2KCYA

Solution structure of ribosomal protein s8e from methanothermobacter thermautotrophicus, northeaststructural genomics consortium (nesg) target tr71d
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
GDRRVRLIRTRGGNTKVRLASDTRINVVDPETGKVEIAEIRNVVENTANPHFVRRNIITRGAVVETNLGNVRVTSRPGQDGVINGVLIRELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title SOLUTION STRUCTURE OF RIBOSOMAL PROTEIN S8E FROM Methanothermobacter thermautotrophicus, NORTHEASTSTRUCTURAL GENOMICS CONSORTIUM (NESG) TARGET TR71D
rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Ribosomal protein
molecule keywords 30S ribosomal protein S8e
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2008-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.310 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2kcyA01
2KCPA 2KCOA 2KCYA
chains in the Genus database with same CATH superfamily
1EAXA 1SGFG 2DE8A 1C5ZB 2OBQA 2WPIS 3QUMP 1THRH 3GCHB 2UWPA 3T62A 4X6PA 3E0PB 1P04A 3HKJB 4GLYA 1WUNH 1GG6C 1MCTA 2XWAA 2OCVB 2ZFQH 4NZLA 1GHAF 2O8WA 1GJDB 2NU0E 1JIRA 3RXCA 1OP0A 1KXBA 3CENA 2JH0D 3SV7A 2C8WB 2FPZA 5JB9S 4XRNA 2GX4A 1C1RA 1J15A 4ZKSU 1M9UA 1EPTB 4O97A 4YO9A 7LPRA 3D49H 2R0LA 1XKBC 1WV7H 1HJ9A 3DT0H 3F68H 2ZPRA 1L4ZA 1ELEE 5J4SA 1HJ8A 2RFKC 2QXIA 4P02A 1GBCA 1TYNA 3BEFB 1UJ1A 4X8VH 7GCHF 1GHAG 2VIQA 4MPUA 4SGAE 2VGCC 5FL7D 3RXGA 1MUEB 1RJXB 1J14A 3PWCA 5IK2D 1YBWA 3UQVA 2V0BA 3UY9A 4XE4A 3UTUH 5L2YH 3C1KA 5DP6A 1BTHH 1NFXA 3OU0A 1IHTH 3SV9A 1BCUH 1WCZA 4FUEA 4INHA 3WWFA 2F9PA 2ZHQH 1AFQB 1AKSB 1XUHA 2TIOA 1HAVA 2BD4A 1AKSA 2NU4E 2G5NA 3A86A 3U69H 6GCHF 5K7RA 3SN8A 2UWOA 3SJIA 4CRDA 1GBFA 1W14U 3SUFA 1F92A 3M5OA 3SZNA 2R0KA 3SORA 3LGUA 2GMTC 1LDTT 2PSYA 2ZU5A 1WDIA 4LK4A 2ZCKP 5FCKA 3EAJA 2XC4A 3QK1A 1N1LA 3RC5A 3RMMH 1NTPA 3QGJA 1ZPBA 1AVWA 1S81A 2BMGB 2PGQB 3P6ZB 4GSOA 4CRFA 3RXQA 3SNBA 1QNJA 1O2IA 1C9PA 2FEQH 4FUGA 1F5LA 3IG6B 3RXKA 1ZRBA 1O5GH 1C1MA 3JZ1B 3MU0A 1DX5M 1HAPH 3VEQB 5C3NA 1G3CA 2Y5FA 4X6NA 4ABEA 2OK5A 4D8NA 3F9HA 1FN8A 1VR1H 2SFAA 3V3MA 4ZXXH 1CT0E 5F8XA 2BDHA 1BBRK 5C5OA 1E1RD 3M37A 4J1YA 2EQNA 3SYJA 2Q1JA 3QN7A 1XVMA 3K6ZA 1IOEA 3RXVA 4FXGH 4JYTA 2Q6GA 1TNJA 1QQ4A 1K1JA 3NXPA 1BMFD 1NRSH 3V0XA 4XOJA 1ZPCA 4HFPB 1O5AB 1TOCB 2AERH 2R2MB 3QTOH 1V2RT 1C2KA 4K69A 2PWXA 3BTME 1H8HD 5GXPA 3KQCA 1UTMA 2ZQ1A 1K1LA 2G5VA 1G36A 1D6RA 5EXNA 3BTTE 1DM4B 1EASA 3KCGH 3V13A 1C4V2 1KDQA 2GMTB 1FI8A 3H7TA 4B75A 1XUGA 1SGCA 2FESH 2BD9A 4XBCA 2H5DA 1KMHB 1O38A 4ISNA 3M7QA 1GMCF 1YPGH 3PLPA 1GJ5H 1JRSA 1BTYA 1V2VT 2VVVA 4FVDA 2ZGBH 3MOCA 1O35A 2Z7FE 1UW7A 4X8SH 5ESTE 1F2SE 4Y8XA 3LGTA 1VGCB 1L1JA 1ACBE 2P3UB 3LC5A 4F55A 2IN2A 1AB9B 4B74A 5GNDA 1H9LB 4YM9A 4X1QU 1FJSA 3ELAH 4FUJA 1D3QB 1V2QT 1W7XH 5HMAA 2F83A 1W0KD 1TQ0B 4MDSA 1FPCH 1GBMA 1O3MA 2QIQA 4B2CA 2FOEA 4BAOB 4B76A 1YPJH 4LZ1H 3SQHE 1GG6B 1DSUA 3Q77A 4UD9H 3DUXH 5DN6D 1LHDH 4NIXA 2GCHF 2WINI 2P93A 3RXRA 1HAHH 3FVFB 3M7UA 2HNTC 2HLDD 2GT8A 1Q2WA 3OTPA 5T1VA 1BJVA 1SC8U 1PPGE 2Y82A 4ZHMU 1V2JT 3A81A 1FAKH 4X1NU 1YY3A 5GCHF 5C17A 1V3XA 4WXVA 1P10A 2ZPSA 2FOBA 1K1NA 5EQSA 3VB5A 2H1UA 5HYOA 1QQUA 1BTZA 3NWUA 4UFDH 1DOJA 2GV6A 3GCHC 3SGBE 1EZXC 1RS0A 3LJOA 1W7GH 3URDA 1AUTC 2ZZUH 2ZC9H 2PUQH 1AI8H 1RTKA 1BT7A 4XBBA 2WV5A 1P8VC 1O3HA 1EQ9A 1J17T 3A8CA 4I33A 2Y81A 4ZCNA 1LTOA 4ABAA 3GCTF 1PYTD 3M61U 4XFQA 3PV5A 1PJPA 5L30H 3AW1A 4O3TA 1FY8E 4TWWA 4AG2A 3RXTA 1DY9A 1Z8IB 3W1EA 4M9FA 2J97A 5I46H 1P11E 2Q6FA 1D6WA 1HV7A 3PRBA 1SPJA 3ZYDA 5EIYA 6ESTA 1AE5A 5FBIA 1S85A 2XBVA 1GBIA 1VCWA 2JETB 1ELFA 5C0TA 3AK5A 2Z9LA 3ZV8A 2W26A 1G32B 1TMTH 1C5TA 1IAUA 2FMJA 1ZOMA 3MNBA 2XRCA 2W3IA 1ZMLA 1SG8B 1AFEH 4VGCB 1YLCA 2QC2A 2ANYA 1BQYA 2VIWA 2LELA 3M7TA 5G4BA 1MAXA 3GOVB 1TA6A 1QL8A 4X0WU 3EE0B 1AFQC 1DLEA 1L1NA 2C8ZB 1UVPA 3ZVEA 1ARCA 3F0OA 1CHGA 1O3LA 1YCPH 3FZDA 1CGHA 1SFQB 4NSYA 4LZ4B 2SGDE 1EP5A 2ALVA 1KLIH 3KYGA 2Z6BD 2D8WA 5TCCA 1P02A 4YLQH 1BJUA 1SQRA 4WVPE 3KQEA 2OINA 1L1GA 2PR3A 1HYLA 1QCPA 1HGTH 2B5TB 3KQ5A 4ZXYH 3ZZ8A 3GY3A 2C90B 3IWMA 1FY3A 3SNAA 1SLUB 4FUDA 2WPHS 1XKAC 4B1TA 1JIMA 2B0FA 2BDCA 6LPRA 4X8UH 5E2PA 2G8TA 1Z6EA 4NIYA 2F4LA 5EQQA 4TWYA 1TGTA 2A5IA 2ZFTA 1VCPA 1HAXB 3RM0H 1S6HA 1O2JA 1A5IA 5SGAE 5L2ZH 3Q76A 1BOQA 4ABIA 2RDEA 1O39A 4ISIH 3I77A 1O2GH 3S9AA 1O2SA 2BY5X 3A7TA 5K0HA 1A1RA 1Z6JH 5CHAC 1DWDH 3Q3KA 5A2MH 2ZKSA 3EA8A 1O3OA 3GDSA 1BUIA 3L3TA 4D9RA 3RXSA 2C3SA 1GHZA 1HAYB 3PROA 2XOKD 1DDJA 1EX3A 1S6FA 2OD3B 1G3DA 1YCPM 3BTEE 3T25A 3VB6A 4OM9A 3E16B 4JK6A 2JH5D 4MG3A 1PPFE 4J2YB 2OXSA 1BB0B 4XBDA 4XSKU 1ZYOA 1FY5A 1MTNB 1RIWC 1E37B 2R2WU 5T3HA 1GL1A 1OWHA 3HGNA 4INLA 2AEIH 4E7NA 4TYDA 2XCNA 1JOUB 1ELGA 2ZA5A 1J8AA 2F9VA 1BRBE 1VGCC 3S0NA 1FN6A 4M7GA 1YPLH 2ZTZA 4NIVA 4B2AA 1IQNA 4AX9H 2WPDD 3UREA 4YESB 1CT2E 5C67A 1LHEH 2ZDLA 1C5QA 2GZ8A 3BTGE 3GISB 1QB6A 3UB0A 2ZGCA 1TALA 1QHRB 1N8OB 1A5GH 1IQEA 2Y80A 2RDLA 3BTFE 1AY6H 1AN1E 2XC0A 5EJZA 4MPXA 3UFAA 5HM9A 1ABJH 2ZG0H 3U8OH 4Q2KA 1G37A 3ATWA 4NA7A 1C5WB 1DICA 1KYNA 1B7XB 2A31A 3ZVCA 2BD8A 2O9QA 1E36B 1W10U 4I31A 1SL3A 2BQWB 3BEIB 1LKAA 1WTGH 4THNH 4K1TA 3W94A 3OSYA 2ZI2H 3H5CB 1O5BB 3ZZ9A 4K1SA 1SGTA 1KLJH 2FYRA 3A7XA 2VWLA 5EODA 1B0EA 1O3BA 1MZDA 1NFUA 1O2OA 4ZKOU 1O2XA 1V2TT 3FFGA 4OS4A 1QZ8A 3GY2A 4JK5A 1BTUA 1EATA 3MU5A 3T26A 1C1PA 1TQ7B 3MH5A 3PTBA 1ZJKA 1EKBB 4IC5A 3B9FH 3URCA 1PPHE 1OOKB 2P95A 3PMAB 1TNHA 2ZFFH 1W0ZU 4K5ZA 1THPB 1O3FA 1TRNA 1NESE 4AFZA 3KF2A 1A5HA 5JBAS 3BEUA 1S84A 1CA8B 3M3TA 1L4DA 4HI3A 4NZQA 1UVOA 4ZKNU 2JJ2D 2QA9E 5ETXA 1YYY1 3MMGA 1RXPA 3LGYA 1FIZA 1IQJA 1P9UA 3VGCC 1NRRH 3TJOA 2F9OA 2SNVA 1GCTC 3ZVAA 4U2WA 3CNRA 2FIRH 3OEED 1OHHD 3M3SA 3LU9B 1TMUH 2SGAA 3QZQA 2XXLA 4F48B 4BAQB 1A0LA 1GDUA 2VJ1A 5DGJA 3BIUH 1ZPZA 5AF9H 2P8OB 3RMOH 4X1PU 3STJA 2ODPA 2BDYA 4KGAA 3VXFH 5HKKD 2EA3A 2BD2A 2BDGA 2BVXH 2P3FH 3WY8A 2VWNA 1QY6A 