5HM9A

Crystal structure of mamo protease domain from magnetospirillum magneticum (apo form)
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
189
structure length
189
Chain Sequence
b'LYHTVPPAVVGVGGGGVNAGPVASGAIVGTNGYVITTLHSVSKLPEISVQVATTGGIRRFPAQVVKTIPGHDLALLKMQTTEKFLHFRMADVQTVVPGQQVFAFGRNMAGAPLVRQGLVQSADAPLAVGATQITHLLRSDAVYSWEQTGGPLVNAQGDLVGINIAATGPTGKVEGFTVPAQVIVSHLQD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MamO protease domain
molecule tags Hydrolase
source organism Magnetospirillum magneticum amb-1
publication title MamO Is a Repurposed Serine Protease that Promotes Magnetite Biomineralization through Direct Transition Metal Binding in Magnetotactic Bacteria.
pubmed doi rcsb
total genus 39
structure length 189
sequence length 189
ec nomenclature
pdb deposition date 2016-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13365 Trypsin_2 Trypsin-like peptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5hm9A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5hm9A01
4AYVB 2FS8A 3RMMH 2W3IA 4JYVH 3URCA 2D2DA 1BUIA 3LH1A 5E0GA 1SI5H 1LTOA 1Y59T 2H5CA 4I32A 1H4WA 1PYTC 4NFFA 3MTYA 3D49H 1KXCA 2Y5FA 4XE4A 3U8OH 2HGTH 2SNWA 4FUBA 1C9TA 1TIOA 4VGCB 3SO3A 1HAXB 3P8OA 1Z8RA 1TNKA 5EGMA 2G4TA 2HPPH 1UVUH 2H2ZA 1GJ5H 3RUOA 2GKVE 1THSH 3SUDA 1GHAG 1MD8A 1BBRK 4YZUA 2FOBA 3ESTA 5I46H 1C5TA 1KLIH 2A4GA 4O3TA 3M7TA 1GMCG 2ZHQH 1BDAA 2SGEE 1FN6A 1OX1A 3LGIA 3P70B 3MMGA 3U1JB 1M9UA 2CGAA 3M35A 3RXBA 4K1TA 1O3GA 1THPB 3ZZAA 1VGCC 2ZTYA 2C8WB 2GD4B 4RKOB 2BXUH 1DDJA 4D9QA 2ZGCA 3DFLA 3UUZA 2BY7X 1CHOG 2ZIQH 2YOLA 1NFYA 1GVZA 1TBRH 4Y79A 2A4RA 2BVSH 1GL1A 2TPIZ 1HYLA 4GLYA 4ISOA 2UUJB 3A7ZA 3DA9B 4D9RA 2V3HH 1T7CA 4FUEA 2G00A 1ZMLA 3SJKA 3A7VA 3SHAH 1AVWA 1DOJA 4NIXA 2OC1A 2WUCA 2VIQA 1QQUA 1SLVB 4LXBH 1UHBB 5AHGH 1AO5A 3G01A 1VITF 4IC5A 5CHAC 2OC0A 3TITA 2FODA 1DUEA 1V2NT 2C8ZB 1O2QA 4AB8A 1XM1A 2F9VA 1YLDA 3GY7A 1A46H 1D4PB 5G4BA 2W26A 3EYDA 2GZ9A 3R3GB 4AORA 5FPYA 1P2OA 4ZHLU 2ZGBH 2PUXB 2J95A 2A45B 2NU2E 3LGVA 5EW1H 4ZUHA 2XC5A 1VITG 2Q6GA 1DWEH 1VITH 5E0JA 1RTLA 1W13U 4GPGA 3TK6A 1YYY1 1Q3XA 1KIGH 2AIQA 3H7OA 5EODA 3GY6A 1P05A 3GDSA 2BD9A 4WMDA 2FX4A 2SNVA 1Y3WA 1FNIA 2AS9A 1K9OE 1YCPM 2RDLA 1A3BH 2FZZA 1FMGA 1YPGH 7ESTE 1C5WB 1OP0A 3DUXH 1SMFE 5FPSA 4X0WU 1A1RA 1ESAA 1LPZB 1GDNA 1WTHD 1HJ9A 3S9CA 1FY5A 4YTAA 4Z0KA 3ZYEA 1P11E 4B2BA 2VGCB 5JPMH 3O8CA 5E2PA 5J4QA 1YPJH 1MAXA 1FN8A 3E6PH 4K2YA 1DWCH 1V2QT 2PGQB 1SLUB 2BXTH 4GAWA 3HGNA 3P95A 3M7UA 1BCUH 2A5AA 1XXFA 4ABBA 4JYUH 1FZZA 1SGYE 3W95A 1SFIA 2A0QB 2WV4A 1DITH 1UTPA 1GJBB 3Q3XA 1SFQB 2WUBA 1O3CA 1ORFA 3E91A 1ZTKA 3S69A 3TH2H 1OWIA 1AWFH 2PSYA 2IN2A 5A0AE 3VFEA 3RU4E 1ELDE 4I8KA 2FWWA 3FP7E 3K6ZA 2NU1E 1GVLA 1WQVH 2FLBH 1O2UA 1J15A 2HPQH 2OQUA 3SJ8A 4ABDA 1LHEH 1C1NA 2PHBA 4K1EA 4B71A 1C1MA 1UVOA 3SOSA 5LPRA 1MKXH 4KTSA 1SGIB 1O2WA 4GVUA 1ELFA 2ZO3H 4NZQA 1UVPA 1UK4A 4FU7A 1WYKA 1O31A 4UFDH 2BDBA 4JZEH 4I8LA 5DP7A 1P01A 2ZF0H 1LPGB 1NRSH 3NCLA 2UWOA 3EA9A 3PM3A 3PB1E 1GMDG 1TA2A 4YLQH 1GHBG 3F9GA 4IMQA 1O2MA 3UOPA 1CGJE 2VNTA 1O36A 3PO1C 5T6GA 1UJ1A 4OS1A 1J14A 1F0TA 4FUGA 5C67A 1EXFA 2V35A 1NC6A 4B75A 1BRUP 2FEQH 3KIDU 1C5XB 5A09A 2G51A 3BG4B 3HGPA 1O2KA 3TPIZ 3F9EA 1H8IH 1BOQA 5EPNA 1ANEA 1WU1A 1INCA 5IYTA 2H9EH 5AVDA 1SQAA 3T29A 2BX4A 4ZHMU 4I8GA 4KKDA 4A1VA 4NIWA 5DK1A 1V2TT 4X2VA 4MPVA 3SI4H 2BOKA 1EQ9A 1GJ6A 2CHAB 1YF4A 1UCYH 2A2QH 2KAIB 2OC8A 1O3IA 4DVAU 2Z3DA 1EPTB 1FI8A 3ATKA 1TGBA 1N8OC 3RXGA 5LH8A 3K65B 2YNBA 1OPHB 4NG9H 5JDUB 2ODPA 2P3FH 1VCWA 1XUFA 5EQRA 1SGEE 3UIRA 4NSYA 1HJ8A 1UTQA 1RS0A 1AB9B 1NO9H 1NS3A 2FI5E 2ZNKH 5GDSH 1DXWA 4KTUA 1RIWB 2FXRA 3ZZ4A 4IC6A 3MYWA 2SGFE 4E06H 1O32A 1PQAA 1BHXB 2ZC9H 4ABGA 2GTBA 1GBIA 1F0SA 1VGCB 4MLFB 2ANWA 1Z8IB 3A8CA 1A0HB 1D3QB 3MO9A 6ESTA 2FI3E 1HAGE 1O3KA 3GCOA 3U8RH 4FUHA 3JZ2B 4K8BA 2V0BA 1ID5H 3HATH 2ANMH 1HGTH 4Y0YE 1V2RT 3SN8A 1GBBA 4CHAB 5DKMA 2BVRH 3PMHB 1C2JA 3MFJA 4TWWA 1TMBH 4BOHA 4X2XA 2J38A 5DGJA 1OWHA 2XRCA 1F7ZA 3BN9A 1JOUB 2NU4E 1DS2E 3BTHE 1O2LA 4YO9A 1C2LA 1PPCE 3SU0A 1GJDB 3NZIA 2ZTXA 2BLVA 1HBTH 1OYQA 3M36A 2NU0E 4D7GA 2OQ5A 1UO6A 4XBDA 1HV7A 2ZQ2A 2Q1JA 5JBCS 3SV2H 4E7RG 2O8WA 2BMGB 2ZGJA 3QGNB 1AMHA 1TRNA 4CRAA 1S6FA 3I77A 1XUHA 3MNXA 4YT6H 3IG6B 1AHTH 1W0ZU 1O37A 5JBTA 5JB9S 4CBNA 3TGJE 7GCHF 3MI4A 3BG8A 2HLCA 4MNVA 5HM2A 3TJNA 3LDXH 3PMAB 2HRVA 1CU1A 3RMLH 1SSXA 2VIDA 2J92A 5EPYA 4WJG2 1ZPCA 2UWLA 3E8LA 2Z7FE 2GDEH 2BM2A 1L4DA 1Q2WA 5F8XA 5EU8A 4A5TS 3OU0A 2JH5D 7LPRA 2JH6D 1O33A 2BTCE 1V2JT 2QIQA 4IN1A 4K1SA 2A32A 3TIUA 1GDUA 1XUGA 3H7TA 4TY7A 1FONA 5DP8A 2F9PA 3LJJA 1Z71A 4DOQA 5PTPA 2JH0D 1HAOH 1DY8A 2HNTE 3ZYDA 4BAKB 6CHAC 1H8DH 1W11U 1AE8H 1S0RA 1TFXA 2ANYA 4TY6A 1C5QA 4O97A 4ISNA 1O38A 3M3TA 4MPXA 2AYWA 3UNRA 3Q00A 3V13A 2WPLS 1GBKA 1W7XH 1O3AA 2FESH 2Y81A 1Z6JH 5AFYH 4X2YA 1MUEB 2ZPQA 3RXJA 2J34A 4X1QU 1EZXC 2KAIA 5DP3A 1GBDA 3KN2A 1O3DA 1YCPH 3HK6B 2ZU3A 3RXEA 1ZJKA 1ELCA 1PPFE 3UOUA 1W7GH 1SBWA 2ALVA 4Y7BA 4CRBA 3O8RA 1MTWA 1RXPA 1TRMA 1LVBA 3TVJB 3QDZB 3E0NB 1LKBA 2AIPA 5DP4A 3F9FA 3TGKE 2GMTC 7GCHG 2BQWB 4DY7B 3EA8A 1QJ6B 1BHXF 3GY5A 