5HM9A

Crystal structure of mamo protease domain from magnetospirillum magneticum (apo form)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
189
structure length
189
Chain Sequence
LYHTVPPAVVGVGGGGVNAGPVASGAIVGTNGYVITTLHSVSKLPEISVQVATTGGIRRFPAQVVKTIPGHDLALLKMQTTEKFLHFRMADVQTVVPGQQVFAFGRNMAGAPLVRQGLVQSADAPLAVGATQITHLLRSDAVYSWEQTGGPLVNAQGDLVGINIAATGPTGKVEGFTVPAQVIVSHLQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title MamO Is a Repurposed Serine Protease that Promotes Magnetite Biomineralization through Direct Transition Metal Binding in Magnetotactic Bacteria.
pubmed doi rcsb
source organism Magnetospirillum magneticum amb-1
molecule tags Hydrolase
molecule keywords MamO protease domain
total genus 39
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5hm9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5hm9A01
1FUJA 1S5SA 2Y7ZA 2D8WA 3SV7A 4CR5A 2ODYB 3UR6A 4NWLA 5LH8A 4IC5A 3ZZ5A 3ZVCA 5T6GA 1SHHB 1T8MA 2NU0E 3SU4A 2FOMB 1G2LA 3HKJB 1PYTC 2BLWA 3P95A 2VU8E 1F0SA 1O3PB 1FV9A 4X2VA 2H2ZA 1O3HA 4Z0KA 1QBVH 2ZU5A 1P06A 2ZG0H 3BTKE 1HNEE 1XUKA 5A2MH 1Z7KA 3DT0H 3OTJE 3FP8E 2PV9B 2BOHB 3STIA 3D23A 2SGPE 1GL0E 4NFFA 5PTPA 5FXLA 4UONA 1SGYE 2K1QA 4RKJB 1JWTA 1OS8A 5T6DA 1ZMNA 1O33A 4ZXYH 5E0GA 3RXBA 2QYIA 5C3NA 1C1TA 1HAXB 1RXPA 2FOGA 1FAXA 3NKKA 4ABFA 3DUXH 2ZFSA 3FP6E 1A3EH 3MFJA 4IMZA 1GMCF 1O3KA 1Z8IB 3Q3YA 2SGFE 2SNWA 3SV2H 1Y3VA 5FBEA 3PWBA 1NM6A 1P2MA 3ZZ8A 1TNHA 3PMAB 4VGCB 2BXUH 1CHOF 4NA7A 3DA9B 1KXEA 4K8YA 3T62A 4D9QA 1ELCA 1HAYB 2BY8X 5HXFA 4ZHLU 3KCGH 3RU4E 2ZPRA 2P59A 1O3BA 1WOFA 3RXKA 3SNCA 5JPMH 1CT4E 1GG6B 4X1SU 4WVPE 4X8SH 3TPIZ 4K1EA 1AY6H 4JZ1A 4I8GA 1SL3A 3URCA 2BQWB 1TPSA 4OGXA 1Z71A 1WAYB 3E16B 3ZVFA 1EASA 7LPRA 3SI3H 3V7TA 5FCRA 1C4U2 3BTGE 2P95A 1VJ9U 1ABJH 1C1QA 1OWHA 1XUFA 1Y3UA 3KEEA 1GVZA 3OY6U 4TPIZ 2GDDA 3LC5A 1NFUA 2ZCLP 8ESTE 1QRZA 1PFXC 2IN2A 4FVBA 1N6XA 4IMQA 4J1YA 1HFDA 2G00A 4Y79A 2ESTE 1O2SA 1DUAA 1P05A 2R3YA 3BTWE 1KLIH 3PROA 1TRYA 5EW2H 4AG1A 2AH4X 1LHGH 3E0NB 1TONA 1NRPH 3M7QA 5FPSA 2WPMS 1TOCB 1ZTJA 4X0WU 1LMWB 5GJ4B 1HV7A 1TBRH 3PMJA 1SMFE 1F92A 2FOEA 3ATMA 2ASUB 3N7OA 3S69A 1T4VH 3O8RA 3UTUH 1O2IA 1IQMA 1OP8A 1OSSA 1W2KH 1BTZA 2VIDA 1G30B 2OC0A 2AMPA 2GCHF 2PW8H 2QGRA 1SC8U 2VINA 1H8IH 3KIDU 5DP4A 3UWJH 2TGTA 2W7UA 5T6FA 1HAGE 1QURH 2WPJS 2ZFTA 3EQ0H 2BYAX 2PKSC 1XVOA 1O2XA 2FXRA 4WMEA 5FBIA 2AIPA 3F1SB 3RXQA 1KTSB 1CHGA 1DDJA 1XUJA 1MZAA 1NFWA 2Q6DA 2W3IA 3PLBA 5EXLA 2KAIB 1JBUH 3MO3A 1ZJDA 4K5ZA 1XUHA 1MCVA 4ABBA 1GI2A 1L1GA 2BY7X 1BOQA 1DANH 1TMTH 2PLXA 4ZKNU 2CHAC 2PGBB 4FXGH 4NWKA 2J94A 1GBHA 2AMQA 2Z3CA 2H1UA 3GDSA 1A61H 2BDAA 1ORFA 4JK5A 2V6NA 2A4RA 1F5RA 4A1VA 5DK1A 2ZFRH 3HK6B 3SJIA 4Q2KA 4JYTA 1ETRH 2HNTE 1DWEH 5HM2A 1C5PA 1A5IA 2BLOA 2QIQA 3W95A 3ENSB 5GPIB 3TJNA 3RDZA 2B0FA 2GDEH 6LPRA 2FX6A 4NSVA 2PUQH 1C5TA 3LIWA 4OGYA 2ZGBH 1V2JT 2P3FH 2KAIA 5DP5A 5DJ7A 1GI6A 2GGVB 1TIOA 2ZO3H 1F5LA 1QGFA 1S0QA 4BNRA 3EA8A 2HLCA 1G2MA 1T8OA 1UJ1A 1UCYK 1XMNB 5IDKA 1DLKB 1ZPZA 4ISIH 1SOTA 1KSNA 5DP7A 1OP2A 4Y8YA 3ZVEA 1C1VH 3A82A 1UTOA 3RM0H 3PLPA 1S6FA 3NPSA 1AVWA 2D2DA 3F9GA 2F9VA 4O3UA 2GP9B 1O5AB 1NFXA 2J38A 1SGDE 1THRH 2H5CA 3SGBE 1CU1A 1WYKA 1FMGA 1GJCB 1CO7E 1P10A 1W0YH 2Y80A 4D8NA 1XXFA 2OINA 3SN8A 4YLUA 3SV8A 4JZFH 1N1LA 3QTOH 1HBTH 3PB1E 3ZZ3A 3T26A 2B5TB 6GCHF 3RP2A 1GCTC 2ZIQH 4FUEA 1PPFE 5CHAB 8KME2 5DO4H 1EAWA 1FZZA 1O2LA 2QN5T 5FPYA 1ZSLA 1BTUA 1SHYA 4TY7A 1YCPH 3IITA 2F9PA 2STAE 5LPRA 1V2UT 2BVXH 2A5KA 4KTUA 1DOJA 2C8ZB 1LHCH 4ZKSU 1P12E 2VIWA 1BB0B 3A7ZA 1V2VT 1AFQB 1CSOE 2ZU4A 5GCHG 1O3AA 3TJUA 3B23B 1TX6A 2XBYA 3R0FA 2CF9H 3LJOA 1P2KA 4DURA 1O3JA 4Y8XA 5E8EH 1GJ8B 2ZU2A 1TGBA 3IG6B 5C20A 1G3BA 1UTQA 3SO3A 1ANBA 4ABJA 1DITH 3GISB 5A8ZA 3ZZBA 1MD8A 3KNXA 1GDQA 4IC6A 1AFEH 4TWYA 2B9LA 1O5BB 5AHGH 3ZVDA 1TPOA 2FWWA 2UUYA 2XXLA 4IN2A 4WH6A 4A6LA 3GOVB 1M9UA 1WQVH 2UUFB 1QA7A 1XUIA 2GTBA 1EZXC 4XE4A 3SORA 1NC6A 1KY9A 2PKAA 1QBNA 3TH3H 1GJ4H 4Y0YE 2OC7A 2VWNA 2BY6X 2FPZA 4AGJA 1O2MA 5IYTA 5EGMA 1WSSH 1P2JA 4TPYA 1C2DA 1W0ZU 3VPKA 4AOQA 1NU7B 1Z8JB 1DUEA 4GVUA 1KIGH 1MD7A 2NU2E 4XBDA 3RXUA 1QY6A 3D65E 1V2WT 2QY0B 1Z1IA 4XBBA 1AFQC 1OYTH 5DP8A 1O3LA 1GHZA 3BEUA 3VB4A 1SGFG 2C3SA 1TALA 1TGSZ 1VITF 2BDHA 1GDNA 1GMDG 2AMDA 3AW0A 4U30A 1GBBA 2R9PA 2AGEX 4TYDA 1QQ4A 3S0NA 5DP3A 1SVPA 1TRNA 2ZHEH 1Z6EA 1QRWA 1LKAA 3E3TA 2C8XB 3LJJA 2ZHDA 3VB6A 1D3PB 1H9HE 1BDAA 1CVWH 1SGIB 2WUCA 1LHDH 2PSXA 1O2KA 1CA8B 3SU3A 1INCA 1TX7A 3RXJA 1FN8A 2EC9H 3F68H 4BTUB 4ISOA 3P6ZB 1QCPA 4HGCA 1O0DH 1AWHB 2Z7FE 1C5UA 1O2VA 2FYQA 1YLDA 3BTDE 2WPIS 4YZUA 1BIOA 1FN6A 3TK5A 3GYLB 4MTBA 1P03A 1NS3A 1TE0A 5FX6A 2ZTXA 3M5OA 4LXBH 2BD8A 8LPRA 1AUJA 3NK8A 1OWEA 2ILNA 1LVBA 3ITIA 1BTHH 5L6NH 1XKAC 4A7IB 3SZNA 1K28D 4LZ4B 3ATLA 5JBTA 4ISNA 1DX5M 3K9XB 2GZ7A 1EOJA 2WV4A 2OC1A 1OKXA 5K7RA 1V2NT 2XC0A 1AHTH 3SUFA 1JIMA 2Y5GA 3GCHB 1LDTT 4MNVA 1DM4B 1GJBB 2ZF0H 1P0SH 4AZ2B 1FQ3A 1WUNH 3HPTB 5LGOA 1O38A 1EZSC 1O5EH 2ZZUH 4D9RA 2GCHG 4HFPB 1GWAA 2Q1JA 3KQEA 1OP0A 4ZROA 3ZZ9A 1UK4A 3BEFB 3S7HB 4KKDA 3RXMA 3P17H 1P2QA 1EPTB 1MMJN 4AX9H 5C2ZA 1GL1A 2C8YB 