2KCYA

Solution structure of ribosomal protein s8e from methanothermobacter thermautotrophicus, northeaststructural genomics consortium (nesg) target tr71d
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
b'GDRRVRLIRTRGGNTKVRLASDTRINVVDPETGKVEIAEIRNVVENTANPHFVRRNIITRGAVVETNLGNVRVTSRPGQDGVINGVLIRELEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S8e
publication title SOLUTION STRUCTURE OF RIBOSOMAL PROTEIN S8E FROM Methanothermobacter thermautotrophicus, NORTHEASTSTRUCTURAL GENOMICS CONSORTIUM (NESG) TARGET TR71D
rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Ribosomal protein
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2008-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.310 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2kcyA01
2KCPA 2KCOA 2KCYA
chains in the Genus database with same CATH superfamily
5FL7D 3F9HA 1O3GA 4D76A 1EZXC 1QY6A 3ZIAD 1YLDA 4WMDA 4FOUC 4UFEH 3SU1A 2D1JA 3KN2A 3HKIB 1HBTH 2D2DA 2QV1A 3VB4A 1MTVA 4QT8C 1QJ6B 1C5QA 1TRYA 1D3PB 2IPQX 1O2SA 1NT1A 5EW2H 1QTFA 3LKWA 1GG6B 1UK2A 2G8TA 3SV2H 2C8XB 2BD4A 4TWYA 1A61H 1ZPZA 2Z7FE 2BXTH 3UAIC 1B7XB 4Y8YA 1WDIA 4F4OC 3OE7D 1EAXA 2K1QA 4JYVH 3ODDA 4MPUA 2SGFE 3AAUA 3NCLA 2BY6X 1K9OE 1E36B 2BY9X 1NO9H 2FI4E 4K1SA 2WPLS 5AF9H 1QRWA 1GBJA 1GMHG 8KME2 1TNLA 1ESAA 3I77A 1E1QD 1BJVA 1LVOA 1RTKA 3JZ1B 1DY8A 5DSFA 3RMMH 1GHVH 1GDUA 5B6LA 3D62A 5A8XA 4BTTB 2ZU1A 3ZZ9A 2F9BH 4LK4A 3EAJA 3E0NB 3OX7U 1KDQA 3HK6B 3ZVAA 1AU8A 1MABB 3HGPA 4XOJA 1C1QA 1AE8H 1GHWH 2PWXA 4IS5A 5FCRA 1TWXB 1TOMH 1F5RA 2TGPZ 2EEKA 4X6OA 2B7DH 1CT4E 1WSSH 1XVOA 1XUIA 4ISNA 2P93A 2J98B 2XBYA 2ALVA 7GCHF 1FJSA 2M2AA 1NN6A 3MI4A 2RCEA 2VVVA 3RUOA 1DUEA 2LELA 1IQKA 1C9PA 1ZRBA 1F0TA 1O3LA 3QGJA 1CVWH 3A86A 2PKAB 1NZQH 1EXFA 1CA8B 3MO9A 5FBEA 2VINA 4H42U 2WV5A 4A1VA 4MG3A 1FNIA 5AHGH 2BVXH 3T28A 3OSYA 1DANH 1E37B 1TOCB 2RA3A 4I31A 1O33A 1C4Y2 1NRQH 2IOTA 2PR3A 4X8VH 1WUNH 5E2OA 1G3CA 2DUCA 2FZZA 4XE4A 4KTUA 1GBTA 2J92A 4FUJA 2O8WA 1KXFA 4Y8XA 2ZNKH 1ZYOA 3RXBA 3T5FH 1BHXB 3TIUA 3M7UA 3LGYA 4YT6H 3KEEA 3SU0A 1MTWA 2BDBA 2CN0H 8LPRA 6CHAB 1W7GH 1BMNH 3ZYEA 3BTWE 3DSOA 1D6WA 2BDHA 3RXCA 1OWDA 1ELBA 1C5WB 1P10A 1TNJA 2Z9JA 5C1XA 1GBIA 1B0EA 5HIZA 2BZ6H 3CS0A 4RKJB 4BTUB 2XCNA 2ZPQA 2A7CA 4Q2KA 1S81A 1P2QA 2Z9KA 2ZO3H 3FZZA 4X6NA 3ZZ8A 4NA9H 3RXAA 4MNVA 5DGJA 1KXDA 4Q63A 3NZIA 5G4BA 2V0BA 2JH5D 4VGCC 2C90B 1O2LA 4NFFA 1RJXB 4O03A 4AFUA 1GI6A 1AD8H 5E0HA 2WPMS 1P3CA 1ZMJA 1O2IA 3OTJE 3D65E 3P8OA 2P95A 1CT0E 1A5HA 2G52A 1DE7H 5DP9A 5L2YH 3RXOA 3S9CA 1DVAH 1YP9A 4B75A 4ZH8A 2G00A 3DA9B 3LIWA 1UTQA 2BY8X 3A7XA 2A31A 3L33A 4JZFH 1IQGA 1O3CA 2Z6BD 3F0OA 3PV5A 3VB6A 4DW2U 2FOEA 3KYGA 4LOYH 3ZZ6A 2G4UA 1WTGH 1V2QT 1P05A 3WW7A 1JRTA 1QBVH 2QN5T 2O8MA 1S5SA 1GDNA 3TJUA 3O8CA 1UK4A 2IJD1 1AUJA 4FUIA 1SVPA 2ZPRA 3BTGE 1GBEA 4TPYA 4ZAEA 5DKMA 1MTNB 2F9VA 1SHYA 1LCYA 4CH2B 3PRBA 1O2JA 1HAPH 1T4UH 3RXJA 1QGFA 3VXFH 1DSTA 5GCHG 2YNBA 2ZHDA 2AGIX 4X8TH 1GG6C 2AMPA 2NWNA 1UCYK 3BTDE 1YPGH 1VJAU 7GCHG 1YPMH 3UOUA 1TX7A 4CRFA 1GJ5H 1COWD 1LKAA 1YCPH 5BPEA 2BQWB 3LONA 2A0QB 2IPHA 3PLBA 1UVUH 1XUJA 2KCOA 2XOKD 3ZVGA 2YMSD 5FPSA 2QCYA 3NPSA 3ESTA 4IMQA 1P01A 2ODYB 3QZQA 3RXVA 3T25A 4DT7B 9ESTA 1A7SA 3SV9A 2ZKSA 1QL8A 2CV3A 2XW9A 4X1SU 2R2MB 3A83A 1C4U2 4NFEA 3H5CB 1MAYA 4F55A 2D8WA 1F0SA 3M36A 2ZC9H 1QB6A 8GCHF 3KQ5A 1S83A 3BTEE 2A2XH 5C1UA 1ANEA 4F48B 1GHZA 1DX5M 1C5VA 1KLIH 1TIOA 1EKBB 2AH4X 2WSSD 4TY7A 2HWLB 2FS9A 4JZIA 1NRNH 4ZMAH 3ZVBA 5FX5A 1YY3A 5C2ZA 2QAAA 4GHQA 2ZP0H 4ABEA 5F8TA 2ZGXH 1GDQA 3RXEA 1JMOH 2WUCA 4RI0A 4UFGH 2BLOA 3S69A 3VXEH 3T62A 1P06A 1GBFA 2RDLA 3MU0A 2Y5FA 4GLYA 1Y3XA 3RC5A 2Y7ZA 1IOEA 1HLTH 5I25A 2BDYA 3RXLA 3KHVA 1H8IH 3ATIA 2OD3B 4X8SH 3L6PA 1AZZA 1P2IA 3RXIA 4JYUH 3M7TA 5GWZA 1SC8U 1VITH 4TSFD 2DE8A 3RU4E 5J4SA 1BCUH 4ZUHA 1C2LA 2XXLA 1FN6A 1QHRB 1O3AA 4ISOA 1V3XA 1A3BH 1GBMA 1LPGB 3EGKH 4FXGH 2CHAC 1GJ8B 4YOGA 4HTCH 4O3TA 4ZKRU 1Z6JH 1Y3VA 2JH6D 1GI9B 3EE7A 2PSYA 5LPEA 1SFQB 4UONA 2R9PA 2V35A 1CA0B 2FEQH 2ZU4A 3H7TA 3A87A 4IGDA 1AWHB 1GVKB 3SU4A 3SYJA 1N8OC 5JBTA 4CHAC 1D4PB 3LJOA 4X2XA 2A2QH 2PUXB 3FN8A 1LPKB 3M7QA 2K8IA 4X1PU 3P92A 4AB8A 1QZ8A 2YMSB 1VZQH 1YPHC 2OBQA 1EAUA 1PQ8A 1FIWA 2FXRA 5C1YA 1W14U 1IQEA 2IN2A 1V2PT 1TPSA 4BXWA 2FDAA 1OKXA 2PKSC 4JYTA 5GDSH 5A8ZA 1W0KD 1RXPA 1T8NA 1LDTT 5E8EH 1KSNA 4CRBA 2P16A 3B23B 3VFEA 3GISB 1HFDA 5IDKA 1QA7A 2FYQA 2CF9H 1D3TB 1Z8GA 2LP6A 3MH6A 4NIVA 2ZGCA 3EDXB 1M9UA 3U9AH 2P3UB 4NA8A 1IQLA 1C2DA 5F6MA 2BOHB 4HFPB 4AFSA 2A5IA 5LPRA 4YZUA 2FOGA 2C3SA 3RLWH 4ZHAA 3ZZBA 2PFEA 3FO8D 3LH1A 4A1TA 4Y76A 2KAIB 1O5FH 3ODFA 6GCHF 4Y11E 4DIIH 4LZ4B 2L6OA 1MTNC 2L74A 4D7FA 4AFQA 3BTME 1FZZA 3G01A 3UNQA 3UQOA 3ATWA 3E1XB 1NBMD 1OHHD 2J4IA 3A82A 2GV7A 4DG4A 4CBOA 3ZVEA 2ZU2A 2AIQA 1BT7A 1HCGA 1J17T 3BTFE 2Y80A 4AGJA 2OC7A 1ELEE 1LPZB 2LNCA 3SW2B 2J9NA 4D8NA 1BZXE 1F92A 4D9QA 4ISHH 4K69A 4IC6A 5GXPA 4PROA 1BRCE 4Q4LA 1HPGA 1VCQA 2PGQB 2ZDVH 2ZHQH 2D26C 3PWBA 3LGVA 3GCTG 2ZDLA 2FOHA 2QIQA 2ZHFH 1YF4A 6LPRA 1HDTH 1QRZA 1CT2E 1ZLRA 4B6FA 3SORA 3QDZB 1O2MA 1EOLA 1H9LB 2BDIA 4SGAE 1UMAH 2OINA 4AYYB 1IQIA 3SJKA 4I32A 1ABJH 3TH2H 2AFQB 1EPTB 2KAIA 4KP0A 1ESBA 2P8OC 1QR3E 3M5OA 2QXIA 1KXEA 2B0FA 1MUEB 2ESTE 1EASA 2UUKB 1ETTH 4GPGA 4OS6A 3DFJA 5FHTA 2Y7XA 2BD8A 2AMDA 5JBCS 1AVXA 4AG2A 1YKTA 5A0CA 3LDXH 2AYWA 1BIOA 2KZ4A 3MNCA 3O8BA 1BOQA 1HYLA 3BG8A 3QZRA 5PTPA 4BAMB 2WPKS 4Y10E 2VH0A 2BDCA 1W12U 5JYIA 1W0YH 3ENSB 1P2MA 3STJA 1HGTH 1BRBE 2VIVA 5E0GA 4AZ2B 2SGPE 2PGBB 2Z94A 3S9AA 1G9IE 5DN6D 4X8UH 3SJOA 1TPPA 1E38B 1SQOA 1IHSH 5ESBA 1AY6H 2V3HH 3GDVA 1BTXA 1L1GA 1S82A 1UTNA 2F43B 2SNVA 1F5LA 3A7WA 1NFXA 4B73A 2GT8A 4IN2A 2UUYA 1FI8A 4GCHG 3LJJA 1NFWA 2FLBH 9LPRA 1OPHB 3MNBA 3P95A 2H6MA 5F8XA 3SHCH 1SL3A 5KGOA 2ZCLP 3K65B 1WBGB 1E1RD 1DUAA 1Z1IA 1EQ9A 4I86A 