4INLA 2OTVA 1IQJA 2Q6DA 1EAWA 1PPGE 5DP5A 1UHBA 2P3UB 4UFGH 4IN2A 2CXVA 1TONA 2CN0H 4JK6A 1P12E 2XCNA 1PPHE 2G8TA 4JZIA 1C1RA 4X1SU 1BTUA 1GBCA 4Y71A 4OGYA 3RMNH 3RU4D 3GOVB 4AFQA 1TWXB 4CR5A 2ZGXH 3U1IB 1V2ST 1GI0A 1SQOA 1T8NA 3A87A 5JB8S 2F9NA 2W7SA 1O3MA 2HNTF 2FP7B 4QT8C 3TH4H 2DE9A 2ZPRA 2ODQA 1LHCH 4ASHA 4FUFA 1MQ5A 2AGGX 3GY3A 1DE7H 2F9UA 2VWNA 4JYTA 1TABE 1TOCB 1IQHA 3F68H 1A5HA 1MTNC 2GZ7A 3N7OA 3GCTF 3SGQE 3MH7A 1ZR0A 3GICB 3RM2H 1BTYA 3LH3A 2BDGA 2O9QA 3A8DA 1RTKA 2Z94A 2GCTC 1NU9A 1GBEA 4TPYA 4JK5A 1EOLA 1SC8U 1TQ0B 1EOJA 3O8BA 5ETXA 3UWIA 2ZHFH 1J8AA 1AU8A 1O30A 2GV7A 1QBNA 3RXIA 3S7KB 2BD3A 3RXUA 3MHWU 2BDHA 2OD3B 1B7XB 5GCHG 3S9BA 4WXVA 1OXGA 3SJOA 3MU0A 1SQTA 3SU2A 2PTCE 3GCHC 5JBAS 1P2QA 2XXLA 3RXQA 1CA8B 1IHSH 2XBYA 3RXKA 2UUKB 1V6DA 1GDQA 1A61H 1GI5A 2CMYA 4Y76A 2Y82A 2VIWA 1EPTA 2BDYA 3P8FA 2WYJA 2NU3E 3ENSB 2HWLB 2VB0A 3TK5A 3LT3A 2F91A 3MU4A 1Y8TA 1O2SA 1C2IA 2FYRA 5TCAA 2ZI2H 4NZLA 1XUKA 1IQFA 4MPWA 4A1XA 3LGTA 2G5VA 3NXPA 4Y7AA 3BTDE 4ZROA 3VB5A 1H1BA 1QL8A 4DIIH 2XCFA 2AMQA 1SLWB 1NM6A 1JIRA 2GT7A 3KHVA 1GL0E 1VR1H 3ZVFA 2A7HA 4UEHH 4BAQB 2EI8A 4NA9H 1C5LH 1FUJA 3BSQA 1UVSH 4F49A 2A1DB 4Q7YA 4NWKA 1GBHA 1O2ZA 4WWYA 1BIOA 4GCHG 2XBVA 3MWIU 2I6SA 1BBRH 1GBJA 2OUAA 2JETC 4NIYA 4HZHA 1HB0B 1TPSA 1K22H 2ESTE 1E0FD 2IJOB 2Y80A 1TB6H 1V2PT 3KQEA 1ZRKA 1ANDA 1C2EA 3OYPA 4DW2U 1K2I1 2Z3CA 1RRKA 4B2AA 2VH0A 1AFEH 2FTMA 3A7XA 1H9IE 2H9HA 3LIWA 2G5NA 2UWPA 3ATMA 3I78A 2BOHB 1YGCH 3GYMA 4XBCA 1SGNE 1MKXK 5JYIA 2C90B 4OS5A 5C20A 1N8OB 3CENA 1D9IA 3ELAH 1NN6A 1CBWC 1W2KH 3BTGE 2AGEX 4JZDH 4DG4A 1W3CA 4NCYA 1QA7A 1XMNB 1P09A 3M61U 4IW4E 1ESTA 1LVYA 1EATA 2ZWLH 2RA3A 2H5DA 3ATWA 1HCGA 3M5NA 1SB1H 3E0PB 1H9LB 5A8YA 2ZFPH 5HXFA 3PV4A 1O2GH 1W12U 1T8OA 1QNJA 2ZG0H 3SQHE 1ELGA 1AVXA 3LJOA 1Q31A 5E2OA 2EC9H 3ZZCA 4MQAA 3E3TA 1ZTJA 3UQOA 2A7JA 4ZH8A 1LQDB 1ARBA 4ISHH 1MCTA 3ITIA 1UCYK 4H42U 3Q76A 2DUCA 1V2WT 4XOJA 1Y5AT 1ELTA 1EJAA 5BRRE 1QCPA 1AN1E 2BYAX 1SGPE 1VZQH 1C1QA 8KME2 1NT1A 1P02A 1DSUA 3OSYA 5E8EH 5ESTE 1KDQB 1F2SE 1BRCE 1NU7B 4WH8A 1GHYH 1NRPH 1CE5A 3PMJA 5JBBS 2QC2A 1DFPA 3A8AA 1DSTA 2C4FH 2QF3A 2M5TA 3LONA 1PQ5A 1GPZA 2JETB 1LKAA 4X6PA 4Y8YA 3MNBA 4UFFH 3MOCA 3D62A 3OTJE 2YNAA 1ANBA 2WPMS 4XDEA 2A5KA 5FXLA 4X6NA 3RXSA 1CA0B 1O5GH 3NKKA 2EI6A 5BPEA 3FZDA 3P8NA 2ZCLP 3F9HA 1SGFG 3A85A 3LC5A 1GJCB 1TGNA 1BITA 1GGDC 4O9VA 4X8SH 4PROA 2P93A 3RXDA 1ELEE 3TNTA 1MBQA 2FIRH 3O8DA 3T28A 4AGJA 2PUQH 1YPHC 3LPRA 4Y8ZA 1C9PA 1IQIA 1JWTA 4NA7A 5F8ZA 2TGPZ 1HJAB 1IQGA 3AASA 4DGJA 1OWDA 1TOMH 3SBKA 1MQ6A 2FDAA 3T25A 2PSXA 4JZFH 3S7HB 3OX7U 1OWEA 3SQEE 2BD2A 3U8TH 1K1MA 3KNXA 3A7WA 3PO1B 4UFEH 1P04A 1K1OA 1L1GA 1KDQA 1LVMA 2G55A 1K1PA 1A0JA 1GHZA 1RJXB 3K6YA 8ESTE 1FY4A 4IBLH 3OY5U 1QURH 3ATLA 1LHGH 1WAYB 1O5BB 2ZDLA 2D1JA 3RMOH 3GDVA 1TALA 2ZFQH 3EAJA 4AN7A 5DP9A 1AFQC 1O3JA 2Z3EA 1CQQA 5DG6A 3UTUH 5C1XA 1UVTH 6CHAB 5FAHA 4ZKRU 1C1SA 1C4U2 3MU1A 4XFQA 1SOTA 1MCVA 3ZZ8A 1A5IA 4THNH 2J9NA 1O2HA 1FDPA 1BMLA 1RGQA 2VVCA 4X1RU 3U98H 2FPZA 1HAHH 1QRXA 2OXSA 1B0FA 1NPMA 3BF6H 3BEUA 5HYOA 1KSNA 2BLWA 1NFWA 1G9IE 1YPMH 4LZ4B 2BLOA 2EI7A 1UTLM 1VJAU 2R3UA 2BD4A 5A0CA 1GI2A 1AE5A 4NIVA 1WTGH 1TLDA 4R0IA 4JMYA 5TJXA 2FOCA 1FPHH 3UR9A 4NSVA 1KXBA 3LKWA 1O3PB 1DWDH 2C8YB 4ABIA 3SJIA 1OS8A 1X7AC 4CRCA 2R9PA 3HK3B 1FLEE 2ZECA 2QXIA 1TRYA 1DLKB 3V3MA 4AZ2B 5GPIB 2OP9A 3RXHA 1T4UH 1ETRH 1G30B 3EDXB 2QV1A 5L2ZH 2QAAA 1W14U 1YLCA 1P06A 3QK1A 1U6QA 3E90B 4A6LA 2GCHF 1S0QA 1EASA 1ZLRA 3NK8A 5HM9A 2F9BH 1JIMA 5HGGA 1B0EA 4X8TH 2GDDA 1DANH 1KXFA 1T8MA 1SL3A 2FM2A 1YCPK 1O2OA 3QWCH 5FCRA 4K8YA 1O3LA 1TX7A 2R3YA 2GCHG 5ESBA 2ALPA 1KXEA 4J2YB 5EXLA 1YKTA 1MU6B 4ZXXH 1XVMA 3ZV9A 2XC0A 5GJ4B 4Y8XA 4ESTE 3IITA 2SGAA 2R0LA 2FO9A 4OS4A 1Y3YA 2BDCA 2ZGHA 1GJ9B 1PPBH 2PKSC 2G4UA 3D23A 3MNCA 2K1QA 3BTKE 4X1PU 1BT7A 1AFQB 5AFZH 4AB9A 1N1LA 1EAIA 3SV6A 4NA8A 2RA0A 3U69H 1BTZA 2XWBI 5H4IB 3TJUA 5B6OA 1Z7KA 4TPIZ 5LPEA 2WYGA 2FOGA 1UCYE 1WBGB 3TH3H 1O3OA 3KCGH 4FU9A 1HAYB 4X6MA 3LU9B 2GP9B 3TGIE 4KGAA 1C1UH 3RXRA 1O2IA 1TNHA 2FTLE 4B74A 4K3JA 3A81A 1G2MA 3AAVA 1T8LA 3M3SA 4UDWH 4MDSA 1GI1A 2BY9X 3BTME 4NWLA 1PJPA 1TYNA 1MU8B 2SGPE 3Q3KA 1C1VH 1BQYA 1Y3UA 1F5RA 4TYDA 4I8JA 2TGDA 2Z6BD 2ANKH 1S81A 4X1NU 4MG3A 4K60A 3RU4T 2BB4A 1IQKA 1O3HA 3ZZ6A 1O5CB 1A2CH 2B5TB 1SHHB 3SNEA 1V3XA 3DFJA 3A83A 4BTTB 2XC4A 1ARCA 1S84A 2BY8X 3GY2A 3PTNA 4Q7ZA 1QHRB 1P2KA 2VWLA 1KLTA 3EE0B 3QTVH 1QB6A 1QTFA 5FHTA 2SFAA 4CR9A 4K69A 4E05H 9LPRA 3AW1A 1GHVH 5C1YA 2VU8E 4AFSA 1C4V2 5SGAE 2OBQA 3PLPA 3SV9A 5DO4H 3BTQE 2HNTC 1A5GH 4YOIA 1BMAA 4AOQA 3Q77A 1DY9A 5K0HA 3STJA 3S0NA 1AWHB 3T2NA 1HIAB 3ZZ7A 1SR5C 5F6MA 3BTTE 4ABJA 1C4Y2 3SHCH 3SUEA 3FFGA 3RM0H 5EXMA 3ZVGA 1QJ1B 1GJAB 1IOEA 5EW2H 1AI8H 6LPRA 4B1TA 1C2HA 3CS7A 3RXOA 4CH8B 1HAVB 3T26A 1L1JA 4MNXA 1NFUA 1QGFA 1C5RA 2CV3A 4I8HA 3KGPA 1YPEH 3PWCA 3A7TA 2ZHDA 1AVGH 1BRBE 4WMEA 1ELBA 1GJ7B 1OP8A 1HAIH 4FVBA 1SPJA 2B8OH 1AQ7A 3UY9A 2R2MB 1BBRE 2BD8A 1GHAF 1K1NA 2PWXA 3KL6A 1GI3A 1K1IA 2FS9A 1GBTA 4B73A 1HUTH 3M5MA 3T27A 1BJVA 1OWJA 3SU1A 4BAHB 1QFKH 1EB1H 2QXHA 1ZSJA 3BTWE 3QO6A 1K1JA 1MTUA 1P2IA 2VWMA 5CMXH 