5HM9A

Crystal structure of mamo protease domain from magnetospirillum magneticum (apo form)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
189
structure length
189
Chain Sequence
LYHTVPPAVVGVGGGGVNAGPVASGAIVGTNGYVITTLHSVSKLPEISVQVATTGGIRRFPAQVVKTIPGHDLALLKMQTTEKFLHFRMADVQTVVPGQQVFAFGRNMAGAPLVRQGLVQSADAPLAVGATQITHLLRSDAVYSWEQTGGPLVNAQGDLVGINIAATGPTGKVEGFTVPAQVIVSHLQD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MamO protease domain
publication title MamO Is a Repurposed Serine Protease that Promotes Magnetite Biomineralization through Direct Transition Metal Binding in Magnetotactic Bacteria.
pubmed doi rcsb
source organism Magnetospirillum magneticum amb-1
molecule tags Hydrolase
total genus 39
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5hm9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5hm9A01
1NRNH 2VU8E 1SFQB 1AVXA 5ESTE 1HB0B 1IQFA 1O2IA 2BQ6B 1K28D 3VFEA 1YM0A 2OC1A 1O36A 3N7OA 4FU9A 5DG6A 2GD4B 2W3IA 4MG3A 1TONA 2FYRA 1GL1A 1J9CH 5IDKA 1Y5BT 5L30H 3B23B 2BYAX 1L0ZA 1SGEE 2A45B 3UR6A 4HTCH 3HATH 3ZZDA 2R3UA 4R0IA 1MU8B 2Q6DA 1Z71A 3BG8A 1GJ4H 3MU8A 1GG6B 2ZPQA 2R2WU 3SI3H 3U98H 1TX6A 3GY8A 1KXFA 1U6QA 2XWBI 3GCHB 1IQIA 3EDXB 1Z6EA 3TK6A 1AKSB 4FUEA 3RXPA 4AYYB 1SFIA 1NRSH 1ZMNA 1GBJA 1V2ST 3ZZ3A 3UQVA 1AMHA 1DWDH 1OPHB 3U69H 1UTKA 1EPTB 1BJVA 1SBWA 1O5FH 1SLVB 2O8TA 4XE4A 2XCNA 2OCVB 3TGJE 5A0BA 1RTFB 4CR9A 8LPRA 1WBGB 2BHGA 2ZDKA 3PLPA 1BZXE 4I8HA 1XKBC 5K7RA 4ABFA 3ZV9A 3UTUH 1HAIH 1ZPBA 3P92A 1HRTH 1GHWH 3M37A 2ZHDA 1UTOA 2GZ9A 1W3CA 1TBQH 1GCTB 4ISOA 2PKSB 3TNTA 2PR3A 1O2MA 1X7AC 1Y8TA 1BTUA 4ABAA 4TY7A 1TX8A 2EI8A 3SJ8A 1O3HA 2VH6A 3LC5A 5C20A 1A3EH 1TGNA 2AMPA 1PYTD 2ZFQH 1O5CB 4MPWA 3V7TA 2V6NA 4SGAE 5BRRE 1NESE 2BY5X 2AIPA 1LVYA 1H1BA 3EA9A 4GSOA 2ZU3A 1D6WA 2BDHA 1MQ5A 1LVOA 4XOJA 1HAOH 1SLUB 2FDAA 4WWYA 1YLDA 3EGKH 2VGCC 2A4QA 1WQVH 1ETRH 1DOJA 1GJ8B 1GMHG 1UVOA 4IC5A 1BBRE 1GHBG 1C5RA 1EASA 4D76A 1AB9B 1MCVA 1D3TB 1TQ7B 1PPGE 3BG4B 1AFQC 2ANMH 1O2GH 1ESTA 3CS7A 1UO6A 2O9QA 3OTJE 4YLQH 2HLCA 1YCPK 2FXRA 5JPMH 1QNJA 3ITIA 3C27B 4JYVH 1Q3XA 1GDUA 1HAXB 4ABJA 4UEHH 2P16A 2HGTH 2UUYA 5ABWA 2VIOA 4NFEA 1QL8A 1ELGA 2DE8A 1QL9A 3DFLA 1ZSJA 2C8WB 2BXUH 3RXCA 1KTSB 2GZ8A 3LONA 4BXWA 1NZQH 1GHAG 1EUFA 3TLOA 2PKAB 3ODFA 4MVNA 2ZGJA 3ZVEA 3HKIB 4OGXA 3SJIA 2W5EA 3GDUA 1HJAC 1A1RA 4ZKRU 3PROA 1ORFA 1ZPZA 3FP7E 1QB1A 4K60A 5EQSA 4ABDA 3A82A 1DITH 1O3JA 3E90B 5DKMA 3SV7A 1A2CH 1QTFA 2TGAA 4AYVB 3VGCB 3QDZB 2RG3A 2Z9JA 4MNVA 1RTLA 4NWLA 3MFJA 1SVPA 1LKBA 3GY3A 2AIQA 3CP7A 5T3HA 3QX5H 1SLXB 2ZTZA 2G5VA 3STIA 2A5KA 1BITA 3PB1E 1C1UH 2ZDNA 2BMGB 2C8YB 1GL0E 3R3GB 4OS7A 2WINI 2VIWA 3GISB 2H5DA 2SGFE 4FUIA 4HFPB 1XUIA 2V0BA 2ZHEH 1MTNC 1C5MD 2ULLA 4Y0ZE 2JETB 4A92A 1FY1A 1XMNB 2ZA5A 3TIUA 3VXFH 1SGFG 2CF8H 3P8GA 1EZUC 1QRXA 2QY0B 2ODYB 3A7VA 2ZDAH 3KQCA 2ODPA 1NRQH 1TMBH 5CMXH 5FPTA 2ZGHA 1TWXB 2A7JA 2P8OB 3IITA 4FU8A 1GJ5H 4JZ1A 1ZTLA 2FOBA 3ATMA 3A8BA 1YPKH 1CGJE 2H9EH 4WXVA 4BAKB 2ZU2A 1GI4A 3URDA 2F9UA 2SGEE 3HGPA 1C5NH 1LPZB 1A61H 1YPLH 4CBOA 1AKSA 1D9IA 3NK8A 1YKTA 2BY7X 1ELTA 3OU0A 5I25A 3SUFA 1PPEE 1K9OE 3SGQE 5GCHG 1GMCF 1O3MA 1VJ9U 1GBHA 3M3TA 1ZHMA 1XKAC 4YOJA 3E3TA 5GIBA 2C8XB 3HK3B 2LNCA 2ZNKH 3H7TA 1EPTA 3RXUA 5F8ZA 1P2NA 1N1LA 1Q2WA 4JZFH 1P2IA 1H9HE 5EXMA 3NPSA 4U01A 3ESTA 4U32A 3DFJA 1AU8A 3SN8A 1FN6A 5H4IB 5DP4A 1V6DA 2ZEBA 3ATLA 2TGDA 1YPJH 4O3UA 4LXBH 3QZQA 1TMTH 4YOIA 5K0HA 4YT7H 1EJNA 4THNH 3SI4H 2ZWLH 5GCHF 5A8XA 1SQOA 3OX7U 1P10A 2PTCE 1B5GH 3BV9B 1EOJA 2PUQH 3FAOA 2OINA 1VGCC 2GV7A 2DUCA 1F5LA 3RC4A 2J94A 1CQQA 3TJNA 1RIWC 1BTYA 2QCYA 2QF0A 2VIDA 3F6UH 2FLBH 4X8UH 2Z7FE 4B71A 1IHTH 1FY4A 1HIAA 2WYGA 4GCHF 3FANA 5FX6A 4X6NA 2O8MA 2OTVA 1ZTKA 4IN2A 1NFXA 1MQ6A 1GBTA 2J9NA 1B7XB 2EC9H 2F91A 2ZHFH 4X8VH 4NZQA 1O32A 1OWDA 1ID5H 2NWNA 4JZIA 4TY6A 1O3NA 3DD2H 2XC0A 1BMMH 1L2EA 4WH8A 1FIZA 5FCKA 1CVWH 1G36A 3ENSB 3RMOH 4YESB 1O2RA 4LOYH 2C93B 3F9EA 4NSYA 4BNRA 3A87A 4ZXYH 3TJUA 2ZCLP 3W95A 2D1JA 3RMLH 2Z9IA 4ASHA 1KIGH 2BXTH 1E36B 3TJVA 4F49A 1XXDA 1SPJA 4NG9H 4BOHA 1DY8A 1BTHH 1SHYA 1Z8RA 3RXJA 2BVXH 4OS1A 1O3OA 3TU7H 4KP0A 4MNWA 3A7ZA 2GX4A 2IJOB 1C1OA 1P04A 3HGNA 1SB1H 3MOCA 1BBRH 3GY4A 2BQ7B 1DUEA 2BOKA 3S9CA 1BTWA 1KLJH 2G5NA 3SU3A 2ZU4A 9ESTA 1C2JA 1W8BH 4IN1A 5E2OA 1WQSA 1IQNA 1V2LT 1YPHE 2OC8A 3BTFE 1EB2A 4KTSA 2TGPZ 1EJAA 2RDLA 2PKAA 3M7TA 3PM3A 3FZDA 1O34A 1ELEE 1O5BB 2VGCB 2SGAA 1AUJA 1O38A 1Z8IB 2GTBA 2XXLA 2ALPA 2HPPH 9LPRA 1QR3E 4E7NA 1V2UT 4FUFA 3OSYA 2QIQA 4K3JA 1A7SA 3BSQA 1VJAU 5DK1A 1OX1A 3H5CB 3ZV8A 2OXSA 1O2PA 4HZHA 2H9HA 1SQTA 2D2DA 1AFQB 1SGTA 2FIRH 3SJ9A 5EXNA 4UFDH 2G8TA 1O3CA 3TNSA 3W94A 4HGCA 4U30A 1JRTA 2ZHWH 1BHXB 4ABHA 3ZVCA 1P8VC 1C2EA 1ZYOA 3SU2A 3SU1A 4Y10E 1O3FA 4BAQB 3V3MA 4ABEA 5J4QA 1EB1H 2HVXA 2FI5E 3STJA 1W7GH 2TGTA 4ABBA 1Y3VA 2QGRA 5G4BA 1AY6H 2FODA 3I77A 1W7XH 2VH0A 1XVOA 1A4WH 1O0DH 4BTIB 1MAYA 1AE5A 4O97A 4WH6A 1HJAB 3SOSA 3RXQA 3LOXA 2ILNA 1SGDE 2BB4A 4X8TH 4BTUB 1FV9A 4YO9A 1EAUA 1XVMA 3LC3A 3PMBB 2OQUA 1S82A 1GHZA 1GGDC 1LCYA 1E37B 4GUXA 1MAXA 3EAJA 1BRBE 1ZSKA 1HUTH 2FO9A 1UTLM 5T6FA 