5HM9A

Crystal structure of mamo protease domain from magnetospirillum magneticum (apo form)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
189
structure length
189
Chain Sequence
LYHTVPPAVVGVGGGGVNAGPVASGAIVGTNGYVITTLHSVSKLPEISVQVATTGGIRRFPAQVVKTIPGHDLALLKMQTTEKFLHFRMADVQTVVPGQQVFAFGRNMAGAPLVRQGLVQSADAPLAVGATQITHLLRSDAVYSWEQTGGPLVNAQGDLVGINIAATGPTGKVEGFTVPAQVIVSHLQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords MamO protease domain
publication title MamO Is a Repurposed Serine Protease that Promotes Magnetite Biomineralization through Direct Transition Metal Binding in Magnetotactic Bacteria.
pubmed doi rcsb
source organism Magnetospirillum magneticum amb-1
total genus 39
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5hm9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5hm9A01
3A8DA 1FMGA 1FZZA 2FLBH 1BBRE 1FN6A 1O3NA 1ZHPA 3ATIA 2GCTB 3ELAH 1HAPH 4MQAA 2OBQA 2ANMH 4JMYA 1RTFB 1EOJA 2H2ZA 1TRNA 3PMJA 4A1TA 3VXEH 4ABDA 1O2KA 3LPRA 2XTTB 3A7XA 1TNGA 3EA9A 4I8GA 1P9SA 5E0GA 1EOLA 4JZFH 1S84A 4RKOB 1GI8B 1W14U 4K1SA 1G3CA 3SU2A 3SJOA 3KQEA 2BY5X 2ZFFH 3SQEE 2Z94A 1YKTA 1BTZA 5DK1A 2ZHFH 4K1EA 3LC5A 1GJ6A 1GJCB 3VB3A 2RCEA 5J4SA 1F2SE 2A31A 2F83A 5FPSA 1O33A 2QY0B 5EQQA 4B76A 2Y5FA 3FVFB 1GHVH 3SUFA 1H1BA 2XNIA 1TNLA 1IQNA 2WUBA 1QJ6B 1AY6H 3O8BA 1O2WA 4IC6A 4GHTA 1SB1H 1AZZA 4BXWA 3KHVA 1GGDC 3LGIA 1RIWB 1E34B 5EXLA 1DUEA 5IYTA 5EPYA 3ENSB 1J8AA 1P2QA 3T27A 4MDSA 1CQQA 3F1SB 1AWFH 1SR5C 1AN1E 1ZGVA 3BV9B 4NCYA 2BDGA 4BAOB 3DFJA 2WINI 1SVPA 1A1RA 3LU9B 1DWCH 3T29A 1Y5BT 2W7UA 1GI1A 1WSSH 1SPJA 1OS8A 5C1UA 2VJ1A 1LQEA 1A0JA 1F92A 2VIWA 5C5NA 1SGFA 2UUKB 2VH6A 4AFUA 1O36A 2NU3E 1A5HA 2R0KA 3SW2B 1NFUA 3SV8A 1JRTA 1BQYA 1L0ZA 3UWIA 3BEFB 4BAKB 3GYMA 1GBLA 1BITA 2R9PA 1QQUA 1MCVA 1UHBA 4J1YA 1ELAA 3RC6A 2ZI2H 3ZZ6A 2PKAB 3SHCH 1ZSJA 2ZFRH 4R8TB 5EGMA 4O03A 4YLUA 2A2QH 4UFDH 4O97A 1QA0A 1CGHA 1KTSB 4MLFB 1A46H 5A0AE 4LK4A 1A0LA 1ZMJA 4K8BA 2GT7A 1WQVH 1FIWA 2OCVB 3HK3B 3S0NA 1GMHG 2FI3E 1SHHB 3K2UA 1O3IA 2EI6A 3RXBA 2FOHA 1V3XA 1S6FA 2QF3A 5ESTE 1NS3A 1GHZA 1FONA 3PB1E 3RU4E 1YLCA 3RM2H 2AEIH 2GVFA 1GGDB 4YOJA 1T7CA 1HBTH 2HNTC 2PKSC 1HAVB 1EQ9A 2XC0A 1C2FA 3DUXH 1TPSA 4NFEA 3F9EA 3FFGA 1GBMA 1P12E 2BMGB 1GI5A 3SGQE 1JRSA 2OQ5A 3LGUA 4AYVB 3BTEE 1C5XB 1GMCG 1V2ST 3MMGA 1IAUA 1WTHD 1F0RA 3A86A 1C9PA 1HNEE 5LH8A 1TGTA 3M61U 4OS7A 4I31A 3UNRA 3EAJA 3WY8A 3A89A 1KTTB 2SFAA 4ZMAH 1THRH 3FANA 1EB2A 1NZQH 2OUAA 5E0HA 1HUTH 7KMEH 1P05A 1C5NH 2AGIX 4F4OC 1NM6A 7GCHG 5C1YA 3VXFH 3ZVBA 4ABEA 1DXWA 2GCHG 4RSPA 1ANEA 4AG1A 4JYVH 2I6QA 4BTIB 3BIVH 1SLVB 4ABIA 2D26C 1UTQA 1CBWC 3ZVAA 2BLVA 1BT7A 3M3TA 3BG8A 1YP9A 4WJG2 1F0SA 3U8RH 1TIOA 3MU1A 1P0SH 2OTVA 1C9TA 1F0TA 2ZFSA 3KN2A 1ZHRA 1GI0A 5EQSA 2PTNA 1P10A 2FZZA 3A81A 4LXBH 4GUXA 1DOJA 2QC2A 4K2YA 2BOHB 1P01A 2FOGA 1SQOA 5ABWA 4B75A 2GZ8A 3Q3KA 4X1NU 4B74A 3S7KB 5GJ4B 1ESTA 4JYUH 4LZ4B 1GBEA 1A5IA 1CU1A 2XRCA 1QL9A 2VWOA 4ASHA 4A5TS 1YPHE 2A4QA 1WBGB 1NRNH 4AFQA 3A82A 1P2KA 1Q31A 1C2KA 2PKSB 3W94A 1DICA 1ARBA 1FV9A 4Y10E 3LIWA 3RM0H 1O2IA 1KXDA 1FN8A 2F9VA 5C20A 1XUKA 3TNSA 1TQ7B 3VB7A 5EXNA 2BLQA 3ZZ8A 1GHYH 1Z8GA 2VIQA 1TE0A 1UTPA 1PFXC 3LH3A 1EJAA 1ZRKA 1Z1JA 1CE5A 3BTDE 2ZFPH 1GVZA 1Z7KA 5HM9A 1GJ7B 5HMAA 1FPCH 2ZNKH 1C1TA 4ABFA 3MH4A 4GHQA 1BMLA 2ZU1A 4Y7AA 6LPRA 2XBXA 1TPAE 1Q2WA 2SGDE 1PQ7A 3SGAE 2PSYA 1SGPE 2OD3B 2AS9A 4K60A 3QDZB 1NTPA 1H4WA 1QL8A 3P8NA 2GMTC 4NIXA 6ESTA 2Y7XA 3A7ZA 1UCYH 5T6FA 2YNAA 1DDJA 1MKWK 3RC5A 1G36A 3U8TH 1VZQH 1DM4B 3MH5A 2UWLA 5E2PA 1O3CA 3SNBA 2BD4A 1O3PB 1LPKB 2BDIA 1BRUP 2ODQA 1EASA 2ZA5A 4FUIA 4TY6A 5HXFA 1K1JA 3NZIA 1SGQE 5JBBS 1HXFH 2ZGXH 1OWIA 2WYJA 1P2NA 2JETC 1FDPA 1QY6A 1MU8B 3MO3A 4NA7A 1AUTC 1LCYA 3SJ9A 1ELDE 3AW1A 4GCHF 4TPYA 5EXMA 2OP9A 4ABGA 3SBKA 2P3TB 1OKXA 2F9BH 1TGSZ 2ZGBH 5C3NA 3VFEA 1P11E 1UJ1A 3B23B 2NU2E 3BG4C 1P04A 3PMHB 4KGAA 4B71A 4ZHAA 5L30H 1JIRA 8KME2 1Z8RA 3UOUA 1QA7A 1LVOA 1MTWA 4K5ZA 1HDTH 2ZQ1A 2FOEA 1H9LB 1JMOH 1IHSH 3GDUA 5CHAC 4OS2A 1NU9A 1GHBG 1W0YH 1ZJDA 2BZAA 3RLWH 4JZIA 3GCTG 1DSUA 2P3FH 4X2WA 3LGYA 2WPKS 2HPPH 3T28A 2Q6FA 1CA0C 2J38A 5FPYA 2H1UA 3PTNA 5A0BA 3ZZ4A 3AASA 1OPHB 3TITA 4A1VA 1A2CH 1BHXB 4NSYA 5GPIB 1V2KT 4ISLA 1LKBA 2CXVA 3QGJA 3K6ZA 5IDKA 4D7GA 1OWKA 1GHWH 2G4TA 2EA3A 3UNSA 2BM2A 3P95A 1SOTA 1PQ5A 1TBQH 2GMTB 1BHXF 3RLYH 2FOAA 2Q6GA 1C2EA 2BD5A 3E0NB 4BAQB 5A8YA 4ZH8A 2A2XH 5JYIA 4DIIH 1IQGA 1G2LA 2PFEA 4BAHB 1O2UA 2VVVA 3LGTA 5DGJA 3VB4A 4DIHH 1S85A 1OWDA 5F6MA 1SMFE 1HJ8A 2FLRH 4I8LA 1GL0E 3MNCA 4I7YH 3OY5U 1HAIH 1XKBC 3TVJB 2PWXA 3RMNH 2ZWLH 3NPSA 1MKXH 4INLA 2W26A 4Y6DA 1NT1A 2AMQA 1EATA 1BJUA 3V13A 1OWEA 3F9GA 3VB5A 1DY8A 4THNH 3S69A 1JOUB 2JETB 5EQRA 1O2OA 2ZCLP 1V2QT 1MTNB 1VITG 1XMNB 4TYDA 1G3DA 2OC8A 2Z7FE 3ZV8A 3URDA 3BG4B 1NRSH 4DGJA 1RRKA 1LPGB 1TRMA 1BBRH 3H5CB 4UONA 3MOCA 1C4V2 2B7DH 2CJIA 3A8BA 3RMOH 5DJ7A 4FUCA 1O5BB 3RXAA 4YOGA 1GBBA 1MD8A 1YPMH 4K69A 2Z9JA 1Z8IB 4NIYA 2R2WU 2K1QA 2VIOA 3GY6A 2NU4E 1OP8A 2VH0A 1ETRH 2C4FH 4MG3A 1OYTH 1YPHC 5FXLA 3UY9A 3VEQB 5DP4A 1DWBH 1F0UA 3TGIE 4X8TH 1PPEE 1CA0B 2BHGA 