2KCYA

Solution structure of ribosomal protein s8e from methanothermobacter thermautotrophicus, northeaststructural genomics consortium (nesg) target tr71d
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
GDRRVRLIRTRGGNTKVRLASDTRINVVDPETGKVEIAEIRNVVENTANPHFVRRNIITRGAVVETNLGNVRVTSRPGQDGVINGVLIRELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30S ribosomal protein S8e
publication title SOLUTION STRUCTURE OF RIBOSOMAL PROTEIN S8E FROM Methanothermobacter thermautotrophicus, NORTHEASTSTRUCTURAL GENOMICS CONSORTIUM (NESG) TARGET TR71D
rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
molecule tags Ribosomal protein
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2008-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.310 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2kcyA01
2KCPA 2KCOA 2KCYA
chains in the Genus database with same CATH superfamily
4FUCA 3IWMA 1O2VA 1W0JD 4ZKSU 1UTLM 3ZYEA 4ABHA 1G3EA 1ESAA 3AASA 1WXRA 4MPWA 4AG2A 2V0BA 1TNIA 4NA8A 1C5ZB 1HRTH 9ESTA 1JBUH 5C0TA 1GJAB 1TNJA 1GBFA 4CR5A 2Z3DA 1YP9A 4MPVA 4X2VA 4AFQA 1ZPBA 2BDBA 3UNQA 4E06H 4JZFH 1BBRE 3A8CA 4F55A 1FNIA 2Y7XA 1TMBH 3P8OA 3U8RH 4WY3A 1GHVH 1S6HA 4WH6A 2BQ7B 2GT7A 3CNRA 4ISNA 1S85A 3S7KB 1YPKH 2W6JD 1GMCG 1Q2WA 2ZCKP 1C2KA 2SGFE 3ZZ5A 1MKXH 1AU8A 2FOMB 2P3TB 1ID5H 3RXRA 3STJA 4CHAB 2F43B 4J2YB 1AHTH 1W2KH 1WQVH 2EI7A 3A7ZA 3JZ1B 3V0XA 2VB0A 3VFEA 2ZHDA 3RXFA 1HAGE 4Q63A 2V6NA 1LHGH 2J94A 3QO6A 4ZXYH 1SMFE 4ABGA 3MNCA 3OTJE 5C5OA 1SQOA 5LH8A 4FUGA 1XKAC 3T26A 1KLIH 2GCTB 4A5TS 5E0GA 2H5CA 4X2WA 2GVFA 1QA0A 3B9FH 4FU9A 2BXTH 1TOMH 5A0BA 1N8OC 5GNDA 1T4UH 3PMBB 3RMOH 2ZPRA 1BRBE 3ENSB 3Q00A 3FP7E 1XMNB 5C1UA 1CA8B 1NFUA 3SU3A 2M2AA 1DDJA 5A8YA 1EKBB 1MTNC 2WHXA 2ZFSA 5EPNA 3EQ0H 1GL0E 2BQ6B 2TGDA 2V3OH 2YOLA 4FVBA 2VGCB 1TGTA 1DXPA 1GHBF 4B6FA 1O3IA 2ZTZA 3FZDA 1RD3B 3RMLH 2XCFA 3BTWE 5TCAA 4U30A 1QFKH 1TX8A 3MU5A 4WH8A 1MKWK 1YWUA 3ATIA 4ZHAA 1SGYE 3GS9A 2P8OC 3SJOA 2FOAA 1FZZA 1XM1A 1XX9A 3U8OH 2R3UA 4QT8C 2CXVA 5DJ7A 4D9RA 3RMNH 3HK3B 3SUFA 5BRRE 1HCGA 3ZZAA 1OXGA 1QURH 1XUHA 3P17H 4UD9H 5AFZH 1ARCA 2AGIX 4E7NA 1BTXA 2XXLA 1V2MT 2BYAX 1SSXA 2FESH 1EATA 1ZLRA 3RXOA 5HYOA 1P9UA 4X8UH 2WPJS 1KXCA 1O3HA 3RM0H 3DSGA 1ZRBA 4MNVA 2CF8H 2ZPSA 3BG4C 2FX6A 3LC5A 1AVWA 1DUAA 2ZQ2A 3PLPA 1Y3XA 1QB9A 2ZI2H 2BB4A 1T8LA 4DIIH 3MH6A 1A0LA 2R0LA 1Z71A 1CHGA 3EGKH 4M9FA 2CK3D 3A8BA 1MBMA 1O2GH 1TYNA 1ZSJA 2XYAA 1GI6A 5JYIA 3M5MA 1BZXE 4R0IA 1BHXB 1FPCH 1TOCB 2XBXA 1HAZB 3UQOA 3VGCC 4K8BA 3ZVEA 4UFGH 1YPMH 5LPEA 5CE1A 2OBOA 3MI4A 2FOFA 4INHA 1GHXH 3LDXH 4IC6A 3LGVA 1QBNA 1C2LA 2ZTXA 1VGCB 4BNRA 3AW0A 1NRSH 1OWIA 3JZ2B 1ARBA 1RJXB 4WJG2 2V3MA 1NESE 1EOJA 1EP6A 2QXIA 1V2JT 1QRXA 6GCHG 1LVMA 2VH6A 3ZZ4A 1QRWA 4UFDH 4AYVB 1ZPCA 4ISIH 1JIMA 4XE4A 4SGBE 1Y59T 4Z1MD 1TQ0B 1MZDA 5C1XA 5E2PA 1GJDB 2BD5A 1TPOA 1DLKB 1GJ7B 1EB2A 1SGIB 2H6MA 1DWEH 2FZZA 5LGOA 3SNBA 5DN6D 1BTHH 2OP9A 3MH7A 3HKIB 3Q3KA 1GVZA 1NM6A 4ASHA 2HALA 1IQKA 3L3TA 5EJZA 5I46H 2J97A 5GDSH 4ZH8A 1LDTT 2GMTC 1GWAA 2B5TB 3TH2H 4BTIB 4YOGA 1UVTH 2AEIH 2XNIA 4GCHG 3LJOA 4DG4A 1GBBA 1J9CH 4BTUB 1LQEA 1E1RD 3S9CA 2ZA5A 1OP0A 1E1QD 2J98B 5T6GA 4NSYA 3BTTE 1FX0B 4K1TA 2ZFFH 1GDUA 2BVSH 2VH0A 4NA7A 2QF4A 3PROA 1E35B 5DP3A 1C1UH 3RC4A 2GV7A 1AVGH 2BDYA 3ITIA 1OP2A 3SV8A 1A46H 1AUTC 3RLWH 4Q7ZA 3ATKA 3STIA 3SUDA 5GPIB 1TA2A 2ZC9H 3T62A 1BTWA 4ZUHA 4Y7BA 1GBHA 2P94A 5B6OA 1DITH 1SQRA 3SV7A 1L4DA 1FIZA 1Z7KA 1T8MA 3MHWU 3RXEA 2ZWLH 2KR7A 2JJ1D 2ZPQA 3DT0H 4ZROA 3SV6A 2VVUA 2JH0D 1ELGA 1HPGA 4B75A 1NRQH 3MMGA 1O2YA 4YO9A 1GHAF 3VPKA 2ODQA 1F0RA 1HAVA 1HXEH 2YNAA 1LMWB 4NGAH 7KMEH 1O3EA 1SC8U 2NU3E 2QXJA 3E3TA 3F2GA 3TJUA 1C1QA 2VBCA 1W14U 1Y5BT 5DG6A 5G4BA 4DW2U 1O2XA 4GLYA 5AVDA 2ZQ1A 1VITF 5C67A 1OPHB 1KXDA 1K22H 3M5NA 2P95A 1P2OA 1C5OH 2F4LA 1CO7E 2AIQA 2BVRH 1LO6A 1HGTH 4CH2B 3M3SA 1V2KT 3TGJE 1C5QA 1LHDH 1VJAU 1QB6A 4IMQA 1DY9A 1LKAA 2ZGXH 5HGGA 4MNWA 2FWWA 2G5NA 4B73A 1GI0A 1C1NA 2AMPA 2VINA 3ZV9A 1GMHF 1O2QA 2ILNA 4AORA 1Z8JB 1KXBA 1O2NA 1BJVA 5FL7D 3RC6A 2ANYA 2TPIZ 1SQTA 1W0ZU 3M61U 4GVUA 2KAIA 1TALA 3RXGA 4O03A 1ANEA 3ZZ8A 1IQGA 3SNEA 2A0QB 2ZDAH 4XBBA 1O2JA 1NRRH 2VWNA 1CBWB 3LOXA 3LGYA 2WUBA 4ZXXH 4INLA 1AKSB 3ZZ6A 1DOJA 1SLUB 3OTPA 2PGBB 4FUIA 3M7UA 2FOBA 2ZU4A 4HZHA 3K2UA 1GHZA 3SUEA 1ZHPA 5FXLA 1MZAA 1ETRH 1LPKB 5I25A 1HIAB 2ODYB 2FI4E 4NIYA 5JDUB 4XBCA 3KN2A 2B8OH 4NCYA 4YT6H 1O0DH 1O2KA 2OINA 2D2DA 4CR9A 1AD8H 1PPGE 3UNRA 2O8WA 1GGDC 3MH4A 1SL3A 1W11U 3TU7H 3SORA 1DVAH 1G3BA 2P16A 2WYGA 3QWCH 1AO5A 1UK3A 1C2DA 1HAIH 3GDSA 1NT1A 4XRNA 5JB8S 3CS7A 2VIVA 1TQ7B 5PTPA 1KSNA 5A8ZA 3GY2A 3FVFB 1THPB 2IPQX 2LELA 2HLCA 3UAIC 2QCYA 2XCNA 2XW9A 3T27A 3UOUA 5AFYH 2PHBA 4AN7A 1OYTH 4E7RG 4FUHA 2B7DH 2AHME 1BTYA 3TGIE 1V2PT 1YF4A 3OEHD 3PWBA 1V2VT 2WPLS 4VGCC 1C1WH 2C8XB 1ZJDA 1TWXB 2J95A 1Z6EA 2QAAA 3PLBA 1J14A 1DUEA 1B0FA 1K2I1 3GY5A 2BTCE 1PPFE 1GBTA 2A7JA 2XRCA 4Q80A 5T1VA 2TGTA 4IS5A 4MLFB 1O2HA 2ZP0H 1P57B 3ZV8A 2AGGX 2D8WA 2JETB 1X7AC 4YLQH 1BA8B 1SGRE 1EZQA 1UTJA 2GT8A 3W95A 1TE0A 3ZVDA 1SLXB 3BTFE 4H42U 3TJVA 1Y3WA 2C8YB 2BY8X 2ZGBH 3K6ZA 3H09A 2IOTA 1O5FH 1K21H 3K6YA 1J16A 4B2AA 3RXIA 3TIUA 1PYTC 3DSPA 2ZGHA 1YPHC 4KKDA 1PFXC 1YCPH 2H9TH 4HFPB 1GI1A 1KDQA 4BAKB 6CHAC 1D3DB 2BX4A 1HJ9A 1ABIH 1ZMLA 2Z3EA 4Y8XA 1ZGIA 1SGDE 1N6YA 1C2IA 3KNXA 4GUXA 1DSUA 1A0JA 1UW7A 3SNAA 1QJ1B 1MQ5A 1WAYB 4YT7H 1G32B 1K9OE 2L6OA 5JBCS 2WPMS 2QE7D 1O5GH 4KGAA 2O9QA 2Q6GA 3LJJA 1HBTH 4CREA 1OWHA 3K9XB 1MKXK 1C5PA 1UK4A 1A2CH 2NWNA 1ANCA 3S69A 2KCAA 2ZFPH 3PV4A 4I8GA 3EAJA 2Z9LA 2WV9A 1WDIA 2A31A 3A8AA 3T29A 1ELCA 4RN6A 3A7VA 2BVXH 1LQDB 1DFPA 1DLEA 1SB1H 4B2CA 2OXSA 1TPSA 2Z9JA 1MAYA 1AIXH 1LHFH 2UWLA 2C3SA 4YOIA 1C5SA 5JB9S 2OD3B 5JPMH 5K0HA 1UHBB 3M5OA 1NRPH 2BZAA 3E90B 4MTBA 2HGTH 4A1TA 1C1VH 3P6ZB 3L6PA 2G00A 2EEKA 