1O2TA 1S0QA 1QY6A 1UHBA 1VZQH 1ABIH 1GHVH 2FS8A 2PW8H 3KN2A 3KCGH 1QHRB 1TBZH 2A1DB 4JZDH 1AUTC 3SHCH 2F9OA 1DWCH 1G3EA 5A2MH 1TGTA 2FESH 4XBCA 3SUDA 5A09A 1EZXC 3RXTA 2PGBB 3PMJA 2GV6A 3T26A 1O2HA 2G51A 4NWKA 2ZGXH 1ZOMA 2CF9H 1PFXC 3G01A 1IOEA 3ZVFA 3RXEA 2JH6D 1K1IA 1C4Y2 4Y7AA 4NZLA 1GI2A 2OP9A 2RCEA 2VWMA 3GYLB 1O3BA 1PQ5A 3KL6A 3GY6A 1GHXH 4DT7B 3ZZ7A 1QA7A 1HAYB 5FBIA 5HM9A 4YTAA 3MYWA 3M7UA 5HGGA 2J34A 4DG4A 4WF8A 1SGNE 2HRVA 3RXSA 4GVUA 5JB8S 3CS0A 3M36A 5FPSA 5SGAE 3RDZA 4FVBA 4I31A 2R3YA 4LZ1H 3IG6B 2XYAA 4MLFB 1C1WH 1S5SA 1AZ8A 4BAHB 3SNEA 3QGJA 4K69A 1RTKA 1FAXA 1KXBA 3OYPA 1SC8U 2AFQB 1NU9A 2VVCA 1D3QB 4UFFH 4XBBA 3PV4A 1LKAA 1BBRK 1C9PA 2A4GA 5EU8A 1IQJA 1MBQA 4NA9H 4Y79A 4UFGH 2P3FH 1LQEA 4K5ZA 1KTTB 3U8RH 1ARCA 1P05A 3ELAH 1NN6A 2O8WA 1E0FD 3LGYA 3O8CA 3E8LA 4YT6H 3TH3H 1ZR0A 1AI8H 3RXBA 5HM2A 1UTNA 2BVSH 2A5IA 2G52A 2BQWB 1DICA 1RIWB 4AFUA 5LGOA 1TIOA 1YC0A 1HAHH 1O3EA 1BMLA 2Z3CA 3Q3XA 2A2XH 4INHA 3SZNA 2ZG0H 4XFQA 3RMNH 4FUHA 2VINA 1YBWA 3Q76A 4YOGA 3RXAA 2ZIQH 2J92A 4CR5A 3DHKH 1K21H 3LJJA 3RXLA 2GCHF 5C1UA 3K65B 2QC2A 1SGPE 1W2KH 1NROH 2J95A 1RRKA 1J14A 3A7YA 4DJZB 4BAOB 2QN5T 4Y6DA 2OLGA 1ANDA 1BMAA 2SNVA 4X6OA 3S7KB 4AG1A 3D65E 1V2PT 3U8OH 1V2RT 1C5LH 2H1UA 1GI9B 3M5NA 1Z1JA 4IW4E 4E05H 1C1VH 1CU1A 1S0RA 1WAYB 2XBXA 1MBMA 5DP9A 1EZSC 3VB5A 5LPRA 3F9GA 2GCTC 1K2I1 4A6LA 1DANH 4ZH8A 3M35A 4WMFA 2PHBA 4GLYA 5JB9S 1CBWC 1C2MA 1TMUH 2QXJA 3LIWA 2I6QA 1K1PA 3MU1A 2Q6GA 4WY3A 1UTMA 2ZU1A 2A7HA 3QUMP 1TNIA 2PGQB 5E0HA 2Z94A 3AAVA 1O5DH 2SGPE 3U1JB 1IQMA 1TQ0B 3QZRA 2ZGCA 1FPCH 2HNTF 4AOQA 4INLA 4DIHH 1O2UA 1O2KA 3HPTB 2CXVA 3RU4T 3QK1A 3MH6A 3UWIA 1S84A 2P93A 3KNXA 1TA2A 2W7UA 1OKXA 4DGJA 1JOUB 1C5YB 2BD7A 2FTLE 3SNAA 2ZI2H 5CE1A 7LPRA 4ZUHA 3KQDA 3LU9B 2WV5A 1HIAB 3RXKA 3JZ2B 3BTQE 1RS0A 3PO1C 1CGHA 4XDEA 6CHAB 1FXYA 3QGNB 4UE7H 3LPRA 2Y81A 5E0GA 1ZHRA 4X2XA 4M7GA 3A7WA 3MNSA 4ABIA 3PTBA 4X8SH 1EP5A 2RA0A 1N6YA 2TBSA 3RM2H 2FOMB 1Y3XA 1K1JA 1C1MA 2J2UA 4NA7A 5DO4H 2VIQA 4NCYA 1UVTH 1RXPA 4Q80A 3NKKA 1QBNA 1HAGE 2PFEA 3ATKA 1UCYE 2XBWA 1C5QA 2NU0E 1C9TA 4K1EA 1GI5A 1HXEH 3PYHA 3S9AA 3BTTE 1BDAA 2YNBA 4BTTB 4GAWA 1DXPA 1YCPM 1MTVA 1S85A 3P8OA 1KXEA 2VNTA 1K1LA 1MTUA 1O39A 1AQ7A 4ZMAH 2GT7A 1GJ7B 1KXAA 5ESBA 1IAUA 2Q1JA 1EATA 1T7CA 1LHGH 4TYDA 1GMHF 4X2VA 1V2VT 2Y5FA 1THRH 1GHBF 1FNIA 1YPHC 4Y7BA 2OC0A 3R0FA 4FUDA 2ZECA 2ZDLA 3ATIA 5A8YA 1JWTA 4B76A 4DVAU 2A31A 5DGJA 1L1JA 2B9LA 1DWEH 1O3AA 1D4PB 3NCLA 4KTCA 3M5OA 3E1XB 1C2IA 1QBOA 3URCA 1UVSH 5EGMA 2BD4A 4H6TA 3VPKA 2HPQH 1VITH 1TNGA 1GHAF 1D6RA 1C1QA 1THSH 1C1RA 4O9VA 4XBDA 4HI3A 2BLOA 2ZGBH 1YF4A 1MU6B 1EX3A 5TCAA 2VB0A 2TPIZ 1OS8A 1PPBH 1LHEH 1F7ZA 1JXPA 2ZQ2A 1HJ9A 4Q2KA 3LGIA 1O30A 1T32A 2CHAC 3MNBA 3RLYH 1TNJA 2FYQA 4BAMB 2H6MA 1DSUA 3GCTG 1O3PB 1BIOA 1ZRBA 2AMQA 2F9PA 2G81E 3K2UA 3SV8A 2QF3A 1IQGA 3P95A 1GVZA 3M7QA 3T25A 6LPRA 2B0FA 1FN8A 8GCHG 1FUJA 3M3SA 2IN2A 2VWNA 3M61U 3UREA 1OWKA 2J38A 3O8BA 2JH5D 1GBMA 1UHBB 1UTQA 4OS6A 5EQQA 1G3CA 1H8IH 1AD8H 4B74A 2H9TH 4CRFA 1TALA 1ESBA 2BDIA 3P8FA 2ODQA 3GCTF 2FZZA 4NIXA 3O8RA 2ZO3H 2F3CE 4F4OC 4KTUA 1AHTH 4MPVA 1DPOA 4AB8A 3RU4D 5L6NH 2XWAA 1TAWA 1CHGA 1DXWA 3VB6A 3TGKE 4Q7ZA 1DVAH 2EI7A 3UOUA 4I8JA 1SG8B 3SNBA 1ZJDA 3ZYDA 3ZZCA 4IGDA 4Y8ZA 1ANCA 1DT2A 1MTSA 5FXLA 1PQAA 2FOEA 1PPHE 4MQAA 3K9XB 4ZHMU 1GDQA 1PQ8A 4AGKA 1YLCA 1GBEA 4YLUA 1OWEA 1OYTH 2ZCKP 4B2CA 1THPB 4I33A 2I6SA 4Y11E 2PUXB 3V12A 3FFGA 5C67A 5CHAC 1P3EA 1ETTH 1GBFA 1BA8B 5GWZA 1WU1A 3A80A 2Q6FA 3ZZ5A 2FI4E 1HGTH 5EQRA 1O37A 1MUEB 3LH1A 1LVBA 2GCTB 2FX6A 1Y3UA 1UVUH 1O5GH 2V3HH 1SOTA 1ELBA 1FZZA 1SOZA 3T2NA 2GT8A 4AORA 2VJ1A 2XRCA 2ZC9H 3K6YA 2FI3E 1V2KT 1AIXH 1BT7A 2Z9KA 5A0CA 1TGSZ 1T4VH 1TABE 4GPGA 1UMAH 3NWUA 3T29A 3ZZ4A 1MZDA 3BTGE 4KELA 1W13U 1GMDG 1VR1H 4ISHH 1GI6A 3UWJH 2Y5GA 1PQ7A 2R9PA 3FP6E 1NM6A 1LQDB 5EW2H 2WPHS 1G2MA 1QFKH 2Y7XA 5ETXA 4A1TA 3LGUA 4TWWA 2BD8A 5C5NA 8ESTE 2R2MB 1QRWA 2GDDA 3BTEE 1GVLA 4NGAH 2FLRH 3S0NA 1DX5M 1OXGA 3DA9B 1V2JT 3UNSA 4ZROA 3DUXH 4IMQA 3SUGA 1W12U 2WYJA 1W10U 1IQEA 1P2OA 1GMDF 2IOTA 3MHWU 1H4WA 4DY7B 2VIVA 1B0FA 1VCQA 1WCZA 3RC6A 2ANKH 1TGCA 1O35A 2FOFA 3BN9A 3BEUA 1MH0A 1MCTA 2Y82A 3B9FH 1C5TA 1GG6C 4B1TA 2GZ7A 2BY9X 2HNTC 1O3DA 1V2WT 1F0TA 2K1QA 5JBCS 1JBUH 1BUIA 1GBBA 2Y7ZA 4I7YH 4CRCA 4CRBA 5A0AE 1PYTC 3GCHC 3S69A 1OWHA 2GKVE 2PTNA 4DIIH 3SGAE 1TOCB 3VB7A 2AGEX 1FAKH 1O2VA 2HOBA 1BTPA 1HJ8A 3D62A 3VXEH 1O2NA 2ZTYA 1K1MA 2R0LA 3KQBA 1A3BH 6GCHG 2NU4E 4E06H 1JRSA 3NUMA 1GWAA 1O5EH 1HAPH 3M5MA 1EXFA 2C4FH 1QBVH 4JK5A 4CHAC 2QA9E 3EQ0H 1ZGIA 4X0WU 1CHOG 3BTDE 3LGTA 1A5GH 2UWLA 2XTTB 3A81A 3ZZBA 3QLPH 1Y3WA 2ZKSA 2M5TA 1INCA 4E7RG 1FIWA 1C2KA 5JBBS 1HLTH 3BTKE 4Y8XA 3EE0B 1MD7A 3K6ZA 1QA0A 1UVPA 6GCHF 2ZCHP 5DP3A 1TA6A 1G37A 1T8NA 2AS9A 2C3SA 2UWOA 4RSPA 1C5WB 2P3UB 1DLEA 1RD3B 4K1SA 4X1NU 4ISLA 5L2ZH 3BTHE 1SL3A 3KIDU 1CHOF 4BXSA 4D7FA 2BY8X 2PV9B 4WMEA 1T8LA 5F03A 2CJIA 1E38B 4TPYA 2XC5A 1BRUP 3SU5A 4CBNA 3S9BA 1ARBA 1FMGA 4AFQA 1JIMA 4K1TA 4ZXXH 1GBLA 3GY7A 1BHXF 1O2SA 4K8BA 4D9QA 1ANBA 1GBCA 1HBTH 1MTNB 1CT0E 2ZDMA 2A2QH 1SGCA 2CHAB 4YZUA 