5HM9A

Crystal structure of mamo protease domain from magnetospirillum magneticum (apo form)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
189
structure length
189
Chain Sequence
LYHTVPPAVVGVGGGGVNAGPVASGAIVGTNGYVITTLHSVSKLPEISVQVATTGGIRRFPAQVVKTIPGHDLALLKMQTTEKFLHFRMADVQTVVPGQQVFAFGRNMAGAPLVRQGLVQSADAPLAVGATQITHLLRSDAVYSWEQTGGPLVNAQGDLVGINIAATGPTGKVEGFTVPAQVIVSHLQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MamO protease domain
publication title MamO Is a Repurposed Serine Protease that Promotes Magnetite Biomineralization through Direct Transition Metal Binding in Magnetotactic Bacteria.
pubmed doi rcsb
source organism Magnetospirillum magneticum amb-1
molecule tags Hydrolase
total genus 39
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5hm9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5hm9A01
1N6XA 3FAOA 3GY6A 2D1JA 3RXDA 1TMBH 2ZU1A 3A87A 4X6PA 2F91A 1EOLA 3BTHE 2C4FH 3AW0A 1P10A 1BBRH 3GDUA 3PROA 1HLTH 1TX6A 2BY8X 1OP8A 2LNCA 1LHDH 1FI8A 3M5OA 2Z9KA 4A1VA 1KXAA 4Y8ZA 1GBFA 3ZVBA 3QGJA 3LH3A 3RXRA 2GV6A 4K69A 2Y80A 1MKXH 4YOGA 4AN7A 2BZAA 3GYMA 1XKBC 1C4U2 4AYVB 5HXFA 1V2KT 2NU1E 1SFQB 1BUIA 1WQVH 3Q00A 1SSXA 2PV9B 2RCEA 3BTWE 5A8ZA 2AEIH 2FI4E 3T27A 2A7JA 4OS4A 3GY3A 1OX1A 1NRNH 3K6YA 2OC8A 1MTWA 2XTTB 2A45B 1TRYA 2J92A 3MH6A 4GUXA 1IOEA 3AAUA 3SV8A 2GD4B 3MH5A 4OS2A 3ZV8A 1EZXC 1V2ST 4X6OA 4ZHLU 1B0FA 3S7HB 1AE8H 1ELGA 5AHGH 1AY6H 1F92A 3VB4A 4H4FA 4Z0KA 2F9UA 5C1YA 3FZDA 2QGRA 5J4QA 1TOMH 3M5LA 1OXGA 3KQCA 2ZTXA 2W7UA 4AB8A 4ZAEA 2Q1JA 3L3TA 2GP9B 5E0GA 3TIUA 3RXAA 6GCHF 1UVOA 4X8TH 4ABBA 1QJ1B 3KHVA 4MNVA 3VXFH 1ZJDA 1GBTA 1O3BA 2FOMB 4NWKA 3W94A 4RKJB 2VVCA 3Q3KA 3CS7A 1QB6A 1TNGA 1A61H 3RP2A 1YPEH 2GVFA 3UTUH 3ZVFA 1ELFA 1SGFA 2XYAA 5ABWA 4IS5A 3M35A 5F8XA 2OBOA 3S7KB 2BVRH 3F9FA 2ZDKA 1YGCH 4Y10E 8KME2 1VITH 3A8CA 1YPKH 1E37B 2BDBA 1O36A 3EGKH 4XBCA 2VIQA 4I8LA 4E7NA 5FPSA 1C5UA 8LPRA 1PQ8A 2V3HH 1AB9C 1GJ6A 3GICB 1JRSA 2BQ7B 4NZLA 1C2FA 3FVFB 1BTPA 1BJUA 3MH7A 3B23B 4X6MA 1G3EA 1WTGH 1FY4A 5T3HA 3NCLA 1CBWC 1LVBA 4AFZA 1CGHA 2P16A 3HPTB 1O3KA 5C3NA 1EKBB 1EAXA 1F0RA 1L1JA 1UTQA 1LVOA 2UUFB 2FIRH 1GHYH 3A89A 3P70B 2ZO3H 5FBEA 1M9UA 2PW8H 4Y6DA 3SGBE 4YLQH 2PSYA 2CJIA 1K22H 4WWYA 2XCNA 2ZGHA 3MFJA 2GMTB 4GHTA 1BRAA 2Y7ZA 2K1QA 5EG4A 4KELA 1BB0B 1OP2A 2FTMA 1BT7A 1K2I1 2BVSH 1BQYA 3TPIZ 1GMHG 4FVDA 3F68H 1RTLA 3SJIA 2Y5FA 1ANEA 4UFEH 2XBYA 1VCWA 2ZNKH 3V7TA 4U30A 2CHAC 2ANMH 1B0EA 1IAUA 3QLPH 4GVUA 1SBWA 1QFKH 4UFDH 2ZDLA 2BDAA 2JETC 2FYRA 2GCTC 4WXIA 1LVYA 3E90B 2FP7B 1O5CB 1SVPA 1OWEA 1O2KA 1C2EA 1TMUH 3ATMA 4B1TA 5C1XA 1OPHB 1ZGIA 3UWIA 1ANDA 1O5GH 4GCHF 3ZZAA 3BTTE 3RDZA 2WYGA 3HGNA 1CQQA 2D26C 2QY0B 1XXDA 1NO9H 1CT2E 2B8OH 1GL0E 1MD7A 1K1MA 5EQSA 3KQBA 3TJUA 2R2WU 2F9OA 2AGIX 1P8VC 1GVLA 1UCYK 2CN0H 3H5CB 1QL9A 4KTSA 1ZRBA 1UVSH 4B2CA 5LH8A 1MKWH 2VWOA 4NIXA 1ELVA 4BAHB 3EA8A 4FU7A 4YOIA 2G4TA 1GI9B 1C5TA 1GI8B 1UHBB 1T8NA 3UNSA 1EATA 2VJ1A 1C5VA 1CT0E 6LPRA 1HAPH 1LKBA 1DVAH 1GHXH 2XCFA 1TE0A 3ZVCA 3RXJA 4CH2B 3SU4A 1W0YH 4BNRA 1S85A 4Z6AH 4NSVA 5F8ZA 3ZZ9A 5CHAB 1ZTJA 4ZKSU 4CH8B 2UWPA 4OS5A 1DITH 1C1NA 3O8RA 1EB2A 1W0ZU 1ZTKA 2XWAA 1PPZA 3LGVA 4D9QA 3ZZ4A 1C1RA 1TYNA 4FUFA 4DW2U 1BTXA 1C5PA 1KXDA 1MCTA 3OTJE 3RLYH 2V6NA 2BDCA 3QN7A 1TBQH 1GHWH 2ZI2H 2P93A 3B9FH 3MH4A 1D9IA 5EW2H 2ZQ2A 1MUEB 1QCPA 3TK6A 1TA6A 2HLCA 3TJOA 4ZHAA 3ATKA 1KYNA 1MQ6A 2A4RA 1AVWA 1GCTB 3FFGA 1T8OA 5DP6A 1O3FA 1LPZB 2NWNA 2Q6DA 2ZGJA 2FTLE 2UUJB 1SLWB 1YPJH 4XBBA 2J95A 1E36B 2QXHA 4I7YH 1TFXA 2BD7A 4RSPA 3P8FA 3M61U 2HNTF 1BA8B 4TYDA 1ELTA 1GMCF 2BLOA 4THNH 1AUTC 4CR5A 2FM2A 4TY6A 4M7GA 1FV9A 1MTSA 1BBRE 4ASHA 1FIWA 3LGWA 1EAIA 1C4Y2 1Y8TA 5T6DA 3VGCB 1P04A 2F83A 3ODDA 2SGFE 1O30A 1HAGE 4O3TA 2NU2E 1LPGB 1GVKB 4HFPB 1P3CA 2SFAA 3A8AA 4DCDA 3BIVH 4NIWA 1ETSH 2PUQH 1V2PT 2ZQ1A 3SBKA 4F4OC 5H4IB 1O2PA 1D6WA 1TGTA 8GCHG 4FU8A 4CRAA 3TH2H 1HXEH 4YT6H 1O2VA 1XUJA 1ELDE 3BF6H 4ISOA 1L0ZA 1IQJA 1FPCH 3CP7A 1OWKA 3K9XB 3LIWA 2R2MB 1EJNA 3I29A 3TNTA 1T8LA 1JIMA 4XBDA 4VGCB 1L2EA 1TQ0B 4MTBA 4Y8XA 2IPHA 4DJZB 2O8TA 1TBZH 1RTKA 1GVZA 1UVUH 1GDQA 2XBWA 1GJDB 1BRUP 5DG6A 1BDAA 1B5GH 1SOZA 1O3CA 3SU0A 1GJ5H 2W7SA 1OS8A 2OQUA 4ABHA 2VB0A 2BD8A 3GY4A 3RU4T 1HDTH 1W13U 1UTKA 1CHOG 1P2IA 2Z94A 1GBDA 3AW1A 3RXVA 1GHBG 2OP9A 2EA3A 3K2UA 3RM0H 2G4UA 1GJAB 2PUXB 1U6QA 2Z9GA 4YO9A 4ZHMU 2W3IA 5C67A 1PYTD 2R3UA 1F5LA 3MTYA 3PTNA 2G5VA 2IOTA 2VWMA 2UUKB 4DURA 1GI3A 2VNTA 2BM2A 5DPAA 1FMGA 4FUDA 3TK9A 3TJNA 1HAVA 2GV7A 1YKTA 2IJOB 2SGQE 3A7ZA 4XDEA 1DY9A 4Q2KA 4JCNA 1SMFE 4K1EA 3UFAA 1MD8A 7GCHG 1ACBE 1MU6B 2TIOA 3UR6A 2QXJA 1EAWA 2P59A 1KXEA 1P3EA 1NS3A 2OXSA 2BXUH 3T29A 3TU7H 4ZKNU 1NTPA 3VB7A 1SL3A 1QA7A 4CR9A 4LZ1H 1F0SA 3LU9B 3PWCA 5FHTA 4ZMAH 1LHGH 3W95A 4UFFH 2FS9A 4Y11E 1XKAC 2BLQA 2WINI 1GG6B 1H4WA 1S0RA 3U9AH 3DUXH 1P2KA 4NG9H 2A32A 1LQDB 4NZQA 3SOSA 1ZOMA 1KSNA 4AGKA 4I8HA 2ZP0H 1FONA 3RMNH 3KL6A 3QUMP 3I78A 1HB0B 3P8NA 2BY5X 1QURH 1V2VT 3S69A 2AFQB 1BZXE 4ABIA 3ZZ7A 3V0XA 1DLKB 1Q2WA 2XC0A 3LJOA 1QRWA 5ETXA 1NC6A 2EEKA 3A83A 1AO5A 3RC4A 1AGJA 1GJ4H 2A5AA 3VB6A 1YLCA 