2QF0A 1QCPA 9LPRA 3BTEE 2SNWA 2OK5A 3OU0A 3PRBA 3TITA 4WVPE 4MPUA 3F1SB 1WYKA 1S0RA 1O2SA 5CHAB 4CHAC 1THRH 2J4IA 1FAKH 2CHAB 1E0FD 3AK5A 4X1SU 3MH5A 4FUBA 2I6SA 1O30A 1Z8IB 4OM9A 2UUYA 4XDEA 1AB9C 3M36A 5FX5A 3KHVA 3TNTA 3ATMA 5GIBA 2UWPA 5C3NA 1P2MA 2ZDLA 5EQRA 4B1TA 4DY7B 1C2MA 1BMAA 1MAXA 1O2LA 2F9NA 4JZ1A 1OX1A 3W94A 2LNCA 2TGPZ 3F6UH 4IN2A 2BX3A 1M9UA 1GMCF 5AHGH 1QBOA 3ZVAA 5HM9A 1IQIA 3N7OA 1Z1JA 3PWCA 4OS2A 1E37B 3RXDA 5FCRA 3S9BA 4RSPA 1JRSA 2ZF0H 3LGIA 1RRKA 1J8AA 4IGDA 1F2SE 5EQSA 4WMDA 2VJ1A 1GHWH 1YLNA 1CSOE 4GHTA 4TY7A 3QTVH 4B71A 1O3JA 1ELEE 4XD7D 5FCKA 1VCWA 1BRCE 1HDTH 3A85A 1EAWA 1FN8A 1G2MA 3OYPA 3M7QA 1O3LA 2XOKD 3TH4H 4K60A 1CVWH 1NC6A 4BXSA 1XXDA 1TONA 1CU1A 3GCTG 1BMFD 4THNH 1YGCH 5FBEA 1GI5A 2V3HH 4CRGA 4MQAA 5E2OA 2FI3E 5F8XA 2UUJB 1NFYA 2YNBA 3DA9B 3PO1B 4CH8B 5GWZA 4ZHMU 1O3PB 4AC9A 3SU5A 1AY6H 1TGSZ 1HFDA 3GY6A 1H9IE 2AMQA 2IPHA 2Y7ZA 3SN8A 4U32A 3EA9A 1EJNA 1Q3XA 5DSFA 4X1RU 4ZKNU 3ZVCA 2A2QH 3GCHB 4MPXA 1P2JA 1TGBA 1O31A 3KCGH 4ZCNA 1QBVH 5F03A 4CRAA 2HVXA 2Y5HA 2EI6A 1O2RA 2W26A 1ZMNA 4TYDA 3BEUA 3AVZA 1F92A 4H4FA 2IJOB 1GJ6A 4AFUA 4DCDA 2FX4A 5K7RA 3PTBA 2WYJA 1ZHRA 1GI9B 2Q6DA 1KY9A 4I32A 4P02A 4D9QA 2QN5T 4YLUA 1C5TA 1EAXA 2A4OA 3GOVB 1MMJN 2ODPA 4U01A 5IK2D 1FONA 1EZXC 1YKTA 3D65E 2F91A 3GY7A 5JBTA 5F53A 3P92A 2ZHWH 1ETSH 3OE7D 1ESBA 1V2TT 2WPHS 2A5IA 1L4ZA 2UWOA 3E8LA 4BAQB 1WTGH 3DHKH 3UNSA 4X6OA 1DWDH 4I8JA 3SHAH 1DM4B 1O3FA 1T7CA 1L0ZA 1HUTH 1DY8A 1QJ6B 5A0CA 3BTDE 4NZQA 1G36A 3SJKA 1NPMA 1C5XB 3H7TA 2ZDMA 1O2OA 2OC0A 4NA9H 3UWJH 3PMAB 1F0UA 2KCPA 1T4VH 5EU8A 4NIWA 3PV2A 2PKSB 2EY4C 3VEQB 2V7QD 4X1QU 2GD4B 1TX7A 6GCHF 1QZ8A 4BANB 1UCYH 2VU8E 1CA0B 1C4V2 3RXPA 2D1JA 3MYWA 1GBKA 4SGAE 1NTPA 1EUFA 1BDAA 2DE8A 3F0OA 4Y6DA 4MNYA 4CRBA 1H8IH 1OWJA 5ABWA 3SU1A 2ZEBA 2YMSC 4Y8ZA 3A7XA 2BHGA 1GI7B 1TNHA 1RGQA 4TPYA 2AYWA 4HTCH 1VITH 3H7OA 1DANH 1WCZA 2ASUB 1GI8B 1TRNA 3NWUA 1O2WA 1YLDA 2CN0H 1EPTB 3N7DA 3S9AA 1SG8B 1J15A 2FOGA 3BG8A 1NU7B 2HNTE 4DIHH 2PUQH 4GCHF 2ALVA 2VIQA 3W1EA 1S84A 3V13A 3VG8A 2HVYB 4JYTA 1HAXB 3KF2A 1S83A 5CHBA 1LVOA 1XUJA 3Q77A 3GDUA 3UR9A 2FTMA 4XBDA 2C4FH 2HPQH 3UREA 1UK2A 1O5AB 1ELDE 4UFEH 2NU4E 1LTOA 4X1PU 1LPGB 1C1MA 1NBMD 2OC7A 7GCHG 1CHOG 2FODA 4ABFA 1GL1A 2ZFQH 1G30B 1GVKB 4FXGH 5T6DA 3AAUA 4PROA 4YTAA 2TGAA 1W0YH 2F9OA 1W7XH 3D49H 4NG9H 1VCQA 3E1XB 2SGQE 1L1GA 2F3CE 1T31A 5T6FA 1GG6C 1XVOA 4H6TA 1O3CA 3GY8A 3LIWA 1CBWC 1SLVB 1P11E 3SGQE 2P93A 2JIZD 2RG3A 5DP5A 1T32A 2JH6D 2BY9X 3PTNA 4FUEA 3A83A 5A8XA 2VWLA 1MQ6A 2Z9KA 1AE5A 4ACBA 1K28D 1O36A 2FEQH 2OTVA 4K1SA 1A5HA 2GZ8A 5FHTA 4I86A 4YXWD 1K1PA 3GY4A 1XUFA 2TBSA 2ZU5A 2W6ID 3QLPH 3VXEH 3TPIZ 3ODFA 3QGNB 2VIPA 1HJ8A 1BJUA 1BTUA 1PPBH 1GMDG 2BD4A 4ISLA 1MTNB 2FXRA 3EE0B 5DO4H 4A7IB 1F5KU 4Z0KA 1EZSC 2FYRA 3T5FH 3SI4H 1C9TA 2M5TA 3TNSA 5CMXH 1P05A 3TVJB 2STBE 4ABDA 1FQ3A 1VKYA 1Y3UA 2WV4A 4LZ4B 4FU7A 2H9EH 6ESTA 1ELBA 2WPKS 3U98H 2GZ9A 5DPAA 2PKAB 1CT0E 3P8NA 1O2TA 2BDCA 3OAAD 2BD2A 1C5YB 1EJAA 4JK6A 5KGOA 3SZEA 1BQYA 4AG1A 4LK4A 1HJAC 3RU4E 4UONA 3A7TA 1ZTKA 1FY5A 1PYTD 1GI4A 1AWFH 2GX4A 1N1LA 1YCPK 2J98A 3LH1A 1DXWA 1GCTC 2A7CA 2BY5X 2DUCA 1B0EA 5DP7A 2FO9A 4AOQA 4TSFD 3E6PH 3GICB 1XXFA 2STAE 2VWOA 1ZHMA 1C4U2 4UFFH 3RU4T 1VCPA 2ESTE 5T3HA 1BBRH 1HXFH 4WXVA 3E91A 1O35A 3E16B 1Y3VA 1HAOH 2ZU1A 2LP6A 2WSSD 4XSKU 3ZZ3A 3RXUA 1WUNH 5C0UA 1TMTH 1QY6A 1YM0A 2UUKB 4X8TH 4AB9A 1TIOA 2BD9A 1C1RA 1BMLA 3VGCB 3NPSA 1WOFA 4JMYA 4JZEH 1FXYA 2XBWA 5EG4A 3T25A 2GV6A 1OHHD 3D62A 3KGPA 1DWCH 1QL7A 2FI5E 4K1EA 3RXSA 2B0FA 1QRZA 1W0KD 4IBLH 2O8MA 1P10A 1SVPA 3OY5U 5C2ZA 3ELAH 4NZLA 2OC8A 4FVDA 1MTUA 1SOTA 2DE9A 1D4PB 2TRMA 2A32A 1UVSH 1NZQH 1C1OA 3SV2H 4TT3D 3V12A 1P2IA 3ZVBA 1P2QA 4D76A 2PGQB 4LZ1H 2FIRH 3M3VA 1GDNA 5A09A 5EIYA 3GCNA 2UUFB 3PLKA 3LGTA 5L30H 1F0SA 2KZ4A 2ZDNA 1K1NA 1QL9A 2PUXB 2GMTB 5A2MH 3DFLA 2Y81A 2FS8A 5DK1A 2GCHG 2SFAA 2XBYA 1W7GH 1AKSA 1AVXA 3HPTB 4Y8YA 1A0HB 5AF9H 1P06A 2F9PA 3LPRA 1IHSH 1H8DH 3E0NB 4DURA 2XC0A 3SU4A 1NN6A 1KTTB 1RIWB 3C1KA 4IMZA 3U69H 4B74A 3VB3A 1HIAA 3SJ9A 3OX7U 4YM9A 4ISOA 2H5DA 2ZCHP 1H4WA 4X6PA 1A5IA 1GJ5H 3BTHE 1ZMJA 2BMGB 3O8CA 1VJ9U 1C2FA 1QL8A 2OQUA 4DVAU 2BLVA 1QIXB 1O39A 3MFJA 2BDAA 4OGYA 1J17T 1IQJA 1S82A 5CHAC 3BSQA 4U2WA 3UY9A 2OCVB 2AH4X 2W7UA 3PMJA 2CHAC 1RTLA 4UDWH 4A1VA 1P2KA 3KQEA 3F9HA 2G4UA 2A2XH 4AGKA 4BAHB 4X8SH 2QC2A 1O33A 2BZ6H 1YBWA 3RLYH 3F68H 4XOJA 1ZRKA 5DP6A 1AFQB 3KL6A 2K8IA 5EXLA 4IW4E 3KQDA 2AFQB 1TAWA 3I78A 2FLRH 3SQHE 3SU2A 1GDQA 1GBDA 1Y3YA 1TBZH 2JH5D 1QNJA 1AN1E 2CV3A 2G4TA 5J4SA 1IQMA 1O2ZA 5L6NH 3BTME 3RXBA 1C5VA 4XFQA 1TABE 1TLDA 2QF5A 3MO9A 4ACAA 5F6MA 2A5AA 3ZVGA 2K0QA 3TK5A 4I8LA 1XUKA 2ZECA 1YPGH 1O5CB 3MNBA 3M7TA 2H2ZA 2FMJA 5E0HA 2BD3A 1YCPM 3F2FA 1ETTH 3IG6B 3SOSA 1FV9A 1YLCA 3A84A 3KQBA 1IQLA 1DSTA 1OKXA 2ZGJA 1ABJH 1QJ7B 2XC5A 3CENA 4BXWA 2BQWB 2ZNKH 3EA8A 2ZIQH 4OS5A 1SHYA 1G3CA 3QZRA 3BTKE 2FTLE 1WBGB 1H9HE 2JJ2D 4OS1A 1K1LA 1S6LA 1AZ8A 3SJIA 1TA6A 3A88A 5GCHF 3SJ8A 3UFAA 2EI8A 1OOKB 2Q6FA 1SR5C 4D7GA 3V3MA 3SNCA 1QQUA 4GSOA 3LH3A 2VIDA 4K69A 2HWLB 1GJ8B 2XWAA 3NXPA 1V3XA 2W3KA 4I31A 1TX6A 1Y5AT 1O3GA 3ZZ9A 4YOJA 1W13U 1MCTA 2WZQA 5DGJA 4I8KA 2IN2A 3SW2B 4X0WU 2QIQA 1Q31A 3GCHC 1MTSA 1B7XB 1O5EH 4B6EA 3RP2A 2BLQA 1ACBE 1RXPA 2AGEX 4Y79A 5FPTA 1C5MD 5DP9A 3LU9B 1DT2A 1MTWA 3WWFA 1VZQH 3FP8E 1RTKA 4X6MA 2GP9B 4TY6A 1DE7H 3PM3A 8LPRA 4JZDH 1K0HA 3GCTF 1C9PA 4VGCB 2W3IA 1QGFA 3KQCA 1ELVA 4UEHH 3ESTA 4FU8A 1BMNH 1TFXA 1O32A 2OUAA 2GCTC 1SGEE 1BMMH 2QXGA 2AIPA 4MDSA 3D23A 1LPZB 1UCYK 1UHBA 2Z94A 2ZKSA 1NS3A 2BOKA 5GCHG 1LVYA 3GDVA 1EB1H 3FFGA 2KCYA 2QGRA 1VR1H 2O8UA 4ABAA 2ZGCA 1GI3A 2YMSD 1UTPA 2JKHA 2PFEA 3F9GA 3TK9A 1FUJA 2VGCC 3NKKA 2SGEE 2BY6X 3NZIA 4O97A 4CRCA 4Z6AH 2XBVA 3BTQE 2GKVE 1PQ7A 4DJZB 2GDDA 2A5KA 2PTCE 4A92A 1KLJH 1LCYA 1F5RA 2B9LA 2VWMA 3MQKC 1BHXF 6CHAB 1WTHD 2VIOA 4KP0A 3F9EA 3MU4A 2BY7X 3TH3H 5HXFA 2QXHA 2WPDD 3DSOA 3IITA 4Y71A 1HAPH 1A7SA 2F9BH 5HKKD 1SGQE 2HNTC 1U6QA 4AGJA 2C8ZB 2FP7B 1ESTA 1L1NA 2TIOA 3NRLA 3QDZB 2EQNA 3SYJA 2BXUH 1FMGA 2AMDA 3SHCH 1MD8A 1C2GA 1Z8GA 1G3DA 2BM2A 1K1IA 3SUGA 4IN1A 4MNXA 3A82A 5ESTE 1A5GH 1EPTC 2C90B 2ZG0H 4ABJA 1OS8A 2ALPA 5L2ZH 3SGBE 1BCUH 3UPEA 1C5UA 1V2RT 3I77A 1JMOH 2FDAA 3ZYDA 3MTYA 2FYQA 2CMYA 1CGHA 3L33A 4LOYH 3QGJA 1Z1IA 3LT3A 4OS4A 1SGTA 1THSH 4NSVA 4MVNA 1ZZZA 3VB5A 2Z7FE 1T8NA 3KYGA 4DT4A 3V7TA 5IDKA 5FX6A 3VB6A 1TNGA 4WF8A 1VGCC 2ZDKA 3B8JA 4R8TB 1B5GH 3RXJA 4ABBA 5B6LA 8ESTE 4AYYB 1YYY1 3DD2H 2KM0A 5EJ1A 5HIZA 2ANKH 3RXTA 1GBEA 2QYIA 5LPFA 1BOQA 3TJNA 3P8GA 1WV7H 5GJ4B 3A7WA 3QK1A 4ZAEA 1MU6B 5A0AE 1SFIA 4JYUH 1RTFB 3KQ5A 1KXFA 4HG6A 1C2JA 3GISB 2Z9GA 4Y76A 1HV7A 4Q7YA 1AB9B 1P02A 2RDLA 1ZOMA 4HGCA 4FETA 3E0PB 1AMHA 2G5VA 2PWXA 2J34A 4D8NA 1O37A 1OWKA 1GJCB 2Z6BD 1V2ST 4BOHA 2NU1E 3O8DA 3ZZBA 1FDPA 4X8VH 1O5BB 1GBJA 5SGAE 3TJOA 7GCHF 1CHOF 1TGNA 5FPYA 3AW1A 1E36B 1JWTA 3ATLA 2ZHQH 3Q76A 4WWYA 2BLWA 4I33A 4INKA 1H1BA 1MH0A 5DP4A 2P59A 2R2WU 1HB0B 1FY4A 2WUCA 1BUIA 1K1JA 1GBLA 1ZTLA 2SGPE 5EOKA 2A4RA 2Y5GA 1BBRK 1EAIA 1JXPA 1PPEE 1YPEH 1C5LH 3RUOA 3UR6A 4BTTB 3KEEA 3RXAA 4OS6A 2KX4A 4FUDA 3M37A 2OC1A 5E8EH 1TNLA 1EXFA 2OQ5A 1CT2E 1KTSB 3A89A 1KXAA 1DICA 1NROH 1UTQA 3NK8A 1MU8B 5IYTA 1GMDF 2F83A 3SU6A 2BOHB 2BDHA 1JOUB 1NU9A 1V2QT 1P3EA 4ZKOU 4O3TA 2HLDD 4ISHH 1IQFA 5H4IB 4J1YA 1A4WH 1S5SA 2W5EA 3OFND 4ABIA 2WV5A 1O2PA 1GBAA 3KIDU 1TBQH 2BD8A 1O3OA 2G8TA 2XNDD 3DFJA 1PPZA 1C2HA 1EOLA 1OP8A 1P8VC 2QV1A 1SHHB 1L2EA 1OWEA 2RA0A 1GJ4H 5J4QA 1TRYA 1EPTA 1PQ8A 3BEFB 1AQ7A 1F7ZA 3KYFA 1TGCA 5CDFE 1GHBG 5L2YH 3R3GB 2J2UA 2R9PA 3EA7A 1IHTH 4P00A 1GCDA 1BB0B 3RXCA 1AZZA 1BTPA 1ELFA 2R3YA 2RDEA 3CS0A 4LXBH 4NWLA 1BRUP 4NFFA 3ZZ7A 3U28C 4Q7XA 5TJXA 1UTNA 3M5LA 3S0NA 3TGKE 1C5NH 5ETXA 1D3TB 1UVPA 3PB1E 4Y11E 2LPRA 4UE7H 4B2BA 1KLTA 2R2MB 3RXLA 1EQ9A 3BV9B 1ZJKA 3DUXH 3NUMA 1GI2A 3A86A 1C1TA 1N8OB 1O34A 1PJPA 3BN9A 2HPPH 3B23B 1SGPE 1N6XA 2K1QA 4WMEA 3RMMH 5HM2A 5HIYA 3U9AH 1AE8H 1EJMA 5F8TA 1FY3A 1P9SA 3MWIU 3ZIAD 1PPCE 1O3MA 2ZDVH 3T28A 2G55A 4TWYA 3QN7A 5EXMA 3EE7A 1GHYH 1GJ9B 1MBQA 3U8TH 2ZU3A 2C8WB 3H5CB 2F9UA 1SGCA 1TPPA 1LHEH 1MTVA 1SGNE 3WW7A 3RXHA 1SLWB 1QTFA 1AUJA 3MOCA 1COWD 2KCOA 4CRDA 3FO8D 1Z8RA 2NU0E 2W7SA 5FAHA 5JBAS 5FPSA 1BT7A 1UVUH 4NFEA 1HAVB 2Y5FA 4YESB 1BIOA 4A1XA 2FOCA 1SBWA 2P8OB 2ZHFH 3HGPA 1RIWC 1O38A 2AERH 1CGJE 2ZFRH 2C93B 5EXNA 1QHRB 2QF3A 4RI0A 1SPJA 4AZ2B 4ZHLU 3TK6A 1C1SA 1A3BH 3F2HA 4Q2KA 3SV9A 1QQ4A 1BRAA 4O3UA 4RT1A 1SOZA 1NY22 1BTZA 3SU0A 3HK6B 1Y5UT 1HAHH 1FPHH 2CF9H 2BLOA 2YMSB 3QTOH 1FLEE 2A4QA 5EODA 2PP6A 2FM2A 3BIUH 4I8HA 3U1IB 1EZUC 3N99A 1P12E 4KTCA 2IJD1 1Y8TA 3BG4B 2KAIB 3QUMP 4D7FA 3FANA 2VVVA 3MNSA 1MUEB 2JETC 1D6RA 2GCHF 2O8LA 2PSYA 5ESBA 1RFNA 1HYLA 1MKWH 1EP5A 4AB8A 3O8RA 1IQNA 2J9NA 1EFRD 2PKAA 3UOPA 1AFQC 1G37A 1AI8H 3SO3A 3UTUH 2XWBI 1FN6A 1BITA 3BEIB 5F8ZA 3EYDA 3GCOA 2H1UA 3ATWA 3M35A 4BAOB 4OGXA 3ODDA 1PQ5A 1FY1A 3HKJB 3SZNA 1XKBC 3PYHA 1O3BA 1QA7A 1KYNA 1D9IA 3Q3XA 3QX5H 4DT7B 5LPRA 1H9LB 4GAWA 8GCHF 2PR3A 4A6LA 3OEED 3LKWA 1ANDA 3BTGE 3ZZDA 5FBIA 1WQSA 1V2UT 1UO6A 4K8YA 1FY8E 1GG6B 2A4GA 2Y80A 2GDEH 1O2UA 3DCLA 3P70B 3G01A 3U1JB 2BDGA 3ZZCA 1SKYE 1CQQA 1YPJH 1FJSA 2ULLA 1XUGA 4RT0A 5BPEA 4AX9H 1W10U 3GYLB 4JYVH 1UVOA 1D3QB 1LVBA 3HATH 1W8BH 3MO3A 1TBRH 1GBMA 2F9VA 2A45B 2Y82A 1GHAG 4AFZA 1W3CA 3P95A 4RKOB 3MU0A 1NFWA 2QY0B 2J92A 3RM2H 3P8FA 1SGFG 3SQEE 1UTKA 1S81A 2FPZA 1L1JA 1S6FA 1ZSLA 1C5RA 1VITG 2I6QA 4FOUC 3WY8A 3UIRA 4F4OC 5EJLA 1E34B 1CT4E 3FKSD 1O5DH 3MU8A 1AWHB 3I29A 1S0QA 1F0TA 1V2NT 2Q1JA 3FN8A 1YPLH 4HI3A 1P09A 4ASUD 5C94A 8KME2 1P04A 1GMHG 3SGAE 3UB0A 1E79D 3CP7A 2ZO3H 8GCHG 2FOEA 2HRVA 1H8HD 5GXPA 1IQHA 4KTSA 3AAVA 1ELAA 1WU1A 3WWBA 1OYQA 5DKMA 3MU1A 2VVCA 1YC0A 3OY6U 1AFEH 2FS9A 1OWDA 5EGMA 5EW2H 1H8ED 1T8OA 1HJAB 1KMHB 3T2NA 2AS9A 1DX5M 2ANWA 2D26C 1DPOA 1TPAE 2P3FH 1KDQB 4IC5A 4F49A 1GCTB 1K1MA 4AFSA 1AGJA 3FZZA 2XTTB 3SNDA 2PLXA 2RCEA 2QA9E 2SGAA 1G2LA 2A7HA 2BD7A 6LPRA 4O9VA 2BDIA 1A3EH 1UMAH 4CRFA 1K1OA 4KTUA 3A87A 1JIRA 2KFWA 3RXKA 2EC9H 3S7HB 1GPZA 3PRDA 4FUJA 1O3KA 2GJGA 3FAOA 1MABB 5EPYA 4X1NU 4WMFA 2RFKC 1G9IE 1P3CA 4KELA 1HNEE 1TNKA 3VB4A 5C5NA 1PQAA 2GZ7A 2L74A 1P03A 3RXVA 3BIVH 1INCA 1UJ1A 1C4Y2 4K2YA 3M3TA 5E0JA 2GTBA 3URCA 4ZMAH 4YZUA 2O8TA 2ANMH 4RKJB 2GGVB 3MNXA 1IQEA 3EDXB 1UCYE 4X2YA 1SI5H 3VXFH 3RDZA 2P3UB 3GY3A 1FAXA 4JCNA 1D6WA 2XC4A 2A1DB 3UWIA 3ZVFA 1SFQB 1EASA 2SGDE 1F5LA 1QR3E 5C1YA 1IOEA 1P2NA 4K5ZA 2G52A 5TCCA 1V6DA 2NU2E 3R0FA 2J38A 3PO1C 4GPGA 5KECA 2OLGA 4NIXA 1GGDB 1GBIA 4TWWA 4Y10E 3HGNA 7LPRA 2THFB 3OSYA 1E38B 1O3DA 1V2OT 4OS7A 3UUZA 1NBME 2R0KA 4CBNA 1MD7A 1ORFA 3URDA 1A1RA 3RC5A 3PV5A 2VNTA 1MCVA 4ABEA 5DP8A 1SGFA 4I7YH 2WPIS 5JBBS 3A8DA 3K65B 1KIGH 2ZFTA 3F0PA 2JDID 1CE5A 3PMHB 5C20A 1ZYOA 2PV9B 1PPHE 3LONA 4F48B 3NCLA 3RXQA 3A7YA 1O3NA 2CGAA 3O8BA 3RXMA 2WINI 1EX3A 1WSSH 3UQVA 4NIVA 1O2IA 3F9FA 1FIWA 4DOQA 4M7GA 4X6NA 1TB6H 3SI3H 1SQAA 2ZHEH 4X2XA 4GHQA 4H6SB 5C17A 4MG3A 1GVLA 4K3JA 1Z6JH 5HMAA 4Y0YE 1KXEA 1NO9H 2EA3A 3TLOA 3VB7A 5EW1H 4Y7AA 1P01A 3LC3A 4DGJA 4E05H 1O3AA 1NFXA 2HNTF 2ZZUH 3QZQA 1ZGVA 1A61H 2SNVA 2FLBH 2Y6TA 1CGIE 4ZKRU 1C1PA 1RS0A 1TMUH 4BAMB 1W12U 3RU4D 1ZSKA 4JZIA 1ZR0A 1DWBH 1NRNH 1LHCH 1ZPZA 1LKBA 1C5WB 2Z9IA 1JRTA 1ELTA 2ZTYA 4TPIZ 3C27B 3N7EA 4Q4LA 3SBKA 4B76A 1EAUA 2G81E 1OSSA 2PKSC 3GYMA 4Y0ZE 4ESTE 2CJIA 2OBQA 3F3BA 4WXIA 2PW8H 1UTOA 1O2MA 2H9HA 4CBOA 1XVMA 1CA0C 4FUFA 2PSXA 3A80A 1GBCA 2V35A 1HAYB 1C2EA 5KEDA 2ZCLP 1XUIA 1V2LT 1ANBA 2G51A 1YPHE 1P0SH 2HOBA 4JK5A 3LGWA 3FOAA 2RA3A 3FP6E 1IAUA 3Q3YA 7ESTE 1FI8A 1D3PB 2Z3CA 1GJBB 1DS2E 1QB1A 2J5UA 2PTNA 2VIWA 2ZU2A 3MO6A 3A81A 1HLTH 3LGUA 4NWKA 1TRMA 1V2WT 3BF6H 1UTMA 1ZTJA 1YY3A 5EQQA 2FOHA