3TH4H 4AGJA 4FUJA 4FVDA 1KLIH 2H5CA 1O3LA 3S7HB 1AB9C 1C5SA 3RXFA 2FEQH 3MTYA 3RUOA 4IMZA 3MO3A 5GJ4B 3QTVH 3SORA 1QQ4A 2BDBA 2SFAA 5AHGH 1NFUA 1QCPA 2KAIB 2AERH 1AN1E 1G30B 1QQUA 4X2WA 2FPZA 3SW2B 4ZHLU 1S83A 3NXPA 1MZAA 2GVFA 5EODA 1TNLA 4K8YA 1ZRKA 4MPUA 3GY5A 3SJKA 3LKWA 5T6GA 1N6XA 2FOCA 2Y5HA 5HMAA 1F5RA 3GCNA 1OYQA 2A4RA 3P8NA 1QJ6B 1HCGA 3A7XA 1TLDA 4KGAA 1A0JA 2XBYA 1AWFH 4NIVA 2CGAA 1N8OC 1A46H 3BTWE 1J16A 3P70B 1F0SA 1P0SH 3TVJB 1A5IA 1MMJN 1BQYA 1F0RA 3PTNA 2HALA 3BEFB 5GXPA 4O03A 1XX9A 2QXGA 2ZZUH 4H4FA 3KHVA 4Y76A 1LHCH 4CH2B 2UWPA 1C5UA 1P01A 4NSVA 3U9AH 1GI3A 2AYWA 1O2WA 1TNKA 1EKBB 5PTPA 5AFZH 3UNQA 2VVUA 3MU4A 4CRDA 3FZZA 1G3BA 1KDQB 3SBKA 2ANWA 1OP8A 1AFEH 1DE7H 2J4IA 2BY6X 3RMMH 1EZQA 1ELFA 1M9UA 3Q3YA 3A83A 1YPEH 1HV7A 1NFWA 4FXGH 4NIYA 4AFZA 1W11U 1GJ6A 4GHTA 5CHAB 3A8DA 1RFNA 1VGCB 2YNAA 3ZVBA 1JIRA 1W0ZU 1C5VA 3LDXH 4ZKSU 1EJMA 5F8TA 3RXDA 3RXHA 4NA8A 1OSSA 4X1SU 1PJPA 2A5AA 2XCFA 4X2YA 4U2WA 1C2GA 1QB6A 3TH2H 1NC6A 4ZAEA 4GHQA 2G4TA 3AW0A 4AZ2B 3SV9A 3KGPA 4WMDA 2A0QB 1SGQE 3MO6A 3UY9A 1NTPA 1F92A 4FUCA 1WUNH 1TYNA 4I8LA 4JZEH 1CT4E 2HNTE 2CV3A 3UFAA 1F2SE 4KKDA 3D49H 3VB4A 1NRPH 4D9RA 1C5OH 2G00A 3ZVDA 1TBRH 1T4UH 1MKWH 1O3IA 1P3CA 1ZTJA 1TPAE 4NFFA 5JYIA 1EAIA 1LPKB 1P03A 3SHAH 1O33A 1XUFA 1VITG 5FHTA 1K1NA 2BDAA 1W14U 3A86A 3PMHB 2SNWA 2ZFFH 1WV7H 3D23A 1MD8A 5DJ7A 2FOGA 3AASA 3SV2H 1EAWA 1MTWA 1FY3A 5FCRA 1ABJH 1C2DA 2FP7B 3M5LA 4AX9H 1XM1A 1H9IE 4J2YB 5E0JA 1VITF 5JBAS 2XC4A 3U8TH 1NT1A 3SV6A 4QT8C 3SNDA 3ZVAA 2BDGA 1WOFA 2TRMA 2QXHA 4ZHAA 1EP6A 1TPSA 1FPHH 3SJOA 4Z0KA 1SR5C 2D26C 1P9SA 3UUZA 2QV1A 3RXRA 1HAZB 4BANB 4MNYA 1FI8A 3Q77A 2AGIX 3GY2A 3RLWH 1YPMH 4CHAB 1C2LA 4JYTA 1ESAA 2SGQE 2O8UA 2VWOA 4JK6A 4JCNA 1AWHB 1BRCE 1MKXH 1P9UA 3VEQB 1YPGH 1SMFE 1GJ9B 3P17H 1UTPA 4DW2U 2XNIA 5I46H 3V0XA 3E0NB 5EPNA 4MTBA 4UFEH 1K1OA 3ZVGA 1O2JA 3OY5U 3FP8E 4Q7YA 2DE9A 3SQEE 3M3VA 1GBDA 1O2XA 3UPEA 1Z7KA 1SGIB 4B2AA 1D3PB 4ISNA 1DFPA 2ZPSA 4B75A 1D3DB 2BD3A 1GI0A 1CSOE 3O8DA 1AZZA 1LVMA 5TCCA 4AB9A 5C2ZA 1J8AA 4Z6AH 4FUGA 1GGDB 1S6FA 4TWYA 4I8KA 3SUEA 2KAIA 3MI4A 1VCWA 2GMTC 1O2OA 1GVKB 2ZU5A 1CGIE 1FDPA 3NZIA 1ANEA 1L1NA 3F9FA 2AH4X 2A7CA 2Z3DA 3U1IB 4D8NA 4YM9A 2P3TB 2AGGX 1AE8H 1ELCA 4ZKNU 1HAVB 3MU5A 4UD9H 1QIXB 2FWWA 1IQHA 4A5TS 1TNHA 5GPIB 1YGCH 3PLKA 2NU2E 1WTHD 2AEIH 1TB6H 2FTMA 1TGBA 3MMGA 3GOVB 2G4UA 4X6MA 4SGBE 1ZLRA 4JYUH 1DLKB 1HPGA 1NS3A 2CMYA 2BM2A 2Y6TA 2GDEH 3RP2A 1C2FA 3UIRA 5T6DA 4B73A 1G9IE 3RU4E 1DUAA 5E8EH 1KDQA 3ZZ8A 2P59A 1LTOA 1L1GA 1P02A 2BD9A 3C1KA 3EYDA 3EA7A 5DP5A 1MKWK 2BTCE 3SU0A 1OP2A 1DY9A 2GP9B 4WXIA 4K2YA 1J17T 1N8OB 2PSXA 2ANYA 2BLVA 3HK6B 1CA0C 1E35B 2ALVA 4OGYA 1PPZA 1GI1A 3PLBA 1NFYA 2UUKB 1JMOH 1UK3A 1P2KA 1GJBB 2QAAA 2W26A 4FUBA 3VB3A 1GCDA 1BJUA 1F5KU 4I32A 2STAE 5JDUB 1Y3YA 1O2YA 1TPOA 1GHYH 4OS4A 5JBTA 3AW1A 3A8AA 8KME2 5C3NA 3LT3A 1CO7E 2LPRA 5FPYA 1TRNA 1LPGB 3T27A 7GCHG 3AVZA 3TJOA 1P06A 1EQ9A 1HYLA 1FONA 1F0UA 2H2ZA 4TPIZ 2C8ZB 1SQAA 2BD2A 4ESTE 3E6PH 3T62A 1OOKB 3ZZ6A 1WYKA 5J4SA 1FY8E 1GI8B 1TPPA 5FX5A 4VGCC 4OS2A 2Y80A 2SGDE 2ZF0H 4J1YA 5DPAA 2F9BH 3WY8A 1HXFH 1Z1IA 2GGVB 5HYOA 1RGQA 1HFDA 1T8MA 2THFB 1GMCG 1V2TT 3F1SB 4DCDA 3SNCA 7GCHF 3F68H 2F9VA 1O3GA 1MKXK 2G55A 8GCHF 4IBLH 3TITA 1LO6A 1ZHPA 4X6PA 4X1RU 3RXVA 3UR9A 1YYY1 2P95A 4LZ4B 4Y0YE 3DT0H 2OBQA 2R0KA 2OD3B 4MPXA 3A84A 1XXFA 5EPYA 1ZMLA 1O3KA 2STBE 3UNRA 3SO3A 1LHFH 1P2JA 1GBKA 7ESTE 2JKHA 1Z8JB 3AAUA 3Q00A 1NU7B 1GBAA 4INKA 3A85A 1DWBH 5A8ZA 5LH8A 2VVVA 1UK4A 4IS5A 1G2LA 3RXIA 1UK2A 2HWLB 1W0YH 3QN7A 3V13A 4MDSA 4R8TB 1TFXA 4JMYA 1L4DA 3RXOA 5EOKA 4GCHG 2BDYA 1P57B 1ZGVA 3BF6H 1A0LA 3BIVH 5EW1H 1UTJA 1PPFE 2XBVA 1NY22 5LPFA 3A89A 1CBWB 1CE5A 1VCPA 1KYNA 2F9NA 1BTXA 1LHDH 1O2LA 1SHHB 1KSNA 3E91A 2BD5A 5LPEA 2ESTE 3I29A 1TRMA 3T5FH 4OS5A 4ABGA 1HNEE 1P2MA 4CH8B 2A4OA 1EAXA 2OQ5A 4MNXA 3MH5A 2PLXA 3MWIU 1SI5H 4DOQA 4RN6A 1E34B 2UUJB 1QJ1B 4Q7XA 2BX4A 1LDTT 4X1QU 3RM0H 2FX4A 1B0EA 1V2QT 2BOHB 3B8JA 4X1PU 1P09A 1PPCE 1HAVA 2Z6BD 1C1NA 1AVGH 1TRYA 1UCYH 2ZQ1A 3E16B 3PO1B 1G32B 3LGVA 5AF9H 3OY6U 2BDCA 2UUFB 2AMDA 2QYIA 4PROA 5AVDA 2ZFSA 1T8OA 4H6SB 1J15A 2QXIA 1XUKA 1KXDA 2V35A 1O5AB 4I8GA 1HDTH 4AFSA 2WUBA 3A8CA 3A7TA 2VWLA 2O8LA 3BIUH 2FMJA 5E2PA 4CRGA 2WPKS 2TIOA 1Q31A 5B6OA 4IC6A 1FY5A 1ACBE 2GMTB 4RKOB 3HKJB 3E0PB 5DP8A 4UONA 3ZYEA 2ZPRA 3LGWA 5C1XA 1FJSA 3GYMA 1BRAA 1GJDB 2A32A 1FLEE 2EI6A 1C1TA 2NU3E 2WPJS 1EPTC 1KLTA 2BZAA 1C5PA 4WJG2 1ZZZA 7KMEH 3KQEA 3TGIE 1KXCA 1IQLA 3JZ1B 2IPHA 1V2MT 5FBEA 1Y5UT 3RXGA 3LH3A 3QWCH 2BLWA 1Z8GA 3P6ZB 3MNCA 1BCUH 2WUCA 3GCOA 5EXLA 1DS2E 1OP0A 1C4U2 1ZMJA 1GI7B 3PWBA 1P12E 4LK4A 1SLWB 4CREA 1OWJA 3TK5A 1C4V2 1GCTC 4RKJB 4CRAA 1YP9A 2D8WA 5L2YH 2PKSC 1SGFA 1GJCB 1QGFA 2BX3A 1P11E 3H7OA 3QTOH 1Z6JH 2EA3A 1ZSLA 2OC7A 1H8DH 3MU0A 1BMNH 3KF2A 1C5ZB 1S81A 1O2ZA 2P94A 1GJAB 1CA0B 1O31A 2EEKA 1SGRE 6CHAC 4FU7A 1NRRH 1BOQA 2ZP0H 1XUJA 2ZTXA 1CT2E 1GPZA 2BZ6H 2W7SA 3PWCA 1AO5A 3CENA 1BTZA 1TE0A 2B5TB 2B7DH 1TOMH 5GDSH 2OBOA 4AG2A 2WPIS 1WSSH 4D7GA 3ODDA 3A88A 2YOLA 3MNXA 1DSTA 3UQOA 3BG4C 1V2OT 2WPMS 1G3DA 2ZFPH 2Z9LA 