4CRDA 1TE0A 3E16B 3SGAE 4D76A 2ZHEH 1S85A 2FX6A 3VPKA 4BAOB 3A89A 5L6NH 3VGCB 2QXJA 1QB9A 1FJSA 3MH6A 2ZU1A 1CGHA 3FP6E 4DIHH 5CHAB 2A31A 1LVOA 3GCTG 4AX9H 2AMDA 5GWZA 2BDAA 3RC4A 4BXSA 3ZZDA 5C1UA 5FCKA 1GI9B 3VXEH 3VXFH 1C1WH 1BRAA 3FVFB 1FAXA 2Z9LA 2HVXA 1Z1JA 1GI4A 3QN7A 2Z9KA 1A7SA 3SU3A 1UK2A 8LPRA 3STIA 1J9CH 2O8TA 1QL9A 3VB3A 1C5NH 4Q80A 4U2WA 3SI3H 5DPAA 4CRFA 1HDTH 4I31A 4ZKSU 1XUIA 1T4VH 1ZMJA 1D3PB 1XKAC 4RKJB 1IQEA 3UNSA 1QR3E 3A88A 4GUXA 3RC5A 4WVPE 1GHXH 2C8XB 1DXPA 1ETTH 4MNWA 4Y6DA 1BA8B 4HTCH 4O03A 2PTNA 3Q3YA 1DVAH 3NUMA 1YP9A 1O3EA 1NESE 3UFAA 5FX6A 3SU5A 3HKJB 3KQCA 4WF8A 5C5NA 5LPFA 4ABAA 3ODFA 5IDKA 2VGCC 1KTTB 1VCQA 1GJ4H 1GJ8B 4DT7B 1H9HE 2AERH 3S9AA 3U9AH 1P8VC 2SGDE 5T3HA 1UTKA 1FXYA 1KXAA 2W5EA 2Y7XA 1IAUA 1ZOMA 1ZPZA 1QL7A 1QRWA 2BQ6B 1TBQH 2VVVA 2ZEBA 2BY6X 1ACBE 3A7YA 2BVXH 1BTPA 2SGQE 3RXPA 2HOBA 1CHGA 1SLXB 1HJAC 2ZDMA 1Z8GA 4E7NA 3QX5H 5AF9H 5C5OA 1VJ9U 1B5GH 1DLEA 5F8TA 3RXMA 1EJMA 3UR6A 1OWKA 4ZXYH 3ZVCA 1HPGA 5LGOA 3DD2H 1MZDA 2FMJA 1PPEE 4IMZA 3V0XA 3KF2A 1TGCA 8GCHG 1G3CA 2BZAA 1P03A 2GVFA 2VJ1A 3MH5A 1MBMA 1O35A 5I25A 3V12A 1HIAA 2O8LA 1OP2A 4YOJA 3RXLA 3SNDA 1HFDA 3AW0A 2ZQ1A 3LGYA 3UWJH 4A7IB 4WY3A 2FOFA 2ZDNA 4ISIH 4H6TA 3JZ1B 1C1TA 2GMTB 1F5LA 1O2RA 5A8XA 1LQEA 5EOKA 4WXIA 3BIUH 2TGTA 3KEEA 4JZ1A 3OY6U 1WCZA 1Y3VA 2F9OA 1CT0E 1SVPA 3SUGA 5L30H 2ZPSA 3BTEE 5T6DA 4LOYH 1GVKB 3RLWH 5T6FA 3MU5A 1Z6EA 3PLBA 3TJOA 4ZKOU 4UD9H 1C5YB 5HMAA 2C3SA 1UTMA 2XWAA 1P2NA 3CP7A 1CBWB 2A5IA 3BG4C 2R0KA 3QUMP 3ZVBA 1D6WA 1O0DH 1GCTC 1TNJA 2ZZUH 1L4ZA 1ZYOA 1G3BA 1FY8E 2BX3A 1GMDF 4MVNA 4BANB 1SGTA 1C2FA 2P94A 3TK9A 3BTFE 5J4SA 1FAKH 2P8OB 1SGFA 1O34A 1CO7E 4FUJA 4KP0A 1FIWA 1HRTH 1C5PA 2RG3A 1AD8H 4ABHA 1GHBF 3E1XB 3PROA 1E37B 4VGCC 4DURA 1GI8B 4ABEA 3VB7A 2BHGA 1O2NA 4D7FA 1S83A 1TNIA 1A4WH 2VH6A 2VIPA 4I33A 1Y5BT 4OS7A 4SGBE 1P0SH 2OINA 1C2MA 1N6YA 4KELA 1PFXC 3QLPH 2UUFB 4NFEA 4I7YH 1CHOF 1P2JA 2ZU5A 1BTWA 3URDA 3T62A 1C5OH 1DICA 1EP5A 1NY22 2G52A 3BEIB 1O2JA 1V2UT 4AG1A 3GY8A 1T32A 1YPKH 4GSOA 5F03A 2W3KA 4Z6AH 2THFB 3QZQA 1TMTH 4FUDA 4J1YA 2PKAB 2H9TH 1AB9C 2FOEA 1YC0A 3RDZA 1TGSZ 1EAUA 1LDTT 3UPEA 2BZ6H 3BIVH 1WUNH 1QA0A 1BMMH 4YLUA 1O5EH 2WPIS 1P10A 1ZTLA 1JRSA 4FUIA 1UK3A 1AIXH 1EP6A 1LMWB 1K28D 2LPRA 1HXEH 3LGWA 1F0UA 3TNSA 5C3NA 4K5ZA 1QRZA 4H4FA 1JMOH 1GBAA 3UREA 4R8TB 2C93B 2ZHWH 1ZGVA 1W10U 1HAPH 1V2LT 1EZQA 1Z1IA 4A92A 4XBBA 1P9UA 3W94A 3PMBB 1YBWA 2A7CA 4NGAH 1GMHF 3MU8A 1ZSLA 4ZAEA 3B8JA 2ZFFH 2TGAA 1GCTB 3QTOH 1C5UA 2J94A 2WPKS 3FZZA 1WSSH 2PR3A 3BEFB 3RXVA 1C2GA 1GCDA 1GWAA 4B76A 2A2XH 2CJIA 3GDUA 1SGQE 2QYIA 2ZCKP 2QN5T 3P17H 1E36B 2PW8H 1AUTC 1O2YA 2AGIX 2GZ8A 1QY6A 1F5KU 3MO6A 1UMAH 1GBFA 1C5VA 4IGDA 1TPAE 2PFEA 4Y11E 2VVUA 4UONA 5TCCA 4MPUA 2A4QA 3R0FA 3BV9B 9ESTA 1AGJA 4CRGA 2VWOA 3RXTA 2QGRA 3SV7A 4INHA 1C1OA 2F3CE 1E35B 1NZQH 3SV8A 2IOTA 2WPHS 1RIWC 2F83A 1TNLA 2B9LA 1K21H 2VIVA 4AG2A 1O2TA 4RSPA 3ZZ9A 1LHFH 2OC7A 1SHYA 1IQMA 2OCVB 1OKXA 5GIBA 2RCEA 1G3DA 3C1KA 3TLOA 4DJZB 3IWMA 3EQ0H 5A2MH 1AY6H 5L2YH 1G37A 3NPSA 4AGKA 1NRRH 1NFXA 2FOMB 3UNQA 4SGAE 1C5ZB 1ELAA 1TPOA 4BNRA 1E34B 1Z8JB 3SNBA 4U01A 1YM0A 1EAXA 3KQBA 1EX3A 2BDIA 4OS6A 1SOZA 5GCHF 4O3UA 1EUFA 3A86A 1QBOA 1AZ8A 1ZJDA 1GHWH 2VINA 3TU7H 1FY1A 1F92A 3DT0H 1CT4E 1HAVA 1THRH 1D6RA 2GGVB 1ZRBA 2BQ7B 1SGDE 5E0HA 1JXPA 1A3EH 3SJ9A 3M5LA 4U32A 4X6OA 2AMPA 1GBMA 1S6HA 2Y6TA 2D8WA 1DUAA 3PWBA 1P9SA 3DHKH 5GXPA 5A8ZA 1VCPA 1LO6A 2BD7A 1C5MD 3B23B 3VGCC 5DP6A 3ZZBA 3PLKA 2BD5A 5FBEA 1EJNA 1XXDA 3L33A 3D65E 1A0LA 4GHQA 1BZXE 5EQSA 1E38B 3ATIA 4OS2A 3NWUA 2PKSB 1ZHRA 2PKAA 4U30A 2D26C 2XYAA 2ZCHP 3HPTB 4HGCA 1IQLA 3M3VA 4FU8A 2LNCA 1L2EA 2QF0A 1O2VA 3K2UA 5FPTA 1TPPA 1LHDH 4FXGH 1GI7B 1NRQH 3LOXA 4B2CA 1V2KT 3AVZA 4M7GA 3I29A 2PGBB 1S82A 2P3TB 2W7UA 5A0BA 3P92A 2FI4E 3RXFA 4HFPB 2GX4A 2PLXA 3LGUA 1CVWH 3CS0A 2FYQA 3RC6A 1BB0B 2ILNA 1JBUH 2TBSA 1WQSA 3P6ZB 1ZMNA 4Y0ZE 1G32B 2Y7ZA 3RXCA 2ZA5A 3F1SB 2HALA 2V6NA 2P95A 1GMCF 2BLQA 2QY0B 1DPOA 5CE1A 4Q7XA 3M5OA 4YT7H 1G3EA 2PV9B 1ABJH 1KLJH 1UTJA 1F0RA 2CHAC 4YESB 3GISB 4TWYA 3SGBE 2Y5GA 1EPTC 2AH4X 2ZU4A 5EQQA 3P8GA 4ZMAH 1C2DA 3KQDA 2ZTZA 2B0FA 1P3CA 2ODYB 3A84A 4X2WA 2ZDAH 1QJ7B 2CF9H 1ABIH 2V3OH 2TRMA 2EA3A 1C2KA 1L1NA 1O3BA 2ZDKA 2GCTB 3SW2B 4AFUA 1QBVH 1UTOA 2B7DH 3M7QA 4AFZA 1ELVA 1FY3A 3L6PA 2CF8H 2Q6FA 3LC3A 2XTTB 2ZKSA 1O2XA 4BTUB 3FP8E 1Y5UT 1C5SA 1MH0A 1QQ4A 4WH6A 1XX9A 1ZGIA 3H5CB 4JCNA 2ASUB 1HXFH 1JRTA 5EXNA 1BTHH 1QIXB 3GY4A 1GG6C 1FV9A 4INKA 6GCHG 3ZVAA 1AZZA 1PQ7A 1ZZZA 1PYTD 1MKWK 1W8BH 1AKSA 3B9FH 3SU6A 3ODDA 4CHAC 1V2MT 1PQ8A 1ZSKA 2ZDVH 1UTNA 2IPHA 2EEKA 1BJUA 1CT2E 1CA0C 1MAYA 1O5AB 3PTBA 1O3NA 4BTIB 1GMHG 2QCYA 4GCHF 1FPCH 1MMJN 3MO3A 1O2PA 1G36A 1LPKB 4YOGA 5C2ZA 2AFQB 3ZV8A 4BXWA 2ZU2A 2A4OA 1RFNA 1YPHE 1O5DH 1XKBC 2XBXA 4FVDA 3A80A 3AAUA 2BY5X 1ETSH 1HNEE 1MTNB 3FANA 3SU4A 3A82A 3UQVA 1D3DB 1QB1A 1P3EA 2OLGA 3VB4A 5EG4A 3M37A 2AEIH 1RTFB 3WY8A 4A1TA 3ZZ3A 2P8OC 1BMNH 4CBOA 1BTXA 1ZHPA 1EZUC 4ISLA 1WV7H 1IHTH 3RLYH 1T31A 2Y5HA 3VEQB 2ULLA 1GI6A 3V7TA 2ZFRH 1XVOA 1V2VT 5K7RA 4Q2KA 3GYLB 4WMFA 1ZPBA 1XUJA 2FOAA 3SNAA 3VB6A 