1XUFA 2RG3A 2UUJB 1RIWC 1S0QA 4OS1A 4IW4E 1EATA 1AVWA 1GMCF 1O38A 1K1JA 4B1TA 2AMQA 1O30A 1SLUB 1BTPA 2BD7A 1OWKA 3A80A 5FAHA 3VB3A 3P8NA 3ITIA 1SHHB 2H5DA 4VGCB 2FOAA 3SUFA 1GMDG 2SGQE 4DJZB 1PJPA 1V2WT 2A45B 3TJNA 1C5LH 2FM2A 1ZRKA 1QL9A 2EI7A 1G3EA 2JIZD 1RD3B 1O3NA 4SGBE 4I33A 2G55A 4FUEA 1P02A 4I8GA 3H7OA 1NS3A 1MKWK 3M37A 1C2GA 1C5OH 3BV9B 2XNDD 5HM2A 3SGBE 1YGCH 1UTJA 1C5PA 3P70B 4B2AA 2HRVA 1YLNA 2CK3D 3GY6A 4TYDA 5C3NA 1PPGE 1S84A 2C8WB 2H2ZA 2XC4A 2ULLA 1L4ZA 1A2CH 3PYHA 1NRRH 1BTYA 1O3FA 1AZ8A 2BQ7B 1W7XH 1MKWH 1KDQB 2ANKH 1GBHA 2ANWA 1ZTJA 1EZQA 1BUIA 1B5GH 1RRKA 4RKOB 1FY1A 3QN7A 2XTTB 4NSVA 1K21H 5GJ4B 2J2UA 3PLPA 2UUFB 3T2NA 3WY8A 1DFPA 2NU0E 3GDSA 4NWKA 1BQYA 1EAWA 2QY0B 4B76A 3FP8E 4RSPA 2ZFSA 2ZA5A 3HGNA 1GJ6A 1O2KA 1O35A 3TJVA 5AFZH 4MNWA 1BMAA 1C1TA 1WU1A 1MZDA 2OCVB 5C5NA 4CREA 1ELAA 7LPRA 2R3YA 4DVAU 4WMEA 4J1YA 3DFLA 3RXDA 1GI4A 4OGYA 2ZFQH 4YLQH 1KXCA 1UVOA 4M7GA 5T1VA 1MH0A 2XNIA 1CSOE 1UTLM 5ETXA 4HG6A 4B6EA 3N7EA 1DPOA 1FUJA 3MFJA 1DWDH 4X2WA 1SGFA 1GBDA 3A8DA 4WH6A 3PLKA 2JJ1D 2C93B 5C17A 4Y7AA 1FX0B 3R3GB 2GCTC 2STBE 1CO7E 1ZHMA 4K8YA 5CDFE 1O2RA 2XBWA 1FAXA 1VCWA 1OWIA 3UIRA 1TONA 2GDEH 3Q77A 3PTNA 4WXVA 3E3TA 3BG4C 2J97A 3BSQA 3HK3B 1ANDA 1EPTC 1HXEH 1WTHD 5EU8A 5HYOA 1VKYA 1QB1A 2PV9B 1BTZA 2AGGX 3RXRA 4OS2A 1MTUA 1SQAA 3MNXA 5FXLA 5GPIB 2BYAX 1C4V2 3F68H 1BTWA 2GMTB 3AVZA 5DPAA 1O34A 3NRLA 3K2UA 4ZROA 4IBLH 2QF4A 1K0HA 3SNBA 1T4VH 8ESTE 4MDSA 2XWBI 3ZZ3A 1W2KH 2ZDMA 3FANA 1RTLA 4NZLA 2PUQH 5BRRE 2VVUA 2EC9H 1P09A 2VNTA 3F9FA 3B8JA 1O3JA 1O32A 3PMHB 1Y3UA 1O0DH 1RTFB 1SGFG 2BZAA 2WPJS 1MMJN 4R0IA 3GICB 2A32A 1O2PA 1P57B 1DXWA 3UREA 1QQUA 3LU9B 4YOIA 3V7TA 2W5EA 2A1DB 1UO6A 1TGNA 2CHAB 2W6ID 2STAE 4WWYA 1ID5H 2VWOA 4JZDH 1INCA 1O2NA 1PPBH 3GCHB 1VGCC 2W7UA 4JK5A 1OS8A 1BHXF 1FDPA 1K22H 2A4QA 1NBME 4I8JA 3BIVH 1AHTH 1ANCA 1J14A 1N8OB 3UR9A 1KXAA 4CHAB 1Z1JA 2PTNA 5A2MH 3AW0A 4DY7B 3LGTA 4AB9A 3CNRA 3ZV9A 1ZPCA 2Y82A 3DSPA 1TABE 2H9HA 2G4TA 3DUXH 2WV9A 1C5ZB 3TGIE 1SQTA 1O3DA 1Y5BT 3BTTE 2PKSB 1NESE 2ZTYA 1CQQA 3K6YA 4ABDA 3JZ2B 4ZXYH 1Y5AT 1EP5A 3CS7A 1H1BA 3I29A 1ZSKA 2H1UA 3R0FA 1GGDB 5EQQA 1PPCE 1UHBA 4KKDA 3RM0H 3V13A 2R3UA 1V2RT 1ESTA 1T8LA 4BXSA 1P04A 1IHTH 2O8UA 1AIXH 1TGSZ 4ACAA 3GDUA 1UTOA 1JRSA 2SNWA 1LQEA 4UEHH 1O3PB 1TMBH 3PM3A 1QIXB 2ZGBH 3U1IB 1Y3YA 3DCLA 3GCOA 3V12A 1O2XA 1GL1A 1ARCA 1W13U 1KIGH 3HPTB 3RM2H 1O36A 2RDEA 2V7QD 4AOQA 3E8LA 4YTAA 2A7JA 3TK5A 1EFRD 1C2KA 1GPZA 1MBQA 1CE5A 1QBOA 3M3SA 3FVFB 1O3MA 1E35B 4H6TA 1AFEH 2A4RA 1FY5A 1A46H 4INHA 1TX6A 3ZVCA 2QXGA 2ZDKA 3A7YA 2ZGJA 3ZVDA 1O2ZA 1SGRE 1QJ1B 3PO1B 2A4OA 2OQ5A 4YOJA 4U30A 4NIWA 2RA0A 2FI3E 3QUMP 1O2HA 4FUBA 1T32A 1QQ4A 1WV7H 1NRSH 3P8GA 5HMAA 2AEIH 2HVXA 3TK6A 1E34B 1GHYH 3ELAH 1XUKA 3QWCH 3PRDA 4RT0A 1UCYH 1D9IA 1AB9B 2FX6A 2GJGA 4XBCA 1SGCA 4XDEA 4MNYA 5JBAS 1TNHA 2QF3A 3GS9A 4ABHA 2PTCE 1H8DH 1HIAB 1HRTH 1O37A 3UWIA 5C0TA 3B9FH 2HNTC 1V2KT 1RFNA 2VIOA 3O8RA 1O2GH 2F9NA 2V3MA 4P00A 2P8OB 2UWLA 1PYTC 4FU8A 4U32A 4K1EA 1G30B 1P2OA 1EZUC 1P9SA 2EY4C 1C9TA 1CHOF 1LO6A 1KLTA 3EA8A 3UPEA 5T6DA 1YC0A 4KGAA 4FETA 2AGEX 3EYDA 2Z3CA 1C5TA 2F3CE 3SU3A 2SGAA 3ATLA 4NSYA 2ZHEH 1BJUA 3VEQB 3VGCC 2KCAA 1THRH 4ABJA 3UTUH 2SGDE 2Z3EA 1EOJA 1GHBF 4K5ZA 1ELTA 1SGPE 4UD9H 2GMTC 3W1EA 2XWAA 4B74A 1W11U 2J5UA 1H9IE 1SSXA 2LPRA 1V2LT 1BMMH 1NFUA 3GYLB 3F6UH 2Z9LA 1Z6EA 4INKA 1L1JA 1O5EH 2C8YB 1A1RA 3AASA 4NWLA 3TU7H 4ABIA 3UFAA 3W95A 1JBUH 2BQ6B 5C94A 3SN8A 3L3TA 1OP0A 2G51A 1T8OA 2BD3A 1ZGIA 2BLWA 1GHAF 5DJ7A 4GSOA 5EPYA 3E16B 1LQDB 1SPJA 3RXMA 2W6JD 1ELDE 1XUHA 4YESB 1LHDH 1HIAA 2HLDD 1E0FD 2ZTXA 2H5CA 3T29A 3A8BA 1ZTKA 2ANMH 4MNXA 4OGXA 3GCHC 3QTVH 4K2YA 3EA7A 1GI5A 1HJ9A 3LPRA 4YM9A 3MTYA 5EXMA 4FU9A 2KM0A 1D3QB 2M5TA 4A1XA 3PROA 3QK1A 2F9PA 5DP3A 1RIWB 4B71A 1MKXK 1EUFA 3V0XA 3TVJB 3EE0B 4U01A 1XXDA 1BBRK 3FZDA 5EXNA 1LMWB 3RMLH 2J94A 5EW1H 2JH0D 4CR9A 4ZHLU 4NA7A 1XKBC 2W26A 4FUHA 3SNEA 1ACBE 1VITF 2VH6A 1K28D 1MKXH 1ETRH 4UFFH 2ILNA 1AUTC 5EXLA 3C27B 4X1RU 1BMLA 1GJCB 4I7YH 4FVDA 1BBRH 2THFB 2OP9A 1SBWA 1HAXB 2PW8H 2OQUA 4BNRA 4DOQA 1GGDC 2F91A 2G5NA 2OUAA 1T7CA 1S6LA 3DSGA 4YXWD 5KECA 3SZNA 1AQ7A 3ATKA 5HM9A 1MAXA 1P2KA 1O39A 1TAWA 3MH5A 1C1MA 1Z7KA 3A89A 1C2MA 3PV4A 1H4WA 4IN1A 2ZF0H 2A4GA 3F2GA 1ZZZA 2Z9GA 1QFKH 4UFDH 5K0HA 3OEED 1GWAA 4AFZA 2HPPH 2P94A 1J9CH 3KIDU 1HAIH 3TPIZ 3LGUA 1LHGH 1SLXB 1XVMA 3RXUA 1XMNB 3FFGA 1OX1A 4FVBA 3SOSA 1NC6A 1O2VA 1OP8A 1P12E 1GCDA 4ISLA 3RC4A 3KL6A 1AGJA 1K2I1 2R2WU 1YLCA 5KEDA 2OLGA 2WPHS 4XBDA 4CRDA 3RC6A 1L0ZA 8GCHG 2BOKA 1FPHH 1ZR0A 4O9VA 4UDWH 1UVPA 1C5RA 1MZAA 2ZEBA 1MQ5A 2FS8A 3PO1C 2ZZUH 2TGAA 3BEFB 1T31A 1O2QA 3STIA 3VB5A 4UE7H 4LZ1H 3SU6A 3F2FA 2VGCC 1L2EA 2ZIQH 4O3UA 4JZEH 3UY9A 3TNTA 3RXTA 5B6OA 3BN9A 3SHAH 1K1MA 1SG8B 1XM1A 2QGRA 2VWMA 1AB9C 1AWFH 4YLUA 1NROH 2VVCA 4H4FA 5DK1A 3H09A 3T27A 3RU4T 1UVTH 2GCTB 1FONA 1MCTA 1WYKA 3N7DA 1AFQB 1V2ST 1YPKH 3D49H 1O5GH 3UNRA 2Y5HA 3SUEA 2TBSA 5EJ1A 1C1PA 1DWCH 1TB6H 1W0JD 2GP9B 5DG6A 1ELCA 1TBZH 3BG4B 1LHFH 2ZFPH 4A5TS 1GI7B 2VU8E 3BEUA 4FU7A 1ZJDA 2GZ7A 5AFYH 4K60A 2CXVA 4DT4A 1A0JA 1ELGA 2ZFRH 3U28C 2I6SA 1EJMA 1P8VC 1WOFA 2O9QA 1OXGA 3SGQE 1BTHH 3TGJE 1TA2A 4AYVB 1AN1E 5FX6A 4RN6A 4KTSA 3A7TA 3PWCA 1TPOA 2ASUB 3N7OA 2XC5A 2FO9A 4BAHB 2ZFFH 3LGIA 1UW7A 2R0LA 4F49A 1Q31A 1V2OT 1VCPA 1NY22 1TMTH 1O3OA 1FAKH 3ZYDA 1YM0A 2XYAA 4K3JA 1QBNA 4MLFB 5ABWA 1Y5UT 1RS0A 2CJIA 3GY4A 2XCFA 4ABBA 1OOKB 4K1TA 1ZGVA 1GMHF 1VGCB 1VJ9U 5AVDA 4OM9A 1DWEH 2Q6GA 3DHKH 2ALPA 1HAGE 2NU3E 2Z3DA 4JCNA 3SU5A 3TH3H 3E6PH 3UB0A 4X2VA 3Q76A 2BVRH 1XUGA 1KMHB 1C1OA 1HXFH 4AC9A 1Z8JB 3MH7A 2TRMA 5EPNA 1UTMA 3F0PA 1GBAA 1C1RA 6GCHG 1O2UA 5IK2D 2FLRH 3M5LA 2ZHWH 1BA8B 2Q6FA 1H8ED 1X7AC 1EZSC 4WXIA 5JDUB 1KTTB 3RXGA 3S9BA 1ARBA 3FOAA 3SI3H 2P3TB 1KYNA 1JIMA 1O3HA 4Q7XA 2KCYA 2P3FH 