1RJXB 1AU8A 1QJ1B 3NZIA 5FX5A 1ETTH 2Z9JA 3VB3A 9LPRA 1A1RA 5DPAA 4FUHA 1AE5A 4NIXA 1QIXB 5EU8A 1FAKH 4ABAA 1GBLA 1P2OA 1ARBA 2HPQH 1GBKA 3GCHC 2ZP0H 3MNCA 1GBAA 2J9NA 1P9UA 1FPHH 4CBOA 2AEIH 4I33A 4GHQA 4QT8C 2O8LA 3PYHA 2IPHA 1HJAC 2JKHA 3MHWU 4UFEH 2OLGA 4YO9A 1KLTA 1C2GA 1UVTH 2J34A 3G01A 1HYLA 1C1WH 5F03A 1UCYH 1GHWH 3RMLH 1LHEH 2ANMH 3I29A 3S9AA 2ZU3A 2ZC9H 5EPYA 1DY9A 2BTCE 2F3CE 1DFPA 2P93A 3RXFA 5JB8S 2SNVA 1LVYA 1NY22 1SGCA 1O3OA 1EXFA 1MCTA 3RXGA 3CS7A 1SI5H 1F0TA 1GHXH 1L0ZA 4IGDA 1RTFB 1AQ7A 1CT2E 1DXPA 4B71A 3TK6A 1THPB 4FUGA 2ODPA 3KHVA 3BTQE 1HPGA 2RA0A 3FFGA 5BRRE 4MPXA 3A81A 1BITA 3Q3KA 1AWFH 1HJ8A 1P02A 4J2YB 1AKSA 3GYMA 3SGQE 4FUJA 2TIOA 2XYAA 4H6SB 4E06H 1P2IA 6GCHG 2OCVB 3ESTA 1Z8RA 1AUTC 2ZDKA 2GCTB 2QCYA 3TGJE 1O2WA 1MZDA 2G8TA 4KP0A 1FIZA 1DY8A 5FCKA 2G5VA 1IHSH 4ISHH 4D7GA 3SJKA 2ZCKP 2JH6D 3LPRA 1GHVH 4INLA 4Y76A 4NA9H 2FODA 1MUEB 2FI3E 1SLWB 2OQ5A 4CRFA 4IS5A 3RC6A 1ANCA 2VGCB 2G4TA 5ESTE 3VXFH 2FM2A 1C5VA 4R8TB 3S9BA 4SGBE 1ZPBA 1ESAA 3KF2A 2BX4A 3U9AH 4CRBA 1YPKH 2Z9GA 1GI0A 1C1SA 1LPZB 1YC0A 2ULLA 2UWLA 3F9FA 2RG3A 1GHYH 4HZHA 2FLRH 5EQRA 1K1NA 5ABWA 3P8OA 1A5GH 4X8UH 1H9LB 5JB9S 1QR3E 1C5ZB 1ZTLA 4UDWH 1YGCH 4ZAEA 2BDCA 4NGAH 4X2XA 1K21H 1BMLA 2H9HA 3SNEA 1IQGA 3ZVAA 5EPNA 2Y6TA 3A80A 5GWZA 5B6OA 2ZQ1A 1BHXB 4CRCA 4DT7B 1E36B 2WUBA 4INKA 2Z9IA 1DVAH 1ZHMA 3E1XB 4M7GA 1RD3B 1H4WA 1NZQH 2W26A 2R2MB 4AORA 2FOFA 3B8JA 3A7WA 1C5WB 3P8FA 1QFKH 4CR9A 2WYGA 3MU8A 4Y7AA 4WJG2 3RLWH 2ZDVH 4I8KA 2BDBA 2ZTYA 4INHA 1MQ5A 1T7CA 1QNJA 1O37A 1O3GA 1AN1E 2A31A 1HJ9A 1D3TB 3A8AA 2FZZA 1O35A 1BRBE 2RCEA 3NUMA 3SU2A 1OX1A 1BMMH 4MNXA 1GJ5H 4K3JA 2VGCC 2STBE 1GJAB 4FU8A 2FS8A 4D7FA 1HCGA 1OWDA 3U1JB 1C5XB 2NWNA 4Y8ZA 1AB9B 1W14U 1HAPH 1GDUA 1PYTD 4CRGA 4AFQA 1DWCH 2FI4E 2DE8A 1TGCA 1BTPA 1UVOA 1BBRK 1KXAA 2FOHA 3EE0B 1ZOMA 3SJ9A 3SI4H 3P70B 3LGVA 1TX8A 3O8CA 1SGRE 2FI5E 1ZMJA 4OS5A 3TK9A 1DWDH 3A84A 1MBQA 3FZZA 1P3CA 4X8TH 1C1OA 4LZ1H 1FNIA 1QJ6B 2BHGA 2CMYA 1SGPE 4U01A 1GBJA 4B2BA 1EAXA 3P8GA 3RMNH 4NFEA 3TJOA 3SHCH 2BDIA 1BBRH 1JOUB 2C8WB 1NFYA 3QWCH 1C5NH 1C5YB 2Y5HA 1C2KA 1A0HB 1NT1A 4ZUHA 1SGEE 4NZQA 4U2WA 3TGKE 4U32A 1YPLH 3DFLA 1B0EA 1JRTA 5EXNA 1WTHD 3PTNA 1T4UH 1QL8A 1TMUH 4UE7H 2THFB 2Z94A 1K1LA 4YT6H 1G3EA 5A09A 4AYVB 1NPMA 3MH5A 1CT0E 1P11E 3MO9A 5TCAA 3ZZ7A 2A7CA 2VWMA 3NCLA 3BEIB 2HPPH 1RTKA 1KLJH 2J2UA 1ZHRA 4JMYA 1IQHA 8GCHF 1D3QB 1UK3A 1RTLA 3ZZCA 3ZZDA 3PWCA 5C67A 4XOJA 2OC8A 1O3MA 1A46H 5AF9H 3U8TH 4XBCA 3RC5A 3LGIA 4AYYB 3QZRA 2A4OA 5BPEA 3UOUA 1Y59T 1BRUP 3GICB 1SR5C 4O03A 3LGTA 2BY5X 1SLUB 2FIRH 3QN7A 5F8TA 5J4QA 1UO6A 1BBRE 1ZYOA 2VWOA 3MU4A 2ANYA 4FUIA 3A89A 3ZYEA 4BAMB 1N8OC 2W7SA 1NRSH 3LGWA 1EPTC 1B0FA 3KGPA 3SU5A 1RRKA 4ZHAA 4E05H 1QL9A 3MOCA 4NZLA 1XX9A 1SLXB 1OPHB 2ZI2H 3M35A 2FTMA 2O8WA 2GD4B 5JYIA 1QQUA 3RXVA 4D76A 4AG2A 4DJZB 1UVSH 2A5IA 4I31A 1GI7B 2B7DH 1Q3XA 1IQJA 3RU4D 1A5HA 1MKWH 3L33A 2OP9A 3T25A 1P09A 1VCQA 1EP5A 2FX4A 1GI1A 1DICA 2EI6A 1G3DA 1GBTA 3MU0A 3DFJA 3TGIE 4DIIH 5A0BA 3QLPH 4KELA 3UUZA 2WPHS 1CA0B 1GCDA 2HGTH 3RM2H 1CA0C 2CN0H 4K2YA 4GAWA 2AGIX 1W12U 1C9TA 3AW1A 3T27A 1G9IE 4I7YH 3V13A 1TNGA 4BAHB 3GCTG 3M36A 1O2TA 1NRRH 2XNIA 3PV4A 1HGTH 1WTGH 4JYVH 3M61U 2UWPA 1TBZH 4DGJA 3GY2A 4A1XA 1KDQA 2ZDLA 1AGJA 2VVUA 4MNWA 3VB5A 5EODA 4X6MA 3UWIA 1UTPA 2H9EH 4MNYA 1PPHE 1HAVB 3GY3A 2SGDE 3UNRA 2P94A 4FU7A 1U6QA 3EGKH 2VH0A 1NRQH 3GY4A 1AB9C 1XM1A 2BDYA 3MTYA 3T5FH 1W3CA 1CBWC 1EJNA 1YPHE 1YCPM 3MYWA 3RXCA 1IHTH 2J4IA 2FLBH 1CGIE 4IBLH 1AI8H 1Z8GA 3Q00A 1PPBH 1ELEE 3GY8A 2ZGCA 1GGDC 2VNTA 3LDXH 4MG3A 4OS6A 5DP9A 5J4SA 2Z3DA 1GHBF 1LKBA 1YBWA 1S6HA 3OYPA 4THNH 1ZHPA 2P8OB 4K1SA 7KMEH 4Y71A 3RXPA 2XWBI 4DW2U 1G3CA 1Z6JH 2AGGX 3A85A 3GCTF 4K60A 1F5KU 1S84A 1GJDB 1C9PA 3BTEE 4RKOB 4CRAA 5DKMA 4BOHA 1QHRB 1MU8B 1K9OE 1BRCE 4LK4A 1E37B 1QB6A 2ZU1A 3RLYH 3RMOH 1C2JA 2GCTC 1TBQH 4JZEH 1J9CH 1ZLRA 3RXSA 2CGAA 1O32A 3LKWA 6ESTA 1QRXA 1HAVA 1TNKA 2FO9A 1HAZB 4GSOA 1TNLA 2QXIA 1D4PB 2C93B 1FXYA 1KDQB 1KXCA 3QX5H 2ANKH 3RU4T 4CREA 4CH2B 4B2CA 1KXDA 1Y3WA 3R3GB 4JYUH 1FIWA 3A8DA 1O5GH 3I78A 3K6YA 3SW2B 5JBAS 2ZKSA 1O2GH 4YLQH 1BMAA 2V3OH 3PMHB 2NU1E 3QK1A 4CHAB 3STJA 3H7OA 2Z3EA 1O2HA 3KQBA 3BG4B 1O3DA 1BTXA 1SGTA 2VVCA 2XWAA 3TITA 1A0LA 4YESB 3QZQA 2BVSH 3E91A 3E90B 3SU6A 2AERH 1UMAH 1TLDA 2F9UA 4SGAE 3ATIA 3UR9A 1IQLA 4AB8A 4MPWA 2GKVE 1T8NA 1EKBB 1LQEA 1RIWC 3SJ8A 1C1NA 1T31A 1UTNA 4Y6DA 1V2TT 3CS0A 3TJVA 1AVXA 1TB6H 5C5OA 3MWIU 5I25A 2O8MA 1K2I1 2G52A 1SOZA 1TA2A 3AAVA 3AAUA 4Q7XA 4BXSA 3V12A 4O3TA 1A2CH 4FU9A 2M5TA 3GDUA 1GMDF 1TMBH 3OU0A 1FY4A 3TIUA 1FY8E 1GHBG 5AVDA 1BTYA 1SQAA 1QTFA 1V2PT 4E7NA 3BTTE 2ZDAH 3C1KA 4MQAA 3M5MA 5T3HA 2ZDMA 1AE8H 4DIHH 2G55A 3FP7E 2O8UA 4BTIB 1PQAA 2HVXA 3VGCC 1VITG 4AGKA 1O36A 1S81A 1ELVA 4X8VH 3BIVH 3MNXA 3K2UA 3ZZ4A 1OXGA 2QXGA 3JZ2B 1EZUC 1UHBA 1YPEH 2PTCE 3BTME 4X6NA 3V0XA 8GCHG 1Z1JA 1Y5BT 3OX7U 4ABDA 1W7XH 2IJOB 2FOAA 2FYRA 2XRCA 1EB2A 1CBWB 3K65B 2BD3A 1C1UH 3ELAH 2H9TH 1LVMA 1GJ9B 2QAAA 2JH0D 4OS2A 1L2EA 1OWKA 1G32B 1P9SA 1SGQE 1J16A 2Y81A 1O34A 2BM2A 3F9EA 4Y11E 1W13U 4MPVA 1GGDB 1BUIA 