2V35A 4UE7H 2R0LA 1V2LT 2WPJS 1OP0A 1GI7B 2TBSA 1XVOA 2Z3EA 4DVAU 5A8ZA 1ZZZA 4LOYH 2W5EA 3UR9A 2C8YB 1A7SA 3CENA 3L6PA 1QQ4A 2THFB 5BPEA 3I78A 2CHAC 4ISNA 3ZZCA 1PYTC 1QFKH 2ODYB 3D62A 1CT2E 4AG2A 2VWNA 3SJIA 4FUGA 1MD7A 1TOMH 2HNTE 1CGJE 3L3TA 1GBDA 4AB8A 1THPB 1SG8B 5EPNA 2BDHA 4WXIA 3B8JA 1AB9C 1W11U 2ZU4A 3A84A 1IQEA 2ZTXA 1J16A 1UTNA 3SV7A 1O3HA 2ZHQH 1UK2A 3URCA 2OC0A 1GJ5H 4UFEH 3TLOA 3UUZA 1AVWA 1EP6A 1ZGIA 2CMYA 4FU9A 4A92A 2FO9A 1ZRBA 1SGRE 5C1XA 1O5CB 1EAXA 2DUCA 4IC5A 4B1TA 3BN9A 3TGKE 1VCQA 3H7TA 1C5ZB 1B0FA 4WXVA 3LDXH 2GV7A 1TLDA 3SUDA 4MNYA 2VWLA 3S9BA 2R2MB 3QZRA 2ANYA 4JK6A 3E3TA 4X1PU 3RXTA 3GY3A 2GP9B 2PSXA 2ALPA 2BX3A 4BAMB 2TGDA 5EOKA 4TWWA 1O2YA 4H6SB 3TJOA 1O2GH 2UUJB 4Y8XA 5GDSH 1W10U 3UPEA 1UTMA 1O5FH 2FIRH 3KNXA 2ULLA 2GV6A 5E0JA 1KSNA 2BZ6H 2BY6X 1CHOG 4IGDA 3NWUA 4X8SH 1SBWA 3ZVGA 3GY8A 3QK1A 2F9OA 1TNKA 2ZKSA 1C5OH 3LC3A 2ZDMA 2IJOB 3OTJE 3SUEA 3PTBA 2VINA 3BTQE 5T6GA 2VGCC 2AGEX 1C1UH 1H9IE 3SNDA 1PPZA 4FU8A 3O8RA 2FOCA 2FYRA 4AGKA 1QRZA 3AW0A 2GZ7A 1GHBF 1YM0A 1UTKA 3FP6E 1GI2A 1TNIA 2WPHS 2FM2A 3RC4A 3ZZ7A 4JK5A 3ITIA 1TRYA 4O9VA 1INCA 1IQLA 1E38B 2CHAB 4ZXYH 2B9LA 2BXUH 3ZZAA 1VCPA 1EAUA 2ZQ2A 1C5QA 6GCHG 1UTJA 1HAHH 1HAYB 2AFQB 1AB9B 1NFWA 3HPTB 4UFFH 2G4UA 3BTFE 1TYNA 1BDAA 1CA8B 3CP7A 1P06A 3AAVA 1BRCE 3Q77A 1TB6H 1DSTA 1XXDA 5FBEA 2OC1A 1AHTH 1TMUH 1SLUB 2Y5GA 4I8KA 1BZXE 1C2LA 3A85A 4A1XA 1SI5H 3TJUA 4DOQA 4CRFA 3VPKA 1PPFE 1PPGE 1T8NA 2PUQH 4D8NA 1O34A 2FEQH 3F9FA 5EW1H 2ZGHA 2A4GA 5HM2A 4XDEA 1O5EH 1GJ8B 1N8OC 1ELTA 1G30B 4INKA 1CGIE 3RXGA 3SV9A 2C90B 1RS0A 3SOSA 3T5FH 3A7WA 1KYNA 1VITF 1PPHE 1RTLA 1SSXA 1KY9A 1WCZA 1C5LH 3MNSA 1K1LA 3N7OA 1ZYOA 3ZZBA 1C1MA 2PR3A 1FY8E 3GY5A 4I8HA 1GMDF 1MBQA 5J4QA 2CF9H 1G37A 1ZJKA 2HOBA 3FP7E 3EE0B 1KXEA 1KDQA 1C5SA 3MU5A 1C2HA 2ODPA 3UFAA 1ZTLA 2O8TA 4SGAE 5C2ZA 2Z9KA 2ZO3H 1QB1A 1SFQB 4PROA 1J9CH 2Z3CA 1T8LA 1WOFA 3H7OA 2WPLS 2BD9A 2XCFA 1WV7H 1Y3YA 2M5TA 2A5KA 3LGWA 1O39A 1S82A 3UWJH 1SGYE 3ZYEA 2ZC9H 3NKKA 1GBCA 1AMHA 3M5NA 2QV1A 3SJ8A 3TH2H 4WH6A 2AGGX 1LHFH 3U1IB 1O3GA 1FAKH 3SZNA 1GI4A 3HATH 1FI8A 4YESB 4OGXA 1MAXA 1B7XB 1ANCA 2YNBA 1AVGH 1U6QA 4NG9H 2PUXB 1C1QA 1NN6A 2QYIA 2RA0A 4NGAH 1AVXA 1X7AC 3ZZ3A 1MMJN 1O35A 4Z6AH 1N8OB 1RD3B 3SJKA 1GBAA 5E2OA 1ELCA 1NESE 1VR1H 3E6PH 3QUMP 1Y5AT 4I32A 3U9AH 1MU6B 4X1QU 1D3PB 2BY8X 3GY2A 1L1JA 2OBOA 3EYDA 1DXPA 1O31A 8GCHG 2XC5A 2BDYA 1V2VT 2W3KA 1RXPA 2D1JA 1JBUH 1BTYA 5DP9A 2I6SA 3RMMH 4ISHH 1F5RA 4Y8ZA 2B0FA 5LPEA 2BX4A 1NC6A 4WMDA 1PQ8A 4ZAEA 1DT2A 1MQ6A 3TJVA 1LHCH 2P59A 3DA9B 3RXLA 2PV9B 3KL6A 4U01A 3HKIB 2OC7A 2QF0A 4NWLA 1GJBB 2ZGCA 5K7RA 3RDZA 1O3JA 1K9OE 2H9TH 5GXPA 2STAE 1L1GA 3KQDA 1O5GH 2O8MA 1VJAU 4XFQA 3MWIU 1DPOA 3E90B 4JZEH 1XUJA 2IPHA 4CRBA 4UD9H 4CHAC 1YPLH 1SGIB 5L2YH 1RGQA 2WV4A 2QXGA 3R3GB 4MPUA 3VB6A 1C2DA 2PW8H 1O2ZA 4ISOA 2VIPA 4H4FA 4DURA 1Y3WA 1P2MA 3M7TA 2XWAA 1GHAG 1ZSLA 2BOKA 3BTGE 1C2GA 3SV2H 1WU1A 2SNVA 1K2I1 1IQHA 5F8XA 4BNRA 2J92A 1O2VA 4NA9H 2FPZA 2XC4A 2AIQA 3E8LA 3UTUH 4H42U 1AI8H 4UFGH 1GBTA 1O2LA 1NRPH 1P3CA 2J95A 4JZ1A 1Y3XA 1WTGH 3RU4D 1D9IA 3MU0A 1Z6JH 1BIOA 1C5YB 3A7VA 2V0BA 3Q00A 1QHRB 1P8VC 3OY6U 3CS7A 1O2TA 3IITA 5DO4H 2HALA 2HNTF 4ZKNU 2ZDKA 3PROA 4X2VA 1ZSKA 2H6MA 3MFJA 3MHWU 2B8OH 2XCNA 1V2WT 2FP7B 3O8CA 4YZUA 4X8UH 1AUJA 1HIAA 1C5MD 1TNHA 3HK6B 4U32A 1TBZH 1TGCA 4FUEA 5FX6A 1ETSH 1SL3A 5FPTA 3EDXB 2SNWA 3RXEA 4M7GA 2FESH 1C2MA 2Y7ZA 4FUFA 3OU0A 4HZHA 1S0QA 4KELA 5GIBA 2HPQH 3UIRA 1O2MA 1MZDA 3M7UA 4Y7BA 1YCPH 2FI4E 1QBVH 1IQKA 1CBWB 3KIDU 2HWLB 3QWCH 1A0HB 5GCHG 3TH4H 2PGQB 1RTKA 1ORFA 1YF4A 3RXKA 4DT7B 1NFYA 3O8DA 2FOBA 3RU4T 1O3OA 1AU8A 2BDCA 4CBNA 2GKVE 2BQWB 3ODDA 1O2JA 2P16A 1UCYK 2Z3DA 3BIUH 1F5KU 2FOFA 1NRQH 2QXHA 1P2JA 1SQAA 4KTCA 5TJXA 2H5DA 1FIZA 1O2QA 4CREA 2TGAA 2CV3A 2G55A 4CHAB 3M3SA 1UMAH 4FU7A 1UVSH 2XXLA 1B5GH 1N1LA 1P02A 4X6PA 4ABAA 2BLWA 1ZLRA 1GMHF 4YOIA 3RXFA 2JH6D 4FXGH 1BTUA 5EG4A 1FLEE 1DVAH 5ESBA 1EB1H 1GJAB 1K1OA 1S5SA 3EQ0H 1HCGA 1GBHA 4WMEA 4AB9A 4MPVA 1WYKA 4I8JA 4NIVA 2YOLA 3ZVDA 1Z71A 3MNBA 1ELEE 1UHBB 4Q7XA 1L4DA 1AKSA 1GCTC 1EKBB 1O2PA 1BMMH 2CF8H 1E0FD 3BF6H 1KDQB 1FJSA 1C5TA 3SV6A 1F7ZA 2BD3A 4BTTB 2FXRA 4O3TA 2KAIA 2NU1E 1SGCA 4KKDA 2A45B 4ISIH 4CH2B 5G4BA 1Q3XA 1GMCF 1V2TT 5FX5A 1K28D 4Z0KA 2SGEE 2BDAA 3I29A 3JZ2B 1VGCC 1D6WA 1LTOA 4JZDH 1C1VH 1UVOA 4ABBA 1C5PA 2FTMA 2UUFB 1V2RT 2SGPE 2J9NA 3ATMA 1ZMNA 4ZHMU 1LQDB 2HGTH 4TY7A 3AVZA 3RXPA 1ZR0A 2OINA 2Z6BD 7GCHF 3PO1C 5FCKA 1SLWB 2EEKA 2GCHF 1MQ5A 1A5GH 1EAWA 4J2YB 1LHGH 1C1PA 5T3HA 3TU7H 3RXHA 1EJMA 2VIVA 2FI5E 1FY3A 5C5OA 2PKAA 3A80A 4IBLH 2H9HA 4ZKOU 1UK3A 1EAIA 2ZPRA 3IG6B 1Z8JB 3HGNA 1EZXC 3GY7A 1MKXK 2LNCA 4E7RG 1SGEE 2J2UA 4YLQH 3SHAH 3SO3A 1ZTKA 1YPEH 2V3HH 3ZV9A 1W2KH 2H9EH 1GDUA 5JBTA 1O32A 1C4U2 3UNQA 2FMJA 3QX5H 4RKJB 1O37A 2GGVB 3RUOA 4GVUA 1UK4A 4DCDA 1SFIA 1HRTH 2BY9X 2G5VA 1Z1IA 2BVSH 1LPZB 4MVNA 5A2MH 1D3DB 2AH4X 1BBRK 4BTUB 4IS5A 2O8UA 4E05H 4B2BA 2F9PA 1PPCE 1ACBE 5K0HA 4X2YA 2P93A 1BB0B 5CHAB 1G3BA 4XBBA 8ESTE 5L2ZH 1GCTB 2ZIQH 1GDQA 4B2CA 2A5IA 3FP8E 1HAVA 1GI3A 1AFEH 2SGAA 1B0EA 3Q3XA 1JWTA 