2Z9JA 2XC4A 4MDSA 1T8MA 2BD5A 1UK2A 5TCCA 3LKWA 1NRSH 3VFEA 4JMYA 5EU8A 2R0LA 1DS2E 7KMEH 1O5FH 1IQIA 4CRDA 4FXGH 1TOCB 3O8DA 1X7AC 3UY9A 2GX4A 3Q77A 1CU1A 1ELBA 1ABIH 1VITF 2Y6TA 5E0JA 1O32A 1SGDE 1Z1JA 2SGEE 3LGYA 4IW4E 4A92A 5ESTE 1UTPA 1P05A 4ESTE 1E35B 1HJAB 1C2KA 1THSH 2F9VA 2VIVA 2A2QH 2BD2A 2PHBA 1WV7H 2Y81A 2VWNA 1K28D 1W3CA 1IQLA 1P02A 2Y7XA 1BIOA 1SGEE 1F2SE 2ZWLH 2AERH 3RXSA 2ZCLP 1FQ3A 3S9BA 3K6ZA 1A2CH 4B76A 3E16B 6ESTA 4MPUA 3BTQE 3RLWH 1C2GA 2FEQH 1RD3B 1TNIA 3I77A 4X8VH 3DFLA 2VH6A 3HKJB 5JBAS 2PLXA 1N8OC 2Z6BD 3BTKE 1C5SA 4K8BA 2Z3CA 3M7TA 1TALA 2C8WB 3NWUA 1C5ZB 4F49A 3MU1A 1QL7A 3VEQB 3P8GA 1XVMA 1Z6EA 2TPIZ 2XBXA 1OKXA 1S0QA 1TMTH 3A80A 3MU8A 3UIRA 1SOTA 1Z6JH 1TAWA 2Z7FE 2WPKS 1SFIA 1G3BA 1LO6A 5L6NH 1Q31A 1AVXA 1C5XB 4RKOB 1EZUC 5LPFA 1YCPK 3PLBA 3SJKA 2A2XH 3ZZ5A 2WPJS 3E1XB 2CMYA 3BTDE 3RXHA 4WH6A 1PPGE 5GCHG 1PQAA 2ZHDA 1ZHMA 3OYPA 3T5FH 5IDKA 1SQTA 4IC5A 2A5KA 4XOJA 1ZZZA 1NU9A 1DFPA 3MNCA 1GBCA 2O8WA 1UTJA 1K9OE 2FOEA 4H6SB 3GYLB 5A0AE 1A4WH 3AASA 1GJCB 2QC2A 3SNCA 3ZYEA 2AYWA 2FLBH 3GCHC 4H42U 1C5OH 5F03A 4A5TS 3TJVA 1NRRH 1EUFA 2VIDA 4CRFA 1T32A 2B0FA 4I31A 3MI4A 2XXLA 3PTBA 2F9PA 3ZZ3A 1T4UH 1FN8A 2FODA 1VGCB 1EZQA 5DP7A 3STJA 3A7WA 1BTZA 3RC5A 2H1UA 1TONA 2GCHF 1GMDF 3LC5A 4B71A 2PKSB 4FUBA 1O5BB 1GBAA 1TIOA 1EX3A 3LDXH 2G81E 1SQOA 2GDEH 3A7VA 1KIGH 4NA9H 4ABAA 1ZSKA 5C5NA 3DHKH 1QQUA 4U2WA 4WJG2 3GY2A 2ZGXH 4ABEA 1AKSA 4X8SH 3T2NA 4X2VA 3SI3H 4CRCA 2P3UB 3SJ9A 2RA0A 2BDIA 2SGPE 5DK1A 5L2YH 4X1RU 1BTUA 1Z8IB 1FY3A 1TPOA 1HV7A 4BOHA 4AFUA 1O2ZA 4Y76A 2QV1A 3ZYDA 1BRBE 1TA2A 4FVBA 5AVDA 3UPEA 1IQGA 2BD4A 1Z7KA 2OLGA 3F9GA 4JK5A 1FPHH 3SNDA 1P2MA 2FS8A 1QBNA 1ESBA 1O5DH 5JDUB 5GIBA 1SGTA 4ISHH 5CMXH 2XNIA 1GJ7B 1DDJA 1OOKB 4ZROA 3N7OA 1DUEA 3JZ2B 1V2UT 1WCZA 3QK1A 1O2TA 4FUIA 5T6FA 2CGAA 1BTHH 1AZ8A 1S5SA 4AB9A 2ZHQH 2GZ9A 3M3SA 2G52A 1O2WA 3PLKA 3SU1A 2ZG0H 3RC6A 3Q3XA 1O3NA 1C1UH 1TPSA 3D65E 5B6OA 3SZNA 3MMGA 1C2JA 2BLWA 1FLEE 1O2OA 1OYTH 3SNBA 1QBOA 2J9NA 3KF2A 1GL1A 9LPRA 3FP8E 4AG1A 2WUBA 2O8UA 2YNBA 4D7GA 5E2OA 4XE4A 4SGBE 2AIPA 6GCHG 2P3FH 3TH4H 4Y79A 4X1NU 2BXTH 1AVGH 2FX6A 1YCPM 3UQVA 1CO7E 3ATLA 2GKVE 2VWLA 4I33A 6CHAB 4GSOA 2VH0A 4U32A 4WF8A 1UK3A 3SNAA 1XUKA 5L2ZH 4B73A 3SV6A 3QX5H 2AGGX 2Y82A 1V2WT 3IWMA 5A8YA 3KGPA 1O5EH 2Z9IA 1L1GA 4DGJA 1N1LA 4IMQA 1QA0A 2GTBA 2STAE 1LQEA 1CA0C 3LH1A 1AB9B 9ESTA 2GZ7A 3E8LA 4TWWA 3UNRA 3VXEH 1D4PB 2DE8A 4X2WA 5K7RA 1RXPA 1D3PB 1V2NT 1Z1IA 2PSXA 2J34A 3PB1E 1SGFG 1NPMA 3RXFA 1ZR0A 1CBWB 1GPZA 2QCYA 3BTGE 1DWCH 3PMBB 1BMLA 4AORA 4LZ4B 5K0HA 1GBIA 2ZHWH 1XM1A 4YTAA 1H1BA 4X8UH 4E05H 1DXPA 4K1SA 4B2AA 1AUJA 1O3HA 4FUCA 2QF0A 2BVXH 2PKAA 5JBCS 3UOPA 1MZAA 3VPKA 2HPQH 4B75A 2BD9A 3TGJE 1SC8U 3O8BA 1C2HA 2D2DA 2Z9LA 3MO3A 2A0QB 2BDYA 1YPMH 1DUAA 1EB1H 5DP5A 4H6TA 1ZRKA 1YPHE 4UFGH 1NY22 1O2NA 1P01A 1D3DB 4RN6A 4KGAA 2PGBB 1C9PA 3A86A 3LONA 3QZQA 3OY5U 3SUGA 3BG8A 1PPEE 5JB9S 1UTLM 2C3SA 1TNKA 2ZU2A 2HNTE 1KXBA 5E8EH 1ZJKA 2HNTC 5C1UA 1UCYH 2A5IA 1BHXB 1AD8H 2JKHA 5DO4H 1T31A 2CHAB 3UNQA 1GBHA 3PMJA 5FAHA 5HYOA 1UO6A 2UWOA 1D3TB 1P9SA 2Q6FA 5DP8A 3RMOH 5DGJA 1JWTA 1S81A 1HNEE 2JETB 1K1JA 2Z3EA 1F5KU 2GCTB 4UE7H 3M36A 3KNXA 4B74A 2BD3A 2PR3A 5HGGA 3DA9B 1SQAA 1J9CH 1GGDC 1TWXB 2H9TH 1ZPZA 2RDLA 4D76A 2QIQA 1RTFB 1UK4A 1DY8A 1GBEA 4XSKU 1LVMA 3URDA 2BX4A 4R0IA 4CRBA 2D8WA 4GCHG 5L30H 1MTNC 3A84A 1CT4E 2BY7X 4PROA 2ZFSA 3SV9A 3DT0H 4X0WU 3SGQE 1LCYA 3RXMA 2BZ6H 1GCTC 3RXKA 4AGJA 2HRVA 2HGTH 1D6RA 3M7QA 1GJ9B 1XVOA 4X2YA 1FY8E 3GY8A 4KTCA 2OTVA 4MLFB 4WMEA 1HFDA 2O9QA 1O2QA 5E0HA 2FI5E 2JH0D 4ZKRU 1UHBA 3LJJA 1LHFH 3PV4A 5EOKA 4AFQA 2XWBI 1RFNA 1SPJA 3F1SB 1O3MA 2CV3A 1C5NH 3RUOA 1QRZA 4K1TA 5AF9H 1ESAA 1JOUB 2RG3A 3P6ZB 4D8NA 3E3TA 1C1TA 3ENSB 5BPEA 2ESTE 4YLUA 1FAKH 2BDGA 3STIA 1ELCA 2C93B 2A4GA 2BY9X 2WPLS 1O2JA 2VGCC 2R3YA 4FU9A 1HIAA 1H8IH 5I46H 2H6MA 2LPRA 3EE0B 2AMQA 3A85A 4XFQA 3PYHA 3P92A 4IGDA 1C2MA 2UUYA 3RXPA 1EXFA 2ANYA 5FX5A 1RGQA 3A81A 1PFXC 3SW2B 3PLPA 2HPPH 3LGUA 2QXIA 3GOVB 1NRQH 1TLDA 3LGTA 5T6GA 5A0BA 2C90B 3SU2A 1P2JA 4CHAC 3ZZ6A 4ABDA 4J2YB 1O3EA 1ZYOA 2ZPQA 4K2YA 1YPLH 3FANA 5TJXA 1P2NA 4D7FA 1P11E 2VVVA 1EPTC 3RXQA 4HGCA 1H8DH 3RXUA 5FBIA 3V13A 2ZDMA 4ISIH 1YF4A 1F0UA 2HOBA 1DE7H 1KLJH 5EXNA 2OBQA 4BAMB 3FZZA 3C1KA 2ZCKP 3BN9A 1FIZA 4GLYA 3SHCH 3TNSA 2WPHS 4AYYB 4NFFA 5HM9A 1QB9A 2B5TB 1GI1A 1GDNA 8ESTE 1NM6A 1O2LA 2TGAA 2ZGCA 1EP6A 1HAVB 1OWDA 1S84A 2AGEX 1DT2A 2A1DB 3QWCH 1K1IA 3BSQA 2FI3E 2H5DA 1V2TT 2OCVB 1BMNH 2F9NA 1AFQC 1ETTH 1BOQA 5JB8S 1SR5C 2W3KA 3LPRA 2B7DH 2A4OA 2UWLA 3ZV9A 5J4SA 1O3GA 3KQEA 1EPTA 5FX6A 1MAXA 4LK4A 4DT7B 3RU4D 2FOGA 4KTUA 1V2LT 3RMMH 5F6MA 5SGAE 3GCTF 3TGKE 1DWEH 1JXPA 3A7TA 1BJVA 1MCVA 4WMDA 4JZIA 3NXPA 2FMJA 2XBVA 2ZC9H 4Q7YA 1SB1H 2ZGBH 4JZFH 3OX7U 1DOJA 3NKKA 4ISNA 5HMAA 1O2MA 2TGTA 3ZZ8A 4SGAE 3KEEA 2Q6GA 3SI4H 3A88A 1MU8B 5FXLA 1HJ8A 2ZKSA 5E2PA 1C1WH 1O3IA 2ZDAH 1G36A 1P12E 1AFEH 1GWAA 2R0KA 4AG2A 2BTCE 1TNJA 1CVWH 3KCGH 1GBBA 3P95A 1UVTH 2TGPZ 3GCNA 1GBJA 1INCA 3KN2A 4ZUHA 3TK5A 1HYLA 2O8LA 4INKA 2FOCA 3NK8A 2FOHA 1O2UA 1ARCA 1EQ9A 3NPSA 3D62A 