3WW7A

Crystal structure of the computationally designed pizza2 protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
82
structure length
82
Chain Sequence
NTQTVLPFTGLNTPNGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVLPFTGLNTPNGVAVDSAGTVYVTDHGNNRVVKLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords Pizza2 protein
publication title Computational design of a self-assembling symmetrical beta-propeller protein.
pubmed doi rcsb
total genus 12
structure length 82
sequence length 82
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.500 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3ww7A00
3WW7A 4ZCNA 3WWFA 5CHBA 5F53A 3WWBA
chains in the Genus database with same CATH superfamily
1O0DH 1A61H 2VIDA 3UQVA 1O3NA 3RMLH 3GY7A 3ZVFA 2VVCA 2KCYA 1BTHH 3PLKA 3MO6A 5A0CA 1BMMH 2GP9B 2J92A 4ABFA 1O36A 1K2I1 1BMFD 2THFB 3BTGE 3EYDA 4K1SA 1Q3XA 2ALPA 2BD8A 1YPEH 5LH8A 4I86A 5KEDA 1DVAH 3U1IB 1X7AC 2VBCA 4NFFA 3M5OA 1O39A 1Y5BT 3ZZCA 1UJ1A 1V2KT 2VINA 1AGJA 1O2RA 1NBME 4Q63A 2STBE 3KIDU 2WPDD 3I78A 4WWYA 3AAUA 5F6MA 3RM2H 1O3MA 2BY5X 1C2DA 3MHWU 2IOTA 3MTYA 5JBAS 1W12U 1V2MT 1D3QB 1TPPA 3TITA 5FX5A 2AGEX 5HMAA 2NU2E 1SOTA 2OC8A 5EQQA 1XVMA 2SGDE 4I32A 3GCHC 3SJIA 2GMTC 3SHAH 1AUTC 1VGCC 1P3EA 2B5TB 2ZFTA 2C8ZB 3BTME 3SUEA 2G5NA 1DT2A 2A31A 3A8AA 4JK5A 1W0KD 4AGKA 2A1DB 1FAKH 5DP4A 3PLBA 1O3OA 3ZZAA 4NWKA 1OKXA 1RTFB 1T32A 2PHBA 4Y79A 3STJA 4ZKSU 1AE8H 2SNWA 5AFYH 3DA9B 1AE5A 3Q3YA 5E8EH 1Z6JH 3EDXB 5JBBS 1FNIA 2BDAA 3ZVCA 5EXNA 4ACBA 2ZGBH 1HAHH 4ZKOU 1ELCA 1O3HA 2ZNKH 1EZSC 4DY7B 1KXCA 1UMAH 1L4ZA 1NS3A 2HPPH 3U8RH 2AEIH 1OWHA 3PTNA 2XWAA 1L1GA 3UB0A 1LKAA 1MAXA 2QAAA 2P95A 2BTCE 4MPUA 4RKJB 3TK6A 1O2YA 3HK3B 1JMOH 1C5SA 1ORFA 2FS8A 2CN0H 1QL8A 4JZFH 1EASA 1DM4B 1GBKA 1XUJA 3PMBB 2A5IA 1BRCE 4CHAC 4NSVA 1TB6H 3S9AA 3JZ2B 2GZ7A 5J4QA 1PYTD 1GMDF 4AYVB 2IN2A 3GS9A 3NPSA 1W8BH 4IC5A 2F9VA 1V2TT 5C3NA 3WWFA 4TY7A 1VCQA 1S85A 3RXGA 3FOAA 4Q7ZA 5TCAA 1W0JD 4ABBA 2R3UA 1ZJKA 4HGCA 4FUGA 4ABJA 2DUCA 4FUBA 2FI3E 5HKKD 2AGIX 1DWBH 2JH6D 2AMPA 1Y5UT 3MOCA 2XCNA 1ZSJA 1N6XA 3A83A 5DO4H 2FZZA 1O2VA 3PMJA 1KXAA 3P92A 2XBVA 2BD3A 1O2UA 1ZR0A 3RXJA 3PWCA 1NESE 4ABEA 1FZZA 2VH6A 3PMAB 1GJCB 1S6HA 1V2ST 1NPMA 3MU1A 2KM0A 4D8NA 1V2QT 1IAUA 1BTPA 1E79D 1GI4A 1B0EA 1NZQH 2PTNA 1UW7A 5DP6A 3A82A 1HJ8A 1W3CA 1GMDG 2HNTF 4BNRA 2C8XB 2RCEA 3KYGA 2WHXA 1A3EH 1LVBA 1TRNA 4GHTA 3A8DA 2DE9A 1Z8RA 4FVBA 1P2QA 1O2PA 1ELEE 1O2SA 1OOKB 2BLQA 2RDEA 1TLDA 5EXMA 2FOGA 1L1JA 1UHBB 1ELTA 3UUZA 4F4OC 1H8IH 3KQEA 1PQ7A 2GDDA 2ANWA 1IQFA 4X1NU 1LPGB 3ZVAA 4DURA 3RXSA 4XD7D 4X2WA 2ZG0H 3KYFA 2AFQB 2AIQA 1O2LA 1RRKA 2A5KA 1EQ9A 3F2GA 1ETTH 1TWXB 1GI0A 4MPWA 4AORA 4ZHLU 2TGAA 4AFQA 3DCLA 1FIZA 1QNJA 2UUYA 4CBNA 3L33A 3RXHA 1GBHA 4OS7A 1TPSA 1T8OA 1BOQA 2TIOA 3A8BA 3OTPA 5PTPA 1QRWA 5CHBA 3SZEA 2JJ1D 3BTFE 3RXDA 2Z3DA 1SLVB 1NBMD 1TGTA 3GCOA 3A89A 1RIWC 4ZMAH 1GGDC 1HXEH 1F2SE 1MKXK 3MNBA 4XBBA 5T6GA 4NSYA 1HAYB 4NA7A 3H5CB 2BMGB 1AB9C 1MQ6A 1O5CB 3MU8A 4K1EA 4RSPA 3RC5A 2HVXA 4WF8A 3D62A 3ELAH 1XUHA 3UNRA 1DWCH 4UD9H 4MNVA 1C5MD 1JIMA 1GVZA 2B9LA 4Z0KA 4JK6A 1XUIA 4Q4LA 5B6LA 1GCTC 1UK3A 2NU4E 1SGIB 3GYLB 2K0QA 2ZGJA 1O37A 4YESB 3QLPH 1EZQA 4CRBA 1J15A 1GDQA 2KCOA 5H4IB 2ODQA 1GJAB 1Y8TA 4K8BA 1MU6B 3A86A 1NRQH 1N1LA 1W0ZU 4Y71A 5GNDA 5JDUB 3TNTA 5CHAB 5KGOA 1DSTA 3VXEH 4AG1A 1G3CA 4OS5A 1GBLA 1ACBE 3RXFA 2HWLB 1A7SA 1C1MA 4XSKU 4AFSA 1GHBF 4IW4E 1KLJH 3F0OA 2M5TA 1TBZH 1GVLA 1VCPA 2WV9A 3P8FA 3M61U 3RXAA 4F49A 4DG4A 3SV6A 4TYDA 2GX4A 1H1BA 4OGXA 1HAZB 4FU7A 3T27A 1OP8A 1MD7A 1D4PB 1AKSA 2STAE 1QHRB 1VZQH 1S0RA 3QGJA 4F55A 4J2YB 1FMGA 1MABB 3F9FA 4R8TB 1MMJN 1P2MA 1P57B 2ZC9H 3GDVA 2KCAA 1MKXH 3MH7A 1K1PA 5F8TA 1UTLM 4U2WA 3CS0A 4NIXA 4TPIZ 4X6PA 5L2YH 1TX7A 1HUTH 1HAIH 3DHKH 2AIPA 5DP7A 4E7RG 2QXGA 1O2OA 1T4VH 3RXKA 3ZZ8A 4NG9H 4X6NA 4KGAA 1FXYA 1TMBH 1GHBG 1BTUA 5DP3A 1TBRH 2Y81A 4AX9H 3SGAE 2ZU4A 1Z1JA 4NIWA 1FJSA 4F48B 1IOEA 1BRUP 1MTWA 3M3SA 1ABJH 2BLWA 2HGTH 2KCPA 4I8LA 2GV7A 2ZHQH 4Q80A 1BHXF 4CH2B 1KLTA 1YPMH 1U6QA 4WXVA 3R3GB 2Z7FE 2BB4A 2ANKH 3SOSA 1MH0A 1CBWB 2XXLA 1TQ0B 1XVOA 1WSSH 2BY6X 5AHGH 1THSH 1FPCH 1QB1A 3DUXH 1LTOA 2H5CA 2CF8H 2H9EH 2BD7A 1KDQA 2TGTA 4GUXA 3GY8A 3MU4A 1VCWA 3SI3H 5T6DA 2ZHDA 3KF2A 2FIRH 3U98H 1NROH 3PMHB 4AOQA 4INHA 1MUEB 2Q6DA 3FANA 3S9CA 3ZVEA 3OSYA 4ABHA 1L0ZA 2D8WA 2ZHEH 3RC4A 4NZLA 1ZPCA 3QGNB 3A8CA 1WV7H 1EJMA 1LHCH 1C5WB 1HBTH 5IDKA 2B8OH 5JPMH 5HIZA 1NFYA 2XNDD 1ELFA 1LCYA 4JZEH 5BPEA 3PROA 4LZ4B 3ZYDA 4X2YA 4FETA 3SZNA 2BZAA 2HLCA 1GG6B 2VNTA 1O3KA 3ZZ7A 1P3CA 1PQAA 1V2PT 3SV7A 2LNCA 1SQRA 5LGOA 1O2QA 1ELVA 1C5RA 3EA9A 4XOJA 4Y10E 4AFZA 2FTMA 1XUKA 3EE7A 3TJUA 1QBNA 4X1SU 2ZF0H 3WW7A 5ESBA 1CA0C 1MBMA 1DANH 1YWUA 1IQGA 1O31A 1TYNA 1UTOA 1GHAG 4RI0A 2P8OC 3ATIA 1A3BH 5HM9A 1QA7A 4X8SH 5JB8S 4OS6A 3OU0A 1SBWA 4GLYA 1C1UH 1AHTH 2G8TA 2B0FA 1LO6A 4DIHH 2OQUA 4WXIA 3F68H 1GVKB 4X1QU 4FU9A 3U9AH 3A88A 2RDLA 1JOUB 1YPHE 1A0LA 1C1QA 1P2KA 2GD4B 1ZJDA 5T1VA 4Q7YA 4KP0A 1F0TA 1CE5A 1SQOA 3ZVDA 1T7CA 1O2WA 1CQQA 1H9LB 3CNRA 4Y7AA 7KMEH 1P9UA 2O8LA 2Z9IA 3G01A 3V12A 3QZRA 4B2BA 4FUCA 4D9QA 2A32A 1HCGA 5C5OA 3FZZA 8KME2 5B6OA 2XW9A 1O35A 1TA6A 5AF9H 4I7YH 2XBYA 5CE1A 4B2CA 3KQCA 4UONA 4X2XA 1D9IA 1EP5A 2XC4A 1J14A 5FCRA 1TE0A 3RMNH 2WINI 3W94A 1MZAA 1XXDA 1C5NH 3BTQE 1UK4A 2BOHB 1BRBE 2PSXA 3SBKA 1MU8B 1ABIH 3BG4B 3LJJA 2XNIA 2OLGA 2FODA 4DIIH 4ESTE 1TRMA 1JWTA 3SU2A 3M35A 1IQNA 4DVAU 1QA0A 2PR3A 9LPRA 4GAWA 4KTSA 1OWIA 4H6TA 5GCHF 5C17A 1GI6A 2LPRA 5F8ZA 4OGYA 3GY6A 2Y82A 2G81E 5FPYA 3AASA 1HNEE 1H4WA 4ASHA 1LMWB 1P12E 1GBCA 3BTTE 2YMSC 3LGWA 1ETRH 1YM0A 2ZFSA 3MNSA 4ISOA 3N99A 2GT8A 4M9FA 1DE7H 2J5UA 1EOJA 1VITH 1K0HA 3VB6A 4XDEA 1QJ7B 1Z8GA 1YYY1 4AB9A 3H7TA 1BCUH 1G3EA 4KKDA 3HPTB 1PPBH 3BTKE 4U30A 3A7XA 1BHXB 1YY3A 