2KCYA

Solution structure of ribosomal protein s8e from methanothermobacter thermautotrophicus, northeaststructural genomics consortium (nesg) target tr71d
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
98
structure length
98
Chain Sequence
GDRRVRLIRTRGGNTKVRLASDTRINVVDPETGKVEIAEIRNVVENTANPHFVRRNIITRGAVVETNLGNVRVTSRPGQDGVINGVLIRELEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosomal protein
molecule keywords 30S ribosomal protein S8e
publication title SOLUTION STRUCTURE OF RIBOSOMAL PROTEIN S8E FROM Methanothermobacter thermautotrophicus, NORTHEASTSTRUCTURAL GENOMICS CONSORTIUM (NESG) TARGET TR71D
rcsb
source organism Methanothermobacter thermautotrophicus str. delta h
total genus 13
structure length 98
sequence length 98
ec nomenclature
pdb deposition date 2008-12-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.310 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 2kcyA01
2KCPA 2KCOA 2KCYA
chains in the Genus database with same CATH superfamily
1FY8E 1YWUA 5AVDA 1O32A 4AORA 1KLJH 3K9XB 3MTYA 5DP5A 4DVAU 5C0UA 1AVXA 4LK4A 1TOMH 1E0FD 2P8OC 2J95A 1KSNA 2FTLE 3UPEA 1XXFA 5TCCA 2VIWA 1SKYE 3M3VA 4X1RU 1TGTA 1BTWA 1Y3UA 1MZAA 1ESBA 3WWBA 6CHAC 2J98B 1THPB 3F9EA 1RJXB 3P95A 2VNTA 3NCLA 1GI0A 1TPPA 4NIVA 2LP6A 1LHFH 2JJ1D 3QDZB 1HUTH 1GMHF 2ZCLP 2VIPA 1Q2WA 5EG4A 5C17A 1V2ST 1AGJA 2A32A 1GJ9B 2AHME 2P93A 5E0JA 4JK5A 2F9NA 2OC7A 1J9CH 5ABWA 3B8JA 1O5DH 1KXDA 8LPRA 1UO6A 1EASA 3RXEA 1GBKA 1O34A 1VGCB 4K1EA 2BD5A 2F4LA 4GCHG 4X6MA 1JIRA 4ZKNU 1H9HE 4GAWA 4ACBA 3EA9A 2ZPQA 2ZDKA 5FBIA 2HVXA 3RXBA 3LGVA 1MU8B 4X8TH 4HGCA 3SV9A 1FJSA 1D9IA 4NA9H 3GY3A 2RA0A 1TPAE 3TJOA 5L2ZH 1O31A 2Q6FA 3TH2H 1SGCA 3Q3XA 3GY4A 1SFIA 3P8NA 4FETA 3EDXB 2WPJS 2OLGA 4MVNA 1THSH 2IPQX 3ATKA 1ELGA 6GCHG 2TPIZ 1YPKH 4ZXXH 3A7ZA 2HPQH 1XUKA 1ZPBA 5DG6A 1TGSZ 3FP8E 3V7TA 2ZQ1A 2B7DH 3RDZA 2ODPA 2P3FH 4YZUA 4XSKU 1S81A 4NG9H 1S84A 3R3GB 2QA9E 3QN7A 4ISHH 5J4SA 1S6LA 1ZRKA 2KCOA 1QGFA 1AD8H 3WY8A 4Y0ZE 1SGRE 1GGDB 1QB9A 3GY8A 1SOTA 1MUEB 5EQQA 2GVFA 4BXWA 3N99A 1AO5A 1ZR0A 1D3TB 1IQMA 1RXPA 3SUGA 3KL6A 1LKAA 3FANA 4ASHA 1ANDA 1RRKA 1P3EA 1D4PB 3M5LA 1W12U 2XNIA 3F9FA 4JZFH 1OWHA 1ZTKA 2HLDD 2UWLA 1F5LA 4ZKSU 1CT0E 2FYQA 1XUHA 3FN8A 1YC0A 2W3KA 1GCTC 8KME2 3QLPH 1A1RA 1ELDE 1IHTH 2BZAA 3ZZ5A 1DLKB 1BMMH 1YPGH 2H5CA 1KY9A 3SZEA 4DY7B 1BA8B 2A5AA 2FOGA 2P3TB 3K6YA 2WYJA 2BLWA 2F9BH 2TRMA 3AW1A 1JOUB 1K1OA 4UFDH 5C1XA 1T4UH 4FUEA 1SGTA 2FOEA 5FAHA 1CE5A 3RXAA 4HZHA 2SGEE 1O36A 4BAMB 1ZTLA 2FLBH 2C8XB 1ID5H 3RC5A 1FUJA 1UCYE 2R2WU 3S7HB 3A7YA 1UTNA 3F3BA 4K8YA 1GJ5H 4OGXA 4ABBA 1LQEA 2H5DA 2BXTH 1DY8A 3CS7A 1K1JA 1JXPA 2SGQE 5EQSA 3URDA 1O2RA 1O2MA 5K7RA 1VITG 4B6FA 1FIWA 1TONA 4TSFD 1BBRE 1W7GH 4NWLA 2CF9H 1ZPCA 3GYLB 3MI4A 4INKA 5CHBA 2ZC9H 2F91A 3HK6B 4FU9A 2QAAA 2GCHG 1XMNB 2OXSA 4GLYA 1QNJA 3ZVGA 4KKDA 3LJJA 3TU7H 2XXLA 1C4V2 1TRYA 1P09A 2W6JD 2DE9A 3U8OH 3K65B 1TB6H 1E36B 1GBCA 5FX5A 1CBWC 1FV9A 1AKSA 3TPIZ 2M2AA 2R3YA 3BEUA 5F8TA 1TPSA 3WWFA 1YLNA 4ISLA 3TGKE 4JCNA 1RIWB 5GWZA 3E0NB 1MZDA 5GNDA 4LXBH 1NRPH 2GT7A 4J1YA 1P10A 1C1QA 1C1TA 2TBSA 3VPKA 3OTJE 1P2JA 3DUXH 1C1OA 3N7DA 1TA2A 3FZZA 3ATMA 4CHAB 1O30A 1ELFA 3N7OA 4Y7BA 2A5KA 4P02A 4WH6A 1BB0B 2V7QD 1UTLM 3MWIU 2BM2A 4K69A 2BD9A 3LT3A 1PPBH 4Q7ZA 3TJVA 3GDVA 2DE8A 4U2WA 1KXEA 1L4ZA 3UOUA 1E1RD 3SJIA 1QL8A 3ZVFA 1FDPA 1OP8A 1KTTB 2PSXA 1V2LT 5EODA 1KDQA 1P9SA 1GJ8B 3P8OA 1DWDH 1O5AB 4IC6A 3SV2H 1A4WH 1BJVA 2A2XH 1GDUA 1ZGVA 2KR7A 1FY3A 3A84A 2FS8A 1ELCA 1O35A 4ABIA 5ETXA 1AB9C 1ZOMA 1OYQA 1O3BA 1UMAH 2PV9B 3MH5A 3ZZBA 1C5QA 3H7TA 1FLEE 1L1NA 2O8WA 1HAVA 3F2FA 5E2OA 3EE7A 1G3CA 3ZVEA 1UTJA 3SU0A 1TGBA 1SQOA 2OP9A 3UUZA 1P04A 1GBIA 1GBFA 3SQEE 4ZCNA 1IQJA 2ZU2A 1Z6EA 2PKAA 4FUBA 1MTNC 3ZZ9A 1AFQC 2XBXA 1SGFG 3S9AA 4D9QA 3ZZ3A 2BDHA 3E3TA 4B71A 3GOVB 1P8VC 3ITIA 1NPMA 5DP4A 4AFUA 3GY7A 2EEKA 3STIA 3PV5A 1AKSB 3H7OA 1O2NA 3TK6A 1Z71A 4AGKA 3RXRA 2AMDA 1O2YA 2VVUA 1V2UT 1O3DA 4ISNA 5LGOA 3U1JB 5AFYH 1LPZB 1AHTH 1E79D 2Z9JA 2QGRA 2XW9A 1ELVA 1GMHG 2SNWA 1GG6B 3EYDA 4I86A 1AUTC 2JH0D 4FVBA 2AH4X 3QGNB 1Y3XA 2UUYA 1C5UA 3W1EA 1AWFH 1JRTA 4X1NU 3A88A 1F2SE 1QRXA 1HV7A 1HAOH 1C1WH 1XKBC 2QF5A 2WUBA 1OWEA 1S83A 5DP6A 1LPGB 4GHQA 2FTMA 2SGPE 5DP8A 1TQ7B 2O8MA 5C1YA 1EB1H 1IQIA 1KDQB 3URCA 1SB1H 2WPLS 1EOLA 3O8CA 3RXQA 1AFEH 1S6HA 4NGAH 4O9VA 2J92A 1WYKA 1GHYH 1S5SA 1CT2E 1H8HD 1O5EH 4YOIA 3A82A 1JBUH 3GISB 2ZHDA 5T6GA 1ABJH 1WTGH 2BXUH 2BD8A 3RXMA 1H8IH 4NZQA 2XWAA 2L6OA 1EZXC 3F2HA 1H4WA 1O3KA 4NCYA 1XUFA 5EW1H 1AN1E 1C1NA 1TGCA 1HXEH 2WUCA 2FOHA 4IC5A 1V6DA 1O38A 4NSYA 1O2OA 1VITH 1WCZA 1A0JA 3P8GA 1HAHH 1J16A 9LPRA 3L33A 2PKAB 1EPTA 1HFDA 1DICA 1QL9A 4MNYA 2ZDAH 1HJAC 1V2OT 3RC4A 2QF4A 2A5IA 3LU9B 4K1TA 1GBAA 4BAQB 4ABGA 1P12E 2VWOA 1L1GA 1DVAH 1W0JD 2Z7FE 3RXVA 4TY6A 1SI5H 2PW8H 3MQKC 3A8AA 6LPRA 1ELEE 1FY1A 1D3QB 2W26A 4DT7B 1NTPA 3ZZDA 5AHGH 4ZMAH 3BTKE 2A4QA 1TLDA 1FY4A 1EB2A 1ZMJA 2IOTA 2ZZUH 4IN1A 4U30A 5AFZH 3SU4A 2P16A 4OGYA 1VJAU 2CK3D 1NN6A 1TGNA 4AG2A 1UJ1A 3PRDA 5JBBS 1HAXB 1TQ0B 2SNVA 2CN0H 3LOXA 4QT8C 2ZP0H 2BQWB 2C93B 1OYTH 3RXGA 3BTHE 5DSFA 4F4OC 3RM0H 1ZMNA 5HIYA 1O5BB 1C2GA 3AW0A 3GCOA 1H9IE 4ZKOU 1XUJA 2FOAA 1GJ4H 3A7TA 1W11U 2BD2A 3BN9A 3Q3YA 3TITA 5E0GA 1IQNA 2BDGA 3BG4C 2G8TA 1MH0A 1Z8RA 3ZZAA 2VIVA 2BTCE 1BRAA 1C2EA 3ZVBA 4XRNA 2Z3CA 4AB8A 1GI8B 1CGJE 2Y5HA 3QZQA 3RXLA 2BD3A 2PGQB 2AIPA 1OSSA 2Z9LA 3GCHB 2ZGJA 4Y8XA 1O2WA 1V2PT 1KYNA 2ASUB 3D65E 3QK1A 1ZMLA 1TMUH 3BG8A 5C94A 1C9PA 5EQRA 5E2PA 1YPHE 2FOFA 1GHZA 1TOCB 2ZHEH 3M7TA 1O3EA 1Y3VA 1J8AA 3W95A 1TRMA 4Y79A 1MCTA 1PPGE 1SGPE 1V3XA 2GCHF 1EPTB 2A4RA 1AWHB 1RD3B 1G9IE 4U01A 3KN2A 1UHBA 3KGPA 3PYHA 5A2MH 1YKTA 4BNRA 4BANB 4RT0A 1TNGA 4O97A 3SU3A 4TPYA 1N8OB 2ZI2H 1V2QT 1IQEA 4WXIA 4NIXA 1YF4A 2A7CA 1BHXF 4XD7D 1ZTJA 4RT1A 2ZDMA 1HGTH 1QURH 4E7NA 