4NZLA 3HKJB 2BD8A 5AFYH 2BVRH 3GOVB 2NWNA 3STJA 1EUFA 1MCTA 2XYAA 2A7CA 2ZG0H 4FUDA 1M9UA 1MTSA 1O3DA 2BXTH 1W0ZU 2A0QB 5AVDA 1GBIA 2AERH 1YC0A 3E16B 3DT0H 1NU7B 3BSQA 3KQBA 2QXJA 3R0FA 1BCUH 1VGCB 1V2MT 2ALVA 4NSVA 1IQMA 3MU8A 2QA9E 3FZDA 1XXFA 1HYLA 4CR5A 3NK8A 5B6OA 3P92A 9LPRA 1TQ0B 1XUIA 1QB6A 3V3MA 1GHXH 4WWYA 4Y79A 3RXSA 3RXOA 1AO5A 1BTXA 3PO1B 1BJVA 4IW4E 1ID5H 3RP2A 1GVKB 3P70B 2WV5A 1CSOE 3E0PB 3F9HA 2F3CE 2RA3A 1SC8U 1VCWA 1O2RA 3TNTA 2A4OA 5A09A 1UO6A 5EU8A 3SNAA 2ZF0H 2D2DA 3NUMA 3DFLA 1YPJH 1LDTT 3KQCA 1E36B 4HI3A 1CT0E 1ESBA 3MNXA 5EODA 3K9XB 1O3KA 1ESAA 3EGKH 4F49A 1GVLA 1AE8H 2FX6A 1O3LA 2V6NA 4U30A 1NFXA 1TPOA 1HB0B 4YT6H 4X0WU 3A8AA 5JDUB 2JKHA 2PGBB 1BRAA 1BTPA 2VU8E 1FQ3A 1J17T 2ZPSA 4MPXA 2FX4A 4AYYB 1O2SA 1G3EA 1L2EA 2AMDA 1RIWC 2SGQE 1TABE 1EX3A 1AIXH 3STIA 1DITH 3Q3YA 1L4ZA 4Q2KA 5JBCS 4BXSA 3M36A 4KTSA 1LHDH 1VJ9U 2GDDA 1YCPM 2B5TB 1YYY1 4ZROA 4DY7B 2VIDA 2CGAA 1KXAA 1D6RA 2BY7X 4VGCC 2QAAA 1FY4A 1AD8H 1UTOA 3Q76A 1O3AA 1IQIA 1QBNA 2XBYA 4R0IA 2F9NA 1XUFA 2C3SA 3P8GA 1W13U 1O2NA 1RJXB 4YM9A 3TH3H 4Q7YA 3MH6A 3ATLA 4MNVA 2FOMB 1OOKB 3P6ZB 3GCTF 1ZPBA 3QTVH 1P03A 1TGNA 9ESTA 2GTBA 1V6DA 2XBWA 1V2NT 2G5NA 1GDNA 5ETXA 3SU5A 3SNEA 1LO6A 2FS9A 4D7FA 3P17H 2CN0H 2IN2A 1ANBA 1SGNE 2QXIA 3PMAB 4A7IB 1WUNH 2EI7A 2LPRA 3BTTE 1H8IH 4AORA 2ZHWH 5GWZA 4D9QA 4D9RA 1HAZB 1O3BA 3ZVEA 1QBOA 1JXPA 1HAGE 3UR6A 2DE8A 4CR9A 1YBWA 2QGRA 3I77A 1O3MA 4B73A 2ZFQH 1QURH 3A8CA 4AOQA 5AF9H 2HLCA 1HJ9A 2C8XB 2ASUB 5PTPA 2O8WA 1O5AB 3FAOA 2QN5T 2R3UA 4CRAA 4RN6A 1AWHB 2UUYA 5DP3A 2F9UA 3T25A 1A4WH 3S9AA 1N6XA 3OSYA 2O9QA 1S6HA 1ABJH 1EXFA 1P09A 4WMFA 4NIWA 4ZKSU 2AYWA 1Y3VA 4ABJA 2ZTYA 1EPTA 4OS6A 3SI4H 1AKSB 2ANWA 3QGNB 1O3EA 4GLYA 5I25A 1CVWH 4INHA 2FDAA 1FUJA 4AN7A 3U1JB 1TFXA 4Y11E 1T4UH 1XUHA 1QIXB 2KAIB 1K1PA 2VVUA 4JYTA 1C5VA 1ZTJA 1W8BH 2ZZUH 4VGCB 4DW2U 2G00A 1XUGA 1TMBH 1TBRH 5BRRE 2Y5HA 3ZYDA 3D65E 2OXSA 4CH8B 3SQHE 2VGCB 1QRXA 1DLKB 4NWKA 1ELVA 3BTKE 1NPMA 4I33A 3T2NA 1J14A 1HLTH 1GL1A 1NY22 2A7JA 2ESTE 3JZ1B 3SORA 1TA2A 2PHBA 4NA8A 1C1WH 4FUJA 5F8ZA 3RXIA 2ZU2A 3TK5A 4OS4A 3PLBA 3E91A 5AFZH 4DJZB 4WY3A 5CE1A 4XBDA 1L1NA 1NO9H 3T62A 3KGPA 4X8VH 4H6TA 1OYQA 1G9IE 3GCHC 5FAHA 3QN7A 1E37B 3RXUA 1SQTA 4X6NA 2O8LA 4NZQA 2W7SA 5DP8A 1T31A 4AFZA 4GCHG 4AFSA 4Q7ZA 1TX8A 1AZ8A 5CMXH 1Y5UT 4K1TA 1DS2E 3TK9A 1FY5A 2ZPQA 2P3UB 2V3OH 3M7QA 7LPRA 1CT4E 2WUCA 3LJOA 4YTAA 1PPBH 3F68H 3LKWA 3KCGH 2EI8A 2EC9H 1HPGA 4ZXXH 1W7XH 1KXCA 1TAWA 1GJ4H 2TPIZ 2G52A 2ZEBA 3PLPA 1C5WB 1ETTH 1V2UT 2XWBI 2Z9LA 3ZZ9A 3MYWA 3W95A 4X1RU 4ZKRU 2ZDLA 2ZDAH 4GAWA 1SGFG 1ANDA 3S7HB 2ZCHP 3QZQA 2GZ9A 1A3BH 1C1SA 1P3EA 1TONA 1VITH 3ATWA 5EW2H 2H5CA 1TMTH 2D8WA 1O3FA 1GBKA 1C2JA 4Y71A 3M5LA 1G2MA 2FTLE 5FHTA 1CHOF 1GBJA 2PTCE 1W3CA 2R3YA 1T4VH 4FVBA 4AGJA 1FY1A 1BTHH 3RXVA 1TPPA 4A6LA 4D76A 4TWYA 2P8OC 3ZZDA 3ZVFA 3LGVA 1QB9A 4FVDA 1S0RA 3F6UH 2A7HA 3MH7A 1BA8B 3RXDA 4UEHH 2BD7A 1SHYA 1DX5M 2ILNA 3GY4A 4ABHA 3V12A 2HVXA 5DG6A 4ZUHA 3V7TA 1LVBA 1OP2A 1MZAA 3ATKA 3RXJA 1FXYA 1DFPA 7ESTE 3GCHB 5DPAA 2G81E 1JIMA 4KP0A 6GCHF 2RG3A 1EJNA 3NXPA 1DUAA 2BLOA 2BD2A 1TGBA 1EPTC 1D4PB 1BTWA 2AIPA 4FUHA 4OS5A 1SGDE 1LKAA 1V2OT 3D23A 5TCCA 3K6YA 4YO9A 3GISB 1FPHH 3GDSA 4KTUA 3SGBE 1PQAA 1QCPA 3M35A 5JB8S 1LVMA 1TOCB 1HXEH 5DP7A 1XX9A 3PV4A 3MU4A 2RDLA 2P95A 3B9FH 3GYLB 2Y80A 1IQFA 2FYQA 1GI6A 3UQOA 4O3UA 5H4IB 1OXGA 5FCRA 1O38A 3M37A 4HTCH 4X6MA 2C93B 4XBCA 8LPRA 3U98H 2BQ7B 3V0XA 1MTUA 3SU0A 2JH0D 5LPFA 3MO6A 4IMZA 4QT8C 1HV7A 1BMAA 2ZP0H 2XBVA 5A8XA 1ELGA 2A5AA 1S81A 1C5UA 2J4IA 2Q1JA 2ZU5A 2Y81A 4X6OA 1F5LA 4XE4A 1K1MA 3MTYA 1A3EH 3PM3A 1K21H 3KF2A 3QLPH 3LT3A 3RXCA 1OWJA 1ZMLA 1QTFA 1G32B 2ANKH 2P8OB 3GICB 3LJJA 2QCYA 1RFNA 1ARCA 4OGYA 4Y0YE 1HAOH 1YCPK 1Y3UA 4K8YA 1BMNH 6CHAC 4GPGA 2Q6DA 3OYPA 3ESTA 1NRRH 1P2OA 2ZGJA 1GG6C 1C4Y2 4MNXA 1AE5A 2TGPZ 3SNCA 1IHTH 2C8WB 2BDBA 3SU6A 1CHGA 2NU0E 4GSOA 3U8OH 4Y0ZE 1GI9B 1C1RA 3RXRA 1HAXB 2VB0A 5A0CA 4JCNA 1MKWH 5HYOA 1KXBA 1FAXA 4XSKU 1MUEB 3QO6A 2VWMA 4IN2A 1UTLM 1QRWA 2WYGA 4X1SU 1P57B 1QR3E 1T8OA 1QJ7B 3GCNA 1XKAC 3A7YA 1OX1A 1AFQC 1EZSC 4K3JA 1EPTB 2FODA 3BTME 5AHGH 2ZDNA 1C1OA 1KLIH 2BB4A 3A87A 1W12U 1ZPCA 1O2HA 1HGTH 1HJAC 2ZHEH 4CBOA 1ZOMA 4WF8A 5DKMA 1MTNC 4OS1A 3EA8A 4DG4A 2OLGA 5JBAS 1TWXB 2STBE 2J94A 4CRGA 4BANB 1TX6A 1LHEH 1EZQA 3U69H 1BUIA 1TX7A 5T6DA 4Y8YA 2A32A 5C67A 3DD2H 1K1NA 3BEIB 2XW9A 1V2JT 1QGFA 1PYTD 3D49H 5SGAE 2VVCA 1GPZA 4IN1A 3HGPA 3SU3A 3PWCA 1C2IA 5E8EH 8GCHF 2ZCKP 3SU4A 1O5DH 2HRVA 1TALA 3K65B 1V2PT 3SI3H 1T32A 2ZU3A 1AQ7A 1J15A 1GWAA 4YT7H 3RXMA 2G8TA 3SN8A 1A61H 2ZFTA 4E06H 6CHAB 3TK6A 3T26A 1GG6B 3S9CA 4ESTE 1MBMA 1THSH 2Z9IA 1CO7E 2BYAX 3TPIZ 2ZECA 4U2WA 2GX4A 3LOXA 1O2XA 2WPMS 1WQSA 1QL7A 2P94A 3SUGA 4WVPE 2GT8A 4CRCA 3ZZ5A 3TGJE 3A7TA 1K1IA 3MO9A 3PMBB 2ZTZA 4IMQA 3TJNA 3VGCC 1MTVA 3IWMA 1DE7H 1ELBA 1ZHMA 1QJ1B 1KLTA 1AFQB 2FWWA 1ABIH 1WAYB 1W7GH 5TCAA 2Y82A 1MH0A 1Y8TA 5LPRA 2GDEH 1PJPA 3DHKH 2A1DB 4MPWA 1BRBE 3ZVCA 3C27B 1MAYA 1O30A 1HJAB 5I46H 3FZZA 1KLJH 1P9UA 1UVTH 1UCYE 5F03A 3QTOH 2JH5D 1GHAF 3LH1A 5JPMH 1E35B 1D3QB 3UOPA 