2O8TA 3EE0B 3A80A 2TGPZ 3A81A 2KR7A 3T2NA 1P11E 1MTSA 1Z7KA 1EOLA 1MZDA 1FY1A 1EAWA 1TNLA 1N8OB 3KNXA 3NUMA 2NWNA 1ZTLA 1EFRD 1FY5A 1G2LA 3MNCA 1TGBA 1GHYH 5GCHG 4ABAA 2XRCA 1HFDA 2J98A 2QV1A 1BTWA 1O3JA 5T3HA 2FESH 1CHOF 1BZXE 1TAWA 3U8OH 5EIYA 1KIGH 1K1MA 1S84A 2WPIS 3KQDA 4XE4A 1W11U 2VJ1A 1GI3A 2BDYA 2P94A 1K1IA 1P2OA 3A85A 5DKMA 3URDA 1BTZA 1TPAE 2AH4X 2WPKS 3Q00A 4YZUA 4TWYA 2NU0E 1C5QA 1C1WH 1S6FA 4UFDH 4K3JA 7GCHF 1E37B 2ZFRH 2J38A 2ZU3A 3F2HA 3SGQE 4NIVA 5ABWA 1IHSH 1K28D 3SHCH 3KQBA 1SGQE 4MNXA 1O2ZA 2ZIQH 1ZPBA 1WYKA 3LGYA 2LELA 4IMZA 4ZUHA 2GCTC 3HKJB 8GCHG 1G37A 3OYPA 5A0AE 1ARCA 2ZWLH 1YPHC 3VGCB 1FV9A 1O2XA 1S83A 1B7XB 3DSGA 4FUEA 3OFND 1YPJH 3PV4A 4BTTB 1EPTA 2VIQA 1SFIA 2BXTH 1O2NA 2H6MA 1CHOG 2PW8H 2EEKA 3LGTA 1EP6A 2UWPA 1S81A 1AKSB 3DFJA 4H6SB 4RN6A 1NFUA 5EPYA 1EATA 2GZ8A 1TOMH 4HFPB 5GDSH 4BXWA 3RXTA 2IJD1 1WTGH 2AYWA 3MO3A 4K1TA 2FDAA 5L2ZH 4THNH 1F5LA 4UFGH 5J4SA 2FX6A 4H42U 1IQKA 3EAJA 1ZGIA 3GY4A 4DGJA 4CRFA 2FS9A 2ZPQA 5EJ1A 2OTVA 2PKSC 1FY3A 4ABDA 2NU1E 4JZIA 1GHXH 2VWOA 1S6LA 2PGQB 1A5IA 7ESTE 2J9NA 1BA8B 2KAIA 2JH5D 2JETB 2WPLS 5DJ7A 2ZEBA 4B6EA 2ULLA 3I77A 2C8YB 2V35A 2PGBB 2ZHFH 4X8UH 3L6PA 5JYIA 3UQOA 3DFLA 1K1LA 2BVRH 1W10U 1J17T 3RM0H 1O38A 1A0HB 3E0NB 1DXPA 1KTSB 2J4IA 1ZYOA 1ESBA 2QYIA 3PO1B 1P0SH 1FY4A 3ZIAD 1PYTC 5A8XA 1WQSA 1HGTH 3AW0A 1OPHB 5EXLA 3NK8A 4FUDA 4KTUA 2Z94A 3ZZDA 1GJ8B 4XFQA 1NRNH 3TH2H 3RXPA 1TRYA 3WWBA 1F5RA 1HAVA 1NU9A 1MTVA 5CDFE 2GCHF 2CMYA 1ESAA 1C5XB 3VG8A 2EC9H 2SGPE 4CH8B 2QC2A 2QCYA 2QN5T 2G5VA 3RC6A 2R2MB 2YNBA 3LGIA 1PPEE 3K6YA 4DCDA 1PQ5A 2WPHS 5E0GA 3TJOA 1HPGA 3M7QA 3SU0A 1AFQB 1PQ8A 1ZTKA 4YT6H 4X0WU 1P9SA 1DDJA 3SU6A 2ZKSA 1F0UA 2F9PA 1AVGH 3P95A 2XBWA 2QF0A 2ZHWH 2F9OA 4BTIB 3RU4E 1O33A 1GJ5H 4RT1A 5JB9S 1DXWA 5LPEA 1D3DB 2EI7A 4I8HA 2V3HH 4RKOB 6CHAB 1VITF 1QQUA 1THRH 1C5UA 3DSOA 4AN7A 1C1VH 1TNJA 3AW1A 1GBIA 2DE8A 2XYAA 4KTCA 4E7NA 4CRCA 1QL7A 2GCHG 1N6YA 1FUJA 1P2NA 3RUOA 3SU3A 1H8DH 1A2CH 1T31A 1AVXA 1GBAA 2BOKA 3GY3A 1SVPA 1SL3A 4WJG2 2OBOA 3QTOH 1VJ9U 1KXEA 3MQKC 1FN8A 1HB0B 2QA9E 2BLOA 4FUJA 2PWXA 1Y59T 3A87A 3SUDA 3SUFA 1IHTH 3E6PH 3FO8D 1HAXB 2C8WB 3HGPA 4JZDH 1DUAA 4OM9A 1JRSA 4NCYA 4KELA 2GVFA 3D49H 3EGKH 2P16A 1P06A 3VFEA 2PUXB 1VITG 2ZPSA 3ZYEA 3O8BA 1VJAU 2H9TH 1KSNA 2ZZUH 4XBDA 1UVPA 2ZDMA 4R0IA 3TH4H 2ANMH 2L74A 1RXPA 3UFAA 1IQHA 1A1RA 1KXDA 1QCPA 4ABIA 3Q3XA 1JIRA 3TJNA 3RXEA 5E2OA 2W7SA 1LHDH 3SO3A 3OEHD 2GKVE 4X6OA 5DP5A 2OUAA 1W7XH 1MCTA 1P01A 1HJAB 3CS7A 2TBSA 4UFFH 3Q77A 3S0NA 1MKWK 1DITH 1O30A 3BIUH 4GVUA 1C1PA 3WY8A 5GWZA 2XOKD 5FXLA 2F4LA 1C5ZB 3GCTF 1ZMNA 4ACAA 4INKA 2JH0D 1FIWA 3SQEE 1AMHA 1TNHA 4OS1A 4CRGA 3UY9A 2VIOA 3BV9B 1O3EA 1E36B 4BTUB 4CRAA 3ATKA 3O8DA 2BD5A 2FOHA 1DLKB 2D1JA 5EG4A 1RJXB 3RXCA 3L3TA 1NFWA 2OC7A 3P17H 1ZGVA 3O8CA 2BY8X 3B8JA 1J9CH 3A7TA 2W3KA 1DFPA 1UCYE 1GJDB 3Q76A 1FQ3A 1DS2E 5GIBA 1NRRH 1V6DA 2SNVA 1WTHD 2OC0A 1G30B 3ZZ3A 1P04A 3TVJB 1AI8H 4MNWA 3M5NA 4ISLA 2GDEH 1NTPA 3ZZ4A 1H9IE 4MTBA 2FEQH 1DX5M 1GBMA 2AMDA 2BY7X 4ZXXH 1TQ7B 1YPLH 3BF6H 3LC3A 2A4RA 2ZDVH 1SGFA 2J98B 1BMNH 5I46H 1CT4E 3SQHE 1GJ6A 4SGAE 3VB5A 4PROA 1C4U2 4FVDA 2FOAA 2Z9LA 2HLDD 3PRBA 1UTNA 1UVOA 5IK2D 2HNTE 1A5HA 3SNEA 1O5AB 1ELBA 2W6JD 3PTBA 1VKYA 3QUMP 2HPQH 2SGEE 2FLBH 1ZRBA 4K5ZA 2WUCA 4WY3A 3RXRA 4B2AA 3ATLA 2FP7B 1F7ZA 1YCPK 2KX4A 2QIQA 1CA8B 2O8UA 1AIXH 1B5GH 1TMTH 4YOGA 1NY22 4YLQH 1SQTA 2K8IA 1O2GH 3SUGA 2BD4A 2TRMA 4HTCH 2ZDLA 2A4QA 2F43B 5EJLA 1BBRE 1O32A 1JRTA 1OX1A 4GPGA 1PPGE 3T29A 1E1RD 3RU4D 1HV7A 2LP6A 3GDUA 2ZU2A 2ZTYA 1JXPA 4ZROA 1ZZZA 1XUGA 1EJAA 4ISHH 1GBJA 1EPTB 3ZVGA 4DOQA 5C20A 3Q3KA 2UUJB 3VXFH 5EQRA 4YOJA 4Q7XA 1C2HA 6GCHF 3ZZ6A 2I6SA 3E0PB 1OWJA 2RA3A 1PPCE 1FX0B 3A7ZA 2ZCHP 3OEED 3GYMA 4NA8A 3SU5A 4WMEA 1YF4A 2ZA5A 5IYTA 4AG2A 3SV8A 2ZCLP 2HVYB 3MH5A 3F6UH 2BD2A 5I25A 5CHAC 5HGGA 3BTEE 5DG6A 4Q2KA 3TNSA 4BAQB 2A4GA 1ZHPA 5F53A 3MU0A 3LIWA 1O3BA 1SC8U 2J34A 1QTFA 1D6WA 4FXGH 1V2UT 2QXIA 2IJOB 1O3IA 3SI4H 1OWDA 3MO9A 1MBQA 2WYGA 1DY8A 2V7QD 4GSOA 2CHAB 1NT1A 3LKWA 2PP6A 1ELAA 2FO9A 1J16A 1QURH 2R2WU 1QL9A 1SGDE 1V2VT 2ODYB 3FZDA 3M7TA 1QY6A 3PM3A 2ZI2H 2AMQA 1TMUH 1ZTJA 3OX7U 4YLUA 3IWMA 1ZLRA 3F2FA 6GCHG 4A5TS 3GY2A 2JDID 2V0BA 4P02A 1TIOA 4ZH8A 1BMAA 1CGIE 2EY4C 1TPOA 1UTKA 1C2KA 2BDIA 1OP2A 3M5LA 3SJ9A 2FOFA 1ZRKA 2SFAA 2AGGX 3C27B 3EQ0H 2KFWA 4BANB 2Z9KA 1BJUA 4ISIH 2G00A 1HAVB 2VU8E 1V2RT 1K1NA 1XM1A 1MTNB 1UTMA 2R0LA 4B71A 4JMYA 1EKBB 1C2LA 3MH4A 1C1TA 1NU7B 3CP7A 4I31A 2ZFQH 1FLEE 1QQ4A 3E16B 1GI8B 2UWLA 2Y5FA 3LOXA 3BN9A 1O5FH 1SGTA 1EB2A 1G3BA 1F0RA 1CVWH 3RXOA 2WUBA 4YXWD 2JJ2D 1CBWC 1RD3B 1QJ6B 1P2JA 3V3MA 3TLOA 2F9BH 1DPOA 1SLWB 3F3BA 2Y5HA 3SW2B 2QXHA 3W95A 1G2MA 2HNTC 3ATWA 4Y7BA 3UTUH 1PFXC 4B75A 1BIOA 2Z3CA 1CT2E 1SGFG 2QF4A 5A8ZA 2ZPRA 3BSQA 4JYUH 3OY5U 1XMNB 2VGCB 1UHBA 2Z6BD 2C90B 3QZQA 4IC6A 3F9HA 3ZV9A 5K7RA 2HRVA 1NO9H 2JIZD 4I8GA 1GI2A 3RXBA 4Y8ZA 1O3LA 4MLFB 2VIPA 1O2HA 4WVPE 1Y3UA 1BMLA 4NA9H 3BTDE 2PTCE 4VGCB 1GBEA 5CMXH 1QJ1B 4O3UA 5BRRE 1O5BB 3URCA 3QN7A 2ZO3H 4Y8XA 1ZHMA 1JBUH 3A7VA 1GG6C 2A45B 1FPHH 2FMJA 4A7IB 5EPNA 3ZZ9A 1BT7A 1AN1E 4Y8YA 2XC5A 3NWUA 2OINA 1TGNA 3S9BA 1CHGA 3RP2A 3NCLA 3M3TA 5DP9A 1YLNA 5G4BA 2WPMS 1BTXA 5KECA 2EI8A 4TSFD 8LPRA 1P09A 3HK6B 2G52A 1V2NT 2Q6GA 4A1TA 1TABE 1KYNA 5HM2A 1M9UA 1O3FA 2QF5A 4IBLH 1F92A 1V2JT 5ESTE 1MTUA 1C2IA 2GJGA 1TNIA 4LK4A 4SGBE 3SNCA 5EJZA 2WZQA 1SGRE 1EAUA 1AWHB 4BOHA 4CR5A 1IQIA 3A7YA 3I29A 3MNXA 3RLYH 2VIVA 5DPAA 4YTAA 2CK3D 3LH1A 1AY6H 1PPZA 3ODFA 2ZGCA 1FAXA 1SGEE 5E0JA 1C2EA 4UDWH 2ASUB 1BJVA 2BXUH 4Y6DA 3GCHB 1Z1IA 3MMGA 3QDZB 2W26A 2ZGXH 2BM2A 2GMTB 1UVSH 1ANBA 4WMFA 1GI5A 2FLRH 1VGCB 4X2VA 5GXPA 2PV9B 3LH3A 1UVTH 2XWBI 1SMFE 3GICB 1RS0A 2ZDNA 4YT7H 3KGPA 1GL0E 2UUKB 4A1XA 3TU7H 2CXVA 2P59A 4HZHA 1GI7B 2ZU1A 1EZUC 