3A89A 3OFND 4RKJB 2G4UA 2CHAB 1WTHD 2QF3A 4A1VA 2XC5A 2FM2A 4ABBA 1N6YA 4BTIB 1WSSH 3DHKH 1FDPA 2TRMA 2W3KA 3UNSA 1YCPK 5A09A 3AAUA 4B2BA 1ZHRA 3RUOA 1TRYA 3RXIA 1GMDG 1IQIA 1UVTH 1SQTA 1T8OA 3RU4E 1IQFA 1UTPA 2D2DA 1HXFH 1AD8H 1NU7B 1TPOA 2J9NA 2BY6X 1VJ9U 3LH3A 1MAYA 4DOQA 4CR9A 2BTCE 2PKAB 4AGJA 4HZHA 1O2LA 1C5SA 1DWEH 1DVAH 4INKA 5LPRA 5GJ4B 1XM1A 1NN6A 2ODYB 3T28A 3ZZ5A 1ZHPA 5B6LA 2C4FH 1SGDE 1HAVB 1UK2A 4DW2U 4X2YA 2WSSD 4K60A 4WMDA 2FI5E 3TH3H 3SJKA 3RXAA 1C1QA 3RXPA 2W5EA 3S9BA 4TSFD 1MMJN 5KEDA 3UIRA 1GI6A 1GGDB 1SR5C 3DCLA 5JBTA 1MKWH 5JBBS 1T4VH 3BTQE 1SGPE 2F9NA 3MH7A 2ZTYA 2IJD1 1O5EH 3HK3B 1O33A 1O37A 1BHXB 5C1XA 1NFYA 1LVOA 1HCGA 2C8YB 3K2UA 1CA0C 2Y6TA 1C2HA 2BX4A 1EZUC 3UOUA 4A92A 4NA8A 1QL9A 3LGVA 3ATMA 1PFXC 1Y3WA 1FV9A 2ZF0H 4JZEH 4Y8YA 1O2NA 3GY4A 3ZYEA 1RRKA 1OS8A 3PMBB 4MPVA 2IPHA 1AZ8A 3LH1A 1EAIA 1VITG 2HALA 2OC0A 1K21H 4NGAH 4H6TA 3ZZAA 2FLBH 5F03A 1TPAE 2FP7B 3KQBA 2ZDAH 9ESTA 1HB0B 1G3BA 2J4IA 3FAOA 1ZHMA 1ZJDA 1A61H 3E6PH 4OS1A 4D7FA 1MABB 1NU9A 3BN9A 3TJVA 1BRUP 1U6QA 2G81E 2QE7D 4ZH8A 2AMPA 2QV1A 4B73A 1A4WH 1K1IA 5JBCS 3AAVA 4I8GA 2FOGA 1O2QA 1AVXA 5ABWA 4MNYA 2ANWA 2SGEE 1QRXA 2ZDVH 4OS2A 4Q4LA 2A7JA 3RXHA 2XBWA 1Q3XA 4RI0A 4DCDA 1O2ZA 5EJLA 1LQDB 4JZIA 2VIPA 1C9TA 4NSVA 3SNCA 1K1MA 1SOTA 2NU2E 1BRAA 2H9TH 2OC1A 1TNGA 1B5GH 1EXFA 3ZZCA 1OWIA 2FLRH 2PW8H 3PLKA 4FUFA 1C2JA 3O8RA 1ZTJA 1V2OT 1IHSH 1NC6A 4GPGA 4E05H 3UNQA 1W0JD 3MO9A 4ACAA 3P8GA 5LPEA 1NROH 5CDFE 3TIUA 3GDUA 3F3BA 1THSH 1DITH 1S82A 1TB6H 2JH6D 2ZFPH 3C27B 4I8KA 3LONA 3MI4A 3GDVA 3H7OA 1ZSJA 1MZAA 4IMQA 5GWZA 2J95A 4BAKB 1YWUA 1GHXH 3AW0A 3F9GA 4MPWA 2SNWA 2CN0H 1TIOA 3ATLA 4YOIA 3PB1E 1UTLM 4H6SB 4K8YA 2ZU4A 8KME2 4WF8A 1O5FH 4WMEA 2C8XB 1HPGA 1JRTA 3TVJB 3BSQA 4I86A 2A4OA 2P8OC 2SGFE 4YOJA 2Q6DA 1EJNA 1P2OA 4UFEH 4ABHA 2PUXB 5EQRA 1C2MA 5CMXH 5FPYA 5FHTA 3S9CA 1AHTH 3OEHD 1VKYA 1AMHA 2NU3E 3LDXH 3UAIC 3UR6A 3SOSA 1K22H 3F2GA 1H8IH 1KSNA 3F9EA 3CP7A 1TBRH 5EXMA 2CV3A 5HGGA 1SB1H 4Q7ZA 1W0YH 2AGGX 4B71A 1TWXB 2KX4A 1EZQA 3U8TH 5J4QA 3PLBA 2WYJA 1UK4A 4RT0A 5A0BA 3A88A 2BX3A 3UWIA 1AUJA 4HGCA 3A87A 1C2EA 1FMGA 3Q3XA 1F7ZA 5H4IB 1K0HA 4AN7A 1O31A 5FPSA 1V2ST 3K65B 1GJAB 2VBCA 2HNTE 5IDKA 2CF8H 1SGRE 1QA0A 1XUJA 2BZ6H 3ATKA 4AFSA 2B7DH 1ETTH 4X8TH 3KYFA 1UHBA 1P05A 3E8LA 1Y3YA 3NPSA 5E2OA 2DUCA 5EJ1A 3SI4H 1EUFA 5FXLA 1IQHA 2AIQA 1ZMJA 1YPMH 2RCEA 2D26C 1FXYA 2ZHFH 1SGNE 2FXRA 3TK9A 4IN1A 3R3GB 2AYWA 2BD5A 2ZDNA 2PTCE 1TA2A 1C4Y2 1PPEE 1D3TB 2F9UA 2ZU3A 1TPSA 1CVWH 3HGPA 1TGSZ 3FZZA 5T6GA 3GCOA 2GCTB 2Z9IA 1SGIB 4FUIA 1FONA 3TH2H 2CJIA 1F5KU 3P8OA 4FOUC 2OLGA 3F1SB 2F3CE 1CSOE 1GHBF 2P59A 4WY3A 1GBKA 5DP5A 1RTFB 1UHBB 4JZDH 3EA9A 2FX6A 1NRNH 1SGYE 1D3DB 1K2I1 2Z3EA 3WWBA 1MTNC 3BTDE 2L74A 2LPRA 2PKAA 3RXMA 8ESTE 3MO3A 4KTUA 3ESTA 1IQKA 1GBHA 1LVMA 1TABE 1C5RA 4DIHH 1C1OA 1MD8A 3FP6E 4BNRA 1GBJA 4AYVB 1EJAA 3VB7A 3MWIU 1O32A 4CRBA 3SBKA 1HAOH 2QF5A 5LH8A 2STBE 3PTNA 2ZHEH 1GBDA 2OTVA 2VWMA 3P17H 1RIWB 5A8ZA 1F5RA 1INCA 1S6LA 2JETC 3S7KB 1CGJE 1GMHF 3PV4A 1Z1IA 1O2KA 2ZU2A 1MTWA 1AWHB 1C2FA 4DVAU 4OS7A 3FP7E 3LKWA 2GP9B 2SGPE 4U30A 2RG3A 2FYQA 4ABFA 3OE7D 1P01A 1FX0B 1O2WA 2FS9A 3A82A 4YOGA 1GBEA 3MU4A 1PPCE 1C4U2 2WPMS 3SHCH 4WWYA 4ZUHA 3PO1B 1QIXB 1TGCA 3TH4H 1GHWH 1YLDA 2Y7ZA 3BTWE 1ELBA 1V2KT 4MNWA 4D9QA 5DP7A 2J92A 2EI8A 1NM6A 1UCYE 2BDIA 4CRAA 1CHOF 3U28C 1QRZA 1C1VH 3KHVA 4CR5A 2ALPA 2JDID 4GUXA 1UVSH 1FQ3A 1MKXH 3SGAE 3FANA 1PPZA 1DXWA 4Y76A 2GZ9A 3QLPH 1QBOA 3DSGA 4MLFB 2WUCA 4AORA 4NFFA 2VIVA 4WH6A 3KEEA 2O8UA 4UFFH 5FCRA 1HIAB 1FPHH 1T8MA 1TE0A 2A4GA 1QBVH 2TGAA 2Z9GA 1A3EH 3DA9B 2OBOA 2BQ7B 3TNSA 3U9AH 3UPEA 1BTPA 1DXPA 2R3YA 2W7UA 1OWKA 1H4WA 4Y71A 2XNIA 2P16A 2IOTA 1UVUH 4BXSA 1DPOA 4ZHLU 2JJ1D 3TPIZ 5DKMA 1GHVH 2BHGA 2UUKB 3R0FA 2J5UA 1K1PA 1Y5AT 3GS9A 1L2EA 1BBRE 2M5TA 5E8EH 1O2HA 1UO6A 1Q31A 3TK6A 1NPMA 1TBZH 3MHWU 4AYYB 2AGIX 2KAIA 1ZMNA 1K9OE 2C93B 5A0AE 4D7GA 1HJAC 2HPPH 6CHAC 1SLVB 4ZROA 5EOKA 3SGQE 5FAHA 5DP8A 1ZSLA 1UK3A 5JB8S 2GD4B 1KXAA 5C1YA 4DURA 2TGPZ 5DJ7A 1UTKA 4TPYA 1PQ7A 2XTTB 1TMBH 5EGMA 3M5LA 1CE5A 1TAWA 2OP9A 2XCFA 3O8BA 3OY6U 4GHQA 4NIWA 3T2NA 2KCAA 3OY5U 1QRWA 5FBEA 1Y5UT 5B6OA 3RLYH 2BZAA 1XMNB 3ZZDA 1G9IE 3KNXA 1OP2A 1KXDA 4B6FA 5DO4H 1QB9A 1O3PB 2WV4A 4Y8ZA 3QGNB 1LPGB 1LPKB 5BRRE 3U1JB 3S69A 3F6UH 1YKTA 4KTSA 2WUBA 1SBWA 2G52A 8GCHG 1KDQB 2BOHB 2K1QA 2QYIA 3QTVH 3TJUA 4SGBE 3KN2A 1SOZA 4K2YA 1QR3E 1QTFA 1AZZA 4B6EA 4Y11E 1OPHB 1ID5H 2VU8E 3P8FA 1O2PA 3A7YA 2KM0A 3WW7A 1CQQA 3UWJH 1QJ6B 1SGFA 5HM2A 2ZQ2A 4RSPA 4UONA 3A83A 4ACBA 2ZO3H 3SJ9A 1OWEA 3AVZA 3MH4A 3OAAD 5EPYA 3UOPA 2KR7A 2OQUA 2M2AA 2CHAC 4X6OA 5A0CA 4CH2B 1CBWB 1L0ZA 2EI7A 2YMSC 3EE7A 2G00A 4NG9H 3DD2H 2GCHG 5C5NA 1GI4A 3ZVFA 5EW2H 1GVZA 1C1NA 1C5NH 1DUAA 4VGCC 5A8YA 3ZZBA 2AFQB 4JMYA 1EAWA 3KL6A 2FODA 2BM2A 1GVLA 1P06A 1Y59T 2XW9A 2PKSC 1F0RA 4NA9H 3MNXA 1O3DA 5EXLA 2UUFB 4X1RU 1HJAB 3MNCA 4CRGA 4AGKA 1IQMA 2PKSB 4KTCA 5DP4A 5GIBA 1TX7A 9LPRA 4GCHG 4IMZA 1W11U 5EU8A 5FX5A 1C5MD 4MQAA 2FX4A 2QY0B 3RXFA 4TY6A 1LVYA 1EJMA 2GCTC 2ZPQA 4I32A 3QZRA 1YPHC 1QJ1B 1AO5A 2A1DB 4XDEA 1P2QA 2ZCHP 3KIDU 1MH0A 1QJ7B 2G4TA 1LVBA 1ELTA 4BXWA 2FTLE 1D3PB 2FTMA 3NK8A 2EI6A 3F0PA 2K8IA 2FOCA 3FOAA 1H9IE 8GCHF 3S7HB 2EEKA 1IQLA 1SSXA 1OKXA 3TGIE 1A0HB 1P09A 5F6MA 1C2DA 1DWBH 1ZSKA 5DG6A 3W95A 1OSSA 2V6NA 1T4UH 2K0QA 1Z8JB 1EOJA 4RT1A 1MU8B 4BAHB 1Y3XA 3TITA 1ELCA 1TPPA 1W8BH 1Y8TA 1W13U 2HRVA 3GY5A 4I8HA 4X6MA 2WYGA 4DJZB 1DS2E 1BMAA 3NCLA 4JYVH 5JYIA 2HWLB 3A85A 3ODDA 1C2IA 4AC9A 4OGXA 1DFPA 3QDZB 2TBSA 1P2JA 2HVYB 1PQ5A 2A32A 1P03A 2ZHWH 3BTHE 3SNDA 1DT2A 1NBME 5DPAA 1AB9C 4TT3D 3UUZA 1OWJA 5AVDA 5A8XA 2QN5T 1SKYE 2A45B 2J2UA 1A7SA 1QA7A 4UDWH 2A2QH 4AFUA 4IGDA 1XUKA 2KFWA 1UTNA 2Y5HA 2HLCA 1S0RA 3B8JA 5HXFA 1LQEA 2AHME 3LIWA 3F9FA 1T8NA 1O3JA 4Y6DA 4ZKRU 1BDAA 1SLXB 