chains in the Genus database with same CATH topology
1E1RD 3KNXA 1OHHD 2K8IA 3N99A 1A1RA 2XNDD 3RC5A 4KTCA 2IJD1 1E1QD 2JIZD 3PV5A 2OINA 1W0JD 3UB0A 3SUFA 1E79D 1FX0B 2KM0A 1W0KD 3SU2A 1H8HD 3F0PA 5EQSA 2JDID 1DY8A 2O8MA 1WXRA 2L6OA 2QF4A 5ESBA 2QV1A 2QE7D 2OC8A 4B71A 3RC4A 3WWBA 4XD7D 3O8RA 5C0TA 5GJ4B 2OC0A 1NS3A 3LONA 3SV8A 2KCPA 3SUDA 1EFRD 4YXWD 3O8BA 1H8ED 2QF5A 5GPIB 2KCYA 3PV2A 1KMHB 2W6ID 2V7QD 2K0QA 5CDFE 4F55A 3SV7A 3OYPA 3EYDA 3P8OA 2KCAA 4TT3D 2YMSD 5C17A 2LELA 2WV9A 2XOKD 2KR7A 2JJ1D 4WH6A 2XCNA 4R8TB 3SV6A 4FETA 4NWLA 4M9FA 3F2FA 2CK3D 4B75A 3U1IB 1CU1A 3M5LA 1BMFD 2W6JD 2AHME 5ETXA 2FOMB 3M5MA 3F0OA 3O8DA 3OEHD 3F2GA 3SU1A 2KZ4A 2KFWA 2F43B 2YMSC 2VBCA 4A92A 4ASUD 3OEED 4K8BA 3LKWA 1RGQA 3PRDA 3M5OA 5EPYA 1MABB 2JJ2D 3E90B 3SU5A 4A1TA 2K1QA 4Q63A 5FPYA 2OBOA 1S6LA 3M5NA 3ZIAD 2A4GA 2F4LA 3L6PA 3DCLA 3N7DA 3P8NA 2WPDD 4I33A 3U1JB 3OAAD 3DSOA 2OK5A 1DY9A 5HKKD 3PRBA 5DSFA 1SKYE 5T1VA 2P59A 2FP7B 3SU4A 2GVFA 3SZEA 2F9UA 3N7EA 3NRLA 4Q4LA 3W1EA 3VG8A 4B73A 4B76A 4B74A 3SYJA 3WW7A 5CHBA 3KF2A 5GNDA 2A4RA 2GGVB 1COWD 2KCOA 4I31A 3SUGA 2OBQA 3F3BA 3FO8D 5FL7D 3RC6A 1N1LA 4ZCNA 3AK5A 1DXWA 5FPSA 4Z1MD 3O8CA 1BT7A 4OM9A 1JXPA 2WZQA 4TSFD 2F9VA 3KEEA 3SU3A 2M2AA 3H09A 1W3CA 4A1XA 2WHXA 5EPNA 4TYDA 5DN6D 3LOXA 2OC1A 2YOLA 2IJOB 3DSPA 5B6LA 1NBMD 4B6EA 2OC7A 1DXPA 5EQRA 4B6FA 1RTLA 4RI0A 5FPTA 4A1VA 4I32A 3OTPA 3FOAA 2WSSD 3F2HA 3SU6A 3SV9A 3WWFA 5C0UA 2J5UA 2XCFA 3SUEA 3FKSD 4U01A 3SU0A 2HLDD 5IK2D 5H4IB 4NWKA 4WH8A 2YMSB 3OFND 2XNIA 2A4QA 3GS9A 4DT4A 5IDKA 2FM2A 1NBME 5F53A 3FN8A 4WF8A 5EQQA 4JMYA 3OE7D 3KN2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCP A;  2KCO A;  2KCY A; 
#chains in the Genus database with same CATH topology
 4FUC A;  3IWM A;  1O2V A;  1W0J D;  4ZKS U;  1UTL M;  3ZYE A;  4ABH A;  1G3E A;  1ESA A;  3AAS A;  1WXR A;  4MPW A;  4AG2 A;  2V0B A;  1TNI A;  4NA8 A;  1C5Z B;  1HRT H;  9EST A;  1JBU H;  5C0T A;  1GJA B;  1TNJ A;  1GBF A;  4CR5 A;  2Z3D A;  1YP9 A;  4MPV A;  4X2V A;  4AFQ A;  1ZPB A;  2BDB A;  3UNQ A;  4E06 H;  4JZF H;  1BBR E;  3A8C A;  4F55 A;  1FNI A;  2Y7X A;  1TMB H;  3P8O A;  3U8R H;  4WY3 A;  1GHV H;  1S6H A;  4WH6 A;  2BQ7 B;  2GT7 A;  3CNR A;  4ISN A;  1S85 A;  3S7K B;  1YPK H;  2W6J D;  1GMC G;  1Q2W A;  2ZCK P;  1C2K A;  2SGF E;  3ZZ5 A;  1MKX H;  1AU8 A;  2FOM B;  2P3T B;  1ID5 H;  3RXR A;  3STJ A;  4CHA B;  2F43 B;  4J2Y B;  1AHT H;  1W2K H;  1WQV H;  2EI7 A;  3A7Z A;  3JZ1 B;  3V0X A;  2VB0 A;  3VFE A;  2ZHD A;  3RXF A;  1HAG E;  4Q63 A;  2V6N A;  1LHG H;  2J94 A;  3QO6 A;  4ZXY H;  1SMF E;  4ABG A;  3MNC A;  3OTJ E;  5C5O A;  1SQO A;  5LH8 A;  4FUG A;  1XKA C;  3T26 A;  1KLI H;  2GCT B;  4A5T S;  5E0G A;  2H5C A;  4X2W A;  2GVF A;  1QA0 A;  3B9F H;  4FU9 A;  2BXT H;  1TOM H;  5A0B A;  1N8O C;  5GND A;  1T4U H;  3PMB B;  3RMO H;  2ZPR A;  1BRB E;  3ENS B;  3Q00 A;  3FP7 E;  1XMN B;  5C1U A;  1CA8 B;  1NFU A;  3SU3 A;  2M2A A;  1DDJ A;  5A8Y A;  1EKB B;  1MTN C;  2WHX A;  2ZFS A;  5EPN A;  3EQ0 H;  1GL0 E;  2BQ6 B;  2TGD A;  2V3O H;  2YOL A;  4FVB A;  2VGC B;  1TGT A;  1DXP A;  1GHB F;  4B6F A;  1O3I A;  2ZTZ A;  3FZD A;  1RD3 B;  3RML H;  2XCF A;  3BTW E;  5TCA A;  4U30 A;  1QFK H;  1TX8 A;  3MU5 A;  4WH8 A;  1MKW K;  1YWU A;  3ATI A;  4ZHA A;  1SGY E;  3GS9 A;  2P8O C;  3SJO A;  2FOA A;  1FZZ A;  1XM1 A;  1XX9 A;  3U8O H;  2R3U A;  4QT8 C;  2CXV A;  5DJ7 A;  4D9R A;  3RMN H;  3HK3 B;  3SUF A;  5BRR E;  1HCG A;  3ZZA A;  1OXG A;  1QUR H;  1XUH A;  3P17 H;  4UD9 H;  5AFZ H;  1ARC A;  2AGI X;  4E7N A;  1BTX A;  2XXL A;  1V2M T;  2BYA X;  1SSX A;  2FES H;  1EAT A;  1ZLR A;  3RXO A;  5HYO A;  1P9U A;  4X8U H;  2WPJ S;  1KXC A;  1O3H A;  3RM0 H;  3DSG A;  1ZRB A;  4MNV A;  2CF8 H;  2ZPS A;  3BG4 C;  2FX6 A;  3LC5 A;  1AVW A;  1DUA A;  2ZQ2 A;  3PLP A;  1Y3X A;  1QB9 A;  2ZI2 H;  2BB4 A;  1T8L A;  4DII H;  3MH6 A;  1A0L A;  2R0L A;  1Z71 A;  1CHG A;  3EGK H;  4M9F A;  2CK3 D;  3A8B A;  1MBM A;  1O2G H;  1TYN A;  1ZSJ A;  2XYA A;  1GI6 A;  5JYI A;  3M5M A;  1BZX E;  4R0I A;  1BHX B;  1FPC H;  1TOC B;  2XBX A;  1HAZ B;  3UQO A;  3VGC C;  4K8B A;  3ZVE A;  4UFG H;  1YPM H;  5LPE A;  5CE1 A;  2OBO A;  3MI4 A;  2FOF A;  4INH A;  1GHX H;  3LDX H;  4IC6 A;  3LGV A;  1QBN A;  1C2L A;  2ZTX A;  1VGC B;  4BNR A;  3AW0 A;  1NRS H;  1OWI A;  3JZ2 B;  1ARB A;  1RJX B;  4WJG 2;  2V3M A;  1NES E;  1EOJ A;  1EP6 A;  2QXI A;  1V2J T;  1QRX A;  6GCH G;  1LVM A;  2VH6 A;  3ZZ4 A;  1QRW A;  4UFD H;  4AYV B;  1ZPC A;  4ISI H;  1JIM A;  4XE4 A;  4SGB E;  1Y59 T;  4Z1M D;  1TQ0 B;  1MZD A;  5C1X A;  5E2P A;  1GJD B;  2BD5 A;  1TPO A;  1DLK B;  1GJ7 B;  1EB2 A;  1SGI B;  2H6M A;  1DWE H;  2FZZ A;  5LGO A;  3SNB A;  5DN6 D;  1BTH H;  2OP9 A;  3MH7 A;  3HKI B;  3Q3K A;  1GVZ A;  1NM6 A;  4ASH A;  2HAL A;  1IQK A;  3L3T A;  5EJZ A;  5I46 H;  2J97 A;  5GDS H;  4ZH8 A;  1LDT T;  2GMT C;  1GWA A;  2B5T B;  3TH2 H;  4BTI B;  4YOG A;  1UVT H;  2AEI H;  2XNI A;  4GCH G;  3LJO A;  4DG4 A;  1GBB A;  1J9C H;  4BTU B;  1LQE A;  1E1R D;  3S9C A;  2ZA5 A;  1OP0 A;  1E1Q D;  2J98 B;  5T6G A;  4NSY A;  3BTT E;  1FX0 B;  4K1T A;  2ZFF H;  1GDU A;  2BVS H;  2VH0 A;  4NA7 A;  2QF4 A;  3PRO A;  1E35 B;  5DP3 A;  1C1U H;  3RC4 A;  2GV7 A;  1AVG H;  2BDY A;  3ITI A;  1OP2 A;  3SV8 A;  1A46 H;  1AUT C;  3RLW H;  4Q7Z A;  3ATK A;  3STI A;  3SUD A;  5GPI B;  1TA2 A;  2ZC9 H;  3T62 A;  1BTW A;  4ZUH A;  4Y7B A;  1GBH A;  2P94 A;  5B6O A;  1DIT H;  1SQR A;  3SV7 A;  1L4D A;  1FIZ A;  1Z7K A;  1T8M A;  3MHW U;  3RXE A;  2ZWL H;  2KR7 A;  2JJ1 D;  2ZPQ A;  3DT0 H;  4ZRO A;  3SV6 A;  2VVU A;  2JH0 D;  1ELG A;  1HPG A;  4B75 A;  1NRQ H;  3MMG A;  1O2Y A;  4YO9 A;  1GHA F;  3VPK A;  2ODQ A;  1F0R A;  1HAV A;  