2A4OA 1WXRA 2XCFA 3BG4C 4CREA 1QRXA 1H8HD 4JYTA 2C3SA 3GCNA 1C5TA 1D3TB 2ZQ1A 1AO5A 2PSYA 1EAXA 5K0HA 1XXFA 4I33A 1K1JA 1UO6A 4BXSA 1IQLA 1TFXA 2VVVA 1DICA 3KCGH 4AYYB 4Z6AH 1P03A 3KN2A 4FUHA 2H5DA 1E38B 1NN6A 8ESTE 4FUFA 5A09A 1HDTH 4RT0A 3M3VA 1DWDH 1AUJA 2P3TB 2CV3A 4DT4A 2OP9A 5DSFA 3E1XB 1TX8A 2A2QH 1QBOA 1P05A 1F5KU 1UTPA 1DLEA 1QBVH 1RTKA 3DD2H 4CR9A 1MD8A 2G4UA 1O34A 2BVXH 3PRDA 3V0XA 3F0PA 3ZZ5A 1O2IA 2BQ6B 2Q6FA 4CHAB 5FHTA 5C5NA 3MU5A 1HAGE 1CU1A 1LPKB 1ELDE 1CO7E 3S7HB 2PLXA 7GCHG 3TIUA 4O03A 1GHWH 3KEEA 2EA3A 2G51A 3U8TH 2FYRA 1C5VA 2NU3E 2W7UA 3QX5H 1IQEA 2FPZA 3RXMA 2B7DH 2CJIA 2OD3B 4UEHH 4ZHMU 4ZKRU 3AK5A 3P6ZB 1N8OC 3ENSB 2QGRA 3E3TA 3BG8A 1O2MA 2ZFPH 1YBWA 3W1EA 1MQ5A 2A5AA 1W2KH 2Y7ZA 1E0FD 3SV2H 3VB7A 4MPXA 1QRZA 4DW2U 3N7EA 1ESTA 2WV5A 1GCDA 3P8OA 1J8AA 3UOPA 3UPEA 1ZMJA 3OE7D 5EOKA 1LVOA 2A7JA 1O2JA 1TGCA 3LGUA 4AC9A 1C2JA 1SGPE 2G55A 2Y5GA 1BITA 1Y3WA 3GISB 1OYQA 3KHVA 5L30H 4QT8C 1BTYA 4AGJA 1YPGH 4WMDA 4NGAH 3LDXH 1L4DA 1SHYA 4ZHAA 3SJOA 1SHHB 4OS2A 1QIXB 3UNQA 3SN8A 1O5GH 1P8VC 2UWOA 3GOVB 4ISNA 1B0FA 1KXBA 5LPRA 1SFQB 3VPKA 3ODDA 1AWFH 3K6ZA 3PB1E 3O8RA 1KDQB 1AU8A 1O3AA 2GV6A 1RTLA 1G32B 2FWWA 2V6NA 1Z8JB 3PWBA 4O9VA 1LHFH 1V2WT 2ALVA 3F9GA 1Y3YA 4MVNA 2F91A 5F8XA 3K2UA 1FONA 2BX3A 3D65E 3VGCC 3GY5A 1O3GA 1C4V2 1ELGA 4A92A 1S82A 2XTTB 1FDPA 4TY6A 3BTWE 1MAYA 4XRNA 2XBXA 3FFGA 5ETXA 2F9NA 4ZCNA 3B23B 2V3OH 2D26C 3TH3H 1GJ7B 1WUNH 3UAIC 1GMCF 1CGJE 2FXRA 3K9XB 2FOBA 2W6ID 4JZ1A 4FU8A 1GI1A 3BEIB 4YO9A 4IS5A 1HRTH 4UE7H 2OBQA 3C1KA 1QB9A 4GCHF 1SGCA 4CBOA 1O3CA 1ID5H 1SG8B 4OS4A 2M2AA 1TOCB 3UR9A 2RG3A 3FP6E 3QTVH 3T26A 2BVSH 1RIWB 1GGDB 2R3YA 1T8MA 2ZFFH 1ANCA 1O2KA 2JETC 3N7DA 4Y0YE 2I6QA 1AB9B 2ZQ2A 1OP0A 5A8YA 5HXFA 1D6RA 3NZIA 1YC0A 2ZTZA 1GBDA 4FUIA 1GCTB 1SQAA 1EZXC 2AHME 2Z3EA 1ZOMA 1F0SA 3MWIU 2H9HA 2UUFB 3P8GA 4E05H 3RXIA 3PO1C 3PV2A 1A46H 1GMCG 5E2PA 2A7HA 2TGDA 6LPRA 2R0KA 5F03A 3A84A 2ZDKA 3SORA 2WYJA 1HIAA 4NWLA 1GDUA 5DN6D 5LPFA 5DGJA 4GCHG 2P3FH 1WDIA 1KMHB 2D2DA 1EUFA 1QR3E 1SOZA 1V2OT 4MQAA 1A4WH 4WH6A 2BDGA 3UNSA 1A5GH 1K9OE 3QWCH 3T5FH 4ASUD 1XUFA 4AZ2B 5E0HA 3RXLA 1XX9A 2BHGA 2BZ6H 2BDBA 3RMMH 3T28A 4K60A 4ZKNU 1AFQC 1PPFE 3KL6A 1FI8A 4B6FA 2YOLA 1AD8H 2ESTE 3RU4T 2FYQA 3SU1A 1K1OA 3K65B 1HXFH 2IPQX 2L6OA 1H9HE 4LXBH 2BQWB 1HAOH 1INCA 3FN8A 6CHAC 3R0FA 2G4TA 3TGIE 1G9IE 1YP9A 1YPKH 3RLWH 1NFXA 3PYHA 1QGFA 1OWEA 2PKAA 3S7KB 3H09A 1SKYE 5FPSA 2VIWA 3HATH 2BYAX 1V2LT 1C1OA 2OCVB 2P3UB 3TJVA 3F1SB 3SYJA 2WV4A 1GDNA 1PPHE 1O5DH 5EODA 1UTJA 4BAKB 1GJBB 4D9RA 2ANYA 1O3PB 1KXFA 2FOEA 4U01A 1YLDA 2RFKC 4BAHB 5DK1A 4ZXYH 2ZCKP 2FX4A 2O8WA 2IPHA 3BIVH 4U32A 1E1QD 2Y80A 3SNDA 3S69A 1Z6EA 1XKBC 3GCTG 4B73A 2ZDAH 1OSSA 5FBIA 5GJ4B 4ABGA 4LZ1H 1EB1H 1W14U 1S5SA 1GWAA 2YNAA 2TPIZ 4X1PU 1ZPZA 4Y11E 3RXVA 2Y7XA 5C1UA 3N7OA 2VWMA 1LHEH 4B74A 2FM2A 1MKWH 1GMHF 3V13A 5C1YA 3P8NA 4MNYA 4A6LA 1HYLA 4WH8A 1T8NA 5FCKA 5C94A 1ANEA 1P2IA 2Y6TA 2K1QA 4MDSA 3U28C 2W3IA 1W13U 1KLIH 1UTQA 3VB4A 3FKSD 1AZZA 4YOIA 3SNBA 2FTLE 2J95A 1GBTA 1HJAC 1T8LA 1ARBA 1ANDA 3LU9B 3TK5A 3BEUA 1E35B 2R9PA 2H1UA 1TGSZ 1ZMLA 1NRPH 2WPJS 1K22H 1C9PA 3ESTA 2J94A 1IQMA 1BUIA 4NIYA 1ZHRA 1OWKA 2RA0A 1SGNE 3LT3A 2VWLA 5AVDA 3PLPA 1CA0B 2J97A 2BD9A 1C5YB 1DUEA 1P10A 5FPTA 3E91A 2P8OB 4I8KA 1HAPH 1C1SA 5FL7D 1GHVH 2ODPA 3UIRA 3RDZA 4BAMB 3ATMA 3IG6B 2OK5A 1O5EH 1GMHG 2BDHA 3QO6A 1SSXA 5FAHA 3GDSA 1YLCA 1Q2WA 1ETSH 1GI9B 2OXSA 3KQ5A 5C2ZA 3TPIZ 5FX6A 2Z9GA 3NKKA 2BX4A 2HOBA 3V7TA 1K21H 1LKBA 3LPRA 4K2YA 5C0UA 1SB1H 1NC6A 5EW2H 2A0QB 3U69H 3FAOA 1SGYE 1ZSLA 1L1NA 1SI5H 1P02A 2HALA 1C9TA 1PJPA 4NZQA 2KAIB 2QXJA 5SGAE 1BRAA 3RXQA 5C67A 4MG3A 1C5LH 4AFUA 4P00A 1YCPH 4K8YA 1LHGH 2H2ZA 3M7UA 4IN1A 5HIYA 1BQYA 3ITIA 4H4FA 1GHAF 1G3DA 2KZ4A 1LQDB 1DWEH 3E90B 3QK1A 3VB3A 3MYWA 1C1NA 4HG6A 1QZ8A 1S0QA 4X8TH 1SLXB 4TPYA 4A1VA 1CGHA 3EA8A 1WQVH 4NFEA 5A0BA 5A2MH 3OY6U 5FBEA 3RMOH 3SV9A 4K69A 3UR6A 1AQ7A 2OQ5A 3SJKA 2A7CA 1SPJA 3TGKE 4JCNA 3B9FH 4FOUC 1OYTH 5DP8A 2ZU5A 3T25A 2W5EA 1CT0E 3AVZA 4B76A 4I8JA 1AFEH 1H8ED 2SGQE 3F9EA 4Z1MD 1EJNA 2VVUA 3SNAA 3PV5A 1LDTT 3UOUA 1A0JA 1VR1H 2EI6A 1Y3VA 2YMSB 3SU4A 4AB8A 3OAAD 5EGMA 2FI5E 1TA2A 1EPTC 5HYOA 3ZV8A 5L6NH 1G36A 1C1RA 1XKAC 4HI3A 1IQJA 5C1XA 2VH0A 2F3CE 1DY9A 1YKTA 2FOCA 3LC5A 3LJOA 1AVWA 2BLVA 1TBQH 3A7WA 4MPVA 1BB0B 2BQ7B 3FVFB 1Z71A 2C4FH 4XBCA 1UK2A 1FN6A 5TJXA 1UCYK 3NXPA 1LVMA 2EQNA 2CGAA 2Q1JA 2FI4E 3U1JB 2ILNA 1Y3XA 2ZGHA 1T4UH 2VWNA 1YCPM 5JBCS 3LONA 3H7OA 4X1RU 4IGDA 1GL1A 1WBGB 1O3DA 1E34B 5EQSA 2CHAC 4X8VH 3HKIB 2ZTXA 4O3TA 2O9QA 1W0YH 1Y5AT 2QF3A 1Q31A 1SR5C 3CENA 1LVYA 1GBFA 1UVUH 4YM9A 3E8LA 4JYVH 2A2XH 3HGNA 1L2EA 1WAYB 3UWIA 2CF9H 1LPZB 3TK9A 2FOMB 3BEFB 1KY9A 3ZZBA 4TWWA 1TNKA 3VEQB 1THPB 1DOJA 4TT3D 4BAOB 1HIAB 2GGVB 3JZ1B 2P93A 2PFEA 1HLTH 1C2GA 1MTNC 5TCCA 1C2MA 3SGBE 4Y76A 2GCTB 1C4Y2 1BBRK 1KTTB 1WOFA 1C5OH 1GPZA 1HJ9A 4CRDA 2VB0A 5EU8A 1UCYH 2Z9JA 1NRSH 3MFJA 1EXFA 1W7GH 5AFZH 1COWD 2SGFE 2GZ9A 4E06H 2C93B 2F83A 2AS9A 5T6FA 7LPRA 4DT7B 1D3PB 3M37A 1WU1A 1RFNA 1OHHD 3FP8E 1MCVA 1NM6A 3IITA 3M36A 6ESTA 1YGCH 5GPIB 3RXUA 5EW1H 2QE7D 1QB6A 2JKHA 2ZECA 1SLUB 4GHQA 5C0TA 1AZ8A 3TGJE 1TNGA 2WSSD 2SGAA 1EX3A 2AERH 4X6MA 2F9UA 2OC1A 3D23A 1TONA 4B1TA 4D7FA 4DJZB 4J1YA 2ZP0H 2PKSB 1TALA 4IN2A 4O97A 4Y0ZE 4D76A 2YMSD 3P70B 3UWJH 9ESTA 3NRLA 8GCHF 2O8MA 2PKAB 4IMQA 2VGCC 4INLA 2QY0B 3LGVA 1WCZA 1CSOE 3ZVBA 1Z8IB 1V3XA 3UREA 2GT7A 2J2UA 3MH6A 5JBTA 1OXGA 1FY8E 3SJ8A 2PUQH 3MI4A 4D7GA 2BDCA 1GJ4H 1ZSKA 3BTHE 1GHZA 3DSPA 4LOYH 1QFKH 3FP7E 4ZAEA 1O2TA 1LQEA 3STIA 4VGCC 1BDAA 3OTJE 1OS8A 1TX6A 3AAVA 1BBRH 3M5MA 3DT0H 2GTBA 1C2FA 1GJ9B 2XC0A 3EA7A 1GBBA 1RGQA 4UFEH 2BY9X 1C5PA 1EAIA 2V3MA 3T62A 1DSUA 4M7GA
chains in the Genus database with same CATH topology