3UY9A 3ZYDA 1ACBE 1HAIH 1GBMA 2UUKB 3UNQA 3M7TA 3Q76A 1C5LH 1VZQH 3U69H 1L1NA 1HDTH 3ATKA 4UFFH 3M3TA 1FY5A 3ODDA 1ANEA 1MTWA 1C5OH 4Q7ZA 2VIQA 4YM9A 1V2RT 1PPZA 1RFNA 1WCZA 3PLKA 4FUCA 2R2WU 1BRAA 2OBOA 1WU1A 1W10U 2ZFFH 3T29A 5EXMA 4WXVA 1ZR0A 1AD8H 3A83A 1PPGE 4WMFA 1TOMH 1GBIA 2XTTB 1FI8A 4HTCH 5E2OA 5F8XA 2ZFQH 1VITH 1LCYA 4IN1A 1ESBA 1UK2A 1O2ZA 4MPUA 1ID5H 1QA0A 2QA9E 1MH0A 1YPHC 3A86A 2PFEA 5GCHF 1NU9A 2GT7A 3RXLA 1J17T 3A88A 3UNSA 1J14A 2W5EA 5GIBA 1EP6A 1ZGIA 3HK3B 1C5MD 4ZKRU 1EOLA 2VIOA 1F7ZA 2XBWA 1EUFA 2HRVA 2XW9A 3SNAA 2EI7A 1O5DH 4NIWA 2ALVA 4B1TA 1WBGB 2BD7A 3ATWA 2JETC 2NU3E 1JRSA 3QGNB 1B5GH 1P01A 1O3FA 1OWIA 3A7YA 3TVJB 3FVFB 2P3UB 1LPGB 2BD9A 1MKXH 4F4OC 2ZQ2A 1BA8B 1P2NA 1PQ7A 3GY6A 1V3XA 5AFZH 2TRMA 3U8OH 1O2UA 3LU9B 5A8XA 1E34B 1LVOA 5JDUB 3LT3A 1DT2A 1YP9A 4X6PA 3E0PB 3P8NA 3RMMH 1LHFH 2OQUA 3ODFA 1W11U 2H5DA 1SG8B 5L30H 3HGPA 1GVLA 1V2QT 1N8OB 2CXVA 2AYWA 2WPKS 4WH8A 1DSUA 1UVUH 2P16A 1TGTA 1V2KT 2QXJA 3A8BA 5JBBS 1IQEA 1FLEE 2GT8A 4GCHG 2VH6A 1RS0A 2XCFA 5LPFA 1VJAU 3MH4A 2CHAB 2H6MA 1K1PA 3MH6A 4B75A 4FVDA 3HGNA 4A92A 1ZMLA 5C1XA 1C2EA 2QF0A 3SQHE 1QL7A 5A0CA 1IQKA 1TAWA 4DOQA 2J95A 1UTKA 1GI5A 4RN6A 5EG4A 2FDAA 4O97A 5C1UA 2P3TB 2EI8A 2HALA 4R0IA 3MMGA 1GMHF 1VCPA 1IQNA 3HATH 1K1MA 1TPPA 1BCUH 4BANB 4H42U 1JXPA 1YKTA 4ZMAH 3SNBA 2ZDNA 3SHAH 2UWOA 2SGEE 3SU0A 3ZV9A 3LGYA 1ABIH 1GCTB 2AS9A 1HIAB 3L6PA 2G81E 1AKSB 3RUOA 1FPCH 3QDZB 1SGFA 2R0LA 4UEHH 3VXEH 4ESTE 2FP7B 2WINI 1FY1A 3PO1B 5K0HA 3TH4H 3EYDA 2BQ7B 3BN9A 3PO1C 1GVKB 1O3CA 3UQOA 1BJVA 1AIXH 3BSQA 5FAHA 1L1JA 2BMGB 4OS1A 1XVMA 3FANA 4MVNA 3U1IB 4AFZA 1S83A 2ODQA 1O3IA 4CRDA 1E38B 2F83A 1G37A 1ELBA 2O9QA 4FUBA 2ZNKH 3MNBA 1SBWA 1KTTB 2SGAA 2NU4E 2C4FH 1C4V2 2BDGA 1C2HA 2J92A 3RXOA 3SBKA 3TNSA 5F6MA 1IQFA 1ELTA 2D26C 1FJSA 4BAKB 3RXRA 1MTVA 3ZZAA 1NESE 5CHAC 3LH3A 2CV3A 2F9OA 4X1QU 1C2IA 2XCNA 3H5CB 1NROH 3SUDA 1BJUA 2CF8H 3MH7A 5EW1H 3VB7A 1F0RA 4MLFB 3QGJA 2TGAA 4K1TA 3RXAA 1O2PA 1G36A 3LONA 4XSKU 4Y7BA 4ABEA 4BAQB 2F9NA 4B73A 1F2SE 1SQOA 3KQCA 5C5NA 4PROA 2OBQA 2A2QH 2WV5A 1MQ6A 2HNTF 4LOYH 4UFGH 4XDEA 2BD5A 3K6ZA 5GDSH 3UQVA 2V0BA 1TQ0B 4ABHA 4DG4A 5C1YA 5GXPA 2GV6A 1ETSH 3F6UH 2FMJA 1EX3A 3EA9A 4ISLA 4OS4A 4WWYA 2G4UA 1GHAF 5CMXH 1O2YA 1O3NA 1TYNA 1LTOA 2A0QB 1DXWA 1EJMA 3O8BA 3DD2H 1TNJA 5DG6A 1XKBC 2V3HH 2W3KA 4BAOB 4TY6A 2CJIA 1OWJA 5HMAA 3TNTA 4JZDH 2BLQA 4ASHA 2D1JA 4X2YA 3OY5U 1PJPA 5FPTA 1V2LT 4IW4E 3M37A 1EAIA 3SV9A 2P8OC 4WMDA 1W7GH 1D6RA 1ZZZA 1C2MA 2YOLA 3RXDA 2QXHA 1JMOH 2HOBA 3SUEA 1HAHH 4YTAA 1GPZA 3ZVBA 3FZDA 1C2FA 1YPJH 1BMNH 3MU5A 1SSXA 2A7JA 2EA3A 2BZ6H 2F9BH 3MNSA 1YYY1 4F49A 3A7TA 1HXEH 3KQDA 1GI4A 4KGAA 1Y3YA 1MTUA 1SPJA 1YPGH 2V35A 1TA6A 3QO6A 3M7UA 4KTSA 2ZGXH 5A0AE 1V2ST 2QC2A 3GY5A 1SQTA 2GMTB 1HIAA 1O2OA 1ZSKA 2PTNA 2BLVA 1C1PA 1J15A 2QF3A 5EQSA 1ZSJA 4B74A 1O39A 2YNAA 1Y5AT 1V2MT 2IOTA 5EQQA 1K1IA 4Y0ZE 1H8DH 1LPKB 1TGNA 4NIVA 1H1BA 5A8YA 1C2LA 3CP7A 2Z9KA 2ZPQA 1FY3A 4UFDH 1GG6C 5TJXA 4CHAC 1ARCA 1DS2E 1E0FD 1O2RA 3SGAE 2I6SA 1UTLM 1GBCA 4HI3A 1IAUA 1CE5A 1ELAA 1KXFA 1Y8TA 3BTHE 4CBNA 7ESTE 1FDPA 1DE7H 5I46H 2VIPA 1Y5UT 1VGCC 5HYOA 4UD9H 4I8JA 3TLOA 2FESH 3P92A 1B7XB 3A87A 3SOSA 3SV6A 1P04A 2PWXA 1PQ8A 3B9FH 2SGQE 5JBCS 3A8CA 1GI3A 1PPEE 1Q2WA 1RGQA 1A3BH 2FOBA 1ZRBA 1ELDE 1NN6A 2ANWA 1TFXA 1GBDA 1O30A 1QBOA 1K1OA 4NA8A 4WXIA 5DGJA 5TCCA 4NIYA 1ZPCA 3C27B 2FEQH 2Z9LA 1GMCG 2LPRA 4A5TS 1EZQA 1QB9A 1JIRA 1ELGA 1BTWA 3QUMP 2TBSA 1W8BH 1ANDA 4XFQA 2FTLE 5HGGA 3LGUA 4ZHMU 2ZGJA 1C5RA 1ZJKA 4WF8A 3E6PH 3A7XA 3URDA 5F8ZA 4DCDA 2ZECA 3SJOA 1J8AA 3F9HA 2ZWLH 2BZAA 4BXWA 3ZZ6A 3MO6A 4B76A 2OD3B 4FUFA 1EPTA 2TGPZ 3UPEA 3ZV8A 1ZGVA 2VJ1A 2DE9A 1C4Y2 4H6TA 5E0JA 2XBXA 3JZ1B 3GY7A 3KN2A 7GCHG 2YNBA 2R3UA 3A7VA 2A1DB 3Q3XA 4MDSA 3UOPA 3GCOA 1UTJA 1O2JA 1BQYA 2BY9X 1MAYA 3AVZA 1GBEA 1TABE 2Y82A 4ABIA 1V6DA 2ZHWH 3BV9B 4CH8B 3BG4C 1X7AC 1L4ZA 2FOCA 2OUAA 2UUJB 1H9IE 3V3MA 2Y5FA 4Y10E 2PGQB 4RSPA 1WQSA 1ELFA 2BXTH 5E0HA 2VIVA 5E2PA 1HRTH 2PUXB 3D49H 1IOEA 1O2QA 4WY3A 4YOGA 5FHTA 2C90B 2GZ8A 3RXEA 4NCYA 1P3EA 2ZFPH 4AFUA 1C5SA 1XXDA 2R0KA 1Y3XA 2GV7A 3I77A 1AMHA 3GCNA 2RA3A 2WYJA 1SLVB 4O9VA 4GHTA 5HM9A 1IQIA 3QTVH 1MU6B 1A7SA 1EB1H 1E35B 1NRNH 1TQ7B 2HWLB 3U98H 1YLCA 1CGHA 2BD4A 1CGJE 1DWBH 1MTNB 2ALPA 4GPGA 1QB1A 2PR3A 1CQQA 1D6WA 5L2YH 3W94A 1A0JA 4AN7A 1UHBB 4I32A 2WPLS 2OXSA 1S82A 3VGCB 3VEQB 5LPEA 4B2AA 2A7HA 1UCYE 4JK6A 4NG9H 4JCNA 1TRMA 3VFEA 1UTMA 3M3SA 1S0RA 2O8TA 1ZTKA 4DVAU 2BQ6B 3SU1A 7GCHF 1HAOH 4X2WA 4GCHF 2OTVA 4VGCC 1HUTH 2Q6GA 2PHBA 1YPMH 1GHAG 1YF4A 3KL6A 3BTFE 5DP6A 2ZCHP 1Q31A 6CHAC 3MI4A 3S9CA 3UREA 2ZEBA 2FS9A 1O2NA 4KTCA 2PKAB 3RXHA 1AZZA 2A45B 3S7KB 1EQ9A 2G51A 5CE1A 5SGAE 3PTBA 4X6OA 3SUGA 1GJ6A 3HKIB 1LO6A 2PKSB 1A4WH 1PQ5A 5ETXA 1C1RA 1P8VC 3U8RH 1SFQB 1AO5A 3EA7A 4K69A 2G5NA 4JZIA 1O5FH 3RXIA 1K22H 3PMBB 1OOKB 1MTNC 3OSYA 4FUDA 3DHKH 3FAOA 3ZVGA 1GBFA 1HB0B 2VVVA 4X1NU 3WY8A 1YCPK 1FONA 2JETB 2TPIZ 2F91A 4GUXA 4YOIA 2Y7XA 2ZHFH 4AB9A 5ESBA 2QV1A 2BVRH 2ZPSA 3M5LA 1TWXB 1C1MA 4YT7H 2LNCA 1YM0A 4NSYA 1VGCB 2B8OH 1NTPA 1T8LA 1BT7A 1GJ7B 2VB0A 5L2ZH 