3AASA 1INCA 3V13A 1C1VH 3C27B 5T6FA 1Z8JB 4X1PU 2ZIQH 1S6FA 2P3UB 1QJ1B 4F55A 4TYDA 5DK1A 4B2BA 5I46H 1A3EH 1BMLA 3GDSA 3OE7D 1C5VA 5B6OA 4NFFA 5L2YH 2ZHQH 1QRWA 1YPLH 2O8LA 3F6UH 1C5NH 5CHAC 1P2IA 1B5GH 4BAOB 1V2MT 3NXPA 1S82A 5T3HA 1T7CA 1ZLRA 4A1XA 3UWJH 2D2DA 3MH7A 4WH8A 3ZYDA 1PQ5A 4I7YH 1SGDE 2ANKH 1Z6JH 4XDEA 2P8OB 1QB6A 1A5GH 1HYLA 3Q00A 7LPRA 1GMDF 2QY0B 3BIUH 3GY2A 2V6NA 4RN6A 1TABE 2VGCC 4OM9A 6CHAB 1O2PA 1QFKH 3PTNA 2C90B 4I8GA 5PTPA 4X8SH 1S0RA 4KTUA 1OWJA 1UVUH 4YM9A 1BUIA 1IQHA 3BSQA 1KIGH 5FL7D 1UTMA 3SU6A 1F0UA 1C2MA 1GI2A 2XBWA 3VB7A 2BMGB 2ODQA 1W13U 1YYY1 1HAYB 5HIZA 1C2JA 4AFSA 2HGTH 4HTCH 2B9LA 3UNQA 2BOHB 1TBZH 2A7HA 5HM9A 2QV1A 2PWXA 4TWWA 1A5IA 2FPZA 1COWD 3SI4H 2VU8E 4OS1A 3ZZ4A 1WXRA 3M3SA 3U69H 1SHHB 4Q63A 2W6ID 1CQQA 4B2AA 2XTTB 1LVOA 1UTOA 1UK3A 4ZXYH 1BTZA 4THNH 2Y81A 3RMLH 1SQTA 3S0NA 1ZGIA 1W14U 2F83A 1HJ8A 3HATH 2FLRH 1EJMA 2VBCA 2JDID 4FUFA 1ESAA 1MMJN 3TJNA 5L6NH 3A89A 2WPHS 1QJ7B 3V0XA 1FAKH 3VB3A 1C4Y2 2PUXB 2THFB 2CHAC 3QGJA 1L1JA 3MU1A 1T8NA 1P03A 4DURA 1SLXB 2Q6GA 2FI4E 4BTTB 1OP0A 1SMFE 2ZF0H 3EA7A 2L74A 2VWMA 2AEIH 2UWPA 2V3MA 4TPIZ 2WPKS 5FPYA 1GI9B 3DD2H 2GCTC 2BX3A 3TH3H 3IWMA 3N7EA 1QA0A 5KGOA 4I8KA 3KEEA 4MPUA 4LZ4B 1NFXA 2ZPSA 3T27A 3IITA 4H42U 2QXGA 4OS6A 1WQSA 5KEDA 3MNSA 1EFRD 2UUFB 4NSVA 1TX8A 3MH4A 1P2NA 4INLA 3U8TH 3RXTA 1LHGH 1FMGA 4IMQA 2AYWA 3RXPA 4D7FA 1YLDA 3BF6H 1GHBF 1L0ZA 4ABEA 1TX7A 1XUIA 1QQUA 2ZU3A 3OY5U 1HIAB 1BT7A 1ZJKA 4I32A 5E0HA 4Q7YA 5CE1A 5SGAE 3F68H 2QN5T 3A83A 3WW7A 1VCPA 2ANMH 1P57B 1X7AC 1O3JA 4XBCA 4ZH8A 3SZNA 1Y59T 1LPKB 2BQ7B 3PWCA 5C0TA 1SGIB 2H1UA 3LGIA 4K8BA 4AG1A 1XXDA 1ZRBA 2ZG0H 1DSUA 3F0PA 4YLQH 1LDTT 2UWOA 3UY9A 4MTBA 4Z6AH 3UQVA 5J4QA 1DX5M 2BDYA 5BPEA 1O2QA 2C8YB 1O3IA 4IGDA 1GDNA 3T26A 3DHKH 2ANWA 1CO7E 3I78A 2ZKSA 3M36A 1O2TA 2Y7ZA 1EKBB 1ZSKA 3GCNA 2AFQB 1CBWB 1EAIA 3U1IB 1K2I1 3O8BA 1YPHC 4H6SB 1SLWB 3LGYA 4A5TS 2KX4A 3RP2A 1AIXH 2GKVE 4DW2U 1XUGA 2WHXA 1C5MD 3KHVA 1AY6H 1LVMA 2JH5D 3RXOA 4HG6A 4OS7A 1TALA 2SGFE 4ABFA 4GHTA 1A2CH 1DPOA 5HKKD 2AS9A 2G4TA 3GICB 1QA7A 4YT6H 1K1NA 5DP3A 3E0PB 1UVTH 3FAOA 1GI3A 4YESB 2EI6A 2JH6D 1FX0B 1P2MA 1BDAA 5T1VA 2YMSB 3ESTA 1DITH 2SGDE 2CJIA 3PO1C 2GZ9A 4VGCC 2FYRA 1CVWH 1ELBA 2ZECA 3EQ0H 2PTNA 3RUOA 5CMXH 2GV6A 1MBQA 1BTYA 4KGAA 1B7XB 5C20A 1GHWH 2XRCA 9ESTA 3QWCH 5LPFA 1O3LA 1FZZA 1AB9B 1ETTH 1GBDA 4TT3D 1N6XA 3K2UA 3SN8A 4AYVB 4FUHA 2TGTA 3CS0A 1C9TA 2OQUA 1VR1H 3ZZ6A 2C8WB 1NBME 2GGVB 3T62A 1BTXA 1AU8A 1GCDA 1NESE 3IG6B 1FY5A 3D23A 3SNAA 1GJCB 3TK5A 1P9UA 1TPOA 1A46H 2VH0A 4M9FA 2J38A 5DJ7A 4PROA 3UTUH 4D8NA 1O3GA 1XM1A 3FFGA 1P2KA 1MKXH 3MMGA 1SR5C 1G30B 3VXEH 3E91A 1E34B 3SYJA 1AFQB 4JYUH 1TMTH 4K1SA 2OC0A 1QHRB 2AGGX 3SGAE 3SJKA 1DXPA 1E35B 4AFQA 4Y11E 2EY4C 3AAUA 1FN8A 5C5NA 4UEHH 4E06H 4DG4A 3RMMH 1U6QA 1SG8B 2DUCA 4I33A 2ZQ2A 4UDWH 1P11E 1SSXA 1GMDG 4ACAA 5A0AE 3ATLA 3FP7E 3M5OA 3SGBE 3SW2B 1C5OH 4MLFB 4A1VA 1GI1A 1O3AA 1K28D 2OBQA 3GYMA 2JETC 4Z1MD 5EXMA 1XX9A 1WDIA 1UVOA 1GVZA 2Y5FA 1F5RA 1Z8GA 1ANEA 2Z3EA 2HVYB 3M7UA 1OS8A 4WY3A 1A0HB 1LKBA 5F53A 4H6TA 3LPRA 3U8RH 4Q7XA 2VINA 1EP5A 3P17H 1YPMH 5FBEA 2Y80A 1KLTA 2ZU1A 3FP6E 4A6LA 2XC4A 1RIWC 2FESH 1E38B 1YCPH 2PP6A 1SGYE 3L6PA 3ZZCA 3RU4D 4ASUD 4ISIH 2ZFQH 2C3SA 4GPGA 5HMAA 4ZHAA 1UCYH 4YLUA 2W3IA 3RXDA 2Z3DA 3H09A 1FAXA 4CHAC 1HRTH 1J14A 2WPDD 2ZDVH 3FVFB 3OYPA 4ABAA 5C1UA 2BY8X 2CXVA 1TE0A 4Y8ZA 2LPRA 4IMZA 3T2NA 2WV4A 3JZ2B 4B76A 1O39A 1BBRH 1SL3A 1EOJA 4MPXA 2VJ1A 3HKJB 1O3OA 5EGMA 5JBCS 3LJOA 2ZDLA 1HBTH 2R3UA 2BX4A 4JYTA 1EAUA 1G2LA 1UK4A 1SFQB 4IN2A 1W10U 4GSOA 1HAGE 1NT1A 3SNEA 3QTVH 1GI5A 3RXCA 4BXSA 1MD7A 1VJ9U 4MG3A 3RXKA 2A45B 1S85A 4NA8A 4UFEH 3TLOA 3DSPA 8ESTE 3F2GA 1TYNA 2V0BA 4HFPB 1JRSA 2GT8A 3AAVA 4ZAEA 1K0HA 4DGJA 1SVPA 2K8IA 3OSYA 4MPWA 3SNBA 1SHYA 4BAHB 1ANBA 1D6RA 3STJA 4BOHA 7GCHF 2FX4A 1O5GH 3JZ1B 2WV5A 3MO3A 5EXLA 1G2MA 4CBOA 3FZDA 2IJD1 1G3EA 2HWLB 2VIQA 4B2CA 4XE4A 4A7IB 4X1SU 1JMOH 1TX6A 1O2HA 2R2MB 3SBKA 2KAIA 4R8TB 4X1QU 4Q80A 1O2XA 2A7JA 2D8WA 4AZ2B 5IK2D 1EJAA 4UFGH 2SGAA 1GHBG 2I6QA 1ETSH 4FU8A 4JK6A 4MNWA 3NWUA 1EZSC 3A81A 1C5WB 1HAVB 2ZNKH 1T8LA 1SQRA 4FUGA 1V2TT 3CENA 2BOKA 1BITA 1NBMD 1P3CA 2AGIX 4Y7AA 1PPEE 1DWEH 3A80A 2VWLA 1MKWH 3ZVCA 1O33A 1DDJA 2QCYA 7ESTE 1QCPA 3CP7A 1E37B 3BG4B 3U28C 2P95A 3A7VA 3UAIC 5A8XA 2FOCA 1K1LA 3MO9A 1JWTA 1GG6C 1CA0B 3M5MA 1QBNA 2QF3A 1EZUC 3RXJA 1P06A 3M3TA 1P2OA 3A85A 5HYOA 3SU2A 3MNXA 4DT4A 2H9TH 2F9VA 1LHEH 1MKXK 3AVZA 5AF9H 2A2QH 1J15A 1ORFA 3KQDA 5HM2A 4XBDA 1W0YH 3SJ8A 1BRBE 3BTFE 4RI0A 3VGCB 3FOAA 3LH3A 1AMHA 3PWBA 1N6YA 1ABIH 1D3DB 1BTHH 2ZFPH 3O8RA 1FN6A 3C1KA 1VCQA 1TNLA 1DT2A 5KECA 2GDDA 2NU1E 2J5UA 1BTUA 3OTPA 1RTLA 2ODYB 1BOQA 3TIUA 3VEQB 2RDLA 2TGPZ 2ZHWH 2J34A 3SJOA 2Z9GA 4E7RG 1W7XH 3NRLA 4K60A 3TH4H 1GMCF 4NIYA 2K0QA 5FX6A 1MTSA 1LTOA 3F0OA 1ZHMA 4Q2KA 3OEED 3F9HA 2YOLA 4FXGH 5ESBA 4D7GA 1SGFA 4AGJA 2GZ8A 1BTPA 1YCPM 2BLQA 2CV3A 2G00A 2KAIB 1SC8U 1LMWB 3SOSA 5T6DA 2WV9A 4NWKA 5L30H 5EPNA 1YCPK 2ZTYA 1QZ8A 3BTEE 5GIBA 2STBE 2G55A 2OBOA 3VB5A 1NFYA 1GBHA 2QE7D 5FHTA 1FIZA 4ABDA 3OAAD 4AYYB 1DLEA 5CHAB 4Y0YE 2C4FH 4A1TA 3RXIA 2AERH 1AZZA 3LC3A 3EA8A 1O3NA 2A1DB 2W5EA 1K1PA 3PMAB 2Z9KA 4YOGA 4CRCA 1EXFA 1OP2A 1LQDB 1AQ7A 1MQ6A 2ANYA 2D26C 3LGWA 4I31A 2NU2E 1RTFB 5EU8A 3Q77A 3SI3H 2B8OH 5I25A 4FVDA 3ZZ8A 2V35A 3GY5A 5FCKA 1LO6A 1PPZA 1C5PA 5A0BA 1HAZB 3FO8D 4ISOA 1V2NT 3PLKA 3SHCH 2I6SA 1D6WA 1MU6B 3A8BA 1NRNH 1BZXE 3MO6A 3QUMP 1O2ZA 3VFEA 2Z9IA 5K0HA 4H4FA 1P0SH 4X8UH 1L2EA 2AMQA 1IQLA 2Y82A 3DSOA 3QX5H 1SGEE 4XFQA 2GMTB 3EE0B 4IBLH 3CNRA 4MNVA 1B0FA 1BMNH 4O3TA 2V3OH 4AN7A 1VKYA 3MH6A 1CGIE 1YGCH 4NIWA 5C5OA 3B9FH 4WWYA 4P00A 1IOEA 4YXWD 4LZ1H 2XBYA 3TVJB 1Q31A 5GDSH 4YTAA 1HAPH 3MFJA 1ZPZA 3PLBA 3VG8A 3QZRA 4KTCA 1DUEA 1OXGA 1QL7A 4Y71A 1GBLA 1TNJA 2ULLA 1UW7A 1KLIH 1MD8A 