1HXE H;  2YNA A;  1LMW B;  4NGA H;  7KME H;  1O3E A;  1SC8 U;  2NU3 E;  2QXJ A;  3E3T A;  3F2G A;  3TJU A;  1C1Q A;  2VBC A;  1W14 U;  1Y5B T;  5DG6 A;  5G4B A;  4DW2 U;  1O2X A;  4GLY A;  5AVD A;  2ZQ1 A;  1VIT F;  5C67 A;  1OPH B;  1KXD A;  1K22 H;  3M5N A;  2P95 A;  1P2O A;  1C5O H;  2F4L A;  1CO7 E;  2AIQ A;  2BVR H;  1LO6 A;  1HGT H;  4CH2 B;  3M3S A;  1V2K T;  3TGJ E;  1C5Q A;  1LHD H;  1VJA U;  1QB6 A;  4IMQ A;  1DY9 A;  1LKA A;  2ZGX H;  5HGG A;  4MNW A;  2FWW A;  2G5N A;  4B73 A;  1GI0 A;  1C1N A;  2AMP A;  2VIN A;  3ZV9 A;  1GMH F;  1O2Q A;  2ILN A;  4AOR A;  1Z8J B;  1KXB A;  1O2N A;  1BJV A;  5FL7 D;  3RC6 A;  2ANY A;  2TPI Z;  1SQT A;  1W0Z U;  3M61 U;  4GVU A;  2KAI A;  1TAL A;  3RXG A;  4O03 A;  1ANE A;  3ZZ8 A;  1IQG A;  3SNE A;  2A0Q B;  2ZDA H;  4XBB A;  1O2J A;  1NRR H;  2VWN A;  1CBW B;  3LOX A;  3LGY A;  2WUB A;  4ZXX H;  4INL A;  1AKS B;  3ZZ6 A;  1DOJ A;  1SLU B;  3OTP A;  2PGB B;  4FUI A;  3M7U A;  2FOB A;  2ZU4 A;  4HZH A;  3K2U A;  1GHZ A;  3SUE A;  1ZHP A;  5FXL A;  1MZA A;  1ETR H;  1LPK B;  5I25 A;  1HIA B;  2ODY B;  2FI4 E;  4NIY A;  5JDU B;  4XBC A;  3KN2 A;  2B8O H;  4NCY A;  4YT6 H;  1O0D H;  1O2K A;  2OIN A;  2D2D A;  4CR9 A;  1AD8 H;  1PPG E;  3UNR A;  2O8W A;  1GGD C;  3MH4 A;  1SL3 A;  1W11 U;  3TU7 H;  3SOR A;  1DVA H;  1G3B A;  2P16 A;  2WYG A;  3QWC H;  1AO5 A;  1UK3 A;  1C2D A;  1HAI H;  3GDS A;  1NT1 A;  4XRN A;  5JB8 S;  3CS7 A;  2VIV A;  1TQ7 B;  5PTP A;  1KSN A;  5A8Z A;  3GY2 A;  3FVF B;  1THP B;  2IPQ X;  2LEL A;  2HLC A;  3UAI C;  2QCY A;  2XCN A;  2XW9 A;  3T27 A;  3UOU A;  5AFY H;  2PHB A;  4AN7 A;  1OYT H;  4E7R G;  4FUH A;  2B7D H;  2AHM E;  1BTY A;  3TGI E;  1V2P T;  1YF4 A;  3OEH D;  3PWB A;  1V2V T;  2WPL S;  4VGC C;  1C1W H;  2C8X B;  1ZJD A;  1TWX B;  2J95 A;  1Z6E A;  2QAA A;  3PLB A;  1J14 A;  1DUE A;  1B0F A;  1K2I 1;  3GY5 A;  2BTC E;  1PPF E;  1GBT A;  2A7J A;  2XRC A;  4Q80 A;  5T1V A;  2TGT A;  4IS5 A;  4MLF B;  1O2H A;  2ZP0 H;  1P57 B;  3ZV8 A;  2AGG X;  2D8W A;  2JET B;  1X7A C;  4YLQ H;  1BA8 B;  1SGR E;  1EZQ A;  1UTJ A;  2GT8 A;  3W95 A;  1TE0 A;  3ZVD A;  1SLX B;  3BTF E;  4H42 U;  3TJV A;  1Y3W A;  2C8Y B;  2BY8 X;  2ZGB H;  3K6Z A;  3H09 A;  2IOT A;  1O5F H;  1K21 H;  3K6Y A;  1J16 A;  4B2A A;  3RXI A;  3TIU A;  1PYT C;  3DSP A;  2ZGH A;  1YPH C;  4KKD A;  1PFX C;  1YCP H;  2H9T H;  4HFP B;  1GI1 A;  1KDQ A;  4BAK B;  6CHA C;  1D3D B;  2BX4 A;  1HJ9 A;  1ABI H;  1ZML A;  2Z3E A;  4Y8X A;  1ZGI A;  1SGD E;  1N6Y A;  1C2I A;  3KNX A;  4GUX A;  1DSU A;  1A0J A;  1UW7 A;  3SNA A;  1QJ1 B;  1MQ5 A;  1WAY B;  4YT7 H;  1G32 B;  1K9O E;  2L6O A;  5JBC S;  2WPM S;  2QE7 D;  1O5G H;  4KGA A;  2O9Q A;  2Q6G A;  3LJJ A;  1HBT H;  4CRE A;  1OWH A;  3K9X B;  1MKX K;  1C5P A;  1UK4 A;  1A2C H;  2NWN A;  1ANC A;  3S69 A;  2KCA A;  2ZFP H;  3PV4 A;  4I8G A;  3EAJ A;  2Z9L A;  2WV9 A;  1WDI A;  2A31 A;  3A8A A;  3T29 A;  1ELC A;  4RN6 A;  3A7V A;  2BVX H;  1LQD B;  1DFP A;  1DLE A;  1SB1 H;  4B2C A;  2OXS A;  1TPS A;  2Z9J A;  1MAY A;  1AIX H;  1LHF H;  2UWL A;  2C3S A;  4YOI A;  1C5S A;  5JB9 S;  2OD3 B;  5JPM H;  5K0H A;  1UHB B;  3M5O A;  1NRP H;  2BZA A;  3E90 B;  4MTB A;  2HGT H;  4A1T A;  1C1V H;  3P6Z B;  3L6P A;  2G00 A;  2EEK A;  2QF0 A;  1QCP A;  9LPR A;  3BTE E;  2SNW A;  2OK5 A;  3OU0 A;  3PRB A;  3TIT A;  4WVP E;  4MPU A;  3F1S B;  1WYK A;  1S0R A;  1O2S A;  5CHA B;  4CHA C;  1THR H;  2J4I A;  1FAK H;  2CHA B;  1E0F D;  3AK5 A;  4X1S U;  3MH5 A;  4FUB A;  2I6S A;  1O30 A;  1Z8I B;  4OM9 A;  2UUY A;  4XDE A;  1AB9 C;  3M36 A;  5FX5 A;  3KHV A;  3TNT A;  3ATM A;  5GIB A;  2UWP A;  5C3N A;  1P2M A;  2ZDL A;  5EQR A;  4B1T A;  4DY7 B;  1C2M A;  1BMA A;  1MAX A;  1O2L A;  2F9N A;  4JZ1 A;  1OX1 A;  3W94 A;  2LNC A;  2TGP Z;  3F6U H;  4IN2 A;  2BX3 A;  1M9U A;  1GMC F;  5AHG H;  1QBO A;  3ZVA A;  5HM9 A;  1IQI A;  3N7O A;  1Z1J A;  3PWC A;  4OS2 A;  1E37 B;  3RXD A;  5FCR A;  3S9B A;  4RSP A;  1JRS A;  2ZF0 H;  3LGI A;  1RRK A;  1J8A A;  4IGD A;  1F2S E;  5EQS A;  4WMD A;  2VJ1 A;  1GHW H;  1YLN A;  1CSO E;  4GHT A;  4TY7 A;  3QTV H;  4B71 A;  1O3J A;  1ELE E;  4XD7 D;  5FCK A;  1VCW A;  1BRC E;  1HDT H;  3A85 A;  1EAW A;  1FN8 A;  1G2M A;  3OYP A;  3M7Q A;  1O3L A;  2XOK D;  3TH4 H;  4K60 A;  1CVW H;  1NC6 A;  4BXS A;  1XXD A;  1TON A;  1CU1 A;  3GCT G;  1BMF D;  4THN H;  1YGC H;  5FBE A;  1GI5 A;  2V3H H;  4CRG A;  4MQA A;  5E2O A;  2FI3 E;  5F8X A;  2UUJ B;  1NFY A;  2YNB A;  3DA9 B;  3PO1 B;  4CH8 B;  5GWZ A;  4ZHM U;  1O3P B;  4AC9 A;  3SU5 A;  1AY6 H;  1TGS Z;  1HFD A;  3GY6 A;  1H9I E;  2AMQ A;  2IPH A;  2Y7Z A;  3SN8 A;  4U32 A;  3EA9 A;  1EJN A;  1Q3X A;  5DSF A;  4X1R U;  4ZKN U;  3ZVC A;  2A2Q H;  3GCH B;  4MPX A;  1P2J A;  1TGB A;  1O31 A;  3KCG H;  4ZCN A;  1QBV H;  5F03 A;  4CRA A;  2HVX A;  2Y5H A;  2EI6 A;  1O2R A;  2W26 A;  1ZMN A;  4TYD A;  3BEU A;  3AVZ A;  1F92 A;  4H4F A;  2IJO B;  1GJ6 A;  4AFU A;  4DCD A;  2FX4 A;  5K7R A;  3PTB A;  2WYJ A;  1ZHR A;  1GI9 B;  2Q6D A;  1KY9 A;  4I32 A;  4P02 A;  4D9Q A;  2QN5 T;  4YLU A;  1C5T A;  1EAX A;  2A4O A;  3GOV B;  1MMJ N;  2ODP A;  4U01 A;  5IK2 D;  1FON A;  1EZX C;  1YKT A;  3D65 E;  2F91 A;  3GY7 A;  5JBT A;  5F53 A;  3P92 A;  2ZHW H;  1ETS H;  3OE7 D;  1ESB A;  1V2T T;  2WPH S;  2A5I A;  1L4Z A;  2UWO A;  3E8L A;  4BAQ B;  1WTG H;  3DHK H;  3UNS A;  4X6O A;  1DWD H;  4I8J A;  3SHA H;  1DM4 B;  1O3F A;  1T7C A;  1L0Z A;  1HUT H;  1DY8 A;  1QJ6 B;  5A0C A;  3BTD E;  4NZQ A;  1G36 A;  3SJK A;  1NPM A;  1C5X B;  3H7T A;  2ZDM A;  1O2O A;  2OC0 A;  4NA9 H;  3UWJ H;  3PMA B;  1F0U A;  2KCP A;  1T4V H;  5EU8 A;  4NIW A;  3PV2 A;  2PKS B;  2EY4 C;  3VEQ B;  2V7Q D;  4X1Q U;  2GD4 B;  1TX7 A;  6GCH F;  1QZ8 A;  4BAN