3WW7A

Crystal structure of the computationally designed pizza2 protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
82
structure length
82
Chain Sequence
b'NTQTVLPFTGLNTPNGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVLPFTGLNTPNGVAVDSAGTVYVTDHGNNRVVKLAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pizza2 protein
publication title Computational design of a self-assembling symmetrical beta-propeller protein.
pubmed doi rcsb
molecule tags De novo protein
total genus 12
structure length 82
sequence length 82
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.500 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3ww7A00
3WWBA 3WWFA 4ZCNA 5F53A 5CHBA 3WW7A
chains in the Genus database with same CATH superfamily
3GCTG 4RT1A 5KGOA 3OEHD 1N6YA 1WCZA 1FV9A 1GCTB 1GBTA 1P2JA 2ZFSA 3AASA 4U2WA 4D8NA 3UNRA 1GG6C 1IQEA 1VCPA 4Y7AA 3NXPA 3OAAD 3MO6A 3S7KB 3GYLB 1EQ9A 1O3JA 2VNTA 1GBCA 4I8LA 2FESH 1GWAA 4JZFH 3RXDA 1SC8U 3E91A 3A85A 4AN7A 1RS0A 2GDEH 2ZGHA 2OCVB 4KTCA 5AVDA 5FL7D 5T6DA 2TBSA 1N8OB 1PJPA 1A4WH 3FP8E 1QB9A 1GDUA 1MD8A 1UK3A 3JZ1B 3K2UA 3SU3A 2QAAA 4GCHF 2ZU4A 1DXPA 1K1IA 1AKSB 2EA3A 1O3IA 3RXMA 3O8CA 3LDXH 8LPRA 1BBRK 1ANEA 2EI6A 1O3EA 1YPKH 1O2VA 2XBXA 1P2NA 1C1NA 1TPOA 1EP5A 4R0IA 4AGJA 1TWXB 1NFYA 5CHAB 1HAPH 2I6SA 5IK2D 2XC4A 1EPTB 2KCYA 2ZHDA 1Y3XA 3FOAA 5K7RA 2CJIA 3MQKC 3FN8A 2BDAA 1W7XH 1F5KU 2ZP0H 5DJ7A 1AY6H 3NPSA 1HAGE 2KFWA 3M36A 4OS6A 1BRAA 5GJ4B 1VJ9U 1HJAB 4YZUA 3Q3KA 4AX9H 2YMSD 1B5GH 1JRTA 3M7QA 4HG6A 3QK1A 1P2IA 1JIRA 2OD3B 1ZJDA 4BOHA 2Y80A 3LGUA 1VGCB 1E1RD 2W26A 3RMOH 4OS5A 1SFIA 1DWEH 1ZTLA 3BIVH 1YP9A 1P9UA 2GT8A 1UK2A 1C4U2 3SV6A 5KECA 3TGJE 3MH4A 2WV4A 1XUFA 1SMFE 2ZGBH 2F9VA 1C2FA 1BBRE 1SKYE 1C5UA 1BHXF 1V2RT 1PPBH 2G4TA 2A1DB 2FLRH 3UUZA 1Z8JB 2OK5A 3T26A 1OSSA 1UHBA 3A84A 3ATIA 3U8TH 1SGTA 2BDIA 3KYFA 1HAVB 4LK4A 3RXPA 1O3OA 1P04A 4P00A 4ZH8A 2AGGX 5HXFA 5ABWA 4RI0A 1T8LA 1GBFA 3TH4H 1P05A 2A4QA 