1T8OA 2ZTXA 2RA3A 3S69A 1OOKB 3T25A 1TNHA 2GX4A 1F0SA 5JBAS 4Y76A 5F8XA 1HAIH 2P59A 1K1IA 2BY5X 2F9UA 4WXVA 2ZU4A 1O3FA 5LH8A 3R0FA 4CREA 1Q3XA 4ESTE 2K1QA 2VB0A 2F9OA 2KCYA 1ZZZA 1YPJH 1O2SA 2G81E 2GCTB 4Q4LA 4RKOB 5ESTE 1A3BH 2F43B 4CRDA 5DN6D 1O2GH 2ZFSA 3V3MA 2BVXH 2EI8A 2ZCKP 2OTVA 2UUJB 1GJ6A 2GJGA 1UHBB 1O3HA 1OX1A 4ABJA 2XC0A 3Q76A 2NU0E 1TAWA 2KFWA 1DANH 2FS9A 2FO9A 2RDEA 2FMJA 1EAXA 2ZGCA 3A8CA 4X6NA 2PUQH 3GCTF 2Y5GA 3SO3A 3PV2A 4MQAA 2GTBA 2A0QB 3KF2A 1UVSH 3PTBA 4KP0A 1HB0B 1PPCE 1VZQH 4CRBA 1FPCH 4B75A 3SV6A 3UOPA 4FUCA 4XOJA 1FI8A 1EATA 2J9NA 5TJXA 2BYAX 1GVLA 1BRUP 3LIWA 5A8YA 1T8MA 4YO9A 7GCHG 5GCHF 8GCHG 3KCGH 1NZQH 1A5HA 1O0DH 3PRBA 3V12A 5TCAA 1T31A 3DT0H 2WZQA 4X6OA 5A0CA 2WINI 1TBQH 3KQBA 2BDAA 2H9EH 4JMYA 4XBBA 2OUAA 3SV7A 3UR6A 1Y3YA 1MTUA 3BTTE 4RKJB 2O9QA 1C1MA 2PKSC 2GD4B 3BTGE 1UVPA 4UD9H 3TNSA 3E16B 4ABHA 3HGNA 1K21H 1TMBH 1IQFA 1TNKA 3MU0A 3LH1A 1BIOA 1CA8B 1WTHD 4CR5A 4B6EA 2PTCE 1W3CA 3BTWE 5F8ZA 1GCTB 5JDUB 1C5RA 1GBTA 4R0IA 5BRRE 2PR3A 2FZZA 4ZKRU 4CH2B 3AK5A 3Q3KA 4JZIA 1QQ4A 1DY9A 4Z0KA 4ZHMU 3P6ZB 1O2LA 1PFXC 2RCEA 1C1SA 1FXYA 1WV7H 4F49A 1HPGA 1C5YB 4I8JA 1RGQA 3UWIA 5DPAA 3P92A 3UB0A 4X8VH 1PJPA 4JYVH 5DP9A 1OWDA 2KCPA 6ESTA 5C2ZA 1DXWA 2VIOA 4TWYA 1NO9H 1XKAC 2OD3B 1F0TA 2FEQH 1HDTH 2QIQA 2LELA 5H4IB 2TGDA 2B5TB 1PQAA 2R9PA 3BV9B 1O2UA 2BDIA 1GWAA 4AB9A 1G32B 1WU1A 3U98H 7KMEH 3K6ZA 2P94A 3SNCA 1GHAG 1F7ZA 1N1LA 1GVKB 1NM6A 3M7QA 3RU4E 1NY22 2HLCA 1PPFE 3UREA 2JJ2D 1KTSB 1V2VT 1EUFA 1VGCC 2BDBA 1G36A 5FPTA 2G5VA 3PO1B 4VGCB 5A09A 1H1BA 3BEFB 1GMCG 1P05A 2WSSD 1TA6A 1CHGA 1EP6A 4LOYH 3MNCA 3ODFA 4FUJA 1QB1A 1GBJA 3LGTA 4MDSA 4AX9H 4NZLA 4BTIB 5HGGA 2XC5A 4WF8A 1C1PA 1CU1A 2ZWLH 3L3TA 1A0LA 1Z1IA 2ZDNA 1H8ED 3M35A 1NRRH 1V2KT 3DSGA 3M37A 3TK9A 1BQYA 1NC6A 3UQOA 1UTQA 1ARBA 2EI7A 3RC6A 1KXAA 2YMSD 1AI8H 5HXFA 1B0EA 1QJ6B 3ZIAD 2ZEBA 4JZ1A 1GGDC 5LPRA 1DS2E 3EAJA 4X2WA 2CF8H 1EAWA 1MAXA 3VB4A 1BMFD 2BB4A 2FOMB 4UE7H 3M61U 4E05H 3SUEA 2ZFTA 1LVYA 5IDKA 3SQHE 1HXFH 1TWXB 4GUXA 4CR9A 1ETRH 2CMYA 1XVOA 5EIYA 4X6PA 4K2YA 1QY6A 1YM0A 2A31A 1S0QA 1O37A 5DGJA 2ZFFH 2G52A 3TGIE 1ZSJA 2JETB 1GPZA 1TBRH 3S9CA 1WAYB 3SUDA 3ODDA 2YNAA 1NS3A 4KTSA 4WMFA 3GY6A 3ZYEA 2IPHA 4AC9A 4SGBE 4FUDA 1FQ3A 3OU0A 2NWNA 2XOKD 1T32A 3OEHD 3PV4A 3E90B 3MU5A 1BRCE 1MBMA 4ZHLU 1MTNB 1Z8IB 3A7WA 3GDUA 1MABB 2KCAA 1TNIA 1V2JT 1GI7B 2G51A 2TIOA 2HOBA 1K9OE 3SGQE 3D49H 4CRAA 3RXSA 1YP9A 2BD4A 3TJUA 3DFJA 1NU9A 3RM2H 3ZVDA 1KXFA 2QC2A 2KM0A 2EQNA 3D62A 2W7UA 3SORA 1KXCA 1C5XB 2H6MA 3F9GA 1OWKA 4SGAE 1O5CB 1ZHPA 1CHOG 5B6LA 1Y3WA 4GVUA 2ZHFH 3PMBB 4WMDA 1Y5UT 1WBGB 1SGQE 1C1RA 2YMSC 2BD7A 2FOBA 2PGBB 1HJ9A 3MOCA 4FU7A 5JB8S 3ATWA 2Y6TA 4WMEA 3HKIB 1C2LA 5JYIA 2J97A 2NU3E 4K5ZA 4D9RA 1HCGA 5DO4H 1H8DH 2F3CE 1H9LB 2GZ7A 1DFPA 2VWNA 1LCYA 3DCLA 4Y10E 5GXPA 3ENSB 4U32A 1ZYOA 3UNRA 2BVRH 2RG3A 1C1UH 1G3BA 1OPHB 2HRVA 2OC1A 2FDAA 1GI6A 3UFAA 4I8LA 1O3PB 4WJG2 1ESTA 3H5CB 3MU4A 5JPMH 1T4VH 3VB6A 1DM4B 1GJ7B 4KELA 2PSYA 3GCTG 4FUIA 2BY6X 2BZ6H 5C67A 3S9BA 1AVGH 1NRSH 1RFNA 2XCFA 3KYFA 1XVMA 2FXRA 2ZGBH 3PMJA 2JKHA 1HLTH 1A7SA 1QR3E 2FX6A 3KQCA 1QBOA 2VH6A 2BY9X 5JB9S 2FIRH 1NU7B 2HNTE 2BVSH 2Q6DA 3KYGA 5GCHG 1LVBA 3A8DA 4DJZB 1Z1JA 5DKMA 2IN2A 3HPTB 3MU8A 2GP9B 1V2WT 3RXFA 1ELTA 3PM3A 1FNIA 1OHHD 1W0KD 2Q1JA 1HJAB 3EGKH 3SNDA 1GJDB 2C8ZB 2EC9H 4J2YB 1C5TA 4X2XA 4M7GA 1QRZA 3NK8A 1THRH 2HPPH 3KQ5A 3PLPA 5E8EH 3QO6A 8GCHF 2O8TA 2BQ6B 2OK5A 4YT7H 1W0ZU 2VIDA 3LGUA 4TY7A 1QBVH 4K3JA 1EX3A 4O3UA 4DOQA 3NZIA 1DUAA 1ANCA 1Y8TA 2BDCA 3OFND 1C5LH 4Y8YA 1P02A 2LNCA 1ACBE 1BJUA 1C2FA 1IHSH 1O2VA 1C2IA 4IS5A 3ZV9A 1V2RT 2D1JA 1UTKA 2XCNA 3LDXH 4DIHH 3QTOH 1GBBA 1PQ8A 1F0RA 1L4DA 1BMAA 2O8UA 1WQVH 3A86A 1NROH 3MNBA 1C2DA 4X0WU 2G4UA 1SQAA 2Z6BD 1AUJA 2BY7X 4GCHF 3S7KB 3MYWA 3ZVAA 2XNDD 2GDEH 3ZV8A 4INHA 3T29A 1RS0A 2STAE 2ALPA 2WYGA 1EJNA 1NFUA 2NU4E 2XBVA 1QTFA 1KMHB 5LPEA 4B74A 1PYTD 2ESTE 2IJOB 4CRGA 2OQ5A 3LKWA 1KXBA 2G5NA 4Y6DA 4DIIH 1SLUB 1TRNA 6GCHF 1MTVA 4B1TA 4CRFA 1ZSLA 1AE5A 1LHCH 3E6PH 4BAKB 4WVPE 4ZROA 2OCVB 2ZO3H 3GS9A 3A87A 5FXLA 1WOFA 5A8ZA 2Y7XA 3T5FH 4JZEH 4AFZA 1GHAF 1C5SA 1MCVA 3BTDE 2ZFRH 1QIXB 2XWBI 3BTQE 1TIOA 2GV7A 2W7SA 2R0LA 5G4BA 4X2VA 1D3PB 1SGNE 2B0FA 2V3HH 4AOQA 4BTUB 1CSOE 2H9HA 1O2JA 4D76A 1F92A 2BLOA 4RSPA 1BCUH 3RLWH 3O8DA 2PFEA 3RXUA 1NFWA 1Y5BT 2ZTZA 3BEIB 4IW4E 5EPYA 2QYIA 1AVWA 4F48B 2RFKC 1G37A 1Y5AT 2ALVA 3UNSA 1GDQA 3RMNH 3T28A 3A7XA 1MTWA 1O5FH 2J2UA 4CH8B 5C3NA 2Z94A 1IAUA 3KNXA 1SBWA 4MPVA 2WPIS 4FOUC 1W2KH 4CBNA 2EA3A 2FI3E 2ZGXH 1PPHE 3LONA 3DFLA 3P70B 3NUMA 1BHXB 1C5ZB 2FM2A 1OKXA 2QF0A 2R0KA 1MQ5A 1EZQA 5EJ1A 3SJ9A 2H2ZA 3BIVH 1MAYA 3KQEA 4OS2A 1CA0C 3OY6U 2CGAA 1O3MA 1UCYK 4UFFH 5EJZA 1JIMA 1GHXH 2M5TA 3ATIA 3PMHB 1DWCH 2QXIA 3TGJE 5GJ4B 1PYTC 1OWIA 1SOZA 1BBRK 3OX7U 3SV8A 1W8BH 5EOKA 3VGCC 1VITF 3G01A 1ZJDA 2QXJA 5DP7A 1HNEE 3TNTA 3LC5A 3DA9B 3SU1A 1DE7H 2AMPA 1UTPA 2WPMS 4A92A 5JBTA 1VCWA 2ZA5A 2SFAA 2ZCHP 2VGCB 2AIQA 3ZZ7A 5FCRA 2KZ4A 3RU4T 3SHAH 3W94A 1YLCA 4I8HA 1K1MA 1GJBB 2ILNA 1P01A 2JIZD 2ZPRA 1EQ9A 3E8LA 4OS5A 1DOJA 3UR9A 3F1SB 5EJLA 5IYTA 1O2IA 4HI3A 3I77A 4B73A 3NPSA 5GPIB 3E1XB 1IQGA 1J17T 1ZHRA 1DWBH 2BHGA 2HALA 3VXFH 3MHWU 2J98A 1WSSH 1PQ7A 3NKKA 5F6MA 1TFXA 3GCHC 2VVCA 2PLXA 2ZGHA 1GI4A 1SLVB 3SU5A 1AE8H 1G3DA 4UONA 1O2KA 1FONA 4YOJA 3B23B 1F5KU 1NRQH 2HNTF 2TGAA 3RMOH 4NA7A 1GHVH 2A4GA 1GJAB 1DSTA 1SPJA 3HGPA 1C2KA 1ARCA 1FPHH 2OC8A 1CHOF 3FKSD 1GL1A 2XYAA 1LHDH 1E1QD 1MKWK 4DCDA 1EPTC 1C4U2 1RTKA 1YPEH 2ZU5A 1C2HA 1K22H 3P8FA 2HNTC 2VVVA 5EXNA 3UIRA 2FI5E 2BLVA 1GL0E 1M9UA 2AGEX 1ELAA 2CHAB 3ELAH 2FP7B 1CGHA 4NFEA 4ZUHA 3RXHA 1CT4E 1N8OC 2J4IA 1A61H 2A4OA 1P2QA 2OINA 4MNXA 4OS4A 5CDFE 4O03A 2QXHA 2PKSB 5EW2H 3RLYH 1AZ8A 3PROA 1O3CA 3I29A 1IQKA 5F03A 1UK2A 1Z7KA 3U9AH 2PHBA 2F9PA 2FWWA 2J94A 1YBWA 2YNBA 1HIAA 4JZDH 1WUNH 4X2YA 3KIDU 3SUFA 1GBEA 3M5NA 2GMTC 1GBMA 3BTME 2FODA 2UUKB 5FPSA 3HK3B 1YY3A 3PB1E