B;  1UCY H;  2VU8 E;  1CA0 B;  1C4V 2;  3RXP A;  2D1J A;  3MYW A;  1GBK A;  4SGA E;  1NTP A;  1EUF A;  1BDA A;  2DE8 A;  3F0O A;  4Y6D A;  4MNY A;  4CRB A;  1H8I H;  1OWJ A;  5ABW A;  3SU1 A;  2ZEB A;  2YMS C;  4Y8Z A;  3A7X A;  2BHG A;  1GI7 B;  1TNH A;  1RGQ A;  4TPY A;  2AYW A;  4HTC H;  1VIT H;  3H7O A;  1DAN H;  1WCZ A;  2ASU B;  1GI8 B;  1TRN A;  3NWU A;  1O2W A;  1YLD A;  2CN0 H;  1EPT B;  3N7D A;  3S9A A;  1SG8 B;  1J15 A;  2FOG A;  3BG8 A;  1NU7 B;  2HNT E;  4DIH H;  2PUQ H;  4GCH F;  2ALV A;  2VIQ A;  3W1E A;  1S84 A;  3V13 A;  3VG8 A;  2HVY B;  4JYT A;  1HAX B;  3KF2 A;  1S83 A;  5CHB A;  1LVO A;  1XUJ A;  3Q77 A;  3GDU A;  3UR9 A;  2FTM A;  4XBD A;  2C4F H;  2HPQ H;  3URE A;  1UK2 A;  1O5A B;  1ELD E;  4UFE H;  2NU4 E;  1LTO A;  4X1P U;  1LPG B;  1C1M A;  1NBM D;  2OC7 A;  7GCH G;  1CHO G;  2FOD A;  4ABF A;  1GL1 A;  2ZFQ H;  1G30 B;  1GVK B;  4FXG H;  5T6D A;  3AAU A;  4PRO A;  4YTA A;  2TGA A;  1W0Y H;  2F9O A;  1W7X H;  3D49 H;  4NG9 H;  1VCQ A;  3E1X B;  2SGQ E;  1L1G A;  2F3C E;  1T31 A;  5T6F A;  1GG6 C;  1XVO A;  4H6T A;  1O3C A;  3GY8 A;  3LIW A;  1CBW C;  1SLV B;  1P11 E;  3SGQ E;  2P93 A;  2JIZ D;  2RG3 A;  5DP5 A;  1T32 A;  2JH6 D;  2BY9 X;  3PTN A;  4FUE A;  3A83 A;  5A8X A;  2VWL A;  1MQ6 A;  2Z9K A;  1AE5 A;  4ACB A;  1K28 D;  1O36 A;  2FEQ H;  2OTV A;  4K1S A;  1A5H A;  2GZ8 A;  5FHT A;  4I86 A;  4YXW D;  1K1P A;  3GY4 A;  1XUF A;  2TBS A;  2ZU5 A;  2W6I D;  3QLP H;  3VXE H;  3TPI Z;  3ODF A;  3QGN B;  2VIP A;  1HJ8 A;  1BJU A;  1BTU A;  1PPB H;  1GMD G;  2BD4 A;  4ISL A;  1MTN B;  2FXR A;  3EE0 B;  5DO4 H;  4A7I B;  1F5K U;  4Z0K A;  1EZS C;  2FYR A;  3T5F H;  3SI4 H;  1C9T A;  2M5T A;  3TNS A;  5CMX H;  1P05 A;  3TVJ B;  2STB E;  4ABD A;  1FQ3 A;  1VKY A;  1Y3U A;  2WV4 A;  4LZ4 B;  4FU7 A;  2H9E H;  6EST A;  1ELB A;  2WPK S;  3U98 H;  2GZ9 A;  5DPA A;  2PKA B;  1CT0 E;  3P8N A;  1O2T A;  2BDC A;  3OAA D;  2BD2 A;  1C5Y B;  1EJA A;  4JK6 A;  5KGO A;  3SZE A;  1BQY A;  4AG1 A;  4LK4 A;  1HJA C;  3RU4 E;  4UON A;  3A7T A;  1ZTK A;  1FY5 A;  1PYT D;  1GI4 A;  1AWF H;  2GX4 A;  1N1L A;  1YCP K;  2J98 A;  3LH1 A;  1DXW A;  1GCT C;  2A7C A;  2BY5 X;  2DUC A;  1B0E A;  5DP7 A;  2FO9 A;  4AOQ A;  4TSF D;  3E6P H;  3GIC B;  1XXF A;  2STA E;  2VWO A;  1ZHM A;  1C4U 2;  4UFF H;  3RU4 T;  1VCP A;  2EST E;  5T3H A;  1BBR H;  1HXF H;  4WXV A;  3E91 A;  1O35 A;  3E16 B;  1Y3V A;  1HAO H;  2ZU1 A;  2LP6 A;  2WSS D;  4XSK U;  3ZZ3 A;  3RXU A;  1WUN H;  5C0U A;  1TMT H;  1QY6 A;  1YM0 A;  2UUK B;  4X8T H;  4AB9 A;  1TIO A;  2BD9 A;  1C1R A;  1BML A;  3VGC B;  3NPS A;  1WOF A;  4JMY A;  4JZE H;  1FXY A;  2XBW A;  5EG4 A;  3T25 A;  2GV6 A;  1OHH D;  3D62 A;  3KGP A;  1DWC H;  1QL7 A;  2FI5 E;  4K1E A;  3RXS A;  2B0F A;  1QRZ A;  1W0K D;  4IBL H;  2O8M A;  1P10 A;  1SVP A;  3OY5 U;  5C2Z A;  3ELA H;  4NZL A;  2OC8 A;  4FVD A;  1MTU A;  1SOT A;  2DE9 A;  1D4P B;  2TRM A;  2A32 A;  1UVS H;  1NZQ H;  1C1O A;  3SV2 H;  4TT3 D;  3V12 A;  1P2I A;  3ZVB A;  1P2Q A;  4D76 A;  2PGQ B;  4LZ1 H;  2FIR H;  3M3V A;  1GDN A;  5A09 A;  5EIY A;  3GCN A;  2UUF B;  3PLK A;  3LGT A;  5L30 H;  1F0S A;  2KZ4 A;  2ZDN A;  1K1N A;  1QL9 A;  2PUX B;  2GMT B;  5A2M H;  3DFL A;  2Y81 A;  2FS8 A;  5DK1 A;  2GCH G;  2SFA A;  2XBY A;  1W7G H;  1AKS A;  1AVX A;  3HPT B;  4Y8Y A;  1A0H B;  5AF9 H;  1P06 A;  2F9P A;  3LPR A;  1IHS H;  1H8D H;  3E0N B;  4DUR A;  2XC0 A;  3SU4 A;  1NN6 A;  1KTT B;  1RIW B;  3C1K A;  4IMZ A;  3U69 H;  4B74 A;  3VB3 A;  1HIA A;  3SJ9 A;  3OX7 U;  4YM9 A;  4ISO A;  2H5D A;  2ZCH P;  1H4W A;  4X6P A;  1A5I A;  1GJ5 H;  3BTH E;  1ZMJ A;  2BMG B;  3O8C A;  1VJ9 U;  1C2F A;  1QL8 A;  2OQU A;  4DVA U;  2BLV A;  1QIX B;  1O39 A;  3MFJ A;  2BDA A;  4OGY A;  1J17 T;  1IQJ A;  1S82 A;  5CHA C;  3BSQ A;  4U2W A;  3UY9 A;  2OCV B;  2AH4 X;  2W7U A;  3PMJ A;  2CHA C;  1RTL A;  4UDW H;  4A1V A;  1P2K A;  3KQE A;  3F9H A;  2G4U A;  2A2X H;  4AGK A;  4BAH B;  4X8S H;  2QC2 A;  1O33 A;  2BZ6 H;  1YBW A;  3RLY H;  3F68 H;  4XOJ A;  1ZRK A;  5DP6 A;  1AFQ B;  3KL6 A;  2K8I A;  5EXL A;  4IW4 E;  3KQD A;  2AFQ B;  1TAW A;  3I78 A;  2FLR H;  3SQH E;  3SU2 A;  1GDQ A;  1GBD A;  1Y3Y A;  1TBZ H;  2JH5 D;  1QNJ A;  1AN1 E;  2CV3 A;  2G4T A;  5J4S A;  1IQM A;  1O2Z A;  5L6N H;  3BTM E;  3RXB A;  1C5V A;  4XFQ A;  1TAB E;  1TLD A;  2QF5 A;  3MO9 A;  4ACA A;  5F6M A;  2A5A A;  3ZVG A;  2K0Q A;  3TK5 A;  4I8L A;  1XUK A;  2ZEC A;  1YPG H;  1O5C B;  3MNB A;  3M7T A;  2H2Z A;  2FMJ A;  5E0H A;  2BD3 A;  1YCP M;  3F2F A;  1ETT H;  3IG6 B;  3SOS A;  1FV9 A;  1YLC A;  3A84 A;  3KQB A;  1IQL A;  1DST A;  1OKX A;  2ZGJ A;  1ABJ H;  1QJ7 B;  2XC5 A;  3CEN A;  4BXW A;  2BQW B;  2ZNK H;  3EA8 A;  2ZIQ H;  4OS5 A;  1SHY A;  1G3C A;  3QZR A;  3BTK E;  2FTL E;  1WBG B;  1H9H E;  2JJ2 D;  4OS1 A;  1K1L A;  1S6L A;  1AZ8 A;  3SJI A;  1TA6 A;  3A88 A;  5GCH F;  3SJ8 A;  3UFA A;  2EI8 A;  1OOK B;  2Q6F A;  1SR5 C;  4D7G A;  3V3M A;  3SNC A;  1QQU A;  4GSO A;  3LH3 A;  2VID A;  4K69 A;  2HWL B;  1GJ8 B;  2XWA A;  3NXP A;  1V3X A;  2W3K A;  4I31 A;  1TX6 A;  1Y5A T;  1O3G A;  3ZZ9 A;  4YOJ A;  1W13 U;  1MCT A;  2WZQ A;  5DGJ A;  4I8K A;  2IN2 A;  3SW2 B;  4X0W U;  2QIQ A;  1Q31 A;  3GCH C;  1MTS A;  1B7X B;  1O5E H;  4B6E A;  3RP2 A;  2BLQ A;  1ACB E;  1RXP A;  2AGE X;  4Y79 A;  5FPT A;  1C5M D;  5DP9 A;  3LU9 B;  1DT2 A;  1MTW A;  3WWF A;  1VZQ H;  3FP8 E;  1RTK A;  4X6M A;  2GP9 B;  4TY6 A;  1DE7 H;  3PM3 A;  8LPR A;  4JZD H;  1K0H A;  3GCT F;  1C9P A;  4VGC B;  2W3I A;  1QGF A;  3KQC A;  1ELV A;  4UEH H;  3EST A;  4FU8 A;  1BMN H;  1TFX A;  1O32 A;  2OUA A;  2GCT C;  1SGE E;  1BMM H;  2QXG A;  2AIP A;  4MDS A;  3D23 A;  1LPZ B;  1UCY K;  1UHB A;  2Z94 A;  2ZKS A;  1NS3 A;  2BOK