1IHSH 1XX9A 4Q7ZA 2QF3A 1G3BA 4MPWA 1UVSH 1QRXA 4O9VA 1RJXB 3WW7A 1MQ5A 1VCWA 1O3KA 1GCTC 3BIUH 1MQ6A 2NU1E 3LC5A 1GHWH 3ZZ7A 5F8ZA 1P01A 5DP6A 2FPZA 2BD9A 1G32B 1MH0A 4BAQB 4OS4A 6GCHG 2FS8A 2ASUB 4DVAU 1TIOA 1ANDA 2QXHA 1O5EH 2Z7FE 3DCLA 4ISNA 1SOZA 3MOCA 3ZZDA 3BEUA 5ESTE 2WSSD 1O5BB 5AFZH 2HWLB 1BTZA 2Z94A 1YCPK 3S9AA 1P3CA 3ZZBA 2GZ7A 2ANYA 1ELGA 1T4UH 3PLKA 3E0NB 2GX4A 4ZXXH 4DIIH 4AG1A 1PPCE 5AHGH 3PRDA 1WTGH 2C8WB 2KX4A 2HVYB 2HNTE 1BMMH 1TYNA 1OWIA 4YT7H 3H5CB 2UWOA 1V2VT 3CP7A 1NRNH 3IITA 4O3UA 1UO6A 3IG6B 2Y6TA 4RKOB 4DJZB 3A82A 5C1XA 1KSNA 5TCCA 1GVZA 3VGCB 3T5FH 5CHAC 1J17T 1C5WB 2TPIZ 1O30A 1EPTC 3QN7A 3Q3XA 1GI3A 2JDID 1LMWB 1WUNH 1J15A 2P8OC 2PGBB 1FY4A 1Z8IB 3U28C 1C5OH 1V2QT 2B9LA 2WPJS 3GDUA 2QC2A 4AFSA 2PW8H 3MTYA 2ZF0H 1T31A 4X8VH 1MTNC 4IW4E 1Z7KA 1LTOA 3N7OA 3SJIA 2QXGA 4WWYA 3N7DA 3STIA 4CR9A 1HJAC 1C5NH 1VITH 1BRBE 4B73A 3F9FA 3MU0A 2HNTC 1O0DH 1C1SA 4SGBE 1FUJA 2GCTB 5EPYA 1QJ7B 1VR1H 1Y3YA 3S9CA 3BTFE 4Q80A 3RXSA 1GHVH 4XD7D 1C5LH 3PROA 3SI4H 1UVUH 2V0BA 3FFGA 1Q3XA 6LPRA 5GNDA 1Y3UA 5EW2H 1SB1H 2VVCA 4JYUH 2ANMH 1AVWA 1O2PA 1DUAA 1K9OE 1QJ6B 3SN8A 3A7VA 1F0SA 3C27B 4NCYA 3ZVGA 4DIHH 3L3TA 3RXLA 1FPHH 1YF4A 3O8BA 2IPHA 4IGDA 1LDTT 4BAKB 3EYDA 1AE8H 1TFXA 2GZ9A 2UUYA 1SLVB 2IOTA 3A87A 5FCRA 1A7SA 1LVOA 2VWMA 2SGFE 4LZ1H 2BDGA 3P70B 3LU9B 3KIDU 1EFRD 1TNIA 1FN8A 4FUIA 3TH2H 2BYAX 1SGPE 1HRTH 3MNSA 2BY5X 1SGYE 2QY0B 3MO3A 3F2FA 1LPKB 3ODFA 1XM1A 1ID5H 1XUGA 1AUJA 1S5SA 3QDZB 3RM0H 4JYTA 3W1EA 3GS9A 2ZPQA 1DICA 1VJAU 3EQ0H 2JH0D 1SHYA 1MMJN 2FZZA 2VGCC 1BCUH 3I77A 2VH6A 2D2DA 3O8DA 7LPRA 5LGOA 3B9FH 1O2SA 3T27A 2JH6D 1OYQA 2R2MB 2Y81A 3SU1A 1W0YH 4K5ZA 2ZDNA 3GDVA 3UQOA 4B76A 2OP9A 3TLOA 3UNSA 4AB8A 1IQFA 2GD4B 3KQCA 2WPLS 5EJZA 4OGYA 1RFNA 2FOBA 4MNXA 3AVZA 2O8UA 5FX6A 5EW1H 3EE0B 1HBTH 2TGDA 3JZ2B 5E2OA 1EZQA 3LONA 3PWBA 4JZ1A 2F9BH 1XXFA 3RLWH 1AWHB 3VXFH 1DY9A 2WPIS 2P16A 4Q7XA 3VB7A 1UVOA 1P11E 5J4QA 1UJ1A 5EQRA 4NWLA 