1UTJA 1Z1JA 1TNLA 1FY4A 4I8JA 3T5FH 4E7RG 4DG4A 3MFJA 1E34B 2A7HA 3HPTB 1TGBA 1O3IA 2B9LA 4X2WA 2ZIQH 5C94A 1HAZB 4CREA 2GVFA 3GY7A 1GJ8B 4AFQA 1P2MA 1VJAU 3RXDA 2KAIB 1TGNA 2HPQH 3GY8A 3DFJA 2DE9A 4R8TB 1WAYB 5CHAB 3GCNA 1C5YB 2KZ4A 2VIOA 1GJCB 4TY7A 1HIAA 1O30A 2J38A 4UE7H 2KCOA 1GJ9B 1CO7E 1OYQA 2VGCB 1MBQA 2BLVA 1C1UH 2ULLA 3DSOA 1C5XB 2YNBA 3LGWA 4A5TS 1SQOA 1KY9A 3RXBA 5AFZH 3N7DA 1E1QD 1WBGB 3BG4C 3IITA 3SQEE 4GAWA 2Z94A 5EG4A 1WYKA 2BXTH 2ZCLP 1SVPA 3N7EA 3N99A 2THFB 3PWBA 3SUDA 1XXDA 1KTSB 1ESAA 5JDUB 1SI5H 2Z9JA 4Q7YA 1LMWB 4YLUA 3PRDA 2BDAA 1Z7KA 4BTTB 1UMAH 1LHGH 5AFYH 2PP6A 1EPTC 1G2MA 1P12E 1ARBA 3FO8D 4PROA 3BIVH 4U01A 3ZVDA 5F53A 2CMYA 5JPMH 3PM3A 1FUJA 5T6FA 1E0FD 3CS0A 4Y0ZE 2EC9H 2OQ5A 3ENSB 1BBRH 1O2VA 4BOHA 4JZFH 1XUIA 4CHAC 4A7IB 4Z0KA 2TGTA 2G55A 1C5OH 1F0UA 1O5CB 2F9BH 2ASUB 2VH0A 1LKBA 1W12U 8LPRA 1DWCH 1EPTA 4H42U 1X7AC 3L33A 5HIYA 2B8OH 3BTKE 3D62A 1TNKA 2ZDKA 3A8BA 4WJG2 4NCYA 3MNSA 4D76A 1LCYA 3RP2A 1NBMD 1TOMH 2GGVB 3P92A 1E38B 1FLEE 5E0GA 3MU8A 2OC8A 3K9XB 1MCVA 1MBMA 2GZ7A 1C2GA 2FOFA 2PSXA 2FOMB 1O5DH 2P94A 3NRLA 1F0SA 1O3NA 1Y3UA 2FWWA 3RDZA 2AGEX 1YPKH 3QX5H 2V3OH 3LGIA 3GCTG 1A2CH 1BIOA 1CBWC 4IC6A 1GI7B 2XNDD 2A4QA 1P3EA 1NO9H 5CE1A 2ZGXH 2HOBA 3A7WA 2V7QD 3A7ZA 4IW4E 3HKIB 3P70B 3PMJA 1T7CA 1MTVA 2XWBI 1QL7A 2ODQA 2EY4C 1WQSA 1NRQH 1COWD 1LHCH 1QBNA 1ESBA 4DGJA 5GDSH 4ISOA 3NKKA 1RTLA 1J16A 3MU1A 3TGJE 1D9IA 3RXOA 2LP6A 1GCDA 2QXJA 2JIZD 2UWLA 1GMDF 4CBNA 1DANH 4ISLA 3SJOA 5KGOA 1VITF 2HGTH 4Q7XA 1CGIE 4X2XA 1GMHG 1PYTC 2GV7A 2FOHA 4FUCA 4JYUH 5HIZA 3RM2H 3ZZ6A 1AGJA 3SHAH 2QXHA 4DT7B 3GYLB 5EW1H 3SU6A 1GI2A 3MTYA 2ZHDA 1GBTA 1TONA 1TBQH 2ESTE 3U1IB 1DLKB 1GVKB 3HATH 1J9CH 3ZV9A 1GPZA 2FS8A 3BG8A 3GY6A 2H9HA 1V2LT 4X2VA 3U8RH 3ZVBA 3TJNA 1H9HE 2W7SA 2W6ID 1D4PB 4KELA 1N6XA 4HTCH 4NWKA 5DP9A 3ODFA 4Z6AH 3DSPA 1CT4E 4GVUA 1GJBB 1HBTH 2PGBB 3LT3A 1CHOG 1LPZB 1MKXK 1E79D 1OYTH 1JXPA 3ZZ4A 3SU1A 3LOXA 3KQDA 1ANEA 1O2YA 4YXWD 2ZDMA 4MTBA 4K1EA 2LNCA 3HK6B 1T31A 4I7YH 4I8LA 4U32A 1WQVH 2J98A 1EOLA 2R9PA 3RMNH 1GMCG 4UFGH 1P0SH 2WHXA 3QWCH 1GJ7B 4A1TA 2FOAA 4WMFA 4Y10E 4UEHH 3A8AA 1GDNA 1SGQE 2CGAA 5ESBA 4YTAA 1UTQA 1SFIA 3P8NA 4CRCA 1F0TA 1ZLRA 3DFLA 3SU5A 1XVOA 4ZMAH 1FIWA 3O8DA 2TGDA 2ANKH 1O2RA 1Z8GA 1TLDA 3E90B 3VB3A 2Y7XA 1KXCA 1V2MT 3I78A 2ZWLH 1SLWB 1GI0A 3PYHA 2GTBA 5E0JA 4LXBH 1DUEA 5LGOA 3SU0A 1HRTH 4FU7A 1S5SA 2YOLA 3STIA 4IBLH 1GI1A 1VZQH 1XX9A 2GDDA 1KLTA 2I6SA 1KIGH 4NWLA 2VINA 4LOYH 1O3GA 1O3KA 1ANCA 5C2ZA 2PTNA 4IN2A 2WV9A 1MTSA 4TPIZ 1P9SA 2YMSB 2WPLS 3PV2A 3TGKE 2BOKA 2KCPA 3L6PA 1S0QA 4ZHAA 2NU1E 1GDQA 1EZSC 3FN8A 7KMEH 2HNTF 1SHHB 2O8LA 1NFWA 3VFEA 1DY8A 4OGYA 2J34A 1H1BA 1P2IA 5IYTA 1K28D 1HUTH 3GYMA 3RXUA 2O8MA 1NZQH 3H09A 5BPEA 3G01A 1HNEE 1CU1A 1JWTA 4WXIA 1O34A 2AMQA 1ELVA 3VPKA 1V2NT 3RC4A 1GBBA 3V12A 1LO6A 2V35A 2F43B 4KKDA 1RGQA 2BY9X 1AWFH 1YLNA 2UUYA 4AG1A 4AB9A 2VNTA 3A8DA 2XBXA 3BG4B 4GHTA 1NRPH 2XYAA 4H4FA 4Q63A 1KXFA 2VB0A 4GCHF 2R3UA 2PFEA 1HAGE 5DSFA 1GI3A 1ZGIA 5FX6A 1YPEH 2QCYA 3EYDA 1UCYK 4FUHA 1MD7A 1ZZZA 4Y79A 3ATIA 1W2KH 3M5NA 1MQ6A 2BY8X 2L6OA 1OP8A 1GI8B 1IQGA 1VCQA 2ZFRH 1VITH 4YZUA 1ESTA 3LC3A 1ANDA 4FETA 5T6DA 3SW2B 6CHAB 1B0FA 1RD3B 1SQAA 2BLWA 2O8TA 1ZTLA 2OC7A 3ZIAD 1BMLA 3ZZ7A 2GJGA 2VVCA 2PV9B 4R0IA 1JMOH 3EDXB 2FO9A 3BF6H 2BVSH 1ORFA 2A5AA 3ZZ3A 4Y7AA 3M3VA 4RN6A 1A3BH 3UQOA 1TRMA 2QGRA 3VG8A 4DIIH 2W6JD 2BLQA 2GKVE 3E1XB 1QFKH 2VH6A 2VWOA 1ZRKA 3E3TA 1UTOA 1H8ED 3Q00A 3TNTA 1S83A 1YM0A 3O8CA 2ZU1A 1HDTH 2J94A 2ZGHA 1G30B 2STAE 1BITA 3GICB 1P2KA 4OS6A 5F8ZA 3SV8A 3NZIA 3D65E 1TX6A 4O9VA 1O2UA 4CBOA 2HVXA 1EB1H 4O3UA 1BRCE 1NT1A 4ASUD 4JCNA 4RKOB 4HG6A 4ABJA 3TK5A 5C1UA 3RC6A 3PO1C 2NWNA 2OUAA 2QAAA 3MH6A 4P00A 2ANMH 2ZTXA 3MYWA 4Y0YE 2YNAA 3MO6A 1ZTKA 2IJOB 3FKSD 4Q80A 3OYPA 2Y5GA 3B23B 2ZECA 4X1SU 1BHXF 2A5KA 2G51A 3SV2H 1T8LA 5I25A 3F2FA 3SU3A 1SMFE 1T32A 5KECA 4JZ1A 1P2NA 1BMMH 1MQ5A 3V7TA 1C5LH 4K3JA 5DK1A 1P3CA 1XXFA 2F91A 3ITIA 1V2PT 7ESTE 2A4RA 3EQ0H 3M5MA 1AE8H 3AASA 1FNIA 3BV9B 1GJ4H 2SGQE 3KGPA 1MTUA 1A46H 1V2UT 2P3TB 2ZP0H 1OXGA 1OX1A 3M36A 3OX7U 1O3AA 1C1WH 3SU4A 1HLTH 4AB8A 1JBUH 1O2MA 3EA7A 1O3EA 4MNVA 2BVRH 5E0HA 2Z9KA 1FY1A 2CXVA 1C5PA 1KXEA 3RLWH 2BQ6B 4YT6H 2BY7X 2H2ZA 1AU8A 1Z8RA 4ABGA 4BANB 1A0JA 1DE7H 1C1TA 1OWDA 5TCAA 2GT7A 1ETRH 1YPHE 3SZEA 3SO3A 4ESTE 2JKHA 3M35A 1AIXH 1P57B 1C5VA 1G2LA 3D23A 3N7OA 2VVUA 2AH4X 3SV6A 1NY22 3TLOA 1QURH 1C1SA 1GL0E 3LPRA 2BD3A 1ZGVA 1GGDC 4KP0A 1EP6A 1PPBH 1TNIA 3A7VA 5GCHG 4BAMB 4A6LA 1AVGH 1G3EA 5F8TA 3LJJA 1O0DH 3Q3YA 3P95A 2AS9A 1TFXA 4AOQA 1O3CA 1YF4A 5LPFA 3A80A 1GBLA 4Y7BA 1YP9A 2ILNA 4F49A 1GCTB 1C5UA 1EFRD 2XBYA 3VGCB 1DSTA 1BTWA 1QB1A 4DY7B 2VIDA 2FI3E 4XD7D 2A2XH 3SJ8A 2BB4A 3RXLA 2H5CA 5GPIB 3VB4A 1BMNH 1ABIH 1H8DH 4FU9A 1GI5A 2CK3D 1O2TA 2J98B 1NS3A 2FI4E 4E06H 4MNXA 3QO6A 2KCYA 3ZVGA 1ETSH 5CHBA 1HFDA 3E0NB 4F4OC 5EPNA 3NUMA 1V2WT 2BDBA 3UNRA 1TX8A 4MVNA 1ANBA 1Y5BT 4CH8B 1YC0A 2UUJB 3SI3H 2V3HH 2RA0A 1BZXE 2WZQA 3E91A 2A0QB 2Z3CA 1XUFA 2BXUH 2ZNKH 1ELAA 2H9EH 3OTJE 2IPQX 4FU8A 3JZ2B 3I29A 3PMHB 3SU2A 6GCHG 2PHBA 4A1XA 1MKWK 1SHYA 2CF9H 2GDEH 4BTUB 1GHYH 1KTTB 3EGKH 3FP8E 3RU4T 1QGFA 1E35B 3U98H 1EB2A 2BD7A 1YGCH 2TPIZ 2QF4A 2QXGA 1N8OC 1HXEH 2ZEBA 1AQ7A 1Z71A 1O36A 1K1OA 2QF0A 2WPJS 3VXEH 3K6YA 3A84A 4WH8A 4FVBA 3UR9A 2H6MA 5PTPA 4ZAEA 1UCYH 4ASHA 3MQKC 4NFEA 5AHGH 2FZZA 1FAXA 4DT4A 4Z1MD 3SUEA 2ZFSA 4QT8C 4K8BA 1ELDE 3RXJA 1GHBG 2I6QA 2YMSD 4ABDA 1FZZA 2V3MA 4IS5A 1GJ6A 1WU1A 1HAIH 3RMLH 2FDAA 2Z3DA 1PQAA 3T27A 5DP3A 1GI9B 2AIPA 1LHFH 1SGEE 2ZGJA 4CHAB 2AMDA 3RU4D 1PQ8A 2WPKS 7GCHG 5C0UA 2A7CA 1MU6B 5TJXA 4O03A 4FUBA 1CA0B 1RFNA 1GWAA 3SUGA 1W3CA 2BYAX 1Y3VA 1V6DA 2D1JA 4AZ2B 5C20A 3F2HA 3SNEA 4YT7H 3CS7A 3T29A 5L6NH 2BLOA 1BTXA 3TU7H 2RA3A 1C2LA 1GBAA 5FPTA 1EAUA 1WOFA 1ZR0A 2PLXA 4ISHH 4OS5A 3RXEA 1WXRA 1BA8B