4CH2B 1J16A 3GCHB 3RP2A 6GCHF 1MD7A 1YPLH 2XNIA 3RXAA 1P2MA 1SGCA 1MTVA 2Z9JA 1WOFA 1W0YH 2FLRH 1KXDA 1LCYA 1PPZA 4BAMB 2WPJS 1S5SA 5ABWA 4UE7H 3T5FH 1GG6B 1OYTH 2ZFTA 1CSOE 1CGIE 4MNYA 2QXGA 3FAOA 1NTPA 1O5FH 1ANCA 1OSSA 2Z9IA 3EA7A 3GCNA 3MH4A 2NWNA 1AUJA 2H6MA 1DM4B 1EKBB 1P57B 1FQ3A 2ZFSA 1EB2A 4AYYB 3SORA 3EGKH 7KMEH 1SG8B 1ZHMA 4ZKNU 1MKWH 5FBIA 4H6SB 2UUYA 3TJVA 1TGTA 2H1UA 4LK4A 4ZHAA 1HAZB 4HI3A 4X8UH 4Y10E 2FOHA 2OBOA 1ESBA 1TX6A 2I6QA 2P16A 2GV6A 2J4IA 2ZP0H 1TAWA 2WV5A 1N6XA 1O3FA 2XBWA 4OGXA 3ZZ5A 1TA6A 1TX8A 2G81E 1NRNH 1D3TB 1K1LA 3ZVEA 3SZNA 1RD3B 1Y3XA 1FIZA 4X8VH 1GBLA 1KTSB 1OOKB 2TIOA 1DX5M 1O39A 4RN6A 3HKIB 2VIOA 1TNGA 4GHTA 4F4OC 1HLTH 4YM9A 4D8NA 3K9XB 1IQNA 2DE8A 3PYHA 1L0ZA 2P59A 2STAE 8GCHF 5FX5A 2WINI 1AKSB 1EZSC 2JKHA 4FUCA 4DCDA 2O8UA 1DWBH 1V2OT 1KYNA 3F6UH 4IS5A 2STBE 2GT8A 1TQ7B 2J2UA 4ABFA 1NROH 1DT2A 1G2LA 1KY9A 1GGDB 3QGJA 3ZVDA 1TBZH 1C1PA 5DJ7A 2QA9E 4KTCA 4MTBA 2R2WU 1J17T 4LZ1H 1MZAA 1TMUH 3L3TA 3SUFA 1MTSA 3QZRA 4XSKU 3SNCA 2XW9A 2Z9GA 4CREA 3C27B 2O8MA 3A8BA 1SGRE 3MNSA
chains in the Genus database with same CATH superfamily
4AYVB 2FS8A 3RMMH 2W3IA 4JYVH 3URCA 2D2DA 1BUIA 3LH1A 5E0GA 1SI5H 1LTOA 1Y59T 2H5CA 4I32A 1H4WA 1PYTC 4NFFA 3MTYA 3D49H 1KXCA 2Y5FA 4XE4A 3U8OH 2HGTH 2SNWA 4FUBA 1C9TA 1TIOA 4VGCB 3SO3A 1HAXB 3P8OA 1Z8RA 1TNKA 5EGMA 2G4TA 2HPPH 1UVUH 2H2ZA 1GJ5H 3RUOA 2GKVE 1THSH 3SUDA 1GHAG 1MD8A 1BBRK 4YZUA 2FOBA 3ESTA 5I46H 1C5TA 1KLIH 2A4GA 4O3TA 3M7TA 1GMCG 2ZHQH 1BDAA 2SGEE 1FN6A 1OX1A 3LGIA 3P70B 3MMGA 3U1JB 1M9UA 2CGAA 3M35A 3RXBA 5EJZA 4K1TA 1O3GA 1THPB 3ZZAA 1VGCC 2ZTYA 2C8WB 2GD4B 4RKOB 2BXUH 1DDJA 4D9QA 2ZGCA 3DFLA 3UUZA 2BY7X 1CHOG 2ZIQH 4XD7D 2YOLA 1NFYA 1GVZA 1TBRH 4Y79A 2A4RA 2BVSH 1GL1A 2TPIZ 1HYLA 4GLYA 4ISOA 2UUJB 3A7ZA 3DA9B 4D9RA 2V3HH 1T7CA 4FUEA 2G00A 1ZMLA 3SJKA 3A7VA 3SHAH 2JIZD 1AVWA 1DOJA 4NIXA 2OC1A 2WUCA 2VIQA 1QQUA 1SLVB 4LXBH 1UHBB 5AHGH 1AO5A 3G01A 1VITF 4IC5A 5CHAC 1SQRA 2OC0A 3TITA 2FODA 1DUEA 1V2NT 2C8ZB 1O2QA 4AB8A 1XM1A 2F9VA 1YLDA 3GY7A 1A46H 1D4PB 5G4BA 2W26A 3EYDA 2GZ9A 3R3GB 4AORA 5FPYA 1P2OA 4ZHLU 2ZGBH 2PUXB 2J95A 2A45B 2NU2E 3LGVA 5EW1H 4ZUHA 2XC5A 3VG8A 1VITG 2Q6GA 1DWEH 2KCPA 1VITH 5E0JA 1RTLA 1W13U 4GPGA 3TK6A 1YYY1 1Q3XA 1KIGH 2AIQA 3H7OA 5EODA 3GY6A 1P05A 3GDSA 2BD9A 4WMDA 2FX4A 2SNVA 1Y3WA 1FNIA 2AS9A 1K9OE 1YCPM 2RDLA 1A3BH 2FZZA 2W6JD 1FMGA 1YPGH 7ESTE 2KCOA 1C5WB 1OP0A 3DUXH 1SMFE 5FPSA 4X0WU 1A1RA 1QZ8A 1ESAA 1LPZB 1GDNA 1WTHD 1HJ9A 3S9CA 1FY5A 4YTAA 4Z0KA 3ZYEA 3WWFA 1P11E 4B2BA 2VGCB 2WZQA 5JPMH 3O8CA 5E2PA 5J4QA 1YPJH 1MAXA 1FN8A 3E6PH 4K2YA 1DWCH 1V2QT 1K0HA 2PGQB 1SLUB 2BXTH 4GAWA 3HGNA 3P95A 3M7UA 1BCUH 2A5AA 1XXFA 4ABBA 4JYUH 1FZZA 1SGYE 3W95A 1SFIA 2A0QB 2WV4A 5KEDA 1DITH 1UTPA 1GJBB 3Q3XA 5EJ1A 1SFQB 2WUBA 1O3CA 1ORFA 3E91A 1ZTKA 3S69A 3TH2H 1OWIA 1AWFH 2PSYA 2IN2A 5A0AE 3VFEA 3RU4E 1ELDE 4I8KA 2FWWA 3FP7E 3K6ZA 3SYJA 2NU1E 1GVLA 5B6LA 1WQVH 2FLBH 1O2UA 1J15A 2HPQH 2OQUA 3SJ8A 4ABDA 1LHEH 1C1NA 2PHBA 4K1EA 4B71A 2EQNA 1C1MA 1UVOA 3SOSA 5LPRA 1MKXH 2L6OA 4KTSA 1SGIB 1O2WA 4GVUA 1ELFA 3U28C 2ZO3H 4NZQA 1UVPA 5IK2D 1UK4A 4FU7A 1WYKA 1O31A 4UFDH 2BDBA 4JZEH 4I8LA 5DP7A 1P01A 2ZF0H 1FX0B 2J98A 1LPGB 1NRSH 3NCLA 2UWOA 3EA9A 3PM3A 1W0JD 3PB1E 1GMDG 1TA2A 4YLQH 1GHBG 3F9GA 4IMQA 1O2MA 3UOPA 1CGJE 2VNTA 1O36A 3PO1C 5T6GA 1UJ1A 4OS1A 1J14A 1F0TA 4FUGA 5C67A 1EXFA 2V35A 3F0OA 1NC6A 4B75A 1BRUP 2IJD1 2FEQH 3KIDU 1C5XB 5A09A 2G51A 3BG4B 3HGPA 1O2KA 3TPIZ 3F9EA 1H8IH 1BOQA 5EPNA 1ANEA 1WU1A 1INCA 5IYTA 2PP6A 2H9EH 5AVDA 1SQAA 3T29A 2BX4A 4ZHMU 4I8GA 4KKDA 4A1VA 4NIWA 5DK1A 1V2TT 4X2VA 4MPVA 3SI4H 2BOKA 1EQ9A 1GJ6A 2CHAB 1YF4A 1UCYH 2A2QH 2KAIB 2OC8A 1O3IA 4DVAU 2Z3DA 1EPTB 1FI8A 3ATKA 1TGBA 1N8OC 3RXGA 5LH8A 3K65B 2YNBA 1OPHB 4NG9H 5JDUB 2ODPA 2P3FH 1VCWA 1XUFA 5EQRA 1SGEE 3UIRA 4NSYA 1HJ8A 1UTQA 2K8IA 1SKYE 1RS0A 1AB9B 1NO9H 1NS3A 2FI5E 2ZNKH 5GDSH 1DXWA 4KTUA 1RIWB 2FXRA 3ZZ4A 4RT1A 4IC6A 3MYWA 2SGFE 4E06H 1O32A 1PQAA 1BHXB 2ZC9H 4ABGA 2GTBA 1GBIA 1F0SA 1VGCB 4MLFB 2ANWA 1Z8IB 3A8CA 2LELA 1A0HB 1D3QB 3MO9A 6ESTA 2FI3E 1WXRA 1HAGE 1O3KA 3GCOA 3U8RH 4FUHA 3JZ2B 4K8BA 2V0BA 1ID5H 3HATH 2ANMH 1HGTH 4Y0YE 2K0QA 4TSFD 1V2RT 3SN8A 1GBBA 3N99A 5DKMA 4CHAB 2BVRH 3PMHB 1C2JA 3MFJA 4B6EA 4Q4LA 4TWWA 1TMBH 4BOHA 4X2XA 2J38A 5DGJA 1OWHA 2XRCA 1F7ZA 5T1VA 3BN9A 1JOUB 2NU4E 1DS2E 3BTHE 1O2LA 3PRDA 4YO9A 1C2LA 1PPCE 3SU0A 1GJDB 3NZIA 2ZTXA 2BLVA 1HBTH 1OYQA 3M36A 2NU0E 2M2AA 4D7GA 2OQ5A 1UO6A 4XBDA 1HV7A 2ZQ2A 2Q1JA 5JBCS 3SV2H 4E7RG 2O8WA 2BMGB 2ZGJA 3QGNB 1AMHA 1TRNA 4CRAA 1S6FA 3I77A 1XUHA 3MNXA 4YT6H 3IG6B 1AHTH 1W0ZU 1O37A 5JBTA 5JB9S 4CBNA 3TGJE 7GCHF 3MI4A 3BG8A 2HLCA 4MNVA 4FOUC 5HM2A 3TJNA 3LDXH 3PMAB 2HRVA 1CU1A 3RMLH 1SSXA 2VIDA 2J92A 1OHHD 5EPYA 4WJG2 1ZPCA 2UWLA 3E8LA 2Z7FE 2GDEH 2BM2A 1L4DA 1Q2WA 5F8XA 5EU8A 4A5TS 3OU0A 2JH5D 7LPRA 2JH6D 1O33A 2BTCE 1V2JT 2QIQA 4IN1A 4K1SA 2A32A 3TIUA 1GDUA 1XUGA 3H7TA 4TY7A 1FONA 5DP8A 2F9PA 3LJJA 1Z71A 4DOQA 5PTPA 2JH0D 1HAOH 1DY8A 2HNTE 1BMFD 3ZYDA 4BAKB 6CHAC 1H8DH 1W11U 1AE8H 1S0RA 1TFXA 2ANYA 4TY6A 1C5QA 4O97A 4ISNA 1O38A 3M3TA 4MPXA 2AYWA 3UNRA 3Q00A 3V13A 2WPLS 