3GICB 1K22H 4O3TA 1Y59T 3KEEA 3BEIB 3EA8A 1C1PA 4DURA 5C1YA 3ZZAA 3SU4A 4A1VA 1LMWB 4AN7A 5BPEA 3UOPA 5FAHA 1EOLA 1C1SA 1ELVA 3GDSA 4VGCB 1IHSH 1L4ZA 6ESTA 2ASUB 3FVFB 2C90B 1ETSH 1XUGA 1T31A 1OWIA 2F83A 3SGBE 3QO6A 1QJ7B 3MH7A 1Y5AT 4NIWA 2WV4A 3Q3KA 1NPMA 1WTGH 1DDJA 2ZFRH 1CA8B 5DP6A 4B2BA 3L6PA 2FS9A 1QURH 1V2NT 2OUAA 1V3XA 1AVWA 1UCYK 3TPIZ 3VGCC 1RJXB 2Z9GA 1QL7A 2NU1E 4H42U 1NO9H 4XSKU 2ZFTA 2BVRH 5F8XA 3TK9A 5TJXA 1FQ3A 2PWXA 3L3TA 4A1XA 2V3OH 1IQKA 2WPLS 4Y8YA 1S6HA 1GBIA 1AGJA 1O2QA 2FOAA 1UJ1A 4WVPE 5AFYH 1ZPCA 1C2HA 2BLQA 2JETC 3GDVA 5EG4A 5DP7A 2FM2A 1A0HB 3ATWA 4Y71A 1BB0B 4ZKOU 5HXFA 5F6MA 3PMAB 3RXMA 2ZHQH 2VIPA 3RC5A 1ELAA 3MH4A 3L33A 1P2QA 2JH0D 2CN0H 2P8OC 3ZZ9A 1QRZA 1KY9A 1YCPH 1ZJKA 4A7IB 1H9LB 1C5XB 3SU6A 2ZDVH 3MO9A 2GCHG 2RA3A 2W3KA 5IYTA 2XW9A 2B8OH 1XUHA 3IWMA 3BTME 3LJOA 5C5OA 1A5HA 2PSYA 4ISIH 3SQHE 3T28A 3I78A 1SGYE 1DM4B 2Z3EA 3F9HA 1SSXA 1ELDE 1GDNA 1QB9A 2FOHA 4UDWH 1TX7A
chains in the Genus database with same CATH superfamily
1NRNH 2VU8E 1SFQB 2K0QA 1AVXA 5ESTE 1HB0B 1IQFA 1O2IA 2BQ6B 1K28D 3VFEA 1YM0A 2OC1A 4ACBA 1O36A 3N7OA 4FU9A 5DG6A 4F55A 2GD4B 2W3IA 4XD7D 4MG3A 1TONA 1YY3A 2FYRA 1GL1A 1J9CH 5IDKA 1Y5BT 5L30H 3B23B 2BYAX 5DN6D 1L0ZA 5CDFE 1SGEE 2A45B 3UR6A 4HTCH 3HATH 3ZZDA 2R3UA 4R0IA 1MU8B 2Q6DA 1Z71A 3BG8A 1GJ4H 3MU8A 1GG6B 2ZPQA 2R2WU 3SI3H 3U98H 1TX6A 3GY8A 1KXFA 1U6QA 2XWBI 3GCHB 1IQIA 3EDXB 1Z6EA 3TK6A 1AKSB 4FUEA 3RXPA 4AYYB 3F2GA 1SFIA 1NRSH 1ZMNA 1GBJA 1V2ST 3ZZ3A 3UQVA 1AMHA 3EE7A 1DWDH 1OPHB 3U69H 1UTKA 4AC9A 1EPTB 1BJVA 1SBWA 1O5FH 1SLVB 2O8TA 4XE4A 2XCNA 2OCVB 3TGJE 5A0BA 1RTFB 4CR9A 8LPRA 1WBGB 2BHGA 2ZDKA 3PLPA 1BZXE 4I8HA 1XKBC 5K7RA 4ABFA 3ZV9A 3UTUH 1HAIH 1ZPBA 3P92A 1HRTH 1GHWH 3M37A 2ZHDA 1UTOA 1SKYE 2GZ9A 2WV9A 1W3CA 1TBQH 1GCTB 4ISOA 2PKSB 3TNTA 2PR3A 1O2MA 1X7AC 1Y8TA 1BTUA 4ABAA 4TY7A 1TX8A 3CNRA 2EI8A 3SJ8A 1O3HA 2VH6A 3LC5A 5C20A 1A3EH 1TGNA 2AMPA 1PYTD 2ZFQH 1O5CB 4MPWA 3V7TA 2V6NA 4SGAE 5BRRE 1NESE 2BY5X 2AIPA 1LVYA 1H1BA 3EA9A 4GSOA 2ZU3A 1D6WA 2BDHA 1MQ5A 1LVOA 4XOJA 1HAOH 1SLUB 2FDAA 4WWYA 1YLDA 3EGKH 2VGCC 2A4QA 1WQVH 1ETRH 1DOJA 1GJ8B 1GMHG 1UVOA 4IC5A 1BBRE 1GHBG 1C5RA 1EASA 4D76A 1AB9B 1MCVA 1D3TB 1TQ7B 1PPGE 3BG4B 1AFQC 2ANMH 1O2GH 1ESTA 3CS7A 1UO6A 2O9QA 3OTJE 4YLQH 2HLCA 1YCPK 2YMSC 2FXRA 5JPMH 1QNJA 3ITIA 3C27B 4JYVH 1Q3XA 1GDUA 1HAXB 4ABJA 4UEHH 3F2FA 2P16A 2HGTH 2UUYA 5ABWA 2VIOA 4NFEA 1QL8A 1ELGA 2DE8A 1QL9A 3DFLA 1ZSJA 2C8WB 2BXUH 3RXCA 1KTSB 2GZ8A 3LONA 4BXWA 1NZQH 1GHAG 1EUFA 3TLOA 2PKAB 3ODFA 4MVNA 2ZGJA 3ZVEA 3HKIB 4OGXA 3SJIA 2W5EA 3GDUA 1HJAC 1A1RA 2KCOA 4ZKRU 3PROA 1ORFA 1ZPZA 3FP7E 1QB1A 4K60A 5EQSA 4ABDA 3A82A 1DITH 1O3JA 3E90B 5DKMA 3SV7A 1A2CH 1QTFA 2TGAA 4AYVB 3VGCB 3QDZB 2RG3A 2Z9JA 4MNVA 1RTLA 4NWLA 3MFJA 1SVPA 1LKBA 3GY3A 2AIQA 3CP7A 5T3HA 3QX5H 1SLXB 2ZTZA 2G5VA 3FO8D 5F53A 3STIA 2A5KA 1BITA 3PB1E 4XRNA 1C1UH 2ZDNA 2BMGB 2C8YB 1GL0E 3R3GB 4OS7A 2WINI 2VIWA 3GISB 2H5DA 2SGFE 4FUIA 4HFPB 1XUIA 2V0BA 2ZHEH 1MTNC 1C5MD 2ULLA 4Y0ZE 5C17A 2JETB 4A92A 1FY1A 1XMNB 2ZA5A 3TIUA 3VXFH 1SGFG 2CF8H 3P8GA 1EZUC 1QRXA 2QY0B 2ODYB 3A7VA 2ZDAH 3KQCA 2ODPA 1NRQH 1TMBH 5CMXH 5FPTA 2ZGHA 3ZIAD 1TWXB 2A7JA 2P8OB 3IITA 4FU8A 1GJ5H 4JZ1A 1ZTLA 2FOBA 3ATMA 3A8BA 1YPKH 1CGJE 1BMFD 4P02A 2H9EH 4WXVA 4BAKB 2ZU2A 1GI4A 3URDA 2F9UA 2SGEE 3HGPA 1C5NH 1LPZB 4RI0A 1A61H 1YPLH 4CBOA 1AKSA 1D9IA 3NK8A 1YKTA 2BY7X 1ELTA 3OU0A 5I25A 3SUFA 1PPEE 1K9OE 3SGQE 5GCHG 1GMCF 1O3MA 1VJ9U 1GBHA 3M3TA 1ZHMA 1XKAC 4YOJA 3E3TA 5GIBA 2C8XB 3HK3B 2LNCA 2ZNKH 3H7TA 1EPTA 3RXUA 5F8ZA 1P2NA 1N1LA 5EJLA 1Q2WA 4JZFH 1P2IA 1H9HE 5EXMA 3NPSA 4U01A 3ESTA 4U32A 3DFJA 1AU8A 3SN8A 3OTPA 1FN6A 5H4IB 2WZQA 5DP4A 1V6DA 2ZEBA 3ATLA 2TGDA 1YPJH 4HG6A 4LXBH 4O3UA 3QZQA 1TMTH 4YOIA 5K0HA 4YT7H 1EJNA 4THNH 3SI4H 2ZWLH 2HVYB 5GCHF 5A8XA 1SQOA 3OX7U 1P10A 2PTCE 1B5GH 3BV9B 1EOJA 2PUQH 2KFWA 3FAOA 2OINA 1VGCC 2GV7A 2DUCA 1F5LA 3RC4A 2J94A 1CQQA 3TJNA 1RIWC 1BTYA 2QCYA 2QF0A 2VIDA 3F6UH 2FLBH 4X8UH 2Z7FE 4B71A 1IHTH 1FY4A 1HIAA 2WYGA 4GCHF 3FANA 2L74A 4M9FA 5FX6A 4X6NA 2O8MA 2OTVA 1ZTKA 4IN2A 1NFXA 1MQ6A 1GBTA 2J9NA 1B7XB 2EC9H 2F91A 2ZHFH 4X8VH 4NZQA 1O32A 1OWDA 1ID5H 2NWNA 4JZIA 4TY6A 1O3NA 3DD2H 2XC0A 1BMMH 1L2EA 4WH8A 1FIZA 5FCKA 1CVWH 1G36A 3ENSB 3RMOH 4YESB 1O2RA 4LOYH 2C93B 3F9EA 4NSYA 4BNRA 3H09A 3A87A 4ZXYH 3TJUA 2ZCLP 3W95A 2D1JA 3RMLH 2Z9IA 4ASHA 1KIGH 2BXTH 1E36B 3TJVA 4F49A 1XXDA 1SPJA 1YWUA 4NG9H 4BOHA 1DY8A 1BTHH 1SHYA 1Z8RA 3RXJA 2BVXH 4OS1A 1O3OA 3TU7H 4KP0A 4MNWA 3A7ZA 2GX4A 2IJOB 1C1OA 1P04A 3HGNA 1SB1H 3MOCA 1BBRH 3GY4A 2BQ7B 1DUEA 2BOKA 3S9CA 1BTWA 1KLJH 2G5NA 3SU3A 2ZU4A 9ESTA 1C2JA 1W8BH 4IN1A 5E2OA 1WQSA 1IQNA 1V2LT 1YPHE 2OC8A 2PP6A 3BTFE 1EB2A 4KTSA 2TGPZ 1EJAA 2RDLA 2PKAA 3M7TA 3PM3A 3FZDA 1O34A 1ELEE 1O5BB 3F3BA 2VGCB 2SGAA 1AUJA 1O38A 1Z8IB 2GTBA 2XXLA 2ALPA 2HPPH 9LPRA 1QR3E 5IK2D 4E7NA 1NBME 1V2UT 4FUFA 3OSYA 2QIQA 4K3JA 1A7SA 2OK5A 3BSQA 1VJAU 5DK1A 1OX1A 3H5CB 3ZV8A 2OXSA 1O2PA 4HZHA 2H9HA 1SQTA 2D2DA 1AFQB 1SGTA 2EQNA 2FIRH 3SJ9A 5EXNA 4UFDH 2G8TA 1O3CA 3TNSA 2YMSB 3W94A 4HGCA 4U30A 1JRTA 2ZHWH 1BHXB 4ABHA 3ZVCA 