1V2NT 2GV6A 1HAVB 4I8LA 3M61U 1C5MD 3QGNB 1C1VH 2JDID 4BTIB 4O97A 1C2EA 1OWJA 2BD5A 3A88A 1IAUA 1HAYB 1G36A 1LVBA 5J4QA 2OBOA 2CGAA 1DICA 1TA6A 3TGKE 2BM2A 1Q3XA 1NTPA 1EJNA 5CHAC 4NZQA 2QXJA 4ZCNA 2WPDD 1T8MA 7ESTE 1LHEH 1QB9A 5FPYA 1UVSH 1V2JT 3TH4H 4ABAA 2HPQH 3GY8A 1TBQH 3WWBA 2I6QA 1TLDA 2GZ8A 1C2JA 2JJ2D 4ZHMU 4TPIZ 1OP2A 1K1NA 1ZOMA 2ANYA 2TGTA 1C1NA 1DY9A 4A6LA 3RU4D 4U2WA 1HB0B 1QL7A 1O31A 2GDDA 1S6HA 4Y7BA 3SI4H 1IQJA 3SU2A 4Z6AH 1G2LA 2FI5E 1HUTH 2ZDAH 1GJ9B 1TBRH 4Y0YE 1LVYA 1WAYB 1HAVA 2QA9E 3RXSA 1FXYA 1TALA 4BOHA 1TMUH 1C5SA 3OEHD 1YPJH 4BANB 1TRMA 4WF8A 1OWHA 3F2HA 2AERH 3OYPA 5A8YA 1F5KU 3U8RH 1JIRA 1Z71A 2GVFA 2OC1A 3NK8A 4I8KA 2Q1JA 2Q6DA 1TNKA 4X2YA 2WUBA 1MU6B 1K1LA 1AFQC 1O2OA 3EQ0H 3SJIA 1ZTLA 1JXPA 1IQNA 3MHWU 1DXPA 2ZPSA 2ZQ2A 3NUMA 2FPZA 3UUZA 1NU9A 1U6QA 2HOBA 1Y8TA 1CHGA 5E2PA 1EAIA 2HNTF 3IITA 1F0UA 1O3EA 1C5YB 2GX4A 1GJ7B 1VR1H 1KLJH 3DT0H 2OC8A 3BIUH 5JB9S 5JB8S 1GBLA 5ESTE 3AK5A 1S85A 3VGCB 2KFWA 2FP7B 3GOVB 1FY8E 1V2UT 1YWUA 5DP8A 3A7VA 1A0LA 3I78A 3FKSD 2NU4E 1GMCG 5EQRA 3URDA 2GT7A 4Q7ZA 1DM4B 3C1KA 2C8ZB 3LH3A 2G5VA 4J2YB 4P02A 4X1NU 1NRPH 4THNH 2FIRH 1CBWB 4MPXA 3PB1E 2R0KA 3NKKA 4ISIH 4DGJA 3KQDA 1GCTC 5GCHF 2W7SA 1MD7A 4H6SB 2J95A 3UWJH 2W3KA 3Q3YA 2FTMA 4TY6A 4ZKSU 3U69H 2VBCA 3KQCA 1UHBB 1EB1H 3SQEE 2QYIA 1SLWB 3SNAA 2BY7X 1YBWA 1ANBA 1P0SH 1QNJA 2ZFTA 2F9OA 1W0ZU 3AW1A 2EI8A 1C5XB 1AVGH 4X6MA 4CH8B 1DLEA 2BY5X 4MTBA 4ABGA 4Y8ZA 1FV9A 4CR5A 1THPB 1S0RA 1ORFA 1BRAA 1DLKB 1Q2WA 5IYTA 3ZZDA 5CE1A 1P3EA 1TGCA 3ZZAA 1RGQA 5L30H 2VB0A 1SGYE 3RP2A 3BTHE 5TCCA 1PPHE 1HV7A 2VWNA 3SJ8A 3M5MA 2PHBA 2BLQA 3KYFA 1CGJE 2BX4A 3KGPA 2HALA 1HJAC 3A85A 3RXPA 3HKJB 1GI2A 1ZJKA 3MNSA 2IJOB 4YO9A 1OSSA 1MQ6A 1GL0E 1GI8B 3VB7A 5EJLA 1ZMNA 3PMAB 1NPMA 1O3KA 4NCYA 1ELVA 2F4LA 3Q3XA 3LGWA 4ZXXH 1SR5C 3ZZ5A 1O2TA 4FUDA 3M5NA 1O5AB 2BD9A 1WQVH 4HZHA 1JWTA 3OY6U 1GJDB 4JMYA 4Y6DA 3P6ZB 2TGDA 3FAOA 2VIQA 2J98A 1UTPA 3LOXA 1SI5H 1TRNA 1O5CB 1SGDE 5I46H 2PP6A 1CGIE 5EIYA 4HGCA 2PKAA 1V2TT 2XBXA 1PPFE 2B5TB 2GKVE 2HVYB 3M3TA 1P2JA 3RXKA 2XRCA 5GIBA 1GBKA 1L1NA 3KCGH 4D9RA 4NIXA 2Y6TA 2JETB 3NXPA 1WCZA 1QCPA 5T6FA 3M35A 1J8AA 1LTOA 4DIHH 3TITA 3SGAE 1GVLA 1TFXA 2ZDNA 3KF2A 1YPLH 2FOFA 2PSXA 1H8HD 1H9HE 2SFAA 3KQEA 3UR6A 2GD4B 3GYMA 3BTQE 1PQ7A 2AIPA 4BAQB 1DSUA 4KELA 1FMGA 3Q00A 4R8TB 4XBBA 2F83A 4XSKU 3RMOH 3DD2H 2VWLA 2O8TA 3MOCA 1N6YA 3S7KB 1K1PA 1PQ5A 1TNGA 3OY5U 2WINI 2AHME 2VGCB 4MVNA 5F03A 1G37A 3MWIU 5A0AE 1YCPK 3BTKE 1O3BA 1ELFA 2V3OH 5JPMH 1OYQA 1DOJA 4JZ1A 1C1SA 1TGBA 2BX3A 4OS7A 1EX3A 3U1JB 5A0BA 1BTUA 1F7ZA 1YCPM 1TX8A 2DE9A 2A5AA 5EJZA 1GJAB 3PTBA 1THSH 3S7HB 1TQ7B 3LC3A 4XRNA 1GBBA 1SGEE 1UK3A 5L2ZH 2ZQ1A 2HNTE 1C1UH 2YOLA 4WH8A 1CGHA 3RDZA 4XFQA 2QF0A 3A81A 1BRUP 3RMNH 1SMFE 3SZEA 3NWUA 2UWPA 2WYJA 2B8OH 1C1WH 3F1SB 1FY3A 2G81E 5CHBA 3MU4A 4FUCA 3A8CA 4A7IB 1CBWC 4TT3D 4D7GA 1QJ7B 4AG1A 1CU1A 4Y71A 3OFND 3T26A 3E90B 2VIWA 3ZZCA 1G2MA 1GHXH 3MO6A 1ABIH 4ESTE 2EI6A 5F53A 5T6GA 1HAOH 3OAAD 4B2CA 5F8ZA 2C4FH 2OTVA 1O3IA 5EQSA 5DP4A 1A5IA 2ZECA 1SGTA 4WJG2 4OS4A 5GNDA 3IWMA 3UOPA 1N1LA 1SGIB 2TPIZ 5T3HA 3GCTF 4CRGA 4Z0KA 2BVSH 2EA3A 1JOUB 2W3IA 4Q7YA 3KNXA 5FPTA 4ASUD 2RFKC 1D3DB 1C5NH 1ZHRA 3ATMA 4HI3A 2QE7D 4K8BA 1A4WH 1TYNA 2ZG0H 6ESTA 4CRCA 1AO5A 2BDGA 3ZVFA 1DS2E 4E05H 2BB4A 1SLVB 2ODPA 2QC2A 1Z8RA 5L6NH 5E0JA 1EP6A 2FOCA 1SQRA 1ZPBA 2FESH 2KR7A 3GY7A 3RXHA 1AKSB 1W10U 6CHAC 3SV6A 3A8AA 1GVZA 2ZTZA 4IC5A 4KTCA 1EB2A 1ZMLA 2GCHF 1FIZA 3KQBA 3SV7A 1PFXC 4GUXA 4B2BA 2K0QA 1SOTA 1P9UA 3RXQA 1YPHE 1MCVA 3RLYH 3SJ9A 1DWBH 1Z8IB 4INLA 4FUFA 3M3VA 1K1IA 1SFIA 2UWOA 7KMEH 3ZZ4A 2Y5GA 4NGAH 2FWWA 3WWFA 4CBNA 1QRXA 2QXHA 1IQMA 1A5GH 1BMFD 5LPFA 4BAOB 1AE5A 3SV8A 4NG9H 2Z9IA 1KXBA 5CHAB 2FTLE 3UNSA 1QURH 2WPIS 5A09A 3LC5A 3URCA 2H9TH 2FODA 2OK5A 2GTBA 1FPCH 2GGVB 3QX5H 1C2HA 1E79D 1V2MT 2JETC 4NIYA 5EGMA 4OS5A 2WV4A 1MBMA 2FYRA 4GCHF 4ZKNU 2FOMB 4GAWA 3TLOA 3IG6B 2CMYA 1GI0A 1O5BB 2HLCA 1MD8A 3QTOH 1CHOG 1P2NA 3MU5A 3RXFA 4E06H 5TCAA 4JK6A 1C2IA 5LGOA 4TWWA 1AKSA 4Q80A 4AORA 3QLPH 4BAKB 3F3BA 1G32B 3N99A 3TNSA 3BEIB 4MQAA 2AS9A 1GHBG 1PPEE 4X1QU 5C5OA 2ZGHA 1HAZB 1FY4A 3AAVA 1AI8H 1YYY1 2BD2A 3MYWA 2P59A 3GY3A 1W8BH 2KCPA 5JBBS 1G3DA 4IMZA 4YT7H 1GMDF 5FCKA 1N6XA 1XXFA 1BITA 1HAHH 1DITH 3P17H 3PMJA 2KX4A 2O8LA 4FUGA 1FN8A 4WY3A 3VG8A 4M9FA 3V3MA 1BDAA 4RT1A 1GHAG 1MTSA 3SNDA 1ZHPA 2FX4A 3FP7E 4DCDA 5DP7A 4ABFA 3A84A 1TPAE 2BDAA 1PQAA 3SQHE 1XX9A 1GBCA 2A5KA 2CF8H 2FOBA 3PMBB 5EG4A 2BXUH 2H9EH 4A92A 1HNEE 2J38A 3OTPA 1XKAC 2BLVA 2Y81A 5C20A 4GHTA 3GY5A 2FMJA 2QF5A 2ZI2H 2XC0A 1C5UA 1ZSJA 5K7RA 1O5DH 1Y59T 2A7HA 3CENA 3FP6E 2JKHA 1FQ3A 5EOKA 3HATH 2F9UA 3SNCA 4MPVA 4GVUA 1UCYE 4X0WU 3MMGA 2WHXA 1IQFA 2B9LA 1K1OA 4X6PA 3A7ZA 3TJOA 1GCTB 4Z1MD 2GCHG 1NM6A 2GZ9A 3F9EA 1OYTH 1VITG 1Y3WA 2BHGA 3MH4A 1F0RA 2NU1E 5DP6A 3SO3A 1GI3A 4DURA 1F2SE 1LKBA 4Y79A 3S0NA 3SUDA 1EJAA 3SBKA 2J34A 2WZQA 3MU1A 5EODA 1SGNE 1NFYA 5C67A 1O2WA 1OWEA 1V2VT 3K6ZA 1G3BA 2EQNA 2XBVA 5FBIA 4E7NA 1AMHA 2HGTH 2YNAA 4CRAA 2PLXA 4LXBH 3ZV8A 1UTKA 1ETSH 2ZU5A 1W3CA 2OXSA 3U8TH 2ZWLH 1O2YA 3P8FA 3E0PB 4AGKA 1LHCH 5CMXH 1UJ1A 4MPWA 1HJAB 2TIOA 2NU2E 5HGGA 4I8HA 4AX9H 3ZZ7A 5LH8A 2SGEE 1YPEH 3Q3KA 2VIPA 3GY2A 5HXFA 3K9XB 1ZSLA 1PYTD 3O8DA 1GJ4H 1QA0A 1GJBB 1SOZA 1EPTA 1TNIA 4E7RG 2OC0A 5DP5A 3F9GA 1D6RA 3BF6H 1P03A 3GCNA 1CA0C 3VPKA 1DT2A 1J16A 3LT3A 5DO4H 4Y0ZE 3QO6A 1C2FA 3W94A 1SB1H 5HIYA 2ZCKP 1S6FA 3SUGA 3MU8A 4ACBA 4XD7D 3OU0A 2VJ1A 1LVMA 1TQ0B 2ZCHP 2YMSC 5H4IB 1V6DA 1TE0A 1SGQE 2VIDA 2ZU3A 1SKYE 1A3EH 1BB0B 3CP7A 2BMGB 3MO3A 3E91A 4ZKOU 5TJXA 1DDJA 1WXRA 1A0HB 1TGTA 1WQSA 2V6NA 1GI1A 1MU8B 3U98H 3D23A 1PPZA 5SGAE 1FLEE 1L4DA 1P11E 5C0UA 1J15A 3TK9A 3U8OH 5HKKD 1HJ8A 4WMFA 1BBRE 3EA9A 2ODQA 4WVPE 3UQVA 2BTCE 1IQHA 1KTSB 2WYGA 3MQKC 1KY9A 4AN7A 3PV2A 4ASHA 1B0FA 1NU7B