chains in the Genus database with same CATH topology
2KZ4A 3RC6A 2YMSD 2HLDD 2OC1A 2O8MA 5FL7D 1KMHB 4TT3D 2J5UA 3SU6A 3OTPA 3ZIAD 3FN8A 1RTLA 2IJOB 2JIZD 4B74A 5C0UA 1E1RD 4YXWD 3O8CA 4I32A 1BT7A 4B6EA 1BMFD 2FOMB 1W3CA 1NBME 2GGVB 3SUEA 3WW7A 1H8HD 1A1RA 1SKYE 3LKWA 3P8OA 5IDKA 3SZEA 4M9FA 3NRLA 3WWBA 5EQRA 3DSPA 4B73A 3F2GA 5GPIB 3AK5A 2K0QA 3VG8A 2KR7A 2XCFA 4KTCA 5C0TA 3GS9A 4K8BA 2L6OA 1DY9A 3F0OA 3OEED 2QV1A 2JJ1D 2K8IA 2YOLA 3F2HA 3SYJA 5ETXA 5ESBA 3F0PA 4ZCNA 2OC0A 3RC5A 1COWD 1DXPA 1RGQA 5C17A 2AHME 3F3BA 3F2FA 2A4RA 3UB0A 2IJD1 2OC7A 2P59A 3SU0A 3SU5A 3SUDA 2WV9A 4NWKA 1WXRA 2KCPA 1DY8A 1NS3A 4Q63A 1DXWA 4U01A 1JXPA 2W6ID 3KN2A 5EPNA 2F9UA 4R8TB 5EQSA 4I33A 2F4LA 2OBOA 5IK2D 4B6FA 2LELA 1OHHD 1W0KD 2K1QA 4TSFD 5H4IB 2QF4A 3O8DA 3RC4A 3SU3A 3U1IB 2QE7D 2KCYA 2XOKD 3M5OA 4NWLA 3OEHD 2A4GA 3O8BA 4A1VA 3E90B 4XD7D 5EPYA 3OAAD 2OBQA 4Q4LA 1W0JD 4A1TA 2OC8A 2VBCA 5CHBA 3FKSD 2F43B 2JDID 5DN6D 1E1QD 3SV9A 1N1LA 4B71A 4Z1MD 2WHXA 1MABB 2KCAA 2OK5A 3PV5A 4F55A 1NBMD 4TYDA 3KNXA 2KFWA 2JJ2D 3P8NA 4FETA 2A4QA 3OFND 2W6JD 3OE7D 2FP7B 5F53A 5FPTA 3LONA 4I31A 3PV2A 3SU4A 3KF2A 2M2AA 5HKKD 2FM2A 2CK3D 2OINA 5FPYA 3WWFA 2KM0A 2WSSD 4B75A 3U1JB 3PRDA 3SV6A 5CDFE 1E79D 3N7EA 5B6LA 3FO8D 3L6PA 2XCNA 3KEEA 3LOXA 1S6LA 3M5MA 4A1XA 4ASUD 5GNDA 1FX0B 2KCOA 2YMSC 4WH8A 3EYDA 5DSFA 1EFRD 3SU2A 4DT4A 5T1VA 2F9VA 3PRBA 2YMSB 4WF8A 2GVFA 5EQQA 5GJ4B 1CU1A 3N99A 3W1EA 3H09A 3SV8A 2WPDD 2WZQA 3OYPA 3SUGA 3N7DA 3SUFA 1H8ED 4RI0A 3M5NA 4JMYA 3FOAA 3DCLA 4WH6A 3DSOA 2XNDD 2V7QD 3SU1A 3SV7A 4B76A 3M5LA 4A92A 4OM9A 3O8RA 2XNIA 5FPSA 2QF5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KCP A;  2KCO A;  2KCY A; 
#chains in the Genus database with same CATH topology
 1FY8 E;  1YWU A;  5AVD A;  1O32 A;  4AOR A;  1KLJ H;  3K9X B;  3MTY A;  5DP5 A;  4DVA U;  5C0U A;  1AVX A;  4LK4 A;  1TOM H;  1E0F D;  2P8O C;  2J95 A;  1KSN A;  2FTL E;  3UPE A;  1XXF A;  5TCC A;  2VIW A;  1SKY E;  3M3V A;  4X1R U;  1TGT A;  1BTW A;  1Y3U A;  1MZA A;  1ESB A;  3WWB A;  6CHA C;  2J98 B;  1THP B;  3F9E A;  1RJX B;  3P95 A;  2VNT A;  3NCL A;  1GI0 A;  1TPP A;  4NIV A;  2LP6 A;  1LHF H;  2JJ1 D;  3QDZ B;  1HUT H;  1GMH F;  2ZCL P;  2VIP A;  1Q2W A;  5EG4 A;  5C17 A;  1V2S T;  1AGJ A;  2A32 A;  1GJ9 B;  2AHM E;  2P93 A;  5E0J A;  4JK5 A;  2F9N A;  2OC7 A;  1J9C H;  5ABW A;  3B8J A;  1O5D H;  1KXD A;  8LPR A;  1UO6 A;  1EAS A;  3RXE A;  1GBK A;  1O34 A;  1VGC B;  4K1E A;  2BD5 A;  2F4L A;  4GCH G;  4X6M A;  1JIR A;  4ZKN U;  1H9H E;  4GAW A;  4ACB A;  3EA9 A;  2ZPQ A;  2ZDK A;  5FBI A;  2HVX A;  3RXB A;  3LGV A;  1MU8 B;  4X8T H;  4HGC A;  3SV9 A;  1FJS A;  1D9I A;  4NA9 H;  3GY3 A;  2RA0 A;  1TPA E;  3TJO A;  5L2Z H;  1O31 A;  2Q6F A;  3TH2 H;  1SGC A;  3Q3X A;  3GY4 A;  1SFI A;  3P8N A;  4FET A;  3EDX B;  2WPJ S;  2OLG A;  4MVN A;  1THS H;  2IPQ X;  3ATK A;  1ELG A;  6GCH G;  2TPI Z;  1YPK H;  4ZXX H;  3A7Z A;  2HPQ H;  1XUK A;  1ZPB A;  5DG6 A;  1TGS Z;  3FP8 E;  3V7T A;  2ZQ1 A;  2B7D H;  3RDZ A;  2ODP A;  2P3F H;  4YZU A;  4XSK U;  1S81 A;  4NG9 H;  1S84 A;  3R3G B;  2QA9 E;  3QN7 A;  4ISH H;  5J4S A;  1S6L A;  1ZRK A;  2KCO A;  1QGF A;  1AD8 H;  3WY8 A;  4Y0Z E;  1SGR E;  1GGD B;  1QB9 A;  3GY8 A;  1SOT A;  1MUE B;  5EQQ A;  2GVF A;  4BXW A;  3N99 A;  1AO5 A;  1ZR0 A;  1D3T B;  1IQM A;  1RXP A;  3SUG A;  3KL6 A;  1LKA A;  3FAN A;  4ASH A;  1AND A;  1RRK A;  1P3E A;  1D4P B;  3M5L A;  1W12 U;  2XNI A;  3F9F A;  4JZF H;  1OWH A;  1ZTK A;  2HLD D;  2UWL A;  1F5L A;  4ZKS U;  1CT0 E;  2FYQ A;  1XUH A;  3FN8 A;  1YC0 A;  2W3K A;  1GCT C;  8KME 2;  3QLP H;  1A1R A;  1ELD E;  1IHT H;  2BZA A;  3ZZ5 A;  1DLK B;  1BMM H;  1YPG H;  2H5C A;  1KY9 A;  3SZE A;  4DY7 B;  1BA8 B;  2A5A A;  2FOG A;  2P3T B;  3K6Y A;  2WYJ A;  2BLW A;  2F9B H;  2TRM A;  3AW1 A;  1JOU B;  1K1O A;  4UFD H;  5C1X A;  1T4U H;  4FUE A;  1SGT A;  2FOE A;  5FAH A;  1CE5 A;  3RXA A;  4HZH A;  2SGE E;  1O36 A;  4BAM B;  1ZTL A;  2FLB H;  2C8X B;  1ID5 H;  3RC5 A;  1FUJ A;  1UCY E;  2R2W U;  3S7H B;  3A7Y A;  1UTN A;  3F3B A;  4K8Y A;  1GJ5 H;  4OGX A;  4ABB A;  1LQE A;  2H5D A;  2BXT H;  1DY8 A;  3CS7 A;  1K1J A;  1JXP A;  2SGQ E;  5EQS A;  3URD A;  1O2R A;  1O2M A;  5K7R A;  1VIT G;  4B6F A;  1FIW A;  1TON A;  4TSF D;  1BBR E;  1W7G H;  4NWL A;  2CF9 H;  1ZPC A;  3GYL B;  3MI4 A;  4INK A;  5CHB A;  2ZC9 H;  2F91 A;  3HK6 B;  4FU9 A;  2QAA A;  2GCH G;  1XMN B;  2OXS A;  4GLY A;  1QNJ A;  3ZVG A;  4KKD A;  3LJJ A;  3TU7 H;  2XXL A;  1C4V 2;  1TRY A;  1P09 A;  2W6J D;  2DE9 A;  3U8O H;  3K65 B;  1TB6 H;  1E36 B;  1GBC A;  5FX5 A;  1CBW C;  1FV9 A;  1AKS A;  3TPI Z;  2M2A A;  2R3Y A;  3BEU A;  5F8T A;  1TPS A;  3WWF A;  1YLN A;  4ISL A;  3TGK E;  4JCN A;  1RIW B;  5GWZ A;  3E0N B;  1MZD A;  5GND A;  4LXB H;  1NRP H;  2GT7 A;  4J1Y A;  1P10 A;  1C1Q A;  1C1T A;  2TBS A;  3VPK A;  3OTJ E;  1P2J A;  3DUX H;  1C1O A;  3N7D A;  1TA2 A;  3FZZ A;  3ATM A;  4CHA B;  1O30 A;  1ELF A;  3N7O A;  4Y7B A;  2A5K A;  4P02 A;  4WH6 A;  1BB0 B;  2V7Q D;  1UTL M;  3MWI U;  2BM2 A;  4K69 A;  2BD9 A;  3LT3 A;  1PPB H;  4Q7Z A;  3TJV A;  3GDV A;  2DE8 A;  4U2W A;  1KXE A;  1L4Z A;  3UOU A;  1E1R D;  3SJI A;  1QL8 A;  3ZVF A;  1FDP A;  1OP8 A;  1KTT B;  2PSX A;  1V2L T;  5EOD A;  1KDQ A;  1P9S A;  1GJ8 B;  3P8O A;  1DWD H;  1O5A B;  4IC6 A;  3SV2 H;  1A4W H;  1BJV A;  2A2X H;  1GDU A;  1ZGV A;  2KR7 A;  1FY3 A;  3A84 A;  2FS8 A;  1ELC A;  1O35 A;  4ABI A;  5ETX A;  1AB9 C;  1ZOM A;  1OYQ A;  1O3B A;  1UMA H;  2PV9 B;  3MH5 A;  3ZZB A;  1C5Q A;  3H7T A;  1FLE E;  1L1N A;  2O8W A;  1HAV A;  3F2F A;  5E2O A;  3EE7 A;  1G3C A;  3ZVE A;  1UTJ A;  3SU0 A;  1TGB A;  1SQO