1P8VC 1C2EA 1ZYOA 3SU2A 3SU1A 4Y10E 1O3FA 2JJ1D 4BAQB 3V3MA 1OHHD 4FOUC 4ABEA 5J4QA 1EB1H 5EJZA 2HVXA 2FI5E 3STJA 1W7GH 2TGTA 4ABBA 1Y3VA 2QGRA 5G4BA 1AY6H 2FODA 3I77A 1W7XH 2VH0A 1XVOA 1A4WH 1O0DH 4BTIB 1MAYA 1AE5A 4O97A 4WH6A 1HJAB 3SOSA 3RXQA 3LOXA 2ILNA 1SGDE 2BB4A 4X8TH 5KGOA 4BTUB 1FV9A 4YO9A 1EAUA 1XVMA 3LC3A 3PMBB 2OQUA 1S82A 1GHZA 1GGDC 1LCYA 1E37B 1COWD 4GUXA 1MAXA 3EAJA 1BRBE 1ZSKA 2F4LA 1HUTH 2FO9A 1UTLM 5T6FA 1O2TA 1S0QA 1QY6A 1UHBA 1VZQH 1ABIH 1GHVH 2FS8A 2PW8H 3KN2A 3KCGH 1QHRB 1TBZH 2A1DB 4RT1A 4JZDH 1AUTC 3SHCH 2F9OA 1DWCH 1G3EA 5A2MH 1TGTA 2FESH 4XBCA 3SUDA 5A09A 1EZXC 3RXTA 2PGBB 3PMJA 2GV6A 1NBMD 3T26A 1O2HA 2G51A 4NWKA 2ZGXH 1ZOMA 2CF9H 1PFXC 3G01A 1IOEA 3ZVFA 3RXEA 2JH6D 1K1IA 1C4Y2 4Y7AA 4NZLA 1GI2A 2OP9A 2RCEA 2VWMA 3GYLB 1O3BA 1PQ5A 3KL6A 3GY6A 1GHXH 4DT7B 3ZZ7A 1QA7A 1HAYB 5FBIA 5HM9A 4YTAA 3MYWA 3M7UA 5HGGA 2J34A 4DG4A 4WF8A 1SGNE 2HRVA 3RXSA 4GVUA 5JB8S 3CS0A 3M36A 5FPSA 5SGAE 3RDZA 4FVBA 4I31A 2R3YA 4LZ1H 3IG6B 2XYAA 4MLFB 1C1WH 1S5SA 1AZ8A 2QF5A 4BAHB 3SNEA 3QGJA 4K69A 1RTKA 1FAXA 1KXBA 3OYPA 1SC8U 2AFQB 1NU9A 2VVCA 1D3QB 4UFFH 4XBBA 3PV4A 1LKAA 1BBRK 1C9PA 2A4GA 5EU8A 1IQJA 1MBQA 2J97A 4NA9H 4Y79A 4UFGH 2P3FH 1LQEA 4K5ZA 1KTTB 3U8RH 1ARCA 1P05A 3ELAH 1NN6A 2O8WA 1E0FD 3LGYA 3O8CA 3E8LA 4YT6H 3TH3H 1ZR0A 5HIYA 1AI8H 3RXBA 5HM2A 1UTNA 2BVSH 2A5IA 2G52A 2BQWB 1DICA 1RIWB 4AFUA 5LGOA 1TIOA 1YC0A 1HAHH 1O3EA 1BMLA 2Z3CA 3Q3XA 2A2XH 4INHA 3SZNA 2ZG0H 4XFQA 3RMNH 2VBCA 2VINA 4FUHA 1YBWA 3Q76A 4YOGA 3RXAA 2ZIQH 2J92A 4CR5A 3DHKH 1K21H 3LJJA 3RXLA 2GCHF 5C1UA 3K65B 2QC2A 1SGPE 1W2KH 1NROH 2J95A 1RRKA 1J14A 3A7YA 4DJZB 4BAOB 2QN5T 4Y6DA 2OLGA 1ANDA 1BMAA 2SNVA 4X6OA 3S7KB 4AG1A 3D65E 1V2PT 3U8OH 1V2RT 1C5LH 2EY4C 2H1UA 1GI9B 3M5NA 1Z1JA 4IW4E 4E05H 1C1VH 1CU1A 1S0RA 1WAYB 2XBXA 1MBMA 5DP9A 1EZSC 3VB5A 5LPRA 3F9GA 2GCTC 1K2I1 4A6LA 1DANH 4ZH8A 3M35A 4WMFA 2PHBA 4GLYA 5JB9S 1CBWC 1C2MA 1TMUH 2QXJA 3LIWA 2I6QA 1K1PA 3MU1A 2Q6GA 4WY3A 1UTMA 2ZU1A 2A7HA 3QUMP 1TNIA 2PGQB 5E0HA 2Z94A 3AAVA 1O5DH 2SGPE 3U1JB 1IQMA 1TQ0B 3QZRA 2ZGCA 1FPCH 2HNTF 4AOQA 4INLA 4DIHH 1O2UA 1O2KA 3HPTB 2CXVA 3RU4T 3QK1A 3MH6A 3UWIA 1S84A 2P93A 3KNXA 1TA2A 2W7UA 1OKXA 3OEED 4DGJA 1JOUB 1C5YB 2BD7A 2FTLE 3SNAA 2ZI2H 5CE1A 7LPRA 4ZUHA 3SZEA 3KQDA 3LU9B 2WV5A 1HIAB 3RXKA 3JZ2B 3BTQE 1RS0A 3PO1C 2F43B 1CGHA 4XDEA 6CHAB 1FXYA 3QGNB 4UE7H 3LPRA 2Y81A 5E0GA 1ZHRA 4X2XA 4M7GA 3A7WA 3MNSA 4ABIA 3PTBA 4X8SH 5HKKD 3F2HA 1EP5A 2RA0A 1N6YA 2TBSA 3RM2H 2FOMB 1Y3XA 1K1JA 1C1MA 2J2UA 4NA7A 5DO4H 2VIQA 4NCYA 1UVTH 1RXPA 4Q80A 3NKKA 1MABB 1QBNA 1HAGE 2PFEA 3ATKA 1UCYE 2XBWA 2J98A 1C5QA 2NU0E 1C9TA 4K1EA 1GI5A 1HXEH 3PYHA 3S9AA 3BTTE 1BDAA 1K0HA 2KCAA 2YNBA 1UW7A 4BTTB 4GAWA 1DXPA 1YCPM 1MTVA 1S85A 3P8OA 1KXEA 2VNTA 1K1LA 1MTUA 1O39A 1AQ7A 4ZMAH 2GT7A 1GJ7B 1KXAA 5ESBA 1IAUA 2Q1JA 1EATA 2KR7A 1T7CA 3OFND 1LHGH 4TYDA 1GMHF 4X2VA 1V2VT 2Y5FA 1THRH 1GHBF 1FNIA 1YPHC 4Y7BA 5C94A 5GNDA 2OC0A 1H8HD 3R0FA 4FUDA 2ZECA 2ZDLA 3ATIA 5A8YA 1JWTA 4B76A 4DVAU 2A31A 5DGJA 1L1JA 2B9LA 1DWEH 1O3AA 1D4PB 3NCLA 4KTCA 3M5OA 3E1XB 1C2IA 1QBOA 3URCA 1UVSH 5EGMA 2BD4A 4H6TA 3VPKA 2HPQH 1WXRA 1VITH 1TNGA 1GHAF 4ZCNA 1D6RA 1C1QA 1THSH 1C1RA 4O9VA 4XBDA 4HI3A 2BLOA 2ZGBH 1YF4A 1SQRA 1MU6B 1EX3A 5TCAA 2VB0A 2TPIZ 2W6ID 2XNDD 1OS8A 1PPBH 1LHEH 1F7ZA 1JXPA 2ZQ2A 1HJ9A 4Q2KA 3LGIA 1O30A 1T32A 2CHAC 3MNBA 3RLYH 1TNJA 2FYQA 5EIYA 4BAMB 2H6MA 1DSUA 3GCTG 1O3PB 1BIOA 1ZRBA 2AMQA 2F9PA 2G81E 3K2UA 3SV8A 2QF3A 1IQGA 3P95A 1GVZA 3M7QA 3GS9A 3T25A 6LPRA 2B0FA 1FN8A 2CK3D 1FUJA 2QE7D 8GCHG 3M3SA 2IN2A 2VWNA 3M61U 3UREA 1OWKA 2J38A 3O8BA 2JH5D 1GBMA 1UHBB 1UTQA 4OS6A 5EQQA 1G3CA 1H8IH 1AD8H 4B74A 2H9TH 4CRFA 1TALA 1ESBA 2BDIA 3P8FA 2ODQA 2JJ2D 3GCTF 2FZZA 4NIXA 3O8RA 2ZO3H 2F3CE 4F4OC 4KTUA 1AHTH 4MPVA 1DPOA 2QF4A 4AB8A 3RU4D 5L6NH 2XWAA 1TAWA 1CHGA 1DXWA 3VB6A 3TGKE 4Q7ZA 1DVAH 2EI7A 3UOUA 4I8JA 1SG8B 3SNBA 1ZJDA 3ZYDA 3ZZCA 4IGDA 4Y8ZA 1ANCA 3PRDA 3UAIC 1DT2A 1MTSA 5FXLA 1PQAA 2FOEA 1PPHE 4MQAA 3K9XB 4ZHMU 1GDQA 1PQ8A 4AGKA 1YLCA 1GBEA 4YLUA 1OWEA 1OYTH 2ZCKP 4B2CA 1THPB 4I33A 2I6SA 4Y11E 2PUXB 3V12A 3FFGA 5C67A 5CHAC 1P3EA 1ETTH 1GBFA 1BA8B 5GWZA 1WU1A 3A80A 2Q6FA 3ZZ5A 2FI4E 1HGTH 5EQRA 1O37A 1MUEB 3LH1A 1LVBA 2GCTB 2FX6A 1Y3UA 1UVUH 1O5GH 2K8IA 2V3HH 1SOTA 1ELBA 1FZZA 1SOZA 3T2NA 2GT8A 4AORA 2VJ1A 2XRCA 2ZC9H 3K6YA 2FI3E 1V2KT 1AIXH 1BT7A 2Z9KA 5A0CA 1TGSZ 1T4VH 1TABE 4GPGA 1UMAH 3NWUA 3T29A 3ZZ4A 1MZDA 3BTGE 4KELA 1W13U 1GMDG 1VR1H 4ISHH 1GI6A 3UWJH 2Y5GA 1PQ7A 2R9PA 3FP6E 2WHXA 1NM6A 4Q63A 1LQDB 5EW2H 2WPHS 1G2MA 1QFKH 2Y7XA 5ETXA 4A1TA 3LGUA 1E1RD 4TWWA 2BD8A 5C5NA 8ESTE 2R2MB 1QRWA 1KMHB 2GDDA 3BTEE 1GVLA 4NGAH 2FLRH 3S0NA 1DX5M 1OXGA 3DA9B 1V2JT 3UNSA 4ZROA 3DUXH 4IMQA 3SUGA 1W12U 2WYJA 1W10U 1IQEA 1W0JD 1P2OA 1GMDF 2IOTA 3MHWU 1H4WA 4DY7B 2VIVA 1B0FA 1VCQA 1WCZA 3RC6A 2ANKH 1TGCA 1O35A 2FOFA 3BN9A 3BEUA 1MH0A 1MCTA 2Y82A 3B9FH 1C5TA 1GG6C 4B1TA 2GZ7A 2BY9X 2HNTC 1O3DA 1V2WT 1F0TA 2K1QA 5JBCS 1JBUH 1BUIA 1GBBA 2Y7ZA 4I7YH 4CRCA 4CRBA 3OEHD 5A0AE 1PYTC 3GCHC 3S69A 1OWHA 2GKVE 2PTNA 4DIIH 3SGAE 1TOCB 3VB7A 2AGEX 1FAKH 1O2VA 2HOBA 