 2RA3A 4U30A 3UR9A 5EW2H 1S6HA 3PROA 2VIQA 2ZGXH 2VVCA 1GMHF 3M5MA 4GPGA 4MNWA 4AB9A 3BTQE 5FHTA 4D8NA 5HYOA 1UCYK 1F5KU 1SMFE 4DW2U 5A0BA 4X6PA 1OX1A 1ANBA 1FMGA 1O0DH 1SGEE 1QJ1B 1C9TA 1H8DH 1GBDA 3NCLA 2DUCA 3A85A 1HAVB 2GCHG 1A5GH 1O2UA 2AMPA 2ASUB 2H9EH 3Q76A 4AGKA 4ZKNU 4BAMB 4K1TA 3VB4A 1Z6JH 1P2OA 2H5DA 1RS0A 2Y5FA 2J38A 1OWKA 2SFAA 5FPTA 2P16A 1G30B 1BMMH 1T7CA 2Z3DA 3SNCA 4FVDA 3SORA 3NZIA 4A7IB 1EB2A 3LONA 4BAOB 3A8BA 1RFNA 3PM3A 2WUBA 1BIOA 1HAXB 1JBUH 2VH0A 2W7UA 1AKSA 2NWNA 1O5DH 4JYUH 1UTNA 1NFUA 3GY2A 1D6RA 1TX8A 3TU7H 1CT2E 3SV8A 2FOEA 1P2MA 5C67A 1HAYB 3MYWA 1O38A 1O3NA 1XUKA 3U1JB 3SU1A 2Y80A 4FUGA 1C2IA 5EU8A 2K1QA 1UVSH 5K7RA 4FUEA 1J17T 1V2LT 1J15A 4WWYA 3QTVH 3QN7A 1BMAA 1OOKB 3KCGH 3BEIB 5AHGH 2A32A 3ZVAA 1NRQH 4FUHA 3KN2A 2XBVA 3S9AA 5C1UA 3ITIA 4FUFA 1W7XH 1C5LH 2R3UA 5JBBS 2OP9A 2OC0A 1W14U 4RN6A 3W95A 1MTNC 1ELDE 2XBWA 1WCZA 4B76A 5A8ZA 5B6OA 1BUIA 3BG8A 3SU0A 3GCTF 4YO9A 4AGJA 4XFQA 3S7HB 3PMBB 1PJPA 4ABAA 3EGKH 1YPKH 1PPHE 1QB6A 2FIRH 2Y81A 3BV9B 5T6GA 1ESTA 1GCDA 1O2NA 4I32A 1ARBA 4DG4A 1KXEA 3T25A 2V3OH 3C27B 1WUNH 3U9AH 3M5OA 3O8DA 1JXPA 1MZAA 4AFZA 3EA9A 2ODQA 1V2PT 2Z3EA 3OTJE 3RXCA 1XXFA 2VB0A 2XCNA 3F9FA 1A46H 4A5TS 4K2YA 1NRRH 1BTYA 4JK6A 4H6SB 3AW1A 2BD9A 1E38B 2QA9E 3WY8A 3RXIA 4I33A 1S84A 1UCYH 1AZZA 1C1RA 3RXUA 4MPUA 3S0NA 1C2HA 1G3BA 1T4VH 1D4PB 1TQ7B 5GJ4B 3HPTB 4Q2KA 3VEQB 1DWEH 5EPYA 2OUAA 1C5QA 2Q6FA 4OS4A 4U01A 3P8OA 1GVKB 4AFUA 1DLKB 2BY6X 2PKAB 5EW1H 2UUFB 1UVTH 1X7AC 3F9GA 1S83A 3V13A 3TH2H 3M7UA 4B71A 5LGOA 1O5EH 2KAIA 1A5HA 1F5RA 3SUGA 3V0XA 4ABFA 1RD3B 3E1XB 1GDNA 2XWAA 1HLTH 2FX6A 3S69A 1Z8IB 1T8NA 4Q7XA 4MDSA 4XDEA 1C5VA 3QO6A 3SU5A 1ZMLA 3U8TH 2FDAA 3MMGA 2I6QA 3UFAA 1CHOG 4TY6A 4CRCA 4MNVA 1C2JA 1K1NA 1Z71A 4GCHF 2VWMA 2HNTF 4Y8YA 1GGDB 1IHSH 1O36A 1ZMJA 1Y3VA 1P0SH 2XTTB 3MH6A 1ZTJA 1YF4A 1NM6A 2VWNA 2WYGA 1VCWA 4HFPB 1O3GA 4K8YA 4JCNA 1GBIA 1HRTH 1EOLA 1ESAA 1SLVB 3LJJA 3T29A 2OBQA 2D26C 3BTWE 1PPFE 1UHBB 1JIRA 3UOPA 1CGJE 2BB4A 3TVJB 1LHFH 1AU8A 4X8TH 1QB9A 1UTKA 4UFDH 2GDDA 3MU0A 4K5ZA 4FUDA 1O2XA 4YTAA 4D9QA 1YLDA 2P3UB 4YLQH 1ANEA 3VB5A 3SZNA 3PLPA 4FU7A 1WQSA 3EE0B 3SI3H 1HAVA 2XC5A 3E90B 1O34A 1FY8E 1AY6H 1ZHMA 1ZGIA 1CE5A 5FAHA 1O2OA 2NU2E