chains in the Genus database with same CATH topology
2HLDD 2K1QA 3OTPA 2YMSB 5T1VA 2CK3D 2OBQA 3KN2A 5GJ4B 3PV2A 1NS3A 1W0JD 2K0QA 2OK5A 4ASUD 3FO8D 4B6EA 2KCPA 3L6PA 4U01A 5B6LA 2F4LA 5EQQA 3SU6A 5C17A 5F53A 2KCYA 3FN8A 3RC6A 5CDFE 5CHBA 2KM0A 3WW7A 5EPNA 2WSSD 5EQSA 1DY8A 1E1RD 3F3BA 3U1IB 3SV7A 3SYJA 3LONA 2IJOB 2JDID 3FKSD 2O8MA 2WZQA 3OYPA 3H09A 4TSFD 1DXWA 2F9UA 1CU1A 3F2FA 3OAAD 5EPYA 3SU3A 1BT7A 2KR7A 3DCLA 3SU2A 2W6ID 3RC4A 1A1RA 1BMFD 2M2AA 3KEEA 4WH6A 4A1XA 4NWKA 3KF2A 2F43B 1RGQA 3P8OA 1NBME 3DSPA 2IJD1 2A4GA 2YMSC 1H8HD 4I33A 4ZCNA 4TT3D 4WF8A 2A4RA 2JJ2D 3M5MA 2OBOA 1E79D 1SKYE 2P59A 2XOKD 4Q63A 5ETXA 1JXPA 2QF4A 3PV5A 4A92A 3SU1A 3LOXA 1DXPA 1NBMD 2GGVB 3SU4A 4OM9A 5FL7D 4YXWD 1DY9A 4JMYA 2XNIA 5DSFA 2OC8A 3W1EA 4B75A 4M9FA 5EQRA 2KFWA 4WH8A 5IK2D 3PRBA 2JJ1D 3EYDA 2AHME 5FPYA 1KMHB 3OEED 1OHHD 3WWBA 4A1TA 2J5UA 2WHXA 2OC0A 3GS9A 3SV9A 4TYDA 3OEHD 2XCNA 3M5NA 2FOMB 2F9VA 5C0TA 3WWFA 3AK5A 2FP7B 4KTCA 4DT4A 3F2GA 5ESBA 4Z1MD 2L6OA 3SUEA 2WPDD 3NRLA 5HKKD 2GVFA 3P8NA 1MABB 4K8BA 4FETA 3SU5A 3SZEA 4B71A 3O8DA 2YMSD 2OC7A 2QE7D 3ZIAD 3UB0A 2QF5A 3OFND 2QV1A 4R8TB 2XNDD 2A4QA 3SV6A 2LELA 3E90B 3SUFA 4B73A 4F55A 3M5OA 4A1VA 2KZ4A 2FM2A 4I32A 4B74A 5GNDA 3F0OA 3VG8A 5H4IB 5FPSA 4Q4LA 1S6LA 3M5LA 2V7QD 2W6JD 2XCFA 3SU0A 2KCOA 3O8BA 1W0KD 5C0UA 2YOLA 2KCAA 2VBCA 3DSOA 4I31A 1COWD 1N1LA 4RI0A 3RC5A 3SUGA 1EFRD 1W3CA 3N7DA 3LKWA 4NWLA 1E1QD 5IDKA 1H8ED 2K8IA 3F0PA 3KNXA 4B76A 3O8CA 4B6FA 1RTLA 3FOAA 3F2HA 3N99A 3N7EA 3OE7D 2OC1A 5DN6D 1FX0B 2OINA 2JIZD 4XD7D 3SUDA 5FPTA 3U1JB 2WV9A 3SV8A 1WXRA 3O8RA 3PRDA 5GPIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCP A;  2KCO A;  2KCY A; 
#chains in the Genus database with same CATH topology
 1EAX A;  1SGF G;  2DE8 A;  1C5Z B;  2OBQ A;  2WPI S;  3QUM P;  1THR H;  3GCH B;  2UWP A;  3T62 A;  4X6P A;  3E0P B;  1P04 A;  3HKJ B;  4GLY A;  1WUN H;  1GG6 C;  1MCT A;  2XWA A;  2OCV B;  2ZFQ H;  4NZL A;  1GHA F;  2O8W A;  1GJD B;  2NU0 E;  1JIR A;  3RXC A;  1OP0 A;  1KXB A;  3CEN A;  2JH0 D;  3SV7 A;  2C8W B;  2FPZ A;  5JB9 S;  4XRN A;  2GX4 A;  1C1R A;  1J15 A;  4ZKS U;  1M9U A;  1EPT B;  4O97 A;  4YO9 A;  7LPR A;  3D49 H;  2R0L A;  1XKB C;  1WV7 H;  1HJ9 A;  3DT0 H;  3F68 H;  2ZPR A;  1L4Z A;  1ELE E;  5J4S A;  1HJ8 A;  2RFK C;  2QXI A;  4P02 A;  1GBC A;  1TYN A;  3BEF B;  1UJ1 A;  4X8V H;  7GCH F;  1GHA G;  2VIQ A;  4MPU A;  4SGA E;  2VGC C;  5FL7 D;  3RXG A;  1MUE B;  1RJX B;  1J14 A;  3PWC A;  5IK2 D;  1YBW A;  3UQV A;  2V0B A;  3UY9 A;  4XE4 A;  3UTU H;  5L2Y H;  3C1K A;  5DP6 A;  1BTH H;  1NFX A;  3OU0 A;  1IHT H;  3SV9 A;  1BCU H;  1WCZ A;  4FUE A;  4INH A;  3WWF A;  2F9P A;  2ZHQ H;  1AFQ B;  1AKS B;  1XUH A;  2TIO A;  1HAV A;  2BD4 A;  1AKS A;  2NU4 E;  2G5N A;  3A86 A;  3U69 H;  6GCH F;  5K7R A;  3SN8 A;  2UWO A;  3SJI A;  4CRD A;  1GBF A;  1W14 U;  3SUF A;  1F92 A;  3M5O A;  3SZN A;  2R0K A;  3SOR A;  3LGU A;  2GMT C;  1LDT T;  2PSY A;  2ZU5 A;  1WDI A;  4LK4 A;  2ZCK P;  5FCK A;  3EAJ A;  2XC4 A;  3QK1 A;  1N1L A;  3RC5 A;  3RMM H;  1NTP A;  3QGJ A;  1ZPB A;  1AVW A;  1S81 A;  2BMG B;  2PGQ B;  3P6Z B;  4GSO A;  4CRF A;  3RXQ A;  3SNB A;  1QNJ A;  1O2I A;  1C9P A;  2FEQ H;  4FUG A;  1F5L A;  3IG6 B;  3RXK A;  1ZRB A;  1O5G H;  1C1M A;  3JZ1 B;  3MU0 A;  1DX5 M;  1HAP H;  3VEQ B;  5C3N A;  1G3C A;  2Y5F A;  4X6N A;  4ABE A;  2OK5 A;  4D8N A;  3F9H A;  1FN8 A;  1VR1 H;  2SFA A;  3V3M A;  4ZXX H;  1CT0 E;  5F8X A;  2BDH A;  1BBR K;  5C5O A;  1E1R D;  3M37 A;  4J1Y A;  2EQN A;  3SYJ A;  2Q1J A;  3QN7 A;  1XVM A;  3K6Z A;  1IOE A;  3RXV A;  4FXG H;  4JYT A;  2Q6G A;  1TNJ A;  1QQ4 A;  1K1J A;  3NXP A;  1BMF D;  1NRS H;  3V0X A;  4XOJ A;  1ZPC A;  4HFP B;  1O5A B;  1TOC B;  2AER H;  2R2M B;  3QTO H;  1V2R T;  1C2K A;  4K69 A;  2PWX A;  3BTM E;  1H8H D;  5GXP A;  3KQC A;  1UTM A;  2ZQ1 A;  1K1L A;  2G5V A;  1G36 A;  1D6R A;  5EXN A;  3BTT E;  1DM4 B;  1EAS A;  3KCG H;  3V13 A;  1C4V 2;  1KDQ A;  2GMT B;  1FI8 A;  3H7T A;  4B75 A;  1XUG A;  1SGC A;  2FES H;  2BD9 A;  4XBC A;  2H5D A;  1KMH B;  1O38 A;  4ISN A;  3M7Q A;  1GMC F;  1YPG H;  3PLP A;  1GJ5 H;  1JRS A;  1BTY A;  1V2V T;  2VVV A;  4FVD A;  2ZGB H;  3MOC A;  1O35 A;  2Z7F E;  1UW7 A;  4X8S H;  5EST E;  1F2S E;  4Y8X A;  3LGT A;  1VGC B;  1L1J A;  1ACB E;  2P3U B;  3LC5 A;  4F55 A;  2IN2 A;  1AB9 B;  4B74 A;  5GND A;  1H9L B;  4YM9 A;  4X1Q U;  1FJS A;  3ELA H;  4FUJ A;  1D3Q B;  1V2Q T;  1W7X H;  5HMA A;  2F83 A;  1W0K D;  1TQ0 B;  4MDS A;  1FPC H;  1GBM A;  1O3M A;  2QIQ A;  4B2C A;  2FOE A;  4BAO B;  4B76 A;  1YPJ H;  4LZ1 H;  3SQH E;  1GG6 B;  1DSU A;  3Q77 A;  4UD9 H;  3DUX H;  5DN6 D;  1LHD H;  4NIX A;  2GCH F;  2WIN I;  2P93 A;  3RXR A;  1HAH H;  3FVF B;  3M7U A;  2HNT C;  2HLD D;  2GT8 A;  1Q2W A;  3OTP A;  5T1V A;  1BJV A;  1SC8 U;  1PPG E;  2Y82 A;  4ZHM U;  1V2J T;  3A81 A;  1FAK H;  4X1N U;  1YY3 A;  5GCH F;  5C17 A;  1V3X A;  4WXV A;  1P10 A;  2ZPS A;  2FOB A;  1K1N A;  5EQS A;  3VB5 A;  2H1U A;  5HYO A;  1QQU A;  1BTZ A;  3NWU A;  4UFD H;  1DOJ A;  2GV6 A;  3GCH C;  3SGB E;  1EZX C;  1RS0 A;  3LJO A;  1W7G H;  3URD A;  1AUT C;  2ZZU H;  2ZC9 H;  2PUQ H;  1AI8 H;  1RTK A;  1BT7 A;  4XBB A;  2WV5 A;  1P8V C;  1O3H A;  1EQ9 A;  1J17 T;  3A8C A;  4I33 A;  2Y81 A;  4ZCN A;  1LTO A;  4ABA A;  3GCT F;  1PYT D;  3M61 U;  4XFQ A;  3PV5 A;  1PJP A;  5L30 H;  3AW1 A;  4O3T A;  1FY8 E;  4TWW A;  4AG2 A;  3RXT A;  1DY9 A;  1Z8I B;  3W1E A;  4M9F A;  2J97 A;  5I46 H;  1P11 E;  2Q6F A;  1D6W A;  1HV7 A;  3PRB A;  1SPJ A;  3ZYD A;  5EIY A;  6EST A;  1AE5 A;  5FBI A;  1S85 A;  2XBV A;  1GBI A;  1VCW A;  2JET B;  1ELF A;  5C0T A;  3AK5 A;  2Z9L A;  3ZV8 A;  2W26 A;  1G32 B;  1TMT H;  1C5T A;  1IAU A;  2FMJ A;  1ZOM A;  3MNB A;  2XRC A;  2W3I A;  1ZML A;  1SG8 B;  1AFE H;  4VGC B;  1YLC A;  2QC2 A;  2ANY A;  1BQY A;  2VIW A;  2LEL A;  3M7T A;  5G4B A;  1MAX A;  3GOV B;  1TA6 A;  1QL8 A;  4X0W U;  3EE0 B;  1AFQ C;  1DLE A;  1L1N A;  2C8Z B;  1UVP A;  3ZVE A;  1ARC A;  3F0O A;  1CHG A;  1O3L A;  1YCP H;  3FZD A;  1CGH A;  1SFQ B;  4NSY A;  4LZ4 B;  2SGD E;  1EP5 A;  2ALV A;  1KLI H;  3KYG A;  2Z6B D;  2D8W A;  5TCC A;  1P02 A;  4YLQ H;  1BJU A;  1SQR A;  4WVP E;  3KQE A;  2OIN A;  1L1G A;  2PR3 A;  1HYL A;  1QCP A;  1HGT H;  2B5T B;  3KQ5 A;  4ZXY H;  3ZZ8 A;  3GY3 A;  2C90 B;  3IWM A;  1FY3 A;  3SNA A;  1SLU B;  4FUD A;  2WPH S;  1XKA C;  4B1T A;  1JIM A;  2B0F A;  2BDC A;  6LPR A;  4X8U H;  5E2P A;  2G8T A;  1Z6E A;  4NIY A;  2F4L A;  5EQQ A;  4TWY A;  1TGT A;  2A5I A;  2ZFT A;  1VCP A;  1HAX B;  3RM0 H;  1S6H A;  1O2J A;  1A5I A;  5SGA E;  5L2Z H;  3Q76 A;  1BOQ A;  4ABI A;  2RDE A;  1O39 A;  4ISI H;  3I77 A;  1O2G H;  3S9A A;  1O2S A;  2BY5 X;  3A7T A;  5K0H A;  1A1R A;  1Z6J H;  5CHA C;  1DWD H;  3Q3K A;  5A2M H;  2ZKS A;  3EA8 A;  1O3O A;  3GDS A;  1BUI A;  3L3T A;  4D9R A;  3RXS A;  2C3S A;  1GHZ A;  1HAY B;  3PRO A;  2XOK D;  1DDJ A;  1EX3 A;  1S6F A;  2OD3 B;  1G3D A;  1YCP M;  3BTE E;  3T25 A;  3VB6 A;  4OM9 A;  3E16 B;  4JK6 A;  2JH5 D;  4MG3 A;  1PPF E;  4J2Y B;  2OXS A;  1BB0 B;  4XBD A;  4XSK U;  1ZYO A;  1FY5 A;  1MTN B;  1RIW C;  1E37 B;  2R2W U;  5T3H A;  1GL1 A;  1OWH A;  3HGN A;  4INL A;  2AEI H;  4E7N A;  4TYD A;  2XCN A;  1JOU B;  1ELG A;  2ZA5 A;  1J8A A;  2F9V A;  1BRB E;  1VGC C;  3S0N A;  1FN6 A;  4M7G A;  1YPL H;  2ZTZ A;  4NIV A;  4B2A A;  1IQN A;  4AX9 H;  2WPD D;  3URE A;  4YES B;  1CT2 E;  5C67 A;  1LHE H;  2ZDL A;  1C5Q A;  2GZ8 A;  3BTG E;  3GIS B;  1QB6 A;  3UB0 A;  2ZGC A;  1TAL A;  1QHR B;  1N8O B;  1A5G H;  1IQE A;  2Y80 A;  2RDL A;  3BTF E;  1AY6 H;  1AN1 E;  2XC0 A;  5EJZ A;  4MPX A;  3UFA A;  5HM9 A;  1ABJ H;  2ZG0 H;  3U8O H;  4Q2K A;  1G37 A;  3ATW A;  4NA7 A;  1C5W B;  1DIC A;  1KYN A;  1B7X B;  2A31 A;  3ZVC A;  2BD8 A;  2O9Q A;  1E36 B;  1W10 U;  4I31 A;  1SL3 A;  2BQW B;  3BEI B;  1LKA A;  1WTG H;  4THN H;  4K1T A;  3W94 A;  3OSY A;  2ZI2 H;  3H5C B;  1O5B B;  3ZZ9 A;  4K1S A;  1SGT A;  1KLJ H;  2FYR A;  3A7X A;  2VWL A;  5EOD A;  1B0E A;  1O3B A;  1MZD A;  1NFU A;  1O2O A;  4ZKO U;  1O2X A;  1V2T T;  3FFG A;  4OS4 A;  1QZ8 A;  3GY2 A;  4JK5 A;  1BTU A;  1EAT A;  3MU5 A;  3T26 A;  1C1P A;  1TQ7 B;  3MH5 A;  3PTB A;  1ZJK A;  1EKB B;  4IC5 A;  3B9F H;  3URC A;  1PPH E;  1OOK B;  2P95 A;  3PMA B;  1TNH A;  2ZFF H;  1W0Z U;  4K5Z A;  1THP B;  1O3F A;  1TRN A;  1NES E;  4AFZ A;  3KF2 A;  1A5H A;  5JBA S;  3BEU A;  1S84 A;  1CA8 B;  3M3T A;  1L4D A;  4HI3 A;  4NZQ A;  1UVO A;  4ZKN U;  2JJ2 D;  2QA9 E;  5ETX A;  1YYY 1;  3MMG A;  1RXP A;  3LGY A;  1FIZ A;  1IQJ A;  1P9U A;  3VGC C;  1NRR H;  3TJO A;  2F9O A;  2SNV A;  1GCT C;  3ZVA A;  4U2W A;  3CNR A;  2FIR H;  3OEE D;  1OHH D;  3M3S A;  3LU9 B;  1TMU H;  2SGA A;  3QZQ A;  2XXL A;  4F48 B;  4BAQ B;  1A0L A;  1GDU A;  2VJ1 A;  5DGJ A;  3BIU H;  1ZPZ A;  5AF9 H;  2P8O B;  3RMO H;  4X1P U;  3STJ A;  2ODP A;  2BDY A;  4KGA A;  3VXF H;  5HKK D;  2EA3 A;  2BD2 A;  2BDG A;  2BVX H;  2P3F H;  3WY8 A;  2VWN A;  1QY6 A;  3A89 A;  3OFN D;  4RKJ B;  2G4U A;  2CHA B;  1WTH D;  2QF3 A;  4A1V A;  2XC5 A;  2FM2 A;  4ABB A;  1N6Y A;  4BTI B;  1WSS H;  3DHK H;  1FDP A;  2TRM A;  2W3K A;  3UNS A;  1YCP K;  5A09 A;  3AAU A;  4B2B A;  1ZHR A;  3RUO A;  1TRY A;  3RXI A;  1GMD G;  1IQI A;  1UVT H;  1SQT A;  1T8O A;  3RU4 E;  1IQF A;  1UTP A;  2D2D A;  1HXF H;  1AD8 H;  1NU7 B;  1TPO A;  2J9N A;  2BY6 X;  1VJ9 U;  3LH3 A;  1MAY A;  4DOQ A;  4CR9 A;  2BTC E;  2PKA B;  4AGJ A;  4HZH A;  1O2L A;  1C5S A;  1DWE H;  1DVA H;  4INK A;  5LPR A;  5GJ4 B;  1XM1 A;  1NN6 A;  2ODY B;  3T28 A;  3ZZ5 A;  1ZHP A;  5B6L A;  2C4F H;  1SGD E;  1HAV B;  1UK2 A;  4DW2 U;  4X2Y A;  2WSS D;  4K60 A;  4WMD A;  2FI5 E;  3TH3 H;  3SJK A;  3RXA A;  1C1Q A;  3RXP A;  2W5E A;  3S9B A;  4TSF D;  1MMJ N;  5KED A;  3UIR A;  1GI6 A;  1GGD B;  1SR5 C;  3DCL A;  5JBT A;  1MKW H;  5JBB S;  1T4V H;  3BTQ E;  1SGP E;  2F9N A;  3MH7 A;  2ZTY A;  2IJD 1;  1O5E H;  3HK3 B;  1O33 A;  1O37 A;  1BHX B;  5C1X A;  1NFY A;  1LVO A;  1HCG A;  2C8Y B;  3K2U A;  1CA0 C;  2Y6T A;  1C2H A;  2BX4 A;  1EZU C;  3UOU A;  4A92 A;  4NA8 A;  1QL9 A;  3LGV A;  3ATM A;  1PFX C;  1Y3W A;  1FV9 A;  2ZF0 H;  4JZE H;  4Y8Y A;  1O2N A;  3GY4 A;  3ZYE A;  1RRK A;  1OS8 A;  3PMB B;  4MPV A;  2IPH A;  1AZ8 A;  3LH1 A;  1EAI A;  1VIT G;  2HAL A;  2OC0 A;  1K21 H;  4NGA H;  4H6T A;  3ZZA A;  2FLB H;  5F03 A;  1TPA E;  2FP7 B;  3KQB A;  2ZDA H;  9EST A;  1HB0 B;  1G3B A;  2J4I A;  3FAO A;  1ZHM A;  1ZJD A;  1A61 H;  3E6P H;  4OS1 A;  4D7F A;  1MAB B;  1NU9 A;  3BN9 A;  3TJV A;  1BRU P;  1U6Q A;  2G81 E;  2QE7 D;  4ZH8 A;  2AMP A;  2QV1 A;  4B73 A;  1A4W H;  1K1I A;  5JBC S;  3AAV A;  4I8G A;  2FOG A;  1O2Q A;  1AVX A;  5ABW A;  4MNY A;  2ANW A;  2SGE E;  1QRX A;  2ZDV H;  4OS2 A;  4Q4L A;  2A7J A;  3RXH A;  2XBW A;  1Q3X A;  4RI0 A;  4DCD A;  1O2Z A;  5EJL A;  1LQD B;  4JZI A;  2VIP A;  1C9T A;  4NSV A;  3SNC A;  1K1M A;  1SOT A;  2NU2 E;  1BRA A;  2H9T H;  2OC1 A;  1TNG A;  1B5G H;  1EXF A;  3ZZC A;  1OWI A;  2FLR H;  2PW8 H;  3PLK A;  4FUF A;  1C2J A;  3O8R A;  1ZTJ A;  1V2O T;  1IHS H;  1NC6 A;  4GPG A;  4E05 H;  3UNQ A;  1W0J D;  3MO9 A;  4ACA A;  3P8G A;  5LPE A;  1NRO H;  5CDF E;  3TIU A;  3GDU A;  3F3B A;  1THS H;  1DIT H;  1S82 A;  1TB6 H;  2JH6 D;  2ZFP H;  3C27 B;  4I8K A;  3LON A;  3MI4 A;  3GDV A;  3H7O A;  1ZSJ A;  1MZA A;  4IMQ A;  5GWZ A;  2J95 A;  4BAK B;  1YWU A;  1GHX H;  3AW0 A;  3F9G A;  4MPW A;  2SNW A;  2CN0 H;  1TIO A;  