5F8TA 5HGGA 2W3IA 4Y76A 3TIUA 2G51A 3LONA 1SGTA 1UVUH 4X2XA 3P8FA 5L6NH 5DP5A 1GMDG 1LMWB 1NROH 1SOZA 4ZHLU 3C1KA 1IOEA 1ZPZA 1DANH 2BQ6B 1YGCH 4NFFA 3GDVA 3KEEA 1O0DH 4HFPB 2DE9A 1XM1A 2TGTA 3AAUA 1FNIA 4CRDA 2GCTC 3A83A 5FBIA 2QIQA 1C5RA 2UWPA 3M5MA 1Z6EA 1YPGH 3PYHA 1TNJA 2Y6TA 3M3VA 1IQJA 3UQVA 2C8ZB 2WPIS 4HGCA 2BTCE 3RMLH 4AX9H 1D3TB 2A4RA 1DY9A 3SU1A 3EA7A 1DLEA 3MI4A 4XOJA 2SGFE 5GCHF 3BTWE 1QNJA 4MNWA 1H8DH 3OX7U 1UVPA 1EZUC 1HFDA 4MTBA 3VGCB 1YLDA 4BOHA 1K22H 1P2IA 4E7NA 1H9HE 1C1NA 3L33A 3CS0A 1ELFA 2OQUA 1BOQA 2PLXA 1KXFA 1XVMA 1LVYA 4B2AA 2IOTA 1YPKH 4UDWH 3ODFA 2ZDVH 1Y59T 4WH8A 5LGOA 3PWBA 1GJ9B 1HIAB 2TRMA 3P8OA 4LZ1H 3G01A 2GD4B 3GCOA 2FS8A 4Q80A 1OSSA 2F91A 1SLXB 3RXQA 1OWHA 1GCDA 1DWDH 2BVXH 3BTHE 3PLKA 1GJDB 1AGJA 2VNTA 1DWEH 1N6YA 5JB9S 3NCLA 1KIGH 2J34A 2ZHDA 1EP5A 1S83A 2AMPA 2TIOA 2Z9GA 3A88A 3E1XB 3UREA 4AZ2B 1GBFA 4TPIZ 3BEUA 4FUBA 3M5OA 1TA6A 5DP6A 4SGBE 2UWOA 1T8MA
chains in the Genus database with same CATH superfamily
3A8DA 1FMGA 1FZZA 2J97A 2FLBH 1W0KD 1BBRE 1FN6A 1O3NA 1ZHPA 2WPDD 2GCTB 3ATIA 3ELAH 1HAPH 4MQAA 2OBQA 2ANMH 4JMYA 1RTFB 1EOJA 2KR7A 2H2ZA 1TRNA 3PMJA 4A1TA 3VXEH 4ABDA 1O2KA 3LPRA 2XTTB 3A7XA 1TNGA 3EA9A 4I8GA 2VBCA 1P9SA 5E0GA 1EOLA 4JZFH 1S84A 4RKOB 1GI8B 1W14U 4K1SA 1G3CA 3SU2A 3SJOA 3KQEA 2BY5X 2ZFFH 3SQEE 2Z94A 1YKTA 1BTZA 5DK1A 2ZHFH 2KCYA 4K1EA 3LC5A 1GJ6A 1GJCB 3VB3A 2RCEA 5J4SA 1F2SE 2A31A 2F83A 3SYJA 5FPSA 1O33A 2QY0B 5EQQA 4B76A 2Y5FA 3FVFB 1GHVH 3SUFA 1H1BA 3UB0A 2XNIA 1TNLA 2GJGA 1IQNA 2WUBA 1QJ6B 1AY6H 3O8BA 1O2WA 4IC6A 4GHTA 1SB1H 1AZZA 4BXWA 3KHVA 1GGDC 3LGIA 1RIWB 1E34B 3PRDA 5EXLA 1DUEA 5IYTA 5EPYA 3ENSB 1J8AA 1P2QA 3T27A 4F48B 4MDSA 1CQQA 3F1SB 1AWFH 1QZ8A 1SR5C 1AN1E 1ZGVA 3BV9B 4NCYA 2BDGA 4BAOB 3DFJA 2WINI 1SVPA 1A1RA 3LU9B 1DWCH 3T29A 1Y5BT 2W7UA 1GI1A 1WSSH 1SPJA 1OS8A 5C1UA 2VJ1A 1LQEA 1A0JA 1F92A 2VIWA 5C5NA 1SGFA 2UUKB 1SKYE 2VH6A 4AFUA 1O36A 2NU3E 1A5HA 2R0KA 3SW2B 1NFUA 3SV8A 1JRTA 1BQYA 1L0ZA 3UWIA 3BEFB 4BAKB 3GYMA 1GBLA 1BITA 2R9PA 1QQUA 1MCVA 1UHBA 4J1YA 1BMFD 1ELAA 2LELA 4XD7D 3RC6A 2ZI2H 3ZZ6A 2PKAB 3SHCH 1ZSJA 2ZFRH 4R8TB 5EGMA 4O03A 4YLUA 2A2QH 4UFDH 4O97A 1QA0A 1CGHA 1KTSB 4MLFB 1A46H 5A0AE 4LK4A 3KYGA 1A0LA 1ZMJA 4K8BA 2GT7A 1WQVH 2KZ4A 1FIWA 2OCVB 3HK3B 3S0NA 1GMHG 2FI3E 1SHHB 3K2UA 1O3IA 2EI6A 3RXBA 2FOHA 1V3XA 1S6FA 2QF3A 5ESTE 1NS3A 1GHZA 1FONA 3PB1E 3RU4E 1YLCA 3RM2H 2AEIH 2GVFA 1GGDB 4YOJA 1T7CA 1HBTH 2HNTC 2PKSC 3OE7D 1HAVB 1EQ9A 2XC0A 1C2FA 3DUXH 1TPSA 4NFEA 3F9EA 3FFGA 1GBMA 1P12E 2BMGB 1GI5A 1KMHB 3SGQE 1JRSA 2OQ5A 3LGUA 4AYVB 3BTEE 1C5XB 1GMCG 1V2ST 3MMGA 1IAUA 1WTHD 1F0RA 3A86A 1C9PA 1HNEE 5LH8A 1TGTA 3M61U 4B6FA 4OS7A 4I31A 3UNRA 3EAJA 3WY8A 3A89A 1KTTB 2SFAA 4ZMAH 1THRH 3FANA 1EB2A 1YY3A 1NZQH 2OUAA 5E0HA 3MQKC 1HUTH 7KMEH 1P05A 1C5NH 2AGIX 4F4OC 1NM6A 7GCHG 5C1YA 3VXFH 3ZVBA 4ABEA 1DXWA 2GCHG 4RSPA 1ANEA 4AG1A 4JYVH 2I6QA 4BTIB 3BIVH 1SLVB 4ABIA 2D26C 1UTQA 1CBWC 3ZVAA 2BLVA 4RT0A 1BT7A 3M3TA 3BG8A 1YP9A 4WJG2 1F0SA 3U8RH 1TIOA 3MU1A 1P0SH 2OTVA 1C9TA 1F0TA 2ZFSA 2JJ1D 2WV9A 3KN2A 2K0QA 1ZHRA 1GI0A 5EQSA 2PTNA 1P10A 2FZZA 3A81A 4LXBH 4GUXA 1DOJA 5HKKD 2QC2A 5C0UA 4K2YA 5EJZA 2BOHB 1P01A 2FOGA 1SQOA 5ABWA 4B75A 2EQNA 2GZ8A 3Q3KA 4X1NU 4B74A 3S7KB 5GJ4B 1ESTA 4JYUH 4LZ4B 1GBEA 1A5IA 1CU1A 2XRCA 1QL9A 2VWOA 4ASHA 4A5TS 1YPHE 2A4QA 1WBGB 1NRNH 4AFQA 3A82A 1P2KA 1Q31A 1C2KA 3CNRA 2PKSB 3W94A 1DICA 1ARBA 1FV9A 4Y10E 3LIWA 3RM0H 2WZQA 1O2IA 1KXDA 1FN8A 2F9VA 2WHXA 5C20A 1XUKA 3TNSA 1WDIA 1TQ7B 3VB7A 5EXNA 3W1EA 2BLQA 3ZZ8A 1GHYH 1Z8GA 2VIQA 1TE0A 1UTPA 1PFXC 3LH3A 1EJAA 1ZRKA 1Z1JA 1CE5A 3BTDE 3DSGA 2ZFPH 3UAIC 1GVZA 1Z7KA 5HM9A 1GJ7B 5HMAA 1FPCH 2ZNKH 1C1TA 4ABFA 3MH4A 4GHQA 1BMLA 2ZU1A 4Y7AA 6LPRA 2XBXA 1TPAE 1Q2WA 2SGDE 1PQ7A 3SGAE 5HIYA 2PSYA 1SGPE 2OD3B 2AS9A 4K60A 3QDZB 1NTPA 1H4WA 1QL8A 3P8NA 2GMTC 4NIXA 6ESTA 2Y7XA 3OEHD 3A7ZA 1UCYH 5T6FA 2YNAA 1DDJA 1MKWK 3RC5A 1G36A 3U8TH 1NBMD 1VZQH 1DM4B 3MH5A 2UWLA 5E2PA 1O3CA 3SNBA 2BD4A 1O3PB 1LPKB 2BDIA 1BRUP 2ODQA 1EASA 2ZA5A 4FUIA 4TY6A 5HXFA 1K1JA 3NZIA 1SGQE 5JBBS 1HXFH 2ZGXH 1OWIA 2WYJA 1P2NA 2JETC 1FDPA 1QY6A 1MU8B 3MO3A 4NA7A 1AUTC 1LCYA 2KCPA 3SJ9A 1ELDE 3AW1A 4GCHF 4TPYA 5EXMA 2OP9A 4ABGA 3SBKA 2P3TB 4ACBA 1OKXA 2F9BH 1TGSZ 2ZGBH 5C3NA 3VFEA 1P11E 1UJ1A 3B23B 2NU2E 3BG4C 1P04A 3PMHB 4KGAA 4B71A 4ZHAA 1W0JD 5L30H 1JIRA 8KME2 4P02A 1Z8RA 3UOUA 1QA7A 1LVOA 1MTWA 4K5ZA 1HDTH 3PRBA 2ZQ1A 2FOEA 1H9LB 1JMOH 1IHSH 3GDUA 5CHAC 4OS2A 1NU9A 2XNDD 1GHBG 1W0YH 1ZJDA 2BZAA 3RLWH 4JZIA 3GCTG 1DSUA 2P3FH 4X2WA 3LGYA 2WPKS 2HPPH 3T28A 2Q6FA 1CA0C 2J38A 5FPYA 2H1UA 3PTNA 5A0BA 3ZZ4A 3AASA 1OPHB 3TITA 4A1VA 1A2CH 1BHXB 4NSYA 5GPIB 1V2KT 4ISLA 2JDID 1LKBA 2CXVA 3QGJA 3F0PA 3K6ZA 5IDKA 3N7EA 4D7GA 1OWKA 5C94A 1GHWH 2G4TA 2EA3A 3UNSA 2BM2A 3P95A 1SOTA 1PQ5A 1TBQH 2GMTB 1BHXF 3RLYH 2FOAA 2Q6GA 4HG6A 1C2EA 2BD5A 3E0NB 4BAQB 5A8YA 4ZH8A 2A2XH 5JYIA 4DIIH 1IQGA 1G2LA 2PFEA 4BAHB 1O2UA 2VVVA 3LGTA 5DGJA 3VB4A 4DIHH 1S85A 1OWDA 5F6MA 1SMFE 1HJ8A 2FLRH 4I8LA 1GL0E 3MNCA 4I7YH 3OY5U 1HAIH 1XKBC 3TVJB 2PWXA 3RMNH 2ZWLH 3NPSA 1MKXH 4INLA 2W26A 4Y6DA 1NT1A 