1BTPA 1HJ8A 3D62A 3VXEH 1O2NA 2ZTYA 1K1MA 2R0LA 3KQBA 1A3BH 6GCHG 2NU4E 4E06H 1JRSA 3NUMA 1GWAA 1O5EH 1HAPH 3M5MA 1EXFA 2C4FH 1QBVH 4JK5A 4CHAC 2QA9E 3EQ0H 1ZGIA 4X0WU 1CHOG 3BTDE 3LGTA 1A5GH 2UWLA 2XTTB 3U28C 3A81A 3ZZBA 3QLPH 1Y3WA 2ZKSA 2M5TA 1INCA 4E7RG 1FIWA 1C2KA 5JBBS 2XOKD 1HLTH 3BTKE 4Y8XA 2IJD1 3EE0B 4B6FA 1MD7A 3K6ZA 1QA0A 1UVPA 6GCHF 2ZCHP 5DP3A 1TA6A 1G37A 1T8NA 2AS9A 2C3SA 2UWOA 4RSPA 1C5WB 2P3UB 1DLEA 1RD3B 4K1SA 4X1NU 4ISLA 5L2ZH 3DCLA 3BTHE 1SL3A 3KIDU 1CHOF 4BXSA 1FX0B 4D7FA 2BY8X 2PV9B 4WMEA 1T8LA 5F03A 2CJIA 1E38B 4TPYA 2XC5A 3KYGA 1WDIA 1BRUP 3SU5A 4CBNA 3S9BA 1ARBA 1FMGA 4AFQA 2WSSD 1JIMA 4K1TA 4ZXXH 1GBLA 3GY7A 1BHXF 1O2SA 4K8BA 4D9QA 1ANBA 1GBCA 4TT3D 1HBTH 1MTNB 5FL7D 5C0TA 1CT0E 2ZDMA 2RFKC 2A2QH 2YMSD 1SGCA 2CHAB 4YZUA 3TH4H 4AGJA 4FUJA 4FVDA 4ASUD 1KLIH 2H5CA 1O3LA 3S7HB 1AB9C 1C5SA 3RXFA 2FEQH 3MTYA 3RUOA 4IMZA 3MO3A 5GJ4B 3DSPA 3QTVH 3SORA 1QQ4A 2BDBA 2SFAA 5AHGH 1NFUA 1QCPA 2KAIB 2AERH 1AN1E 1G30B 1QQUA 4X2WA 2FPZA 3SW2B 4ZHLU 1S83A 3NXPA 1MZAA 2GVFA 5EODA 1TNLA 4K8YA 1ZRKA 4MPUA 3GY5A 3SJKA 2J98B 3LKWA 5T6GA 1N6XA 2FOCA 2Y5HA 5HMAA 1F5RA 3UB0A 3GCNA 1OYQA 2A4RA 3P8NA 1QJ6B 1HCGA 3A7XA 1TLDA 4KGAA 1A0JA 2XBYA 1AWFH 4NIVA 2CGAA 1N8OC 1A46H 4RT0A 3BTWE 1J16A 3P70B 1F0SA 1P0SH 3TVJB 1A5IA 1MMJN 1BQYA 1F0RA 3PTNA 2HALA 2V7QD 3BEFB 2RDEA 5GXPA 4O03A 1XX9A 2QXGA 2ZZUH 4H4FA 3KHVA 3N7DA 4Y76A 1LHCH 4CH2B 2UWPA 1C5UA 1P01A 4NSVA 3U9AH 1GI3A 2AYWA 1O2WA 1TNKA 1EKBB 5PTPA 5AFZH 3UNQA 2VVUA 3MU4A 4CRDA 3FZZA 1G3BA 1KDQB 3SBKA 2ANWA 1OP8A 1AFEH 1DE7H 2J4IA 3NRLA 2BY6X 3RMMH 1EZQA 1ELFA 1M9UA 3Q3YA 3A83A 1YPEH 1HV7A 1NFWA 4FXGH 4NIYA 4AFZA 1W11U 2JIZD 1GJ6A 4GHTA 5CHAB 3A8DA 1RFNA 1VGCB 2YNAA 3ZVBA 5B6LA 1JIRA 1W0ZU 1C5VA 3LDXH 4ZKSU 1EJMA 5F8TA 3RXDA 3RXHA 4NA8A 1OSSA 4X1SU 1PJPA 2A5AA 2XCFA 4X2YA 4U2WA 1C2GA 1QB6A 3TH2H 1NC6A 4ZAEA 4GHQA 4F48B 2G4TA 3AW0A 4AZ2B 3SV9A 3KGPA 4WMDA 2A0QB 1SGQE 3MO6A 3UY9A 1NTPA 1F92A 4FUCA 1WUNH 1TYNA 4I8LA 4JZEH 1CT4E 2HNTE 2CV3A 3UFAA 3OE7D 1F2SE 4KKDA 3D49H 3VB4A 1NRPH 4D9RA 1C5OH 2G00A 3ZVDA 1TBRH 1T4UH 1MKWH 1O3IA 1P3CA 1ZTJA 1TPAE 4NFFA 3DSGA 1EAIA 5JYIA 1LPKB 1P03A 3SHAH 1O33A 1XUFA 1VITG 5FHTA 1K1NA 2BDAA 1W14U 3A86A 4P00A 3PMHB 2SNWA 2ZFFH 1WV7H 3D23A 1MD8A 5DJ7A 2FOGA 3AASA 3SV2H 1EAWA 1MTWA 1FY3A 5FCRA 4ACAA 1ABJH 1C2DA 2FP7B 3M5LA 4AX9H 1XM1A 1H9IE 4J2YB 5E0JA 1VITF 5JBAS 2XC4A 3U8TH 1NT1A 3SV6A 4QT8C 3SNDA 3ZVAA 2BDGA 1WOFA 2TRMA 2HLDD 2QXHA 2LP6A 4ZHAA 1EP6A 1TPSA 1FPHH 3WW7A 3SJOA 4Z0KA 1SR5C 4OM9A 2D26C 1P9SA 3UUZA 3WWBA 2QV1A 3RXRA 1HAZB 4BANB 4MNYA 1FI8A 3Q77A 5T1VA 2AGIX 3GY2A 3RLWH 1YPMH 4CHAB 1C2LA 4JYTA 1ESAA 2SGQE 2O8UA 2VWOA 4JK6A 4JCNA 1AWHB 1BRCE 1MKXH 1P9UA 3VEQB 1YPGH 1SMFE 1GJ9B 3P17H 1UTPA 4DW2U 2XNIA 5I46H 3V0XA 3E0NB 5EPNA 4MTBA 4UFEH 1K1OA 3ZVGA 1O2JA 3OY5U 3FP8E 4Q7YA 2DE9A 3SQEE 3M3VA 1GBDA 1O2XA 3UPEA 1Z7KA 1SGIB 4B2AA 1D3PB 4ISNA 1DFPA 2ZPSA 3PV5A 4B75A 2KZ4A 1D3DB 2BD3A 1GI0A 1CSOE 3O8DA 1AZZA 1LVMA 5TCCA 4AB9A 5C2ZA 1J8AA 4Z6AH 4FUGA 1GGDB 1S6FA 4TWYA 4I8KA 3SUEA 2KAIA 3MI4A 1VCWA 2GMTC 3KYFA 1O2OA 1GVKB 2ZU5A 1CGIE 1FDPA 3NZIA 1ANEA 1L1NA 3F9FA 2AH4X 2A7CA 2Z3DA 3U1IB 4D8NA 4YM9A 2P3TB 2AGGX 1AE8H 1ELCA 4ZKNU 1HAVB 3MU5A 4UD9H 1QIXB 2FWWA 1IQHA 4A5TS 1TNHA 5GPIB 1YGCH 3PLKA 2NU2E 2KCYA 1WTHD 2M2AA 2AEIH 1TB6H 2FTMA 1TGBA 3MMGA 3GOVB 2G4UA 4X6MA 4SGBE 1ZLRA 4JYUH 1DLKB 1HPGA 1NS3A 2CMYA 2BM2A 1QZ8A 2Y6TA 2GDEH 4FETA 3RP2A 1C2FA 3UIRA 1VKYA 5T6DA 4B73A 2GJGA 1G9IE 3RU4E 1DUAA 5E8EH 1KDQA 3ZZ8A 2P59A 1LTOA 1L1GA 1P02A 2BD9A 3C1KA 3EYDA 3EA7A 2V3MA 5DP5A 1MKWK 2BTCE 3SU0A 1OP2A 1DY9A 2GP9B 4WXIA 4K2YA 1J17T 1N8OB 2PSXA 2ANYA 2BLVA 3HK6B 1CA0C 1E35B 2ALVA 4OGYA 1PPZA 1GI1A 3PLBA 1NFYA 2UUKB 1JMOH 1UK3A 1P2KA 1GJBB 2QAAA 2AHME 3DSOA 2W26A 4FUBA 3VB3A 1GCDA 1BJUA 1F5KU 4I32A 2STAE 5JDUB 1Y3YA 1O2YA 1TPOA 1GHYH 4OS4A 5JBTA 3VG8A 3AW1A 3A8AA 8KME2 5C3NA 3SYJA 3PRBA 3LT3A 1CO7E 2LPRA 5FPYA 1TRNA 1LPGB 3T27A 7GCHG 3AVZA 3TJOA 1P06A 1EQ9A 1HYLA 1FONA 1F0UA 2H2ZA 4TPIZ 2C8ZB 3PV2A 1SQAA 2BD2A 4ESTE 2KM0A 3E6PH 3T62A 1OOKB 3ZZ6A 1WYKA 5DSFA 5J4SA 1FY8E 1GI8B 1TPPA 5FX5A 4VGCC 4OS2A 2Y80A 2SGDE 2ZF0H 4J1YA 5DPAA 2F9BH 3FN8A 3WY8A 1HXFH 1Z1IA 2GGVB 5HYOA 1RGQA 4I86A 1HFDA 1T8MA 2THFB 1GMCG 1V2TT 3AK5A 3F1SB 4DCDA 3SNCA 7GCHF 4TSFD 3F68H 2F9VA 1O3GA 2JDID 1MKXK 2G55A 8GCHF 4IBLH 3TITA 1LO6A 1ZHPA 4X6PA 4X1RU 3RXVA 3UR9A 1YYY1 2P95A 4LZ4B 4Y0YE 3DT0H 2OBQA 2R0KA 2OD3B 4MPXA 3WWFA 5EJ1A 3A84A 1XXFA 5EPYA 1ZMLA 1O3KA 2STBE 3UNRA 3SO3A 1LHFH 1P2JA 1GBKA 7ESTE 2JKHA 1Z8JB 3AAUA 3Q00A 1NU7B 1GBAA 4INKA 3A85A 4YXWD 1DWBH 5A8ZA 5LH8A 2VVVA 1UK4A 2KX4A 1G2LA 4IS5A 3RXIA 1UK2A 2HWLB 1W0YH 3QN7A 3V13A 4MDSA 4R8TB 1TFXA 4JMYA 1L4DA 3RXOA 5EOKA 4GCHG 1H8ED 2BDYA 1P57B 1ZGVA 3BF6H 1A0LA 3BIVH 5EW1H 1UTJA 3F0PA 1PPFE 2XBVA 1NY22 2LELA 5LPFA 3A89A 1CBWB 1CE5A 1VCPA 1KYNA 2F9NA 1BTXA 1LHDH 1O2LA 1SHHB 1KSNA 3E91A 2BD5A 5LPEA 2ESTE 3I29A 1TRMA 3MQKC 4Z1MD 3T5FH 1E79D 4OS5A 4ABGA 1HNEE 1P2MA 4CH8B 2A4OA 1EAXA 2OQ5A 4MNXA 3MH5A 2PLXA 3MWIU 1SI5H 4DOQA 4RN6A 1E34B 2UUJB 1QJ1B 4Q7XA 2BX4A 1LDTT 4X1QU 3RM0H 2FX4A 1B0EA 