1GBKA 1W7XH 1O3AA 2FESH 2Y81A 1Z6JH 5AFYH 4X2YA 1MUEB 2ZPQA 3RXJA 2J34A 4X1QU 1EZXC 2KAIA 5DP3A 5GNDA 1GBDA 3KN2A 1O3DA 1YCPH 3HK6B 2ZU3A 3RXEA 1ZJKA 1ELCA 1PPFE 3UOUA 1W7GH 1SBWA 2ALVA 4Y7BA 4CRBA 3O8RA 1MTWA 1RXPA 1TRMA 4RI0A 1LVBA 3TVJB 3QDZB 3E0NB 1LKBA 2AIPA 5DP4A 3F9FA 3TGKE 2GMTC 7GCHG 2BQWB 4DY7B 3EA8A 1QJ6B 2JDID 1BHXF 3GY5A 4INLA 2OTVA 1IQJA 2Q6DA 1EAWA 1PPGE 5DP5A 1UHBA 2P3UB 4UFGH 3F2GA 4IN2A 2CXVA 1TONA 2CN0H 4JK6A 1P12E 2XCNA 1PPHE 2G8TA 4JZIA 1C1RA 4X1SU 1BTUA 1GBCA 4Y71A 4OGYA 3RMNH 2HLDD 2V3MA 3GOVB 3RU4D 5EIYA 4AFQA 1TWXB 3OFND 4CR5A 2ZGXH 3U1IB 1V2ST 1GI0A 4F48B 1SQOA 1T8NA 2F4LA 3A87A 5JB8S 5DN6D 2F9NA 2W7SA 1O3MA 2HNTF 2FP7B 4QT8C 3TH4H 2DE9A 2ZPRA 2ODQA 1LHCH 4ASHA 4FUFA 1MQ5A 2AGGX 3GY3A 5HIZA 1DE7H 2F9UA 2VWNA 4JYTA 1TABE 1TOCB 1IQHA 3F68H 1A5HA 1MTNC 2GZ7A 3N7OA 3GCTF 3SGQE 5HKKD 3MH7A 1ZR0A 3GICB 3RM2H 1BTYA 3LH3A 2BDGA 2O9QA 3A8DA 1RTKA 2Z94A 2GCTC 1NU9A 1GBEA 4TPYA 4JK5A 1EOLA 1SC8U 1TQ0B 1EOJA 3O8BA 5ETXA 3UWIA 2ZHFH 1J8AA 1AU8A 1O30A 2GV7A 1QBNA 3RXIA 3S7KB 2BD3A 3RXUA 3FN8A 3MHWU 2BDHA 2OD3B 1B7XB 5GCHG 3S9BA 4WXVA 1OXGA 3SJOA 1W0KD 3MU0A 1SQTA 3SU2A 2PTCE 3GCHC 5JBAS 1P2QA 5F53A 2XXLA 3RXQA 1CA8B 1IHSH 2XBYA 3RXKA 2UUKB 1V6DA 1GDQA 1A61H 2WV9A 1GI5A 2CMYA 4Y76A 2Y82A 3N7DA 2KZ4A 2VIWA 1EPTA 2BDYA 3P8FA 2WYJA 2NU3E 3ENSB 2HWLB 2VB0A 3TK5A 3LT3A 2F91A 3MU4A 1Y8TA 1O2SA 1C2IA 2FYRA 5TCAA 2ZI2H 4NZLA 1XUKA 1IQFA 4MPWA 4A1XA 2J5UA 2G5VA 3LGTA 3NXPA 4Y7AA 3BTDE 4ZROA 3VB5A 1H1BA 1QL8A 4DIIH 2XCFA 2AMQA 1SLWB 1NM6A 1JIRA 2GT7A 3KHVA 1GL0E 1VR1H 3GS9A 3ZVFA 2A7HA 4Z1MD 4UEHH 2WPDD 4BAQB 2EI8A 4NA9H 1C5LH 1FUJA 3BSQA 1UVSH 4F49A 2AHME 2A1DB 4Q7YA 4NWKA 1GBHA 1O2ZA 4WWYA 1BIOA 4GCHG 2XBVA 3MWIU 2I6SA 1BBRH 1GBJA 2OUAA 2JETC 4NIYA 4HZHA 1HB0B 1TPSA 2RDEA 1K22H 3UB0A 2ESTE 1E0FD 2IJOB 2Y80A 1TB6H 1V2PT 3KQEA 3AK5A 3W1EA 1ZRKA 1ANDA 1C2EA 2YMSB 3OYPA 4DW2U 1K2I1 2Z3CA 1RRKA 4B2AA 2KFWA 2VH0A 3PRBA 1AFEH 2FTMA 3A7XA 1H9IE 2H9HA 3LIWA 2G5NA 2UWPA 3ATMA 3I78A 2BOHB 1YGCH 3GYMA 2QF5A 4XBCA 2XOKD 1SGNE 1MKXK 5JYIA 2C90B 4OS5A 4FETA 5C20A 1N8OB 3CENA 1D9IA 3ELAH 1NN6A 1CBWC 1W2KH 5CDFE 3BTGE 2AGEX 4JZDH 4DG4A 1W3CA 4XRNA 4NCYA 1QA7A 1XMNB 1P09A 3M61U 4IW4E 1ESTA 1LVYA 1EATA 2ZWLH 2RA3A 2H5DA 3ATWA 1HCGA 3M5NA 1SB1H 3E0PB 1H9LB 5A8YA 2ZFPH 5HXFA 3PV4A 1O2GH 1W12U 1T8OA 1QNJA 2ZG0H 3SQHE 1ELGA 1AVXA 3LJOA 1Q31A 5E2OA 2EC9H 2F43B 4MQAA 3ZZCA 3E3TA 1ZTJA 3UQOA 2A7JA 4ZH8A 1LQDB 1ARBA 4ISHH 1MCTA 3ITIA 1UCYK 4H42U 3Q76A 2DUCA 1V2WT 4XOJA 1Y5AT 1ELTA 1EJAA 5BRRE 1QCPA 1AN1E 2BYAX 5C94A 1SGPE 1VZQH 1C1QA 8KME2 1NT1A 1P02A 1DSUA 3OSYA 5E8EH 5ESTE 1KDQB 1F2SE 1BRCE 1NU7B 4WH8A 1GHYH 1NRPH 1CE5A 3PMJA 5JBBS 2QC2A 1DFPA 3A8AA 1DSTA 2C4FH 1NBMD 2QF3A 2M5TA 3LONA 1PQ5A 1GPZA 2JETB 1LKAA 4X6PA 4Y8YA 5FL7D 3MNBA 4UFFH 3MOCA 3D62A 3OTJE 2YNAA 1ANBA 2WPMS 4XDEA 2A5KA 5FXLA 4X6NA 3RXSA 1CA0B 1O5GH 3NKKA 2EI6A 5BPEA 3FZDA 3P8NA 4M9FA 2ZCLP 3F9HA 1SGFG 3A85A 3LC5A 1GJCB 1TGNA 1BITA 1GGDC 4O9VA 4X8SH 4PROA 2P93A 3RXDA 1ELEE 3TNTA 1MBQA 2FIRH 3O8DA 3T28A 4AGJA 2PUQH 1YPHC 3LPRA 4Y8ZA 1C9PA 1IQIA 1JWTA 4NA7A 5F8ZA 2TGPZ 2WHXA 1HJAB 1IQGA 3AASA 4DGJA 1OWDA 1TOMH 3SBKA 1MQ6A 2FDAA 3T25A 2PSXA 4JZFH 3S7HB 3OX7U 1OWEA 3SQEE 2BD2A 3U8TH 1K1MA 3KNXA 3A7WA 3PO1B 4UFEH 1P04A 1K1OA 1L1GA 1KDQA 1LVMA 2G55A 1K1PA 4DT4A 1A0JA 1GHZA 1RJXB 3K6YA 8ESTE 1FY4A 4IBLH 3OY5U 1QURH 3ATLA 1LHGH 1WAYB 1O5BB 2ZDLA 2D1JA 3RMOH 3GDVA 3WWBA 1TALA 2ZFQH 3EAJA 3KQ5A 4AN7A 1AFQC 5DP9A 1O3JA 2Z3EA 1CQQA 5DG6A 3UTUH 5C1XA 1UVTH 6CHAB 5FAHA 4ZKRU 1C1SA 1C4U2 3MU1A 2JJ1D 1SOTA 1MCVA 4XFQA 3ZZ8A 1A5IA 4THNH 5HIYA 2J9NA 1O2HA 1FDPA 1BMLA 1RGQA 2VVCA 4X1RU 3U98H 2FPZA 1HAHH 1QRXA 2RFKC 2OXSA 1B0FA 1NPMA 3BF6H 3BEUA 5HYOA 1KSNA 2BLWA 1NFWA 1G9IE 1YPMH 4AC9A 4LZ4B 2BLOA 2EI7A 1UTLM 1VJAU 2R3UA 2BD4A 5A0CA 1GI2A 1AE5A 4NIVA 1WTGH 1TLDA 4R0IA 4JMYA 5TJXA 2FOCA 1FPHH 3UR9A 4NSVA 1KXBA 3LKWA 1O3PB 1DWDH 2KCAA 2C8YB 4TT3D 4ABIA 3SJIA 3OEHD 1OS8A 1X7AC 4CRCA 2R9PA 3HK3B 1FLEE 2ZECA 2QXIA 1TRYA 1DLKB 3V3MA 4AZ2B 5GPIB 2OP9A 3RXHA 1T4UH 1ETRH 1G30B 3EDXB 2QV1A 5L2ZH 2QAAA 1W14U 1YLCA 1P06A 3QK1A 1U6QA 5C0TA 3E90B 4A6LA 2GCHF 1S0QA 1EASA 1ZLRA 3NK8A 5HM9A 2F9BH 1JIMA 5HGGA 3N7EA 1B0EA 4X8TH 2GDDA 1DANH 1KXFA 1T8MA 1SL3A 2FM2A 1YCPK 1O2OA 3QWCH 5FCRA 4K8YA 1O3LA 1TX7A 2R3YA 2GCHG 5ESBA 2ALPA 1KXEA 4J2YB 5EXLA 1YKTA 1MU6B 4ZXXH 1XVMA 3ZV9A 2XC0A 5GJ4B 4Y8XA 4ESTE 3IITA 2SGAA 2R0LA 2FO9A 3FOAA 4OS4A 1Y3YA 2BDCA 2ZGHA 4RT0A 1GJ9B 1PPBH 2PKSC 2G4UA 3D23A 3MNCA 2K1QA 3BTKE 4X1PU 1BT7A 1AFQB 5AFZH 4AB9A 1N1LA 2QF4A 1EAIA 3SV6A 4NA8A 2RA0A 3U69H 1BTZA 2XWBI 5H4IB 3TJUA 5B6OA 1Z7KA 4TPIZ 5LPEA 2WYGA 2FOGA 1UCYE 1WBGB 3TH3H 1O3OA 2KR7A 3KCGH 4FU9A 1HAYB 4X6MA 2L74A 3LU9B 2GP9B 3TGIE 4KGAA 1C1UH 3RXRA 1O2IA 1TNHA 2FTLE 4B74A 4K3JA 3A81A 1G2MA 3AAVA 1T8LA 3M3SA 4UDWH 4MDSA 1GI1A 2BY9X 3BTME 4NWLA 1PJPA 1TYNA 1MU8B 2SGPE 3Q3KA 1C1VH 1BQYA 1Y3UA 1F5RA 4TYDA 4I8JA 2TGDA 2HVYB 2Z6BD 4F55A 2ANKH 1S81A 4X1NU 4MG3A 4K60A 3RU4T 2BB4A 1IQKA 1O3HA 3ZZ6A 1O5CB 1A2CH 2B5TB 1SHHB 3SNEA 1V3XA 3DFJA 3A83A 3FKSD 4BTTB 2XC4A 1ARCA 1S84A 2BY8X 3GY2A 3PTNA 4Q7ZA 1QHRB 1P2KA 