chains in the Genus database with same CATH topology
4I33A 3F0PA 5EPNA 5FL7D 1E79D 2WZQA 5EPYA 3SZEA 3NRLA 3SU4A 3M5LA 5IK2D 2OINA 1EFRD 1JXPA 1COWD 1NS3A 2W6JD 2QF4A 3F2FA 1DXPA 3FN8A 3LONA 3SU6A 3LOXA 4I32A 3SU1A 3ZIAD 3KN2A 1H8ED 2HLDD 2FOMB 2K8IA 2QV1A 2XNDD 5CHBA 3KEEA 3SU0A 3M5OA 2KCOA 2XOKD 2YMSB 4TT3D 2CK3D 2OBQA 1RTLA 1CU1A 2A4RA 2YMSD 3OFND 4TYDA 5FPSA 3E90B 3LKWA 3DSOA 3FOAA 2OC8A 2KM0A 1W3CA 1W0KD 4A1XA 3F3BA 3H09A 3AK5A 2KCYA 2FP7B 2KFWA 3N99A 5F53A 2KZ4A 3OAAD 3SV9A 2XCNA 4B71A 3O8BA 3N7DA 3FKSD 5EQRA 5IDKA 3OE7D 2JDID 3SUEA 2K1QA 5EQSA 4U01A 4F55A 1DXWA 1W0JD 5GJ4B 5GNDA 2P59A 2W6ID 4Q63A 1N1LA 2KCPA 2OBOA 3PRDA 3KF2A 3O8DA 4NWKA 5DN6D 1H8HD 4B76A 4DT4A 1E1QD 2OC0A 2A4QA 4ASUD 2WSSD 2VBCA 3KNXA 1DY8A 5ESBA 5FPTA 1NBME 3P8OA 2WPDD 3VG8A 5DSFA 4M9FA 2QE7D 4ZCNA 4K8BA 3GS9A 4R8TB 5B6LA 3FO8D 4A1TA 2F43B 5FPYA 4B75A 5C0TA 4B73A 3WWBA 2L6OA 2AHME 1S6LA 4RI0A 3PV5A 2JJ2D 3F0OA 4YXWD 1MABB 3O8RA 2KR7A 3SUGA 4XD7D 4A92A 3DSPA 1NBMD 1OHHD 2YMSC 5T1VA 2XNIA 3OTPA 3WW7A 3SV6A 5H4IB 2WV9A 3RC5A 5ETXA 1DY9A 2A4GA 3F2GA 1RGQA 3N7EA 4KTCA 4B6EA 2O8MA 1SKYE 3OEED 3SV7A 2V7QD 1BT7A 2K0QA 3O8CA 2QF5A 2IJD1 1E1RD 3EYDA 3L6PA 4FETA 4WH6A 2OC7A 3SU3A 2JJ1D 3M5MA 5C17A 2KCAA 1FX0B 2M2AA 1WXRA 5EQQA 2LELA 4TSFD 3U1JB 2F9UA 5CDFE 3SU2A 3W1EA 2F9VA 2WHXA 3RC4A 4B74A 3WWFA 2XCFA 2J5UA 3PRBA 5C0UA 2IJOB 1BMFD 3P8NA 4Q4LA 5HKKD 3RC6A 3SV8A 3OEHD 4Z1MD 4NWLA 3SUFA 1A1RA 4A1VA 4WF8A 4OM9A 2F4LA 2YOLA 3F2HA 4WH8A 3SU5A 3OYPA 3U1IB 2FM2A 3DCLA 4I31A 3UB0A 2GVFA 2OC1A 3SUDA 2OK5A 1KMHB 3M5NA 3PV2A 5GPIB 2JIZD 4B6FA 2GGVB 3SYJA 4JMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCP A;  2KCO A;  2KCY A; 
#chains in the Genus database with same CATH topology
 5FL7 D;  3F9H A;  1O3G A;  4D76 A;  1EZX C;  1QY6 A;  3ZIA D;  1YLD A;  4WMD A;  4FOU C;  4UFE H;  3SU1 A;  2D1J A;  3KN2 A;  3HKI B;  1HBT H;  2D2D A;  2QV1 A;  3VB4 A;  1MTV A;  4QT8 C;  1QJ6 B;  1C5Q A;  1TRY A;  1D3P B;  2IPQ X;  1O2S A;  1NT1 A;  5EW2 H;  1QTF A;  3LKW A;  1GG6 B;  1UK2 A;  2G8T A;  3SV2 H;  2C8X B;  2BD4 A;  4TWY A;  1A61 H;  1ZPZ A;  2Z7F E;  2BXT H;  3UAI C;  1B7X B;  4Y8Y A;  1WDI A;  4F4O C;  3OE7 D;  1EAX A;  2K1Q A;  4JYV H;  3ODD A;  4MPU A;  2SGF E;  3AAU A;  3NCL A;  2BY6 X;  1K9O E;  1E36 B;  2BY9 X;  1NO9 H;  2FI4 E;  4K1S A;  2WPL S;  5AF9 H;  1QRW A;  1GBJ A;  1GMH G;  8KME 2;  1TNL A;  1ESA A;  3I77 A;  1E1Q D;  1BJV A;  1LVO A;  1RTK A;  3JZ1 B;  1DY8 A;  5DSF A;  3RMM H;  1GHV H;  1GDU A;  5B6L A;  3D62 A;  5A8X A;  4BTT B;  2ZU1 A;  3ZZ9 A;  2F9B H;  4LK4 A;  3EAJ A;  3E0N B;  3OX7 U;  1KDQ A;  3HK6 B;  3ZVA A;  1AU8 A;  1MAB B;  3HGP A;  4XOJ A;  1C1Q A;  1AE8 H;  1GHW H;  2PWX A;  4IS5 A;  5FCR A;  1TWX B;  1TOM H;  1F5R A;  2TGP Z;  2EEK A;  4X6O A;  2B7D H;  1CT4 E;  1WSS H;  1XVO A;  1XUI A;  4ISN A;  2P93 A;  2J98 B;  2XBY A;  2ALV A;  7GCH F;  1FJS A;  2M2A A;  1NN6 A;  3MI4 A;  2RCE A;  2VVV A;  3RUO A;  1DUE A;  2LEL A;  1IQK A;  1C9P A;  1ZRB A;  1F0T A;  1O3L A;  3QGJ A;  1CVW H;  3A86 A;  2PKA B;  1NZQ H;  1EXF A;  1CA8 B;  3MO9 A;  5FBE A;  2VIN A;  4H42 U;  2WV5 A;  4A1V A;  4MG3 A;  1FNI A;  5AHG H;  2BVX H;  3T28 A;  3OSY A;  1DAN H;  1E37 B;  1TOC B;  2RA3 A;  4I31 A;  1O33 A;  1C4Y 2;  1NRQ H;  2IOT A;  2PR3 A;  4X8V H;  1WUN H;  5E2O A;  1G3C A;  2DUC A;  2FZZ A;  4XE4 A;  4KTU A;  1GBT A;  2J92 A;  4FUJ A;  2O8W A;  1KXF A;  4Y8X A;  2ZNK H;  1ZYO A;  3RXB A;  3T5F H;  1BHX B;  3TIU A;  3M7U A;  3LGY A;  4YT6 H;  3KEE A;  3SU0 A;  1MTW A;  2BDB A;  2CN0 H;  8LPR A;  6CHA B;  1W7G H;  1BMN H;  3ZYE A;  3BTW E;  3DSO A;  1D6W A;  2BDH A;  3RXC A;  1OWD A;  1ELB A;  1C5W B;  1P10 A;  1TNJ A;  2Z9J A;  5C1X A;  1GBI A;  1B0E A;  5HIZ A;  2BZ6 H;  3CS0 A;  4RKJ B;  4BTU B;  2XCN A;  2ZPQ A;  2A7C A;  4Q2K A;  1S81 A;  1P2Q A;  2Z9K A;  2ZO3 H;  3FZZ A;  4X6N A;  3ZZ8 A;  4NA9 H;  3RXA A;  4MNV A;  5DGJ A;  1KXD A;  4Q63 A;  3NZI A;  5G4B A;  2V0B A;  2JH5 D;  4VGC C;  2C90 B;  1O2L A;  4NFF A;  1RJX B;  4O03 A;  4AFU A;  1GI6 A;  1AD8 H;  5E0H A;  2WPM S;  1P3C A;  1ZMJ A;  1O2I A;  3OTJ E;  3D65 E;  3P8O A;  2P95 A;  1CT0 E;  1A5H A;  2G52 A;  1DE7 H;  5DP9 A;  5L2Y H;  3RXO A;  3S9C A;  1DVA H;  1YP9 A;  4B75 A;  4ZH8 A;  2G00 A;  3DA9 B;  3LIW A;  1UTQ A;  2BY8 X;  3A7X A;  2A31 A;  3L33 A;  4JZF H;  1IQG A;  1O3C A;  2Z6B D;  3F0O A;  3PV5 A;  3VB6 A;  4DW2 U;  2FOE A;  3KYG A;  4LOY H;  3ZZ6 A;  2G4U A;  1WTG H;  1V2Q T;  1P05 A;  3WW7 A;  1JRT A;  1QBV H;  2QN5 T;  2O8M A;  1S5S A;  1GDN A;  3TJU A;  3O8C A;  1UK4 A;  2IJD 1;  1AUJ A;  4FUI A;  1SVP A;  2ZPR A;  3BTG E;  1GBE A;  4TPY A;  4ZAE A;  5DKM A;  1MTN B;  2F9V A;  1SHY A;  1LCY A;  4CH2 B;  3PRB A;  1O2J A;  1HAP H;  1T4U H;  3RXJ A;  1QGF A;  3VXF H;  1DST A;  5GCH G;  2YNB A;  2ZHD A;  2AGI X;  4X8T H;  1GG6 C;  2AMP A;  2NWN A;  1UCY K;  3BTD E;  1YPG H;  1VJA U;  7GCH G;  1YPM H;  3UOU A;  1TX7 A;  4CRF A;  1GJ5 H;  1COW D;  1LKA A;  1YCP H;  5BPE A;  2BQW B;  3LON A;  2A0Q B;  2IPH A;  3PLB A;  1UVU H;  1XUJ A;  2KCO A;  2XOK D;  3ZVG A;  2YMS D;  5FPS A;  2QCY A;  3NPS A;  3EST A;  4IMQ A;  1P01 A;  2ODY B;  3QZQ A;  3RXV A;  3T25 A;  4DT7 B;  9EST A;  1A7S A;  3SV9 A;  2ZKS A;  1QL8 A;  2CV3 A;  2XW9 A;  4X1S U;  2R2M B;  3A83 A;  1C4U 2;  4NFE A;  3H5C B;  1MAY A;  4F55 A;  2D8W A;  1F0S A;  3M36 A;  2ZC9 H;  1QB6 A;  8GCH F;  3KQ5 A;  1S83 A;  3BTE E;  2A2X H;  5C1U A;  1ANE A;  4F48 B;  1GHZ A;  1DX5 M;  1C5V A;  1KLI H;  1TIO A;  1EKB B;  2AH4 X;  2WSS D;  4TY7 A;  2HWL B;  2FS9 A;  4JZI A;  1NRN H;  4ZMA H;  3ZVB A;  5FX5 A;  1YY3 A;  5C2Z A;  2QAA A;  4GHQ A;  2ZP0 H;  4ABE A;  5F8T A;  2ZGX H;  1GDQ A;  3RXE A;  1JMO H;  2WUC A;  4RI0 A;  4UFG H;  