3EAJA 1GI9B 2AIQA 1MTSA 2A32A 1DSTA 1HXFH 1THSH 1DPOA 5AFYH 1SB1H 4BTTB 1ESTA 2A4GA 3LC3A 4Q7YA 3MU1A 1KYNA 2Q6FA 3EDXB 3GDVA 1XUGA 4AFSA 2VWLA 4ABGA 3CENA 5G4BA 3LH1A 2BX3A 1EJAA 1D3DB 1O5CB 1F0UA 1TPAE 2GMTC 2ZA5A 1HJAB 1NO9H 3SNDA 2EEKA 2A4QA 3Q77A 3BF6H 1P57B 3T28A 2RDLA 1WV7H 2DUCA 2PSYA 1D9IA 4ZXXH 2XC4A 3D62A 1LQDB 4Z6AH 1UVPA 3RXTA 2GZ9A 3UIRA 3H7TA 2I6QA 3L3TA 2A2XH 1ZRKA 4ZKOU 1S85A 3TU7H 2BD2A 4GLYA 1K1JA 3SQEE 3NWUA 3LOXA 4E7RG 4K8BA 1MAXA 1BZXE 5EOKA 3IWMA 1DLEA 1SFIA 3AASA 1GI8B 1C5QA 1QJ7B 4H4FA 3NXPA 3TH2H 1O31A 1MKXK 1HLTH 3RC4A 4DY7B 1KXBA 1OYQA 3PM3A 1VR1H 3O8DA 2SFAA 2JH5D 2ZHQH 4TWWA 2Z6BD 1EAUA 1SGNE 2ZGHA 1EATA 1PPCE 2BOKA 2XBVA 4I8LA 4YOJA 1TNIA 1VCWA 4X1RU 3UFAA 1N6YA 2BB4A 6CHAB 4OS7A 9ESTA 3M5NA 1O3EA 1MBMA 1V2OT 3E8LA 1T32A 4Q80A 2AFQB 2TGDA 4A1TA 1CHOG 2A5AA 2XC5A 1AVGH 2GVFA 2HNTC 3M3VA 1AZ8A 1MKWK 3BG8A 3BIUH 1RIWB 4ZH8A 1BHXF 3T2NA 2GX4A 4I8HA 1L4DA 2ZTZA 1GMHG 5H4IB 4X1PU
chains in the Genus database with same CATH superfamily
1FUJA 1S5SA 2Y7ZA 4M9FA 2D8WA 3SV7A 4CR5A 2ODYB 3UR6A 4NWLA 5EJLA 5LH8A 4IC5A 3ZZ5A 3ZVCA 5T6GA 1SHHB 1T8MA 2NU0E 3SU4A 2FOMB 1G2LA 3HKJB 1PYTC 2BLWA 3P95A 2VU8E 1F0SA 1O3PB 1FV9A 4X2VA 2H2ZA 1O3HA 4Z0KA 1QBVH 2ZU5A 1P06A 2ZG0H 3BTKE 1HNEE 1XUKA 5A2MH 1Z7KA 3DT0H 3OTJE 3FP8E 2PV9B 2BOHB 3STIA 3D23A 2SGPE 1GL0E 4NFFA 5PTPA 1W0KD 5FXLA 4UONA 1SGYE 2K1QA 4RKJB 1JWTA 1OS8A 5T6DA 1YWUA 1ZMNA 1O33A 4ZXYH 1FX0B 5E0GA 3RXBA 2QYIA 5C3NA 1C1TA 1HAXB 1YLNA 1RXPA 2FOGA 2J5UA 1FAXA 3NKKA 4ABFA 4Z1MD 3DUXH 2ZFSA 3FP6E 1A3EH 3MFJA 4IMZA 1GMCF 1O3KA 4FOUC 1Z8IB 2JJ2D 3Q3YA 2SGFE 2SNWA 3SV2H 1Y3VA 5FBEA 3PWBA 1NM6A 1P2MA 3ZZ8A 1TNHA 4RT1A 3OEHD 3PMAB 4VGCB 2BXUH 1CHOF 4NA7A 3DA9B 2L74A 1KXEA 4K8YA 3T62A 4D9QA 1ELCA 1HAYB 3PRDA 2BY8X 5HXFA 4ZHLU 3KCGH 1SQRA 3RU4E 2ZPRA 2P59A 5KEDA 1O3BA 1WOFA 3RXKA 3SNCA 5JPMH 4B6FA 1CT4E 1GG6B 4X1SU 4WVPE 4X8SH 2LP6A 3TPIZ 3EE7A 4K1EA 1AY6H 4JZ1A 4I8GA 1SL3A 3URCA 2BQWB 1TPSA 4OGXA 1Z71A 1WAYB 3E16B 3OEED 3ZVFA 1EASA 7LPRA 3SI3H 3V7TA 5FCRA 1C4U2 3BTGE 2P95A 1VJ9U 1ABJH 1C1QA 1OWHA 1XUFA 1Y3UA 3KEEA 1GVZA 2KCPA 3OY6U 2GDDA 3LC5A 4TPIZ 1NFUA 2ZCLP 8ESTE 1QRZA 1PFXC 2IN2A 4FVBA 1N6XA 4IMQA 4J1YA 1HFDA 2G00A 4Y79A 2ESTE 1O2SA 1DUAA 1P05A 2R3YA 3BTWE 1KLIH 3PROA 1TRYA 5EW2H 4AG1A 2AH4X 1LHGH 3E0NB 1TONA 1NRPH 3M7QA 5FPSA 2WPMS 1TOCB 1ZTJA 4X0WU 1LMWB 5GJ4B 1HV7A 1TBRH 3PMJA 1SMFE 1F92A 2FOEA 3ATMA 2ASUB 3N7OA 3S69A 1T4VH 3O8RA 3UTUH 1O2IA 1IQMA 1OP8A 1OSSA 1W2KH 1BTZA 2VIDA 1G30B 2OC0A 2AMPA 2GCHF 2PW8H 2QGRA 1SC8U 4RT0A 2VINA 3N7EA 1H8IH 3KIDU 5DP4A 3UWJH 2TGTA 2RFKC 2W7UA 5T6FA 5B6LA 1HAGE 1QURH 2WPJS 2ZFTA 3EQ0H 2BYAX 4B6EA 2PKSC 1XVOA 3F2GA 1O2XA 2FXRA 4WMEA 5FBIA 2AIPA 3F1SB 3RXQA 1KTSB 1CHGA 1DDJA 1XUJA 1MZAA 1NFWA 2Q6DA 2W3IA 3PLBA 5EXLA 2KAIB 1JBUH 2J98A 3MO3A 1ZJDA 2J97A 4K5ZA 1XUHA 1MCVA 4ABBA 1GI2A 1L1GA 2BY7X 1BOQA 1DANH 1TMTH 2PLXA 4ZKNU 2CHAC 2PGBB 4FXGH 4NWKA 2J94A 1GBHA 2AMQA 2Z3CA 2H1UA 3GDSA 1A61H 2BDAA 1ORFA 3DSPA 4JK5A 2V6NA 2A4RA 1F5RA 4A1VA 5DK1A 2ZFRH 3HK6B 3SJIA 4Q2KA 4JYTA 1ETRH 2HNTE 1DWEH 5HM2A 1C5PA 1A5IA 2BLOA 2QIQA 3W95A 3ENSB 5GPIB 3TJNA 4F55A 3RDZA 2B0FA 2GDEH 6LPRA 2FX6A 4NSVA 2PUQH 1C5TA 3LIWA 4OGYA 2V7QD 2ZGBH 1V2JT 3ZIAD 2P3FH 2WZQA 2KAIA 5DP5A 5DJ7A 1GI6A 2GGVB 1TIOA 2ZO3H 1F5LA 1QGFA 1S0QA 4BNRA 3EA8A 2HLCA 1G2MA 1T8OA 1UJ1A 1UCYK 1XMNB 5IDKA 1DLKB 1ZPZA 4ISIH 1SOTA 1KSNA 5DP7A 1OP2A 4Y8YA 3ZVEA 1C1VH 3A82A 1UTOA 3RM0H 3PLPA 1S6FA 1WDIA 3NPSA 1AVWA 2D2DA 3F9GA 2F9VA 4O3UA 2GP9B 1O5AB 1NFXA 2J38A 1SGDE 1THRH 2H5CA 3SGBE 1CU1A 1WYKA 1FMGA 1GJCB 1CO7E 1P10A 1W0YH 2Y80A 4D8NA 1XXFA 2OINA 3SN8A 4YLUA 3SV8A 4JZFH 1N1LA 3QTOH 1HBTH 3PB1E 3ZZ3A 3T26A 2B5TB 6GCHF 3PV2A 3RP2A 1GCTC 3WWFA 2ZIQH 4FUEA 4I86A 1PPFE 5CHAB 8KME2 5DO4H 1EAWA 1FZZA 1O2LA 2QN5T 5FPYA 1ZSLA 3UB0A 1BTUA 1SHYA 4TY7A 1YCPH 3IITA 2F9PA 2STAE 5LPRA 1V2UT 2BVXH 2A5KA 4KTUA 1DOJA 2C8ZB 1LHCH 4ZKSU 4ASUD 1P12E 2VIWA 1BB0B 3A7ZA 3FO8D 1V2VT 1AFQB 1CSOE 2ZU4A 5GCHG 1O3AA 3TJUA 3B23B 1TX6A 3W1EA 2XBYA 3R0FA 2CF9H 3LJOA 1P2KA 4DURA 1O3JA 4Y8XA 5E8EH 1GJ8B 2ZU2A 1TGBA 3IG6B 5C20A 1G3BA 1UTQA 3SO3A 1ANBA 4ABJA 1DITH 3GISB 5A8ZA 3DSGA 3ZZBA 1MD8A 3KNXA 1GDQA 4IC6A 1AFEH 4TWYA 2B9LA 1O5BB 5AHGH 3ZVDA 1TPOA 2FWWA 2UUYA 2XXLA 4IN2A 4WH6A 4A6LA 3GOVB 1M9UA 1WQVH 2UUFB 3SZEA 1QA7A 1XUIA 2GTBA 1EZXC 4XE4A 3SORA 1NC6A 1KY9A 2PKAA 1QBNA 3TH3H 1GJ4H 4Y0YE 2OC7A 2BY6X 2FPZA 2VWNA 4AGJA 1O2MA 5IYTA 5EGMA 1WSSH 1P2JA 4TPYA 1C2DA 1W0ZU 3VPKA 4AOQA 1NU7B 1Z8JB 1DUEA 4GVUA 1KIGH 1MD7A 2NU2E 4XBDA 3KQ5A 3RXUA 1QY6A 3D65E 1V2WT 2QY0B 1Z1IA 3F0PA 4XBBA 1AFQC 1OYTH 1NBMD 1O3LA 5DP8A 1GHZA 3BEUA 3VB4A 1SGFG 2C3SA 2J98B 1TALA 1TGSZ 1VITF 2BDHA 1GDNA 1GMDG 2AMDA 3AW0A 4U30A 1GBBA 2R9PA 2AGEX 4TYDA 1QQ4A 3S0NA 5DP3A 1SVPA 1TRNA 2ZHEH 1Z6EA 1QRWA 1LKAA 3E3TA 2C8XB 3LJJA 2ZHDA 3VB6A 1D3PB 1H9HE 1BDAA 1CVWH 1SGIB 2WUCA 1LHDH 2PSXA 1O2KA 1CA8B 3SU3A 1INCA 1TX7A 3RXJA 1FN8A 2EC9H 3F68H 4BTUB 4ISOA 3P6ZB 1QCPA 4HGCA 1O0DH 1AWHB 2Z7FE 1C5UA 1O2VA 2FYQA 1YLDA 3BTDE 2WPIS 4YZUA 1BIOA 1FN6A 3TK5A 3GYLB 4MTBA 1P03A 1NS3A 1TE0A 5FX6A 2ZTXA 3M5OA 4LXBH 