2AMQA 1EATA 1BJUA 3V13A 1OWEA 3F9GA 3VB5A 1DY8A 4THNH 3S69A 1JOUB 2JETB 5EQRA 1O2OA 2ZCLP 1V2QT 1MTNB 1VITG 1XMNB 2QF5A 4TYDA 1G3DA 2OC8A 2Z7FE 3ZV8A 3URDA 3BG4B 1NRSH 4DGJA 1RRKA 1LPGB 1TRMA 1BBRH 3H5CB 4UONA 3MOCA 1C4V2 2B7DH 2CJIA 3A8BA 2KX4A 3RMOH 5DJ7A 4FUCA 1O5BB 3RXAA 4YOGA 1GBBA 1MD8A 1YPMH 4K69A 2Z9JA 1Z8IB 2WSSD 4NIYA 2R2WU 2K1QA 2VIOA 3GY6A 2NU4E 1OP8A 2VH0A 1ETRH 2C4FH 4MG3A 1OYTH 1YPHC 5FXLA 3UY9A 3VEQB 4M9FA 5DP4A 1DWBH 2KCOA 1F0UA 3TGIE 2KCAA 4X8TH 1PPEE 1CA0B 2BHGA 2V35A 4UE7H 2R0LA 1V2LT 2WPJS 1OP0A 1GI7B 2TBSA 1XVOA 2Z3EA 4DVAU 5A8ZA 1ZZZA 4LOYH 2W5EA 3UR9A 5C0TA 2C8YB 5FL7D 1A7SA 3CENA 3L6PA 1QQ4A 2THFB 5BPEA 3I78A 2CHAC 4ISNA 3ZZCA 1PYTC 1QFKH 2ODYB 5DN6D 3D62A 1CT2E 4AG2A 2VWNA 3SJIA 4FOUC 4FUGA 1MD7A 1TOMH 2HNTE 1CGJE 3L3TA 1GBDA 4AB8A 1THPB 1SG8B 5EPNA 2BDHA 4WXIA 3B8JA 1AB9C 1W11U 2ZU4A 3U28C 2KM0A 3A84A 1IQEA 2ZTXA 1J16A 1UTNA 3SV7A 1O3HA 2ZHQH 1UK2A 3URCA 2OC0A 1GJ5H 4UFEH 3TLOA 3UUZA 1AVWA 1EP6A 1ZGIA 2CMYA 4FU9A 4A92A 2FO9A 1ZRBA 1SGRE 5C1XA 1O5CB 1EAXA 2DUCA 4IC5A 4B1TA 3BN9A 3TGKE 1VCQA 3H7TA 4TSFD 1C5ZB 1B0FA 4WXVA 3LDXH 2GV7A 1TLDA 5C17A 3SUDA 4MNYA 2VWLA 3S9BA 2R2MB 3QZRA 2ANYA 4JK6A 3E3TA 4X1PU 3RXTA 3GY3A 2GP9B 2PSXA 2ALPA 2BX3A 4BAMB 2TGDA 5EOKA 4TWWA 1O2YA 4H6SB 3TJOA 1O2GH 2UUJB 4Y8XA 5GDSH 1W10U 3UPEA 1UTMA 1O5FH 2FIRH 3KNXA 2ULLA 2GV6A 1E1QD 1EFRD 5E0JA 1KSNA 2BZ6H 2BY6X 1CHOG 4IGDA 3NWUA 4X8SH 1SBWA 3ZVGA 3GY8A 3QK1A 2F9OA 1TNKA 2ZKSA 1C5OH 3LC3A 2ZDMA 2IJOB 3OTJE 3SUEA 3PTBA 2VINA 3BTQE 5T6GA 2VGCC 2AGEX 1C1UH 1H9IE 3SNDA 1PPZA 4FU8A 3O8RA 3N99A 2FOCA 2FYRA 4AGKA 1QRZA 3AW0A 2GZ7A 1GHBF 1YM0A 1UTKA 3FP6E 1GI2A 1TNIA 2WPHS 2FM2A 3RC4A 3ZZ7A 4JK5A 3ITIA 1TRYA 4O9VA 1INCA 2PP6A 1IQLA 1E38B 2CHAB 4ZXYH 2B9LA 3H09A 2BXUH 3ZZAA 1VCPA 1EAUA 2ZQ2A 1C5QA 6GCHG 4RI0A 1UTJA 1HAHH 3F2GA 1HAYB 2AFQB 1AB9B 1NFWA 3HPTB 4UFFH 2G4UA 3BTFE 1TYNA 1BDAA 1CA8B 3CP7A 1P06A 3AAVA 1BRCE 3Q77A 1TB6H 1DSTA 1XXDA 5FBEA 2OC1A 1AHTH 1TMUH 1SLUB 2Y5GA 4I8KA 1BZXE 1C2LA 3A85A 4A1XA 1SI5H 3TJUA 4DOQA 4CRFA 3VPKA 1PPFE 1PPGE 1T8NA 2PUQH 4D8NA 1O34A 2FEQH 3F9FA 5EW1H 2ZGHA 2A4GA 5HM2A 4XDEA 1O5EH 1GJ8B 1N8OC 1ELTA 1G30B 4INKA 1CGIE 3RXGA 3SV9A 2C90B 1RS0A 3SOSA 3T5FH 3A7WA 1KYNA 1VITF 1PPHE 1RTLA 1SSXA 1KY9A 1WCZA 1C5LH 3MNSA 1K1LA 3N7OA 1ZYOA 3F2FA 3ZZBA 5B6LA 1C1MA 2PR3A 1FY8E 3GY5A 4I8HA 1GMDF 1MBQA 5J4QA 2CF9H 1G37A 1ZJKA 2HOBA 3FP7E 2W6JD 3EE0B 1KXEA 1KDQA 1YLNA 4Q4LA 1C5SA 3MU5A 1C2HA 2ODPA 3UFAA 1ZTLA 2O8TA 4SGAE 5C2ZA 2Z9KA 3AK5A 2ZO3H 1QB1A 1SFQB 4PROA 1J9CH 2Z3CA 1T8LA 1WOFA 3H7OA 2WPLS 2BD9A 2XCFA 1WV7H 1Y3YA 2M5TA 2A5KA 3LGWA 1O39A 1S82A 3UWJH 1SGYE 3ZYEA 2ZC9H 3NKKA 1GBCA 1AMHA 3M5NA 2QV1A 3SJ8A 3TH2H 2JIZD 4WH6A 2AGGX 1LHFH 3U1IB 1O3GA 1FAKH 3SZNA 1GI4A 3HATH 1FI8A 4YESB 4OGXA 1MAXA 1B7XB 1ANCA 2YNBA 1AVGH 1U6QA 4NG9H 2PUXB 4OM9A 1C1QA 1NN6A 2QYIA 2RA0A 4NGAH 1AVXA 1X7AC 3ZZ3A 1MMJN 1O35A 4Z6AH 3DSOA 1N8OB 1RD3B 3SJKA 1GBAA 5E2OA 4TT3D 1ELCA 1NESE 1VR1H 3E6PH 3QUMP 1Y5AT 4I32A 3U9AH 4B6EA 1MU6B 4YXWD 4X1QU 1D3PB 2BY8X 3GY2A 1L1JA 2OBOA 3EYDA 1DXPA 1O31A 8GCHG 2XC5A 2BDYA 1V2VT 2W3KA 1RXPA 2D1JA 1JBUH 1BTYA 5DP9A 2I6SA 3RMMH 4ISHH 1F5RA 2V7QD 4Y8ZA 2B0FA 5LPEA 2BX4A 1NC6A 4WMDA 1PQ8A 4ZAEA 1DT2A 3NRLA 1MQ6A 3TJVA 2J98B 1LHCH 2P59A 4F55A 3DA9B 3RXLA 2PV9B 3KL6A 4U01A 3HKIB 2OC7A 2QF0A 4NWLA 1GJBB 2ZGCA 5K7RA 3RDZA 1O3JA 1K9OE 3N7DA 2H9TH 5GXPA 2STAE 1L1GA 3PV2A 3KQDA 1O5GH 2O8MA 1VJAU 2HVYB 4XFQA 3MWIU 1DPOA 3E90B 4JZEH 1XUJA 2IPHA 4CRBA 4UD9H 4CHAC 1YPLH 1SGIB 5L2YH 1RGQA 2WV4A 2QXGA 3R3GB 2YMSD 4MPUA 3VB6A 1C2DA 2PW8H 1O2ZA 1COWD 4ISOA 2VIPA 4H4FA 2HLDD 4DURA 1Y3WA 1P2MA 3M7TA 2XWAA 1GHAG 1ZSLA 2BOKA 3BTGE 1C2GA 3SV2H 1WU1A 2SNVA 1K2I1 1IQHA 5F8XA 4BNRA 2J92A 1O2VA 4NA9H 2FPZA 2XC4A 2AIQA 3E8LA 3UTUH 4H42U 1AI8H 4UFGH 1GBTA 1O2LA 1NRPH 1P3CA 2J95A 4JZ1A 1Y3XA 1WTGH 3RU4D 1D9IA 3MU0A 1Z6JH 1BIOA 1C5YB 3A7VA 2V0BA 3Q00A 1QHRB 1P8VC 3OY6U 3CS7A 1O2TA 3IITA 2IPQX 5DO4H 2HALA 4XRNA 2HNTF 4ZKNU 2ZDKA 3PROA 4X2VA 1ZSKA 2H6MA 3MFJA 3MHWU 2B8OH 2XCNA 1V2WT 2FP7B 3O8CA 4YZUA 4X8UH 1AUJA 1HIAA 2LP6A 1C5MD 2QE7D 1TNHA 3HK6B 4U32A 1TBZH 1TGCA 4FUEA 5FX6A 1ETSH 1SL3A 5FPTA 3EDXB 2SNWA 3RXEA 4M7GA 2FESH 1MABB 1C2MA 2Y7ZA 4FUFA 3OU0A 4HZHA 1S0QA 4KELA 5GIBA 2HPQH 3UIRA 1O2MA 1MZDA 3M7UA 4Y7BA 1YCPH 2FI4E 1QBVH 1IQKA 2AHME 1CBWB 3KIDU 2HWLB 3QWCH 1A0HB 5GCHG 3TH4H 2PGQB 1RTKA 1ORFA 1YF4A 3RXKA 4DT7B 1NFYA 3O8DA 2FOBA 3RU4T 1O3OA 1AU8A 2BDCA 4CBNA 2GKVE 2BQWB 3ODDA 1O2JA 2P16A 1UCYK 2Z3DA 3BIUH 1F5KU 2FOFA 1NRQH 2QXHA 1P2JA 1SQAA 4KTCA 5TJXA 2H5DA 3F0OA 1FIZA 1O2QA 4CREA 2TGAA 2CV3A 2G55A 4CHAB 3M3SA 1UMAH 4FU7A 3WW7A 1FX0B 1UVSH 2XXLA 1B5GH 1N1LA 1P02A 4X6PA 4ABAA 2BLWA 1ZLRA 1GMHF 4YOIA 3RXFA 2JH6D 4FXGH 1BTUA 5EG4A 1FLEE 1DVAH 5ESBA 1EB1H 4I86A 3FN8A 1GJAB 1K1OA 1S5SA 3EQ0H 1HCGA 1GBHA 4WMEA 4AB9A 4MPVA 1WYKA 4I8JA 4NIVA 2YOLA 3ZVDA 1Z71A 3MNBA 1ELEE 1UHBB 4Q7XA 1L4DA 1AKSA 1GCTC 1EKBB 1O2PA 1BMMH 2CF8H 1E0FD 3BF6H 1KDQB 1FJSA 1C5TA 3SV6A 1F7ZA 2BD3A 4BTTB 2FXRA 4O3TA 2KAIA 2NU1E 1SGCA 4KKDA 2A45B 4ISIH 4CH2B 5G4BA 1Q3XA 1GMCF 3F2HA 1V2TT 5FX5A 1K28D 4Z0KA 