A;  2OP9 A;  3UUZ A;  1P04 A;  1GBI A;  1GBF A;  3SQE E;  4ZCN A;  1IQJ A;  2ZU2 A;  1Z6E A;  2PKA A;  4FUB A;  1MTN C;  3ZZ9 A;  1AFQ C;  2XBX A;  1SGF G;  3S9A A;  4D9Q A;  3ZZ3 A;  2BDH A;  3E3T A;  4B71 A;  3GOV B;  1P8V C;  3ITI A;  1NPM A;  5DP4 A;  4AFU A;  3GY7 A;  2EEK A;  3STI A;  3PV5 A;  1AKS B;  3H7O A;  1O2N A;  3TK6 A;  1Z71 A;  4AGK A;  3RXR A;  2AMD A;  1O2Y A;  2VVU A;  1V2U T;  1O3D A;  4ISN A;  5LGO A;  3U1J B;  5AFY H;  1LPZ B;  1AHT H;  1E79 D;  2Z9J A;  2QGR A;  2XW9 A;  1ELV A;  1GMH G;  2SNW A;  1GG6 B;  3EYD A;  4I86 A;  1AUT C;  2JH0 D;  4FVB A;  2AH4 X;  3QGN B;  1Y3X A;  2UUY A;  1C5U A;  3W1E A;  1AWF H;  1JRT A;  4X1N U;  3A88 A;  1F2S E;  1QRX A;  1HV7 A;  1HAO H;  1C1W H;  1XKB C;  2QF5 A;  2WUB A;  1OWE A;  1S83 A;  5DP6 A;  1LPG B;  4GHQ A;  2FTM A;  2SGP E;  5DP8 A;  1TQ7 B;  2O8M A;  5C1Y A;  1EB1 H;  1IQI A;  1KDQ B;  3URC A;  1SB1 H;  2WPL S;  1EOL A;  3O8C A;  3RXQ A;  1AFE H;  1S6H A;  4NGA H;  4O9V A;  2J92 A;  1WYK A;  1GHY H;  1S5S A;  1CT2 E;  1H8H D;  1O5E H;  4YOI A;  3A82 A;  1JBU H;  3GIS B;  2ZHD A;  5T6G A;  1ABJ H;  1WTG H;  2BXU H;  2BD8 A;  3RXM A;  1H8I H;  4NZQ A;  2XWA A;  2L6O A;  1EZX C;  3F2H A;  1H4W A;  1O3K A;  4NCY A;  1XUF A;  5EW1 H;  1AN1 E;  1C1N A;  1TGC A;  1HXE H;  2WUC A;  2FOH A;  4IC5 A;  1V6D A;  1O38 A;  4NSY A;  1O2O A;  1VIT H;  1WCZ A;  1A0J A;  3P8G A;  1HAH H;  1J16 A;  9LPR A;  3L33 A;  2PKA B;  1EPT A;  1HFD A;  1DIC A;  1QL9 A;  4MNY A;  2ZDA H;  1HJA C;  1V2O T;  3RC4 A;  2QF4 A;  2A5I A;  3LU9 B;  4K1T A;  1GBA A;  4BAQ B;  4ABG A;  1P12 E;  2VWO A;  1L1G A;  1DVA H;  1W0J D;  2Z7F E;  3RXV A;  4TY6 A;  1SI5 H;  2PW8 H;  3MQK C;  3A8A A;  6LPR A;  1ELE E;  1FY1 A;  1D3Q B;  2W26 A;  4DT7 B;  1NTP A;  3ZZD A;  5AHG H;  4ZMA H;  3BTK E;  2A4Q A;  1TLD A;  1FY4 A;  1EB2 A;  1ZMJ A;  2IOT A;  2ZZU H;  4IN1 A;  4U30 A;  5AFZ H;  3SU4 A;  2P16 A;  4OGY A;  1VJA U;  2CK3 D;  1NN6 A;  1TGN A;  4AG2 A;  1UJ1 A;  3PRD A;  5JBB S;  1HAX B;  1TQ0 B;  2SNV A;  2CN0 H;  3LOX A;  4QT8 C;  2ZP0 H;  2BQW B;  2C93 B;  1OYT H;  3RXG A;  3BTH E;  5DSF A;  4F4O C;  3RM0 H;  1ZMN A;  5HIY A;  1O5B B;  1C2G A;  3AW0 A;  3GCO A;  1H9I E;  4ZKO U;  1XUJ A;  2FOA A;  1GJ4 H;  3A7T A;  1W11 U;  2BD2 A;  3BN9 A;  3Q3Y A;  3TIT A;  5E0G A;  1IQN A;  2BDG A;  3BG4 C;  2G8T A;  1MH0 A;  1Z8R A;  3ZZA A;  2VIV A;  2BTC E;  1BRA A;  1C2E A;  3ZVB A;  4XRN A;  2Z3C A;  4AB8 A;  1GI8 B;  1CGJ E;  2Y5H A;  3QZQ A;  3RXL A;  2BD3 A;  2PGQ B;  2AIP A;  1OSS A;  2Z9L A;  3GCH B;  2ZGJ A;  4Y8X A;  1O2W A;  1V2P T;  1KYN A;  2ASU B;  3D65 E;  3QK1 A;  1ZML A;  1TMU H;  3BG8 A;  5C94 A;  1C9P A;  5EQR A;  5E2P A;  1YPH E;  2FOF A;  1GHZ A;  1TOC B;  2ZHE H;  3M7T A;  1O3E A;  1Y3V A;  1J8A A;  3W95 A;  1TRM A;  4Y79 A;  1MCT A;  1PPG E;  1SGP E;  1V3X A;  2GCH F;  1EPT B;  2A4R A;  1AWH B;  1RD3 B;  1G9I E;  4U01 A;  3KN2 A;  1UHB A;  3KGP A;  3PYH A;  5A2M H;  1YKT A;  4BNR A;  4BAN B;  4RT0 A;  1TNG A;  4O97 A;  3SU3 A;  4TPY A;  1N8O B;  2ZI2 H;  1V2Q T;  1IQE A;  4WXI A;  4NIX A;  1YF4 A;  2A7C A;  1BHX F;  4XD7 D;  1ZTJ A;  4RT1 A;  2ZDM A;  1HGT H;  1QUR H;  4E7N A;  3AAS A;  1INC A;  3V13 A;  1C1V H;  3C27 B;  5T6F A;  1Z8J B;  4X1P U;  2ZIQ H;  1S6F A;  2P3U B;  1QJ1 B;  4F55 A;  4TYD A;  5DK1 A;  4B2B A;  5I46 H;  1A3E H;  1BML A;  3GDS A;  3OE7 D;  1C5V A;  5B6O A;  4NFF A;  5L2Y H;  2ZHQ H;  1QRW A;  1YPL H;  2O8L A;  3F6U H;  1C5N H;  5CHA C;  1P2I A;  1B5G H;  4BAO B;  1V2M T;  3NXP A;  1S82 A;  5T3H A;  1T7C A;  1ZLR A;  4A1X A;  3UWJ H;  2D2D A;  3MH7 A;  4WH8 A;  3ZYD A;  1PQ5 A;  4I7Y H;  1SGD E;  2ANK H;  1Z6J H;  4XDE A;  2P8O B;  1QB6 A;  1A5G H;  1HYL A;  3Q00 A;  7LPR A;  1GMD F;  2QY0 B;  3BIU H;  3GY2 A;  2V6N A;  4RN6 A;  1TAB E;  2VGC C;  4OM9 A;  6CHA B;  1O2P A;  1QFK H;  3PTN A;  2C90 B;  4I8G A;  5PTP A;  4X8S H;  1S0R A;  4KTU A;  1OWJ A;  1UVU H;  4YM9 A;  1BUI A;  1IQH A;  3BSQ A;  1KIG H;  5FL7 D;  1UTM A;  3SU6 A;  1F0U A;  1C2M A;  1GI2 A;  2XBW A;  3VB7 A;  2BMG B;  2ODQ A;  1W13 U;  1YYY 1;  1HAY B;  5HIZ A;  1C2J A;  4AFS A;  2HGT H;  4HTC H;  2B9L A;  3UNQ A;  2BOH B;  1TBZ H;  2A7H A;  5HM9 A;  2QV1 A;  2PWX A;  4TWW A;  1A5I A;  2FPZ A;  1COW D;  3SI4 H;  2VU8 E;  4OS1 A;  3ZZ4 A;  1WXR A;  3M3S A;  3U69 H;  1SHH B;  4Q63 A;  2W6I D;  1CQQ A;  4B2A A;  2XTT B;  1LVO A;  1UTO A;  1UK3 A;  4ZXY H;  1BTZ A;  4THN H;  2Y81 A;  3RML H;  1SQT A;  3S0N A;  1ZGI A;  1W14 U;  2F83 A;  1HJ8 A;  3HAT H;  2FLR H;  1EJM A;  2VBC A;  2JDI D;  4FUF A;  1ESA A;  1MMJ N;  3TJN A;  5L6N H;  3A89 A;  2WPH S;  1QJ7 B;  3V0X A;  1FAK H;  3VB3 A;  1C4Y 2;  2PUX B;  2THF B;  2CHA C;  3QGJ A;  1L1J A;  3MU1 A;  1T8N A;  1P03 A;  4DUR A;  1SLX B;  2Q6G A;  2FI4 E;  4BTT B;  1OP0 A;  1SMF E;  2ZF0 H;  3EA7 A;  2L74 A;  2VWM A;  2AEI H;  2UWP A;  2V3M A;  4TPI Z;  2WPK S;  5FPY A;  1GI9 B;  3DD2 H;  2GCT C;  2BX3 A;  3TH3 H;  3IWM A;  3N7E A;  1QA0 A;  5KGO A;  4I8K A;  3KEE A;  4MPU A;  4LZ4 B;  1NFX A;  2ZPS A;  3T27 A;  3IIT A;  4H42 U;  2QXG A;  4OS6 A;  1WQS A;  5KED A;  3MNS A;  1EFR D;  2UUF B;  4NSV A;  1TX8 A;  3MH4 A;  1P2N A;  4INL A;  3U8T H;  3RXT A;  1LHG H;  1FMG A;  4IMQ A;  2AYW A;  3RXP A;  4D7F A;  1YLD A;  3BF6 H;  1GHB F;  1L0Z A;  4ABE A;  1TX7 A;  1XUI A;  1QQU A;  2ZU3 A;  3OY5 U;  1HIA B;  1BT7 A;  1ZJK A;  4I32 A;  5E0H A;  4Q7Y A;  5CE1 A;  5SGA E;  3F68 H;  2QN5 T;  3A83 A;  3WW7 A;  1VCP A;  2ANM H;  1P57 B;  1X7A C;  1O3J A;  4XBC A;  4ZH8 A;  3SZN A;  1Y59 T;  1LPK B;  2BQ7 B;  3PWC A;  5C0T A;  1SGI B;  2H1U A;  3LGI A;  4K8B A;  4AG1 A;  1XXD A;  1ZRB A;  2ZG0 H;  1DSU A;  3F0P A;  4YLQ H;  1LDT T;  2UWO A;  3UY9 A;  4MTB A;  4Z6A H;  3UQV A;  5J4Q A;  1DX5 