2BLO A;  3S69 A;  3VXE H;  3T62 A;  1P06 A;  1GBF A;  2RDL A;  3MU0 A;  2Y5F A;  4GLY A;  1Y3X A;  3RC5 A;  2Y7Z A;  1IOE A;  1HLT H;  5I25 A;  2BDY A;  3RXL A;  3KHV A;  1H8I H;  3ATI A;  2OD3 B;  4X8S H;  3L6P A;  1AZZ A;  1P2I A;  3RXI A;  4JYU H;  3M7T A;  5GWZ A;  1SC8 U;  1VIT H;  4TSF D;  2DE8 A;  3RU4 E;  5J4S A;  1BCU H;  4ZUH A;  1C2L A;  2XXL A;  1FN6 A;  1QHR B;  1O3A A;  4ISO A;  1V3X A;  1A3B H;  1GBM A;  1LPG B;  3EGK H;  4FXG H;  2CHA C;  1GJ8 B;  4YOG A;  4HTC H;  4O3T A;  4ZKR U;  1Z6J H;  1Y3V A;  2JH6 D;  1GI9 B;  3EE7 A;  2PSY A;  5LPE A;  1SFQ B;  4UON A;  2R9P A;  2V35 A;  1CA0 B;  2FEQ H;  2ZU4 A;  3H7T A;  3A87 A;  4IGD A;  1AWH B;  1GVK B;  3SU4 A;  3SYJ A;  1N8O C;  5JBT A;  4CHA C;  1D4P B;  3LJO A;  4X2X A;  2A2Q H;  2PUX B;  3FN8 A;  1LPK B;  3M7Q A;  2K8I A;  4X1P U;  3P92 A;  4AB8 A;  1QZ8 A;  2YMS B;  1VZQ H;  1YPH C;  2OBQ A;  1EAU A;  1PQ8 A;  1FIW A;  2FXR A;  5C1Y A;  1W14 U;  1IQE A;  2IN2 A;  1V2P T;  1TPS A;  4BXW A;  2FDA A;  1OKX A;  2PKS C;  4JYT A;  5GDS H;  5A8Z A;  1W0K D;  1RXP A;  1T8N A;  1LDT T;  5E8E H;  1KSN A;  4CRB A;  2P16 A;  3B23 B;  3VFE A;  3GIS B;  1HFD A;  5IDK A;  1QA7 A;  2FYQ A;  2CF9 H;  1D3T B;  1Z8G A;  2LP6 A;  3MH6 A;  4NIV A;  2ZGC A;  3EDX B;  1M9U A;  3U9A H;  2P3U B;  4NA8 A;  1IQL A;  1C2D A;  5F6M A;  2BOH B;  4HFP B;  4AFS A;  2A5I A;  5LPR A;  4YZU A;  2FOG A;  2C3S A;  3RLW H;  4ZHA A;  3ZZB A;  2PFE A;  3FO8 D;  3LH1 A;  4A1T A;  4Y76 A;  2KAI B;  1O5F H;  3ODF A;  6GCH F;  4Y11 E;  4DII H;  4LZ4 B;  2L6O A;  1MTN C;  2L74 A;  4D7F A;  4AFQ A;  3BTM E;  1FZZ A;  3G01 A;  3UNQ A;  3UQO A;  3ATW A;  3E1X B;  1NBM D;  1OHH D;  2J4I A;  3A82 A;  2GV7 A;  4DG4 A;  4CBO A;  3ZVE A;  2ZU2 A;  2AIQ A;  1BT7 A;  1HCG A;  1J17 T;  3BTF E;  2Y80 A;  4AGJ A;  2OC7 A;  1ELE E;  1LPZ B;  2LNC A;  3SW2 B;  2J9N A;  4D8N A;  1BZX E;  1F92 A;  4D9Q A;  4ISH H;  4K69 A;  4IC6 A;  5GXP A;  4PRO A;  1BRC E;  4Q4L A;  1HPG A;  1VCQ A;  2PGQ B;  2ZDV H;  2ZHQ H;  2D26 C;  3PWB A;  3LGV A;  3GCT G;  2ZDL A;  2FOH A;  2QIQ A;  2ZHF H;  1YF4 A;  6LPR A;  1HDT H;  1QRZ A;  1CT2 E;  1ZLR A;  4B6F A;  3SOR A;  3QDZ B;  1O2M A;  1EOL A;  1H9L B;  2BDI A;  4SGA E;  1UMA H;  2OIN A;  4AYY B;  1IQI A;  3SJK A;  4I32 A;  1ABJ H;  3TH2 H;  2AFQ B;  1EPT B;  2KAI A;  4KP0 A;  1ESB A;  2P8O C;  1QR3 E;  3M5O A;  2QXI A;  1KXE A;  2B0F A;  1MUE B;  2EST E;  1EAS A;  2UUK B;  1ETT H;  4GPG A;  4OS6 A;  3DFJ A;  5FHT A;  2Y7X A;  2BD8 A;  2AMD A;  5JBC S;  1AVX A;  4AG2 A;  1YKT A;  5A0C A;  3LDX H;  2AYW A;  1BIO A;  2KZ4 A;  3MNC A;  3O8B A;  1BOQ A;  1HYL A;  3BG8 A;  3QZR A;  5PTP A;  4BAM B;  2WPK S;  4Y10 E;  2VH0 A;  2BDC A;  1W12 U;  5JYI A;  1W0Y H;  3ENS B;  1P2M A;  3STJ A;  1HGT H;  1BRB E;  2VIV A;  5E0G A;  4AZ2 B;  2SGP E;  2PGB B;  2Z94 A;  3S9A A;  1G9I E;  5DN6 D;  4X8U H;  3SJO A;  1TPP A;  1E38 B;  1SQO A;  1IHS H;  5ESB A;  1AY6 H;  2V3H H;  3GDV A;  1BTX A;  1L1G A;  1S82 A;  1UTN A;  2F43 B;  2SNV A;  1F5L A;  3A7W A;  1NFX A;  4B73 A;  2GT8 A;  4IN2 A;  2UUY A;  1FI8 A;  4GCH G;  3LJJ A;  1NFW A;  2FLB H;  9LPR A;  1OPH B;  3MNB A;  3P95 A;  2H6M A;  5F8X A;  3SHC H;  1SL3 A;  5KGO A;  2ZCL P;  3K65 B;  1WBG B;  1E1R D;  1DUA A;  1Z1I A;  1EQ9 A;  4I86 A;  1XUF A;  2RG3 A;  2UUJ B;  1RIW C;  1S0Q A;  4OS1 A;  4IW4 E;  1EAT A;  1AVW A;  1GMC F;  1O38 A;  1K1J A;  4B1T A;  2AMQ A;  1O30 A;  1SLU B;  1BTP A;  2BD7 A;  1OWK A;  3A80 A;  5FAH A;  3VB3 A;  3P8N A;  3ITI A;  1SHH B;  2H5D A;  4VGC B;  2FOA A;  3SUF A;  1GMD G;  2SGQ E;  4DJZ B;  1PJP A;  1V2W T;  2A45 B;  3TJN A;  1C5L H;  2FM2 A;  1ZRK A;  1QL9 A;  2EI7 A;  1G3E A;  2JIZ D;  1RD3 B;  1O3N A;  4SGB E;  4I33 A;  2G55 A;  4FUE A;  1P02 A;  4I8G A;  3H7O A;  1NS3 A;  1MKW K;  3M37 A;  1C2G A;  1C5O H;  3BV9 B;  2XND D;  5HM2 A;  3SGB E;  1YGC H;  1UTJ A;  1C5P A;  3P70 B;  4B2A A;  2HRV A;  1YLN A;  2CK3 D;  3GY6 A;  4TYD A;  5C3N A;  1PPG E;  1S84 A;  2C8W B;  2H2Z A;  2XC4 A;  2ULL A;  1L4Z A;  1A2C H;  3PYH A;  1NRR H;  1BTY A;  1O3F A;  1AZ8 A;  2BQ7 B;  1W7X H;  1MKW H;  1KDQ B;  2ANK H;  1GBH A;  2ANW A;  1ZTJ A;  1EZQ A;  1BUI A;  1B5G H;  1RRK A;  4RKO B;  1FY1 A;  3QN7 A;  2XTT B;  4NSV A;  1K21 H;  5GJ4 B;  2J2U A;  3PLP A;  2UUF B;  3T2N A;  3WY8 A;  1DFP A;  2NU0 E;  3GDS A;  4NWK A;  1BQY A;  1EAW A;  2QY0 B;  4B76 A;  3FP8 E;  4RSP A;  2ZFS A;  2ZA5 A;  3HGN A;  1GJ6 A;  1O2K A;  1O35 A;  3TJV A;  5AFZ H;  4MNW A;  1BMA A;  1C1T A;  1WU1 A;  1MZD A;  2OCV B;  5C5N A;  4CRE A;  1ELA A;  7LPR A;  2R3Y A;  4DVA U;  4WME A;  4J1Y A;  3DFL A;  3RXD A;  1GI4 A;  4OGY A;  2ZFQ H;  4YLQ H;  1KXC A;  1UVO A;  4M7G A;  5T1V A;  1MH0 A;  2XNI A;  1CSO E;  1UTL M;  5ETX A;  4HG6 A;  4B6E A;  3N7E A;  1DPO A;  1FUJ A;  3MFJ A;  1DWD H;  4X2W A;  1SGF A;  1GBD A;  3A8D A;  4WH6 A;  3PLK A;  2JJ1 D;  2C93 B;  5C17 A;  4Y7A A;  1FX0 B;  3R3G B;  2GCT C;  2STB E;  1CO7 E;  1ZHM A;  4K8Y A;  5CDF E;  1O2R A;  2XBW A;  1FAX A;  1VCW A;  1OWI A;  3UIR A;  1TON A;  2GDE H;  3Q77 A;  3PTN A;  4WXV A;  3E3T A;  3BG4 C;  2J97 A;  3BSQ A;  3HK3 B;  1AND A;  1EPT C;  1HXE H;  1WTH D;  5EU8 A;  5HYO A;  1VKY A;  1QB1 A;  2PV9 B;  1BTZ A;  2AGG X;  3RXR A;  4OS2 A;  1MTU A;  1SQA A;  3MNX A;  5FXL A;  5GPI B;  2BYA X;  1C4V 2;  3F68 H;  1BTW A;  2GMT B;  3AVZ A;  5DPA A;  1O34 A;  3NRL A;  3K2U A;  4ZRO A;  4IBL H;  2QF4 A;  1K0H A;  3SNB A;  1T4V H;  8EST E;  4MDS A;  2XWB I;  3ZZ3 A;  1W2K H;  2ZDM A;  3FAN A;  1RTL A;  4NZL A;  2PUQ H;  5BRR E;  2VVU A;  2EC9 H;  1P09 A;  2VNT A;  3F9F A;  3B8J A;  1O3J A;  1O32 A;  3PMH B;  1Y3U A;  1O0D H;  1RTF B;  1SGF G;  2BZA A;  2WPJ S;  1MMJ N;  4R0I A;  3GIC B;  2A32 A;  1O2P A;  