A;  5GCH G;  1LVY A;  3GDV A;  1EB1 H;  3FFG A;  2KCY A;  2QGR A;  1VR1 H;  2O8U A;  4ABA A;  2ZGC A;  1GI3 A;  2YMS D;  1UTP A;  2JKH A;  2PFE A;  3F9G A;  3TK9 A;  1FUJ A;  2VGC C;  3NKK A;  2SGE E;  2BY6 X;  3NZI A;  4O97 A;  4CRC A;  4Z6A H;  2XBV A;  3BTQ E;  2GKV E;  1PQ7 A;  4DJZ B;  2GDD A;  2A5K A;  2PTC E;  4A92 A;  1KLJ H;  1LCY A;  1F5R A;  2B9L A;  2VWM A;  3MQK C;  1BHX F;  6CHA B;  1WTH D;  2VIO A;  4KP0 A;  3F9E A;  3MU4 A;  2BY7 X;  3TH3 H;  5HXF A;  2QXH A;  2WPD D;  3DSO A;  3IIT A;  4Y71 A;  1HAP H;  1A7S A;  2F9B H;  5HKK D;  1SGQ E;  2HNT C;  1U6Q A;  4AGJ A;  2C8Z B;  2FP7 B;  1EST A;  1L1N A;  2TIO A;  3NRL A;  3QDZ B;  2EQN A;  3SYJ A;  2BXU H;  1FMG A;  2AMD A;  3SHC H;  1MD8 A;  1C2G A;  1Z8G A;  1G3D A;  2BM2 A;  1K1I A;  3SUG A;  4IN1 A;  4MNX A;  3A82 A;  5EST E;  1A5G H;  1EPT C;  2C90 B;  2ZG0 H;  4ABJ A;  1OS8 A;  2ALP A;  5L2Z H;  3SGB E;  1BCU H;  3UPE A;  1C5U A;  1V2R T;  3I77 A;  1JMO H;  2FDA A;  3ZYD A;  3MTY A;  2FYQ A;  2CMY A;  1CGH A;  3L33 A;  4LOY H;  3QGJ A;  1Z1I A;  3LT3 A;  4OS4 A;  1SGT A;  1THS H;  4NSV A;  4MVN A;  1ZZZ A;  3VB5 A;  2Z7F E;  1T8N A;  3KYG A;  4DT4 A;  3V7T A;  5IDK A;  5FX6 A;  3VB6 A;  1TNG A;  4WF8 A;  1VGC C;  2ZDK A;  3B8J A;  4R8T B;  1B5G H;  3RXJ A;  4ABB A;  5B6L A;  8EST E;  4AYY B;  1YYY 1;  3DD2 H;  2KM0 A;  5EJ1 A;  5HIZ A;  2ANK H;  3RXT A;  1GBE A;  2QYI A;  5LPF A;  1BOQ A;  3TJN A;  3P8G A;  1WV7 H;  5GJ4 B;  3A7W A;  3QK1 A;  4ZAE A;  1MU6 B;  5A0A E;  1SFI A;  4JYU H;  1RTF B;  3KQ5 A;  1KXF A;  4HG6 A;  1C2J A;  3GIS B;  2Z9G A;  4Y76 A;  1HV7 A;  4Q7Y A;  1AB9 B;  1P02 A;  2RDL A;  1ZOM A;  4HGC A;  4FET A;  3E0P B;  1AMH A;  2G5V A;  2PWX A;  2J34 A;  4D8N A;  1O37 A;  1OWK A;  1GJC B;  2Z6B D;  1V2S T;  4BOH A;  2NU1 E;  3O8D A;  3ZZB A;  1FDP A;  4X8V H;  1O5B B;  1GBJ A;  5SGA E;  3TJO A;  7GCH F;  1CHO F;  1TGN A;  5FPY A;  3AW1 A;  1E36 B;  1JWT A;  3ATL A;  2ZHQ H;  3Q76 A;  4WWY A;  2BLW A;  4I33 A;  4INK A;  1H1B A;  1MH0 A;  5DP4 A;  2P59 A;  2R2W U;  1HB0 B;  1FY4 A;  2WUC A;  1BUI A;  1K1J A;  1GBL A;  1ZTL A;  2SGP E;  5EOK A;  2A4R A;  2Y5G A;  1BBR K;  1EAI A;  1JXP A;  1PPE E;  1YPE H;  1C5L H;  3RUO A;  3UR6 A;  4BTT B;  3KEE A;  3RXA A;  4OS6 A;  2KX4 A;  4FUD A;  3M37 A;  2OC1 A;  5E8E H;  1TNL A;  1EXF A;  2OQ5 A;  1CT2 E;  1KTS B;  3A89 A;  1KXA A;  1DIC A;  1NRO H;  1UTQ A;  3NK8 A;  1MU8 B;  5IYT A;  1GMD F;  2F83 A;  3SU6 A;  2BOH B;  2BDH A;  1JOU B;  1NU9 A;  1V2Q T;  1P3E A;  4ZKO U;  4O3T A;  2HLD D;  4ISH H;  1IQF A;  5H4I B;  4J1Y A;  1A4W H;  1S5S A;  2W5E A;  3OFN D;  4ABI A;  2WV5 A;  1O2P A;  1GBA A;  3KID U;  1TBQ H;  2BD8 A;  1O3O A;  2G8T A;  2XND D;  3DFJ A;  1PPZ A;  1C2H A;  1EOL A;  1OP8 A;  1P8V C;  2QV1 A;  1SHH B;  1L2E A;  1OWE A;  2RA0 A;  1GJ4 H;  5J4Q A;  1TRY A;  1EPT A;  1PQ8 A;  3BEF B;  1AQ7 A;  1F7Z A;  3KYF A;  1TGC A;  5CDF E;  1GHB G;  5L2Y H;  3R3G B;  2J2U A;  2R9P A;  3EA7 A;  1IHT H;  4P00 A;  1GCD A;  1BB0 B;  3RXC A;  1AZZ A;  1BTP A;  1ELF A;  2R3Y A;  2RDE A;  3CS0 A;  4LXB H;  4NWL A;  1BRU P;  4NFF A;  3ZZ7 A;  3U28 C;  4Q7X A;  5TJX A;  1UTN A;  3M5L A;  3S0N A;  3TGK E;  1C5N H;  5ETX A;  1D3T B;  1UVP A;  3PB1 E;  4Y11 E;  2LPR A;  4UE7 H;  4B2B A;  1KLT A;  2R2M B;  3RXL A;  1EQ9 A;  3BV9 B;  1ZJK A;  3DUX H;  3NUM A;  1GI2 A;  3A86 A;  1C1T A;  1N8O B;  1O34 A;  1PJP A;  3BN9 A;  2HPP H;  3B23 B;  1SGP E;  1N6X A;  2K1Q A;  4WME A;  3RMM H;  5HM2 A;  5HIY A;  3U9A H;  1AE8 H;  1EJM A;  5F8T A;  1FY3 A;  1P9S A;  3MWI U;  3ZIA D;  1PPC E;  1O3M A;  2ZDV H;  3T28 A;  2G55 A;  4TWY A;  3QN7 A;  5EXM A;  3EE7 A;  1GHY H;  1GJ9 B;  1MBQ A;  3U8T H;  2ZU3 A;  2C8W B;  3H5C B;  2F9U A;  1SGC A;  1TPP A;  1LHE H;  1MTV A;  1SGN E;  3WW7 A;  3RXH A;  1SLW B;  1QTF A;  1AUJ A;  3MOC A;  1COW D;  2KCO A;  4CRD A;  3FO8 D;  1Z8R A;  2NU0 E;  2W7S A;  5FAH A;  5JBA S;  5FPS A;  1BT7 A;  1UVU H;  4NFE A;  1HAV B;  2Y5F A;  4YES B;  1BIO A;  4A1X A;  2FOC A;  1SBW A;  2P8O B;  2ZHF H;  3HGP A;  1RIW C;  1O38 A;  2AER H;  1CGJ E;  2ZFR H;  2C93 B;  5EXN A;  1QHR B;  2QF3 A;  4RI0 A;  1SPJ A;  4AZ2 B;  4ZHL U;  3TK6 A;  1C1S A;  1A3B H;  3F2H A;  4Q2K A;  3SV9 A;  1QQ4 A;  1BRA A;  4O3U A;  4RT1 A;  1SOZ A;  1NY2 2;  1BTZ A;  3SU0 A;  3HK6 B;  1Y5U T;  1HAH H;  1FPH H;  2CF9 H;  2BLO A;  2YMS B;  3QTO H;  1FLE E;  2A4Q A;  5EOD A;  2PP6 A;  2FM2 A;  3BIU H;  4I8H A;  3U1I B;  1EZU C;  3N99 A;  1P12 E;  4KTC A;  2IJD 1;  1Y8T A;  3BG4 B;  2KAI B;  3QUM P;  4D7F A;  3FAN A;  2VVV A;  3MNS A;  1MUE B;  2JET C;  1D6R A;  2GCH F;  2O8L A;  2PSY A;  5ESB A;  1RFN A;  1HYL A;  1MKW H;  1EP5 A;  4AB8 A;  3O8R A;  1IQN A;  2J9N A;  1EFR D;  2PKA A;  3UOP A;  1AFQ C;  1G37 A;  1AI8 H;  3SO3 A;  3UTU H;  2XWB I;  1FN6 A;  1BIT A;  3BEI B;  5F8Z A;  3EYD A;  3GCO A;  2H1U A;  3ATW A;  3M35 A;  4BAO B;  4OGX A;  3ODD A;  1PQ5 A;  1FY1 A;  3HKJ B;  3SZN A;  1XKB C;  3PYH A;  1O3B A;  1QA7 A;  1KYN A;  1D9I A;  3Q3X A;  3QX5 H;  4DT7 B;  5LPR A;  1H9L B;  4GAW A;  8GCH F;  2PR3 A;  4A6L A;  3OEE D;  3LKW A;  1AND A;  3BTG E;  3ZZD A;  5FBI A;  1WQS A;  1V2U T;  1UO6 A;  4K8Y A;  1FY8 E;  1GG6 B;  2A4G A;  2Y80 A;  2GDE H;  1O2U A;  3DCL A;  3P70 B;  3G01 A;  3U1J B;  2BDG A;  3ZZC A;  1SKY E;  1CQQ A;  1YPJ H;  1FJS A;  2ULL A;  1XUG A;  4RT0 A;  5BPE A;  4AX9 H;  1W10 U;  3GYL B;  4JYV H;  1UVO A;  1D3Q B;  1LVB A;  3HAT H;  1W8B H;  3MO3 A;  1TBR H;  1GBM A;  2F9V A;  2A45 B;  2Y82 A;  1GHA G;  4AFZ A;  1W3C A;  3P95 A;  4RKO B;  3MU0 A;  1NFW A;  2QY0 B;  2J92 A;  3RM2 H;  3P8F A;  1SGF G;  3SQE E;  1UTK A;  1S81 A;  2FPZ A;  1L1J A;  1S6F A;  1ZSL A;  1C5R A;  1VIT G;  2I6Q A;  4FOU C;  3WY8 A;  3UIR A;  