4HTCH 3RXCA 4ZH8A 1FXYA 3PO1B 3EAJA 1TRMA 2G8TA 1ANCA 3EQ0H 3PMAB 1HJAC 1W11U 1ZPBA 4I8GA 1YP9A 1QNJA 5HM2A 2GT7A 3PWBA 1OSSA 1Y5UT 3T62A 4FUEA 2P8OB 2AH4X 1EAUA 4NFEA 4JYVH 1TABE 5C5OA 2FESH 5F8TA 4ISLA 2H5CA 1EZSC 1ZLRA 3HK6B 4YESB 1DWBH 4MVNA 2ZCHP 4NGAH 1GHAF 1GJ8B 3KQDA 1V2QT 1BTYA 2VIWA 1CGIE 3M7UA 1IQEA 1OWHA 3D23A 4WH8A 2QN5T 1A3BH 3U8TH 1K21H 1G3CA 1G37A 2BMGB 1ORFA 1C1PA 1UCYE 3V12A 4A6LA 5G4BA 3FP6E 4OS6A 1DANH 1E34B 1TX8A 2DUCA 1PPFE 2P94A 1DXWA 1P9UA 3BG4C 3LC3A 3SUEA 1MQ5A 1RIWC 2GZ8A 1YC0A 1YYY1 1A5GH 3QTOH 1C9TA 1K1NA 1KY9A 1VITG 1SGPE 2H9EH 3U98H 1YCPH 5JPMH 2CF9H 1PYTC 2OC1A 3A8BA 4MNWA 5GDSH 1MZDA 4BAQB 1IQNA 1EJAA 5GWZA 1JMOH 2KAIA 4CBNA 3A7XA 1VJ9U 3R3GB 1O3OA 5DKMA 1DM4B 1WQSA 3G01A 1BTWA 1ARBA 2ZFFH 3Q76A 1S6HA 1KXFA 1Y3YA 1RRKA 3U1JB 3E0NB 3E0PB 1VZQH 1KDQA 2ODYB 3ODFA 1C1SA 3EA7A 5EPYA 2ZFPH 4MPWA 5EW1H 3RU4E 1BMAA 1SGCA 4NA7A 1N8OB 4IN2A 1W7XH 2C8XB 1C2DA 1Z8RA 2FYQA 4I8JA 5CE1A 3M3TA 2HALA 4X1QU 5BRRE 3KIDU 1VGCC 4AOQA 3BTME 1NFWA 2YOLA 4AZ2B 2PTCE 1BCUH 1GBLA 2R9PA 3SNEA 4Y0ZE 1THPB 2ZU4A 1J17T 1LHCH 2W5EA 1S82A 1ZHPA 1C5LH 3U1IB 1P57B 3EA9A 1AKSB 4LXBH 1CA8B 2TBSA 1G32B 1T7CA 3H7TA 1EOJA 5A2MH 1W7GH 3OY6U 4INLA 1BBRK 1NRPH 4UEHH 1SLVB 1QQ4A 1K1OA 2ZFRH 1LHEH 1IQKA 1O35A 1P03A 2F9BH 1TPPA 2AIQA 3SUDA 2CF8H 2JH6D 1N6YA 2PFEA 1MKXK 2WUCA 1C2IA 1C5MD 3GCHB 3TITA 1WUNH 4MNYA 2YNAA 3SORA 2VU8E 1F0TA 1PJPA 2BB4A 5EQQA 2ZIQH 1ZTLA 2FX4A 3SQEE 2SGAA 2BDHA 1O39A 3F9EA 1PPBH 1O5AB 2BX3A 3ATIA 2W26A 3S9AA 3PM3A 2ANKH 1C1QA 2ZHEH 4ABFA 1W14U 1GDUA 3S9CA 1FY5A 4X1SU 1WOFA 2GCHG 4NSYA 1GMDG 4JYTA 1K1LA 4BAKB 1MBMA 1G2LA 3ESTA 4A1XA 3B8JA 1HAXB 3M37A 1SLUB 1GI0A 1HAIH 2GT8A 3ZVAA 5FCKA 1J8AA 4K3JA 2PWXA 3BV9B 1KLIH 3ZVGA 1P0SH 1SGQE 1JBUH 1TRNA 7LPRA 1ANBA 1A1RA 4BTUB 3O8CA 1ETRH 1ELEE 1QR3E 2STBE 1A7SA 1GBKA 4ZXYH 1YPGH 1UTMA 3E91A 4Y7AA 3OU0A 6CHAC 1Y3XA 1AZZA 1SGIB 3ZVEA 1C1OA 1O2HA 1TX7A 2OINA 1GHVH 2WV5A 3MO9A 3UOUA 4YT7H 1IHTH 1MMJN 1KTSB 1XX9A 5EXMA 2BHGA 1L1NA 2V3OH 2ZDVH 4Q80A 2GMTC 4OGXA 1VCQA 4UD9H 1BITA 1GMHF 4WY3A 1EASA 2ZHFH 4NIYA 2P3TB 1ZSLA 3H7OA 1UVPA 3L6PA 3UQOA 4CREA 4BTIB 2FPZA 1Y3UA 1A0JA 5I25A 1H9IE 2ZF0H 1IQHA 3RMLH 4Y0YE 1Y3WA 2PKAB 5EPNA 2AMDA 2J2UA 4BTTB 1NT1A 1MH0A 1PQ5A 5AFZH 1NFXA 4MG3A 1RJXB 3LOXA 1TGBA 2GDDA 5LGOA 5LPEA 2QA9E 4DVAU 4CRGA 2AS9A 4JZ1A 1WU1A 1AU8A 1DSUA 5DP9A 1SGYE 4MQAA 4Q7ZA 1HJ9A 2NU0E 1QTFA 1CA0B 1F7ZA 1SGNE 3AAVA 3RXTA 3A8DA 4OGYA 1C1VH 5DP3A 4FUJA 1AMHA 2OC0A 1YPHC 2CXVA 1P06A 2G00A 3T25A 2BYAX 1QRXA 1VCPA 2ZPSA 1YBWA 1XUHA 3GCOA 5A0CA 2ANWA 4LOYH 3ZZBA 1TQ7B 3VB5A 3RXEA 3V3MA 4DY7B 2BQ6B 2SNWA 2ZFQH 1OWJA 5EQRA 1PPHE 4UONA 2ZTZA 5JBTA 5EODA 3HKIB 1HAOH 3RXIA 4DIIH 4YM9A 2FLRH 4IN1A 3FP7E 2C8ZB 4WXVA 3SV2H 2WYJA 1A5IA 4YOJA 1QL8A 1ABJH 2FOBA 2B9LA 5CHAC 1NZQH 1UMAH 1O3DA 3RM2H 2H2ZA 1C5QA 1G9IE 1W8BH 4ZXXH 1WYKA 1O2XA 2O8MA 1QJ7B 1TGCA 5IYTA 2BOKA 2FOFA 3C27B 1O37A 1LDTT 1WSSH 4MPXA 1Q3XA 3SGAE 1MKWK 1E38B 1GBMA 1L4ZA 3ZVDA 1CE5A 3VB3A 1ELAA 4R8TB 1FZZA 2ILNA 5A09A 1OWIA 4I8KA 1VR1H 1O2GH 4O97A 1QGFA 4Y8YA 1MAYA 4FUGA 3ITIA 2BLVA 1YM0A 1D3QB 2M5TA 2WPIS 3R0FA 1OYQA 1VJAU 5FPYA 1Y5AT 5DJ7A 1BHXF 4WVPE 1UTOA 1XXFA 4ABJA 4X2XA 3SU3A 3RXBA 1GGDB 3BTEE 1HIAB 3HATH 5GJ4B 2OQ5A 2SNVA 5JBBS 4ZKOU 1G2MA 1THRH 3GDVA 3GY7A 2ZA5A 3MOCA 1ZHRA 3F9HA 4OS7A 2EI7A 1HAZB 4INHA 1MTNB 3VGCC 2G55A 1MTUA 1V6DA 1DPOA 2C8YB 5EGMA 4NCYA 2BY6X 1UTNA 1O2YA 2IN2A 7ESTE 1C1MA 1GI2A 4MNXA 1DWDH 2WPMS 4KP0A 3OSYA 3SU6A 8GCHF 1WBGB 2ODQA 1PPCE 1Z71A 3T28A 3GDSA 4IC6A 1NROH 1TGNA 2H9HA 1TNHA 4GPGA 4HZHA 4QT8C 3BEFB 3SUFA 3SHAH 1AE5A 3SV7A 2ZECA 4DIHH 1CGJE 3BEUA 2JH5D 3BIUH 3EYDA 1TGSZ 3HK3B 1AIXH 1AN1E 3HGPA 3MWIU 1O33A 1A0HB 5GPIB 1H9LB 2I6QA 1C2LA 1HGTH 1QBVH 1H9HE 2V35A 4VGCC 1TPAE 2NU4E 3RXOA 2OD3B 2ULLA 3QDZB 1HXFH 2HVXA 1V2RT 5C20A 1FN6A 2VGCB 1KXCA 3MU0A 1GMCG 1ZMJA 3L33A 4JZDH 3ELAH 3P8OA 2I6SA 4NA8A 1SG8B 3LGIA 1EP5A 1L4DA 1P09A 1J14A 1CHOF 1XUIA 1SGRE 2ASUB 1V2OT 2GGVB 1A0LA 1GHBF 3WY8A 1P2OA 4E7RG 1TB6H 3QTVH 1CHGA 1Y5BT 3M5MA 1P2QA 1OP0A 4KKDA 1GI4A 1UJ1A 2RA3A 4CHAB 4U01A 2AMPA 3K65B 2ZU5A 3ZZCA 1C4V2 3MNXA 1QJ6B 1NN6A 2XW9A 7GCHF 5GXPA 3LT3A 1EPTB 1G3DA 2VVUA 4D9RA 3U8RH 1F5RA 5FPTA 4A7IB 1QB1A 1FDPA 2J94A 1V3XA 2BQWB 3F6UH 1DX5M 3MYWA 5TCAA 4K60A 1GI5A 1FY1A 1XUFA 1YLDA 2FXRA 1IQFA 2A4QA 4YZUA 3TLOA 1HAYB 4IMZA 1A3EH 2ZFTA 3MNSA 3MO6A 3QO6A 1ID5H 1O2RA 1QHRB 5FCRA 3M5NA 3P17H 2FDAA 1T4VH 2G51A 1GG6C 1QY6A 2P95A 2FOAA 4CBOA 1V2MT 1O3JA 2ALPA 3SJOA 1Z8GA 3E6PH 1PQ7A 2VINA 1LMWB 1GJBB 1SHHB 3QGNB 2QYIA 4K5ZA 1HRTH 3UWJH 2A31A 3MU5A 1O38A 1AFQB 1J16A 1O3LA 1AWHB 4K8YA 1S6FA 3Q3YA 2QAAA 4JZEH 1E0FD 1HBTH 2G5NA 5A8XA 4TPYA 4BANB 2A7CA 4ABGA 2J38A 3D49H 2J4IA 4Y7BA 3PO1C 1LPKB 3A82A 4JK6A 5DP4A 1KLTA 2FWWA 1O0DH 2F3CE 1FJSA 2OUAA 3ATWA 1FAXA 3NZIA 3GCTG 2ZDNA 4Q7XA 1IHSH 1C5RA 2HWLB 1HPGA 1AHTH 1TBRH 3DFJA 1LKAA 2FO9A 2P8OC 3NUMA 3RXLA 1DSTA 1B7XB 1NFUA 2VIOA 2ZPRA 2ZTYA 1TNLA 1C5WB 1O2SA 1SI5H 3A7YA 1XMNB 1AI8H 2EI6A 3QZRA 3IITA 3SO3A 2DE9A 1ZGVA 1A5HA 5EXLA 3SQHE 4HI3A 1O34A 3S0NA 3IG6B 4UDWH 4DG4A 4O03A 2Z3DA 3JZ1B 2A7HA 1EJMA 