1P57 B;  1DXW A;  3URE A;  1QQU A;  3LU9 B;  4YOI A;  3V7T A;  2W5E A;  2A1D B;  1UO6 A;  1TGN A;  2CHA B;  2W6I D;  2STA E;  4WWY A;  1ID5 H;  2VWO A;  4JZD H;  1INC A;  1O2N A;  1PPB H;  3GCH B;  1VGC C;  2W7U A;  4JK5 A;  1OS8 A;  1BHX F;  1FDP A;  1K22 H;  2A4Q A;  1NBM E;  4I8J A;  3BIV H;  1AHT H;  1ANC A;  1J14 A;  1N8O B;  3UR9 A;  1KXA A;  4CHA B;  1Z1J A;  2PTN A;  5A2M H;  3AW0 A;  4DY7 B;  3LGT A;  4AB9 A;  3CNR A;  3ZV9 A;  1ZPC A;  2Y82 A;  3DSP A;  1TAB E;  2H9H A;  2G4T A;  3DUX H;  2WV9 A;  1C5Z B;  3TGI E;  1SQT A;  1O3D A;  1Y5B T;  3BTT E;  2PKS B;  1NES E;  2ZTY A;  1CQQ A;  3K6Y A;  4ABD A;  3JZ2 B;  4ZXY H;  1Y5A T;  1EP5 A;  3CS7 A;  1H1B A;  3I29 A;  1ZSK A;  2H1U A;  3R0F A;  1GGD B;  5EQQ A;  1PPC E;  1UHB A;  4KKD A;  3RM0 H;  3V13 A;  2R3U A;  1V2R T;  1EST A;  1T8L A;  4BXS A;  1P04 A;  1IHT H;  2O8U A;  1AIX H;  1TGS Z;  4ACA A;  3GDU A;  1UTO A;  1JRS A;  2SNW A;  1LQE A;  4UEH H;  1O3P B;  1TMB H;  3PM3 A;  1QIX B;  2ZGB H;  3U1I B;  1Y3Y A;  3DCL A;  3GCO A;  3V12 A;  1O2X A;  1GL1 A;  1ARC A;  1W13 U;  1KIG H;  3HPT B;  3RM2 H;  1O36 A;  2RDE A;  2V7Q D;  4AOQ A;  3E8L A;  4YTA A;  2A7J A;  3TK5 A;  1EFR D;  1C2K A;  1GPZ A;  1MBQ A;  1CE5 A;  1QBO A;  3M3S A;  3FVF B;  1O3M A;  1E35 B;  4H6T A;  1AFE H;  2A4R A;  1FY5 A;  1A46 H;  4INH A;  1TX6 A;  3ZVC A;  2QXG A;  2ZDK A;  3A7Y A;  2ZGJ A;  3ZVD A;  1O2Z A;  1SGR E;  1QJ1 B;  3PO1 B;  2A4O A;  2OQ5 A;  4YOJ A;  4U30 A;  4NIW A;  2RA0 A;  2FI3 E;  3QUM P;  1O2H A;  4FUB A;  1T32 A;  1QQ4 A;  1WV7 H;  1NRS H;  3P8G A;  5HMA A;  2AEI H;  2HVX A;  3TK6 A;  1E34 B;  1GHY H;  3ELA H;  1XUK A;  3QWC H;  3PRD A;  4RT0 A;  1UCY H;  1D9I A;  1AB9 B;  2FX6 A;  2GJG A;  4XBC A;  1SGC A;  4XDE A;  4MNY A;  5JBA S;  1TNH A;  2QF3 A;  3GS9 A;  4ABH A;  2PTC E;  1H8D H;  1HIA B;  1HRT H;  1O37 A;  3UWI A;  5C0T A;  3B9F H;  2HNT C;  1V2K T;  1RFN A;  2VIO A;  3O8R A;  1O2G H;  2F9N A;  2V3M A;  4P00 A;  2P8O B;  2UWL A;  1PYT C;  4FU8 A;  4U32 A;  4K1E A;  1G30 B;  1P2O A;  1EZU C;  1P9S A;  2EY4 C;  1C9T A;  1CHO F;  1LO6 A;  1KLT A;  3EA8 A;  3UPE A;  5T6D A;  1YC0 A;  4KGA A;  4FET A;  2AGE X;  3EYD A;  2Z3C A;  1C5T A;  2F3C E;  3SU3 A;  2SGA A;  3ATL A;  4NSY A;  2ZHE H;  1BJU A;  3VEQ B;  3VGC C;  2KCA A;  1THR H;  4ABJ A;  3UTU H;  2SGD E;  2Z3E A;  1EOJ A;  1GHB F;  4K5Z A;  1ELT A;  1SGP E;  4UD9 H;  2GMT C;  3W1E A;  2XWA A;  4B74 A;  1W11 U;  2J5U A;  1H9I E;  1SSX A;  2LPR A;  1V2L T;  1BMM H;  1NFU A;  3GYL B;  3F6U H;  2Z9L A;  1Z6E A;  4INK A;  1L1J A;  1O5E H;  2C8Y B;  1A1R A;  3AAS A;  4NWL A;  3TU7 H;  4ABI A;  3UFA A;  3W95 A;  1JBU H;  2BQ6 B;  5C94 A;  3SN8 A;  3L3T A;  1OP0 A;  2G51 A;  1T8O A;  2BD3 A;  1ZGI A;  2BLW A;  1GHA F;  5DJ7 A;  4GSO A;  5EPY A;  3E16 B;  1LQD B;  1SPJ A;  3RXM A;  2W6J D;  1ELD E;  1XUH A;  4YES B;  1LHD H;  1HIA A;  2HLD D;  1E0F D;  2ZTX A;  2H5C A;  3T29 A;  3A8B A;  1ZTK A;  2ANM H;  4MNX A;  4OGX A;  3GCH C;  3QTV H;  4K2Y A;  3EA7 A;  1GI5 A;  1HJ9 A;  3LPR A;  4YM9 A;  3MTY A;  5EXM A;  4FU9 A;  2KM0 A;  1D3Q B;  2M5T A;  4A1X A;  3PRO A;  3QK1 A;  2F9P A;  5DP3 A;  1RIW B;  4B71 A;  1MKX K;  1EUF A;  3V0X A;  3TVJ B;  3EE0 B;  4U01 A;  1XXD A;  1BBR K;  3FZD A;  5EXN A;  1LMW B;  3RML H;  2J94 A;  5EW1 H;  2JH0 D;  4CR9 A;  4ZHL U;  4NA7 A;  1XKB C;  2W26 A;  4FUH A;  3SNE A;  1ACB E;  1VIT F;  2VH6 A;  1K28 D;  1MKX H;  1ETR H;  4UFF H;  2ILN A;  1AUT C;  5EXL A;  3C27 B;  4X1R U;  1BML A;  1GJC B;  4I7Y H;  4FVD A;  1BBR H;  2THF B;  2OP9 A;  1SBW A;  1HAX B;  2PW8 H;  2OQU A;  4BNR A;  4DOQ A;  1GGD C;  2F91 A;  2G5N A;  2OUA A;  1T7C A;  1S6L A;  3DSG A;  4YXW D;  5KEC A;  3SZN A;  1AQ7 A;  3ATK A;  5HM9 A;  1MAX A;  1P2K A;  1O39 A;  1TAW A;  3MH5 A;  1C1M A;  1Z7K A;  3A89 A;  1C2M A;  3PV4 A;  1H4W A;  4IN1 A;  2ZF0 H;  2A4G A;  3F2G A;  1ZZZ A;  2Z9G A;  1QFK H;  4UFD H;  5K0H A;  3OEE D;  1GWA A;  4AFZ A;  2HPP H;  2P94 A;  1J9C H;  3KID U;  1HAI H;  3TPI Z;  3LGU A;  1LHG H;  1SLX B;  1XVM A;  3RXU A;  1XMN B;  3FFG A;  1OX1 A;  4FVB A;  3SOS A;  1NC6 A;  1O2V A;  1OP8 A;  1P12 E;  1GCD A;  4ISL A;  3RC4 A;  3KL6 A;  1AGJ A;  1K2I 1;  2R2W U;  1YLC A;  5KED A;  2OLG A;  2WPH S;  4XBD A;  4CRD A;  3RC6 A;  1L0Z A;  8GCH G;  2BOK A;  1FPH H;  1ZR0 A;  4O9V A;  4UDW H;  1UVP A;  1C5R A;  1MZA A;  2ZEB A;  1MQ5 A;  2FS8 A;  3PO1 C;  2ZZU H;  2TGA A;  3BEF B;  1T31 A;  1O2Q A;  3STI A;  3VB5 A;  4UE7 H;  4LZ1 H;  3SU6 A;  3F2F A;  2VGC C;  1L2E A;  2ZIQ H;  4O3U A;  4JZE H;  3UY9 A;  3TNT A;  3RXT A;  5B6O A;  3BN9 A;  3SHA H;  1K1M A;  1SG8 B;  1XM1 A;  2QGR A;  2VWM A;  1AB9 C;  1AWF H;  4YLU A;  1NRO H;  2VVC A;  4H4F A;  5DK1 A;  3H09 A;  3T27 A;  3RU4 T;  1UVT H;  2GCT B;  1FON A;  1MCT A;  1WYK A;  3N7D A;  1AFQ B;  1V2S T;  1YPK H;  3D49 H;  1O5G H;  3UNR A;  2Y5H A;  3SUE A;  2TBS A;  5EJ1 A;  1C1P A;  1DWC H;  1TB6 H;  1W0J D;  2GP9 B;  5DG6 A;  1ELC A;  1TBZ H;  3BG4 B;  1LHF H;  2ZFP H;  4A5T S;  1GI7 B;  2VU8 E;  3BEU A;  4FU7 A;  1ZJD A;  2GZ7 A;  5AFY H;  4K60 A;  2CXV A;  4DT4 A;  1A0J A;  1ELG A;  2ZFR H;  3U28 C;  2I6S A;  1EJM A;  1P8V C;  1WOF A;  2O9Q A;  1OXG A;  3SGQ E;  1BTH H;  3TGJ E;  1TA2 A;  4AYV B;  1AN1 E;  5FX6 A;  4RN6 A;  4KTS A;  3A7T A;  3PWC A;  1TPO A;  2ASU B;  3N7O A;  2XC5 A;  2FO9 A;  4BAH B;  2ZFF H;  3LGI A;  1UW7 A;  2R0L A;  4F49 A;  1Q31 A;  1V2O T;  1VCP A;  1NY2 2;  1TMT H;  1O3O A;  1FAK H;  3ZYD A;  1YM0 A;  2XYA A;  4K3J A;  1QBN A;  4MLF B;  5ABW A;  1Y5U T;  1RS0 A;  2CJI A;  3GY4 A;  2XCF A;  4ABB A;  1OOK B;  4K1T A;  1ZGV A;  1GMH F;  1VGC B;  1VJ9 U;  5AVD A;  4OM9 A;  1DWE H;  2Q6G A;  3DHK H;  2ALP A;  1HAG E;  2NU3 E;  2Z3D A;  4JCN A;  