3O8BA 3ZIAD 2FOMB 1E1QD 2FP7B 1NBMD 3AK5A 2KCPA 2KZ4A 4JMYA 2QF5A 4B71A 4B73A 3E90B 3GS9A 2AHME 3W1EA 2F9VA 2KCYA 4TT3D 5GJ4B 3WWFA 4I31A 2K8IA 3RC5A 3EYDA 3N7EA 1BMFD 2GGVB 2WZQA 3FOAA 3P8OA 1A1RA 1W0JD 4WF8A 3WWBA 2A4QA 2F43B 3OE7D 3PV2A 5CDFE 4A1VA 3LOXA 4Q4LA 3U1IB 2VBCA 5B6LA 5HKKD 3OEHD 3VG8A 4B74A 2FM2A 2CK3D 3M5OA 1E1RD 3SV9A 3P8NA 2K0QA 2XCNA 3F2HA 4WH8A 3RC6A 4YXWD 4NWLA 2JJ2D 5DN6D 1JXPA 2K1QA 1NBME 4Q63A 2KCOA 5H4IB 2XOKD 1COWD 2F4LA 1KMHB 2WPDD 4K8BA 4B76A 2LELA 3FKSD 1H8ED 1N1LA 3KF2A 3SU0A 5EQRA 5GNDA 3F3BA 2XNIA 4WH6A 4Z1MD 3OYPA 1OHHD 3PV5A 3SU6A 3SU2A 4ASUD 1FX0B 4B75A 2YMSB 3SU4A 4A1XA 3RC4A 2OC8A 3OAAD 5EQQA 3OFND 3OEED 5GPIB 3O8RA 2KM0A 3O8DA 1RTLA 2P59A 2QE7D 4I32A 2QF4A 3SU5A 1E79D 5C17A 5C0TA 1WXRA 2XCFA 5IDKA 1DXWA 1H8HD 5FPYA 3SV8A 1W3CA 2WSSD 2XNDD 3F0OA 5EPYA 2OC7A 1DY9A 4B6FA 2YOLA 2WV9A 2F9UA 2OC1A 3O8CA 3SV6A 2JIZD 2WHXA 3SUEA 3DSOA 2YMSC 2IJD1 2A4GA 4TYDA 5F53A 4I33A 3SU1A 4A92A 1W0KD 2YMSD 4FETA 4KTCA 3N99A 2L6OA 4M9FA 5FPTA 2J5UA 3KN2A 4NWKA 3NRLA 2O8MA 2IJOB 5FL7D 5ETXA 3SV7A 3FN8A 1DY8A 2V7QD 4F55A 4ZCNA 2OC0A 2OK5A 3SU3A 3U1JB 1MABB 4R8TB 3LKWA 4DT4A 3M5NA 3WW7A 5ESBA 5DSFA 2KCAA 4XD7D 3LONA 2W6ID 4RI0A 1S6LA 3H09A 3DSPA 1SKYE 5FPSA 2OBOA 5EPNA 1BT7A 2OBQA 2A4RA 5EQSA 1NS3A 2OINA 5C0UA 3F2FA 3PRDA 3SYJA 2KR7A 3F0PA 3F2GA 2M2AA 4B6EA 2JDID 3SUFA 3UB0A 1CU1A 3SUDA 3SUGA 3FO8D 3M5MA 3DCLA 3L6PA 4OM9A 3KNXA 2GVFA 2HLDD 3PRBA 5IK2D 1RGQA 1EFRD 3M5LA 3KEEA 2QV1A 4TSFD 2W6JD 3N7DA 1DXPA 3OTPA 4U01A 2KFWA 5CHBA 5T1VA 3SZEA 4A1TA 2JJ1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WW7 A;  4ZCN A;  3WWF A;  5CHB A;  5F53 A;  3WWB A; 
#chains in the Genus database with same CATH topology
 1O0D H;  1A61 H;  2VID A;  3UQV A;  1O3N A;  3RML H;  3GY7 A;  3ZVF A;  2VVC A;  2KCY A;  1BTH H;  3PLK A;  3MO6 A;  5A0C A;  1BMM H;  2GP9 B;  2J92 A;  4ABF A;  1O36 A;  1K2I 1;  1BMF D;  2THF B;  3BTG E;  3EYD A;  4K1S A;  1Q3X A;  2ALP A;  2BD8 A;  1YPE H;  5LH8 A;  4I86 A;  5KED A;  1DVA H;  3U1I B;  1X7A C;  2VBC A;  4NFF A;  3M5O A;  1O39 A;  1Y5B T;  3ZZC A;  1UJ1 A;  1V2K T;  2VIN A;  1AGJ A;  1O2R A;  1NBM E;  4Q63 A;  2STB E;  3KID U;  2WPD D;  3I78 A;  4WWY A;  3AAU A;  5F6M A;  3RM2 H;  1O3M A;  2BY5 X;  1C2D A;  3MHW U;  2IOT A;  3MTY A;  5JBA S;  1W12 U;  1V2M T;  1D3Q B;  1TPP A;  3TIT A;  5FX5 A;  2AGE X;  5HMA A;  2NU2 E;  1SOT A;  2OC8 A;  5EQQ A;  1XVM A;  2SGD E;  4I32 A;  3GCH C;  3SJI A;  2GMT C;  3SHA H;  1AUT C;  1VGC C;  1P3E A;  2B5T B;  2ZFT A;  2C8Z B;  3BTM E;  3SUE A;  2G5N A;  1DT2 A;  2A31 A;  3A8A A;  4JK5 A;  1W0K D;  4AGK A;  2A1D B;  1FAK H;  5DP4 A;  3PLB A;  1O3O A;  3ZZA A;  4NWK A;  1OKX A;  1RTF B;  1T32 A;  2PHB A;  4Y79 A;  3STJ A;  4ZKS U;  1AE8 H;  2SNW A;  5AFY H;  3DA9 B;  1AE5 A;  3Q3Y A;  5E8E H;  1Z6J H;  3EDX B;  5JBB S;  1FNI A;  2BDA A;  3ZVC A;  5EXN A;  4ACB A;  2ZGB H;  1HAH H;  4ZKO U;  1ELC A;  1O3H A;  2ZNK H;  1EZS C;  4DY7 B;  1KXC A;  1UMA H;  1L4Z A;  1NS3 A;  2HPP H;  3U8R H;  2AEI H;  1OWH A;  3PTN A;  2XWA A;  1L1G A;  3UB0 A;  1LKA A;  1MAX A;  2QAA A;  2P95 A;  2BTC E;  4MPU A;  4RKJ B;  3TK6 A;  1O2Y A;  3HK3 B;  1JMO H;  1C5S A;  1ORF A;  2FS8 A;  2CN0 H;  1QL8 A;  4JZF H;  1EAS A;  1DM4 B;  1GBK A;  1XUJ A;  3PMB B;  2A5I A;  1BRC E;  4CHA C;  4NSV A;  1TB6 H;  3S9A A;  3JZ2 B;  2GZ7 A;  5J4Q A;  1PYT D;  1GMD F;  4AYV B;  2IN2 A;  3GS9 A;  3NPS A;  1W8B H;  4IC5 A;  2F9V A;  1V2T T;  5C3N A;  3WWF A;  4TY7 A;  1VCQ A;  1S85 A;  3RXG A;  3FOA A;  4Q7Z A;  5TCA A;  1W0J D;  4ABB A;  2R3U A;  1ZJK A;  4HGC A;  4FUG A;  4ABJ A;  2DUC A;  4FUB A;  2FI3 E;  5HKK D;  2AGI X;  1DWB H;  2JH6 D;  2AMP A;  1Y5U T;  3MOC A;  2XCN A;  1ZSJ A;  1N6X A;  3A83 A;  5DO4 H;  2FZZ A;  1O2V A;  3PMJ A;  1KXA A;  3P92 A;  2XBV A;  2BD3 A;  1O2U A;  1ZR0 A;  3RXJ A;  3PWC A;  1NES E;  4ABE A;  1FZZ A;  2VH6 A;  3PMA B;  1GJC B;  1S6H A;  1V2S T;  1NPM A;  3MU1 A;  2KM0 A;  4D8N A;  1V2Q T;  1IAU A;  1BTP A;  1E79 D;  1GI4 A;  1B0E A;  1NZQ H;  2PTN A;  1UW7 A;  5DP6 A;  3A82 A;  1HJ8 A;  1W3C A;  1GMD G;  2HNT F;  4BNR A;  2C8X B;  2RCE A;  3KYG A;  2WHX A;  1A3E H;  1LVB A;  1TRN A;  4GHT A;  3A8D A;  2DE9 A;  1Z8R A;  4FVB A;  1P2Q A;  1O2P A;  1ELE E;  1O2S A;  1OOK B;  2BLQ A;  2RDE A;  1TLD A;  5EXM A;  2FOG A;  1L1J A;  1UHB B;  1ELT A;  3UUZ A;  4F4O C;  1H8I H;  3KQE A;  1PQ7 A;  2GDD A;  2ANW A;  1IQF A;  4X1N U;  1LPG B;  3ZVA A;  4DUR A;  3RXS A;  4XD7 D;  4X2W A;  2ZG0 H;  3KYF A;  2AFQ B;  2AIQ A;  1O2L A;  1RRK A;  2A5K A;  1EQ9 A;  3F2G A;  1ETT H;  1TWX B;  1GI0 A;  4MPW A;  4AOR A;  4ZHL U;  2TGA A;  4AFQ A;  3DCL A;  1FIZ A;  1QNJ A;  2UUY A;  4CBN A;  3L33 A;  3RXH A;  1GBH A;  4OS7 A;  1TPS A;  1T8O A;  1BOQ A;  2TIO A;  3A8B A;  3OTP A;  5PTP A;  1QRW A;  5CHB A;  3SZE A;  2JJ1 D;  3BTF E;  3RXD A;  2Z3D A;  1SLV B;  1NBM D;  1TGT A;  3GCO A;  3A89 A;  1RIW C;  4ZMA H;  1GGD C;  1HXE H;  1F2S E;  1MKX K;  3MNB A;  4XBB A;  5T6G A;  4NSY A;  1HAY B;  4NA7 A;  3H5C B;  2BMG B;  1AB9 C;  1MQ6 A;  1O5C B;  3MU8 A;  4K1E A;  4RSP A;  3RC5 A;  2HVX A;  4WF8 A;  3D62 A;  3ELA H;  1XUH A;  3UNR A;  1DWC H;  4UD9 H;  4MNV A;  1C5M D;  1JIM A;  1GVZ A;  2B9L A;  4Z0K A;  4JK6 A;  1XUI A;  4Q4L A;  5B6L A;  1GCT C;  1UK3 A;  2NU4 E;  1SGI B;  3GYL B;  2K0Q A;  2ZGJ A;  1O37 A;  4YES B;  3QLP H;  1EZQ A;  4CRB A;  1J15 A;  1GDQ A;  2KCO A;  5H4I B;  2ODQ A;  1GJA B;  1Y8T A;  4K8B A;  1MU6 B;  3A86 A;  1NRQ H;  1N1L A;  1W0Z U;  4Y71 A;  5GND A;  5JDU B;  3TNT A;  5CHA B;  5KGO A;  1DST A;  3VXE H;  4AG1 A;  1G3C A;  4OS5 A;  1GBL A;  1ACB E;  3RXF A;  2HWL B;  1A7S A;  1C1M A;  4XSK U;  4AFS A;  1GHB F;  4IW4 E;  1KLJ H;  3F0O A;  2M5T A;  1TBZ H;  1GVL A;  1VCP A;  2WV9 A;  