3GY5A 2TGDA 4BXWA 4X1PU 2XC5A 3BTFE 5ESBA 2VIPA 3TVJB 5AFYH 1BMMH 4WMFA 2XRCA 2BOHB 3TH3H 1DICA 1MTVA 1O31A 4O3UA 4B2BA 3UUZA 3PMHB 4BAOB 1W10U 3MU4A 1JIRA 1IQMA 1S83A 2Y5HA 1ESTA 3SN8A 1C5YB 1O3PB 3UR9A 3URCA 3M3VA 1NFYA 4GHQA 1GHZA 1AQ7A 2WV4A 2ODPA 2NU3E 2ZZUH 3DD2H 3U69H 4A1TA 2TRMA 4GAWA 1A46H 1DLEA 1SHYA 1FNIA 3CS0A 2V0BA 1BRCE 3GISB 5PTPA 1Y3VA 3SJ8A 5GCHF 2KAIB 4NWLA 4JYUH 4NIVA 1NU7B 4X6NA 2Y5GA 1LTOA 1ZMLA 4MPVA 4TPIZ 4TWYA 1O3AA 3SU5A 1GI7B 1MBQA 2THFB 1KDQB 1HAHH 3MNBA 1RS0A 2FZZA 3RXGA 1ZSJA 1GHAG 4J1YA 2PGQB 4AFSA 1NESE 2OC7A 1JRTA 4O9VA 1WAYB 3MHWU 3U8OH 1AWFH 1CSOE 2ZEBA 3EDXB 4BXSA 1WTHD 2QXGA 4DOQA 1HCGA 4E06H 1Y59T 1J15A 4Y71A 1O2IA 1ZMNA 4OS1A 2EI8A 3T26A 1V2JT 1FUJA 1HUTH 1Z8JB 5C2ZA 1GI6A 3TGIE 1GCDA 3BG4B 2ZU3A 3AVZA 1RIWB 4FUHA 1KTTB 2EC9H 4TY7A 1G30B 4AX9H 3UREA 3ZZDA 2ALVA 1SLXB 2PTNA 3BEIB 4IBLH 2QF3A 1XUGA 1QIXB 1ZPCA 3CENA 1W2KH 1W12U 4I32A 5JYIA 1K1PA 5LPRA 2SGDE 2PKSC
chains in the Genus database with same CATH superfamily
1N6XA 3FAOA 3GY6A 2D1JA 3RXDA 1TMBH 2ZU1A 3A87A 4X6PA 2F91A 1EOLA 3BTHE 2C4FH 3AW0A 1P10A 1BBRH 3GDUA 3PROA 1HLTH 1TX6A 2BY8X 1OP8A 2LNCA 1LHDH 1FI8A 3M5OA 2Z9KA 4A1VA 1KXAA 4Y8ZA 1GBFA 3ZVBA 3QGJA 3LH3A 3RXRA 2GV6A 4K69A 2Y80A 1MKXH 5EJ1A 4YOGA 4AN7A 2BZAA 3GYMA 1XKBC 1C4U2 4AYVB 5HXFA 1V2KT 2NU1E 1SFQB 1BUIA 1WQVH 3Q00A 1SSXA 2PV9B 2RCEA 3BTWE 5A8ZA 2AEIH 2FI4E 3T27A 2A7JA 4OS4A 3GY3A 1OX1A 1NRNH 3K6YA 2OC8A 1MTWA 2XTTB 2A45B 1TRYA 2J92A 3MH6A 4GUXA 1IOEA 3AAUA 3SV8A 2GD4B 2J5UA 3MH5A 4OS2A 3ZV8A 1EZXC 1V2ST 4X6OA 4ZHLU 1B0FA 3S7HB 1AE8H 1ELGA 5AHGH 1AY6H 1F92A 3VB4A 4H4FA 1MABB 4Z0KA 2F9UA 5C1YA 3FZDA 2QGRA 5J4QA 1TOMH 3M5LA 1OXGA 3KQCA 2ZTXA 2W7UA 2EY4C 4AB8A 4ZAEA 3UAIC 2Q1JA 3L3TA 2GP9B 2KCYA 5E0GA 3TIUA 3RXAA 6GCHF 1UVOA 4X8TH 4ABBA 1QJ1B 3KHVA 4ACAA 4MNVA 3VXFH 1ZJDA 1GBTA 1O3BA 2FOMB 4NWKA 3W94A 4RKJB 2YMSD 3DCLA 2VVCA 3Q3KA 3CS7A 1QB6A 1TNGA 1A61H 3RP2A 1YPEH 2GVFA 3UTUH 3ZVFA 1ELFA 1SGFA 2XYAA 5ABWA 4IS5A 3M35A 5F8XA 2OBOA 3S7KB 2BVRH 3F9FA 2ZDKA 1YGCH 4Y10E 8KME2 1VITH 3A8CA 1YPKH 1E37B 2BDBA 1O36A 3EGKH 4XBCA 2VIQA 4I8LA 4E7NA 4OM9A 5FPSA 1C5UA 8LPRA 1PQ8A 2V3HH 1AB9C 3KQ5A 1E1QD 1GJ6A 3GICB 1JRSA 2KR7A 2BQ7B 3F3BA 4NZLA 3OTPA 1C2FA 3FVFB 1BTPA 1BJUA 3MH7A 3F2GA 3B23B 4X6MA 3VG8A 1G3EA 1WTGH 1FY4A 5T3HA 3NCLA 1CBWC 2KFWA 1LVBA 4AFZA 1CGHA 3OEHD 2P16A 3MQKC 3HPTB 1O3KA 5C3NA 1EKBB 5C17A 1EAXA 1F0RA 1L1JA 1UTQA 1LVOA 2UUFB 2FIRH 1GHYH 3A89A 3P70B 2ZO3H 5FBEA 1M9UA 2PW8H 4Y6DA 3SGBE 5B6LA 4YLQH 2WPDD 2PSYA 2CJIA 1K22H 4WWYA 2XCNA 2ZGHA 3MFJA 2GMTB 4GHTA 1BRAA 2Y7ZA 2K1QA 5EG4A 4KELA 1BB0B 1OP2A 2FTMA 1BT7A 1K2I1 2BVSH 1BQYA 3TPIZ 1GMHG 4FVDA 3F68H 1RTLA 3SJIA 2Y5FA 1ANEA 4UFEH 2XBYA 1VCWA 2ZNKH 3V7TA 4U30A 2CHAC 2ANMH 1B0EA 1IAUA 1QZ8A 5HIZA 3QLPH 4GVUA 1SBWA 1QFKH 4UFDH 2ZDLA 2BDAA 2JETC 2JDID 2FYRA 2GCTC 4WXIA 1LVYA 3E90B 2FP7B 1O5CB 1SVPA 1OWEA 1O2KA 1C2EA 1TMUH 3ATMA 3WWBA 4B1TA 5C0TA 5C1XA 1OPHB 5DN6D 1ZGIA 3UWIA 1ANDA 1O5GH 4GCHF 3ZZAA 3BTTE 3RDZA 2WYGA 1WDIA 1CQQA 3HGNA 2D26C 2QY0B 1XXDA 4TSFD 1NO9H 1CT2E 2B8OH 1GL0E 1MD7A 1K1MA 5EQSA 3KQBA 3TJUA 2R2WU 2F9OA 2AGIX 1P8VC 1GVLA 1UCYK 2CN0H 3H5CB 1QL9A 4KTSA 1ZRBA 1UVSH 4B2CA 5LH8A 1MKWH 2VWOA 4NIXA 1ELVA 4BAHB 2RFKC 3EA8A 4FU7A 4YOIA 2G4TA 1GI9B 1C5TA 1GI8B 1UHBB 1T8NA 3UNSA 1EATA 2VJ1A 1C5VA 1CT0E 6LPRA 1HAPH 1LKBA 1DVAH 5HKKD 1GHXH 2XCFA 1FX0B 1TE0A 3ZVCA 2YMSC 3RXJA 4CH2B 5T1VA 3SU4A 1W0YH 3F2HA 4BNRA 1S85A 4Z6AH 4NSVA 5F8ZA 3ZZ9A 5CHAB 1ZTJA 4ZKSU 4CH8B 2UWPA 4OS5A 1DITH 1C1NA 3O8RA 1EB2A 1H8HD 1W0ZU 1ZTKA 1PPZA 2XWAA 3LGVA 4D9QA 3ZZ4A 1C1RA 1TYNA 4FUFA 4DW2U 1BTXA 1C5PA 1KXDA 1MCTA 3OTJE 3RLYH 2V6NA 2BDCA 3QN7A 1TBQH 1GHWH 2ZI2H 2P93A 3B9FH 3MH4A 2F43B 1D9IA 1OHHD 5EW2H 2ZQ2A 1MUEB 1QCPA 3TK6A 1TA6A 2HLCA 3TJOA 4ZHAA 3ATKA 1KYNA 3GS9A 1MQ6A 2A4RA 1AVWA 1GCTB 3FFGA 1T8OA 5DP6A 1O3FA 1LPZB 2NWNA 2Q6DA 2ZGJA 2FTLE 2UUJB 1SLWB 1YPJH 4XBBA 2J95A 2IPQX 1E36B 2QXHA 4I7YH 1TFXA 2BD7A 4RSPA 3P8FA 3M61U 2HNTF 1BA8B 4TYDA 1ELTA 1GMCF 2BLOA 4THNH 1AUTC 4M9FA 4CR5A 2FM2A 4TY6A 4M7GA 1FV9A 1MTSA 1BBRE 4ASHA 1FIWA 3LGWA 1EAIA 1C4Y2 1Y8TA 5T6DA 3VGCB 1P04A 2HVYB 2F83A 3DSOA 3ODDA 2SGFE 1O30A 1HAGE 4O3TA 2NU2E 1LPGB 1GVKB 4HFPB 1P3CA 2SFAA 3A8AA 4DCDA 3BIVH 4NIWA 1ETSH 2PUQH 1V2PT 2ZQ1A 3SBKA 4F4OC 5H4IB 1O2PA 1D6WA 1TGTA 8GCHG 4FU8A 4CRAA 3TH2H 1HXEH 4YT6H 1O2VA 1XUJA 1ELDE 3BF6H 4ISOA 1L0ZA 1IQJA 1FPCH 3CP7A 1OWKA 3K9XB 4Z1MD 3LIWA 2R2MB 1EJNA 3I29A 3TNTA 1T8LA 1JIMA 4XBDA 4VGCB 1L2EA 1TQ0B 4MTBA 5CDFE 4Y8XA 2IPHA 4DJZB 2O8TA 1TBZH 1RTKA 1GVZA 1UVUH 1GDQA 2XBWA 1GJDB 1BRUP 5DG6A 1BDAA 1B5GH 1SOZA 1O3CA 3SU0A 1GJ5H 2W7SA 1OS8A 2OQUA 4ABHA 2VB0A 2BD8A 3GY4A 3RU4T 3KYFA 1HDTH 1W13U 1UTKA 1CHOG 1P2IA 2Z94A 1GBDA 3AW1A 3RXVA 1GHBG 2OP9A 2EA3A 3K2UA 3RM0H 2G4UA 1GJAB 2PUXB 1U6QA 2Z9GA 4YO9A 4ZHMU 2W3IA 5C67A 1PYTD 2R3UA 1F5LA 3MTYA 3PTNA 2G5VA 2IOTA 2VWMA 2UUKB 4DURA 1GI3A 2VNTA 2BM2A 5DPAA 1FMGA 4FUDA 3TK9A 3TJNA 1HAVA 2GV7A 3DSPA 1YKTA 1YWUA 2IJOB 2SGQE 3A7ZA 4XDEA 1DY9A 4Q2KA 4JCNA 1SMFE 4K1EA 3UFAA 1MD8A 7GCHG 1ACBE 1MU6B 2TIOA 3UR6A 2QXJA 1EAWA 2P59A 1KXEA 1P3EA 