3DCLA 2SGEE 2XOKD 2BDAA 3I29A 3JZ2B 1VGCC 3F3BA 2RFKC 1D6WA 1LTOA 4JZDH 1C1VH 1UVOA 4ABBA 1C5PA 2FTMA 2UUFB 1V2RT 2SGPE 2J9NA 3ATMA 1ZMNA 4ZHMU 1LQDB 2HGTH 4TY7A 1OHHD 3AVZA 3RXPA 1ZR0A 2OINA 2Z6BD 7GCHF 3PO1C 5FCKA 1SLWB 2EEKA 2GCHF 1MQ5A 1A5GH 1EAWA 4J2YB 1LHGH 1C1PA 5T3HA 3TU7H 3RXHA 1EJMA 2VIVA 2FI5E 1FY3A 5C5OA 2PKAA 5EIYA 3A80A 4IBLH 2H9HA 4ZKOU 1UK3A 1EAIA 2ZPRA 3IG6B 1Z8JB 3HGNA 2CK3D 1EZXC 3GY7A 1MKXK 2JJ2D 2LNCA 4E7RG 1SGEE 2J2UA 4YLQH 3SHAH 3SO3A 1ZTKA 1YPEH 2V3HH 3ZV9A 1W2KH 2H9EH 1GDUA 5JBTA 1O32A 1C4U2 3UNQA 2FMJA 3QX5H 4RKJB 1O37A 2GGVB 3RUOA 4GVUA 1UK4A 4DCDA 1SFIA 1HRTH 2BY9X 2G5VA 1Z1IA 2BVSH 1LPZB 4MVNA 5A2MH 1D3DB 2AH4X 1BBRK 4BTUB 4IS5A 2O8UA 4E05H 4B2BA 2F9PA 1PPCE 1ACBE 5K0HA 4X2YA 2P93A 1BB0B 3OEED 5CHAB 1G3BA 4XBBA 8ESTE 5L2ZH 1GCTB 2ZIQH 1GDQA 4B2CA 2A5IA 3FP8E 1HAVA 1GI3A 1AFEH 2SGAA 1B0EA 3Q3XA 1JWTA 4NZLA 3HKJB 2BD8A 5AFYH 2BVRH 3GOVB 2NWNA 3STJA 1H8ED 1EUFA 1MCTA 2XYAA 2A7CA 5T1VA 2ZG0H 4FUDA 1M9UA 4RT1A 1MTSA 1O3DA 2BXTH 1W0ZU 2A0QB 5AVDA 1GBIA 2AERH 1YC0A 3E16B 3DT0H 4FETA 1NU7B 3BSQA 3KQBA 2QXJA 3R0FA 1BCUH 1VGCB 1V2MT 2ALVA 4NSVA 1IQMA 3MU8A 2QA9E 3FZDA 1XXFA 1HYLA 4CR5A 3NK8A 5B6OA 2M2AA 5CHBA 3P92A 9LPRA 4Z1MD 1TQ0B 1XUIA 1QB6A 3V3MA 1GHXH 4WWYA 4Y79A 3RXSA 3RXOA 1AO5A 1BTXA 3PO1B 1BJVA 4IW4E 1ID5H 3RP2A 1GVKB 3P70B 2WV5A 1CSOE 3E0PB 3F9HA 2F3CE 2RA3A 1SC8U 1VCWA 1O2RA 3TNTA 2A4OA 5A09A 1UO6A 1UW7A 5EU8A 3SNAA 2ZF0H 5KEDA 2D2DA 3NUMA 3DFLA 1YPJH 1LDTT 3KQCA 1E36B 4HI3A 1CT0E 1ESBA 3MNXA 5EODA 3K9XB 1O3KA 1ESAA 3EGKH 4F49A 1GVLA 1AE8H 2FX6A 1O3LA 2V6NA 4U30A 1NFXA 1TPOA 1HB0B 4YT6H 4X0WU 3A8AA 5JDUB 2JKHA 2PGBB 1BRAA 1BTPA 2VU8E 1FQ3A 1J17T 2ZPSA 4MPXA 2FX4A 3OAAD 4AYYB 1O2SA 1G3EA 1L2EA 2AMDA 1RIWC 2SGQE 1TABE 1EX3A 1AIXH 3STIA 1DITH 3Q3YA 1L4ZA 4Q2KA 5JBCS 4BXSA 3M36A 4KTSA 1LHDH 1VJ9U 2GDDA 4DT4A 1YCPM 2B5TB 1YYY1 4ZROA 4DY7B 2VIDA 2CGAA 1KXAA 1D6RA 2BY7X 4VGCC 2QAAA 1FY4A 1AD8H 1UTOA 3Q76A 1O3AA 1IQIA 1QBNA 2XBYA 4R0IA 2F9NA 1XUFA 2C3SA 3P8GA 3DSPA 1W13U 1O2NA 1RJXB 4YM9A 3TH3H 4Q7YA 3MH6A 3ATLA 4MNVA 2FOMB 1OOKB 3P6ZB 3GCTF 1ZPBA 3QTVH 1P03A 1TGNA 9ESTA 2GTBA 1V6DA 2XBWA 1V2NT 2G5NA 1GDNA 1SQRA 5ETXA 3SU5A 3SNEA 1LO6A 2FS9A 4D7FA 3P17H 2CN0H 2IN2A 1ANBA 1SGNE 2QXIA 3PMAB 4A7IB 1WUNH 2EI7A 2LPRA 3BTTE 1H8IH 4AORA 2ZHWH 5GWZA 2F4LA 4D9QA 4D9RA 1HAZB 1O3BA 3ZVEA 1QBOA 1JXPA 1HAGE 3UR6A 2DE8A 4CR9A 1YBWA 2QGRA 3I77A 1O3MA 4B73A 2ZFQH 1QURH 3A8CA 4AOQA 5AF9H 2HLCA 1HJ9A 2C8XB 2ASUB 5PTPA 2O8WA 1O5AB 3FAOA 2QN5T 2R3UA 4CRAA 4RN6A 1AWHB 2UUYA 5DP3A 2F9UA 3T25A 1A4WH 3S9AA 1N6XA 3OSYA 3EE7A 2O9QA 1S6HA 1ABJH 1EXFA 1P09A 4WMFA 4NIWA 4ZKSU 2AYWA 1Y3VA 4ABJA 2ZTYA 1EPTA 4OS6A 3SI4H 1AKSB 2ANWA 5CDFE 3QGNB 1O3EA 4GLYA 5I25A 1CVWH 4INHA 2FDAA 1FUJA 4AN7A 3U1JB 1TFXA 4Y11E 1T4UH 1XUHA 1QIXB 2EY4C 1K1PA 2KAIB 2VVUA 4JYTA 4P00A 1C5VA 1ZTJA 1W8BH 2ZZUH 4VGCB 4DW2U 5GNDA 2G00A 1XUGA 1TMBH 1TBRH 5BRRE 2Y5HA 3ZYDA 3D65E 2OXSA 4CH8B 3SQHE 2VGCB 1QRXA 1DLKB 4NWKA 1ELVA 3BTKE 3WWFA 1NPMA 4I33A 3T2NA 1J14A 4AC9A 1HLTH 1GL1A 1NY22 2A7JA 2ESTE 3JZ1B 3SORA 1TA2A 2PHBA 4NA8A 1C1WH 4FUJA 5F8ZA 3RXIA 2ZU2A 3TK5A 4OS4A 3PLBA 3E91A 5AFZH 4DJZB 4WY3A 5CE1A 4XBDA 3ZIAD 1L1NA 1NO9H 1H8HD 3T62A 3KGPA 4X8VH 2W6ID 4H6TA 1OYQA 4Q63A 1G9IE 3GCHC 5FAHA 3QN7A 1E37B 3RXUA 1SQTA 4X6NA 2O8LA 4NZQA 2W7SA 5DP8A 1T31A 4AFZA 4GCHG 4AFSA 4Q7ZA 1TX8A 1AZ8A 5CMXH 1Y5UT 4K1TA 1DS2E 3TK9A 1FY5A 2ZPQA 2P3UB 2V3OH 3M7QA 7LPRA 1CT4E 2WUCA 5EJ1A 3LJOA 4YTAA 1PPBH 3F68H 3LKWA 3KCGH 2EI8A 2EC9H 1HPGA 4ZXXH 1S6LA 1W7XH 1KXCA 1TAWA 1GJ4H 2TPIZ 2G52A 2ZEBA 3PLPA 1C5WB 1ETTH 1V2UT 2XWBI 2Z9LA 3ZZ9A 3MYWA 3W95A 4X1RU 4ZKRU 2ZDLA 2ZDAH 4GAWA 1SGFG 1ANDA 2QF4A 3S7HB 2ZCHP 3QZQA 2GZ9A 1A3BH 1C1SA 1P3EA 1TONA 1VITH 4ZCNA 3ATWA 3KYFA 5EW2H 2H5CA 1TMTH 3FOAA 2D8WA 1O3FA 3WWBA 1GBKA 5KGOA 5EJLA 1C2JA 4Y71A 3M5LA 1G2MA 2FTLE 5FHTA 1CHOF 1GBJA 2PTCE 1W3CA 2J5UA 1T4VH 2R3YA 4FVBA 1FY1A 4AGJA 1BTHH 3RXVA 1TPPA 4A6LA 4D76A 4TWYA 2P8OC 5HIZA 3ZZDA 3ZVFA 3LGVA 1QB9A 2K8IA 4FVDA 1S0RA 5KECA 3F6UH 2A7HA 3MH7A 1NBME 1BA8B 3RXDA 4UEHH 2BD7A 4ACAA 2OK5A 1SHYA 1DX5M 2ILNA 3GY4A 4ABHA 3V12A 2HVXA 5DG6A 4ZUHA 3V7TA 1LVBA 1OP2A 1MZAA 3ATKA 3RXJA 1FXYA 1DFPA 7ESTE 3GCHB 5DPAA 2G81E 1JIMA 4KP0A 6GCHF 2RG3A 1EJNA 3NXPA 1DUAA 2BLOA 2BD2A 1TGBA 1EPTC 1D4PB 1BTWA 2AIPA 4FUHA 4OS5A 1SGDE 1LKAA 1V2OT 3D23A 5TCCA 3K6YA 4YO9A 3GISB 1FPHH 3GDSA 4KTUA 3SGBE 1PQAA 1QCPA 3M35A 5JB8S 1LVMA 1TOCB 1HXEH 5DP7A 1XX9A 3PV4A 3MU4A 3VG8A 2RDLA 2P95A 3B9FH 3GYLB 2Y80A 1IQFA 2FYQA 1GI6A 3UQOA 4O3UA 5H4IB 1OXGA 5FCRA 1O38A 3M37A 4HTCH 4X6MA 2C93B 4XBCA 8LPRA 3U98H 2BQ7B 3SZEA 3V0XA 4ASUD 1MTUA 3SU0A 2JH0D 5LPFA 3MO6A 4IMZA 4QT8C 1HV7A 1BMAA 2ZP0H 2XBVA 5A8XA 1ELGA 2A5AA 1S81A 1C5UA 2J4IA 2Q1JA 2ZU5A 2Y81A 4X6OA 1F5LA 4XE4A 1K1MA 3MTYA 1A3EH 3PM3A 1K21H 3KF2A 3QLPH 3LT3A 3RXCA 1OWJA 1ZMLA 1QTFA 1G32B 2ANKH 2KFWA 2P8OB 3GICB 3LJJA 2QCYA 1RFNA 1ARCA 2RDEA 4OGYA 4Y0YE 1YCPK 1Y3UA 1HAOH 4K8YA 1BMNH 3KQ5A 4GPGA 6CHAC 2Q6DA 3OYPA 3ESTA 1NRRH 1P2OA 2ZGJA 1GG6C 1C4Y2 4MNXA 1AE5A 2TGPZ 3SNCA 1IHTH 2C8WB 2BDBA 5F53A 3SU6A 1CHGA 2NU0E 4GSOA 3U8OH 4Y0ZE 