2BD8A 8LPRA 1AUJA 3NK8A 1OWEA 2ILNA 1LVBA 3ITIA 1BTHH 5L6NH 1XKAC 4A7IB 3SZNA 1K28D 4LZ4B 3ATLA 5JBTA 4ISNA 1DX5M 3K9XB 2GZ7A 1EOJA 2WV4A 2OC1A 1OKXA 5K7RA 1V2NT 2XC0A 5GNDA 1AHTH 3SUFA 1JIMA 2Y5GA 3GCHB 1EFRD 1LDTT 4MNVA 1DM4B 1GJBB 2ZF0H 1P0SH 4AZ2B 5C0TA 1FQ3A 1WUNH 1H8HD 3HPTB 5LGOA 1O38A 1EZSC 1O5EH 2ZZUH 4D9RA 2GCHG 4HFPB 1GWAA 2Q1JA 3KQEA 4XD7D 1OP0A 4ZROA 3ZZ9A 5IK2D 1UK4A 3BEFB 1QZ8A 4KKDA 3S7HB 3RXMA 3P17H 1P2QA 1EPTB 1MMJN 4AX9H 5C2ZA 1GL1A 2C8YB 2HVYB 1RJXB 1AU8A 1QJ1B 3NZIA 5FX5A 1ETTH 2Z9JA 3VB3A 9LPRA 1A1RA 5DPAA 4FUHA 1AE5A 4NIXA 1QIXB 5EU8A 1OHHD 1FAKH 4ABAA 1GBLA 1P2OA 1ARBA 2HPQH 1GBKA 3GCHC 2ZP0H 3MNCA 3OFND 1GBAA 2J9NA 1P9UA 1FPHH 4CBOA 2AEIH 4I33A 4GHQA 4QT8C 2O8LA 1E1RD 3PYHA 2IPHA 1HJAC 2JKHA 3MHWU 4UFEH 2OLGA 4YO9A 1KLTA 1C2GA 1UVTH 2J34A 3G01A 1HYLA 1C1WH 5F03A 1UCYH 1GHWH 3RMLH 1LHEH 2ANMH 3I29A 3S9AA 2ZU3A 2ZC9H 5EPYA 1DY9A 2BTCE 2F3CE 1DFPA 2P93A 3RXFA 5JB8S 2SNVA 1LVYA 1NY22 1SGCA 1O3OA 1EXFA 1MCTA 3RXGA 3CS7A 1SI5H 1F0TA 1GHXH 1L0ZA 4IGDA 1RTFB 1AQ7A 1CT2E 1DXPA 4B71A 3TK6A 1THPB 4FUGA 2ODPA 3KHVA 3BTQE 1HPGA 1VKYA 2KCAA 2RA0A 3FFGA 5BRRE 4MPXA 3A81A 1BITA 3Q3KA 1AWFH 2CK3D 1HJ8A 1P02A 2M2AA 4J2YB 1AKSA 3GYMA 3SGQE 4FUJA 2TIOA 2XYAA 1W0JD 4H6SB 4E06H 1P2IA 6GCHG 2OCVB 3ESTA 1Z8RA 1AUTC 2ZDKA 2GCTB 2QCYA 3TGJE 1O2WA 1MZDA 2G8TA 4KP0A 1FIZA 1DY8A 5FCKA 2G5VA 1IHSH 4ISHH 4D7GA 2F4LA 3SJKA 2ZCKP 4FETA 2JH6D 3LPRA 1GHVH 4INLA 4Y76A 4NA9H 2FODA 1MUEB 2FI3E 1SLWB 2OQ5A 4CRFA 4IS5A 3RC6A 1ANCA 2VGCB 2G4TA 5ESTE 3VXFH 2FM2A 1C5VA 4R8TB 3S9BA 4SGBE 1ZPBA 1ESAA 3KF2A 2BX4A 3U9AH 4CRBA 1YPKH 2Z9GA 1GI0A 1C1SA 1LPZB 1YC0A 2ULLA 2UWLA 3F9FA 2RG3A 1GHYH 4HZHA 4RI0A 2FLRH 5EQRA 1K1NA 5ABWA 3P8OA 1A5GH 4X8UH 1H9LB 5JB9S 1QR3E 1C5ZB 1ZTLA 4UDWH 1YGCH 4ZAEA 3U28C 2BDCA 4NGAH 4X2XA 1K21H 1BMLA 2H9HA 3SNEA 1IQGA 3ZVAA 5EPNA 2Y6TA 3A80A 5GWZA 5B6OA 2ZQ1A 1BHXB 4CRCA 4DT7B 1E36B 2WUBA 4INKA 2Z9IA 1DVAH 1ZHMA 3E1XB 4M7GA 1RD3B 1H4WA 1NZQH 2W26A 2R2MB 4AORA 2PP6A 2VBCA 2FOFA 3B8JA 5CDFE 3A7WA 1C5WB 3P8FA 1QFKH 4CR9A 2WYGA 3MU8A 4Y7AA 4WJG2 3RLWH 2ZDVH 4I8KA 2BDBA 2ZTYA 4INHA 1MQ5A 1T7CA 1QNJA 1O37A 1O3GA 1AN1E 2A31A 1HJ9A 1E1QD 1D3TB 3A8AA 2FZZA 1O35A 1BRBE 2RCEA 2XNDD 3NUMA 4AC9A 3SU2A 3N7DA 1OX1A 1BMMH 1S6LA 2HLDD 4MNXA 1GJ5H 4K3JA 2VGCC 2STBE 1GJAB 4FU8A 2FS8A 4D7FA 1HCGA 1OWDA 3U1JB 1C5XB 2NWNA 4HG6A 4Y8ZA 1AB9B 1W14U 1HAPH 1GDUA 1PYTD 4CRGA 4AFQA 1DWCH 2FI4E 2DE8A 3WW7A 1TGCA 3KYFA 1BTPA 1UVOA 1BBRK 1KXAA 2FOHA 3EE0B 1ZOMA 3SJ9A 3SI4H 3P70B 3LGVA 1TX8A 3O8CA 1SGRE 2FI5E 1ZMJA 4OS5A 3TK9A 1DWDH 3A84A 1MBQA 3FZZA 1P3CA 4X8TH 1C1OA 4LZ1H 1FNIA 1QJ6B 2BHGA 2CMYA 1SGPE 4U01A 1GBJA 4B2BA 5EJZA 3N99A 1EAXA 3P8GA 3RMNH 4NFEA 3TJOA 3SHCH 2BDIA 1BBRH 1JOUB 2C8WB 1NFYA 3QWCH 1C5NH 1C5YB 2Y5HA 1C2KA 1A0HB 1NT1A 4ZUHA 1SGEE 4NZQA 4U2WA 3TGKE 4U32A 1YPLH 3DFLA 1B0EA 1JRTA 5EXNA 4Q63A 1WTHD 3H09A 3PTNA 1T4UH 1QL8A 1TMUH 4UE7H 2THFB 2Z94A 1K1LA 4YT6H 3DCLA 1G3EA 5A09A 4AYVB 1NPMA 3MH5A 1CT0E 1P11E 3MO9A 5TCAA 3ZZ7A 2A7CA 2VWMA 3NCLA 3BEIB 2HPPH 1RTKA 3KYGA 1KLJH 2J2UA 1ZHRA 4JMYA 1IQHA 8GCHF 1D3QB 1UK3A 1RTLA 3ZZCA 3ZZDA 3PWCA 5C67A 4XOJA 2OC8A 1O3MA 1A46H 5AF9H 3U8TH 4XBCA 3RC5A 3LGIA 4AYYB 3QZRA 2A4OA 5BPEA 3UOUA 1Y59T 1BRUP 3GICB 1SR5C 4O03A 3LGTA 2BY5X 1SLUB 2FIRH 3QN7A 5F8TA 5J4QA 1UO6A 1BBRE 1ZYOA 2VWOA 3MU4A 2ANYA 4FUIA 3A89A 3ZYEA 4BAMB 5C94A 1N8OC 2W7SA 1NRSH 3LGWA 1EPTC 1B0FA 5F53A 3KGPA 3SU5A 1RRKA 4ZHAA 4E05H 1QL9A 5DN6D 3MOCA 4NZLA 1XX9A 1SLXB 1OPHB 2ZI2H 3M35A 4TSFD 2FTMA 2O8WA 2GD4B 5JYIA 1QQUA 3RXVA 4D76A 4AG2A 4DJZB 1UVSH 2A5IA 4I31A 1GI7B 2B7DH 1Q3XA 1IQJA 3RU4D 1A5HA 1MKWH 3L33A 2OP9A 3T25A 1P09A 1VCQA 1EP5A 2FX4A 1GI1A 4DT4A 1DICA 2EI6A 1G3DA 1GBTA 3MU0A 3DFJA 3TGIE 4DIIH 5A0BA 3QLPH 4KELA 3UUZA 2WPHS 1CA0B 1GCDA 2HGTH 3RM2H 1CA0C 2CN0H 4K2YA 4GAWA 2AGIX 1W12U 1C9TA 3AW1A 3T27A 1G9IE 4I7YH 3V13A 1TNGA 4BAHB 3GCTG 3AK5A 3M36A 1O2TA 1NRRH 2XNIA 5C17A 4YXWD 3PV4A 1HGTH 1WTGH 4JYVH 3M61U 2UWPA 1TBZH 4DGJA 3GY2A 4A1XA 1KDQA 2ZDLA 1AGJA 2VVUA 4MNWA 3VB5A 5EODA 4X6MA 3UWIA 1UTPA 2H9EH 4MNYA 1PPHE 1HAVB 3GY3A 2SGDE 2LELA 3UNRA 2P94A 4FU7A 1U6QA 3EGKH 2VH0A 1NRQH 3GY4A 1AB9C 2EY4C 1XM1A 2BDYA 3MTYA 3T5FH 1W3CA 1CBWC 1EJNA 1YPHE 1YCPM 3MYWA 3RXCA 1IHTH 2J4IA 2FLBH 1CGIE 4IBLH 1AI8H 1Z8GA 3Q00A 1PPBH 1ELEE 3GY8A 2ZGCA 1GGDC 2VNTA 3LDXH 4MG3A 4OS6A 5DP9A 5J4SA 2Z3DA 1GHBF 1LKBA 1YBWA 1S6HA 3OYPA 4THNH 1ZHPA 2P8OB 4K1SA 7KMEH 4Y71A 3RXPA 2XWBI 4DW2U 1G3CA 1Z6JH 2AGGX 3A85A 3GCTF 4K60A 1F5KU 1S84A 1GJDB 1C9PA 3BTEE 4RKOB 4CRAA 5DKMA 4BOHA 1QHRB 1MU8B 1K9OE 1BRCE 4LK4A 1E37B 1QB6A 2ZU1A 3RLYH 3RMOH 1C2JA 5KECA 2GCTC 1TBQH 4JZEH 1J9CH 1ZLRA 2KCOA 3RXSA 2CGAA 1O32A 2YMSB 4TT3D 3LKWA 6ESTA 1QRXA 1HAVA 1TNKA 2FO9A 1HAZB 2KCYA 4GSOA 1TNLA 2QXIA 1D4PB 2C93B 1FXYA 1KDQB 1KXCA 3QX5H 2ANKH 3RU4T 4CREA 4CH2B 2JJ1D 4B2CA 1KXDA 1Y3WA 3R3GB 4JYUH 1FIWA 3A8DA 1O5GH 3I78A 3WWBA 3K6YA 3SW2B 5JBAS 2ZKSA 1O2GH 4YLQH 1BMAA 2V3OH 3PMHB 2NU1E 3QK1A 4CHAB 3STJA 5C0UA 3H7OA 2Z3EA 1O2HA 3KQBA 3BG4B 1O3DA 1BTXA 1SGTA 2VVCA 2XWAA 1KMHB 1A0LA 3TITA 4YESB 2W6ID 3QZQA 2BVSH 3E91A 3E90B 3SU6A 2AERH 