3ATL A;  4YOI A;  3PB1 E;  1UTL M;  4H6S B;  4K8Y A;  2ZU4 A;  8KME 2;  4WF8 A;  1O5F H;  4WME A;  2C8X B;  1HPG A;  1JRT A;  3TVJ B;  3BSQ A;  4I86 A;  2A4O A;  2P8O C;  2SGF E;  4YOJ A;  2Q6D A;  1EJN A;  1P2O A;  4UFE H;  4ABH A;  2PUX B;  5EQR A;  1C2M A;  5CMX H;  5FPY A;  5FHT A;  3S9C A;  1AHT H;  3OEH D;  1VKY A;  1AMH A;  2NU3 E;  3LDX H;  3UAI C;  3UR6 A;  3SOS A;  1K22 H;  3F2G A;  1H8I H;  1KSN A;  3F9E A;  3CP7 A;  1TBR H;  5EXM A;  2CV3 A;  5HGG A;  1SB1 H;  4Q7Z A;  1W0Y H;  2AGG X;  4B71 A;  1TWX B;  2KX4 A;  1EZQ A;  3U8T H;  5J4Q A;  3PLB A;  2WYJ A;  1UK4 A;  4RT0 A;  5A0B A;  3A88 A;  2BX3 A;  3UWI A;  1AUJ A;  4HGC A;  3A87 A;  1C2E A;  1FMG A;  3Q3X A;  1F7Z A;  5H4I B;  1K0H A;  4AN7 A;  1O31 A;  5FPS A;  1V2S T;  3K65 B;  1GJA B;  2VBC A;  2HNT E;  5IDK A;  2CF8 H;  1SGR E;  1QA0 A;  1XUJ A;  2BZ6 H;  3ATK A;  4AFS A;  2B7D H;  1ETT H;  4X8T H;  3KYF A;  1UHB A;  1P05 A;  3E8L A;  1Y3Y A;  3NPS A;  5E2O A;  2DUC A;  5EJ1 A;  3SI4 H;  1EUF A;  5FXL A;  1IQH A;  2AIQ A;  1ZMJ A;  1YPM H;  2RCE A;  2D26 C;  1FXY A;  2ZHF H;  1SGN E;  2FXR A;  3TK9 A;  4IN1 A;  3R3G B;  2AYW A;  2BD5 A;  2ZDN A;  2PTC E;  1TA2 A;  1C4Y 2;  1PPE E;  1D3T B;  2F9U A;  2ZU3 A;  1TPS A;  1CVW H;  3HGP A;  1TGS Z;  3FZZ A;  5T6G A;  3GCO A;  2GCT B;  2Z9I A;  1SGI B;  4FUI A;  1FON A;  3TH2 H;  2CJI A;  1F5K U;  3P8O A;  4FOU C;  2OLG A;  3F1S B;  2F3C E;  1CSO E;  1GHB F;  2P59 A;  4WY3 A;  1GBK A;  5DP5 A;  1RTF B;  1UHB B;  4JZD H;  3EA9 A;  2FX6 A;  1NRN H;  1SGY E;  1D3D B;  1K2I 1;  2Z3E A;  3WWB A;  1MTN C;  3BTD E;  2L74 A;  2LPR A;  2PKA A;  3RXM A;  8EST E;  3MO3 A;  4KTU A;  3EST A;  1IQK A;  1GBH A;  1LVM A;  1TAB E;  1C5R A;  4DIH H;  1C1O A;  1MD8 A;  3FP6 E;  4BNR A;  1GBJ A;  4AYV B;  1EJA A;  3VB7 A;  3MWI U;  1O32 A;  4CRB A;  3SBK A;  1HAO H;  2QF5 A;  5LH8 A;  2STB E;  3PTN A;  2ZHE H;  1GBD A;  2OTV A;  2VWM A;  3P17 H;  1RIW B;  5A8Z A;  1F5R A;  1INC A;  1S6L A;  2JET C;  3S7K B;  1CGJ E;  1GMH F;  3PV4 A;  1Z1I A;  1O2K A;  2ZU2 A;  1MTW A;  1AWH B;  1C2F A;  4DVA U;  4OS7 A;  3FP7 E;  3LKW A;  2GP9 B;  2SGP E;  4U30 A;  2RG3 A;  2FYQ A;  4ABF A;  3OE7 D;  1P01 A;  1FX0 B;  1O2W A;  2FS9 A;  3A82 A;  4YOG A;  1GBE A;  3MU4 A;  1PPC E;  1C4U 2;  2WPM S;  3SHC H;  4WWY A;  4ZUH A;  3PO1 B;  1QIX B;  1TGC A;  3TH4 H;  1GHW H;  1YLD A;  2Y7Z A;  3BTW E;  1ELB A;  1V2K T;  4MNW A;  4D9Q A;  5DP7 A;  2J92 A;  2EI8 A;  1NM6 A;  1UCY E;  2BDI A;  4CRA A;  1CHO F;  3U28 C;  1QRZ A;  1C1V H;  3KHV A;  4CR5 A;  2ALP A;  2JDI D;  4GUX A;  1UVS H;  1FQ3 A;  1MKX H;  3SGA E;  3FAN A;  1PPZ A;  1DXW A;  4Y76 A;  2GZ9 A;  3QLP H;  1QBO A;  3DSG A;  4MLF B;  2WUC A;  4AOR A;  4NFF A;  2VIV A;  4WH6 A;  3KEE A;  2O8U A;  4UFF H;  5FCR A;  1HIA B;  1FPH H;  1T8M A;  1TE0 A;  2A4G A;  1QBV H;  2TGA A;  2Z9G A;  1A3E H;  3DA9 B;  2OBO A;  2BQ7 B;  3TNS A;  3U9A H;  3UPE A;  1BTP A;  1DXP A;  2R3Y A;  2W7U A;  1OWK A;  1H4W A;  4Y71 A;  2XNI A;  2P16 A;  2IOT A;  1UVU H;  4BXS A;  1DPO A;  4ZHL U;  2JJ1 D;  3TPI Z;  5DKM A;  1GHV H;  2BHG A;  2UUK B;  3R0F A;  2J5U A;  1K1P A;  1Y5A T;  3GS9 A;  1L2E A;  1BBR E;  2M5T A;  5E8E H;  1O2H A;  1UO6 A;  1Q31 A;  3TK6 A;  1NPM A;  1TBZ H;  3MHW U;  4AYY B;  2AGI X;  2KAI A;  1ZMN A;  1K9O E;  2C93 B;  5A0A E;  4D7G A;  1HJA C;  2HPP H;  6CHA C;  1SLV B;  4ZRO A;  5EOK A;  3SGQ E;  5FAH A;  5DP8 A;  1ZSL A;  1UK3 A;  5JB8 S;  2GD4 B;  1KXA A;  5C1Y A;  4DUR A;  2TGP Z;  5DJ7 A;  1UTK A;  4TPY A;  1PQ7 A;  2XTT B;  1TMB H;  5EGM A;  3M5L A;  1CE5 A;  1TAW A;  2OP9 A;  2XCF A;  3O8B A;  3OY6 U;  4GHQ A;  4NIW A;  3T2N A;  2KCA A;  3OY5 U;  1QRW A;  5FBE A;  1Y5U T;  5B6O A;  3RLY H;  2BZA A;  1XMN B;  3ZZD A;  1G9I E;  3KNX A;  1OP2 A;  1KXD A;  4B6F A;  5DO4 H;  1QB9 A;  1O3P B;  2WV4 A;  4Y8Z A;  3QGN B;  1LPG B;  1LPK B;  5BRR E;  3U1J B;  3S69 A;  3F6U H;  1YKT A;  4KTS A;  2WUB A;  1SBW A;  2G52 A;  8GCH G;  1KDQ B;  2BOH B;  2K1Q A;  2QYI A;  3QTV H;  3TJU A;  4SGB E;  3KN2 A;  1SOZ A;  4K2Y A;  1QR3 E;  1QTF A;  1AZZ A;  4B6E A;  4Y11 E;  1OPH B;  1ID5 H;  2VU8 E;  3P8F A;  1O2P A;  3A7Y A;  2KM0 A;  3WW7 A;  1CQQ A;  3UWJ H;  1QJ6 B;  1SGF A;  5HM2 A;  2ZQ2 A;  4RSP A;  4UON A;  3A83 A;  4ACB A;  2ZO3 H;  3SJ9 A;  1OWE A;  3AVZ A;  3MH4 A;  3OAA D;  5EPY A;  3UOP A;  2KR7 A;  2OQU A;  2M2A A;  2CHA C;  4X6O A;  5A0C A;  4CH2 B;  1CBW B;  1L0Z A;  2EI7 A;  2YMS C;  3EE7 A;  2G00 A;  4NG9 H;  3DD2 H;  2GCH G;  5C5N A;  1GI4 A;  3ZVF A;  5EW2 H;  1GVZ A;  1C1N A;  1C5N H;  1DUA A;  4VGC C;  5A8Y A;  3ZZB A;  2AFQ B;  4JMY A;  1EAW A;  3KL6 A;  2FOD A;  2BM2 A;  1GVL A;  1P06 A;  1Y59 T;  2XW9 A;  2PKS C;  1F0R A;  4NA9 H;  3MNX A;  1O3D A;  5EXL A;  2UUF B;  4X1R U;  1HJA B;  3MNC A;  4CRG A;  4AGK A;  1IQM A;  2PKS B;  4KTC A;  5DP4 A;  5GIB A;  1TX7 A;  9LPR A;  4GCH G;  4IMZ A;  1W11 U;  5EU8 A;  5FX5 A;  1C5M D;  4MQA A;  2FX4 A;  2QY0 B;  3RXF A;  4TY6 A;  1LVY A;  1EJM A;  2GCT C;  2ZPQ A;  4I32 A;  3QZR A;  1YPH C;  1QJ1 B;  1AO5 A;  2A1D B;  4XDE A;  1P2Q A;  2ZCH P;  3KID U;  1MH0 A;  1QJ7 B;  2G4T A;  1LVB A;  1ELT A;  4BXW A;  2FTL E;  1D3P B;  2FTM A;  3NK8 A;  2EI6 A;  3F0P A;  2K8I A;  2FOC A;  3FOA A;  1H9I E;  8GCH F;  3S7H B;  2EEK A;  1IQL A;  1SSX A;  1OKX A;  3TGI E;  1A0H B;  1P09 A;  5F6M A;  1C2D A;  1DWB H;  1ZSK A;  5DG6 A;  3W95 A;  1OSS A;  2V6N A;  1T4U H;  2K0Q A;  1Z8J B;  1EOJ A;  4RT1 A;  1MU8 B;  4BAH B;  1Y3X A;  3TIT A;  1ELC A;  1TPP A;  1W8B H;  1Y8T A;  1W13 U;  2HRV A;  3GY5 A;  4I8H A;  4X6M A;  2WYG A;  4DJZ B;  1DS2 E;  1BMA A;  3NCL A;  4JYV H;  5JYI A;  2HWL B;  3A85 A;  3ODD A;  1C2I A;  4AC9 A;  4OGX A;  1DFP A;  3QDZ B;  2TBS A;  1P2J A;  2HVY