1GI9B 1C1RA 3RXRA 1HAXB 2VB0A 5A0CA 4JCNA 1MKWH 5HYOA 1KXBA 1FAXA 4XSKU 1MUEB 3QO6A 2VWMA 4IN2A 1UTLM 1QRWA 2WYGA 4X1SU 1P57B 1QR3E 1T8OA 1QJ7B 3GCNA 1XKAC 3A7YA 1OX1A 1AFQC 2V3MA 1EZSC 4K3JA 1EPTB 2FODA 3BTME 5AHGH 2ZDNA 1C1OA 1KLIH 2BB4A 3A87A 1W12U 1ZPCA 1O2HA 1HGTH 1HJAC 2ZHEH 4CBOA 1ZOMA 4WF8A 5DKMA 1MTNC 4OS1A 2YMSC 3EA8A 4DG4A 2OLGA 5JBAS 1TWXB 2STBE 2J94A 4CRGA 4BANB 1TX6A 1LHEH 1EZQA 3U69H 1BUIA 1TX7A 5T6DA 4Y8YA 3OFND 2A32A 5C67A 3DD2H 1K1NA 3BEIB 2XW9A 1V2JT 1QGFA 1PYTD 3D49H 5SGAE 2VVCA 1GPZA 4IN1A 3HGPA 3SU3A 3PWCA 3OTPA 1C2IA 5E8EH 8GCHF 2ZCKP 3SU4A 1O5DH 2HRVA 1TALA 3K65B 1V2PT 3SI3H 1T32A 2ZU3A 5IK2D 1AQ7A 1J15A 1GWAA 4YT7H 3RXMA 2G8TA 3SN8A 1A61H 2ZFTA 4E06H 6CHAB 3TK6A 3T26A 1GG6B 3S9CA 3PV5A 4ESTE 1MBMA 1THSH 2Z9IA 1CO7E 2BYAX 3TPIZ 2ZECA 4U2WA 2GX4A 3LOXA 1O2XA 2WPMS 1WQSA 1QL7A 2P94A 3SUGA 4WVPE 2GT8A 4CRCA 3ZZ5A 3TGJE 3A7TA 1K1IA 3MO9A 3PMBB 2ZTZA 4IMQA 3TJNA 3VGCC 1MTVA 3IWMA 1DE7H 1ELBA 1ZHMA 1QJ1B 1KLTA 1AFQB 2FWWA 1ABIH 1WAYB 1W7GH 5TCAA 2Y82A 1MH0A 1Y8TA 5LPRA 2GDEH 1PJPA 3DHKH 1E79D 2A1DB 4MPWA 1BRBE 3ZVCA 3C27B 1MAYA 1O30A 1HJAB 5I46H 3FZZA 1KLJH 1P9UA 1UVTH 1E1RD 1UCYE 5F03A 3QTOH 2JH5D 1GHAF 3LH1A 5JPMH 1E35B 2YMSB 1D3QB 3UOPA 5F8TA 5HGGA 2W3IA 4Y76A 3TIUA 2G51A 3LONA 1SGTA 1UVUH 4X2XA 3P8FA 2F43B 5DP5A 5L6NH 1GMDG 1LMWB 1NROH 1SOZA 2L74A 4ZHLU 3C1KA 1IOEA 1VKYA 1ZPZA 1DANH 2BQ6B 1YGCH 4NFFA 3GDVA 3KEEA 1O0DH 4HFPB 2DE9A 1YWUA 1XM1A 2TGTA 3AAUA 1FNIA 4CRDA 2GCTC 3A83A 5FBIA 2QIQA 1C5RA 2UWPA 3M5MA 1Z6EA 1YPGH 3PYHA 1TNJA 2Y6TA 3M3VA 1IQJA 3UQVA 2C8ZB 2WPIS 4HGCA 2BTCE 3RMLH 4AX9H 1D3TB 2A4RA 1DY9A 3SU1A 3EA7A 1DLEA 3MI4A 3FKSD 4XOJA 2SGFE 5GCHF 3BTWE 2J98A 1QNJA 4MNWA 1H8DH 3OX7U 1UVPA 1EZUC 1HFDA 4MTBA 3VGCB 1YLDA 4BOHA 1K22H 1P2IA 4E7NA 1H9HE 1C1NA 3L33A 3CS0A 1ELFA 2OQUA 1BOQA 1WXRA 2PLXA 1KXFA 5DSFA 1XVMA 1LVYA 4B2AA 2IOTA 1YPKH 4UDWH 3ODFA 2ZDVH 1Y59T 4WH8A 5LGOA 3PWBA 1GJ9B 1HIAB 2TRMA 3P8OA 4LZ1H 3G01A 2GD4B 1K0HA 3GCOA 2FS8A 4Q80A 1OSSA 2F91A 1SLXB 3RXQA 1OWHA 1GCDA 1DWDH 2BVXH 3BTHE 3PLKA 1GJDB 1AGJA 2VNTA 2IJD1 1DWEH 1N6YA 2L6OA 5JB9S 3NCLA 1KIGH 2J34A 2ZHDA 1EP5A 1S83A 2AMPA 2TIOA 2Z9GA 3A88A 3E1XB 3UREA 3FO8D 4AZ2B 1GBFA 4TPIZ 3BEUA 4FUBA 3M5OA 1TA6A 5DP6A 4SGBE 2UWOA 3GS9A 1T8MA
chains in the Genus database with same CATH topology
3A8DA 1FMGA 1FZZA 2FLBH 1BBRE 1FN6A 1O3NA 1ZHPA 3ATIA 2GCTB 3ELAH 1HAPH 4MQAA 2OBQA 2ANMH 4JMYA 1RTFB 1EOJA 2H2ZA 1TRNA 3PMJA 4A1TA 3VXEH 4ABDA 1O2KA 3LPRA 2XTTB 3A7XA 1TNGA 3EA9A 4I8GA 1P9SA 5E0GA 1EOLA 4JZFH 1S84A 4RKOB 1GI8B 1W14U 4K1SA 1G3CA 3SU2A 3SJOA 3KQEA 2BY5X 2ZFFH 3SQEE 2Z94A 1YKTA 1BTZA 5DK1A 2ZHFH 4K1EA 3LC5A 1GJ6A 1GJCB 3VB3A 2RCEA 5J4SA 1F2SE 2A31A 2F83A 5FPSA 1O33A 2QY0B 5EQQA 4B76A 2Y5FA 3FVFB 1GHVH 3SUFA 1H1BA 2XNIA 1TNLA 1IQNA 2WUBA 1QJ6B 1AY6H 3O8BA 1O2WA 4IC6A 4GHTA 1SB1H 1AZZA 4BXWA 3KHVA 1GGDC 3LGIA 1RIWB 1E34B 5EXLA 1DUEA 5IYTA 5EPYA 3ENSB 1J8AA 1P2QA 3T27A 4MDSA 1CQQA 3F1SB 1AWFH 1SR5C 1AN1E 1ZGVA 3BV9B 4NCYA 2BDGA 4BAOB 3DFJA 2WINI 1SVPA 1A1RA 3LU9B 1DWCH 3T29A 1Y5BT 2W7UA 1GI1A 1WSSH 1SPJA 1OS8A 5C1UA 2VJ1A 1LQEA 1A0JA 1F92A 2VIWA 5C5NA 1SGFA 2UUKB 2VH6A 4AFUA 1O36A 2NU3E 1A5HA 2R0KA 3SW2B 1NFUA 3SV8A 1JRTA 1BQYA 1L0ZA 3UWIA 3BEFB 4BAKB 3GYMA 1GBLA 1BITA 2R9PA 1QQUA 1MCVA 1UHBA 4J1YA 1ELAA 3RC6A 2ZI2H 3ZZ6A 2PKAB 3SHCH 1ZSJA 2ZFRH 4R8TB 5EGMA 4O03A 4YLUA 2A2QH 4UFDH 4O97A 1QA0A 1CGHA 1KTSB 4MLFB 1A46H 5A0AE 4LK4A 1A0LA 1ZMJA 4K8BA 2GT7A 1WQVH 1FIWA 2OCVB 3HK3B 3S0NA 1GMHG 2FI3E 1SHHB 3K2UA 1O3IA 2EI6A 3RXBA 2FOHA 1V3XA 1S6FA 2QF3A 5ESTE 1NS3A 1GHZA 1FONA 3PB1E 3RU4E 1YLCA 3RM2H 2AEIH 2GVFA 1GGDB 4YOJA 1T7CA 1HBTH 2HNTC 2PKSC 1HAVB 1EQ9A 2XC0A 1C2FA 3DUXH 1TPSA 4NFEA 3F9EA 3FFGA 1GBMA 1P12E 2BMGB 1GI5A 3SGQE 1JRSA 2OQ5A 3LGUA 4AYVB 3BTEE 1C5XB 1GMCG 1V2ST 3MMGA 1IAUA 1WTHD 1F0RA 3A86A 1C9PA 1HNEE 5LH8A 1TGTA 3M61U 4OS7A 4I31A 3UNRA 3EAJA 3WY8A 3A89A 1KTTB 2SFAA 4ZMAH 1THRH 3FANA 1EB2A 1NZQH 2OUAA 5E0HA 1HUTH 7KMEH 1P05A 1C5NH 2AGIX 4F4OC 1NM6A 7GCHG 5C1YA 3VXFH 3ZVBA 4ABEA 1DXWA 2GCHG 4RSPA 1ANEA 4AG1A 4JYVH 2I6QA 4BTIB 3BIVH 1SLVB 4ABIA 2D26C 1UTQA 1CBWC 3ZVAA 2BLVA 1BT7A 3M3TA 3BG8A 1YP9A 4WJG2 1F0SA 3U8RH 1TIOA 3MU1A 1P0SH 2OTVA 1C9TA 1F0TA 2ZFSA 3KN2A 1ZHRA 1GI0A 5EQSA 2PTNA 1P10A 2FZZA 3A81A 4LXBH 4GUXA 1DOJA 2QC2A 4K2YA 2BOHB 1P01A 2FOGA 1SQOA 5ABWA 4B75A 2GZ8A 3Q3KA 4X1NU 4B74A 3S7KB 5GJ4B 1ESTA 4JYUH 4LZ4B 1GBEA 1A5IA 1CU1A 2XRCA 1QL9A 2VWOA 4ASHA 4A5TS 1YPHE 2A4QA 1WBGB 1NRNH 4AFQA 3A82A 1P2KA 1Q31A 1C2KA 2PKSB 3W94A 1DICA 1ARBA 1FV9A 4Y10E 3LIWA 3RM0H 1O2IA 1KXDA 1FN8A 2F9VA 5C20A 1XUKA 3TNSA 1TQ7B 3VB7A 5EXNA 2BLQA 3ZZ8A 1GHYH 1Z8GA 2VIQA 1TE0A 1UTPA 1PFXC 3LH3A 1EJAA 1ZRKA 1Z1JA 1CE5A 3BTDE 2ZFPH 1GVZA 1Z7KA 5HM9A 1GJ7B 5HMAA 1FPCH 2ZNKH 1C1TA 4ABFA 3MH4A 4GHQA 1BMLA 2ZU1A 4Y7AA 6LPRA 2XBXA 1TPAE 1Q2WA 2SGDE 1PQ7A 3SGAE 2PSYA 1SGPE 2OD3B 2AS9A 4K60A 3QDZB 1NTPA 1H4WA 1QL8A 3P8NA 2GMTC 4NIXA 6ESTA 2Y7XA 3A7ZA 1UCYH 5T6FA 2YNAA 1DDJA 1MKWK 3RC5A 1G36A 3U8TH 1VZQH 1DM4B 3MH5A 2UWLA 5E2PA 1O3CA 3SNBA 2BD4A 1O3PB 1LPKB 2BDIA 1BRUP 2ODQA 1EASA 2ZA5A 4FUIA 4TY6A 