2VWLA 1KLTA 3EE0B 3QTVH 1QB6A 1QTFA 5FHTA 2SFAA 4CR9A 4K69A 4E05H 9LPRA 3AW1A 1GHVH 5C1YA 2VU8E 4AFSA 1C4V2 5SGAE 2OBQA 3PLPA 3SV9A 5DO4H 3BTQE 2HNTC 1A5GH 4YOIA 1BMAA 4AOQA 4OM9A 3Q77A 1DY9A 1H8HD 2J97A 3STJA 5K0HA 3S0NA 1AWHB 3UAIC 3T2NA 1HIAB 3ZZ7A 1SR5C 5F6MA 3BTTE 4ABJA 1C4Y2 3SHCH 3SUEA 3FFGA 3RM0H 5EXMA 3ZVGA 1QJ1B 1GJAB 1IOEA 5EW2H 4B6FA 1AI8H 6LPRA 4B1TA 1C2HA 5C17A 3CS7A 3RXOA 4CH8B 2YMSC 1HAVB 3T26A 1L1JA 2EY4C 4MNXA 1NFUA 1QGFA 1C5RA 2CV3A 4I8HA 3KGPA 1YPEH 3PWCA 3A7TA 2ZHDA 1AVGH 1BRBE 4WMEA 1ELBA 1GJ7B 1OP8A 1HAIH 4FVBA 1SPJA 2B8OH 1AQ7A 3UY9A 2R2MB 1BBRE 2BD8A 1GHAF 1K1NA 2PWXA 3KL6A 1GI3A 1K1IA 2FS9A 1GBTA 4B73A 1HUTH 3M5MA 3T27A 1BJVA 1OWJA 3SU1A 4BAHB 1QFKH 1EB1H 1UW7A 2QXHA 1ZSJA 3BTWE 3QO6A 1K1JA 1MTUA 1P2IA 2VWMA 5CMXH 4CRDA 1TE0A 3E16B 3SGAE 4D76A 2ZHEH 1S85A 2FX6A 3VPKA 4BAOB 3A89A 5L6NH 3VGCB 4I86A 2QXJA 1QB9A 1FJSA 3MH6A 2ZU1A 1CGHA 3FP6E 4DIHH 5CHAB 2A31A 1LVOA 3GCTG 4AX9H 2AMDA 5GWZA 2BDAA 3RC4A 4BXSA 3ZZDA 5C1UA 5FCKA 1GI9B 3VXEH 3VXFH 1C1WH 1BRAA 3FVFB 1FAXA 2Z9LA 2HVXA 1Z1JA 1GI4A 3QN7A 2Z9KA 1A7SA 3SU3A 1UK2A 8LPRA 3STIA 1J9CH 2O8TA 1QL9A 3VB3A 1C5NH 4Q80A 4U2WA 2CK3D 5DPAA 3SI3H 4CRFA 1HDTH 3OE7D 4I31A 4ZKSU 1XUIA 1T4VH 1ZMJA 1D3PB 1XKAC 4RKJB 1IQEA 3UNSA 1QR3E 3A88A 4GUXA 3RC5A 4WVPE 1GHXH 3FO8D 2C8XB 1DXPA 1ETTH 4MNWA 1YWUA 4Y6DA 1BA8B 4HTCH 4O03A 2PTNA 3Q3YA 1DVAH 4P00A 3NUMA 1YP9A 3DSPA 1O3EA 1NESE 3UFAA 5FX6A 3SU5A 3HKJB 3KQCA 4WF8A 3KYFA 5C5NA 5LPFA 2LP6A 4ABAA 3ODFA 5IDKA 2VGCC 1KTTB 2VBCA 1VCQA 1GJ4H 1GJ8B 4DT7B 1H9HE 2AERH 3S9AA 3U9AH 1P8VC 2SGDE 5T3HA 1UTKA 1FXYA 1KXAA 2W5EA 2Y7XA 1IAUA 1ZOMA 1ZPZA 1QL7A 1QRWA 2BQ6B 1TBQH 2VVVA 2ZEBA 2BY6X 1ACBE 2IPQX 3A7YA 2BVXH 1BTPA 2SGQE 3RXPA 2HOBA 1CHGA 2V7QD 1SLXB 1HJAC 2ZDMA 1Z8GA 4E7NA 3QX5H 4HG6A 5AF9H 5C5OA 1VJ9U 1B5GH 1DLEA 5F8TA 3RXMA 1EJMA 3UR6A 1OWKA 4ZXYH 3ZVCA 1HPGA 5LGOA 3DD2H 1MZDA 2FMJA 1PPEE 4IMZA 3V0XA 3KF2A 1TGCA 8GCHG 1G3CA 2BZAA 1P03A 2GVFA 2VJ1A 3MH5A 1MBMA 1O35A 5I25A 3V12A 1HIAA 2O8LA 1OP2A 4YOJA 3RXLA 3SNDA 1HFDA 3AW0A 2ZQ1A 3LGYA 3UWJH 4A7IB 4WY3A 5C0UA 2FOFA 2ZDNA 2WSSD 4ISIH 4H6TA 3JZ1B 1C1TA 2GMTB 1F5LA 1O2RA 5A8XA 1LQEA 5EOKA 4WXIA 3BIUH 2TGTA 3KEEA 4JZ1A 3OY6U 1WCZA 2KM0A 1Y3VA 2F9OA 1CT0E 1SVPA 3SUGA 5L30H 2ZPSA 3BTEE 5T6DA 4LOYH 1GVKB 3RLWH 5T6FA 3MU5A 1Z6EA 3PLBA 3TJOA 4ZKOU 4UD9H 1C5YB 5HMAA 2C3SA 1UTMA 2XWAA 1P2NA 3CP7A 1CBWB 2A5IA 3BG4C 2R0KA 3QUMP 3ZVBA 1D6WA 1O0DH 1GCTC 1TNJA 2ZZUH 1L4ZA 1ZYOA 1G3BA 1FY8E 2BX3A 1GMDF 4MVNA 4BANB 1SGTA 1C2FA 2P94A 3TK9A 3BTFE 5J4SA 1FAKH 2P8OB 1SGFA 1O34A 1CO7E 4FUJA 4KP0A 1FIWA 1HRTH 1C5PA 2RG3A 1AD8H 4ABHA 1GHBF 3E1XB 3PROA 1E37B 4VGCC 4DURA 1GI8B 4ABEA 3VB7A 2BHGA 1O2NA 4D7FA 1S83A 1TNIA 1A4WH 2VH6A 2VIPA 4I33A 1Y5BT 4OS7A 4SGBE 1P0SH 2OINA 1C2MA 1N6YA 4KELA 1PFXC 2QE7D 3QLPH 2UUFB 2KCYA 4NFEA 4I7YH 1CHOF 1P2JA 2ZU5A 1BTWA 3URDA 3T62A 1C5OH 1DICA 1EP5A 1NY22 2G52A 3BEIB 1O2JA 1V2UT 4AG1A 3GY8A 1T32A 1YPKH 4GSOA 5F03A 2W3KA 4Z6AH 2THFB 3QZQA 1TMTH 4FUDA 4J1YA 2PKAB 2H9TH 2J98B 1AB9C 2FOEA 1YC0A 3RDZA 1TGSZ 1EAUA 1LDTT 3UPEA 2BZ6H 3BIVH 1WUNH 1QA0A 2XNDD 1BMMH 4YLUA 1O5EH 2WPIS 1P10A 1ZTLA 1JRSA 4FUIA 1UK3A 1AIXH 1EP6A 1LMWB 1K28D 2LPRA 1HXEH 3LGWA 1F0UA 3TNSA 5C3NA 4K5ZA 1QRZA 4H4FA 1JMOH 1GBAA 3UREA 4R8TB 2C93B 1E1QD 5EJLA 2ZHWH 1ZGVA 1W10U 1HAPH 1V2LT 1EZQA 1Z1IA 4A92A 4XBBA 1P9UA 3W94A 3PMBB 1YBWA 2A7CA 4NGAH 1GMHF 3MU8A 1ZSLA 4ZAEA 3B8JA 2ZFFH 2TGAA 1GCTB 3QTOH 1C5UA 1E79D 2J94A 2WPKS 3FZZA 1WSSH 2PR3A 3BEFB 3RXVA 1C2GA 1GCDA 1GWAA 4B76A 2A2XH 2CJIA 3PV5A 3GDUA 1SGQE 2QYIA 2ZCKP 2QN5T 3P17H 1E36B 2PW8H 1AUTC 1O2YA 2AGIX 2GZ8A 1QY6A 1F5KU 3MO6A 1UMAH 5KECA 1GBFA 1C5VA 4IGDA 1S6LA 1TPAE 2PFEA 4Y11E 2VVUA 4UONA 5TCCA 4MPUA 3OAAD 2A4QA 3R0FA 3BV9B 9ESTA 1AGJA 4CRGA 3MQKC 2VWOA 3RXTA 1WDIA 2QGRA 3SV7A 4INHA 1KMHB 1C1OA 2F3CE 1E35B 1NZQH 3SV8A 3EE7A 2IOTA 3CNRA 2WPHS 1RIWC 2F83A 1TNLA 2B9LA 1K21H 2VIVA 4AG2A 1O2TA 3H09A 4RSPA 3ZZ9A 1LHFH 2OC7A 1SHYA 1IQMA 2OCVB 1OKXA 5GIBA 2RCEA 1G3DA 3C1KA 3TLOA 4DJZB 1VKYA 3IWMA 3EQ0H 5A2MH 1AY6H 5L2YH 1G37A 3NPSA 4AGKA 1NRRH 1NFXA 2FOMB 3UNQA 4SGAE 1C5ZB 1ELAA 1TPOA 4BNRA 1E34B 1Z8JB 3ZIAD 3SNBA 4U01A 1YM0A 1EAXA 3KQBA 1EX3A 2BDIA 4OS6A 1SOZA 5GCHF 4O3UA 1EUFA 3A86A 1QBOA 1AZ8A 1ZJDA 1GHWH 2VINA 3TU7H 5CHBA 1FY1A 1F92A 3DT0H 1CT4E 1HAVA 1THRH 1D6RA 2GGVB 1ZRBA 2BQ7B 1SGDE 5E0HA 1JXPA 1A3EH 3SJ9A 3M5LA 4U32A 4X6OA 2AMPA 1GBMA 1S6HA 2Y6TA 2D8WA 1DUAA 3PWBA 1P9SA 3DHKH 5GXPA 4ZCNA 5A8ZA 1VCPA 1LO6A 2BD7A 1C5MD 3B23B 2JJ2D 3VGCC 5DP6A 3ZZBA 3PLKA 2BD5A 5FBEA 1EJNA 1XXDA 3DSOA 3L33A 3D65E 1A0LA 4GHQA 1BZXE 5EQSA 1E38B 3ATIA 4OS2A 3NWUA 2PKSB 1ZHRA 2PKAA 4U30A 2D26C 2XYAA 2ZCHP 3HPTB 4HGCA 1IQLA 3M3VA 4FU8A 2LNCA 1L2EA 3DCLA 2QF0A 1O2VA 3K2UA 5FPTA 1TPPA 1LHDH 4FXGH 1GI7B 2GJGA 1NRQH 3OEED 3LOXA 4B2CA 1V2KT 3AVZA 4M7GA 3I29A 2PGBB 1S82A 2P3TB 2W7UA 5DSFA 5A0BA 3P92A 1YLNA 2FI4E 3RXFA 3SZEA 4HFPB 2GX4A 2PLXA 3LGUA 1CVWH 3CS0A 2FYQA 3F0PA 3RC6A 2YMSD 3WW7A 1BB0B 4ACBA 2ILNA 1JBUH 2TBSA 1WQSA 3P6ZB 1ZMNA 4Y0ZE 1G32B 2Y7ZA 3RXCA 2ZA5A 3F1SB 2HALA 2V6NA 2P95A 1GMCF 2BLQA 2QY0B 1DPOA 5CE1A 4Q7XA 3M5OA 4YT7H 1G3EA 2PV9B 