1UMAH 1TLDA 2F9UA 4SGAE 3ATIA 3UR9A 1IQLA 4AB8A 4MPWA 2GKVE 1T8NA 1EKBB 1LQEA 1RIWC 3SJ8A 1C1NA 1T31A 1UTNA 2KM0A 4Y6DA 1V2TT 3CS0A 3TJVA 1AVXA 1TB6H 5C5OA 3MWIU 5I25A 2O8MA 1K2I1 2G52A 1SOZA 1TA2A 3AAVA 3AAUA 4Q7XA 4BXSA 3V12A 4O3TA 1A2CH 2YMSD 4FU9A 5HIYA 2M5TA 3GDUA 1GMDF 1TMBH 3OU0A 1FY4A 3TIUA 1FY8E 1GHBG 5AVDA 1BTYA 1SQAA 1QTFA 1V2PT 4E7NA 3BTTE 2ZDAH 3C1KA 4MQAA 3M5MA 5T3HA 2ZDMA 1AE8H 4DIHH 2G55A 3FP7E 2O8UA 4BTIB 1PQAA 2HVXA 3VGCC 1VITG 4AGKA 1O36A 1S81A 1ELVA 4X8VH 3BIVH 3MNXA 3K2UA 3ZZ4A 1OXGA 2QXGA 3JZ2B 1EZUC 1UHBA 1YPEH 2PTCE 3BTME 4XRNA 4X6NA 3V0XA 8GCHG 1Z1JA 1Y5BT 3OX7U 4ABDA 1W7XH 2IJOB 2FOAA 2FYRA 2XRCA 1EB2A 1CBWB 3K65B 2BD3A 1C1UH 3ELAH 2H9TH 1LVMA 1GJ9B 2QAAA 2JH0D 4OS2A 4ZCNA 1L2EA 1OWKA 1G32B 1P9SA 1SGQE 1J16A 2Y81A 1O34A 2BM2A 3F9EA 1UW7A 4Y11E 1W13U 4MPVA 1GGDB 1BUIA 3UY9A 3ZYDA 1ACBE 1HAIH 1GBMA 2UUKB 3UNQA 3M7TA 3Q76A 1C5LH 1VZQH 3U69H 1L1NA 1HDTH 3ATKA 4UFFH 3M3TA 1FY5A 1NBME 3ODDA 1ANEA 1MTWA 1C5OH 4Q7ZA 2VIQA 4YM9A 1V2RT 1PPZA 1RFNA 1WCZA 3PLKA 4FUCA 2R2WU 1BRAA 2OBOA 1WU1A 1W10U 2ZFFH 3T29A 5EXMA 4WXVA 1ZR0A 1AD8H 3A83A 1PPGE 4WMFA 1TOMH 1GBIA 2XTTB 1FI8A 4HTCH 5E2OA 5F8XA 2ZFQH 1VITH 1LCYA 4IN1A 2WPDD 1ESBA 1UK2A 1O2ZA 4MPUA 1ID5H 1QA0A 2QA9E 1MH0A 1YPHC 2QF4A 2PFEA 3A86A 5GCHF 1NU9A 2GT7A 3RXLA 1J17T 3A88A 3SYJA 3UNSA 1J14A 2W5EA 5GIBA 1EP6A 1ZGIA 3HK3B 1WXRA 1C5MD 4ZKRU 1EOLA 2VIOA 1F7ZA 2XBWA 1EUFA 2HRVA 2XW9A 3SNAA 2EI7A 1O5DH 4NIWA 2ALVA 4B1TA 1WBGB 2BD7A 3ATWA 2RDEA 2JETC 2NU3E 1JRSA 3QGNB 1B5GH 1P01A 1O3FA 1OWIA 3A7YA 3TVJB 3FVFB 3FKSD 2P3UB 1LPGB 2BD9A 1MKXH 4F4OC 2ZQ2A 1BA8B 1P2NA 1PQ7A 3GY6A 1V3XA 5AFZH 2TRMA 3U8OH 1O2UA 3LU9B 5A8XA 1E34B 1LVOA 5JDUB 3LT3A 1YY3A 1DT2A 1YP9A 4X6PA 3E0PB 3P8NA 3RMMH 1LHFH 2OQUA 3ODFA 1W11U 2H5DA 1SG8B 5L30H 3HGPA 1GVLA 1V2QT 1N8OB 2CXVA 2AYWA 2WPKS 4WH8A 1DSUA 3CNRA 1UVUH 2P16A 1TGTA 1V2KT 2QXJA 3A8BA 5JBBS 1IQEA 1FLEE 2GT8A 4GCHG 2VH6A 1RS0A 2XCFA 3PV5A 5LPFA 1VJAU 3MH4A 2CHAB 2H6MA 1K1PA 3MH6A 4B75A 4FVDA 3HGNA 4A92A 5T1VA 1ZMLA 5C1XA 3F0OA 1C2EA 2QF0A 3SQHE 1QL7A 5A0CA 3OAAD 1IQKA 1TAWA 4DOQA 2J95A 1UTKA 1GI5A 4RN6A 5EG4A 2FDAA 4O97A 5C1UA 2P3TB 2EI8A 2HALA 4R0IA 3MMGA 1GMHF 2K8IA 1VCPA 1IQNA 3HATH 1K1MA 1TPPA 1BCUH 4BANB 2JIZD 4H42U 1JXPA 1YKTA 4ZMAH 3SNBA 1H8ED 2ZDNA 3SHAH 2UWOA 2SGEE 3SU0A 3ZV9A 3LGYA 2XOKD 5CHBA 1ABIH 1GCTB 2AS9A 1HIAB 3L6PA 4P00A 2G81E 1AKSB 3RUOA 1FPCH 3QDZB 1SGFA 2R0LA 4UEHH 3VXEH 4ESTE 2FP7B 2WINI 1FY1A 3PO1B 5K0HA 3TH4H 3EYDA 2BQ7B 3BN9A 3PO1C 1GVKB 1O3CA 3F2FA 2KR7A 3UQOA 1BJVA 1AIXH 3BSQA 5FAHA 2WV9A 1L1JA 2BMGB 4OS1A 1XVMA 3FANA 4MVNA 3U1IB 4AFZA 1S83A 2ODQA 1O3IA 4CRDA 1E38B 2F83A 1G37A 1ELBA 2O9QA 4FUBA 2ZNKH 3MNBA 1SBWA 1KTTB 2SGAA 2NU4E 2C4FH 1C4V2 2BDGA 1C2HA 2J92A 3RXOA 3SBKA 3TNSA 5F6MA 1IQFA 1ELTA 2D26C 1FJSA 4BAKB 3RXRA 1MTVA 3ZZAA 1NESE 5CHAC 3LH3A 2CV3A 2F9OA 4X1QU 1C2IA 2XCNA 3H5CB 1NROH 3SUDA 1BJUA 2CF8H 3MH7A 5EW1H 3VB7A 1F0RA 4MLFB 3QGJA 2TGAA 4K1TA 3RXAA 1O2PA 1G36A 3LONA 4XSKU 4Y7BA 4ABEA 4BAQB 2F9NA 4B73A 1F2SE 1SQOA 3KQCA 5C5NA 4PROA 2OBQA 2A2QH 2WV5A 1MQ6A 2HNTF 4LOYH 4UFGH 4XDEA 2BD5A 3K6ZA 5GDSH 3UQVA 2V0BA 1TQ0B 2F43B 4ABHA 4DG4A 5C1YA 5GXPA 2GV6A 1ETSH 3F6UH 2FMJA 1EX3A 3EA9A 4ISLA 4OS4A 4WWYA 2G4UA 1GHAF 5CMXH 1O2YA 1O3NA 1TYNA 1LTOA 2A0QB 1DXWA 1EJMA 3O8BA 2WHXA 3DD2H 1TNJA 5DG6A 1XKBC 2V3HH 2W3KA 2V3MA 4BAOB 4TY6A 2CJIA 1OWJA 5HMAA 3TNTA 4JZDH 2BLQA 4ASHA 2D1JA 2QE7D 4X2YA 3OY5U 3PRBA 1PJPA 5FPTA 1V2LT 4IW4E 3M37A 1EAIA 3SV9A 2P8OC 4WMDA 1W7GH 1D6RA 4P02A 1ZZZA 1C2MA 2YOLA 3RXDA 2QXHA 1JMOH 2HOBA 2QF5A 3SUEA 1HAHH 4YTAA 1GPZA 3ZVBA 3FZDA 1C2FA 1YPJH 1BMNH 3MU5A 1SSXA 2A7JA 2EA3A 2KX4A 2BZ6H 2F9BH 3MNSA 5HIZA 1YYY1 4F49A 3A7TA 1HXEH 3KQDA 1GI4A 4KGAA 1Y3YA 1MTUA 2GJGA 1SPJA 1YPGH 2V35A 1TA6A 3QO6A 3M7UA 4KTSA 2ZGXH 5A0AE 1V2ST 2QC2A 3GY5A 1SQTA 2GMTB 1HIAA 1O2OA 1ZSKA 2PTNA 2BLVA 1C1PA 1J15A 2QF3A 5EQSA 1ZSJA 4B74A 1O39A 2YNAA 1Y5AT 1V2MT 2IOTA 5EQQA 1K1IA 4Y0ZE 1H8DH 1LPKB 1TGNA 4NIVA 1H1BA 2AHME 5A8YA 1C2LA 3CP7A 2Z9KA 2ZPQA 1FY3A 4UFDH 1GG6C 5TJXA 4CHAC 1ARCA 1DS2E 1E0FD 1O2RA 3SGAE 2I6SA 1UTLM 1GBCA 4HI3A 1IAUA 1CE5A 1ELAA 1KXFA 1Y8TA 3BTHE 4CBNA 7ESTE 1FDPA 1DE7H 5I46H 2VIPA 1Y5UT 1VGCC 5HYOA 4UD9H 3NRLA 4I8JA 3TLOA 2FESH 3P92A 1B7XB 3A87A 3SOSA 3SV6A 1P04A 2L6OA 2PWXA 1PQ8A 3B9FH 2SGQE 5JBCS 3A8CA 1GI3A 1PPEE 1Q2WA 1RGQA 1A3BH 2FOBA 1ZRBA 1ELDE 1NN6A 2ANWA 1TFXA 1GBDA 1O30A 1QBOA 1K1OA 4NA8A 4WXIA 5DGJA 5TCCA 4NIYA 1ZPCA 3C27B 2FEQH 3UAIC 2Z9LA 1GMCG 2LPRA 4A5TS 1EZQA 1QB9A 1JIRA 1ELGA 1BTWA 3QUMP 2TBSA 2EQNA 1W8BH 1ANDA 4XFQA 3OTPA 2FTLE 5HGGA 3LGUA 1MABB 4ZHMU 2ZGJA 1C5RA 1ZJKA 2IPQX 4WF8A 3E6PH 3A7XA 3URDA 5F8ZA 4DCDA 2ZECA 3SJOA 1J8AA 3F9HA 2ZWLH 2BZAA 3MQKC 4BXWA 3ZZ6A 3MO6A 4B76A 2OD3B 4FUFA 1EPTA 2TGPZ 5FL7D 3UPEA 2WSSD 3ZV8A 1ZGVA 2VJ1A 2DE9A 1C4Y2 4H6TA 5E0JA 2XBXA 3JZ1B 3GY7A 3KN2A 7GCHG 2YNBA 2R3UA 3A7VA 2A1DB 3Q3XA 4F48B 4MDSA 3UOPA 3GCOA 1UTJA 1O2JA 1BQYA 2BY9X 1MAYA 3AVZA 1GBEA 1TABE 2Y82A 4ABIA 3F2HA 1V6DA 2ZHWH 3GS9A 3BV9B 4CH8B 3BG4C 1X7AC 1L4ZA 2FOCA 2OUAA 2UUJB 1H9IE 3V3MA 2Y5FA 4Y10E 1E79D 4ACBA 2PGQB 4RSPA 1WQSA 