8GCHG 1Q2WA 4GAWA 5TCAA 4WH6A 1NT1A 2XRCA 1KLIH 3LC3A 2BVXH 1K21H 2ZQ1A 5FPYA 2J38A 2VIPA 3A81A 3LPRA 1EAUA 1W2KH 2FO9A 3SV7A 1EB1H 3KEEA 2F83A 4ISLA 2AH4X 5E0HA 2ZNKH 3ZVDA 2H1UA 2QF4A 3ZVBA 4Y8XA 1NROH 1BMFD 3ATWA 2B5TB 3SUEA 2AIQA 3ZZ3A 1GMHF 1QRZA 5L2ZH 1NU7B 3AK5A 4A6LA 1GJ9B 3DSOA 2A5KA 2KZ4A 2BD7A 2EI8A 5JBTA 1MTSA 3MNCA 1MTVA 3ZZ4A 4CREA 2Z9JA 1K1PA 3M3SA 4GVUA 2YMSB 1J9CH 2J98B 4R8TB 2G8TA 2AMPA 1V2OT 4WH8A 3T62A 1GJBB 2QYIA 2HLCA 1SQRA 2HLDD 1C1UH 1FPCH 1TNKA 4FXGH 4TYDA 2GDDA 3UOPA 1ZOMA 1L2EA 1V2KT 4UFDH 2OLGA 2V6NA 4GHQA 1DSUA 1EOJA 3P8GA 1M9UA 2V3HH 2Y7XA 3CENA 2A5IA 2G55A 1K1LA 1PFXC 1AVGH 1C5XB 2V3MA 1RD3B 4YM9A 2A2QH 4CRCA 1H8HD 3R3GB 2FOMB 1QR3E 4NSVA 5CDFE 2C8ZB 1A5IA 1E35B 4JYVH 1GBJA 2PTNA 2IPQX 5JB8S 3TH3H 1GI9B 1NZQH 3SNAA 3A7WA 4K1EA 1BMLA 3E3TA 2QXIA 3L33A 1D4PB 1CE5A 4BTTB 3F2GA 2XC0A 3SORA 3FP6E 1Z8GA 2WPKS 4JMYA 1HJ8A 3SYJA 3GYMA 2VIQA 2YNAA 1MAYA 1C4V2 1W0JD 1JOUB 1WV7H 2J34A 3RUOA 2H2ZA 2EC9H 2BQ7B 3ITIA 3K65B 3LJJA 1K1NA 2BVRH 1TRMA 2PKAB 1MCVA 1UMAH 1FIWA 1MABB 5A8YA 2OXSA 1YPJH 1HXFH 1W10U 2BY8X 1W11U 2PUXB 4I33A 1GJAB 4H6SB 2QIQA 4YTAA 4ZMAH 3IWMA 2BXUH 1AQ7A 1HPGA 4MTBA 1EASA 3ELAH 1GVLA 3S69A 1L4DA 1HAOH 4I31A 3TNSA 1L1GA 1C2MA 4X2VA 1QQUA 4AFZA 1D3DB 4MG3A 2FWWA 4FUBA 2H6MA 3QLPH 2L74A 1CBWC 2ZFQH 4B6EA 2RG3A 4UONA 1W13U 2PP6A 2OTVA 1H1BA 1SVPA 2ESTE 4INHA 3K9XB 5G4BA 2BQ6B 1F5RA 4FVBA 5HKKD 4WVPE 2DE9A 1F0TA 1UTKA 1GBDA 4IC6A 3N7EA 3DD2H 2FM2A 1C4Y2 1ZPZA 2H9EH 4DW2U 2WZQA 3KCGH 4TT3D 2OC0A 1KXAA 3RC5A 3SBKA 3SZEA 3SI3H 2B0FA 2GMTB 2L6OA 3PMHB 5T6FA 1CT0E 1HAYB 3S9BA 2YMSC 1SGFG 2BLOA 2Y5HA 7ESTE 3U1IB 2F9PA 1X7AC 1SGDE 1GHXH 2FOHA 4OGXA 2ZCLP 5C5NA 3RU4T 3VB4A 3HK6B 1LPZB 7KMEH 1GMCF 1GJ8B 2OC8A 3TGKE 1V2ST 3VB5A 4FUJA 5JB9S 1O3NA 5DG6A 3M3TA 4UD9H 1F0UA 3NRLA 2BDYA 4DT7B 1ZMNA 4BTIB 4DOQA 1HGTH 2FOGA 2ZKSA 1N1LA 3F68H 2BLQA 5CMXH 5DP3A 6ESTA 1VITF 1CA0C 4YLUA 2HNTF 3A8DA 4AYVB 1FIZA 1CHOF 3A80A 1ARCA 1MZDA 