1ABJH 1KLJH 1UTJA 1F0RA 2CHAC 4YESB 3GISB 4TWYA 3SGBE 2Y5GA 1EPTC 2AH4X 2ZU4A 5EQQA 3P8GA 4ZMAH 1C2DA 3KQDA 2ZTZA 2B0FA 1P3CA 2ODYB 3A84A 4X2WA 2ZDAH 1QJ7B 2CF9H 1ABIH 2V3OH 2TRMA 2EA3A 1C2KA 1L1NA 1O3BA 2ZDKA 4ACAA 2GCTB 3SW2B 4AFUA 1QBVH 1UTOA 2B7DH 3M7QA 4AFZA 1ELVA 1FY3A 3L6PA 2CF8H 2Q6FA 3LC3A 2XTTB 2ZKSA 1O2XA 4BTUB 3FP8E 1Y5UT 1C5SA 1MH0A 1QQ4A 4WH6A 2KX4A 1XX9A 1ZGIA 3H5CB 4JCNA 2ASUB 1HXFH 1JRTA 5EXNA 1BTHH 1QIXB 3GY4A 1GG6C 1FV9A 4INKA 6GCHG 3ZVAA 1AZZA 1PQ7A 1ZZZA 1PYTD 3OTPA 1MKWK 3DSGA 1W8BH 1AKSA 3B9FH 3SU6A 4ASUD 3ODDA 4CHAC 1V2MT 1PQ8A 1ZSKA 2ZDVH 1UTNA 2IPHA 2EEKA 1BJUA 1CT2E 1CA0C 1MAYA 1O5AB 3KYGA 3PTBA 1O3NA 4BTIB 1GMHG 2QCYA 4GCHF 1FPCH 1MMJN 3MO3A 1O2PA 1G36A 1LPKB 4YOGA 5C2ZA 1E1RD 2AFQB 3ZV8A 4BXWA 2ZU2A 2A4OA 1RFNA 1YPHE 1O5DH 1XKBC 2XBXA 4FVDA 3A80A 3AAUA 2BY5X 1ETSH 1HNEE 1MTNB 3FANA 3SU4A 3F2FA 3A82A 3UQVA 1D3DB 1QB1A 1P3EA 2OLGA 3VB4A 5EG4A 3M37A 2AEIH 1RTFB 3WY8A 4A1TA 3ZZ3A 2P8OC 1BMNH 4CBOA 1BTXA 1ZHPA 1YY3A 1EZUC 2OK5A 4ISLA 1WV7H 1IHTH 3RLYH 4YXWD 1T31A 2Y5HA 3VEQB 2ULLA 1GI6A 3V7TA 2ZFRH 1XVOA 1V2VT 1MABB 4Q2KA 3GYLB 4WMFA 1ZPBA 5K7RA 1XUJA 2FOAA 3SNAA 3VB6A 4CH2B 1J16A 3GCHB 3RP2A 6GCHF 1MD7A 1YPLH 2XNIA 3RXAA 1P2MA 1SGCA 1MTVA 2Z9JA 1WOFA 1W0YH 2FLRH 5KGOA 1KXDA 1LCYA 1PPZA 4BAMB 2WPJS 1S5SA 5ABWA 4UE7H 3T5FH 1GG6B 1OYTH 2ZFTA 1CSOE 1CGIE 4MNYA 2QXGA 3FAOA 3F3BA 1NTPA 1O5FH 1ANCA 1OSSA 2Z9IA 3EA7A 3GCNA 3MH4A 2NWNA 1AUJA 2H6MA 1DM4B 1EKBB 1P57B 1FQ3A 2ZFSA 1EB2A 4AYYB 3SORA 3EGKH 7KMEH 1SG8B 1ZHMA 4ZKNU 1MKWH 5FBIA 4H6SB 2UUYA 3TJVA 1TGTA 2H1UA 4LK4A 4ZHAA 1HAZB 2W6ID 4HI3A 4X8UH 4Y10E 2FOHA 2OBOA 1ESBA 1TX6A 2I6QA 2P16A 2GV6A 2J4IA 2ZP0H 4Q63A 1TAWA 2WV5A 3PV2A 1N6XA 1O3FA 2XBWA 4OGXA 3ZZ5A 1TA6A 1TX8A 2G81E 1NRNH 1D3TB 1K1LA 3ZVEA 4P02A 3SZNA 1RD3B 1Y3XA 3F2HA 1FIZA 4X8VH 1GBLA 1KTSB 1OOKB 2TIOA 1DX5M 1O39A 4RN6A 3HKIB 1EFRD 2VIOA 1TNGA 4GHTA 4F4OC 1HLTH 4YM9A 4D8NA 3K9XB 1IQNA 2DE8A 3PYHA 1L0ZA 2P59A 2STAE 8GCHF 1H8ED 5FX5A 2WINI 1AKSB 1EZSC 1NBME 2JKHA 4FUCA 2O8UA 4DCDA 1DWBH 1V2OT 1KYNA 3F6UH 4IS5A 2STBE 2GT8A 1COWD 1TQ7B 2J2UA 4ABFA 1NROH 1DT2A 1G2LA 1KY9A 1GGDB 3QGJA 3ZVDA 1TBZH 1C1PA 5DJ7A 2QA9E 4KTCA 3NRLA 4MTBA 2R2WU 1J17T 4LZ1H 1MZAA 1TMUH 3L3TA 3SUFA 1MTSA 3QZRA 4XSKU 3SNCA 2XW9A 2Z9GA 4CREA 3C27B 2O8MA 3A8BA 1SGRE 3MNSA
chains in the Genus database with same CATH topology
4AYVB 2FS8A 3RMMH 2W3IA 4JYVH 3URCA 2D2DA 1BUIA 3LH1A 5E0GA 1SI5H 1LTOA 1Y59T 2H5CA 4I32A 1H4WA 1PYTC 4NFFA 3MTYA 3D49H 1KXCA 2Y5FA 4XE4A 3U8OH 2HGTH 2SNWA 4FUBA 1C9TA 1TIOA 4VGCB 3SO3A 1HAXB 3P8OA 1Z8RA 1TNKA 5EGMA 2G4TA 2HPPH 1UVUH 2H2ZA 1GJ5H 3RUOA 2GKVE 1THSH 3SUDA 1GHAG 1MD8A 1BBRK 4YZUA 2FOBA 3ESTA 5I46H 1C5TA 1KLIH 2A4GA 4O3TA 3M7TA 1GMCG 2ZHQH 1BDAA 2SGEE 1FN6A 1OX1A 3LGIA 3P70B 3MMGA 3U1JB 1M9UA 2CGAA 3M35A 3RXBA 4K1TA 1O3GA 1THPB 3ZZAA 1VGCC 2ZTYA 2C8WB 2GD4B 4RKOB 2BXUH 1DDJA 4D9QA 2ZGCA 3DFLA 3UUZA 2BY7X 1CHOG 2ZIQH 2YOLA 1NFYA 1GVZA 1TBRH 4Y79A 2A4RA 2BVSH 1GL1A 2TPIZ 1HYLA 4GLYA 4ISOA 2UUJB 3A7ZA 3DA9B 4D9RA 2V3HH 1T7CA 4FUEA 2G00A 1ZMLA 3SJKA 3A7VA 3SHAH 1AVWA 1DOJA 4NIXA 2OC1A 2WUCA 2VIQA 1QQUA 1SLVB 4LXBH 1UHBB 5AHGH 1AO5A 3G01A 1VITF 4IC5A 5CHAC 2OC0A 3TITA 2FODA 1DUEA 1V2NT 2C8ZB 1O2QA 4AB8A 1XM1A 2F9VA 1YLDA 3GY7A 1A46H 1D4PB 5G4BA 2W26A 3EYDA 2GZ9A 3R3GB 4AORA 5FPYA 1P2OA 4ZHLU 2ZGBH 2PUXB 2J95A 2A45B 2NU2E 3LGVA 5EW1H 4ZUHA 2XC5A 1VITG 2Q6GA 1DWEH 1VITH 5E0JA 1RTLA 1W13U 4GPGA 3TK6A 1YYY1 1Q3XA 1KIGH 2AIQA 3H7OA 5EODA 3GY6A 1P05A 3GDSA 2BD9A 4WMDA 2FX4A 2SNVA 1Y3WA 1FNIA 2AS9A 1K9OE 1YCPM 2RDLA 1A3BH 2FZZA 1FMGA 1YPGH 7ESTE 1C5WB 1OP0A 3DUXH 1SMFE 5FPSA 4X0WU 1A1RA 1ESAA 1LPZB 1GDNA 1WTHD 1HJ9A 3S9CA 1FY5A 4YTAA 4Z0KA 3ZYEA 1P11E 4B2BA 2VGCB 5JPMH 3O8CA 5E2PA 5J4QA 1YPJH 1MAXA 1FN8A 3E6PH 4K2YA 1DWCH 1V2QT 2PGQB 1SLUB 2BXTH 4GAWA 3HGNA 3P95A 3M7UA 1BCUH 2A5AA 1XXFA 4ABBA 4JYUH 1FZZA 1SGYE 3W95A 1SFIA 2A0QB 2WV4A 1DITH 1UTPA 1GJBB 3Q3XA 1SFQB 2WUBA 1O3CA 1ORFA 3E91A 1ZTKA 3S69A 3TH2H 1OWIA 1AWFH 2PSYA 2IN2A 5A0AE 3VFEA 3RU4E 1ELDE 4I8KA 2FWWA 3FP7E 3K6ZA 2NU1E 1GVLA 1WQVH 2FLBH 1O2UA 1J15A 2HPQH 2OQUA 3SJ8A 4ABDA 1LHEH 1C1NA 2PHBA 4K1EA 4B71A 1C1MA 1UVOA 3SOSA 5LPRA 1MKXH 4KTSA 1SGIB 1O2WA 4GVUA 1ELFA 2ZO3H 4NZQA 1UVPA 1UK4A 4FU7A 1WYKA 1O31A 4UFDH 2BDBA 4JZEH 4I8LA 5DP7A 1P01A 2ZF0H 1LPGB 1NRSH 3NCLA 2UWOA 3EA9A 3PM3A 3PB1E 1GMDG 1TA2A 4YLQH 1GHBG 3F9GA 4IMQA 1O2MA 3UOPA 1CGJE 2VNTA 1O36A 3PO1C 5T6GA 1UJ1A 4OS1A 1J14A 1F0TA 4FUGA 5C67A 1EXFA 2V35A 1NC6A 4B75A 1BRUP 2FEQH 3KIDU 1C5XB 5A09A 2G51A 3BG4B 3HGPA 1O2KA 3TPIZ 3F9EA 1H8IH 1BOQA 5EPNA 1ANEA 1WU1A 1INCA 5IYTA 2H9EH 5AVDA 1SQAA 3T29A 2BX4A 4ZHMU 4I8GA 4KKDA 4A1VA 4NIWA 5DK1A 1V2TT 4X2VA 4MPVA 3SI4H 2BOKA 1EQ9A 1GJ6A 2CHAB 1YF4A 1UCYH 2A2QH 2KAIB 2OC8A 1O3IA 4DVAU 2Z3DA 1EPTB 1FI8A 3ATKA 1TGBA 1N8OC 3RXGA 5LH8A 3K65B 2YNBA 1OPHB 4NG9H 5JDUB 2ODPA 2P3FH 1VCWA 1XUFA 5EQRA 1SGEE 3UIRA 4NSYA 1HJ8A 1UTQA 1RS0A 1AB9B 1NO9H 1NS3A 2FI5E 2ZNKH 5GDSH 1DXWA 4KTUA 1RIWB 2FXRA 3ZZ4A 4IC6A 3MYWA 2SGFE 4E06H 1O32A 1PQAA 1BHXB 2ZC9H 4ABGA 2GTBA 1GBIA 1F0SA 1VGCB 4MLFB 2ANWA 1Z8IB 3A8CA 1A0HB 1D3QB 3MO9A 6ESTA 