1NS3A 2J98B 2OXSA 2BXUH 3T29A 3TU7H 4ZKNU 1NTPA 3VB7A 1SL3A 1QA7A 4CR9A 4LZ1H 1F0SA 3LU9B 3PWCA 5FHTA 4ZMAH 1LHGH 3W95A 4UFFH 4F48B 2FS9A 4Y11E 1XKAC 2BLQA 2WINI 1GG6B 1H4WA 1S0RA 3SYJA 3U9AH 3DUXH 1P2KA 1UW7A 4NG9H 2A32A 1LQDB 4NZQA 3SOSA 1ZOMA 1KSNA 4AGKA 4I8HA 2ZP0H 4P00A 1FONA 3RMNH 3KL6A 3QUMP 3I78A 1HB0B 3P8NA 2BY5X 1QURH 1V2VT 3N7DA 3S69A 2AFQB 1BZXE 4ABIA 3ZZ7A 3V0XA 1DLKB 1Q2WA 2XC0A 3LJOA 1QRWA 5ETXA 1NC6A 2EEKA 3A83A 1AO5A 3RC4A 1AGJA 1GJ4H 2A5AA 3VB6A 1YLCA 2Z9JA 2XC4A 4MDSA 1T8MA 2BD5A 1UK2A 5TCCA 3LKWA 1NRSH 3VFEA 2QF5A 4JMYA 5EU8A 2KZ4A 2R0LA 1DS2E 7KMEH 1O5FH 1IQIA 3AK5A 4CRDA 4FXGH 1TOCB 1E79D 3O8DA 1X7AC 3UY9A 2GX4A 3Q77A 1CU1A 1ELBA 1ABIH 1VITF 2Y6TA 5E0JA 1O32A 1SGDE 1Z1JA 2SGEE 3LGYA 4IW4E 4A92A 5ESTE 1UTPA 1P05A 4ESTE 1E35B 1HJAB 1C2KA 1THSH 2F9VA 2VIVA 2A2QH 2BD2A 2PHBA 1WV7H 2Y81A 2VWNA 1K28D 1NBMD 1W3CA 1IQLA 1P02A 2Y7XA 1BIOA 1SGEE 1F2SE 2ZWLH 2AERH 3RXSA 2ZCLP 1FQ3A 3S9BA 3K6ZA 1A2CH 4B76A 3E16B 6ESTA 4MPUA 3BTQE 3RLWH 1C2GA 2FEQH 1RD3B 1TNIA 3I77A 4X8VH 3DFLA 2VH6A 3HKJB 5JBAS 2PLXA 1N8OC 1SKYE 2Z6BD 3BTKE 1C5SA 4K8BA 2Z3CA 3M7TA 1YLNA 1TALA 2C8WB 3NWUA 1C5ZB 4F49A 3MU1A 1QL7A 3VEQB 3P8GA 1XVMA 2WSSD 1Z6EA 2TPIZ 2XBXA 1OKXA 1S0QA 1TMTH 3A80A 3MU8A 3UIRA 1SOTA 1Z6JH 3DSGA 1TAWA 2Z7FE 2WPKS 1SFIA 3SZEA 1G3BA 1LO6A 5L6NH 1Q31A 1AVXA 1C5XB 4RKOB 1EZUC 5LPFA 1YCPK 3PLBA 3SJKA 2A2XH 3ZZ5A 2WPJS 3E1XB 2CMYA 3BTDE 3RXHA 4WH6A 1PPGE 5GCHG 5EIYA 1PQAA 2ZHDA 1ZHMA 3OYPA 3T5FH 5IDKA 1SQTA 4IC5A 2A5KA 4XOJA 1ZZZA 1NU9A 1DFPA 3MNCA 1GBCA 2O8WA 1UTJA 1K9OE 2FOEA 4H6SB 3GYLB 5A0AE 1A4WH 3AASA 1GJCB 2QC2A 3SNCA 3ZYEA 2AYWA 2FLBH 3GCHC 4H42U 1C5OH 5F03A 4A5TS 3TJVA 1NRRH 1EUFA 2VIDA 4CRFA 1T32A 2B0FA 4I31A 3MI4A 2XXLA 3PTBA 2F9PA 3ZZ3A 1T4UH 1FN8A 2FODA 1VGCB 1EZQA 5DP7A 3STJA 3A7WA 1BTZA 3RC5A 2H1UA 1TONA 2GCHF 1GMDF 3LC5A 4B71A 2V7QD 3WWFA 2PKSB 4FUBA 1O5BB 1GBAA 1TIOA 1EX3A 3LDXH 2G81E 4DT4A 1SQOA 2GDEH 3A7VA 1KIGH 4NA9H 4ABAA 1ZSKA 5C5NA 3DHKH 1QQUA 4U2WA 4WJG2 3GY2A 2ZGXH 4ABEA 1AKSA 4X8SH 3T2NA 4X2VA 3SI3H 4CRCA 2P3UB 3SJ9A 2RA0A 2BDIA 2SGPE 5DK1A 5L2YH 4X1RU 1BTUA 1Z8IB 1FY3A 1TPOA 1HV7A 4BOHA 4AFUA 1O2ZA 4Y76A 2QV1A 3ZYDA 1BRBE 4ASUD 1TA2A 4FVBA 3PRBA 5AVDA 3UPEA 2RDEA 1IQGA 2BD4A 1Z7KA 2OLGA 3F9GA 4JK5A 1FPHH 3SNDA 1P2MA 2FS8A 1QBNA 1ESBA 1O5DH 5JDUB 5GIBA 1SGTA 4ISHH 5CMXH 2XNIA 1GJ7B 1DDJA 1OOKB 5KECA 4ZROA 3N7OA 1DUEA 3JZ2B 1V2UT 1WCZA 3QK1A 1O2TA 1NBME 4FUIA 5T6FA 2CGAA 1BTHH 2F4LA 1AZ8A 1S5SA 3H09A 4AB9A 2ZHQH 2GZ9A 3M3SA 2G52A 1O2WA 3PLKA 3SU1A 2ZG0H 3RC6A 3Q3XA 1O3NA 1C1UH 1TPSA 3D65E 5B6OA 3SZNA 3MMGA 1C2JA 2BLWA 4F55A 1FLEE 1O2OA 1OYTH 3SNBA 1QBOA 2LP6A 2J9NA 3KF2A 1GL1A 9LPRA 3FP8E 4AG1A 2WUBA 2O8UA 2YNBA 4D7GA 5E2OA 4XE4A 4SGBE 2AIPA 6GCHG 2P3FH 3TH4H 4Y79A 4X1NU 2BXTH 1AVGH 2FX6A 1YCPM 3UQVA 1CO7E 3ATLA 2GKVE 2VWLA 4I33A 6CHAB 4GSOA 2VH0A 4U32A 4WF8A 1UK3A 3SNAA 1XUKA 5L2ZH 4B73A 3SV6A 3QX5H 2AGGX 2Y82A 1V2WT 3IWMA 5A8YA 3KGPA 1O5EH 2Z9IA 1L1GA 4DGJA 1N1LA 4IMQA 1QA0A 2GTBA 2STAE 1LQEA 1CA0C 3LH1A 1AB9B 2KM0A 1BMFD 9ESTA 2GZ7A 3E8LA 3FN8A 4TWWA 3VXEH 1D4PB 2DE8A 4X2WA 3UNRA 5K7RA 1RXPA 1YY3A 1D3PB 1V2NT 1Z1IA 2PSXA 2J34A 3PB1E 1SGFG 1NPMA 3RXFA 1ZR0A 1CBWB 1GPZA 2QCYA 3BTGE 2JJ1D 1DWCH 3PMBB 1BMLA 4AORA 4LZ4B 5K0HA 1GBIA 2ZHWH 1XM1A 4YTAA 1H1BA 4X8UH 4E05H 1DXPA 4K1SA 4B2AA 1AUJA 3OAAD 1O3HA 4FUCA 2QF0A 2BVXH 2PKAA 4RI0A 5JBCS 3UOPA 1MZAA 3VPKA 2HPQH 4B75A 2BD9A 3TGJE 1SC8U 3O8BA 1C2HA 2D2DA 2Z9LA 3MO3A 2A0QB 2BDYA 1YPMH 2L74A 1DUAA 4Q4LA 1EB1H 5DP5A 4H6TA 1ZRKA 1YPHE 4UFGH 1NY22 1O2NA 1P01A 1D3DB 4RN6A 4KGAA 5F53A 2PGBB 1C9PA 3A86A 3LONA 3QZQA 3OY5U 3SUGA 3BG8A 1PPEE 5JB9S 1UTLM 2C3SA 1TNKA 2ZU2A 2HNTE 1KXBA 5E8EH 1ZJKA 2HNTC 5C1UA 1UCYH 2A5IA 1BHXB 1AD8H 2JKHA 5DO4H 1T31A 2CHAB 3UNQA 1GBHA 3PMJA 5FAHA 1H8ED 5HYOA 1UO6A 2UWOA 1D3TB 1P9SA 2Q6FA 5DP8A 3RMOH 5DGJA 1JWTA 1S81A 1HNEE 2JETB 1K1JA 2Z3EA 1F5KU 2GCTB 4UE7H 3M36A 3KNXA 4B74A 2BD3A 2PR3A 5HGGA 3DA9B 1SQAA 1J9CH 1GGDC 1TWXB 2H9TH 1ZPZA 2RDLA 2WZQA 4D76A 2QIQA 1RTFB 1UK4A 1DY8A 1GBEA 4XSKU 1LVMA 3URDA 2BX4A 4R0IA 4CRBA 2D8WA 5C0UA 4GCHG 5L30H 1MTNC 3A84A 1CT4E 2BY7X 4PROA 2ZFSA 3SV9A 3DT0H 5DSFA 4X0WU 3SGQE 1LCYA 3RXMA 2BZ6H 1GCTC 3RXKA 4AGJA 2J97A 2HRVA 3CNRA 2HGTH 1D6RA 3M7QA 1GJ9B 1XVOA 4X2YA 1FY8E 3GY8A 4KTCA 2OTVA 4MLFB 4WMEA 1HFDA 2O9QA 1O2QA 5E0HA 2KCAA 2FI5E 2JH0D 4ZKRU 1UHBA 3LJJA 1LHFH 3PV4A 5EOKA 4AFQA 2XWBI 1RFNA 1SPJA 3F1SB 1O3MA 2CV3A 1C5NH 3RUOA 2QE7D 2YMSB 1QRZA 4K1TA 5AF9H 1ESAA 1JOUB 2RG3A 3P6ZB 4D8NA 3E3TA 5KEDA 1C1TA 3ENSB 5BPEA 2ESTE 4YLUA 1FAKH 2BDGA 3STIA 1ELCA 2C93B 2A4GA 2BY9X 2WPLS 3NRLA 1O2JA 2VGCC 2R3YA 4FU9A 4P02A 1HIAA 1H8IH 5I46H 2H6MA 2LPRA 3EE0B 2AMQA 3A85A 4XFQA 3PYHA 3P92A 4IGDA 1C2MA 2UUYA 3RXPA 1EXFA 2ANYA 5FX5A 1RGQA 3A81A 1PFXC 3SW2B 3PLPA 2HPPH 3LGUA 2QXIA 3GOVB 1NRQH 1TLDA 3LGTA 5T6GA 5A0BA 2C90B 3SU2A 1P2JA 4CHAC 3ZZ6A 4ABDA 4J2YB 1O3EA 1ZYOA 2ZPQA 4K2YA 1YPLH 3FANA 5TJXA 1P2NA 4D7FA 1P11E 2VVVA 1EPTC 3RXQA 4HGCA 1H8DH 3RXUA 5FBIA 3V13A 2ZDMA 4ISIH 4I86A 1YF4A 1F0UA 2HOBA 1DE7H 1KLJH 5EXNA 2OBQA 4BAMB 3FZZA 3C1KA 2ZCKP 3BN9A 1FIZA 4GLYA 3SHCH 