B;  1PQ5 A;  2A32 A;  1P03 A;  2ZHW H;  3BTH E;  3SND A;  1DT2 A;  1NBM E;  5DPA A;  1AB9 C;  4TT3 D;  3UUZ A;  1OWJ A;  5AVD A;  5A8X A;  2QN5 T;  1SKY E;  2A45 B;  2J2U A;  1A7S A;  1QA7 A;  4UDW H;  2A2Q H;  4AFU A;  4IGD A;  1XUK A;  2KFW A;  1UTN A;  2Y5H A;  2HLC A;  1S0R A;  3B8J A;  5HXF A;  1LQE A;  2AHM E;  3LIW A;  3F9F A;  1T8N A;  1O3J A;  4Y6D A;  4ZKR U;  1BDA A;  1SLX B;  1UTJ A;  1Z1J A;  1TNL A;  1FY4 A;  4I8J A;  3T5F H;  4E7R G;  4DG4 A;  3MFJ A;  1E34 B;  2A7H A;  3HPT B;  1TGB A;  1O3I A;  2B9L A;  4X2W A;  2ZIQ H;  5C94 A;  1HAZ B;  4CRE A;  2GVF A;  3GY7 A;  1GJ8 B;  4AFQ A;  1P2M A;  1VJA U;  3RXD A;  2KAI B;  1TGN A;  2HPQ H;  3GY8 A;  3DFJ A;  2DE9 A;  4R8T B;  1WAY B;  5CHA B;  3GCN A;  1C5Y B;  2KZ4 A;  2VIO A;  1GJC B;  4TY7 A;  1HIA A;  1O30 A;  2J38 A;  4UE7 H;  2KCO A;  1GJ9 B;  1CO7 E;  1OYQ A;  2VGC B;  1MBQ A;  2BLV A;  1C1U H;  2ULL A;  3DSO A;  1C5X B;  2YNB A;  3LGW A;  4A5T S;  1SQO A;  1KY9 A;  3RXB A;  5AFZ H;  3N7D A;  1E1Q D;  1WBG B;  3BG4 C;  3IIT A;  3SQE E;  4GAW A;  2Z94 A;  5EG4 A;  1WYK A;  2BXT H;  2ZCL P;  1SVP A;  3N7E A;  3N99 A;  2THF B;  3PWB A;  3SUD A;  1XXD A;  1KTS B;  1ESA A;  5JDU B;  1SI5 H;  2Z9J A;  4Q7Y A;  1LMW B;  4YLU A;  3PRD A;  2BDA A;  1Z7K A;  4BTT B;  1UMA H;  1LHG H;  5AFY H;  2PP6 A;  1EPT C;  1G2M A;  1P12 E;  1ARB A;  3FO8 D;  4PRO A;  3BIV H;  4U01 A;  3ZVD A;  5F53 A;  2CMY A;  5JPM H;  3PM3 A;  1FUJ A;  5T6F A;  1E0F D;  3CS0 A;  4Y0Z E;  2EC9 H;  2OQ5 A;  3ENS B;  1BBR H;  1O2V A;  4BOH A;  4JZF H;  1XUI A;  4CHA C;  4A7I B;  4Z0K A;  2TGT A;  2G55 A;  1C5O H;  1F0U A;  1O5C B;  2F9B H;  2ASU B;  2VH0 A;  1LKB A;  1W12 U;  8LPR A;  1DWC H;  1EPT A;  4H42 U;  1X7A C;  3L33 A;  5HIY A;  2B8O H;  3BTK E;  3D62 A;  1TNK A;  2ZDK A;  3A8B A;  4WJG 2;  4NCY A;  3MNS A;  4D76 A;  1LCY A;  3RP2 A;  1NBM D;  1TOM H;  2GGV B;  3P92 A;  1E38 B;  1FLE E;  5E0G A;  3MU8 A;  2OC8 A;  3K9X B;  1MCV A;  1MBM A;  2GZ7 A;  1C2G A;  2FOF A;  2PSX A;  2FOM B;  1O5D H;  2P94 A;  3NRL A;  1F0S A;  1O3N A;  1Y3U A;  2FWW A;  3RDZ A;  2AGE X;  1YPK H;  3QX5 H;  2V3O H;  3LGI A;  3GCT G;  1A2C H;  1BIO A;  1CBW C;  4IC6 A;  1GI7 B;  2XND D;  2A4Q A;  1P3E A;  1NO9 H;  5CE1 A;  2ZGX H;  2HOB A;  3A7W A;  2V7Q D;  3A7Z A;  4IW4 E;  3HKI B;  3P70 B;  3PMJ A;  1T7C A;  1MTV A;  2XWB I;  1QL7 A;  2ODQ A;  2EY4 C;  1WQS A;  1NRQ H;  1COW D;  1LHC H;  1QBN A;  1ESB A;  4DGJ A;  5GDS H;  4ISO A;  3NKK A;  1RTL A;  1J16 A;  3MU1 A;  3TGJ E;  1D9I A;  3RXO A;  2LP6 A;  1GCD A;  2QXJ A;  2JIZ D;  2UWL A;  1GMD F;  4CBN A;  1DAN H;  4ISL A;  3SJO A;  5KGO A;  1VIT F;  2HGT H;  4Q7X A;  1CGI E;  4X2X A;  1GMH G;  1PYT C;  2GV7 A;  2FOH A;  4FUC A;  4JYU H;  5HIZ A;  3RM2 H;  3ZZ6 A;  1AGJ A;  3SHA H;  2QXH A;  4DT7 B;  3GYL B;  5EW1 H;  3SU6 A;  1GI2 A;  3MTY A;  2ZHD A;  1GBT A;  1TON A;  1TBQ H;  2EST E;  3U1I B;  1DLK B;  1GVK B;  3HAT H;  1J9C H;  3ZV9 A;  1GPZ A;  2FS8 A;  3BG8 A;  3GY6 A;  2H9H A;  1V2L T;  4X2V A;  3U8R H;  3ZVB A;  3TJN A;  1H9H E;  2W7S A;  2W6I D;  1D4P B;  4KEL A;  1N6X A;  4HTC H;  4NWK A;  5DP9 A;  3ODF A;  4Z6A H;  3DSP A;  1CT4 E;  4GVU A;  1GJB B;  1HBT H;  2PGB B;  3LT3 A;  1CHO G;  1LPZ B;  1MKX K;  1E79 D;  1OYT H;  1JXP A;  3ZZ4 A;  3SU1 A;  3LOX A;  3KQD A;  1ANE A;  1O2Y A;  4YXW D;  2ZDM A;  4MTB A;  4K1E A;  2LNC A;  3HK6 B;  1T31 A;  4I7Y H;  4I8L A;  4U32 A;  1WQV H;  2J98 A;  1EOL A;  2R9P A;  3RMN H;  1GMC G;  4UFG H;  1P0S H;  2WHX A;  3QWC H;  1GJ7 B;  4A1T A;  2FOA A;  4WMF A;  4Y10 E;  4UEH H;  3A8A A;  1GDN A;  1SGQ E;  2CGA A;  5ESB A;  4YTA A;  1UTQ A;  1SFI A;  3P8N A;  4CRC A;  1F0T A;  1ZLR A;  3DFL A;  3SU5 A;  1XVO A;  4ZMA H;  1FIW A;  3O8D A;  2TGD A;  2ANK H;  1O2R A;  1Z8G A;  1TLD A;  3E90 B;  3VB3 A;  2Y7X A;  1KXC A;  1V2M T;  3I78 A;  2ZWL H;  1SLW B;  1GI0 A;  3PYH A;  2GTB A;  5E0J A;  4LXB H;  1DUE A;  5LGO A;  3SU0 A;  1HRT H;  4FU7 A;  1S5S A;  2YOL A;  3STI A;  4IBL H;  1GI1 A;  1VZQ H;  1XX9 A;  2GDD A;  1KLT A;  2I6S A;  1KIG H;  4NWL A;  2VIN A;  4LOY H;  1O3G A;  1O3K A;  1ANC A;  5C2Z A;  2PTN A;  4IN2 A;  2WV9 A;  1MTS A;  4TPI Z;  1P9S A;  2YMS B;  2WPL S;  3PV2 A;  3TGK E;  2BOK A;  2KCP A;  3L6P A;  1S0Q A;  4ZHA A;  2NU1 E;  1GDQ A;  1EZS C;  3FN8 A;  7KME H;  2HNT F;  1SHH B;  2O8L A;  1NFW A;  3VFE A;  1DY8 A;  4OGY A;  2J34 A;  1H1B A;  1P2I A;  5IYT A;  1K28 D;  1HUT H;  3GYM A;  3RXU A;  2O8M A;  1NZQ H;  3H09 A;  5BPE A;  3G01 A;  1HNE E;  1CU1 A;  1JWT A;  4WXI A;  1O34 A;  2AMQ A;  1ELV A;  3VPK A;  1V2N T;  3RC4 A;  1GBB A;  3V12 A;  1LO6 A;  2V35 A;  2F43 B;  4KKD A;  1RGQ A;  2BY9 X;  1AWF H;  1YLN A;  2UUY A;  4AG1 A;  4AB9 A;  2VNT A;  3A8D A;  2XBX A;  3BG4 B;  4GHT A;  1NRP H;  2XYA A;  4H4F A;  4Q63 A;  1KXF A;  2VB0 A;  4GCH F;  2R3U A;  2PFE A;  1HAG E;  5DSF A;  1GI3 A;  1ZGI A;  5FX6 A;  1YPE H;  2QCY A;  3EYD A;  1UCY K;  4FUH A;  1MD7 A;  1ZZZ A;  4Y79 A;  3ATI A;  1W2K H;  3M5N A;  1MQ6 A;  2BY8 X;  2L6O A;  1OP8 A;  1GI8 B;  1IQG A;  1VCQ A;  2ZFR H;  1VIT H;  4YZU A;  1EST A;  3LC3 A;  1AND A;  4FET A;  5T6D A;  3SW2 B;  6CHA B;  1B0F A;  1RD3 B;  1SQA A;  2BLW A;  2O8T A;  1ZTL A;  2OC7 A;  3ZIA D;  1BML A;  3ZZ7 A;  2GJG A;  2VVC A;  2PV9 B;  4R0I A;  1JMO H;  3EDX B;  2FO9 A;  3BF6 H;  2BVS H;  1ORF A;  2A5A A;  3ZZ3 A;  4Y7A A;  3M3V A;  4RN6 A;  1A3B H;  3UQO A;  1TRM A;  2QGR A;  3VG8 A;  4DII H;  2W6J D;  2BLQ A;  2GKV E;  3E1X B;  1QFK H;  2VH6 A;  2VWO A;  1ZRK A;  3E3T A;  1UTO A;  1H8E D;  3Q00 A;  3TNT A;  1S83 A;  1YM0 A;  3O8C A;  2ZU1 A;  1HDT H;  2J94 A;  2ZGH A;  1G30 B;  2STA E;  1BIT A;  3GIC B;  1P2K A;  4OS6 A;  5F8Z A;  3SV8 A;  3NZI A;  3D65 E;  1TX6 A;  4O9V A;  