3SU5 A;  3TH3 H;  3E6P H;  3UB0 A;  4X2V A;  3Q76 A;  2BVR H;  1XUG A;  1KMH B;  1C1O A;  1HXF H;  4AC9 A;  1Z8J B;  3MH7 A;  2TRM A;  5EPN A;  1UTM A;  3F0P A;  1GBA A;  1C1R A;  6GCH G;  1O2U A;  5IK2 D;  2FLR H;  3M5L A;  2ZHW H;  1BA8 B;  2Q6F A;  1H8E D;  1X7A C;  1EZS C;  4WXI A;  5JDU B;  1KTT B;  3RXG A;  3S9B A;  1ARB A;  3FOA A;  3SI3 H;  2P3T B;  1KYN A;  1JIM A;  1O3H A;  4Q7X A;  2KCY A;  2P3F H;  1V2N T;  2GV6 A;  1HAV B;  4I8L A;  3M61 U;  1C5M D;  3QGN B;  1C1V H;  2JDI D;  4BTI B;  4O97 A;  1C2E A;  1OWJ A;  2BD5 A;  3A88 A;  1IAU A;  1HAY B;  1G36 A;  1LVB A;  5J4Q A;  2OBO A;  2CGA A;  1DIC A;  1TA6 A;  3TGK E;  2BM2 A;  1Q3X A;  1NTP A;  1EJN A;  5CHA C;  4NZQ A;  2QXJ A;  4ZCN A;  2WPD D;  1T8M A;  7EST E;  1LHE H;  1QB9 A;  5FPY A;  1UVS H;  1V2J T;  3TH4 H;  4ABA A;  2HPQ H;  3GY8 A;  1TBQ H;  3WWB A;  2I6Q A;  1TLD A;  2GZ8 A;  1C2J A;  2JJ2 D;  4ZHM U;  4TPI Z;  1OP2 A;  1K1N A;  1ZOM A;  2ANY A;  2TGT A;  1C1N A;  1DY9 A;  4A6L A;  3RU4 D;  4U2W A;  1HB0 B;  1QL7 A;  1O31 A;  2GDD A;  1S6H A;  4Y7B A;  3SI4 H;  1IQJ A;  3SU2 A;  4Z6A H;  1G2L A;  2FI5 E;  1HUT H;  2ZDA H;  1GJ9 B;  1TBR H;  4Y0Y E;  1LVY A;  1WAY B;  1HAV A;  2QA9 E;  3RXS A;  1FXY A;  1TAL A;  4BOH A;  1TMU H;  1C5S A;  3OEH D;  1YPJ H;  4BAN B;  1TRM A;  4WF8 A;  1OWH A;  3F2H A;  2AER H;  3OYP A;  5A8Y A;  1F5K U;  3U8R H;  1JIR A;  1Z71 A;  2GVF A;  2OC1 A;  3NK8 A;  4I8K A;  2Q1J A;  2Q6D A;  1TNK A;  4X2Y A;  2WUB A;  1MU6 B;  1K1L A;  1AFQ C;  1O2O A;  3EQ0 H;  3SJI A;  1ZTL A;  1JXP A;  1IQN A;  3MHW U;  1DXP A;  2ZPS A;  2ZQ2 A;  3NUM A;  2FPZ A;  3UUZ A;  1NU9 A;  1U6Q A;  2HOB A;  1Y8T A;  1CHG A;  5E2P A;  1EAI A;  2HNT F;  3IIT A;  1F0U A;  1O3E A;  1C5Y B;  2GX4 A;  1GJ7 B;  1VR1 H;  1KLJ H;  3DT0 H;  2OC8 A;  3BIU H;  5JB9 S;  5JB8 S;  1GBL A;  5EST E;  3AK5 A;  1S85 A;  3VGC B;  2KFW A;  2FP7 B;  3GOV B;  1FY8 E;  1V2U T;  1YWU A;  5DP8 A;  3A7V A;  1A0L A;  3I78 A;  3FKS D;  2NU4 E;  1GMC G;  5EQR A;  3URD A;  2GT7 A;  4Q7Z A;  1DM4 B;  3C1K A;  2C8Z B;  3LH3 A;  2G5V A;  4J2Y B;  4P02 A;  4X1N U;  1NRP H;  4THN H;  2FIR H;  1CBW B;  4MPX A;  3PB1 E;  2R0K A;  3NKK A;  4ISI H;  4DGJ A;  3KQD A;  1GCT C;  5GCH F;  2W7S A;  1MD7 A;  4H6S B;  2J95 A;  3UWJ H;  2W3K A;  3Q3Y A;  2FTM A;  4TY6 A;  4ZKS U;  3U69 H;  2VBC A;  3KQC A;  1UHB B;  1EB1 H;  3SQE E;  2QYI A;  1SLW B;  3SNA A;  2BY7 X;  1YBW A;  1ANB A;  1P0S H;  1QNJ A;  2ZFT A;  2F9O A;  1W0Z U;  3AW1 A;  2EI8 A;  1C5X B;  1AVG H;  4X6M A;  4CH8 B;  1DLE A;  2BY5 X;  4MTB A;  4ABG A;  4Y8Z A;  1FV9 A;  4CR5 A;  1THP B;  1S0R A;  1ORF A;  1BRA A;  1DLK B;  1Q2W A;  5IYT A;  3ZZD A;  5CE1 A;  1P3E A;  1TGC A;  3ZZA A;  1RGQ A;  5L30 H;  2VB0 A;  1SGY E;  3RP2 A;  3BTH E;  5TCC A;  1PPH E;  1HV7 A;  2VWN A;  3SJ8 A;  3M5M A;  2PHB A;  2BLQ A;  3KYF A;  1CGJ E;  2BX4 A;  3KGP A;  2HAL A;  1HJA C;  3A85 A;  3RXP A;  3HKJ B;  1GI2 A;  1ZJK A;  3MNS A;  2IJO B;  4YO9 A;  1OSS A;  1MQ6 A;  1GL0 E;  1GI8 B;  3VB7 A;  5EJL A;  1ZMN A;  3PMA B;  1NPM A;  1O3K A;  4NCY A;  1ELV A;  2F4L A;  3Q3X A;  3LGW A;  4ZXX H;  1SR5 C;  3ZZ5 A;  1O2T A;  4FUD A;  3M5N A;  1O5A B;  2BD9 A;  1WQV H;  4HZH A;  1JWT A;  3OY6 U;  1GJD B;  4JMY A;  4Y6D A;  3P6Z B;  2TGD A;  3FAO A;  2VIQ A;  2J98 A;  1UTP A;  3LOX A;  1SI5 H;  1TRN A;  1O5C B;  1SGD E;  5I46 H;  2PP6 A;  1CGI E;  5EIY A;  4HGC A;  2PKA A;  1V2T T;  2XBX A;  1PPF E;  2B5T B;  2GKV E;  2HVY B;  3M3T A;  1P2J A;  3RXK A;  2XRC A;  5GIB A;  1GBK A;  1L1N A;  3KCG H;  4D9R A;  4NIX A;  2Y6T A;  2JET B;  3NXP A;  1WCZ A;  1QCP A;  5T6F A;  3M35 A;  1J8A A;  1LTO A;  4DIH H;  3TIT A;  3SGA E;  1GVL A;  1TFX A;  2ZDN A;  3KF2 A;  1YPL H;  2FOF A;  2PSX A;  1H8H D;  1H9H E;  2SFA A;  3KQE A;  3UR6 A;  2GD4 B;  3GYM A;  3BTQ E;  1PQ7 A;  2AIP A;  4BAQ B;  1DSU A;  4KEL A;  1FMG A;  3Q00 A;  4R8T B;  4XBB A;  2F83 A;  4XSK U;  3RMO H;  3DD2 H;  2VWL A;  2O8T A;  3MOC A;  1N6Y A;  3S7K B;  1K1P A;  1PQ5 A;  1TNG A;  3OY5 U;  2WIN I;  2AHM E;  2VGC B;  4MVN A;  5F03 A;  1G37 A;  3MWI U;  5A0A E;  1YCP K;  3BTK E;  1O3B A;  1ELF A;  2V3O H;  5JPM H;  1OYQ A;  1DOJ A;  4JZ1 A;  1C1S A;  1TGB A;  2BX3 A;  4OS7 A;  1EX3 A;  3U1J B;  5A0B A;  1BTU A;  1F7Z A;  1YCP M;  1TX8 A;  2DE9 A;  2A5A A;  5EJZ A;  1GJA B;  3PTB A;  1THS H;  3S7H B;  1TQ7 B;  3LC3 A;  4XRN A;  1GBB A;  1SGE E;  1UK3 A;  5L2Z H;  2ZQ1 A;  2HNT E;  1C1U H;  2YOL A;  4WH8 A;  1CGH A;  3RDZ A;  4XFQ A;  2QF0 A;  3A81 A;  1BRU P;  3RMN H;  1SMF E;  3SZE A;  3NWU A;  2UWP A;  2WYJ A;  2B8O H;  1C1W H;  3F1S B;  1FY3 A;  2G81 E;  5CHB A;  3MU4 A;  4FUC A;  3A8C A;  4A7I B;  1CBW C;  4TT3 D;  4D7G A;  1QJ7 B;  4AG1 A;  1CU1 A;  4Y71 A;  3OFN D;  3T26 A;  3E90 B;  2VIW A;  3ZZC A;  1G2M A;  1GHX H;  3MO6 A;  1ABI H;  4EST E;  2EI6 A;  5F53 A;  5T6G A;  1HAO H;  3OAA D;  4B2C A;  5F8Z A;  2C4F H;  2OTV A;  1O3I A;  5EQS A;  5DP4 A;  1A5I A;  2ZEC A;  1SGT A;  4WJG 2;  4OS4 A;  5GND A;  3IWM A;  3UOP A;  1N1L A;  1SGI B;  2TPI Z;  5T3H A;  3GCT F;  4CRG A;  4Z0K A;  2BVS H;  2EA3 A;  1JOU B;  2W3I A;  4Q7Y A;  3KNX A;  5FPT A;  4ASU D;  2RFK C;  1D3D B;  1C5N H;  1ZHR A;  3ATM A;  4HI3 A;  2QE7 D;  4K8B A;  1A4W H;  1TYN A;  2ZG0 H;  6EST A;  4CRC A;  1AO5 A;  2BDG A;  3ZVF A;  1DS2 E;  4E05 H;  2BB4 A;  1SLV B;  2ODP A;  2QC2 A;  1Z8R A;  5L6N H;  5E0J A;  1EP6 A;  2FOC A;  1SQR A;  1ZPB A;  2FES H;  2KR7 A;  3GY7 A;  3RXH A;  1AKS B;  1W10 U;  6CHA C;  3SV6 A;  3A8A A;  1GVZ A;  2ZTZ A;  4IC5 A;  4KTC A;  1EB2 A;  1ZML A;  2GCH F;  1FIZ A;  3KQB A;  3SV7 A;  1PFX C;  4GUX A;  4B2B A;  2K0Q A;  1SOT A;  1P9U A;  3RXQ A;  1YPH E;  1MCV A;  3RLY H;  3SJ9 A;  1DWB H;  1Z8I B;  4INL A;  4FUF