5HIYA 3TNSA 2WPHS 4AYYB 4NFFA 5HM9A 1QB9A 2B5TB 1GI1A 1GDNA 8ESTE 1NM6A 1O2LA 2TGAA 2ZGCA 1EP6A 1HAVB 1OWDA 1S84A 2AGEX 1DT2A 2A1DB 3QWCH 1K1IA 2JIZD 3F0PA 3BSQA 3WW7A 2FI3E 2H5DA 1V2TT 2OCVB 1BMNH 4HG6A 2F9NA 1AFQC 1ETTH 1BOQA 5JB8S 1SR5C 2W3KA 3LPRA 2B7DH 5KGOA 2A4OA 2UWLA 3ZV9A 5J4SA 1O3GA 2K0QA 1EPTA 3KQEA 3OE7D 5FX6A 1MAXA 1S6LA 4LK4A 4DT7B 3RU4D 2FOGA 4KTUA 1V2LT 3RMMH 5F6MA 5SGAE 3GCTF 3TGKE 1DWEH 1JXPA 3A7TA 1BJVA 1MCVA 4WMDA 4JZIA 3NXPA 2FMJA 2XBVA 2ZC9H 4Q7YA 1SB1H 2ZGBH 4JZFH 3OX7U 1DOJA 2W6JD 3NKKA 4ISNA 3N99A 5HMAA 1O2MA 2TGTA 3ZZ8A 4SGAE 3PV2A 3KEEA 2Q6GA 3SI4H 3A88A 1MU8B 5FXLA 1HJ8A 2ZKSA 5E2PA 2VBCA 1C1WH 1O3IA 2ZDAH 1G36A 1P12E 1AFEH 1GWAA 2R0KA 4AG2A 2BTCE 1TNJA 1CVWH 3KCGH 1GBBA 3P95A 1UVTH 2TGPZ 3GCNA 1GBJA 1INCA 3KN2A 4ZUHA 3TK5A 1HYLA 2J98A 2O8LA 2W6ID 2FOCA 4INKA 3NK8A 2FOHA 1O2UA 1ARCA 1EQ9A 3NPSA 4FETA 2CK3D 3D62A 4HTCH 3RXCA 4ZH8A 4FOUC 1FXYA 2WHXA 3PO1B 3EAJA 1TRMA 2QF4A 2G8TA 1ANCA 3EQ0H 3PMAB 1HJAC 1W11U 1ZPBA 4I8GA 1YP9A 1QNJA 5HM2A 2GT7A 3PWBA 1OSSA 1Y5UT 3T62A 4FUEA 4RT1A 2P8OB 2AH4X 1EAUA 4NFEA 4JYVH 1TABE 5C5OA 2FESH 5F8TA 4ISLA 2H5CA 1EZSC 1ZLRA 3HK6B 4YESB 1DWBH 4MVNA 2ZCHP 4NGAH 1GHAF 1GJ8B 3KQDA 1V2QT 1BTYA 2VIWA 1CGIE 3M7UA 1IQEA 1OWHA 3D23A 4WH8A 5C94A 2QN5T 1A3BH 3U8TH 1K21H 1G3CA 1G37A 2BMGB 1ORFA 3UB0A 1C1PA 1UCYE 3V12A 4A6LA 5G4BA 3FP6E 3U28C 4OS6A 1DANH 1E34B 1TX8A 2DUCA 1PPFE 2P94A 1DXWA 1P9UA 3BG4C 3LC3A 3SUEA 1MQ5A 1RIWC 2GZ8A 1YC0A 1YYY1 1A5GH 3QTOH 1C9TA 1K1NA 1KY9A 1VITG 1SGPE 2H9EH 3U98H 1YCPH 5JPMH 2CF9H 1PYTC 2OC1A 3A8BA 4MNWA 5GDSH 1MZDA 4BAQB 1IQNA 1EJAA 5GWZA 1JMOH 2KAIA 4B6EA 4CBNA 3A7XA 1VJ9U 3R3GB 1O3OA 5CHBA 5DKMA 1DM4B 1WQSA 3G01A 1BTWA 1ARBA 2ZFFH 3OEED 3Q76A 1S6HA 1KXFA 1Y3YA 1RRKA 3U1JB 3E0NB 3E0PB 1VZQH 1KDQA 2ODYB 3ODFA 1C1SA 3EA7A 5EPYA 2ZFPH 4MPWA 5EW1H 3RU4E 1BMAA 1SGCA 4NA7A 1N8OB 4IN2A 1W7XH 2C8XB 1C2DA 1Z8RA 2FYQA 4I8JA 5CE1A 3M3TA 2HALA 4X1QU 5BRRE 3KIDU 1VGCC 4AOQA 3BTME 1NFWA 2YOLA 4AZ2B 2PTCE 1BCUH 1GBLA 2R9PA 3SNEA 4Y0ZE 1THPB 2ZU4A 1J17T 1LHCH 2XNDD 2W5EA 1S82A 1ZHPA 2K8IA 1C5LH 3U1IB 1P57B 3EA9A 1AKSB 4LXBH 1CA8B 2TBSA 1G32B 1T7CA 3H7TA 1EOJA 5A2MH 1W7GH 3OY6U 4INLA 1BBRK 1NRPH 4UEHH 1SLVB 1QQ4A 1K1OA 2ZFRH 1LHEH 1IQKA 1O35A 1P03A 2F9BH 1TPPA 2AIQA 4XRNA 3SUDA 2CF8H 2JH6D 4ACBA 1N6YA 2PFEA 1MKXK 2WUCA 1C2IA 1C5MD 3GCHB 2EQNA 3TITA 1WUNH 4MNYA 2YNAA 3SORA 2VU8E 1F0TA 1PJPA 2BB4A 5EQQA 2ZIQH 1ZTLA 2FX4A 3SQEE 2SGAA 2BDHA 1O39A 3F9EA 1PPBH 1O5AB 2BX3A 3ATIA 2W26A 3S9AA 3PM3A 2ANKH 1C1QA 2ZHEH 4ABFA 1W14U 1GDUA 3S9CA 1FY5A 4Q63A 4X1SU 1WOFA 2XOKD 2GCHG 4NSYA 1GMDG 4JYTA 1K1LA 4BAKB 1MBMA 1G2LA 3ESTA 4A1XA 3B8JA 1HAXB 3M37A 1SLUB 1GI0A 1HAIH 2GT8A 3ZVAA 5FCKA 1J8AA 4K3JA 2PWXA 3BV9B 1KLIH 3ZVGA 1P0SH 1SGQE 1JBUH 1TRNA 2OK5A 1ANBA 1A1RA 4BTUB 7LPRA 3O8CA 1ETRH 1ELEE 1QR3E 2STBE 1A7SA 1GBKA 4ZXYH 1YPGH 1UTMA 3E91A 4Y7AA 3OU0A 4YXWD 6CHAC 1Y3XA 1AZZA 1SGIB 3ZVEA 1C1OA 1O2HA 1TX7A 2OINA 1GHVH 2WV5A 3MO9A 3UOUA 4YT7H 1IHTH 1MMJN 1KTSB 1XX9A 5EXMA 2BHGA 1L1NA 2V3OH 2ZDVH 4Q80A 2GMTC 4OGXA 1VCQA 4UD9H 1BITA 1GMHF 4WY3A 1EASA 2ZHFH 2IJD1 4NIYA 2P3TB 1ZSLA 3H7OA 1UVPA 3L6PA 2PP6A 3UQOA 4CREA 4BTIB 2FPZA 1Y3UA 4AC9A 1A0JA 5I25A 1H9IE 2ZF0H 1IQHA 3RMLH 4Y0YE 1Y3WA 2PKAB 5EPNA 2AMDA 2J2UA 4BTTB 1NT1A 1MH0A 1PQ5A 5AFZH 1NFXA 4MG3A 1RJXB 3LOXA 1TGBA 2GDDA 5LGOA 5LPEA 2QA9E 2WV9A 4DVAU 4CRGA 2AS9A 4JZ1A 1WU1A 1AU8A 1DSUA 5DP9A 1SGYE 4MQAA 4Q7ZA 1SQRA 1HJ9A 2NU0E 1QTFA 1CA0B 1F7ZA 1SGNE 1W0KD 3AAVA 3RXTA 3A8DA 4OGYA 1C1VH 5DP3A 4FUJA 1AMHA 2OC0A 1YPHC 2CXVA 1P06A 2G00A 3T25A 2BYAX 1QRXA 1VCPA 2ZPSA 1YBWA 1XUHA 3GCOA 5A0CA 2ANWA 4LOYH 3ZZBA 1TQ7B 3VB5A 3RXEA 3V3MA 4DY7B 2BQ6B 2SNWA 2ZFQH 1OWJA 5EQRA 1PPHE 4UONA 2ZTZA 5JBTA 5EODA 3HKIB 1HAOH 3RXIA 4DIIH 4YM9A 2FLRH 4IN1A 3FP7E 2C8ZB 4WXVA 3SV2H 2WYJA 1A5IA 4YOJA 1QL8A 1ABJH 2FOBA 2B9LA 5CHAC 1NZQH 1UMAH 1O3DA 3RM2H 2KX4A 2H2ZA 1C5QA 1G9IE 1W8BH 4ZXXH 1WYKA 1O2XA 2O8MA 1QJ7B 1TGCA 4TT3D 5IYTA 2BOKA 2FOFA 3C27B 1O37A 1LDTT 1WSSH 1COWD 4MPXA 1Q3XA 3SGAE 1MKWK 1E38B 1GBMA 1L4ZA 3ZVDA 1CE5A 3VB3A 1ELAA 4R8TB 1FZZA 2ILNA 5A09A 1OWIA 4I8KA 1VR1H 1O2GH 1W0JD 4O97A 1QGFA 2JJ2D 4Y8YA 1MAYA 4FUGA 3ITIA 2BLVA 1YM0A 1D3QB 2M5TA 2WPIS 3R0FA 1OYQA 1VJAU 5FPYA 1Y5AT 5DJ7A 2M2AA 3W1EA 1BHXF 4WVPE 1UTOA 1XXFA 4ABJA 1E1RD 4X2XA 3SU3A 3RXBA 2GJGA 1GGDB 3BTEE 1HIAB 3HATH 5GJ4B 2OQ5A 2SNVA 5JBBS 4ZKOU 1G2MA 1THRH 5GNDA 3GDVA 3GY7A 2ZA5A 3MOCA 1ZHRA 3F9HA 4OS7A 2EI7A 1HAZB 4INHA 1MTNB 3VGCC 2G55A 1MTUA 1V6DA 1DPOA 2C8YB 5EGMA 4NCYA 2BY6X 1UTNA 1O2YA 2IN2A 3FO8D 7ESTE 1C1MA 1GI2A 4MNXA 1DWDH 2WPMS 4KP0A 3OSYA 3SU6A 8GCHF 1WBGB 2ODQA 1PPCE 4XD7D 1Z71A 3T28A 3GDSA 4IC6A 1NROH 1TGNA 2H9HA 1TNHA 4GPGA 4HZHA 4QT8C 3BEFB 3SUFA 3SHAH 1AE5A 3SV7A 2ZECA 4DIHH 1CGJE 3BEUA 2JH5D 3BIUH 3EYDA 1TGSZ 4B6FA 3HK3B 1AIXH 1AN1E 3HGPA 3MWIU 1O33A 1A0HB 5GPIB 1H9LB 2I6QA 1C2LA 1HGTH 1QBVH 3PRDA 1H9HE 3FOAA 2V35A 4VGCC 1TPAE 2NU4E 3RXOA 2OD3B 2ULLA 3ZIAD 3QDZB 1HXFH 2HVXA 1V2RT 5C20A 3F2FA 1FN6A 1VKYA 2VGCB 1KXCA 1WXRA 3MU0A 1GMCG 1ZMJA 3L33A 4JZDH 3ELAH 2KCOA 3P8OA 2I6SA 4NA8A 1SG8B 3LGIA 1EP5A 1L4DA 1P09A 