1O2U A;  4CBO A;  2HVX A;  1EB1 H;  4O3U A;  1BRC E;  1NT1 A;  4ASU D;  4JCN A;  4RKO B;  4HG6 A;  4ABJ A;  3TK5 A;  5C1U A;  3RC6 A;  3PO1 C;  2NWN A;  2OUA A;  2QAA A;  3MH6 A;  4P00 A;  2ANM H;  2ZTX A;  3MYW A;  4Y0Y E;  2YNA A;  3MO6 A;  1ZTK A;  2IJO B;  3FKS D;  4Q80 A;  3OYP A;  2Y5G A;  3B23 B;  2ZEC A;  4X1S U;  1BHX F;  2A5K A;  2G51 A;  3SV2 H;  1T8L A;  5I25 A;  3F2F A;  3SU3 A;  1SMF E;  1T32 A;  5KEC A;  4JZ1 A;  1P2N A;  1BMM H;  1MQ5 A;  3V7T A;  1C5L H;  4K3J A;  5DK1 A;  1P3C A;  1XXF A;  2F91 A;  3ITI A;  1V2P T;  7EST E;  2A4R A;  3EQ0 H;  3M5M A;  1AE8 H;  3AAS A;  1FNI A;  3BV9 B;  1GJ4 H;  2SGQ E;  3KGP A;  1MTU A;  1A46 H;  1V2U T;  2P3T B;  2ZP0 H;  1OXG A;  1OX1 A;  3M36 A;  3OX7 U;  1O3A A;  1C1W H;  3SU4 A;  1HLT H;  4AB8 A;  1JBU H;  1O2M A;  3EA7 A;  1O3E A;  4MNV A;  2BVR H;  5E0H A;  2Z9K A;  1FY1 A;  2CXV A;  1C5P A;  1KXE A;  3RLW H;  2BQ6 B;  4YT6 H;  2BY7 X;  2H2Z A;  1AU8 A;  1Z8R A;  4ABG A;  4BAN B;  1A0J A;  1DE7 H;  1C1T A;  1OWD A;  5TCA A;  2GT7 A;  1ETR H;  1YPH E;  3SZE A;  3SO3 A;  4EST E;  2JKH A;  3M35 A;  1AIX H;  1P57 B;  1C5V A;  1G2L A;  3D23 A;  3N7O A;  2VVU A;  2AH4 X;  3SV6 A;  1NY2 2;  3TLO A;  1QUR H;  1C1S A;  1GL0 E;  3LPR A;  2BD3 A;  1ZGV A;  1GGD C;  4KP0 A;  1EP6 A;  1PPB H;  1TNI A;  3A7V A;  5GCH G;  4BAM B;  4A6L A;  1AVG H;  1G3E A;  5F8T A;  3LJJ A;  1O0D H;  3Q3Y A;  3P95 A;  2AS9 A;  1TFX A;  4AOQ A;  1O3C A;  1YF4 A;  5LPF A;  3A80 A;  1GBL A;  4Y7B A;  1YP9 A;  2ILN A;  4F49 A;  1GCT B;  1C5U A;  1EFR D;  2XBY A;  3VGC B;  1DST A;  1BTW A;  1QB1 A;  4DY7 B;  2VID A;  2FI3 E;  4XD7 D;  2A2X H;  3SJ8 A;  2BB4 A;  3RXL A;  2H5C A;  5GPI B;  3VB4 A;  1BMN H;  1ABI H;  1H8D H;  4FU9 A;  1GI5 A;  2CK3 D;  1O2T A;  2J98 B;  1NS3 A;  2FI4 E;  4E06 H;  4MNX A;  3QO6 A;  2KCY A;  3ZVG A;  1ETS H;  5CHB A;  1HFD A;  3E0N B;  4F4O C;  5EPN A;  3NUM A;  1V2W T;  2BDB A;  3UNR A;  1TX8 A;  4MVN A;  1ANB A;  1Y5B T;  4CH8 B;  1YC0 A;  2UUJ B;  3SI3 H;  2V3H H;  2RA0 A;  1BZX E;  2WZQ A;  3E91 A;  2A0Q B;  2Z3C A;  1XUF A;  2BXU H;  2ZNK H;  1ELA A;  2H9E H;  3OTJ E;  2IPQ X;  4FU8 A;  3JZ2 B;  3I29 A;  3PMH B;  3SU2 A;  6GCH G;  2PHB A;  4A1X A;  1MKW K;  1SHY A;  2CF9 H;  2GDE H;  4BTU B;  1GHY H;  1KTT B;  3EGK H;  3FP8 E;  3RU4 T;  1QGF A;  1E35 B;  3U98 H;  1EB2 A;  2BD7 A;  1YGC H;  2TPI Z;  2QF4 A;  2QXG A;  1N8O C;  1HXE H;  2ZEB A;  1AQ7 A;  1Z71 A;  1O36 A;  1K1O A;  2QF0 A;  2WPJ S;  3VXE H;  3K6Y A;  3A84 A;  4WH8 A;  4FVB A;  3UR9 A;  2H6M A;  5PTP A;  4ZAE A;  1UCY H;  4ASH A;  3MQK C;  4NFE A;  5AHG H;  2FZZ A;  1FAX A;  4DT4 A;  4Z1M D;  3SUE A;  2ZFS A;  4QT8 C;  4K8B A;  1ELD E;  3RXJ A;  1GHB G;  2I6Q A;  2YMS D;  4ABD A;  1FZZ A;  2V3M A;  4IS5 A;  1GJ6 A;  1WU1 A;  1HAI H;  3RML H;  2FDA A;  2Z3D A;  1PQA A;  3T27 A;  5DP3 A;  1GI9 B;  2AIP A;  1LHF H;  1SGE E;  2ZGJ A;  4CHA B;  2AMD A;  3RU4 D;  1PQ8 A;  2WPK S;  7GCH G;  5C0U A;  2A7C A;  1MU6 B;  5TJX A;  4O03 A;  4FUB A;  1CA0 B;  1RFN A;  1GWA A;  3SUG A;  1W3C A;  2BYA X;  1Y3V A;  1V6D A;  2D1J A;  4AZ2 B;  5C20 A;  3F2H A;  3SNE A;  4YT7 H;  3CS7 A;  3T29 A;  5L6N H;  2BLO A;  1BTX A;  3TU7 H;  2RA3 A;  1C2L A;  1GBA A;  5FPT A;  1EAU A;  1WOF A;  1ZR0 A;  2PLX A;  4ISH H;  4OS5 A;  3RXE A;  1WXR A;  1BA8 B; 
#chains in the Genus database with same CATH homology
 2HLD D;  2K1Q A;  3OTP A;  2YMS B;  5T1V A;  2CK3 D;  2OBQ A;  3KN2 A;  5GJ4 B;  3PV2 A;  1NS3 A;  1W0J D;  2K0Q A;  2OK5 A;  4ASU D;  3FO8 D;  4B6E A;  2KCP A;  3L6P A;  4U01 A;  5B6L A;  2F4L A;  5EQQ A;  3SU6 A;  5C17 A;  5F53 A;  2KCY A;  3FN8 A;  3RC6 A;  5CDF E;  5CHB A;  2KM0 A;  3WW7 A;  5EPN A;  2WSS D;  5EQS A;  1DY8 A;  1E1R D;  3F3B A;  3U1I B;  3SV7 A;  3SYJ A;  3LON A;  2IJO B;  2JDI D;  3FKS D;  2O8M A;  2WZQ A;  3OYP A;  3H09 A;  4TSF D;  1DXW A;  2F9U A;  1CU1 A;  3F2F A;  3OAA D;  5EPY A;  3SU3 A;  1BT7 A;  2KR7 A;  3DCL A;  3SU2 A;  2W6I D;  3RC4 A;  1A1R A;  1BMF D;  2M2A A;  3KEE A;  4WH6 A;  4A1X A;  4NWK A;  3KF2 A;  2F43 B;  1RGQ A;  3P8O A;  1NBM E;  3DSP A;  2IJD 1;  2A4G A;  2YMS C;  1H8H D;  4I33 A;  4ZCN A;  4TT3 D;  4WF8 A;  2A4R A;  2JJ2 D;  3M5M A;  2OBO A;  1E79 D;  1SKY E;  2P59 A;  2XOK D;  4Q63 A;  5ETX A;  1JXP A;  2QF4 A;  3PV5 A;  4A92 A;  3SU1 A;  3LOX A;  1DXP A;  1NBM D;  2GGV B;  3SU4 A;  4OM9 A;  5FL7 D;  4YXW D;  1DY9 A;  4JMY A;  2XNI A;  5DSF A;  2OC8 A;  3W1E A;  4B75 A;  4M9F A;  5EQR A;  2KFW A;  4WH8 A;  5IK2 D;  3PRB A;  2JJ1 D;  3EYD A;  2AHM E;  5FPY A;  1KMH B;  3OEE D;  1OHH D;  3WWB A;  4A1T A;  2J5U A;  2WHX A;  2OC0 A;  3GS9 A;  3SV9 A;  4TYD A;  3OEH D;  2XCN A;  3M5N A;  2FOM B;  2F9V A;  5C0T A;  3WWF A;  3AK5 A;  2FP7 B;  4KTC A;  4DT4 A;  3F2G A;  5ESB A;  4Z1M D;  2L6O A;  3SUE A;  2WPD D;  3NRL A;  5HKK D;  2GVF A;  3P8N A;  1MAB B;  4K8B A;  4FET A;  3SU5 A;  3SZE A;  4B71 A;  3O8D A;  2YMS D;  2OC7 A;  2QE7 D;  3ZIA D;  3UB0 A;  2QF5 A;  3OFN D;  2QV1 A;  4R8T B;  2XND D;  2A4Q A;  3SV6 A;  2LEL A;  3E90 B;  3SUF A;  4B73 A;  4F55 A;  3M5O A;  4A1V A;  2KZ4 A;  2FM2 A;  4I32 A;  4B74 A;  5GND A;  3F0O A;  3VG8 A;  5H4I B;  5FPS A;  4Q4L A;  1S6L A;  3M5L A;  2V7Q D;  2W6J D;  2XCF A;  3SU0 A;  2KCO A;  3O8B A;  1W0K D;  5C0U A;  2YOL A;  2KCA A;  2VBC A;  3DSO A;  4I31 A;  1COW D;  1N1L A;  4RI0 A;  3RC5 A;  3SUG A;  1EFR D;  1W3C A;  3N7D A;  3LKW A;  4NWL A;  1E1Q D;  5IDK A;  1H8E D;  2K8I A;  3F0P A;  3KNX A;  4B76 A;  3O8C A;  4B6F A;  1RTL A;  3FOA A;  3F2H A;  3N99 A;  3N7E A;  3OE7 D;  2OC1 A;  5DN6 D;  1FX0 B;  2OIN A;  2JIZ D;  4XD7 D;  3SUD A;  5FPT A;  3U1J B;  2WV9 A;  3SV8 A;  1WXR A;  3O8R A;  3PRD A;  5GPI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...