2FI3E 1HAGE 1O3KA 3GCOA 3U8RH 4FUHA 3JZ2B 4K8BA 2V0BA 1ID5H 3HATH 2ANMH 1HGTH 4Y0YE 1V2RT 3SN8A 1GBBA 4CHAB 5DKMA 2BVRH 3PMHB 1C2JA 3MFJA 4TWWA 1TMBH 4BOHA 4X2XA 2J38A 5DGJA 1OWHA 2XRCA 1F7ZA 3BN9A 1JOUB 2NU4E 1DS2E 3BTHE 1O2LA 4YO9A 1C2LA 1PPCE 3SU0A 1GJDB 3NZIA 2ZTXA 2BLVA 1HBTH 1OYQA 3M36A 2NU0E 4D7GA 2OQ5A 1UO6A 4XBDA 1HV7A 2ZQ2A 2Q1JA 5JBCS 3SV2H 4E7RG 2O8WA 2BMGB 2ZGJA 3QGNB 1AMHA 1TRNA 4CRAA 1S6FA 3I77A 1XUHA 3MNXA 4YT6H 3IG6B 1AHTH 1W0ZU 1O37A 5JBTA 5JB9S 4CBNA 3TGJE 7GCHF 3MI4A 3BG8A 2HLCA 4MNVA 5HM2A 3TJNA 3LDXH 3PMAB 2HRVA 1CU1A 3RMLH 1SSXA 2VIDA 2J92A 5EPYA 4WJG2 1ZPCA 2UWLA 3E8LA 2Z7FE 2GDEH 2BM2A 1L4DA 1Q2WA 5F8XA 5EU8A 4A5TS 3OU0A 2JH5D 7LPRA 2JH6D 1O33A 2BTCE 1V2JT 2QIQA 4IN1A 4K1SA 2A32A 3TIUA 1GDUA 1XUGA 3H7TA 4TY7A 1FONA 5DP8A 2F9PA 3LJJA 1Z71A 4DOQA 5PTPA 2JH0D 1HAOH 1DY8A 2HNTE 3ZYDA 4BAKB 6CHAC 1H8DH 1W11U 1AE8H 1S0RA 1TFXA 2ANYA 4TY6A 1C5QA 4O97A 4ISNA 1O38A 3M3TA 4MPXA 2AYWA 3UNRA 3Q00A 3V13A 2WPLS 1GBKA 1W7XH 1O3AA 2FESH 2Y81A 1Z6JH 5AFYH 4X2YA 1MUEB 2ZPQA 3RXJA 2J34A 4X1QU 1EZXC 2KAIA 5DP3A 1GBDA 3KN2A 1O3DA 1YCPH 3HK6B 2ZU3A 3RXEA 1ZJKA 1ELCA 1PPFE 3UOUA 1W7GH 1SBWA 2ALVA 4Y7BA 4CRBA 3O8RA 1MTWA 1RXPA 1TRMA 1LVBA 3TVJB 3QDZB 3E0NB 1LKBA 2AIPA 5DP4A 3F9FA 3TGKE 2GMTC 7GCHG 2BQWB 4DY7B 3EA8A 1QJ6B 1BHXF 3GY5A 4INLA 2OTVA 1IQJA 2Q6DA 1EAWA 1PPGE 5DP5A 1UHBA 2P3UB 4UFGH 4IN2A 2CXVA 1TONA 2CN0H 4JK6A 1P12E 2XCNA 1PPHE 2G8TA 4JZIA 1C1RA 4X1SU 1BTUA 1GBCA 4Y71A 4OGYA 3RMNH 3RU4D 3GOVB 4AFQA 1TWXB 4CR5A 2ZGXH 3U1IB 1V2ST 1GI0A 1SQOA 1T8NA 3A87A 5JB8S 2F9NA 2W7SA 1O3MA 2HNTF 2FP7B 4QT8C 3TH4H 2DE9A 2ZPRA 2ODQA 1LHCH 4ASHA 4FUFA 1MQ5A 2AGGX 3GY3A 1DE7H 2F9UA 2VWNA 4JYTA 1TABE 1TOCB 1IQHA 3F68H 1A5HA 1MTNC 2GZ7A 3N7OA 3GCTF 3SGQE 3MH7A 1ZR0A 3GICB 3RM2H 1BTYA 3LH3A 2BDGA 2O9QA 3A8DA 1RTKA 2Z94A 2GCTC 1NU9A 1GBEA 4TPYA 4JK5A 1EOLA 1SC8U 1TQ0B 1EOJA 3O8BA 5ETXA 3UWIA 2ZHFH 1J8AA 1AU8A 1O30A 2GV7A 1QBNA 3RXIA 3S7KB 2BD3A 3RXUA 3MHWU 2BDHA 2OD3B 1B7XB 5GCHG 3S9BA 4WXVA 1OXGA 3SJOA 3MU0A 1SQTA 3SU2A 2PTCE 3GCHC 5JBAS 1P2QA 2XXLA 3RXQA 1CA8B 1IHSH 2XBYA 3RXKA 2UUKB 1V6DA 1GDQA 1A61H 1GI5A 2CMYA 4Y76A 2Y82A 2VIWA 1EPTA 2BDYA 3P8FA 2WYJA 2NU3E 3ENSB 2HWLB 2VB0A 3TK5A 3LT3A 2F91A 3MU4A 1Y8TA 1O2SA 1C2IA 2FYRA 5TCAA 2ZI2H 4NZLA 1XUKA 1IQFA 4MPWA 4A1XA 3LGTA 2G5VA 3NXPA 4Y7AA 3BTDE 4ZROA 3VB5A 1H1BA 1QL8A 4DIIH 2XCFA 2AMQA 1SLWB 1NM6A 1JIRA 2GT7A 3KHVA 1GL0E 1VR1H 3ZVFA 2A7HA 4UEHH 4BAQB 2EI8A 4NA9H 1C5LH 1FUJA 3BSQA 1UVSH 4F49A 2A1DB 4Q7YA 4NWKA 1GBHA 1O2ZA 4WWYA 1BIOA 4GCHG 2XBVA 3MWIU 2I6SA 1BBRH 1GBJA 2OUAA 2JETC 4NIYA 4HZHA 1HB0B 1TPSA 1K22H 2ESTE 1E0FD 2IJOB 2Y80A 1TB6H 1V2PT 3KQEA 1ZRKA 1ANDA 1C2EA 3OYPA 4DW2U 1K2I1 2Z3CA 1RRKA 4B2AA 2VH0A 1AFEH 2FTMA 3A7XA 1H9IE 2H9HA 3LIWA 2G5NA 2UWPA 3ATMA 3I78A 2BOHB 1YGCH 3GYMA 4XBCA 1SGNE 1MKXK 5JYIA 2C90B 4OS5A 5C20A 1N8OB 3CENA 1D9IA 3ELAH 1NN6A 1CBWC 1W2KH 3BTGE 2AGEX 4JZDH 4DG4A 1W3CA 4NCYA 1QA7A 1XMNB 1P09A 3M61U 4IW4E 1ESTA 1LVYA 1EATA 2ZWLH 2RA3A 2H5DA 3ATWA 1HCGA 3M5NA 1SB1H 3E0PB 1H9LB 5A8YA 2ZFPH 5HXFA 3PV4A 1O2GH 1W12U 1T8OA 1QNJA 2ZG0H 3SQHE 1ELGA 1AVXA 3LJOA 1Q31A 5E2OA 2EC9H 3ZZCA 4MQAA 3E3TA 1ZTJA 3UQOA 2A7JA 4ZH8A 1LQDB 1ARBA 4ISHH 1MCTA 3ITIA 1UCYK 4H42U 3Q76A 2DUCA 1V2WT 4XOJA 1Y5AT 1ELTA 1EJAA 5BRRE 1QCPA 1AN1E 2BYAX 1SGPE 1VZQH 1C1QA 8KME2 1NT1A 1P02A 1DSUA 3OSYA 5E8EH 5ESTE 1KDQB 1F2SE 1BRCE 1NU7B 4WH8A 1GHYH 1NRPH 1CE5A 3PMJA 5JBBS 2QC2A 1DFPA 3A8AA 1DSTA 2C4FH 2QF3A 2M5TA 3LONA 1PQ5A 1GPZA 2JETB 1LKAA 4X6PA 4Y8YA 3MNBA 4UFFH 3MOCA 3D62A 3OTJE 2YNAA 1ANBA 2WPMS 4XDEA 2A5KA 5FXLA 4X6NA 3RXSA 1CA0B 1O5GH 3NKKA 2EI6A 5BPEA 3FZDA 3P8NA 2ZCLP 3F9HA 1SGFG 3A85A 3LC5A 1GJCB 1TGNA 1BITA 1GGDC 4O9VA 4X8SH 4PROA 2P93A 3RXDA 1ELEE 3TNTA 1MBQA 2FIRH 3O8DA 3T28A 4AGJA 2PUQH 1YPHC 3LPRA 4Y8ZA 1C9PA 1IQIA 1JWTA 4NA7A 5F8ZA 2TGPZ 1HJAB 1IQGA 3AASA 4DGJA 1OWDA 1TOMH 3SBKA 1MQ6A 2FDAA 3T25A 2PSXA 4JZFH 3S7HB 3OX7U 1OWEA 3SQEE 2BD2A 3U8TH 1K1MA 3KNXA 3A7WA 3PO1B 4UFEH 1P04A 1K1OA 1L1GA 1KDQA 1LVMA 2G55A 1K1PA 1A0JA 1GHZA 1RJXB 3K6YA 8ESTE 1FY4A 4IBLH 3OY5U 1QURH 3ATLA 1LHGH 1WAYB 1O5BB 2ZDLA 2D1JA 3RMOH 3GDVA 1TALA 2ZFQH 3EAJA 4AN7A 5DP9A 1AFQC 1O3JA 2Z3EA 1CQQA 5DG6A 3UTUH 5C1XA 1UVTH 6CHAB 5FAHA 4ZKRU 1C1SA 1C4U2 3MU1A 4XFQA 1SOTA 1MCVA 3ZZ8A 1A5IA 4THNH 2J9NA 1O2HA 1FDPA 1BMLA 1RGQA 2VVCA 4X1RU 3U98H 2FPZA 1HAHH 1QRXA 2OXSA 1B0FA 1NPMA 3BF6H 3BEUA 5HYOA 1KSNA 2BLWA 1NFWA 1G9IE 1YPMH 4LZ4B 2BLOA 2EI7A 1UTLM 1VJAU 2R3UA 2BD4A 5A0CA 1GI2A 1AE5A 4NIVA 1WTGH 1TLDA 4R0IA 4JMYA 5TJXA 2FOCA 1FPHH 3UR9A 4NSVA 1KXBA 3LKWA 1O3PB 1DWDH 2C8YB 4ABIA 3SJIA 1OS8A 1X7AC 4CRCA 2R9PA 3HK3B 1FLEE 2ZECA 2QXIA 1TRYA 1DLKB 3V3MA 4AZ2B 5GPIB 2OP9A 3RXHA 1T4UH 1ETRH 1G30B 3EDXB 2QV1A 5L2ZH 2QAAA 1W14U 1YLCA 1P06A 3QK1A 1U6QA 3E90B 4A6LA 2GCHF 1S0QA 1EASA 1ZLRA 3NK8A 5HM9A 2F9BH 1JIMA 5HGGA 1B0EA 4X8TH 2GDDA 1DANH 1KXFA 1T8MA 1SL3A 2FM2A 1YCPK 1O2OA 3QWCH 5FCRA 4K8YA 1O3LA 1TX7A 2R3YA 2GCHG 5ESBA 2ALPA 1KXEA 4J2YB 5EXLA 1YKTA 1MU6B 4ZXXH 1XVMA 3ZV9A 2XC0A 5GJ4B 4Y8XA 4ESTE 3IITA 2SGAA 2R0LA 2FO9A 4OS4A 1Y3YA 2BDCA 2ZGHA 1GJ9B 1PPBH 2PKSC 2G4UA 3D23A 3MNCA 2K1QA