1J14A 1CHOF 1XUIA 1SGRE 2ASUB 1V2OT 5IK2D 2GGVB 1A0LA 1GHBF 3WY8A 1P2OA 4E7RG 1TB6H 3QTVH 1CHGA 1Y5BT 3M5MA 1P2QA 1OP0A 4KKDA 1GI4A 1UJ1A 2RA3A 4CHAB 4U01A 2AMPA 3K65B 2ZU5A 3ZZCA 1C4V2 3MNXA 1QJ6B 1NN6A 2XW9A 7GCHF 5GXPA 3LT3A 1EPTB 1G3DA 2VVUA 4D9RA 3U8RH 1F5RA 5FPTA 5EJLA 5EJZA 4A7IB 1QB1A 1FDPA 2J94A 1V3XA 2BQWB 3F6UH 1DX5M 3MYWA 1K0HA 5TCAA 4K60A 1GI5A 1FY1A 1XUFA 1YLDA 2FXRA 1IQFA 2A4QA 4YZUA 3TLOA 1HAYB 4IMZA 1A3EH 2ZFTA 3MNSA 3MO6A 3QO6A 1ID5H 1O2RA 1QHRB 4ZCNA 5FCRA 3M5NA 3P17H 2FDAA 1T4VH 2G51A 1GG6C 3F0OA 1QY6A 2P95A 2FOAA 4CBOA 2AHME 1V2MT 1O3JA 2ALPA 3SJOA 1Z8GA 3E6PH 1KMHB 1PQ7A 2VINA 1LMWB 1GJBB 1SHHB 3QGNB 2QYIA 4K5ZA 1HRTH 3UWJH 2A31A 3MU5A 1O38A 3FKSD 1AFQB 1J16A 1O3LA 1AWHB 4K8YA 1S6FA 3Q3YA 2QAAA 4JZEH 1E0FD 1HBTH 2G5NA 5A8XA 4TPYA 4BANB 2A7CA 4ABGA 2J38A 3D49H 2J4IA 4Y7BA 3PO1C 1LPKB 3A82A 4JK6A 5DP4A 1KLTA 2FWWA 1O0DH 2F3CE 1FJSA 2OUAA 3ATWA 1FAXA 3NZIA 3GCTG 2ZDNA 4Q7XA 1IHSH 1C5RA 2HWLB 3EE7A 5FL7D 1HPGA 1AHTH 1TBRH 3DFJA 2KCPA 1LKAA 2FO9A 4RT0A 2P8OC 3NUMA 3RXLA 1DSTA 1B7XB 2L6OA 1NFUA 2VIOA 2ZPRA 2ZTYA 1TNLA 1C5WB 1O2SA 1SI5H 3A7YA 1XMNB 1AI8H 2EI6A 3QZRA 3IITA 3SO3A 2DE9A 1ZGVA 1A5HA 5EXLA 3SQHE 4HI3A 1O34A 3S0NA 3IG6B 4UDWH 4DG4A 4O03A 2Z3DA 3JZ1B 2A7HA 2HLDD 1EJMA 3GY5A 2TGDA 4BXWA 2LELA 4X1PU 2XC5A 3BTFE 5ESBA 2VIPA 3TVJB 5AFYH 1BMMH 4WMFA 2XRCA 2BOHB 3TH3H 1DICA 1MTVA 1O31A 4O3UA 4B2BA 3UUZA 3PMHB 2V3MA 4BAOB 1W10U 3MU4A 1JIRA 1IQMA 1S83A 2Y5HA 1ESTA 3SN8A 1C5YB 1O3PB 3UR9A 3URCA 3M3VA 1NFYA 4GHQA 1GHZA 1AQ7A 2WV4A 2ODPA 2NU3E 2ZZUH 3DD2H 3U69H 4A1TA 2TRMA 4GAWA 1A46H 1DLEA 1SHYA 1FNIA 3CS0A 2V0BA 1BRCE 3GISB 5PTPA 1Y3VA 3SJ8A 5GCHF 3KYGA 2KAIB 4NWLA 4JYUH 4NIVA 1NU7B 4X6NA 2Y5GA 1LTOA 1ZMLA 4MPVA 4TPIZ 4TWYA 1O3AA 3SU5A 1GI7B 1MBQA 2THFB 3N7EA 1KDQB 1HAHH 3MNBA 1RS0A 2FZZA 3RXGA 1ZSJA 1GHAG 4J1YA 2PGQB 3PV5A 4AFSA 1NESE 2OC7A 1JRTA 4O9VA 1WAYB 3MHWU 3U8OH 1AWFH 1CSOE 2ZEBA 3EDXB 4BXSA 1WTHD 2QXGA 4DOQA 1HCGA 4E06H 1Y59T 1J15A 4Y71A 1O2IA 1ZMNA 4OS1A 2EI8A 3T26A 1V2JT 1FUJA 1HUTH 1Z8JB 5C2ZA 1EFRD 1GI6A 3TGIE 1GCDA 3BG4B 2ZU3A 3AVZA 1RIWB 4FUHA 1KTTB 2EC9H 4TY7A 1G30B 3OFND 4AX9H 3UREA 3ZZDA 2ALVA 1SLXB 2PTNA 3BEIB 4IBLH 2QF3A 1XUGA 1QIXB 1ZPCA 3CENA 1W2KH 1W12U 4I32A 5JYIA 1K1PA 5LPRA 2SGDE 2PKSC
chains in the Genus database with same CATH topology
1N6XA 3FAOA 3GY6A 2D1JA 3RXDA 1TMBH 2ZU1A 3A87A 4X6PA 2F91A 1EOLA 3BTHE 2C4FH 3AW0A 1P10A 1BBRH 3GDUA 3PROA 1HLTH 1TX6A 2BY8X 1OP8A 2LNCA 1LHDH 1FI8A 3M5OA 2Z9KA 4A1VA 1KXAA 4Y8ZA 1GBFA 3ZVBA 3QGJA 3LH3A 3RXRA 2GV6A 4K69A 2Y80A 1MKXH 4YOGA 4AN7A 2BZAA 3GYMA 1XKBC 1C4U2 4AYVB 5HXFA 1V2KT 2NU1E 1SFQB 1BUIA 1WQVH 3Q00A 1SSXA 2PV9B 2RCEA 3BTWE 5A8ZA 2AEIH 2FI4E 3T27A 2A7JA 4OS4A 3GY3A 1OX1A 1NRNH 3K6YA 2OC8A 1MTWA 2XTTB 2A45B 1TRYA 2J92A 3MH6A 4GUXA 1IOEA 3AAUA 3SV8A 2GD4B 3MH5A 4OS2A 3ZV8A 1EZXC 1V2ST 4X6OA 4ZHLU 1B0FA 3S7HB 1AE8H 1ELGA 5AHGH 1AY6H 1F92A 3VB4A 4H4FA 4Z0KA 2F9UA 5C1YA 3FZDA 2QGRA 5J4QA 1TOMH 3M5LA 1OXGA 3KQCA 2ZTXA 2W7UA 4AB8A 4ZAEA 2Q1JA 3L3TA 2GP9B 5E0GA 3TIUA 3RXAA 6GCHF 1UVOA 4X8TH 4ABBA 1QJ1B 3KHVA 4MNVA 3VXFH 1ZJDA 1GBTA 1O3BA 2FOMB 4NWKA 3W94A 4RKJB 2VVCA 3Q3KA 3CS7A 1QB6A 1TNGA 1A61H 3RP2A 1YPEH 2GVFA 3UTUH 3ZVFA 1ELFA 1SGFA 2XYAA 5ABWA 4IS5A 3M35A 5F8XA 2OBOA 3S7KB 2BVRH 3F9FA 2ZDKA 1YGCH 4Y10E 8KME2 1VITH 3A8CA 1YPKH 1E37B 2BDBA 1O36A 3EGKH 4XBCA 2VIQA 4I8LA 4E7NA 5FPSA 1C5UA 8LPRA 1PQ8A 2V3HH 1AB9C 1GJ6A 3GICB 1JRSA 2BQ7B 4NZLA 1C2FA 3FVFB 1BTPA 1BJUA 3MH7A 3B23B 4X6MA 1G3EA 1WTGH 1FY4A 5T3HA 3NCLA 1CBWC 1LVBA 4AFZA 1CGHA 2P16A 3HPTB 1O3KA 5C3NA 1EKBB 1EAXA 1F0RA 1L1JA 1UTQA 1LVOA 2UUFB 2FIRH 1GHYH 3A89A 3P70B 2ZO3H 5FBEA 1M9UA 2PW8H 4Y6DA 3SGBE 4YLQH 2PSYA 2CJIA 1K22H 4WWYA 2XCNA 2ZGHA 3MFJA 2GMTB 4GHTA 1BRAA 2Y7ZA 2K1QA 5EG4A 4KELA 1BB0B 1OP2A 2FTMA 1BT7A 1K2I1 2BVSH 1BQYA 3TPIZ 1GMHG 4FVDA 3F68H 1RTLA 3SJIA 2Y5FA 1ANEA 4UFEH 2XBYA 1VCWA 2ZNKH 3V7TA 4U30A 2CHAC 2ANMH 1B0EA 1IAUA 3QLPH 4GVUA 1SBWA 1QFKH 4UFDH 2ZDLA 2BDAA 2JETC 2FYRA 2GCTC 4WXIA 1LVYA 3E90B 2FP7B 1O5CB 1SVPA 1OWEA 1O2KA 1C2EA 1TMUH 3ATMA 4B1TA 5C1XA 1OPHB 1ZGIA 3UWIA 1ANDA 1O5GH 4GCHF 3ZZAA 3BTTE 3RDZA 2WYGA 3HGNA 1CQQA 2D26C 2QY0B 1XXDA 1NO9H 1CT2E 2B8OH 1GL0E 1MD7A 1K1MA 5EQSA 3KQBA 3TJUA 2R2WU 2F9OA 2AGIX 1P8VC 1GVLA 1UCYK 2CN0H 3H5CB 1QL9A 4KTSA 1ZRBA 1UVSH 4B2CA 5LH8A 1MKWH 2VWOA 4NIXA 1ELVA 4BAHB 3EA8A 4FU7A 4YOIA 2G4TA 1GI9B 1C5TA 1GI8B 1UHBB 1T8NA 3UNSA 1EATA 2VJ1A 1C5VA 1CT0E 6LPRA 1HAPH 1LKBA 1DVAH 1GHXH 2XCFA 1TE0A 3ZVCA 3RXJA 4CH2B 3SU4A 1W0YH 4BNRA 1S85A 4Z6AH 4NSVA 5F8ZA 3ZZ9A 5CHAB 1ZTJA 4ZKSU 4CH8B 2UWPA 4OS5A 1DITH 1C1NA 3O8RA 1EB2A 1W0ZU 1ZTKA 2XWAA 1PPZA 3LGVA 4D9QA 3ZZ4A 1C1RA 1TYNA 4FUFA 4DW2U 1BTXA 1C5PA 1KXDA 1MCTA 3OTJE 3RLYH 2V6NA 2BDCA 3QN7A 1TBQH 1GHWH 2ZI2H 2P93A 3B9FH 3MH4A 1D9IA 5EW2H 2ZQ2A 1MUEB 1QCPA 3TK6A 1TA6A 2HLCA 3TJOA 4ZHAA 3ATKA 1KYNA 1MQ6A 2A4RA 1AVWA 1GCTB 3FFGA 1T8OA 5DP6A 1O3FA 1LPZB 2NWNA 2Q6DA 2ZGJA 2FTLE 2UUJB 1SLWB 1YPJH 4XBBA 2J95A 1E36B 2QXHA 4I7YH 1TFXA 2BD7A 4RSPA 3P8FA 3M61U 2HNTF 1BA8B 4TYDA 1ELTA 1GMCF 2BLOA 4THNH 1AUTC 4CR5A 2FM2A 4TY6A 4M7GA 1FV9A 