M;  2BDY A;  5BPE A;  1O2Q A;  2C8Y B;  1O3I A;  4IGD A;  1GDN A;  3T26 A;  3DHK H;  2ANW A;  1CO7 E;  3I78 A;  2ZKS A;  3M36 A;  1O2T A;  2Y7Z A;  1EKB B;  1ZSK A;  3GCN A;  2AFQ B;  1CBW B;  1EAI A;  3U1I B;  1K2I 1;  3O8B A;  1YPH C;  4H6S B;  1SLW B;  3LGY A;  4A5T S;  2KX4 A;  3RP2 A;  1AIX H;  2GKV E;  4DW2 U;  1XUG A;  2WHX A;  1C5M D;  3KHV A;  1AY6 H;  1LVM A;  2JH5 D;  3RXO A;  4HG6 A;  4OS7 A;  1TAL A;  2SGF E;  4ABF A;  4GHT A;  1A2C H;  1DPO A;  5HKK D;  2AS9 A;  2G4T A;  3GIC B;  1QA7 A;  4YT6 H;  1K1N A;  5DP3 A;  3E0P B;  1UVT H;  3FAO A;  1GI3 A;  4YES B;  2EI6 A;  2JH6 D;  1FX0 B;  1P2M A;  1BDA A;  5T1V A;  2YMS B;  3EST A;  1DIT H;  2SGD E;  2CJI A;  3PO1 C;  2GZ9 A;  4VGC C;  2FYR A;  1CVW H;  1ELB A;  2ZEC A;  3EQ0 H;  2PTN A;  3RUO A;  5CMX H;  2GV6 A;  1MBQ A;  1BTY A;  4KGA A;  1B7X B;  5C20 A;  1GHW H;  2XRC A;  9EST A;  3QWC H;  5LPF A;  1O3L A;  1FZZ A;  1AB9 B;  1ETT H;  1GBD A;  4TT3 D;  1N6X A;  3K2U A;  3SN8 A;  4AYV B;  4FUH A;  2TGT A;  3CS0 A;  1C9T A;  2OQU A;  1VR1 H;  3ZZ6 A;  2C8W B;  1NBM E;  2GGV B;  3T62 A;  1BTX A;  1AU8 A;  1GCD A;  1NES E;  3IG6 B;  1FY5 A;  3D23 A;  3SNA A;  1GJC B;  3TK5 A;  1P9U A;  1TPO A;  1A46 H;  2VH0 A;  4M9F A;  2J38 A;  5DJ7 A;  4PRO A;  3UTU H;  4D8N A;  1O3G A;  1XM1 A;  3FFG A;  1P2K A;  1MKX H;  3MMG A;  1SR5 C;  1G30 B;  3VXE H;  3E91 A;  1E34 B;  3SYJ A;  1AFQ B;  4JYU H;  1TMT H;  4K1S A;  2OC0 A;  1QHR B;  2AGG X;  3SGA E;  3SJK A;  1DXP A;  1E35 B;  4AFQ A;  4Y11 E;  2EY4 C;  3AAU A;  1FN8 A;  5C5N A;  4UEH H;  4E06 H;  4DG4 A;  3RMM H;  1U6Q A;  1SG8 B;  2DUC A;  4I33 A;  2ZQ2 A;  4UDW H;  1P11 E;  1SSX A;  1GMD G;  4ACA A;  5A0A E;  3ATL A;  3FP7 E;  3M5O A;  3SGB E;  3SW2 B;  1C5O H;  4MLF B;  4A1V A;  1GI1 A;  1O3A A;  1K28 D;  2OBQ A;  3GYM A;  2JET C;  4Z1M D;  5EXM A;  1XX9 A;  1WDI A;  1UVO A;  1GVZ A;  2Y5F A;  1F5R A;  1Z8G A;  1ANE A;  2Z3E A;  2HVY B;  3M7U A;  1OS8 A;  4WY3 A;  1A0H B;  1LKB A;  5F53 A;  4H6T A;  3LPR A;  3U8R H;  4Q7X A;  2VIN A;  1EP5 A;  3P17 H;  1YPM H;  5FBE A;  2Y80 A;  1KLT A;  2ZU1 A;  3FP6 E;  4A6L A;  2XC4 A;  1RIW C;  2FES H;  1E38 B;  1YCP H;  2PP6 A;  1SGY E;  3L6P A;  3ZZC A;  3RU4 D;  4ASU D;  4ISI H;  2ZFQ H;  2C3S A;  4GPG A;  5HMA A;  4ZHA A;  1UCY H;  4YLU A;  2W3I A;  3RXD A;  2Z3D A;  3H09 A;  1FAX A;  4CHA C;  1HRT H;  1J14 A;  2WPD D;  2ZDV H;  3FVF B;  3OYP A;  4ABA A;  5C1U A;  2BY8 X;  2CXV A;  1TE0 A;  4Y8Z A;  2LPR A;  4IMZ A;  3T2N A;  2WV4 A;  3JZ2 B;  4B76 A;  1O39 A;  1BBR H;  1SL3 A;  1EOJ A;  4MPX A;  2VJ1 A;  3HKJ B;  1O3O A;  5EGM A;  5JBC S;  3LJO A;  2ZDL A;  1HBT H;  2R3U A;  2BX4 A;  4JYT A;  1EAU A;  1G2L A;  1UK4 A;  1SFQ B;  4IN2 A;  1W10 U;  4GSO A;  1HAG E;  1NT1 A;  3SNE A;  3QTV H;  1GI5 A;  3RXC A;  4BXS A;  1MD7 A;  1VJ9 U;  4MG3 A;  3RXK A;  2A45 B;  1S85 A;  4NA8 A;  4UFE H;  3TLO A;  3DSP A;  8EST E;  3F2G A;  1TYN A;  2V0B A;  4HFP B;  1JRS A;  2GT8 A;  3AAV A;  4ZAE A;  1K0H A;  4DGJ A;  1SVP A;  2K8I A;  3OSY A;  4MPW A;  3SNB A;  1SHY A;  4BAH B;  1ANB A;  1D6R A;  3STJ A;  4BOH A;  7GCH F;  2FX4 A;  1O5G H;  3JZ1 B;  2WV5 A;  3MO3 A;  5EXL A;  1G2M A;  4CBO A;  3FZD A;  2IJD 1;  1G3E A;  2HWL B;  2VIQ A;  4B2C A;  4XE4 A;  4A7I B;  4X1S U;  1JMO H;  1TX6 A;  1O2H A;  2R2M B;  3SBK A;  2KAI A;  4R8T B;  4X1Q U;  4Q80 A;  1O2X A;  2A7J A;  2D8W A;  4AZ2 B;  5IK2 D;  1EJA A;  4UFG H;  2SGA A;  1GHB G;  2I6Q A;  1ETS H;  4FU8 A;  4JK6 A;  4MNW A;  3NWU A;  1EZS C;  3A81 A;  1C5W B;  1HAV B;  2ZNK H;  1T8L A;  1SQR A;  4FUG A;  1V2T T;  3CEN A;  2BOK A;  1BIT A;  1NBM D;  1P3C A;  2AGI X;  4Y7A A;  1PPE E;  1DWE H;  3A80 A;  2VWL A;  1MKW H;  3ZVC A;  1O33 A;  1DDJ A;  2QCY A;  7EST E;  1QCP A;  3CP7 A;  1E37 B;  3BG4 B;  3U28 C;  2P95 A;  3A7V A;  3UAI C;  5A8X A;  2FOC A;  1K1L A;  3MO9 A;  1JWT A;  1GG6 C;  1CA0 B;  3M5M A;  1QBN A;  2QF3 A;  1EZU C;  3RXJ A;  1P06 A;  3M3T A;  1P2O A;  3A85 A;  5HYO A;  3SU2 A;  3MNX A;  4DT4 A;  2H9T H;  2F9V A;  1LHE H;  1MKX K;  3AVZ A;  5AF9 H;  2A2Q H;  1J15 A;  1ORF A;  3KQD A;  5HM2 A;  4XBD A;  1W0Y H;  3SJ8 A;  1BRB E;  3BTF E;  4RI0 A;  3VGC B;  3FOA A;  3LH3 A;  1AMH A;  3PWB A;  1N6Y A;  1ABI H;  1D3D B;  1BTH H;  2ZFP H;  3O8R A;  1FN6 A;  3C1K A;  1VCQ A;  1TNL A;  1DT2 A;  5KEC A;  2GDD A;  2NU1 E;  2J5U A;  1BTU A;  3OTP A;  1RTL A;  2ODY B;  1BOQ A;  3TIU A;  3VEQ B;  2RDL A;  2TGP Z;  2ZHW H;  2J34 A;  3SJO A;  2Z9G A;  4E7R G;  1W7X H;  3NRL A;  4K60 A;  3TH4 H;  1GMC F;  4NIY A;  2K0Q A;  5FX6 A;  1MTS A;  1LTO A;  3F0O A;  1ZHM A;  4Q2K A;  3OEE D;  3F9H A;  2YOL A;  4FXG H;  5ESB A;  4D7G A;  1SGF A;  4AGJ A;  2GZ8 A;  1BTP A;  1YCP M;  2BLQ A;  2CV3 A;  2G00 A;  2KAI B;  1SC8 U;  1LMW B;  3SOS A;  5T6D A;  2WV9 A;  4NWK A;  5L30 H;  5EPN A;  1YCP K;  2ZTY A;  1QZ8 A;  3BTE E;  5GIB A;  2STB E;  2G55 A;  2OBO A;  3VB5 A;  1NFY A;  1GBH A;  2QE7 D;  5FHT A;  1FIZ A;  4ABD A;  3OAA D;  4AYY B;  1DLE A;  5CHA B;  4Y0Y E;  2C4F H;  4A1T A;  3RXI A;  2AER H;  1AZZ A;  3LC3 A;  3EA8 A;  1O3N A;  2A1D B;  2W5E A;  1K1P A;  3PMA B;  2Z9K A;  4YOG A;  4CRC A;  1EXF A;  1OP2 A;  1LQD B;  1AQ7 A;  1MQ6 A;  2ANY A;  2D26 C;  3LGW A;  4I31 A;  2NU2 E;  1RTF B;  5EU8 A;  3Q77 A;  3SI3 H;  2B8O H;  5I25 A;  4FVD A;  3ZZ8 A;  2V35 A;  3GY5 A;  5FCK A;  1LO6 A;  1PPZ A;  1C5P A;  5A0B A;  1HAZ B;  3FO8 D;  4ISO A;  1V2N T;  3PLK A;  3SHC H;  2I6S A;  1D6W A;  1MU6 B;  3A8B A;  1NRN H;  1BZX E;  3MO6 A;  3QUM P;  1O2Z A;  3VFE A;  2Z9I A;  5K0H A;  4H4F A;  1P0S H;  4X8U H;  1L2E A;  2AMQ A;  1IQL A;  2Y82 A;  3DSO A;  3QX5 H;  1SGE E;  4XFQ A;  2GMT B;  3EE0 B;  4IBL H;  3CNR A;  4MNV A;  1B0F A;  1BMN H;  4O3T A;  2V3O H;  4AN7 A;  1VKY A;  3MH6 