3P8F A;  3M61 U;  3RXA A;  4F49 A;  4DG4 A;  3SV6 A;  4TYD A;  2GX4 A;  1H1B A;  4OGX A;  1HAZ B;  4FU7 A;  3T27 A;  1OP8 A;  1MD7 A;  1D4P B;  1AKS A;  2STA E;  1QHR B;  1VZQ H;  1S0R A;  3QGJ A;  4F55 A;  4J2Y B;  1FMG A;  1MAB B;  3F9F A;  4R8T B;  1MMJ N;  1P2M A;  1P57 B;  2ZC9 H;  3GDV A;  2KCA A;  1MKX H;  3MH7 A;  1K1P A;  5F8T A;  1UTL M;  4U2W A;  3CS0 A;  4NIX A;  4TPI Z;  4X6P A;  5L2Y H;  1TX7 A;  1HUT H;  1HAI H;  3DHK H;  2AIP A;  5DP7 A;  4E7R G;  2QXG A;  1O2O A;  1T4V H;  3RXK A;  3ZZ8 A;  4NG9 H;  4X6N A;  4KGA A;  1FXY A;  1TMB H;  1GHB G;  1BTU A;  5DP3 A;  1TBR H;  2Y81 A;  4AX9 H;  3SGA E;  2ZU4 A;  1Z1J A;  4NIW A;  1FJS A;  4F48 B;  1IOE A;  1BRU P;  1MTW A;  3M3S A;  1ABJ H;  2BLW A;  2HGT H;  2KCP A;  4I8L A;  2GV7 A;  2ZHQ H;  4Q80 A;  1BHX F;  4CH2 B;  1KLT A;  1YPM H;  1U6Q A;  4WXV A;  3R3G B;  2Z7F E;  2BB4 A;  2ANK H;  3SOS A;  1MH0 A;  1CBW B;  2XXL A;  1TQ0 B;  1XVO A;  1WSS H;  2BY6 X;  5AHG H;  1THS H;  1FPC H;  1QB1 A;  3DUX H;  1LTO A;  2H5C A;  2CF8 H;  2H9E H;  2BD7 A;  1KDQ A;  2TGT A;  4GUX A;  3GY8 A;  3MU4 A;  1VCW A;  3SI3 H;  5T6D A;  2ZHD A;  3KF2 A;  2FIR H;  3U98 H;  1NRO H;  3PMH B;  4AOQ A;  4INH A;  1MUE B;  2Q6D A;  3FAN A;  3S9C A;  3ZVE A;  3OSY A;  4ABH A;  1L0Z A;  2D8W A;  2ZHE H;  3RC4 A;  4NZL A;  1ZPC A;  3QGN B;  3A8C A;  1WV7 H;  1EJM A;  1LHC H;  1C5W B;  1HBT H;  5IDK A;  2B8O H;  5JPM H;  5HIZ A;  1NFY A;  2XND D;  1ELF A;  1LCY A;  4JZE H;  5BPE A;  3PRO A;  4LZ4 B;  3ZYD A;  4X2Y A;  4FET A;  3SZN A;  2BZA A;  2HLC A;  1GG6 B;  2VNT A;  1O3K A;  3ZZ7 A;  1P3C A;  1PQA A;  1V2P T;  3SV7 A;  2LNC A;  1SQR A;  5LGO A;  1O2Q A;  1ELV A;  1C5R A;  3EA9 A;  4XOJ A;  4Y10 E;  4AFZ A;  2FTM A;  1XUK A;  3EE7 A;  3TJU A;  1QBN A;  4X1S U;  2ZF0 H;  3WW7 A;  5ESB A;  1CA0 C;  1MBM A;  1DAN H;  1YWU A;  1IQG A;  1O31 A;  1TYN A;  1UTO A;  1GHA G;  4RI0 A;  2P8O C;  3ATI A;  1A3B H;  5HM9 A;  1QA7 A;  4X8S H;  5JB8 S;  4OS6 A;  3OU0 A;  1SBW A;  4GLY A;  1C1U H;  1AHT H;  2G8T A;  2B0F A;  1LO6 A;  4DIH H;  2OQU A;  4WXI A;  3F68 H;  1GVK B;  4X1Q U;  4FU9 A;  3U9A H;  3A88 A;  2RDL A;  1JOU B;  1YPH E;  1A0L A;  1C1Q A;  1P2K A;  2GD4 B;  1ZJD A;  5T1V A;  4Q7Y A;  4KP0 A;  1F0T A;  1CE5 A;  1SQO A;  3ZVD A;  1T7C A;  1O2W A;  1CQQ A;  1H9L B;  3CNR A;  4Y7A A;  7KME H;  1P9U A;  2O8L A;  2Z9I A;  3G01 A;  3V12 A;  3QZR A;  4B2B A;  4FUC A;  4D9Q A;  2A32 A;  1HCG A;  5C5O A;  3FZZ A;  8KME 2;  5B6O A;  2XW9 A;  1O35 A;  1TA6 A;  5AF9 H;  4I7Y H;  2XBY A;  5CE1 A;  4B2C A;  3KQC A;  4UON A;  4X2X A;  1D9I A;  1EP5 A;  2XC4 A;  1J14 A;  5FCR A;  1TE0 A;  3RMN H;  2WIN I;  3W94 A;  1MZA A;  1XXD A;  1C5N H;  3BTQ E;  1UK4 A;  2BOH B;  1BRB E;  2PSX A;  3SBK A;  1MU8 B;  1ABI H;  3BG4 B;  3LJJ A;  2XNI A;  2OLG A;  2FOD A;  4DII H;  4EST E;  1TRM A;  1JWT A;  3SU2 A;  3M35 A;  1IQN A;  4DVA U;  1QA0 A;  2PR3 A;  9LPR A;  4GAW A;  4KTS A;  1OWI A;  4H6T A;  5GCH F;  5C17 A;  1GI6 A;  2LPR A;  5F8Z A;  4OGY A;  3GY6 A;  2Y82 A;  2G81 E;  5FPY A;  3AAS A;  1HNE E;  1H4W A;  4ASH A;  1LMW B;  1P12 E;  1GBC A;  3BTT E;  2YMS C;  3LGW A;  1ETR H;  1YM0 A;  2ZFS A;  3MNS A;  4ISO A;  3N99 A;  2GT8 A;  4M9F A;  1DE7 H;  2J5U A;  1EOJ A;  1VIT H;  1K0H A;  3VB6 A;  4XDE A;  1QJ7 B;  1Z8G A;  1YYY 1;  4AB9 A;  3H7T A;  1BCU H;  1G3E A;  4KKD A;  3HPT B;  1PPB H;  3BTK E;  4U30 A;  3A7X A;  1BHX B;  1YY3 A;  2O8T A;  3EE0 B;  3A80 A;  2TGP Z;  3A81 A;  2KR7 A;  3T2N A;  1P11 E;  1MTS A;  1Z7K A;  1EOL A;  1MZD A;  1FY1 A;  1EAW A;  1TNL A;  1N8O B;  3KNX A;  3NUM A;  2NWN A;  1ZTL A;  1EFR D;  1FY5 A;  1G2L A;  3MNC A;  1TGB A;  1GHY H;  5GCH G;  4ABA A;  2XRC A;  1HFD A;  2J98 A;  2QV1 A;  1BTW A;  1O3J A;  5T3H A;  2FES H;  1CHO F;  1BZX E;  1TAW A;  3U8O H;  5EIY A;  1KIG H;  1K1M A;  1S84 A;  2WPI S;  3KQD A;  4XE4 A;  1W11 U;  2VJ1 A;  1GI3 A;  2BDY A;  2P94 A;  1K1I A;  1P2O A;  3A85 A;  5DKM A;  3URD A;  1BTZ A;  1TPA E;  2AH4 X;  2WPK S;  3Q00 A;  4YZU A;  4TWY A;  2NU0 E;  1C5Q A;  1C1W H;  1S6F A;  4UFD H;  4K3J A;  7GCH F;  1E37 B;  2ZFR H;  2J38 A;  2ZU3 A;  3F2H A;  3SGQ E;  4NIV A;  5ABW A;  1IHS H;  1K28 D;  3SHC H;  3KQB A;  1SGQ E;  4MNX A;  1O2Z A;  2ZIQ H;  1ZPB A;  1WYK A;  3LGY A;  2LEL A;  4IMZ A;  4ZUH A;  2GCT C;  3HKJ B;  8GCH G;  1G37 A;  3OYP A;  5A0A E;  1ARC A;  2ZWL H;  1YPH C;  3VGC B;  1FV9 A;  1O2X A;  1S83 A;  1B7X B;  3DSG A;  4FUE A;  3OFN D;  1YPJ H;  3PV4 A;  4BTT B;  1EPT A;  2VIQ A;  1SFI A;  2BXT H;  1O2N A;  2H6M A;  1CHO G;  2PW8 H;  2EEK A;  3LGT A;  1EP6 A;  2UWP A;  1S81 A;  1AKS B;  3DFJ A;  4H6S B;  4RN6 A;  1NFU A;  5EPY A;  1EAT A;  2GZ8 A;  1TOM H;  4HFP B;  5GDS H;  4BXW A;  3RXT A;  2IJD 1;  1WTG H;  2AYW A;  3MO3 A;  4K1T A;  2FDA A;  5L2Z H;  4THN H;  1F5L A;  4UFG H;  5J4S A;  2FX6 A;  4H42 U;  1IQK A;  3EAJ A;  1ZGI A;  3GY4 A;  4DGJ A;  4CRF A;  2FS9 A;  2ZPQ A;  5EJ1 A;  2OTV A;  2PKS C;  1FY3 A;  4ABD A;  2NU1 E;  4JZI A;  1GHX H;  2VWO A;  1S6L A;  2PGQ B;  1A5I A;  7EST E;  2J9N A;  1BA8 B;  2KAI A;  2JH5 D;  2JET B;  2WPL S;  5DJ7 A;  2ZEB A;  4B6E A;  2ULL A;  3I77 A;  2C8Y B;  2V35 A;  2PGB B;  2ZHF H;  4X8U H;  3L6P A;  5JYI A;  3UQO A;  3DFL A;  1K1L A;  2BVR H;  1W10 U;  1J17 T;  3RM0 H;  1O38 A;  1A0H B;  3E0N B;  1DXP A;  1KTS B;  2J4I A;  1ZYO A;  1ESB A;  2QYI A;  3PO1 B;  1P0S H;  1FY4 A;  3ZIA D;  1PYT C;  5A8X A;  1WQS A;  1HGT H;  3AW0 A;  1OPH B;  5EXL A;  3NK8 A;  4FUD A;  4KTU A;  2Z94 A;  3ZZD A;  1GJ8 B;  4XFQ A;  1NRN H;  3TH2 H;  3RXP A;  1TRY A;  3WWB A;  1F5R A;  1HAV A;  1NU9 A;  1MTV A;  5CDF E;  2GCH F;  2CMY A;  1ESA A;  1C5X B;  3VG8 A;  2EC9 H;  2SGP E;  4CH8 B;  2QC2 A;  2QCY A;  2QN5 