1ELFA 2BXTH 5E0HA 2VIVA 5E2PA 1HRTH 2PUXB 3D49H 1IOEA 1O2QA 4WY3A 4YOGA 5FHTA 2C90B 2KZ4A 2GZ8A 5KGOA 3RXEA 4NCYA 5HKKD 1P3EA 2ZFPH 4AFUA 1C5SA 1XXDA 2R0KA 1SKYE 1Y3XA 2GV7A 3I77A 1AMHA 3GCNA 2RA3A 2WYJA 1SLVB 3F3BA 4O9VA 4GHTA 5HM9A 1IQIA 3QTVH 1MU6B 1A7SA 1EB1H 1E35B 1NRNH 1TQ7B 2HWLB 3U98H 1YLCA 1CGHA 2BD4A 4OM9A 1CGJE 1DWBH 1MTNB 2ALPA 4GPGA 1QB1A 4ACAA 2PR3A 1CQQA 1D6WA 5L2YH 3W94A 1A0JA 4AN7A 1UHBB 4I32A 2WPLS 2OXSA 1S82A 3VGCB 3VEQB 5LPEA 4B2AA 2A7HA 1UCYE 4JK6A 3VG8A 4NG9H 4JCNA 5DSFA 1TRMA 3VFEA 1UTMA 3M3SA 1S0RA 2O8TA 1ZTKA 4DVAU 2BQ6B 3SU1A 7GCHF 1HAOH 4X2WA 4GCHF 2OTVA 4VGCC 1HUTH 2Q6GA 2PHBA 1YPMH 5EJ1A 1GHAG 1YF4A 3KL6A 3BTFE 5DP6A 2ZCHP 1Q31A 6CHAC 3MI4A 3S9CA 3UREA 2ZEBA 2FS9A 1O2NA 4KTCA 2PKAB 3RXHA 1AZZA 1K0HA 2A45B 2JDID 3S7KB 1EQ9A 2G51A 5CE1A 5SGAE 3PTBA 4X6OA 3SUGA 1GJ6A 3HKIB 1LO6A 2PKSB 1A4WH 1PQ5A 5ETXA 1C1RA 1P8VC 3U8RH 1SFQB 1AO5A 3EA7A 4K69A 2G5NA 4JZIA 1O5FH 3RXIA 1K22H 3PMBB 1OOKB 1MTNC 3OSYA 4FUDA 3DHKH 3FAOA 3ZVGA 1GBFA 1HB0B 2VVVA 4X1NU 3WY8A 1YCPK 1FONA 2JETB 2TPIZ 2F91A 4GUXA 4YOIA 2Y7XA 2ZHFH 4AB9A 5ESBA 2QV1A 2BVRH 2ZPSA 3M5LA 1TWXB 1C1MA 4YT7H 2LNCA 1YM0A 4NSYA 3OE7D 1VGCB 2B8OH 1NTPA 1T8LA 1BT7A 1GJ7B 2VB0A 5L2ZH 3EAJA 1GI9B 1BMFD 2AIQA 1MTSA 2A32A 1DSTA 1HXFH 1THSH 1DPOA 5AFYH 1SB1H 4BTTB 1ESTA 2A4GA 3LC3A 4Q7YA 3MU1A 1KYNA 2Q6FA 3EDXB 3GDVA 1XUGA 4AFSA 2VWLA 1COWD 4ABGA 3CENA 5G4BA 3LH1A 2BX3A 1EJAA 1D3DB 1O5CB 2YMSC 5EIYA 1F0UA 2OK5A 1TPAE 2GMTC 2ZA5A 1HJAB 1NO9H 3SNDA 2EEKA 2A4QA 3Q77A 3BF6H 2W6JD 1P57B 3T28A 2RDLA 1WV7H 2DUCA 2PSYA 1D9IA 4ZXXH 2XC4A 3D62A 1LQDB 4Z6AH 1UVPA 3RXTA 2GZ9A 3UIRA 3H7TA 2I6QA 3L3TA 2A2XH 1ZRKA 4ZKOU 1S85A 3TU7H 2BD2A 2IJD1 4GLYA 1K1JA 3SQEE 3NWUA 3LOXA 4E7RG 2KFWA 4K8BA 1MAXA 1BZXE 5EOKA 3IWMA 1DLEA 3DSOA 1SFIA 3AASA 1GI8B 1C5QA 1QJ7B 4H4FA 3NXPA 3TH2H 1O31A 1MKXK 1HLTH 3RC4A 4DY7B 2K0QA 1KXBA 1OYQA 3PM3A 1VR1H 3O8DA 2SFAA 2JH5D 2ZHQH 4TWWA 2Z6BD 1EAUA 1SGNE 2ZGHA 1EATA 1PPCE 2BOKA 2XBVA 4I8LA 4YOJA 1TNIA 4Q4LA 1VCWA 4X1RU 3UFAA 1N6YA 2BB4A 6CHAB 4OS7A 9ESTA 3M5NA 3FOAA 1O3EA 1MBMA 1V2OT 3E8LA 1T32A 4Q80A 2AFQB 2TGDA 4A1TA 1CHOG 2A5AA 1AVGH 2GVFA 2XC5A 2HNTC 3M3VA 1AZ8A 1MKWK 3BG8A 3BIUH 1RIWB 4ZH8A 1BHXF 3T2NA 2GX4A 3FN8A 4I8HA 1L4DA 2ZTZA 1GMHG 5H4IB 4X1PU
chains in the Genus database with same CATH topology
1FUJA 1S5SA 2Y7ZA 2D8WA 3SV7A 4CR5A 2ODYB 3UR6A 4NWLA 5LH8A 4IC5A 3ZZ5A 3ZVCA 5T6GA 1SHHB 1T8MA 2NU0E 3SU4A 2FOMB 1G2LA 3HKJB 1PYTC 2BLWA 3P95A 2VU8E 1F0SA 1O3PB 1FV9A 4X2VA 2H2ZA 1O3HA 4Z0KA 1QBVH 2ZU5A 1P06A 2ZG0H 3BTKE 1HNEE 1XUKA 5A2MH 1Z7KA 3DT0H 3OTJE 3FP8E 2PV9B 2BOHB 3STIA 3D23A 2SGPE 1GL0E 4NFFA 5PTPA 5FXLA 4UONA 1SGYE 2K1QA 4RKJB 1JWTA 1OS8A 5T6DA 1ZMNA 1O33A 4ZXYH 5E0GA 3RXBA 2QYIA 5C3NA 1C1TA 1HAXB 1RXPA 2FOGA 1FAXA 3NKKA 4ABFA 3DUXH 2ZFSA 3FP6E 1A3EH 3MFJA 4IMZA 1GMCF 1O3KA 1Z8IB 3Q3YA 2SGFE 2SNWA 3SV2H 1Y3VA 5FBEA 3PWBA 1NM6A 1P2MA 3ZZ8A 1TNHA 3PMAB 4VGCB 2BXUH 1CHOF 4NA7A 3DA9B 1KXEA 4K8YA 3T62A 4D9QA 1ELCA 1HAYB 2BY8X 5HXFA 4ZHLU 3KCGH 3RU4E 2ZPRA 2P59A 1O3BA 1WOFA 3RXKA 3SNCA 5JPMH 1CT4E 1GG6B 4X1SU 4WVPE 4X8SH 3TPIZ 4K1EA 1AY6H 4JZ1A 4I8GA 1SL3A 3URCA 2BQWB 1TPSA 4OGXA 1Z71A 1WAYB 3E16B 3ZVFA 1EASA 7LPRA 3SI3H 3V7TA 5FCRA 1C4U2 3BTGE 2P95A 1VJ9U 1ABJH 1C1QA 1OWHA 1XUFA 1Y3UA 3KEEA 1GVZA 3OY6U 4TPIZ 2GDDA 3LC5A 1NFUA 2ZCLP 8ESTE 1QRZA 1PFXC 2IN2A 4FVBA 1N6XA 4IMQA 4J1YA 1HFDA 2G00A 4Y79A 2ESTE 1O2SA 1DUAA 1P05A 2R3YA 3BTWE 1KLIH 3PROA 1TRYA 5EW2H 4AG1A 2AH4X 1LHGH 3E0NB 1TONA 1NRPH 3M7QA 5FPSA 2WPMS 1TOCB 1ZTJA 4X0WU 1LMWB 5GJ4B 1HV7A 1TBRH 3PMJA 1SMFE 1F92A 2FOEA 3ATMA 2ASUB 3N7OA 3S69A 1T4VH 3O8RA 3UTUH 1O2IA 1IQMA 1OP8A 1OSSA 1W2KH 1BTZA 2VIDA 1G30B 2OC0A 2AMPA 2GCHF 2PW8H 2QGRA 1SC8U 2VINA 1H8IH 3KIDU 5DP4A 3UWJH 2TGTA 2W7UA 5T6FA 1HAGE 1QURH 2WPJS 2ZFTA 3EQ0H 2BYAX 2PKSC 1XVOA 1O2XA 2FXRA 4WMEA 5FBIA 2AIPA 3F1SB 3RXQA 1KTSB 1CHGA 1DDJA 1XUJA 1MZAA 1NFWA 2Q6DA 2W3IA 3PLBA 5EXLA 2KAIB 1JBUH 3MO3A 1ZJDA 4K5ZA 1XUHA 1MCVA 4ABBA 1GI2A 1L1GA 2BY7X 1BOQA 1DANH 1TMTH 2PLXA 4ZKNU 2CHAC 2PGBB 4FXGH 4NWKA 2J94A 1GBHA 2AMQA 2Z3CA 2H1UA 3GDSA 1A61H 2BDAA 1ORFA 4JK5A 2V6NA 2A4RA 1F5RA 4A1VA 5DK1A 2ZFRH 3HK6B 3SJIA 4Q2KA 4JYTA 1ETRH 2HNTE 1DWEH 5HM2A 1C5PA 1A5IA 2BLOA 2QIQA 3W95A 3ENSB 5GPIB 3TJNA 3RDZA 2B0FA 2GDEH 6LPRA 2FX6A 4NSVA 2PUQH 1C5TA 3LIWA 4OGYA 2ZGBH 1V2JT 2P3FH 2KAIA 5DP5A 5DJ7A 1GI6A 2GGVB 1TIOA 2ZO3H 1F5LA 1QGFA 1S0QA 4BNRA 3EA8A 2HLCA 1G2MA 1T8OA 1UJ1A 1UCYK 1XMNB 5IDKA 1DLKB 1ZPZA 4ISIH 1SOTA 1KSNA 5DP7A 1OP2A 4Y8YA 3ZVEA 1C1VH 3A82A 1UTOA 3RM0H 3PLPA 1S6FA 3NPSA 1AVWA 2D2DA 3F9GA 2F9VA 4O3UA 2GP9B 1O5AB 1NFXA 2J38A 1SGDE 1THRH 2H5CA 3SGBE 1CU1A 1WYKA 1FMGA 1GJCB 1CO7E 1P10A 1W0YH 2Y80A 4D8NA 1XXFA 2OINA 3SN8A 4YLUA 3SV8A 4JZFH 1N1LA 3QTOH 1HBTH 3PB1E 3ZZ3A 3T26A 2B5TB 6GCHF 3RP2A 1GCTC 2ZIQH 4FUEA 1PPFE 5CHAB 8KME2 5DO4H 1EAWA 1FZZA 1O2LA 2QN5T 5FPYA 1ZSLA 1BTUA 1SHYA 4TY7A 1YCPH 3IITA 2F9PA 2STAE 5LPRA 1V2UT 2BVXH 2A5KA 4KTUA 1DOJA 2C8ZB 1LHCH 4ZKSU 1P12E 2VIWA 1BB0B 3A7ZA 1V2VT 1AFQB 1CSOE 2ZU4A 5GCHG 1O3AA 3TJUA 3B23B 1TX6A 2XBYA 3R0FA 2CF9H 3LJOA 1P2KA 4DURA 1O3JA 