A;  1CGI E;  1YGC H;  4NIW A;  5C5O A;  3B9F H;  4WWY A;  4P00 A;  1IOE A;  4YXW D;  4LZ1 H;  2XBY A;  3TVJ B;  1Q31 A;  5GDS H;  4YTA A;  1HAP H;  3MFJ A;  1ZPZ A;  3PLB A;  3VG8 A;  3QZR A;  4KTC A;  1DUE A;  1OXG A;  1QL7 A;  4Y71 A;  1GBL A;  1TNJ A;  2ULL A;  1UW7 A;  1KLI H;  1MD8 A;  1T8O A;  2ZTX A;  2RA3 A;  3S69 A;  1OOK B;  3T25 A;  1TNH A;  2GX4 A;  1F0S A;  5JBA S;  4Y76 A;  5F8X A;  1HAI H;  2P59 A;  1K1I A;  2BY5 X;  2F9U A;  4WXV A;  2ZU4 A;  1O3F A;  5LH8 A;  3R0F A;  4CRE A;  1Q3X A;  4EST E;  2K1Q A;  2VB0 A;  2F9O A;  2KCY A;  1ZZZ A;  1YPJ H;  1O2S A;  2G81 E;  2GCT B;  4Q4L A;  4RKO B;  5EST E;  1A3B H;  2F43 B;  4CRD A;  5DN6 D;  1O2G H;  2ZFS A;  3V3M A;  2BVX H;  2EI8 A;  2ZCK P;  2OTV A;  2UUJ B;  1GJ6 A;  2GJG A;  1UHB B;  1O3H A;  1OX1 A;  4ABJ A;  2XC0 A;  3Q76 A;  2NU0 E;  1TAW A;  2KFW A;  1DAN H;  2FS9 A;  2FO9 A;  2RDE A;  2FMJ A;  1EAX A;  2ZGC A;  3A8C A;  4X6N A;  2PUQ H;  3GCT F;  2Y5G A;  3SO3 A;  3PV2 A;  4MQA A;  2GTB A;  2A0Q B;  3KF2 A;  1UVS H;  3PTB A;  4KP0 A;  1HB0 B;  1PPC E;  1VZQ H;  4CRB A;  1FPC H;  4B75 A;  3SV6 A;  3UOP A;  4FUC A;  4XOJ A;  1FI8 A;  1EAT A;  2J9N A;  5TJX A;  2BYA X;  1GVL A;  1BRU P;  3LIW A;  5A8Y A;  1T8M A;  4YO9 A;  7GCH G;  5GCH F;  8GCH G;  3KCG H;  1NZQ H;  1A5H A;  1O0D H;  3PRB A;  3V12 A;  5TCA A;  1T31 A;  3DT0 H;  2WZQ A;  4X6O A;  5A0C A;  2WIN I;  1TBQ H;  3KQB A;  2BDA A;  2H9E H;  4JMY A;  4XBB A;  2OUA A;  3SV7 A;  3UR6 A;  1Y3Y A;  1MTU A;  3BTT E;  4RKJ B;  2O9Q A;  1C1M A;  2PKS C;  2GD4 B;  3BTG E;  1UVP A;  4UD9 H;  3TNS A;  3E16 B;  4ABH A;  3HGN A;  1K21 H;  1TMB H;  1IQF A;  1TNK A;  3MU0 A;  3LH1 A;  1BIO A;  1CA8 B;  1WTH D;  4CR5 A;  4B6E A;  2PTC E;  1W3C A;  3BTW E;  5F8Z A;  1GCT B;  5JDU B;  1C5R A;  1GBT A;  4R0I A;  5BRR E;  2PR3 A;  2FZZ A;  4ZKR U;  4CH2 B;  3AK5 A;  3Q3K A;  4JZI A;  1QQ4 A;  1DY9 A;  4Z0K A;  4ZHM U;  3P6Z B;  1O2L A;  1PFX C;  2RCE A;  1C1S A;  1FXY A;  1WV7 H;  4F49 A;  1HPG A;  1C5Y B;  4I8J A;  1RGQ A;  3UWI A;  5DPA A;  3P92 A;  3UB0 A;  4X8V H;  1PJP A;  4JYV H;  5DP9 A;  1OWD A;  2KCP A;  6EST A;  5C2Z A;  1DXW A;  2VIO A;  4TWY A;  1NO9 H;  1XKA C;  2OD3 B;  1F0T A;  2FEQ H;  1HDT H;  2QIQ A;  2LEL A;  5H4I B;  2TGD A;  2B5T B;  1PQA A;  2R9P A;  3BV9 B;  1O2U A;  2BDI A;  1GWA A;  4AB9 A;  1G32 B;  1WU1 A;  3U98 H;  7KME H;  3K6Z A;  2P94 A;  3SNC A;  1GHA G;  1F7Z A;  1N1L A;  1GVK B;  1NM6 A;  3M7Q A;  3RU4 E;  1NY2 2;  2HLC A;  1PPF E;  3URE A;  2JJ2 D;  1KTS B;  1V2V T;  1EUF A;  1VGC C;  2BDB A;  1G36 A;  5FPT A;  2G5V A;  3PO1 B;  4VGC B;  5A09 A;  1H1B A;  3BEF B;  1GMC G;  1P05 A;  2WSS D;  1TA6 A;  1CHG A;  1EP6 A;  4LOY H;  3MNC A;  3ODF A;  4FUJ A;  1QB1 A;  1GBJ A;  3LGT A;  4MDS A;  4AX9 H;  4NZL A;  4BTI B;  5HGG A;  2XC5 A;  4WF8 A;  1C1P A;  1CU1 A;  2ZWL H;  3L3T A;  1A0L A;  1Z1I A;  2ZDN A;  1H8E D;  3M35 A;  1NRR H;  1V2K T;  3DSG A;  3M37 A;  3TK9 A;  1BQY A;  1NC6 A;  3UQO A;  1UTQ A;  1ARB A;  2EI7 A;  3RC6 A;  1KXA A;  2YMS D;  1AI8 H;  5HXF A;  1B0E A;  1QJ6 B;  3ZIA D;  2ZEB A;  4JZ1 A;  1GGD C;  5LPR A;  1DS2 E;  3EAJ A;  4X2W A;  2CF8 H;  1EAW A;  1MAX A;  3VB4 A;  1BMF D;  2BB4 A;  2FOM B;  4UE7 H;  3M61 U;  4E05 H;  3SUE A;  2ZFT A;  1LVY A;  5IDK A;  3SQH E;  1HXF H;  1TWX B;  4GUX A;  4CR9 A;  1ETR H;  2CMY A;  1XVO A;  5EIY A;  4X6P A;  4K2Y A;  1QY6 A;  1YM0 A;  2A31 A;  1S0Q A;  1O37 A;  5DGJ A;  2ZFF H;  2G52 A;  3TGI E;  1ZSJ A;  2JET B;  1GPZ A;  1TBR H;  3S9C A;  1WAY B;  3SUD A;  3ODD A;  2YNA A;  1NS3 A;  4KTS A;  4WMF A;  3GY6 A;  3ZYE A;  2IPH A;  4AC9 A;  4SGB E;  4FUD A;  1FQ3 A;  3OU0 A;  2NWN A;  2XOK D;  1T32 A;  3OEH D;  3PV4 A;  3E90 B;  3MU5 A;  1BRC E;  1MBM A;  4ZHL U;  1MTN B;  1Z8I B;  3A7W A;  3GDU A;  1MAB B;  2KCA A;  1TNI A;  1V2J T;  1GI7 B;  2G51 A;  2TIO A;  2HOB A;  1K9O E;  3SGQ E;  3D49 H;  4CRA A;  3RXS A;  1YP9 A;  2BD4 A;  3TJU A;  3DFJ A;  1NU9 A;  3RM2 H;  3ZVD A;  1KXF A;  2QC2 A;  2KM0 A;  2EQN A;  3D62 A;  2W7U A;  3SOR A;  1KXC A;  1C5X B;  2H6M A;  3F9G A;  1OWK A;  4SGA E;  1O5C B;  1ZHP A;  1CHO G;  5B6L A;  1Y3W A;  4GVU A;  2ZHF H;  3PMB B;  4WMD A;  1Y5U T;  1WBG B;  1SGQ E;  1C1R A;  2YMS C;  2BD7 A;  2FOB A;  2PGB B;  1HJ9 A;  3MOC A;  4FU7 A;  5JB8 S;  3ATW A;  2Y6T A;  4WME A;  3HKI B;  1C2L A;  5JYI A;  2J97 A;  2NU3 E;  4K5Z A;  4D9R A;  1HCG A;  5DO4 H;  1H8D H;  2F3C E;  1H9L B;  2GZ7 A;  1DFP A;  2VWN A;  1LCY A;  3DCL A;  4Y10 E;  5GXP A;  3ENS B;  4U32 A;  1ZYO A;  3UNR A;  2BVR H;  2RG3 A;  1C1U H;  1G3B A;  1OPH B;  2HRV A;  2OC1 A;  2FDA A;  1GI6 A;  3UFA A;  4I8L A;  1O3P B;  4WJG 2;  1EST A;  3H5C B;  3MU4 A;  5JPM H;  1T4V H;  3VB6 A;  1DM4 B;  1GJ7 B;  4KEL A;  2PSY A;  3GCT G;  4FUI A;  2BY6 X;  2BZ6 H;  5C67 A;  3S9B A;  1AVG H;  1NRS H;  1RFN A;  2XCF A;  3KYF A;  1XVM A;  2FXR A;  2ZGB H;  3PMJ A;  2JKH A;  1HLT H;  1A7S A;  1QR3 E;  2FX6 A;  3KQC A;  1QBO A;  2VH6 A;  2BY9 X;  5JB9 S;  2FIR H;  1NU7 B;  2HNT E;  2BVS H;  2Q6D A;  3KYG A;  5GCH G;  1LVB A;  3A8D A;  4DJZ B;  1Z1J A;  5DKM A;  2IN2 A;  3HPT B;  3MU8 A;  2GP9 B;  1V2W T;  3RXF A;  1ELT A;  3PM3 A;  1FNI A;  1OHH D;  1W0K D;  2Q1J A;  1HJA B;  3EGK H;  3SND A;  1GJD B;  2C8Z B;  2EC9 H;  4J2Y B;  1C5T A;  4X2X A;  4M7G A;  1QRZ A;  3NK8 A;  1THR H;  2HPP H;  3KQ5 A;  3PLP A;  5E8E H;  3QO6 A;  8GCH F;  2O8T A;  2BQ6 B;  2OK5 A;  4YT7 H;  1W0Z U;  2VID A;  3LGU A;  4TY7 A;  1QBV H;  4K3J A;  1EX3 A;  4O3U A;  4DOQ A;  3NZI A;  1DUA A;  1ANC A;  1Y8T A;  2BDC A;  3OFN D;  1C5L H;  4Y8Y A;  1P02 A;  2LNC A;  1ACB E;  1BJU A;  1C2F A;  1IHS H;  1O2V A;  1C2I A;  4IS5 A;  3ZV9 A;  1V2R T;  2D1J A;  1UTK A;  2XCN A;  3LDX H;  4DIH H;  3QTO H;  1GBB A;  1PQ8 