T;  2G5V A;  3RC6 A;  2R2M B;  2YNB A;  3LGI A;  1PPE E;  3K6Y A;  4DCD A;  1PQ5 A;  2WPH S;  5E0G A;  3TJO A;  1HPG A;  3M7Q A;  3SU0 A;  1AFQ B;  1PQ8 A;  1ZTK A;  4YT6 H;  4X0W U;  1P9S A;  1DDJ A;  3SU6 A;  2ZKS A;  1F0U A;  2F9P A;  1AVG H;  3P95 A;  2XBW A;  2QF0 A;  2ZHW H;  2F9O A;  4BTI B;  3RU4 E;  1O33 A;  1GJ5 H;  4RT1 A;  5JB9 S;  1DXW A;  5LPE A;  1D3D B;  2EI7 A;  4I8H A;  2V3H H;  4RKO B;  6CHA B;  1VIT F;  1QQU A;  1THR H;  1C5U A;  3DSO A;  4AN7 A;  1C1V H;  1TNJ A;  3AW1 A;  1GBI A;  2DE8 A;  2XYA A;  4KTC A;  4E7N A;  4CRC A;  1QL7 A;  2GCH G;  1N6Y A;  1FUJ A;  1P2N A;  3RUO A;  3SU3 A;  1H8D H;  1A2C H;  1T31 A;  1AVX A;  1GBA A;  2BOK A;  3GY3 A;  1SVP A;  1SL3 A;  4WJG 2;  2OBO A;  3QTO H;  1VJ9 U;  1KXE A;  3MQK C;  1FN8 A;  1HB0 B;  2QA9 E;  2BLO A;  4FUJ A;  2PWX A;  1Y59 T;  3A87 A;  3SUD A;  3SUF A;  1IHT H;  3E6P H;  3FO8 D;  1HAX B;  2C8W B;  3HGP A;  4JZD H;  1DUA A;  4OM9 A;  1JRS A;  4NCY A;  4KEL A;  2GVF A;  3D49 H;  3EGK H;  2P16 A;  1P06 A;  3VFE A;  2PUX B;  1VIT G;  2ZPS A;  3ZYE A;  3O8B A;  1VJA U;  2H9T H;  1KSN A;  2ZZU H;  4XBD A;  1UVP A;  2ZDM A;  4R0I A;  3TH4 H;  2ANM H;  2L74 A;  1RXP A;  3UFA A;  1IQH A;  1A1R A;  1KXD A;  1QCP A;  4ABI A;  3Q3X A;  1JIR A;  3TJN A;  3RXE A;  5E2O A;  2W7S A;  1LHD H;  3SO3 A;  3OEH D;  2GKV E;  4X6O A;  5DP5 A;  2OUA A;  1W7X H;  1MCT A;  1P01 A;  1HJA B;  3CS7 A;  2TBS A;  4UFF H;  3Q77 A;  3S0N A;  1MKW K;  1DIT H;  1O30 A;  3BIU H;  4GVU A;  1C1P A;  3WY8 A;  5GWZ A;  2XOK D;  5FXL A;  2F4L A;  1C5Z B;  3GCT F;  1ZMN A;  4ACA A;  4INK A;  2JH0 D;  1FIW A;  3SQE E;  1AMH A;  1TNH A;  4OS1 A;  4CRG A;  3UY9 A;  2VIO A;  3BV9 B;  1O3E A;  1E36 B;  4BTU B;  4CRA A;  3ATK A;  3O8D A;  2BD5 A;  2FOH A;  1DLK B;  2D1J A;  5EG4 A;  1RJX B;  3RXC A;  3L3T A;  1NFW A;  2OC7 A;  3P17 H;  1ZGV A;  3O8C A;  2BY8 X;  3B8J A;  1J9C H;  3A7T A;  2W3K A;  1DFP A;  1UCY E;  1GJD B;  3Q76 A;  1FQ3 A;  1DS2 E;  5GIB A;  1NRR H;  1V6D A;  2SNV A;  1WTH D;  2OC0 A;  1G30 B;  3ZZ3 A;  1P04 A;  3TVJ B;  1AI8 H;  4MNW A;  3M5N A;  4ISL A;  2GDE H;  1NTP A;  3ZZ4 A;  1H9I E;  4MTB A;  2FEQ H;  1DX5 M;  1GBM A;  2AMD A;  2BY7 X;  4ZXX H;  1TQ7 B;  1YPL H;  3BF6 H;  3LC3 A;  2A4R A;  2ZDV H;  1SGF A;  2J98 B;  1BMN H;  5I46 H;  1CT4 E;  3SQH E;  1GJ6 A;  4SGA E;  3VB5 A;  4PRO A;  1C4U 2;  4FVD A;  2FOA A;  2Z9L A;  2HLD D;  3PRB A;  1UTN A;  1UVO A;  5IK2 D;  2HNT E;  1A5H A;  3SNE A;  1O5A B;  1ELB A;  2W6J D;  3PTB A;  1VKY A;  3QUM P;  2HPQ H;  2SGE E;  2FLB H;  1ZRB A;  4K5Z A;  2WUC A;  4WY3 A;  3RXR A;  4B2A A;  3ATL A;  2FP7 B;  1F7Z A;  1YCP K;  2KX4 A;  2QIQ A;  1CA8 B;  2O8U A;  1AIX H;  1B5G H;  1TMT H;  4YOG A;  1NY2 2;  4YLQ H;  1SQT A;  2K8I A;  1O2G H;  3SUG A;  2BD4 A;  2TRM A;  4HTC H;  2ZDL A;  2A4Q A;  2F43 B;  5EJL A;  1BBR E;  1O32 A;  1JRT A;  1OX1 A;  4GPG A;  1PPG E;  3T29 A;  1E1R D;  3RU4 D;  1HV7 A;  2LP6 A;  3GDU A;  2ZU2 A;  2ZTY A;  1JXP A;  4ZRO A;  1ZZZ A;  1XUG A;  1EJA A;  4ISH H;  1GBJ A;  1EPT B;  3ZVG A;  4DOQ A;  5C20 A;  3Q3K A;  2UUJ B;  3VXF H;  5EQR A;  4YOJ A;  4Q7X A;  1C2H A;  6GCH F;  3ZZ6 A;  2I6S A;  3E0P B;  1OWJ A;  2RA3 A;  1PPC E;  1FX0 B;  3A7Z A;  2ZCH P;  3OEE D;  3GYM A;  4NA8 A;  3SU5 A;  4WME A;  1YF4 A;  2ZA5 A;  5IYT A;  4AG2 A;  3SV8 A;  2ZCL P;  2HVY B;  3MH5 A;  3F6U H;  2BD2 A;  5I25 A;  5CHA C;  5HGG A;  3BTE E;  5DG6 A;  4Q2K A;  3TNS A;  4BAQ B;  2A4G A;  1ZHP A;  5F53 A;  3MU0 A;  3LIW A;  1O3B A;  1SC8 U;  2J34 A;  1QTF A;  1D6W A;  4FXG H;  1V2U T;  2QXI A;  2IJO B;  1O3I A;  3SI4 H;  1OWD A;  3MO9 A;  1MBQ A;  2WYG A;  1DY8 A;  2V7Q D;  4GSO A;  2CHA B;  1NT1 A;  3LKW A;  2PP6 A;  1ELA A;  2FO9 A;  1J16 A;  1QUR H;  2R2W U;  1QL9 A;  1SGD E;  1V2V T;  2ODY B;  3FZD A;  3M7T A;  1QY6 A;  3PM3 A;  2ZI2 H;  2AMQ A;  1TMU H;  1ZTJ A;  3OX7 U;  4YLU A;  3IWM A;  1ZLR A;  3F2F A;  6GCH G;  4A5T S;  3GY2 A;  2JDI D;  2V0B A;  4P02 A;  1TIO A;  4ZH8 A;  1BMA A;  1CGI E;  2EY4 C;  1TPO A;  1UTK A;  1C2K A;  2BDI A;  1OP2 A;  3M5L A;  3SJ9 A;  2FOF A;  1ZRK A;  2SFA A;  2AGG X;  3C27 B;  3EQ0 H;  2KFW A;  4BAN B;  2Z9K A;  1BJU A;  4ISI H;  2G00 A;  1HAV B;  2VU8 E;  1V2R T;  1K1N A;  1XM1 A;  1MTN B;  1UTM A;  2R0L A;  4B71 A;  4JMY A;  1EKB B;  1C2L A;  3MH4 A;  1C1T A;  1NU7 B;  3CP7 A;  4I31 A;  2ZFQ H;  1FLE E;  1QQ4 A;  3E16 B;  1GI8 B;  2UWL A;  2Y5F A;  3LOX A;  3BN9 A;  1O5F H;  1SGT A;  1EB2 A;  1G3B A;  1F0R A;  1CVW H;  3RXO A;  2WUB A;  4YXW D;  2JJ2 D;  1CBW C;  1RD3 B;  1QJ6 B;  1P2J A;  3V3M A;  3TLO A;  2F9B H;  1DPO A;  1SLW B;  3F3B A;  2Y5H A;  3SW2 B;  2QXH A;  3W95 A;  1G2M A;  2HNT C;  3ATW A;  4Y7B A;  3UTU H;  1PFX C;  4B75 A;  1BIO A;  2Z3C A;  1CT2 E;  1SGF G;  2QF4 A;  5A8Z A;  2ZPR A;  3BSQ A;  4JYU H;  3OY5 U;  1XMN B;  2VGC B;  1UHB A;  2Z6B D;  2C90 B;  3QZQ A;  4IC6 A;  3F9H A;  3ZV9 A;  5K7R A;  2HRV A;  1NO9 H;  2JIZ D;  4I8G A;  1GI2 A;  3RXB A;  4Y8Z A;  1O3L A;  4MLF B;  2VIP A;  1O2H A;  4WVP E;  1Y3U A;  1BML A;  4NA9 H;  3BTD E;  2PTC E;  4VGC B;  1GBE A;  5CMX H;  1QJ1 B;  4O3U A;  5BRR E;  1O5B B;  3URC A;  3QN7 A;  2ZO3 H;  4Y8X A;  1ZHM A;  1JBU H;  3A7V A;  1GG6 C;  2A45 B;  1FPH H;  2FMJ A;  4A7I B;  5EPN A;  3ZZ9 A;  1BT7 A;  1AN1 E;  4Y8Y A;  2XC5 A;  3NWU A;  2OIN A;  1TGN A;  3S9B A;  1CHG A;  3RP2 A;  3NCL A;  3M3T A;  5DP9 A;  1YLN A;  5G4B A;  2WPM S;  1BTX A;  5KEC A;  2EI8 A;  4TSF D;  8LPR A;  1P09 A;  3HK6 B;  2G52 A;  1V2N T;  2Q6G A;  4A1T A;  1TAB E;  1KYN A;  5HM2 A;  1M9U A;  1O3F A;  2QF5 A;  4IBL H;  1F92 A;  1V2J T;  5EST E;  1MTU A;  1C2I A;  2GJG A;  1TNI A;  4LK4 A;  4SGB E;  3SNC A;  5EJZ A;  2WZQ A;  1SGR E;  1EAU A;  1AWH B;  4BOH