5HXFA 1K1JA 3NZIA 1SGQE 5JBBS 1HXFH 2ZGXH 1OWIA 2WYJA 1P2NA 2JETC 1FDPA 1QY6A 1MU8B 3MO3A 4NA7A 1AUTC 1LCYA 3SJ9A 1ELDE 3AW1A 4GCHF 4TPYA 5EXMA 2OP9A 4ABGA 3SBKA 2P3TB 1OKXA 2F9BH 1TGSZ 2ZGBH 5C3NA 3VFEA 1P11E 1UJ1A 3B23B 2NU2E 3BG4C 1P04A 3PMHB 4KGAA 4B71A 4ZHAA 5L30H 1JIRA 8KME2 1Z8RA 3UOUA 1QA7A 1LVOA 1MTWA 4K5ZA 1HDTH 2ZQ1A 2FOEA 1H9LB 1JMOH 1IHSH 3GDUA 5CHAC 4OS2A 1NU9A 1GHBG 1W0YH 1ZJDA 2BZAA 3RLWH 4JZIA 3GCTG 1DSUA 2P3FH 4X2WA 3LGYA 2WPKS 2HPPH 3T28A 2Q6FA 1CA0C 2J38A 5FPYA 2H1UA 3PTNA 5A0BA 3ZZ4A 3AASA 1OPHB 3TITA 4A1VA 1A2CH 1BHXB 4NSYA 5GPIB 1V2KT 4ISLA 1LKBA 2CXVA 3QGJA 3K6ZA 5IDKA 4D7GA 1OWKA 1GHWH 2G4TA 2EA3A 3UNSA 2BM2A 3P95A 1SOTA 1PQ5A 1TBQH 2GMTB 1BHXF 3RLYH 2FOAA 2Q6GA 1C2EA 2BD5A 3E0NB 4BAQB 5A8YA 4ZH8A 2A2XH 5JYIA 4DIIH 1IQGA 1G2LA 2PFEA 4BAHB 1O2UA 2VVVA 3LGTA 5DGJA 3VB4A 4DIHH 1S85A 1OWDA 5F6MA 1SMFE 1HJ8A 2FLRH 4I8LA 1GL0E 3MNCA 4I7YH 3OY5U 1HAIH 1XKBC 3TVJB 2PWXA 3RMNH 2ZWLH 3NPSA 1MKXH 4INLA 2W26A 4Y6DA 1NT1A 2AMQA 1EATA 1BJUA 3V13A 1OWEA 3F9GA 3VB5A 1DY8A 4THNH 3S69A 1JOUB 2JETB 5EQRA 1O2OA 2ZCLP 1V2QT 1MTNB 1VITG 1XMNB 4TYDA 1G3DA 2OC8A 2Z7FE 3ZV8A 3URDA 3BG4B 1NRSH 4DGJA 1RRKA 1LPGB 1TRMA 1BBRH 3H5CB 4UONA 3MOCA 1C4V2 2B7DH 2CJIA 3A8BA 3RMOH 5DJ7A 4FUCA 1O5BB 3RXAA 4YOGA 1GBBA 1MD8A 1YPMH 4K69A 2Z9JA 1Z8IB 4NIYA 2R2WU 2K1QA 2VIOA 3GY6A 2NU4E 1OP8A 2VH0A 1ETRH 2C4FH 4MG3A 1OYTH 1YPHC 5FXLA 3UY9A 3VEQB 5DP4A 1DWBH 1F0UA 3TGIE 4X8TH 1PPEE 1CA0B 2BHGA 2V35A 4UE7H 2R0LA 1V2LT 2WPJS 1OP0A 1GI7B 2TBSA 1XVOA 2Z3EA 4DVAU 5A8ZA 1ZZZA 4LOYH 2W5EA 3UR9A 2C8YB 1A7SA 3CENA 3L6PA 1QQ4A 2THFB 5BPEA 3I78A 2CHAC 4ISNA 3ZZCA 1PYTC 1QFKH 2ODYB 3D62A 1CT2E 4AG2A 2VWNA 3SJIA 4FUGA 1MD7A 1TOMH 2HNTE 1CGJE 3L3TA 1GBDA 4AB8A 1THPB 1SG8B 5EPNA 2BDHA 4WXIA 3B8JA 1AB9C 1W11U 2ZU4A 3A84A 1IQEA 2ZTXA 1J16A 1UTNA 3SV7A 1O3HA 2ZHQH 1UK2A 3URCA 2OC0A 1GJ5H 4UFEH 3TLOA 3UUZA 1AVWA 1EP6A 1ZGIA 2CMYA 4FU9A 4A92A 2FO9A 1ZRBA 1SGRE 5C1XA 1O5CB 1EAXA 2DUCA 4IC5A 4B1TA 3BN9A 3TGKE 1VCQA 3H7TA 1C5ZB 1B0FA 4WXVA 3LDXH 2GV7A 1TLDA 3SUDA 4MNYA 2VWLA 3S9BA 2R2MB 3QZRA 2ANYA 4JK6A 3E3TA 4X1PU 3RXTA 3GY3A 2GP9B 2PSXA 2ALPA 2BX3A 4BAMB 2TGDA 5EOKA 4TWWA 1O2YA 4H6SB 3TJOA 1O2GH 2UUJB 4Y8XA 5GDSH 1W10U 3UPEA 1UTMA 1O5FH 2FIRH 3KNXA 2ULLA 2GV6A 5E0JA 1KSNA 2BZ6H 2BY6X 1CHOG 4IGDA 3NWUA 4X8SH 1SBWA 3ZVGA 3GY8A 3QK1A 2F9OA 1TNKA 2ZKSA 1C5OH 3LC3A 2ZDMA 2IJOB 3OTJE 3SUEA 3PTBA 2VINA 3BTQE 5T6GA 2VGCC 2AGEX 1C1UH 1H9IE 3SNDA 1PPZA 4FU8A 3O8RA 2FOCA 2FYRA 4AGKA 1QRZA 3AW0A 2GZ7A 1GHBF 1YM0A 1UTKA 3FP6E 1GI2A 1TNIA 2WPHS 2FM2A 3RC4A 3ZZ7A 4JK5A 3ITIA 1TRYA 4O9VA 1INCA 1IQLA 1E38B 2CHAB 4ZXYH 2B9LA 2BXUH 3ZZAA 1VCPA 1EAUA 2ZQ2A 1C5QA 6GCHG 1UTJA 1HAHH 1HAYB 2AFQB 1AB9B 1NFWA 3HPTB 4UFFH 2G4UA 3BTFE 1TYNA 1BDAA 1CA8B 3CP7A 1P06A 3AAVA 1BRCE 3Q77A 1TB6H 1DSTA 1XXDA 5FBEA 2OC1A 1AHTH 1TMUH 1SLUB 2Y5GA 4I8KA 1BZXE 1C2LA 3A85A 4A1XA 1SI5H 3TJUA 4DOQA 4CRFA 3VPKA 1PPFE 1PPGE 1T8NA 2PUQH 4D8NA 1O34A 2FEQH 3F9FA 5EW1H 2ZGHA 2A4GA 5HM2A 4XDEA 1O5EH 1GJ8B 1N8OC 1ELTA 1G30B 4INKA 1CGIE 3RXGA 3SV9A 2C90B 1RS0A 3SOSA 3T5FH 3A7WA 1KYNA 1VITF 1PPHE 1RTLA 1SSXA 1KY9A 1WCZA 1C5LH 3MNSA 1K1LA 3N7OA 1ZYOA 3ZZBA 1C1MA 2PR3A 1FY8E 3GY5A 4I8HA 1GMDF 1MBQA 5J4QA 2CF9H 1G37A 1ZJKA 2HOBA 3FP7E 3EE0B 1KXEA 1KDQA 1C5SA 3MU5A 1C2HA 2ODPA 3UFAA 1ZTLA 2O8TA 4SGAE 5C2ZA 2Z9KA 2ZO3H 1QB1A 1SFQB 4PROA 1J9CH 2Z3CA 1T8LA 1WOFA 3H7OA 2WPLS 2BD9A 2XCFA 1WV7H 1Y3YA 2M5TA 2A5KA 3LGWA 1O39A 1S82A 3UWJH 1SGYE 3ZYEA 2ZC9H 3NKKA 1GBCA 1AMHA 3M5NA 2QV1A 3SJ8A 3TH2H 4WH6A 2AGGX 1LHFH 3U1IB 1O3GA 1FAKH 3SZNA 1GI4A 3HATH 1FI8A 4YESB 4OGXA 1MAXA 1B7XB 1ANCA 2YNBA 1AVGH 1U6QA 4NG9H 2PUXB 1C1QA 1NN6A 2QYIA 2RA0A 4NGAH 1AVXA 1X7AC 3ZZ3A 1MMJN 1O35A 4Z6AH 1N8OB 1RD3B 3SJKA 1GBAA 5E2OA 1ELCA 1NESE 1VR1H 3E6PH 3QUMP 1Y5AT 4I32A 3U9AH 1MU6B 4X1QU 1D3PB 2BY8X 3GY2A 1L1JA 2OBOA 3EYDA 1DXPA 1O31A 8GCHG 2XC5A 2BDYA 1V2VT 2W3KA 1RXPA 2D1JA 1JBUH 1BTYA 5DP9A 2I6SA 3RMMH 4ISHH 1F5RA 4Y8ZA 2B0FA 5LPEA 2BX4A 1NC6A 4WMDA 1PQ8A 4ZAEA 1DT2A 1MQ6A 3TJVA 1LHCH 2P59A 3DA9B 3RXLA 2PV9B 3KL6A 4U01A 3HKIB 2OC7A 2QF0A 4NWLA 1GJBB 2ZGCA 5K7RA 3RDZA 1O3JA 1K9OE 2H9TH 5GXPA 2STAE 1L1GA 3KQDA 1O5GH 2O8MA 1VJAU 4XFQA 3MWIU 1DPOA 3E90B 4JZEH 1XUJA 2IPHA 4CRBA 4UD9H 4CHAC 1YPLH 1SGIB 5L2YH 1RGQA 2WV4A 2QXGA 3R3GB 4MPUA 3VB6A 1C2DA 2PW8H 1O2ZA 4ISOA 2VIPA 4H4FA 4DURA 1Y3WA 1P2MA 3M7TA 2XWAA 1GHAG 1ZSLA 2BOKA 3BTGE 1C2GA 3SV2H 1WU1A 2SNVA 1K2I1 1IQHA 5F8XA 4BNRA 2J92A 1O2VA 4NA9H 2FPZA 2XC4A 2AIQA 3E8LA 3UTUH 4H42U 1AI8H 4UFGH 1GBTA 1O2LA 1NRPH 1P3CA 2J95A 4JZ1A 1Y3XA 1WTGH 3RU4D 1D9IA 3MU0A 1Z6JH 1BIOA 1C5YB 3A7VA 2V0BA 3Q00A 1QHRB 1P8VC 3OY6U 3CS7A 1O2TA 3IITA 5DO4H 2HALA 2HNTF 4ZKNU 2ZDKA 3PROA 4X2VA 1ZSKA 2H6MA 3MFJA 3MHWU 2B8OH 2XCNA 1V2WT 2FP7B 3O8CA 4YZUA 4X8UH 1AUJA 1HIAA 1C5MD 1TNHA 3HK6B 4U32A 1TBZH 1TGCA 4FUEA 5FX6A 1ETSH 1SL3A 5FPTA 3EDXB 2SNWA 3RXEA 4M7GA 2FESH 1C2MA 2Y7ZA 4FUFA 3OU0A 4HZHA 1S0QA 4KELA 5GIBA 2HPQH 3UIRA 1O2MA 1MZDA 3M7UA 4Y7BA 1YCPH 2FI4E 1QBVH 1IQKA 1CBWB 3KIDU 2HWLB 3QWCH 1A0HB 5GCHG 3TH4H 2PGQB 1RTKA 1ORFA 1YF4A 3RXKA 4DT7B 1NFYA 3O8DA 2FOBA 3RU4T