A;  1F0R A;  1L4D A;  1BMA A;  2O8U A;  1WQV H;  3A86 A;  1NRO H;  3MNB A;  1C2D A;  4X0W U;  2G4U A;  1SQA A;  2Z6B D;  1AUJ A;  2BY7 X;  4GCH F;  3S7K B;  3MYW A;  3ZVA A;  2XND D;  2GDE H;  3ZV8 A;  4INH A;  3T29 A;  1RS0 A;  2STA E;  2ALP A;  2WYG A;  1EJN A;  1NFU A;  2NU4 E;  2XBV A;  1QTF A;  1KMH B;  5LPE A;  4B74 A;  1PYT D;  2EST E;  2IJO B;  4CRG A;  2OQ5 A;  3LKW A;  1KXB A;  2G5N A;  4Y6D A;  4DII H;  1SLU B;  1TRN A;  6GCH F;  1MTV A;  4B1T A;  4CRF A;  1ZSL A;  1AE5 A;  1LHC H;  3E6P H;  4BAK B;  4WVP E;  4ZRO A;  2OCV B;  2ZO3 H;  3GS9 A;  3A87 A;  5FXL A;  1WOF A;  5A8Z A;  2Y7X A;  3T5F H;  4JZE H;  4AFZ A;  1GHA F;  1C5S A;  1MCV A;  3BTD E;  2ZFR H;  1QIX B;  2XWB I;  3BTQ E;  1TIO A;  2GV7 A;  2W7S A;  2R0L A;  5G4B A;  4X2V A;  1D3P B;  1SGN E;  2B0F A;  2V3H H;  4AOQ A;  4BTU B;  1CSO E;  2H9H A;  1O2J A;  4D76 A;  1F92 A;  2BLO A;  4RSP A;  1BCU H;  3RLW H;  3O8D A;  2PFE A;  3RXU A;  1NFW A;  1Y5B T;  2ZTZ A;  3BEI B;  4IW4 E;  5EPY A;  2QYI A;  1AVW A;  4F48 B;  2RFK C;  1G37 A;  1Y5A T;  2ALV A;  3UNS A;  1GDQ A;  3RMN H;  3T28 A;  3A7X A;  1MTW A;  1O5F H;  2J2U A;  4CH8 B;  5C3N A;  2Z94 A;  1IAU A;  3KNX A;  1SBW A;  4MPV A;  2WPI S;  4FOU C;  1W2K H;  4CBN A;  2EA3 A;  2FI3 E;  2ZGX H;  1PPH E;  3LON A;  3DFL A;  3P70 B;  3NUM A;  1BHX B;  1C5Z B;  2FM2 A;  1OKX A;  2QF0 A;  2R0K A;  1MQ5 A;  1EZQ A;  5EJ1 A;  3SJ9 A;  2H2Z A;  3BIV H;  1MAY A;  3KQE A;  4OS2 A;  1CA0 C;  3OY6 U;  2CGA A;  1O3M A;  1UCY K;  4UFF H;  5EJZ A;  1JIM A;  1GHX H;  2M5T A;  3ATI A;  3PMH B;  1DWC H;  2QXI A;  3TGJ E;  5GJ4 B;  1PYT C;  1OWI A;  1SOZ A;  1BBR K;  3OX7 U;  3SV8 A;  1W8B H;  5EOK A;  3VGC C;  1VIT F;  3G01 A;  1ZJD A;  2QXJ A;  5DP7 A;  1HNE E;  3TNT A;  3LC5 A;  3DA9 B;  3SU1 A;  1DE7 H;  2AMP A;  1UTP A;  2WPM S;  4A92 A;  5JBT A;  1VCW A;  2ZA5 A;  2SFA A;  2ZCH P;  2VGC B;  2AIQ A;  3ZZ7 A;  5FCR A;  2KZ4 A;  3RU4 T;  3SHA H;  3W94 A;  1YLC A;  4I8H A;  1K1M A;  1GJB B;  2ILN A;  1P01 A;  2JIZ D;  2ZPR A;  1EQ9 A;  3E8L A;  4OS5 A;  1DOJ A;  3UR9 A;  3F1S B;  5EJL A;  5IYT A;  1O2I A;  4HI3 A;  3I77 A;  4B73 A;  3NPS A;  5GPI B;  3E1X B;  1IQG A;  1J17 T;  1ZHR A;  1DWB H;  2BHG A;  2HAL A;  3VXF H;  3MHW U;  2J98 A;  1WSS H;  1PQ7 A;  3NKK A;  5F6M A;  1TFX A;  3GCH C;  2VVC A;  2PLX A;  2ZGH A;  1GI4 A;  1SLV B;  3SU5 A;  1AE8 H;  1G3D A;  4UON A;  1O2K A;  1FON A;  4YOJ A;  3B23 B;  1F5K U;  1NRQ H;  2HNT F;  2TGA A;  3RMO H;  4NA7 A;  1GHV H;  2A4G A;  1GJA B;  1DST A;  1SPJ A;  3HGP A;  1C2K A;  1ARC A;  1FPH H;  2OC8 A;  1CHO F;  3FKS D;  1GL1 A;  2XYA A;  1LHD H;  1E1Q D;  1MKW K;  4DCD A;  1EPT C;  1C4U 2;  1RTK A;  1YPE H;  2ZU5 A;  1C2H A;  1K22 H;  3P8F A;  2HNT C;  2VVV A;  5EXN A;  3UIR A;  2FI5 E;  2BLV A;  1GL0 E;  1M9U A;  2AGE X;  1ELA A;  2CHA B;  3ELA H;  2FP7 B;  1CGH A;  4NFE A;  4ZUH A;  3RXH A;  1CT4 E;  1N8O C;  2J4I A;  1A61 H;  2A4O A;  1P2Q A;  2OIN A;  4MNX A;  4OS4 A;  5CDF E;  4O03 A;  2QXH A;  2PKS B;  5EW2 H;  3RLY H;  1AZ8 A;  3PRO A;  1O3C A;  3I29 A;  1IQK A;  5F03 A;  1UK2 A;  1Z7K A;  3U9A H;  2PHB A;  2F9P A;  2FWW A;  2J94 A;  1YBW A;  2YNB A;  1HIA A;  4JZD H;  1WUN H;  4X2Y A;  3KID U;  3SUF A;  1GBE A;  3M5N A;  2GMT C;  1GBM A;  3BTM E;  2FOD A;  2UUK B;  5FPS A;  3HK3 B;  1YY3 A;  3PB1 E; 
#chains in the Genus database with same CATH homology
 2KZ4 A;  3RC6 A;  2YMS D;  2HLD D;  2OC1 A;  2O8M A;  5FL7 D;  1KMH B;  4TT3 D;  2J5U A;  3SU6 A;  3OTP A;  3ZIA D;  3FN8 A;  1RTL A;  2IJO B;  2JIZ D;  4B74 A;  5C0U A;  1E1R D;  4YXW D;  3O8C A;  4I32 A;  1BT7 A;  4B6E A;  1BMF D;  2FOM B;  1W3C A;  1NBM E;  2GGV B;  3SUE A;  3WW7 A;  1H8H D;  1A1R A;  1SKY E;  3LKW A;  3P8O A;  5IDK A;  3SZE A;  4M9F A;  3NRL A;  3WWB A;  5EQR A;  3DSP A;  4B73 A;  3F2G A;  5GPI B;  3AK5 A;  2K0Q A;  3VG8 A;  2KR7 A;  2XCF A;  4KTC A;  5C0T A;  3GS9 A;  4K8B A;  2L6O A;  1DY9 A;  3F0O A;  3OEE D;  2QV1 A;  2JJ1 D;  2K8I A;  2YOL A;  3F2H A;  3SYJ A;  5ETX A;  5ESB A;  3F0P A;  4ZCN A;  2OC0 A;  3RC5 A;  1COW D;  1DXP A;  1RGQ A;  5C17 A;  2AHM E;  3F3B A;  3F2F A;  2A4R A;  3UB0 A;  2IJD 1;  2OC7 A;  2P59 A;  3SU0 A;  3SU5 A;  3SUD A;  2WV9 A;  4NWK A;  1WXR A;  2KCP A;  1DY8 A;  1NS3 A;  4Q63 A;  1DXW A;  4U01 A;  1JXP A;  2W6I D;  3KN2 A;  5EPN A;  2F9U A;  4R8T B;  5EQS A;  4I33 A;  2F4L A;  2OBO A;  5IK2 D;  4B6F A;  2LEL A;  1OHH D;  1W0K D;  2K1Q A;  4TSF D;  5H4I B;  2QF4 A;  3O8D A;  3RC4 A;  3SU3 A;  3U1I B;  2QE7 D;  2KCY A;  2XOK D;  3M5O A;  4NWL A;  3OEH D;  2A4G A;  3O8B A;  4A1V A;  3E90 B;  4XD7 D;  5EPY A;  3OAA D;  2OBQ A;  4Q4L A;  1W0J D;  4A1T A;  2OC8 A;  2VBC A;  5CHB A;  3FKS D;  2F43 B;  2JDI D;  5DN6 D;  1E1Q D;  3SV9 A;  1N1L A;  4B71 A;  4Z1M D;  2WHX A;  1MAB B;  2KCA A;  2OK5 A;  3PV5 A;  4F55 A;  1NBM D;  4TYD A;  3KNX A;  2KFW A;  2JJ2 D;  3P8N A;  4FET A;  2A4Q A;  3OFN D;  2W6J D;  3OE7 D;  2FP7 B;  5F53 A;  5FPT A;  3LON A;  4I31 A;  3PV2 A;  3SU4 A;  3KF2 A;  2M2A A;  5HKK D;  2FM2 A;  2CK3 D;  2OIN A;  5FPY A;  3WWF A;  2KM0 A;  2WSS D;  4B75 A;  3U1J B;  3PRD A;  3SV6 A;  5CDF E;  1E79 D;  3N7E A;  5B6L A;  3FO8 D;  3L6P A;  2XCN A;  3KEE A;  3LOX A;  1S6L A;  3M5M A;  4A1X A;  4ASU D;  5GND A;  1FX0 B;  2KCO A;  2YMS C;  4WH8 A;  3EYD A;  5DSF A;  1EFR D;  3SU2 A;  4DT4 A;  5T1V A;  2F9V A;  3PRB A;  2YMS B;  4WF8 A;  2GVF A;  5EQQ A;  5GJ4 B;  1CU1 A;  3N99 A;  3W1E A;  3H09 A;  3SV8 A;  2WPD D;  2WZQ A;  3OYP A;  3SUG A;  3N7D A;  3SUF A;  1H8E D;  4RI0 A;  3M5N A;  4JMY A;  3FOA A;  3DCL A;  4WH6 A;  3DSO A;  2XND D;  2V7Q D;  3SU1 A;  3SV7 A;  4B76 A;  3M5L A;  4A92 A;  4OM9 A;  3O8R A;  2XNI A;  5FPS A;  2QF5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...