1MTSA 1BBRE 4ASHA 1FIWA 3LGWA 1EAIA 1C4Y2 1Y8TA 5T6DA 3VGCB 1P04A 2F83A 3ODDA 2SGFE 1O30A 1HAGE 4O3TA 2NU2E 1LPGB 1GVKB 4HFPB 1P3CA 2SFAA 3A8AA 4DCDA 3BIVH 4NIWA 1ETSH 2PUQH 1V2PT 2ZQ1A 3SBKA 4F4OC 5H4IB 1O2PA 1D6WA 1TGTA 8GCHG 4FU8A 4CRAA 3TH2H 1HXEH 4YT6H 1O2VA 1XUJA 1ELDE 3BF6H 4ISOA 1L0ZA 1IQJA 1FPCH 3CP7A 1OWKA 3K9XB 3LIWA 2R2MB 1EJNA 3I29A 3TNTA 1T8LA 1JIMA 4XBDA 4VGCB 1L2EA 1TQ0B 4MTBA 4Y8XA 2IPHA 4DJZB 2O8TA 1TBZH 1RTKA 1GVZA 1UVUH 1GDQA 2XBWA 1GJDB 1BRUP 5DG6A 1BDAA 1B5GH 1SOZA 1O3CA 3SU0A 1GJ5H 2W7SA 1OS8A 2OQUA 4ABHA 2VB0A 2BD8A 3GY4A 3RU4T 1HDTH 1W13U 1UTKA 1CHOG 1P2IA 2Z94A 1GBDA 3AW1A 3RXVA 1GHBG 2OP9A 2EA3A 3K2UA 3RM0H 2G4UA 1GJAB 2PUXB 1U6QA 2Z9GA 4YO9A 4ZHMU 2W3IA 5C67A 1PYTD 2R3UA 1F5LA 3MTYA 3PTNA 2G5VA 2IOTA 2VWMA 2UUKB 4DURA 1GI3A 2VNTA 2BM2A 5DPAA 1FMGA 4FUDA 3TK9A 3TJNA 1HAVA 2GV7A 1YKTA 2IJOB 2SGQE 3A7ZA 4XDEA 1DY9A 4Q2KA 4JCNA 1SMFE 4K1EA 3UFAA 1MD8A 7GCHG 1ACBE 1MU6B 2TIOA 3UR6A 2QXJA 1EAWA 2P59A 1KXEA 1P3EA 1NS3A 2OXSA 2BXUH 3T29A 3TU7H 4ZKNU 1NTPA 3VB7A 1SL3A 1QA7A 4CR9A 4LZ1H 1F0SA 3LU9B 3PWCA 5FHTA 4ZMAH 1LHGH 3W95A 4UFFH 2FS9A 4Y11E 1XKAC 2BLQA 2WINI 1GG6B 1H4WA 1S0RA 3U9AH 3DUXH 1P2KA 4NG9H 2A32A 1LQDB 4NZQA 3SOSA 1ZOMA 1KSNA 4AGKA 4I8HA 2ZP0H 1FONA 3RMNH 3KL6A 3QUMP 3I78A 1HB0B 3P8NA 2BY5X 1QURH 1V2VT 3S69A 2AFQB 1BZXE 4ABIA 3ZZ7A 3V0XA 1DLKB 1Q2WA 2XC0A 3LJOA 1QRWA 5ETXA 1NC6A 2EEKA 3A83A 1AO5A 3RC4A 1AGJA 1GJ4H 2A5AA 3VB6A 1YLCA 2Z9JA 2XC4A 4MDSA 1T8MA 2BD5A 1UK2A 5TCCA 3LKWA 1NRSH 3VFEA 4JMYA 5EU8A 2R0LA 1DS2E 7KMEH 1O5FH 1IQIA 4CRDA 4FXGH 1TOCB 3O8DA 1X7AC 3UY9A 2GX4A 3Q77A 1CU1A 1ELBA 1ABIH 1VITF 2Y6TA 5E0JA 1O32A 1SGDE 1Z1JA 2SGEE 3LGYA 4IW4E 4A92A 5ESTE 1UTPA 1P05A 4ESTE 1E35B 1HJAB 1C2KA 1THSH 2F9VA 2VIVA 2A2QH 2BD2A 2PHBA 1WV7H 2Y81A 2VWNA 1K28D 1W3CA 1IQLA 1P02A 2Y7XA 1BIOA 1SGEE 1F2SE 2ZWLH 2AERH 3RXSA 2ZCLP 1FQ3A 3S9BA 3K6ZA 1A2CH 4B76A 3E16B 6ESTA 4MPUA 3BTQE 3RLWH 1C2GA 2FEQH 1RD3B 1TNIA 3I77A 4X8VH 3DFLA 2VH6A 3HKJB 5JBAS 2PLXA 1N8OC 2Z6BD 3BTKE 1C5SA 4K8BA 2Z3CA 3M7TA 1TALA 2C8WB 3NWUA 1C5ZB 4F49A 3MU1A 1QL7A 3VEQB 3P8GA 1XVMA 1Z6EA 2TPIZ 2XBXA 1OKXA 1S0QA 1TMTH 3A80A 3MU8A 3UIRA 1SOTA 1Z6JH 1TAWA 2Z7FE 2WPKS 1SFIA 1G3BA 1LO6A 5L6NH 1Q31A 1AVXA 1C5XB 4RKOB 1EZUC 5LPFA 1YCPK 3PLBA 3SJKA 2A2XH 3ZZ5A 2WPJS 3E1XB 2CMYA 3BTDE 3RXHA 4WH6A 1PPGE 5GCHG 1PQAA 2ZHDA 1ZHMA 3OYPA 3T5FH 5IDKA 1SQTA 4IC5A 2A5KA 4XOJA 1ZZZA 1NU9A 1DFPA 3MNCA 1GBCA 2O8WA 1UTJA 1K9OE 2FOEA 4H6SB 3GYLB 5A0AE 1A4WH 3AASA 1GJCB 2QC2A 3SNCA 3ZYEA 2AYWA 2FLBH 3GCHC 4H42U 1C5OH 5F03A 4A5TS 3TJVA 1NRRH 1EUFA 2VIDA 4CRFA 1T32A 2B0FA 4I31A 3MI4A 2XXLA 3PTBA 2F9PA 3ZZ3A 1T4UH 1FN8A 2FODA 1VGCB 1EZQA 5DP7A 3STJA 3A7WA 1BTZA 3RC5A 2H1UA 1TONA 2GCHF 1GMDF 3LC5A 4B71A 2PKSB 4FUBA 1O5BB 1GBAA 1TIOA 1EX3A 3LDXH 2G81E 1SQOA 2GDEH 3A7VA 1KIGH 4NA9H 4ABAA 1ZSKA 5C5NA 3DHKH 1QQUA 4U2WA 4WJG2 3GY2A 2ZGXH 4ABEA 1AKSA 4X8SH 3T2NA 4X2VA 3SI3H 4CRCA 2P3UB 3SJ9A 2RA0A 2BDIA 2SGPE 5DK1A 5L2YH 4X1RU 1BTUA 1Z8IB 1FY3A 1TPOA 1HV7A 4BOHA 4AFUA 1O2ZA 4Y76A 2QV1A 3ZYDA 1BRBE 1TA2A 4FVBA 5AVDA 3UPEA 1IQGA 2BD4A 1Z7KA 2OLGA 3F9GA 4JK5A 1FPHH 3SNDA 1P2MA 2FS8A 1QBNA 1ESBA 1O5DH 5JDUB 5GIBA 1SGTA 4ISHH 5CMXH 2XNIA 1GJ7B 1DDJA 1OOKB 4ZROA 3N7OA 1DUEA 3JZ2B 1V2UT 1WCZA 3QK1A 1O2TA 4FUIA 5T6FA 2CGAA 1BTHH 1AZ8A 1S5SA 4AB9A 2ZHQH 2GZ9A 3M3SA 2G52A 1O2WA 3PLKA 3SU1A 2ZG0H 3RC6A 3Q3XA 1O3NA 1C1UH 1TPSA 3D65E 5B6OA 3SZNA 3MMGA 1C2JA 2BLWA 1FLEE 1O2OA 1OYTH 3SNBA 1QBOA 2J9NA 3KF2A 1GL1A 9LPRA 3FP8E 4AG1A 2WUBA 2O8UA 2YNBA 4D7GA 5E2OA 4XE4A 4SGBE 2AIPA 6GCHG 2P3FH 3TH4H 4Y79A 4X1NU 2BXTH 1AVGH 2FX6A 1YCPM 3UQVA 1CO7E 3ATLA 2GKVE 2VWLA 4I33A 6CHAB 4GSOA 2VH0A 4U32A 4WF8A 1UK3A 3SNAA 1XUKA 5L2ZH 4B73A 3SV6A 3QX5H 2AGGX 2Y82A 1V2WT 3IWMA 5A8YA 3KGPA 1O5EH 2Z9IA 1L1GA 4DGJA 1N1LA 4IMQA 1QA0A 2GTBA 2STAE 1LQEA 1CA0C 3LH1A 1AB9B 9ESTA 2GZ7A 3E8LA 4TWWA 3UNRA 3VXEH 1D4PB 2DE8A 4X2WA 5K7RA 1RXPA 1D3PB 1V2NT 1Z1IA 2PSXA 2J34A 3PB1E 1SGFG 1NPMA 3RXFA 1ZR0A 1CBWB 1GPZA 2QCYA 3BTGE 1DWCH 3PMBB 1BMLA 4AORA 4LZ4B 5K0HA 1GBIA 2ZHWH 1XM1A 4YTAA 1H1BA 4X8UH 4E05H 1DXPA 4K1SA 4B2AA 1AUJA 1O3HA 4FUCA 2QF0A 2BVXH 2PKAA 5JBCS 3UOPA 1MZAA 3VPKA 2HPQH 4B75A 2BD9A 3TGJE 1SC8U 3O8BA 1C2HA 2D2DA 2Z9LA 3MO3A 2A0QB 2BDYA 1YPMH 1DUAA 1EB1H 5DP5A 4H6TA 1ZRKA 1YPHE 4UFGH 1NY22 1O2NA 1P01A 1D3DB 4RN6A 4KGAA 2PGBB 1C9PA 3A86A 3LONA 3QZQA 3OY5U 3SUGA 3BG8A 1PPEE 5JB9S 1UTLM 2C3SA 1TNKA 2ZU2A 2HNTE 1KXBA 5E8EH 1ZJKA 2HNTC 5C1UA 1UCYH 2A5IA 1BHXB 1AD8H 2JKHA 5DO4H 1T31A 2CHAB 3UNQA 1GBHA 3PMJA 5FAHA 5HYOA 1UO6A 2UWOA 1D3TB 1P9SA 2Q6FA 5DP8A 3RMOH 5DGJA 1JWTA 1S81A 1HNEE 2JETB 1K1JA 2Z3EA 1F5KU 2GCTB 4UE7H 3M36A 3KNXA 4B74A 2BD3A 2PR3A 5HGGA 3DA9B 1SQAA 1J9CH 1GGDC 1TWXB 2H9TH 1ZPZA 2RDLA 4D76A 2QIQA 1RTFB 1UK4A 1DY8A 1GBEA 4XSKU 1LVMA 3URDA 2BX4A 4R0IA 4CRBA 2D8WA 4GCHG 5L30H 1MTNC 3A84A 1CT4E 2BY7X 4PROA 2ZFSA 3SV9A 3DT0H 4X0WU 3SGQE 1LCYA 3RXMA 2BZ6H 1GCTC 3RXKA 4AGJA 2HRVA 2HGTH 1D6RA 3M7QA 1GJ9B 1XVOA 4X2YA 1FY8E 3GY8A 4KTCA 2OTVA 4MLFB 4WMEA 1HFDA 2O9QA 1O2QA 5E0HA 2FI5E 2JH0D 4ZKRU 1UHBA 3LJJA 1LHFH 3PV4A 5EOKA 4AFQA 2XWBI 1RFNA