A;  4CR5 A;  1IQI A;  3A7Y A;  3I29 A;  3MNX A;  3RLY H;  2VIV A;  5DPA A;  4YTA A;  2CK3 D;  3LH1 A;  1AY6 H;  1PPZ A;  3ODF A;  2ZGC A;  1FAX A;  1SGE E;  5E0J A;  1C2E A;  4UDW H;  2ASU B;  1BJV A;  2BXU H;  4Y6D A;  3GCH B;  1Z1I A;  3MMG A;  3QDZ B;  2W26 A;  2ZGX H;  2BM2 A;  2GMT B;  1UVS H;  1ANB A;  4WMF A;  1GI5 A;  2FLR H;  1VGC B;  4X2V A;  5GXP A;  2PV9 B;  3LH3 A;  1UVT H;  2XWB I;  1SMF E;  3GIC B;  1RS0 A;  2ZDN A;  4YT7 H;  3KGP A;  1GL0 E;  2UUK B;  4A1X A;  3TU7 H;  2CXV A;  2P59 A;  4HZH A;  1GI7 B;  2ZU1 A;  1EZU C;  2A4O A;  1WXR A;  2XCF A;  3BG4 C;  4CRE A;  1QRX A;  1H8H D;  4JYT A;  2C3S A;  3GCN A;  1C5T A;  1D3T B;  2ZQ1 A;  1AO5 A;  2PSY A;  1EAX A;  5K0H A;  1XXF A;  4I33 A;  1K1J A;  1UO6 A;  4BXS A;  1IQL A;  1TFX A;  2VVV A;  1DIC A;  3KCG H;  4AYY B;  4Z6A H;  1P03 A;  3KN2 A;  4FUH A;  2H5D A;  1E38 B;  1NN6 A;  8EST E;  4FUF A;  5A09 A;  1HDT H;  4RT0 A;  3M3V A;  1DWD H;  1AUJ A;  2P3T B;  2CV3 A;  4DT4 A;  2OP9 A;  5DSF A;  3E1X B;  1TX8 A;  2A2Q H;  1QBO A;  1P05 A;  1F5K U;  1UTP A;  1DLE A;  1QBV H;  1RTK A;  3DD2 H;  4CR9 A;  1MD8 A;  2G4U A;  1O34 A;  2BVX H;  3PRD A;  3V0X A;  3F0P A;  3ZZ5 A;  1O2I A;  2BQ6 B;  2Q6F A;  4CHA B;  5FHT A;  5C5N A;  3MU5 A;  1HAG E;  1CU1 A;  1LPK B;  1ELD E;  1CO7 E;  3S7H B;  2PLX A;  7GCH G;  3TIU A;  4O03 A;  1GHW H;  3KEE A;  2EA3 A;  2G51 A;  3U8T H;  2FYR A;  1C5V A;  2NU3 E;  2W7U A;  3QX5 H;  1IQE A;  2FPZ A;  3RXM A;  2B7D H;  2CJI A;  2OD3 B;  4UEH H;  4ZHM U;  4ZKR U;  3AK5 A;  3P6Z B;  1N8O C;  3ENS B;  2QGR A;  3E3T A;  3BG8 A;  1O2M A;  2ZFP H;  1YBW A;  3W1E A;  1MQ5 A;  2A5A A;  1W2K H;  2Y7Z A;  1E0F D;  3SV2 H;  3VB7 A;  4MPX A;  1QRZ A;  4DW2 U;  3N7E A;  1EST A;  2WV5 A;  1GCD A;  3P8O A;  1J8A A;  3UOP A;  3UPE A;  1ZMJ A;  3OE7 D;  5EOK A;  1LVO A;  2A7J A;  1O2J A;  1TGC A;  3LGU A;  4AC9 A;  1C2J A;  1SGP E;  2G55 A;  2Y5G A;  1BIT A;  1Y3W A;  3GIS B;  1OYQ A;  3KHV A;  5L30 H;  4QT8 C;  1BTY A;  4AGJ A;  1YPG H;  4WMD A;  4NGA H;  3LDX H;  1L4D A;  1SHY A;  4ZHA A;  3SJO A;  1SHH B;  4OS2 A;  1QIX B;  3UNQ A;  3SN8 A;  1O5G H;  1P8V C;  2UWO A;  3GOV B;  4ISN A;  1B0F A;  1KXB A;  5LPR A;  1SFQ B;  3VPK A;  3ODD A;  1AWF H;  3K6Z A;  3PB1 E;  3O8R A;  1KDQ B;  1AU8 A;  1O3A A;  2GV6 A;  1RTL A;  1G32 B;  2FWW A;  2V6N A;  1Z8J B;  3PWB A;  4O9V A;  1LHF H;  1V2W T;  2ALV A;  3F9G A;  1Y3Y A;  4MVN A;  2F91 A;  5F8X A;  3K2U A;  1FON A;  2BX3 A;  3D65 E;  3VGC C;  3GY5 A;  1O3G A;  1C4V 2;  1ELG A;  4A92 A;  1S82 A;  2XTT B;  1FDP A;  4TY6 A;  3BTW E;  1MAY A;  4XRN A;  2XBX A;  3FFG A;  5ETX A;  2F9N A;  4ZCN A;  3B23 B;  2V3O H;  2D26 C;  3TH3 H;  1GJ7 B;  1WUN H;  3UAI C;  1GMC F;  1CGJ E;  2FXR A;  3K9X B;  2FOB A;  2W6I D;  4JZ1 A;  4FU8 A;  1GI1 A;  3BEI B;  4YO9 A;  4IS5 A;  1HRT H;  4UE7 H;  2OBQ A;  3C1K A;  1QB9 A;  4GCH F;  1SGC A;  4CBO A;  1O3C A;  1ID5 H;  1SG8 B;  4OS4 A;  2M2A A;  1TOC B;  3UR9 A;  2RG3 A;  3FP6 E;  3QTV H;  3T26 A;  2BVS H;  1RIW B;  1GGD B;  2R3Y A;  1T8M A;  2ZFF H;  1ANC A;  1O2K A;  2JET C;  3N7D A;  4Y0Y E;  2I6Q A;  1AB9 B;  2ZQ2 A;  1OP0 A;  5A8Y A;  5HXF A;  1D6R A;  3NZI A;  1YC0 A;  2ZTZ A;  1GBD A;  4FUI A;  1GCT B;  1SQA A;  1EZX C;  2AHM E;  2Z3E A;  1ZOM A;  1F0S A;  3MWI U;  2H9H A;  2UUF B;  3P8G A;  4E05 H;  3RXI A;  3PO1 C;  3PV2 A;  1A46 H;  1GMC G;  5E2P A;  2A7H A;  2TGD A;  6LPR A;  2R0K A;  5F03 A;  3A84 A;  2ZDK A;  3SOR A;  2WYJ A;  1HIA A;  4NWL A;  1GDU A;  5DN6 D;  5LPF A;  5DGJ A;  4GCH G;  2P3F H;  1WDI A;  1KMH B;  2D2D A;  1EUF A;  1QR3 E;  1SOZ A;  1V2O T;  4MQA A;  1A4W H;  4WH6 A;  2BDG A;  3UNS A;  1A5G H;  1K9O E;  3QWC H;  3T5F H;  4ASU D;  1XUF A;  4AZ2 B;  5E0H A;  3RXL A;  1XX9 A;  2BHG A;  2BZ6 H;  2BDB A;  3RMM H;  3T28 A;  4K60 A;  4ZKN U;  1AFQ C;  1PPF E;  3KL6 A;  1FI8 A;  4B6F A;  2YOL A;  1AD8 H;  2EST E;  3RU4 T;  2FYQ A;  3SU1 A;  1K1O A;  3K65 B;  1HXF H;  2IPQ X;  2L6O A;  1H9H E;  4LXB H;  2BQW B;  1HAO H;  1INC A;  3FN8 A;  6CHA C;  3R0F A;  2G4T A;  3TGI E;  1G9I E;  1YP9 A;  1YPK H;  3RLW H;  1NFX A;  3PYH A;  1QGF A;  1OWE A;  2PKA A;  3S7K B;  3H09 A;  1SKY E;  5FPS A;  2VIW A;  3HAT H;  2BYA X;  1V2L T;  1C1O A;  2OCV B;  2P3U B;  3TJV A;  3F1S B;  3SYJ A;  2WV4 A;  1GDN A;  1PPH E;  1O5D H;  5EOD A;  1UTJ A;  4BAK B;  1GJB B;  4D9R A;  2ANY A;  1O3P B;  1KXF A;  2FOE A;  4U01 A;  1YLD A;  2RFK C;  4BAH B;  5DK1 A;  4ZXY H;  2ZCK P;  2FX4 A;  2O8W A;  2IPH A;  3BIV H;  4U32 A;  1E1Q D;  2Y80 A;  3SND A;  3S69 A;  1Z6E A;  1XKB C;  3GCT G;  4B73 A;  2ZDA H;  1OSS A;  5FBI A;  5GJ4 B;  4ABG A;  4LZ1 H;  1EB1 H;  1W14 U;  1S5S A;  1GWA A;  2YNA A;  2TPI Z;  4X1P U;  1ZPZ A;  4Y11 E;  3RXV A;  2Y7X A;  5C1U A;  3N7O A;  2VWM A;  1LHE H;  4B74 A;  2FM2 A;  1MKW H;  1GMH F;  3V13 A;  5C1Y A;  3P8N A;  4MNY A;  4A6L A;  1HYL A;  4WH8 A;  1T8N A;  5FCK A;  5C94 A;  1ANE A;  1P2I A;  2Y6T A;  2K1Q A;  4MDS A;  3U28 C;  2W3I A;  1W13 U;  1KLI H;  1UTQ A;  3VB4 A;  3FKS D;  1AZZ A;  4YOI A;  3SNB A;  2FTL E;  2J95 A;  1GBT A;  1HJA C;  1T8L A;  1ARB A;  1AND A;  3LU9 B;  3TK5 A;  3BEU A;  1E35 B;  2R9P A;  2H1U A;  1TGS Z;  1ZML A;  1NRP H;  2WPJ S;  1K22 H;  1C9P A;  3EST A;  2J94 A;  1IQM A;  1BUI A;  4NIY A;  1ZHR A;  1OWK A;  2RA0 A;  1SGN E;  3LT3 A;  2VWL A;  5AVD A;  3PLP A;  1CA0 B;  2J97 A;  2BD9 A;  1C5Y B;  1DUE A;  1P10 A;  5FPT A;  3E91 A;  2P8O B;  4I8K A;  1HAP H;  1C1S A;  5FL7 D;  1GHV H;  2ODP A;  3UIR A;  3RDZ A;  4BAM B;  3ATM A;  3IG6 B;  2OK5 A;  1O5E H;  1GMH G;  2BDH A;  3QO6 A;  1SSX A;  5FAH A;  3GDS A;  1YLC A;  1Q2W A;  1ETS H;  1GI9 B;  2OXS A;  3KQ5 A;  5C2Z A;  3TPI Z;  5FX6 A;  2Z9G A;  3NKK A;  2BX4 A;  