3KQ5A 1V2QT 2BOHB 3B8JA 4X1PU 1P09A 1PPCE 1HAVA 2Z6BD 1C1NA 1AVGH 1TRYA 1UCYH 1S6LA 2ZQ1A 3E16B 3PO1B 1G32B 3LGVA 5AF9H 3OY6U 2BDCA 2UUFB 2AMDA 2IPQX 2QYIA 4PROA 5AVDA 2ZFSA 1T8OA 4H6SB 1J15A 3N7EA 2QXIA 1XUKA 1KXDA 2V35A 1O5AB 4I8GA 1HDTH 4AFSA 2WUBA 3A8CA 3A7TA 2VWLA 2O8LA 3BIUH 2FMJA 5E2PA 4CRGA 2WPKS 2TIOA 1Q31A 5B6OA 4IC6A 1FY5A 1ACBE 2GMTB 4RKOB 3HKJB 3E0PB 5DP8A 4UONA 3ZYEA 2ZPRA 3LGWA 3OAAD 5C1XA 1FJSA 3FKSD 3GYMA 1BRAA 1GJDB 2A32A 1FLEE 2EI6A 1C1TA 2NU3E 2WPJS 1EPTC 1KLTA 2BZAA 1C5PA 4WJG2 1ZZZA 7KMEH 2KCPA 3KQEA 3TGIE 1KXCA 1IQLA 3JZ1B 2IPHA 1V2MT 5FBEA 1Y5UT 3RXGA 3LH3A 5CHBA 3QWCH 2BLWA 1Z8GA 3W1EA 3P6ZB 3MNCA 1BCUH 2WUCA 3GCOA 5EXLA 1DS2E 1OP0A 1C4U2 1ZMJA 1GI7B 3PWBA 1P12E 4LK4A 1SLWB 4CREA 1OWJA 3TK5A 1C4V2 1GCTC 4RKJB 4CRAA 1YP9A 2D8WA 5L2YH 2PKSC 1SGFA 1GJCB 1QGFA 1YLNA 2BX3A 1P11E 3H7OA 3QTOH 1Z6JH 2EA3A 4B6EA 1ZSLA 2OC7A 1H8DH 3MU0A 1BMNH 3KF2A 1C5ZB 1S81A 1O2ZA 2P94A 1EFRD 1GJAB 4Q4LA 1CA0B 1O31A 2EEKA 1SGRE 6CHAC 4FU7A 4DT4A 1NRRH 1BOQA 2ZP0H 1XUJA 3FOAA 2ZTXA 1CT2E 1GPZA 2BZ6H 2W7SA 3PWCA 1AO5A 3CENA 1BTZA 1TE0A 2B5TB 2B7DH 1TOMH 5GDSH 2OBOA 4AG2A 2WPIS 5KEDA 1WSSH 4D7GA 3ODDA 3A88A 2YOLA 3MNXA 1DSTA 3UQOA 3BG4C 1V2OT 2WPMS 1G3DA 2ZFPH 2WPDD 2Z9LA 3GICB 1K22H 4O3TA 1Y59T 3KEEA 3BEIB 2J5UA 3EA8A 1C1PA 4DURA 5C1YA 3ZZAA 3SU4A 4A1VA 1LMWB 4AN7A 5BPEA 3UOPA 5FAHA 1EOLA 1C1SA 1ELVA 3GDSA 4VGCB 1IHSH 1L4ZA 6ESTA 2ASUB 3FVFB 2C90B 1ETSH 1XUGA 1T31A 1OWIA 1W0KD 2F83A 3SGBE 3QO6A 1QJ7B 3MH7A 1Y5AT 4NIWA 2WV4A 3Q3KA 1NPMA 1WTGH 1DDJA 2ZFRH 1CA8B 5DP6A 4B2BA 2W6JD 3L6PA 2FS9A 1QURH 2L6OA 1V2NT 2OUAA 1V3XA 1AVWA 1UCYK 3TPIZ 3VGCC 1RJXB 2Z9GA 1QL7A 2NU1E 4H42U 5HIZA 1NO9H 4XSKU 2ZFTA 2BVRH 5F8XA 3TK9A 5TJXA 1FQ3A 2PWXA 3L3TA 4A1XA 2V3OH 1IQKA 2WPLS 4Y8YA 3N99A 1S6HA 1GBIA 1AGJA 1O2QA 2FOAA 1UJ1A 4WVPE 5AFYH 5C0UA 1ZPCA 1C2HA 2BLQA 2JETC 3F0OA 3GDVA 5EG4A 5DP7A 2FM2A 1A0HB 3ATWA 4Y71A 1BB0B 4ZKOU 5HXFA 5F6MA 3PMAB 3RXMA 2ZHQH 2VIPA 3RC5A 1ELAA 3MH4A 3L33A 1P2QA 2JH0D 2CN0H 2P8OC 3ZZ9A 1QRZA 1KY9A 1YCPH 1ZJKA 4A7IB 1H9LB 1C5XB 3SU6A 2ZDVH 3MO9A 2GCHG 2RA3A 2W3KA 5IYTA 2XW9A 5KECA 2B8OH 1XUHA 3IWMA 3BTME 3LJOA 5C5OA 1A5HA 2PSYA 4ISIH 3SQHE 3T28A 3I78A 1SGYE 1DM4B 2Z3EA 3F9HA 1SSXA 1ELDE 1GDNA 1QB9A 2FOHA 4UDWH 1TX7A 1E1QD
chains in the Genus database with same CATH topology
1NRNH 2VU8E 1SFQB 1AVXA 5ESTE 1HB0B 1IQFA 1O2IA 2BQ6B 1K28D 3VFEA 1YM0A 2OC1A 1O36A 3N7OA 4FU9A 5DG6A 2GD4B 2W3IA 4MG3A 1TONA 2FYRA 1GL1A 1J9CH 5IDKA 1Y5BT 5L30H 3B23B 2BYAX 1L0ZA 1SGEE 2A45B 3UR6A 4HTCH 3HATH 3ZZDA 2R3UA 4R0IA 1MU8B 2Q6DA 1Z71A 3BG8A 1GJ4H 3MU8A 1GG6B 2ZPQA 2R2WU 3SI3H 3U98H 1TX6A 3GY8A 1KXFA 1U6QA 2XWBI 3GCHB 1IQIA 3EDXB 1Z6EA 3TK6A 1AKSB 4FUEA 3RXPA 4AYYB 1SFIA 1NRSH 1ZMNA 1GBJA 1V2ST 3ZZ3A 3UQVA 1AMHA 1DWDH 1OPHB 3U69H 1UTKA 1EPTB 1BJVA 1SBWA 1O5FH 1SLVB 2O8TA 4XE4A 2XCNA 2OCVB 3TGJE 5A0BA 1RTFB 4CR9A 8LPRA 1WBGB 2BHGA 2ZDKA 3PLPA 1BZXE 4I8HA 1XKBC 5K7RA 4ABFA 3ZV9A 3UTUH 1HAIH 1ZPBA 3P92A 1HRTH 1GHWH 3M37A 2ZHDA 1UTOA 2GZ9A 1W3CA 1TBQH 1GCTB 4ISOA 2PKSB 3TNTA 2PR3A 1O2MA 1X7AC 1Y8TA 1BTUA 4ABAA 4TY7A 1TX8A 2EI8A 3SJ8A 1O3HA 2VH6A 3LC5A 5C20A 1A3EH 1TGNA 2AMPA 1PYTD 2ZFQH 1O5CB 4MPWA 3V7TA 2V6NA 4SGAE 5BRRE 1NESE 2BY5X 2AIPA 1LVYA 1H1BA 3EA9A 4GSOA 2ZU3A 1D6WA 2BDHA 1MQ5A 1LVOA 4XOJA 1HAOH 1SLUB 2FDAA 4WWYA 1YLDA 3EGKH 2VGCC 2A4QA 1WQVH 1ETRH 1DOJA 1GJ8B 1GMHG 1UVOA 4IC5A 1BBRE 1GHBG 1C5RA 1EASA 4D76A 1AB9B 1MCVA 1D3TB 1TQ7B 1PPGE 3BG4B 1AFQC 2ANMH 1O2GH 1ESTA 3CS7A 1UO6A 2O9QA 3OTJE 4YLQH 2HLCA 1YCPK 2FXRA 5JPMH 1QNJA 3ITIA 3C27B 4JYVH 1Q3XA 1GDUA 1HAXB 4ABJA 4UEHH 2P16A 2HGTH 2UUYA 5ABWA 2VIOA 4NFEA 1QL8A 1ELGA 2DE8A 1QL9A 3DFLA 1ZSJA 2C8WB 2BXUH 3RXCA 1KTSB 2GZ8A 3LONA 4BXWA 1NZQH 1GHAG 1EUFA 3TLOA 2PKAB 3ODFA 4MVNA 2ZGJA 3ZVEA 3HKIB 4OGXA 3SJIA 2W5EA 3GDUA 1HJAC 1A1RA 4ZKRU 3PROA 1ORFA 1ZPZA 3FP7E 1QB1A 4K60A 5EQSA 4ABDA 3A82A 1DITH 1O3JA 3E90B 5DKMA 3SV7A 1A2CH 1QTFA 2TGAA 4AYVB 3VGCB 3QDZB 2RG3A 2Z9JA 4MNVA 1RTLA 4NWLA 3MFJA 1SVPA 1LKBA 3GY3A 2AIQA 3CP7A 5T3HA 3QX5H 1SLXB 2ZTZA 2G5VA 3STIA 2A5KA 1BITA 3PB1E 1C1UH 2ZDNA 2BMGB 2C8YB 1GL0E 3R3GB 4OS7A 2WINI 2VIWA 3GISB 2H5DA 2SGFE 4FUIA 4HFPB 1XUIA 2V0BA 2ZHEH 1MTNC 1C5MD 2ULLA 4Y0ZE 2JETB 4A92A 1FY1A 1XMNB 2ZA5A 3TIUA 3VXFH 1SGFG 2CF8H 3P8GA 1EZUC 1QRXA 2QY0B 2ODYB 3A7VA 2ZDAH 3KQCA 2ODPA 1NRQH 1TMBH 5CMXH 5FPTA 2ZGHA 1TWXB 2A7JA 2P8OB 3IITA 4FU8A 1GJ5H 4JZ1A 1ZTLA 2FOBA 3ATMA 3A8BA 1YPKH 1CGJE 2H9EH 4WXVA 4BAKB 2ZU2A 1GI4A 3URDA 2F9UA 2SGEE 3HGPA 1C5NH 1LPZB 1A61H 1YPLH 4CBOA 1AKSA 1D9IA 3NK8A 1YKTA 2BY7X 1ELTA 3OU0A 5I25A 3SUFA 1PPEE 1K9OE 3SGQE 5GCHG 1GMCF 1O3MA 1VJ9U 1GBHA 3M3TA 1ZHMA 1XKAC 4YOJA 3E3TA 5GIBA 2C8XB 3HK3B 2LNCA 2ZNKH 3H7TA 1EPTA 3RXUA 5F8ZA 1P2NA 1N1LA 1Q2WA 4JZFH 1P2IA 1H9HE 5EXMA 3NPSA 4U01A 3ESTA 4U32A 3DFJA 1AU8A 3SN8A 1FN6A 5H4IB 5DP4A 1V6DA 2ZEBA 3ATLA 2TGDA 1YPJH 4O3UA 4LXBH 3QZQA 1TMTH 4YOIA 5K0HA 4YT7H 1EJNA 4THNH 3SI4H 2ZWLH 5GCHF 5A8XA 1SQOA 3OX7U 1P10A 2PTCE 1B5GH 3BV9B 1EOJA 2PUQH 3FAOA 2OINA 1VGCC 2GV7A 2DUCA 1F5LA 3RC4A 2J94A 1CQQA 3TJNA 1RIWC 1BTYA 2QCYA 2QF0A 2VIDA 3F6UH 2FLBH 4X8UH 