4F4O C;  5EJL A;  1E34 B;  1CT4 E;  3FKS D;  1O5D H;  3MU8 A;  1AWH B;  3I29 A;  1S0Q A;  1F0T A;  1V2N T;  2Q1J A;  3FN8 A;  1YPL H;  4HI3 A;  1P09 A;  4ASU D;  5C94 A;  8KME 2;  1P04 A;  1GMH G;  3SGA E;  3UB0 A;  1E79 D;  3CP7 A;  2ZO3 H;  8GCH G;  2FOE A;  2HRV A;  1H8H D;  5GXP A;  1IQH A;  4KTS A;  3AAV A;  1ELA A;  1WU1 A;  3WWB A;  1OYQ A;  5DKM A;  3MU1 A;  2VVC A;  1YC0 A;  3OY6 U;  1AFE H;  2FS9 A;  1OWD A;  5EGM A;  5EW2 H;  1H8E D;  1T8O A;  1HJA B;  1KMH B;  3T2N A;  2AS9 A;  1DX5 M;  2ANW A;  2D26 C;  1DPO A;  1TPA E;  2P3F H;  1KDQ B;  4IC5 A;  4F49 A;  1GCT B;  1K1M A;  4AFS A;  1AGJ A;  3FZZ A;  2XTT B;  3SND A;  2PLX A;  2RCE A;  2QA9 E;  2SGA A;  1G2L A;  2A7H A;  2BD7 A;  6LPR A;  4O9V A;  2BDI A;  1A3E H;  1UMA H;  4CRF A;  1K1O A;  4KTU A;  3A87 A;  1JIR A;  2KFW A;  3RXK A;  2EC9 H;  3S7H B;  1GPZ A;  3PRD A;  4FUJ A;  1O3K A;  2GJG A;  3FAO A;  1MAB B;  5EPY A;  4X1N U;  4WMF A;  2RFK C;  1G9I E;  1P3C A;  4KEL A;  1HNE E;  1TNK A;  3VB4 A;  5C5N A;  1PQA A;  2GZ7 A;  2L74 A;  1P03 A;  3RXV A;  3BIV H;  1INC A;  1UJ1 A;  1C4Y 2;  4K2Y A;  3M3T A;  5E0J A;  2GTB A;  3URC A;  4ZMA H;  4YZU A;  2O8T A;  2ANM H;  4RKJ B;  2GGV B;  3MNX A;  1IQE A;  3EDX B;  1UCY E;  4X2Y A;  1SI5 H;  3VXF H;  3RDZ A;  2P3U B;  3GY3 A;  1FAX A;  4JCN A;  1D6W A;  2XC4 A;  2A1D B;  3UWI A;  3ZVF A;  1SFQ B;  1EAS A;  2SGD E;  1F5L A;  1QR3 E;  5C1Y A;  1IOE A;  1P2N A;  4K5Z A;  2G52 A;  5TCC A;  1V6D A;  2NU2 E;  3R0F A;  2J38 A;  3PO1 C;  4GPG A;  5KEC A;  2OLG A;  4NIX A;  1GGD B;  1GBI A;  4TWW A;  4Y10 E;  3HGN A;  7LPR A;  2THF B;  3OSY A;  1E38 B;  1O3D A;  1V2O T;  4OS7 A;  3UUZ A;  1NBM E;  2R0K A;  4CBN A;  1MD7 A;  1ORF A;  3URD A;  1A1R A;  3RC5 A;  3PV5 A;  2VNT A;  1MCV A;  4ABE A;  5DP8 A;  1SGF A;  4I7Y H;  2WPI S;  5JBB S;  3A8D A;  3K65 B;  1KIG H;  2ZFT A;  3F0P A;  2JDI D;  1CE5 A;  3PMH B;  5C20 A;  1ZYO A;  2PV9 B;  1PPH E;  3LON A;  4F48 B;  3NCL A;  3RXQ A;  3A7Y A;  1O3N A;  2CGA A;  3O8B A;  3RXM A;  2WIN I;  1EX3 A;  1WSS H;  3UQV A;  4NIV A;  1O2I A;  3F9F A;  1FIW A;  4DOQ A;  4M7G A;  4X6N A;  1TB6 H;  3SI3 H;  1SQA A;  2ZHE H;  4X2X A;  4GHQ A;  4H6S B;  5C17 A;  4MG3 A;  1GVL A;  4K3J A;  1Z6J H;  5HMA A;  4Y0Y E;  1KXE A;  1NO9 H;  2EA3 A;  3TLO A;  3VB7 A;  5EW1 H;  4Y7A A;  1P01 A;  3LC3 A;  4DGJ A;  4E05 H;  1O3A A;  1NFX A;  2HNT F;  2ZZU H;  3QZQ A;  1ZGV A;  1A61 H;  2SNV A;  2FLB H;  2Y6T A;  1CGI E;  4ZKR U;  1C1P A;  1RS0 A;  1TMU H;  4BAM B;  1W12 U;  3RU4 D;  1ZSK A;  4JZI A;  1ZR0 A;  1DWB H;  1NRN H;  1LHC H;  1ZPZ A;  1LKB A;  1C5W B;  2Z9I A;  1JRT A;  1ELT A;  2ZTY A;  4TPI Z;  3C27 B;  3N7E A;  4Q4L A;  3SBK A;  4B76 A;  1EAU A;  2G81 E;  1OSS A;  2PKS C;  3GYM A;  4Y0Z E;  4EST E;  2CJI A;  2OBQ A;  3F3B A;  4WXI A;  2PW8 H;  1UTO A;  1O2M A;  2H9H A;  4CBO A;  1XVM A;  1CA0 C;  4FUF A;  2PSX A;  3A80 A;  1GBC A;  2V35 A;  1HAY B;  1C2E A;  5KED A;  2ZCL P;  1XUI A;  1V2L T;  1ANB A;  2G51 A;  1YPH E;  1P0S H;  2HOB A;  4JK5 A;  3LGW A;  3FOA A;  2RA3 A;  3FP6 E;  1IAU A;  3Q3Y A;  7EST E;  1FI8 A;  1D3P B;  2Z3C A;  1GJB B;  1DS2 E;  1QB1 A;  2J5U A;  2PTN A;  2VIW A;  2ZU2 A;  3MO6 A;  3A81 A;  1HLT H;  3LGU A;  4NWK A;  1TRM A;  1V2W T;  3BF6 H;  1UTM A;  1ZTJ A;  1YY3 A;  5EQQ A;  2FOH A; 
#chains in the Genus database with same CATH homology
 1E1R D;  3KNX A;  1OHH D;  2K8I A;  3N99 A;  1A1R A;  2XND D;  3RC5 A;  4KTC A;  2IJD 1;  1E1Q D;  2JIZ D;  3PV5 A;  2OIN A;  1W0J D;  3UB0 A;  3SUF A;  1E79 D;  1FX0 B;  2KM0 A;  1W0K D;  3SU2 A;  1H8H D;  3F0P A;  5EQS A;  2JDI D;  1DY8 A;  2O8M A;  1WXR A;  2L6O A;  2QF4 A;  5ESB A;  2QV1 A;  2QE7 D;  2OC8 A;  4B71 A;  3RC4 A;  3WWB A;  4XD7 D;  3O8R A;  5C0T A;  5GJ4 B;  2OC0 A;  1NS3 A;  3LON A;  3SV8 A;  2KCP A;  3SUD A;  1EFR D;  4YXW D;  3O8B A;  1H8E D;  2QF5 A;  5GPI B;  2KCY A;  3PV2 A;  1KMH B;  2W6I D;  2V7Q D;  2K0Q A;  5CDF E;  4F55 A;  3SV7 A;  3OYP A;  3EYD A;  3P8O A;  2KCA A;  4TT3 D;  2YMS D;  5C17 A;  2LEL A;  2WV9 A;  2XOK D;  2KR7 A;  2JJ1 D;  4WH6 A;  2XCN A;  4R8T B;  3SV6 A;  4FET A;  4NWL A;  4M9F A;  3F2F A;  2CK3 D;  4B75 A;  3U1I B;  1CU1 A;  3M5L A;  1BMF D;  2W6J D;  2AHM E;  5ETX A;  2FOM B;  3M5M A;  3F0O A;  3O8D A;  3OEH D;  3F2G A;  3SU1 A;  2KZ4 A;  2KFW A;  2F43 B;  2YMS C;  2VBC A;  4A92 A;  4ASU D;  3OEE D;  4K8B A;  3LKW A;  1RGQ A;  3PRD A;  3M5O A;  5EPY A;  1MAB B;  2JJ2 D;  3E90 B;  3SU5 A;  4A1T A;  2K1Q A;  4Q63 A;  5FPY A;  2OBO A;  1S6L A;  3M5N A;  3ZIA D;  2A4G A;  2F4L A;  3L6P A;  3DCL A;  3N7D A;  3P8N A;  2WPD D;  4I33 A;  3U1J B;  3OAA D;  3DSO A;  2OK5 A;  1DY9 A;  5HKK D;  3PRB A;  5DSF A;  1SKY E;  5T1V A;  2P59 A;  2FP7 B;  3SU4 A;  2GVF A;  3SZE A;  2F9U A;  3N7E A;  3NRL A;  4Q4L A;  3W1E A;  3VG8 A;  4B73 A;  4B76 A;  4B74 A;  3SYJ A;  3WW7 A;  5CHB A;  3KF2 A;  5GND A;  2A4R A;  2GGV B;  1COW D;  2KCO A;  4I31 A;  3SUG A;  2OBQ A;  3F3B A;  3FO8 D;  5FL7 D;  3RC6 A;  1N1L A;  4ZCN A;  3AK5 A;  1DXW A;  5FPS A;  4Z1M D;  3O8C A;  1BT7 A;  4OM9 A;  1JXP A;  2WZQ A;  4TSF D;  2F9V A;  3KEE A;  3SU3 A;  2M2A A;  3H09 A;  1W3C A;  4A1X A;  2WHX A;  5EPN A;  4TYD A;  5DN6 D;  3LOX A;  2OC1 A;  2YOL A;  2IJO B;  3DSP A;  5B6L A;  1NBM D;  4B6E A;  2OC7 A;  1DXP A;  5EQR A;  4B6F A;  1RTL A;  4RI0 A;  5FPT A;  4A1V A;  4I32 A;  3OTP A;  3FOA A;  2WSS D;  3F2H A;  3SU6 A;  3SV9 A;  3WWF A;  5C0U A;  2J5U A;  2XCF A;  3SUE A;  3FKS D;  4U01 A;  3SU0 A;  2HLD D;  5IK2 D;  5H4I B;  4NWK A;  4WH8 A;  2YMS B;  3OFN D;  2XNI A;  2A4Q A;  3GS9 A;  4DT4 A;  5IDK A;  2FM2 A;  1NBM E;  5F53 A;  3FN8 A;  4WF8 A;  5EQQ A;  4JMY A;  3OE7 D;  3KN2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...