A;  3M3V A;  1K1I A;  1SFI A;  2UWO A;  7KME H;  3ZZ4 A;  2Y5G A;  4NGA H;  2FWW A;  3WWF A;  4CBN A;  1QRX A;  2QXH A;  1IQM A;  1A5G H;  1BMF D;  5LPF A;  4BAO B;  1AE5 A;  3SV8 A;  4NG9 H;  2Z9I A;  1KXB A;  5CHA B;  2FTL E;  3UNS A;  1QUR H;  2WPI S;  5A09 A;  3LC5 A;  3URC A;  2H9T H;  2FOD A;  2OK5 A;  2GTB A;  1FPC H;  2GGV B;  3QX5 H;  1C2H A;  1E79 D;  1V2M T;  2JET C;  4NIY A;  5EGM A;  4OS5 A;  2WV4 A;  1MBM A;  2FYR A;  4GCH F;  4ZKN U;  2FOM B;  4GAW A;  3TLO A;  3IG6 B;  2CMY A;  1GI0 A;  1O5B B;  2HLC A;  1MD8 A;  3QTO H;  1CHO G;  1P2N A;  3MU5 A;  3RXF A;  4E06 H;  5TCA A;  4JK6 A;  1C2I A;  5LGO A;  4TWW A;  1AKS A;  4Q80 A;  4AOR A;  3QLP H;  4BAK B;  3F3B A;  1G32 B;  3N99 A;  3TNS A;  3BEI B;  4MQA A;  2AS9 A;  1GHB G;  1PPE E;  4X1Q U;  5C5O A;  2ZGH A;  1HAZ B;  1FY4 A;  3AAV A;  1AI8 H;  1YYY 1;  2BD2 A;  3MYW A;  2P59 A;  3GY3 A;  1W8B H;  2KCP A;  5JBB S;  1G3D A;  4IMZ A;  4YT7 H;  1GMD F;  5FCK A;  1N6X A;  1XXF A;  1BIT A;  1HAH H;  1DIT H;  3P17 H;  3PMJ A;  2KX4 A;  2O8L A;  4FUG A;  1FN8 A;  4WY3 A;  3VG8 A;  4M9F A;  3V3M A;  1BDA A;  4RT1 A;  1GHA G;  1MTS A;  3SND A;  1ZHP A;  2FX4 A;  3FP7 E;  4DCD A;  5DP7 A;  4ABF A;  3A84 A;  1TPA E;  2BDA A;  1PQA A;  3SQH E;  1XX9 A;  1GBC A;  2A5K A;  2CF8 H;  2FOB A;  3PMB B;  5EG4 A;  2BXU H;  2H9E H;  4A92 A;  1HNE E;  2J38 A;  3OTP A;  1XKA C;  2BLV A;  2Y81 A;  5C20 A;  4GHT A;  3GY5 A;  2FMJ A;  2QF5 A;  2ZI2 H;  2XC0 A;  1C5U A;  1ZSJ A;  5K7R A;  1O5D H;  1Y59 T;  2A7H A;  3CEN A;  3FP6 E;  2JKH A;  1FQ3 A;  5EOK A;  3HAT H;  2F9U A;  3SNC A;  4MPV A;  4GVU A;  1UCY E;  4X0W U;  3MMG A;  2WHX A;  1IQF A;  2B9L A;  1K1O A;  4X6P A;  3A7Z A;  3TJO A;  1GCT B;  4Z1M D;  2GCH G;  1NM6 A;  2GZ9 A;  3F9E A;  1OYT H;  1VIT G;  1Y3W A;  2BHG A;  3MH4 A;  1F0R A;  2NU1 E;  5DP6 A;  3SO3 A;  1GI3 A;  4DUR A;  1F2S E;  1LKB A;  4Y79 A;  3S0N A;  3SUD A;  1EJA A;  3SBK A;  2J34 A;  2WZQ A;  3MU1 A;  5EOD A;  1SGN E;  1NFY A;  5C67 A;  1O2W A;  1OWE A;  1V2V T;  3K6Z A;  1G3B A;  2EQN A;  2XBV A;  5FBI A;  4E7N A;  1AMH A;  2HGT H;  2YNA A;  4CRA A;  2PLX A;  4LXB H;  3ZV8 A;  1UTK A;  1ETS H;  2ZU5 A;  1W3C A;  2OXS A;  3U8T H;  2ZWL H;  1O2Y A;  3P8F A;  3E0P B;  4AGK A;  1LHC H;  5CMX H;  1UJ1 A;  4MPW A;  1HJA B;  2TIO A;  2NU2 E;  5HGG A;  4I8H A;  4AX9 H;  3ZZ7 A;  5LH8 A;  2SGE E;  1YPE H;  3Q3K A;  2VIP A;  3GY2 A;  5HXF A;  3K9X B;  1ZSL A;  1PYT D;  3O8D A;  1GJ4 H;  1QA0 A;  1GJB B;  1SOZ A;  1EPT A;  1TNI A;  4E7R G;  2OC0 A;  5DP5 A;  3F9G A;  1D6R A;  3BF6 H;  1P03 A;  3GCN A;  1CA0 C;  3VPK A;  1DT2 A;  1J16 A;  3LT3 A;  5DO4 H;  4Y0Z E;  3QO6 A;  1C2F A;  3W94 A;  1SB1 H;  5HIY A;  2ZCK P;  1S6F A;  3SUG A;  3MU8 A;  4ACB A;  4XD7 D;  3OU0 A;  2VJ1 A;  1LVM A;  1TQ0 B;  2ZCH P;  2YMS C;  5H4I B;  1V6D A;  1TE0 A;  1SGQ E;  2VID A;  2ZU3 A;  1SKY E;  1A3E H;  1BB0 B;  3CP7 A;  2BMG B;  3MO3 A;  3E91 A;  4ZKO U;  5TJX A;  1DDJ A;  1WXR A;  1A0H B;  1TGT A;  1WQS A;  2V6N A;  1GI1 A;  1MU8 B;  3U98 H;  3D23 A;  1PPZ A;  5SGA E;  1FLE E;  1L4D A;  1P11 E;  5C0U A;  1J15 A;  3TK9 A;  3U8O H;  5HKK D;  1HJ8 A;  4WMF A;  1BBR E;  3EA9 A;  2ODQ A;  4WVP E;  3UQV A;  2BTC E;  1IQH A;  1KTS B;  2WYG A;  3MQK C;  1KY9 A;  4AN7 A;  3PV2 A;  4ASH A;  1B0F A;  1NU7 B; 
#chains in the Genus database with same CATH homology
 4I33 A;  3F0P A;  5EPN A;  5FL7 D;  1E79 D;  2WZQ A;  5EPY A;  3SZE A;  3NRL A;  3SU4 A;  3M5L A;  5IK2 D;  2OIN A;  1EFR D;  1JXP A;  1COW D;  1NS3 A;  2W6J D;  2QF4 A;  3F2F A;  1DXP A;  3FN8 A;  3LON A;  3SU6 A;  3LOX A;  4I32 A;  3SU1 A;  3ZIA D;  3KN2 A;  1H8E D;  2HLD D;  2FOM B;  2K8I A;  2QV1 A;  2XND D;  5CHB A;  3KEE A;  3SU0 A;  3M5O A;  2KCO A;  2XOK D;  2YMS B;  4TT3 D;  2CK3 D;  2OBQ A;  1RTL A;  1CU1 A;  2A4R A;  2YMS D;  3OFN D;  4TYD A;  5FPS A;  3E90 B;  3LKW A;  3DSO A;  3FOA A;  2OC8 A;  2KM0 A;  1W3C A;  1W0K D;  4A1X A;  3F3B A;  3H09 A;  3AK5 A;  2KCY A;  2FP7 B;  2KFW A;  3N99 A;  5F53 A;  2KZ4 A;  3OAA D;  3SV9 A;  2XCN A;  4B71 A;  3O8B A;  3N7D A;  3FKS D;  5EQR A;  5IDK A;  3OE7 D;  2JDI D;  3SUE A;  2K1Q A;  5EQS A;  4U01 A;  4F55 A;  1DXW A;  1W0J D;  5GJ4 B;  5GND A;  2P59 A;  2W6I D;  4Q63 A;  1N1L A;  2KCP A;  2OBO A;  3PRD A;  3KF2 A;  3O8D A;  4NWK A;  5DN6 D;  1H8H D;  4B76 A;  4DT4 A;  1E1Q D;  2OC0 A;  2A4Q A;  4ASU D;  2WSS D;  2VBC A;  3KNX A;  1DY8 A;  5ESB A;  5FPT A;  1NBM E;  3P8O A;  2WPD D;  3VG8 A;  5DSF A;  4M9F A;  2QE7 D;  4ZCN A;  4K8B A;  3GS9 A;  4R8T B;  5B6L A;  3FO8 D;  4A1T A;  2F43 B;  5FPY A;  4B75 A;  5C0T A;  4B73 A;  3WWB A;  2L6O A;  2AHM E;  1S6L A;  4RI0 A;  3PV5 A;  2JJ2 D;  3F0O A;  4YXW D;  1MAB B;  3O8R A;  2KR7 A;  3SUG A;  4XD7 D;  4A92 A;  3DSP A;  1NBM D;  1OHH D;  2YMS C;  5T1V A;  2XNI A;  3OTP A;  3WW7 A;  3SV6 A;  5H4I B;  2WV9 A;  3RC5 A;  5ETX A;  1DY9 A;  2A4G A;  3F2G A;  1RGQ A;  3N7E A;  4KTC A;  4B6E A;  2O8M A;  1SKY E;  3OEE D;  3SV7 A;  2V7Q D;  1BT7 A;  2K0Q A;  3O8C A;  2QF5 A;  2IJD 1;  1E1R D;  3EYD A;  3L6P A;  4FET A;  4WH6 A;  2OC7 A;  3SU3 A;  2JJ1 D;  3M5M A;  5C17 A;  2KCA A;  1FX0 B;  2M2A A;  1WXR A;  5EQQ A;  2LEL A;  4TSF D;  3U1J B;  2F9U A;  5CDF E;  3SU2 A;  3W1E A;  2F9V A;  2WHX A;  3RC4 A;  4B74 A;  3WWF A;  2XCF A;  2J5U A;  3PRB A;  5C0U A;  2IJO B;  1BMF D;  3P8N A;  4Q4L A;  5HKK D;  3RC6 A;  3SV8 A;  3OEH D;  4Z1M D;  4NWL A;  3SUF A;  1A1R A;  4A1V A;  4WF8 A;  4OM9 A;  2F4L A;  2YOL A;  3F2H A;  4WH8 A;  3SU5 A;  3OYP A;  3U1I B;  2FM2 A;  3DCL A;  4I31 A;  3UB0 A;  2GVF A;  2OC1 A;  3SUD A;  2OK5 A;  1KMH B;  3M5N A;  3PV2 A;  5GPI B;  2JIZ D;  4B6F A;  2GGV B;  3SYJ A;  4JMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...