2Z7FE 4B71A 1IHTH 1FY4A 1HIAA 2WYGA 4GCHF 3FANA 5FX6A 4X6NA 2O8MA 2OTVA 1ZTKA 4IN2A 1NFXA 1MQ6A 1GBTA 2J9NA 1B7XB 2EC9H 2F91A 2ZHFH 4X8VH 4NZQA 1O32A 1OWDA 1ID5H 2NWNA 4JZIA 4TY6A 1O3NA 3DD2H 2XC0A 1BMMH 1L2EA 4WH8A 1FIZA 5FCKA 1CVWH 1G36A 3ENSB 3RMOH 4YESB 1O2RA 4LOYH 2C93B 3F9EA 4NSYA 4BNRA 3A87A 4ZXYH 3TJUA 2ZCLP 3W95A 2D1JA 3RMLH 2Z9IA 4ASHA 1KIGH 2BXTH 1E36B 3TJVA 4F49A 1XXDA 1SPJA 4NG9H 4BOHA 1DY8A 1BTHH 1SHYA 1Z8RA 3RXJA 2BVXH 4OS1A 1O3OA 3TU7H 4KP0A 4MNWA 3A7ZA 2GX4A 2IJOB 1C1OA 1P04A 3HGNA 1SB1H 3MOCA 1BBRH 3GY4A 2BQ7B 1DUEA 2BOKA 3S9CA 1BTWA 1KLJH 2G5NA 3SU3A 2ZU4A 9ESTA 1C2JA 1W8BH 4IN1A 5E2OA 1WQSA 1IQNA 1V2LT 1YPHE 2OC8A 3BTFE 1EB2A 4KTSA 2TGPZ 1EJAA 2RDLA 2PKAA 3M7TA 3PM3A 3FZDA 1O34A 1ELEE 1O5BB 2VGCB 2SGAA 1AUJA 1O38A 1Z8IB 2GTBA 2XXLA 2ALPA 2HPPH 9LPRA 1QR3E 4E7NA 1V2UT 4FUFA 3OSYA 2QIQA 4K3JA 1A7SA 3BSQA 1VJAU 5DK1A 1OX1A 3H5CB 3ZV8A 2OXSA 1O2PA 4HZHA 2H9HA 1SQTA 2D2DA 1AFQB 1SGTA 2FIRH 3SJ9A 5EXNA 4UFDH 2G8TA 1O3CA 3TNSA 3W94A 4HGCA 4U30A 1JRTA 2ZHWH 1BHXB 4ABHA 3ZVCA 1P8VC 1C2EA 1ZYOA 3SU2A 3SU1A 4Y10E 1O3FA 4BAQB 3V3MA 4ABEA 5J4QA 1EB1H 2HVXA 2FI5E 3STJA 1W7GH 2TGTA 4ABBA 1Y3VA 2QGRA 5G4BA 1AY6H 2FODA 3I77A 1W7XH 2VH0A 1XVOA 1A4WH 1O0DH 4BTIB 1MAYA 1AE5A 4O97A 4WH6A 1HJAB 3SOSA 3RXQA 3LOXA 2ILNA 1SGDE 2BB4A 4X8TH 4BTUB 1FV9A 4YO9A 1EAUA 1XVMA 3LC3A 3PMBB 2OQUA 1S82A 1GHZA 1GGDC 1LCYA 1E37B 4GUXA 1MAXA 3EAJA 1BRBE 1ZSKA 1HUTH 2FO9A 1UTLM 5T6FA 1O2TA 1S0QA 1QY6A 1UHBA 1VZQH 1ABIH 1GHVH 2FS8A 2PW8H 3KN2A 3KCGH 1QHRB 1TBZH 2A1DB 4JZDH 1AUTC 3SHCH 2F9OA 1DWCH 1G3EA 5A2MH 1TGTA 2FESH 4XBCA 3SUDA 5A09A 1EZXC 3RXTA 2PGBB 3PMJA 2GV6A 3T26A 1O2HA 2G51A 4NWKA 2ZGXH 1ZOMA 2CF9H 1PFXC 3G01A 1IOEA 3ZVFA 3RXEA 2JH6D 1K1IA 1C4Y2 4Y7AA 4NZLA 1GI2A 2OP9A 2RCEA 2VWMA 3GYLB 1O3BA 1PQ5A 3KL6A 3GY6A 1GHXH 4DT7B 3ZZ7A 1QA7A 1HAYB 5FBIA 5HM9A 4YTAA 3MYWA 3M7UA 5HGGA 2J34A 4DG4A 4WF8A 1SGNE 2HRVA 3RXSA 4GVUA 5JB8S 3CS0A 3M36A 5FPSA 5SGAE 3RDZA 4FVBA 4I31A 2R3YA 4LZ1H 3IG6B 2XYAA 4MLFB 1C1WH 1S5SA 1AZ8A 4BAHB 3SNEA 3QGJA 4K69A 1RTKA 1FAXA 1KXBA 3OYPA 1SC8U 2AFQB 1NU9A 2VVCA 1D3QB 4UFFH 4XBBA 3PV4A 1LKAA 1BBRK 1C9PA 2A4GA 5EU8A 1IQJA 1MBQA 4NA9H 4Y79A 4UFGH 2P3FH 1LQEA 4K5ZA 1KTTB 3U8RH 1ARCA 1P05A 3ELAH 1NN6A 2O8WA 1E0FD 3LGYA 3O8CA 3E8LA 4YT6H 3TH3H 1ZR0A 1AI8H 3RXBA 5HM2A 1UTNA 2BVSH 2A5IA 2G52A 2BQWB 1DICA 1RIWB 4AFUA 5LGOA 1TIOA 1YC0A 1HAHH 1O3EA 1BMLA 2Z3CA 3Q3XA 2A2XH 4INHA 3SZNA 2ZG0H 4XFQA 3RMNH 4FUHA 2VINA 1YBWA 3Q76A 4YOGA 3RXAA 2ZIQH 2J92A 4CR5A 3DHKH 1K21H 3LJJA 3RXLA 2GCHF 5C1UA 3K65B 2QC2A 1SGPE 1W2KH 1NROH 2J95A 1RRKA 1J14A 3A7YA 4DJZB 4BAOB 2QN5T 4Y6DA 2OLGA 1ANDA 1BMAA 2SNVA 4X6OA 3S7KB 4AG1A 3D65E 1V2PT 3U8OH 1V2RT 1C5LH 2H1UA 1GI9B 3M5NA 1Z1JA 4IW4E 4E05H 1C1VH 1CU1A 1S0RA 1WAYB 2XBXA 1MBMA 5DP9A 1EZSC 3VB5A 5LPRA 3F9GA 2GCTC 1K2I1 4A6LA 1DANH 4ZH8A 3M35A 4WMFA 2PHBA 4GLYA 5JB9S 1CBWC 1C2MA 1TMUH 2QXJA 3LIWA 2I6QA 1K1PA 3MU1A 2Q6GA 4WY3A 1UTMA 2ZU1A 2A7HA 3QUMP 1TNIA 2PGQB 5E0HA 2Z94A 3AAVA 1O5DH 2SGPE 3U1JB 1IQMA 1TQ0B 3QZRA 2ZGCA 1FPCH 2HNTF 4AOQA 4INLA 4DIHH 1O2UA 1O2KA 3HPTB 2CXVA 3RU4T 3QK1A 3MH6A 3UWIA 1S84A 2P93A 3KNXA 1TA2A 2W7UA 1OKXA 4DGJA 1JOUB 1C5YB 2BD7A 2FTLE 3SNAA 2ZI2H 5CE1A 7LPRA 4ZUHA 3KQDA 3LU9B 2WV5A 1HIAB 3RXKA 3JZ2B 3BTQE 1RS0A 3PO1C 1CGHA 4XDEA 6CHAB 1FXYA 3QGNB 4UE7H 3LPRA 2Y81A 5E0GA 1ZHRA 4X2XA 4M7GA 3A7WA 3MNSA 4ABIA 3PTBA 4X8SH 1EP5A 2RA0A 1N6YA 2TBSA 3RM2H 2FOMB 1Y3XA 1K1JA 1C1MA 2J2UA 4NA7A 5DO4H 2VIQA 4NCYA 1UVTH 1RXPA 4Q80A 3NKKA 1QBNA 1HAGE 2PFEA 3ATKA 1UCYE 2XBWA 1C5QA 2NU0E 1C9TA 4K1EA 1GI5A 1HXEH 3PYHA 3S9AA 3BTTE 1BDAA 2YNBA 4BTTB 4GAWA 1DXPA 1YCPM 1MTVA 1S85A 3P8OA 1KXEA 2VNTA 1K1LA 1MTUA 1O39A 1AQ7A 4ZMAH 2GT7A 1GJ7B 1KXAA 5ESBA 1IAUA 2Q1JA 1EATA 1T7CA 1LHGH 4TYDA 1GMHF 4X2VA 1V2VT 2Y5FA 1THRH 1GHBF 1FNIA 1YPHC 4Y7BA 2OC0A 3R0FA 4FUDA 2ZECA 2ZDLA 3ATIA 5A8YA 1JWTA 4B76A 4DVAU 2A31A 5DGJA 1L1JA 2B9LA 1DWEH 1O3AA 1D4PB 3NCLA 4KTCA 3M5OA 3E1XB 1C2IA 1QBOA 3URCA 1UVSH 5EGMA 2BD4A 4H6TA 3VPKA 2HPQH 1VITH 1TNGA 1GHAF 1D6RA 1C1QA 1THSH 1C1RA 4O9VA 4XBDA 4HI3A 2BLOA 2ZGBH 1YF4A 1MU6B 1EX3A 5TCAA 2VB0A 2TPIZ 1OS8A 1PPBH 1LHEH 1F7ZA 1JXPA 2ZQ2A 1HJ9A 4Q2KA 3LGIA 1O30A 1T32A 2CHAC 3MNBA 3RLYH 1TNJA 2FYQA 4BAMB 2H6MA 1DSUA 3GCTG 1O3PB 1BIOA 1ZRBA 2AMQA 2F9PA 2G81E 3K2UA 3SV8A 2QF3A 1IQGA 3P95A 1GVZA 3M7QA 3T25A 6LPRA 2B0FA 1FN8A 8GCHG 1FUJA 3M3SA 2IN2A 2VWNA 3M61U 3UREA 1OWKA 2J38A 3O8BA 2JH5D 1GBMA 1UHBB 1UTQA 4OS6A 5EQQA 1G3CA 1H8IH 1AD8H 4B74A 2H9TH 4CRFA 1TALA 1ESBA 2BDIA 3P8FA 2ODQA 3GCTF 2FZZA 4NIXA 3O8RA 2ZO3H 2F3CE 4F4OC 4KTUA 1AHTH 4MPVA 1DPOA 4AB8A 3RU4D 5L6NH 2XWAA 1TAWA 1CHGA 1DXWA 3VB6A 3TGKE 4Q7ZA 1DVAH 2EI7A 3UOUA 4I8JA 1SG8B 3SNBA 1ZJDA 3ZYDA 3ZZCA 4IGDA 4Y8ZA 1ANCA 1DT2A 1MTSA 5FXLA 1PQAA 2FOEA 1PPHE 4MQAA 3K9XB 4ZHMU 1GDQA 1PQ8A 4AGKA 1YLCA 1GBEA 4YLUA 1OWEA 1OYTH 2ZCKP 4B2CA 1THPB 4I33A 2I6SA 4Y11E 2PUXB 3V12A 3FFGA 5C67A 5CHAC 1P3EA 1ETTH 1GBFA 1BA8B 5GWZA 1WU1A 3A80A 2Q6FA 3ZZ5A 2FI4E 1HGTH 5EQRA 1O37A 1MUEB 3LH1A 1LVBA 2GCTB 2FX6A 1Y3UA 1UVUH 1O5GH 2V3HH 1SOTA 1ELBA 1FZZA 1SOZA 3T2NA 2GT8A 4AORA 2VJ1A 2XRCA