4Y8XA 5E8EH 1GJ8B 2ZU2A 1TGBA 3IG6B 5C20A 1G3BA 1UTQA 3SO3A 1ANBA 4ABJA 1DITH 3GISB 5A8ZA 3ZZBA 1MD8A 3KNXA 1GDQA 4IC6A 1AFEH 4TWYA 2B9LA 1O5BB 5AHGH 3ZVDA 1TPOA 2FWWA 2UUYA 2XXLA 4IN2A 4WH6A 4A6LA 3GOVB 1M9UA 1WQVH 2UUFB 1QA7A 1XUIA 2GTBA 1EZXC 4XE4A 3SORA 1NC6A 1KY9A 2PKAA 1QBNA 3TH3H 1GJ4H 4Y0YE 2OC7A 2VWNA 2BY6X 2FPZA 4AGJA 1O2MA 5IYTA 5EGMA 1WSSH 1P2JA 4TPYA 1C2DA 1W0ZU 3VPKA 4AOQA 1NU7B 1Z8JB 1DUEA 4GVUA 1KIGH 1MD7A 2NU2E 4XBDA 3RXUA 1QY6A 3D65E 1V2WT 2QY0B 1Z1IA 4XBBA 1AFQC 1OYTH 5DP8A 1O3LA 1GHZA 3BEUA 3VB4A 1SGFG 2C3SA 1TALA 1TGSZ 1VITF 2BDHA 1GDNA 1GMDG 2AMDA 3AW0A 4U30A 1GBBA 2R9PA 2AGEX 4TYDA 1QQ4A 3S0NA 5DP3A 1SVPA 1TRNA 2ZHEH 1Z6EA 1QRWA 1LKAA 3E3TA 2C8XB 3LJJA 2ZHDA 3VB6A 1D3PB 1H9HE 1BDAA 1CVWH 1SGIB 2WUCA 1LHDH 2PSXA 1O2KA 1CA8B 3SU3A 1INCA 1TX7A 3RXJA 1FN8A 2EC9H 3F68H 4BTUB 4ISOA 3P6ZB 1QCPA 4HGCA 1O0DH 1AWHB 2Z7FE 1C5UA 1O2VA 2FYQA 1YLDA 3BTDE 2WPIS 4YZUA 1BIOA 1FN6A 3TK5A 3GYLB 4MTBA 1P03A 1NS3A 1TE0A 5FX6A 2ZTXA 3M5OA 4LXBH 2BD8A 8LPRA 1AUJA 3NK8A 1OWEA 2ILNA 1LVBA 3ITIA 1BTHH 5L6NH 1XKAC 4A7IB 3SZNA 1K28D 4LZ4B 3ATLA 5JBTA 4ISNA 1DX5M 3K9XB 2GZ7A 1EOJA 2WV4A 2OC1A 1OKXA 5K7RA 1V2NT 2XC0A 1AHTH 3SUFA 1JIMA 2Y5GA 3GCHB 1LDTT 4MNVA 1DM4B 1GJBB 2ZF0H 1P0SH 4AZ2B 1FQ3A 1WUNH 3HPTB 5LGOA 1O38A 1EZSC 1O5EH 2ZZUH 4D9RA 2GCHG 4HFPB 1GWAA 2Q1JA 3KQEA 1OP0A 4ZROA 3ZZ9A 1UK4A 3BEFB 3S7HB 4KKDA 3RXMA 3P17H 1P2QA 1EPTB 1MMJN 4AX9H 5C2ZA 1GL1A 2C8YB 1RJXB 1AU8A 1QJ1B 3NZIA 5FX5A 1ETTH 2Z9JA 3VB3A 9LPRA 1A1RA 5DPAA 4FUHA 1AE5A 4NIXA 1QIXB 5EU8A 1FAKH 4ABAA 1GBLA 1P2OA 1ARBA 2HPQH 1GBKA 3GCHC 2ZP0H 3MNCA 1GBAA 2J9NA 1P9UA 1FPHH 4CBOA 2AEIH 4I33A 4GHQA 4QT8C 2O8LA 3PYHA 2IPHA 1HJAC 2JKHA 3MHWU 4UFEH 2OLGA 4YO9A 1KLTA 1C2GA 1UVTH 2J34A 3G01A 1HYLA 1C1WH 5F03A 1UCYH 1GHWH 3RMLH 1LHEH 2ANMH 3I29A 3S9AA 2ZU3A 2ZC9H 5EPYA 1DY9A 2BTCE 2F3CE 1DFPA 2P93A 3RXFA 5JB8S 2SNVA 1LVYA 1NY22 1SGCA 1O3OA 1EXFA 1MCTA 3RXGA 3CS7A 1SI5H 1F0TA 1GHXH 1L0ZA 4IGDA 1RTFB 1AQ7A 1CT2E 1DXPA 4B71A 3TK6A 1THPB 4FUGA 2ODPA 3KHVA 3BTQE 1HPGA 2RA0A 3FFGA 5BRRE 4MPXA 3A81A 1BITA 3Q3KA 1AWFH 1HJ8A 1P02A 4J2YB 1AKSA 3GYMA 3SGQE 4FUJA 2TIOA 2XYAA 4H6SB 4E06H 1P2IA 6GCHG 2OCVB 3ESTA 1Z8RA 1AUTC 2ZDKA 2GCTB 2QCYA 3TGJE 1O2WA 1MZDA 2G8TA 4KP0A 1FIZA 1DY8A 5FCKA 2G5VA 1IHSH 4ISHH 4D7GA 3SJKA 2ZCKP 2JH6D 3LPRA 1GHVH 4INLA 4Y76A 4NA9H 2FODA 1MUEB 2FI3E 1SLWB 2OQ5A 4CRFA 4IS5A 3RC6A 1ANCA 2VGCB 2G4TA 5ESTE 3VXFH 2FM2A 1C5VA 4R8TB 3S9BA 4SGBE 1ZPBA 1ESAA 3KF2A 2BX4A 3U9AH 4CRBA 1YPKH 2Z9GA 1GI0A 1C1SA 1LPZB 1YC0A 2ULLA 2UWLA 3F9FA 2RG3A 1GHYH 4HZHA 2FLRH 5EQRA 1K1NA 5ABWA 3P8OA 1A5GH 4X8UH 1H9LB 5JB9S 1QR3E 1C5ZB 1ZTLA 4UDWH 1YGCH 4ZAEA 2BDCA 4NGAH 4X2XA 1K21H 1BMLA 2H9HA 3SNEA 1IQGA 3ZVAA 5EPNA 2Y6TA 3A80A 5GWZA 5B6OA 2ZQ1A 1BHXB 4CRCA 4DT7B 1E36B 2WUBA 4INKA 2Z9IA 1DVAH 1ZHMA 3E1XB 4M7GA 1RD3B 1H4WA 1NZQH 2W26A 2R2MB 4AORA 2FOFA 3B8JA 3A7WA 1C5WB 3P8FA 1QFKH 4CR9A 2WYGA 3MU8A 4Y7AA 4WJG2 3RLWH 2ZDVH 4I8KA 2BDBA 2ZTYA 4INHA 1MQ5A 1T7CA 1QNJA 1O37A 1O3GA 1AN1E 2A31A 1HJ9A 1D3TB 3A8AA 2FZZA 1O35A 1BRBE 2RCEA 3NUMA 3SU2A 1OX1A 1BMMH 4MNXA 1GJ5H 4K3JA 2VGCC 2STBE 1GJAB 4FU8A 2FS8A 4D7FA 1HCGA 1OWDA 3U1JB 1C5XB 2NWNA 4Y8ZA 1AB9B 1W14U 1HAPH 1GDUA 1PYTD 4CRGA 4AFQA 1DWCH 2FI4E 2DE8A 1TGCA 1BTPA 1UVOA 1BBRK 1KXAA 2FOHA 3EE0B 1ZOMA 3SJ9A 3SI4H 3P70B 3LGVA 1TX8A 3O8CA 1SGRE 2FI5E 1ZMJA 4OS5A 3TK9A 1DWDH 3A84A 1MBQA 3FZZA 1P3CA 4X8TH 1C1OA 4LZ1H 1FNIA 1QJ6B 2BHGA 2CMYA 1SGPE 4U01A 1GBJA 4B2BA 1EAXA 3P8GA 3RMNH 4NFEA 3TJOA 3SHCH 2BDIA 1BBRH 1JOUB 2C8WB 1NFYA 3QWCH 1C5NH 1C5YB 2Y5HA 1C2KA 1A0HB 1NT1A 4ZUHA 1SGEE 4NZQA 4U2WA 3TGKE 4U32A 1YPLH 3DFLA 1B0EA 1JRTA 5EXNA 1WTHD 3PTNA 1T4UH 1QL8A 1TMUH 4UE7H 2THFB 2Z94A 1K1LA 4YT6H 1G3EA 5A09A 4AYVB 1NPMA 3MH5A 1CT0E 1P11E 3MO9A 5TCAA 3ZZ7A 2A7CA 2VWMA 3NCLA 3BEIB 2HPPH 1RTKA 1KLJH 2J2UA 1ZHRA 4JMYA 1IQHA 8GCHF 1D3QB 1UK3A 1RTLA 3ZZCA 3ZZDA 3PWCA 5C67A 4XOJA 2OC8A 1O3MA 1A46H 5AF9H 3U8TH 4XBCA 3RC5A 3LGIA 4AYYB 3QZRA 2A4OA 5BPEA 3UOUA 1Y59T 1BRUP 3GICB 1SR5C 4O03A 3LGTA 2BY5X 1SLUB 2FIRH 3QN7A 5F8TA 5J4QA 1UO6A 1BBRE 1ZYOA 2VWOA 3MU4A 2ANYA 4FUIA 3A89A 3ZYEA 4BAMB 1N8OC 2W7SA 1NRSH 3LGWA 1EPTC 1B0FA 3KGPA 3SU5A 1RRKA 4ZHAA 4E05H 1QL9A 3MOCA 4NZLA 1XX9A 1SLXB 1OPHB 2ZI2H 3M35A 2FTMA 2O8WA 2GD4B 5JYIA 1QQUA 3RXVA 4D76A 4AG2A 4DJZB 1UVSH 2A5IA 4I31A 1GI7B 2B7DH 1Q3XA 1IQJA 3RU4D 1A5HA 1MKWH 3L33A 2OP9A 3T25A 1P09A 1VCQA 1EP5A 2FX4A 1GI1A 1DICA 2EI6A 1G3DA 1GBTA 3MU0A 3DFJA 3TGIE 4DIIH 5A0BA 3QLPH 4KELA 3UUZA 2WPHS 1CA0B 1GCDA 2HGTH 3RM2H 1CA0C 2CN0H 4K2YA 4GAWA 2AGIX 1W12U 1C9TA 3AW1A 3T27A 1G9IE 4I7YH 3V13A 1TNGA 4BAHB 3GCTG 3M36A 1O2TA 1NRRH 2XNIA 3PV4A 1HGTH 1WTGH 4JYVH 3M61U 2UWPA 1TBZH 4DGJA 3GY2A 4A1XA 1KDQA 2ZDLA 1AGJA 2VVUA 4MNWA 3VB5A 5EODA 4X6MA 3UWIA 1UTPA 2H9EH 4MNYA 1PPHE 1HAVB 3GY3A 2SGDE 3UNRA 2P94A 4FU7A 1U6QA 3EGKH 2VH0A 1NRQH 3GY4A 1AB9C 1XM1A 2BDYA 3MTYA 3T5FH 1W3CA 1CBWC 1EJNA 1YPHE 1YCPM 3MYWA 3RXCA 1IHTH 2J4IA 2FLBH 1CGIE 4IBLH 1AI8H 1Z8GA 3Q00A 1PPBH 1ELEE 3GY8A 2ZGCA 1GGDC 2VNTA 3LDXH 4MG3A 4OS6A 5DP9A 5J4SA 2Z3DA 1GHBF 1LKBA 1YBWA 1S6HA 3OYPA 4THNH 1ZHPA