2HOB A;  3V7T A;  1K21 H;  1LKB A;  3LPR A;  4K2Y A;  5C0U A;  1SB1 H;  1NC6 A;  5EW2 H;  2A0Q B;  3U69 H;  3FAO A;  1SGY E;  1ZSL A;  1L1N A;  1SI5 H;  1P02 A;  2HAL A;  1C9T A;  1PJP A;  4NZQ A;  2KAI B;  2QXJ A;  5SGA E;  1BRA A;  3RXQ A;  5C67 A;  4MG3 A;  1C5L H;  4AFU A;  4P00 A;  1YCP H;  4K8Y A;  1LHG H;  2H2Z A;  3M7U A;  4IN1 A;  5HIY A;  1BQY A;  3ITI A;  4H4F A;  1GHA F;  1G3D A;  2KZ4 A;  1LQD B;  1DWE H;  3E90 B;  3QK1 A;  3VB3 A;  3MYW A;  1C1N A;  4HG6 A;  1QZ8 A;  1S0Q A;  4X8T H;  1SLX B;  4TPY A;  4A1V A;  1CGH A;  3EA8 A;  1WQV H;  4NFE A;  5A0B A;  5A2M H;  3OY6 U;  5FBE A;  3RMO H;  3SV9 A;  4K69 A;  3UR6 A;  1AQ7 A;  2OQ5 A;  3SJK A;  2A7C A;  1SPJ A;  3TGK E;  4JCN A;  3B9F H;  4FOU C;  1OYT H;  5DP8 A;  2ZU5 A;  3T25 A;  2W5E A;  1CT0 E;  3AVZ A;  4B76 A;  4I8J A;  1AFE H;  1H8E D;  2SGQ E;  3F9E A;  4Z1M D;  1EJN A;  2VVU A;  3SNA A;  3PV5 A;  1LDT T;  3UOU A;  1A0J A;  1VR1 H;  2EI6 A;  1Y3V A;  2YMS B;  3SU4 A;  4AB8 A;  3OAA D;  5EGM A;  2FI5 E;  1TA2 A;  1EPT C;  5HYO A;  3ZV8 A;  5L6N H;  1G36 A;  1C1R A;  1XKA C;  4HI3 A;  1IQJ A;  5C1X A;  2VH0 A;  2F3C E;  1DY9 A;  1YKT A;  2FOC A;  3LC5 A;  3LJO A;  1AVW A;  2BLV A;  1TBQ H;  3A7W A;  4MPV A;  1BB0 B;  2BQ7 B;  3FVF B;  1Z71 A;  2C4F H;  4XBC A;  1UK2 A;  1FN6 A;  5TJX A;  1UCY K;  3NXP A;  1LVM A;  2EQN A;  2CGA A;  2Q1J A;  2FI4 E;  3U1J B;  2ILN A;  1Y3X A;  2ZGH A;  1T4U H;  2VWN A;  1YCP M;  5JBC S;  3LON A;  3H7O A;  4X1R U;  4IGD A;  1GL1 A;  1WBG B;  1O3D A;  1E34 B;  5EQS A;  2CHA C;  4X8V H;  3HKI B;  2ZTX A;  4O3T A;  2O9Q A;  1W0Y H;  1Y5A T;  2QF3 A;  1Q31 A;  1SR5 C;  3CEN A;  1LVY A;  1GBF A;  1UVU H;  4YM9 A;  3E8L A;  4JYV H;  2A2X H;  3HGN A;  1L2E A;  1WAY B;  3UWI A;  2CF9 H;  1LPZ B;  3TK9 A;  2FOM B;  3BEF B;  1KY9 A;  3ZZB A;  4TWW A;  1TNK A;  3VEQ B;  1THP B;  1DOJ A;  4TT3 D;  4BAO B;  1HIA B;  2GGV B;  3JZ1 B;  2P93 A;  2PFE A;  1HLT H;  1C2G A;  1MTN C;  5TCC A;  1C2M A;  3SGB E;  4Y76 A;  2GCT B;  1C4Y 2;  1BBR K;  1KTT B;  1WOF A;  1C5O H;  1GPZ A;  1HJ9 A;  4CRD A;  2VB0 A;  5EU8 A;  1UCY H;  2Z9J A;  1NRS H;  3MFJ A;  1EXF A;  1W7G H;  5AFZ H;  1COW D;  2SGF E;  2GZ9 A;  4E06 H;  2C93 B;  2F83 A;  2AS9 A;  5T6F A;  7LPR A;  4DT7 B;  1D3P B;  3M37 A;  1WU1 A;  1RFN A;  1OHH D;  3FP8 E;  1MCV A;  1NM6 A;  3IIT A;  3M36 A;  6EST A;  1YGC H;  5GPI B;  3RXU A;  5EW1 H;  2QE7 D;  1QB6 A;  2JKH A;  2ZEC A;  1SLU B;  4GHQ A;  5C0T A;  1AZ8 A;  3TGJ E;  1TNG A;  2WSS D;  2SGA A;  1EX3 A;  2AER H;  4X6M A;  2F9U A;  2OC1 A;  3D23 A;  1TON A;  4B1T A;  4D7F A;  4DJZ B;  4J1Y A;  2ZP0 H;  2PKS B;  1TAL A;  4IN2 A;  4O97 A;  4Y0Z E;  4D76 A;  2YMS D;  3P70 B;  3UWJ H;  9EST A;  3NRL A;  8GCH F;  2O8M A;  2PKA B;  4IMQ A;  2VGC C;  4INL A;  2QY0 B;  3LGV A;  1WCZ A;  1CSO E;  3ZVB A;  1Z8I B;  1V3X A;  3URE A;  2GT7 A;  2J2U A;  3MH6 A;  5JBT A;  1OXG A;  1FY8 E;  3SJ8 A;  2PUQ H;  3MI4 A;  4D7G A;  2BDC A;  1GJ4 H;  1ZSK A;  3BTH E;  1GHZ A;  3DSP A;  4LOY H;  1QFK H;  3FP7 E;  4ZAE A;  1O2T A;  1LQE A;  3STI A;  4VGC C;  1BDA A;  3OTJ E;  1OS8 A;  1TX6 A;  3AAV A;  1BBR H;  3M5M A;  3DT0 H;  2GTB A;  1C2F A;  1GJ9 B;  2XC0 A;  3EA7 A;  1GBB A;  1RGQ A;  4UFE H;  2BY9 X;  1C5P A;  1EAI A;  2V3M A;  3T62 A;  1DSU A;  4M7G A; 
#chains in the Genus database with same CATH homology
 3O8B A;  3ZIA D;  2FOM B;  1E1Q D;  2FP7 B;  1NBM D;  3AK5 A;  2KCP A;  2KZ4 A;  4JMY A;  2QF5 A;  4B71 A;  4B73 A;  3E90 B;  3GS9 A;  2AHM E;  3W1E A;  2F9V A;  2KCY A;  4TT3 D;  5GJ4 B;  3WWF A;  4I31 A;  2K8I A;  3RC5 A;  3EYD A;  3N7E A;  1BMF D;  2GGV B;  2WZQ A;  3FOA A;  3P8O A;  1A1R A;  1W0J D;  4WF8 A;  3WWB A;  2A4Q A;  2F43 B;  3OE7 D;  3PV2 A;  5CDF E;  4A1V A;  3LOX A;  4Q4L A;  3U1I B;  2VBC A;  5B6L A;  5HKK D;  3OEH D;  3VG8 A;  4B74 A;  2FM2 A;  2CK3 D;  3M5O A;  1E1R D;  3SV9 A;  3P8N A;  2K0Q A;  2XCN A;  3F2H A;  4WH8 A;  3RC6 A;  4YXW D;  4NWL A;  2JJ2 D;  5DN6 D;  1JXP A;  2K1Q A;  1NBM E;  4Q63 A;  2KCO A;  5H4I B;  2XOK D;  1COW D;  2F4L A;  1KMH B;  2WPD D;  4K8B A;  4B76 A;  2LEL A;  3FKS D;  1H8E D;  1N1L A;  3KF2 A;  3SU0 A;  5EQR A;  5GND A;  3F3B A;  2XNI A;  4WH6 A;  4Z1M D;  3OYP A;  1OHH D;  3PV5 A;  3SU6 A;  3SU2 A;  4ASU D;  1FX0 B;  4B75 A;  2YMS B;  3SU4 A;  4A1X A;  3RC4 A;  2OC8 A;  3OAA D;  5EQQ A;  3OFN D;  3OEE D;  5GPI B;  3O8R A;  2KM0 A;  3O8D A;  1RTL A;  2P59 A;  2QE7 D;  4I32 A;  2QF4 A;  3SU5 A;  1E79 D;  5C17 A;  5C0T A;  1WXR A;  2XCF A;  5IDK A;  1DXW A;  1H8H D;  5FPY A;  3SV8 A;  1W3C A;  2WSS D;  2XND D;  3F0O A;  5EPY A;  2OC7 A;  1DY9 A;  4B6F A;  2YOL A;  2WV9 A;  2F9U A;  2OC1 A;  3O8C A;  3SV6 A;  2JIZ D;  2WHX A;  3SUE A;  3DSO A;  2YMS C;  2IJD 1;  2A4G A;  4TYD A;  5F53 A;  4I33 A;  3SU1 A;  4A92 A;  1W0K D;  2YMS D;  4FET A;  4KTC A;  3N99 A;  2L6O A;  4M9F A;  5FPT A;  2J5U A;  3KN2 A;  4NWK A;  3NRL A;  2O8M A;  2IJO B;  5FL7 D;  5ETX A;  3SV7 A;  3FN8 A;  1DY8 A;  2V7Q D;  4F55 A;  4ZCN A;  2OC0 A;  2OK5 A;  3SU3 A;  3U1J B;  1MAB B;  4R8T B;  3LKW A;  4DT4 A;  3M5N A;  3WW7 A;  5ESB A;  5DSF A;  2KCA A;  4XD7 D;  3LON A;  2W6I D;  4RI0 A;  1S6L A;  3H09 A;  3DSP A;  1SKY E;  5FPS A;  2OBO A;  5EPN A;  1BT7 A;  2OBQ A;  2A4R A;  5EQS A;  1NS3 A;  2OIN A;  5C0U A;  3F2F A;  3PRD A;  3SYJ A;  2KR7 A;  3F0P A;  3F2G A;  2M2A A;  4B6E A;  2JDI D;  3SUF A;  3UB0 A;  1CU1 A;  3SUD A;  3SUG A;  3FO8 D;  3M5M A;  3DCL A;  3L6P A;  4OM9 A;  3KNX A;  2GVF A;  2HLD D;  3PRB A;  5IK2 D;  1RGQ A;  1EFR D;  3M5L A;  3KEE A;  2QV1 A;  4TSF D;  2W6J D;  3N7D A;  1DXP A;  3OTP A;  4U01 A;  2KFW A;  5CHB A;  5T1V A;  3SZE A;  4A1T A;  2JJ1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...