2PLXA 3UR6A 1Y8TA 4ABEA 2VU8E 3SV8A 4ABFA 4GPGA 2W3IA 1TGSZ 3SNBA 1P0SH 4X1PU 2RCEA 2UWLA 5FPTA 3PMJA 3W95A 1MKXK 2IJOB 4NIVA 1GJ6A 3RXIA 1DVAH 1V3XA 3QGNB 1KXCA 1KXEA 1O2YA 4IMZA 4ASHA 1QQ4A 1OOKB 3RU4E 1FAXA 3SV9A 5DKMA 4FUCA 3SQEE 1YPLH 2ZU5A 1BZXE 1BTPA 5K0HA 4CHAB 3A86A 4GCHG 1QBVH 1ELFA 1YM0A 4B2CA 2P3TB 5E0JA 3MU5A 2BB4A 1O3MA 5C0TA 1P2MA 2G5VA 3V7TA 3SJ9A 3T2NA 5JBBS 3Q77A 1C5MD 2PFEA 2BY7X 4Y0YE 1P2KA 2J4IA 1BTXA 1QB6A 4MQAA 5F03A 1LKBA 2ZWLH 3ZZAA 4B2AA 3SUGA 1GBAA 3F1SB 4NG9H 1EPTA 4E7RG 4BAHB 1NBME 3FO8D 5AF9H 1AU8A 1O2XA 3BG4C 4X0WU 1FJSA 1EB2A 4HTCH 3GY2A 3LKWA 3KQ5A 1P3EA 3RXRA 4K1TA 3RXCA 1AZZA 1O3GA 3ZVCA 1MTWA 1V2LT 1SLUB 1Y3WA 1N6XA 1P2OA 1LHDH 1F2SE 2M2AA 2TRMA 1SLWB 3MH7A 2A45B 1O3BA 3M35A 4IS5A 1ZYOA 1EAXA 8ESTE 3G01A 2R0LA 5HYOA 1W0KD 3F0PA 4UFGH 3GCNA 1O5DH 1O2JA 2H9TH 1MCTA 1P06A 3GY3A 5IDKA 1O5CB 3K6YA 5FAHA 3MO9A 2ZTXA 2Z6BD 2BX3A 2FI5E 1MAXA 1O2OA 2PTCE 4Y76A 2RDLA 1PYTC 1ELVA 1C1OA 1OPHB 1SGEE 1P12E 1MKWK 1S0RA 3BTWE 1FXYA 2G00A 3M5LA 4Z0KA 5I25A 1H8DH 1BMNH 1CHGA 5A8XA 1D9IA 2OBOA 5GCHF 5L2YH 1TLDA 2R2WU 1J14A 1E1QD 1EKBB 1W0ZU 4MLFB 4ZUHA 1AB9C 1ESAA 2GV7A 1NU9A 2D8WA 1YGCH 1ZRBA 2J9NA 3P8OA 1MU8B 5DP9A 1DANH 1KTTB 1TB6H 1HLTH 3TJOA 3LGVA 1HAVA 1GGDC 4O3TA 1MUEB 1ZSJA 5FXLA 1EZUC 1T7CA 3D62A 2A31A 1GI0A 2PKSC 3E16B 3W94A 2CN0H 4UFFH 2SFAA 1TA2A 4A1VA 2PSYA 3F9GA 3RM2H 3GY5A 4KP0A 3SU2A 1GL0E 4AG2A 1LO6A 3ATLA 8KME2 4H42U 3KGPA 1OWHA 1G30B 1CGIE 1S81A 3PV5A 5EGMA 5DP5A 4B6FA 1ZR0A 1O2GH 2V3OH 2H9HA 5FPSA 1XUKA 4FUHA 2RA0A 2UUKB 1F0RA 1LVMA 2XNDD 5EG4A 2W3KA 4B74A 1BBRH 2GP9B 1DPOA 1BT7A 3U98H 1DDJA 1EATA 2KM0A 1DE7H 3MH6A 3QO6A 1SG8B 4MPXA 1CQQA 5A2MH 3Q3YA 4DT4A 4AFQA 1QGFA 1GI7B 2FS9A 4X1SU 5CHBA 2Y5FA 1GJCB 4NA7A 4X2XA 4M9FA 5E2PA 1QNJA 1THSH 1BRUP 1UHBB 1CT4E 4JCNA 1B7XB 5KEDA 2FOEA 3SJOA 2ALPA 1BMAA 4UFEH 2ZGXH 3PO1B 4F49A 3TK5A 1TNJA 4BXSA 4FVDA 1RTFB 1N8OC 2BY9X 1BA8B 1YWUA 4ABGA 1OWDA 4ACAA 2SGAA 5EXLA 5C2ZA 1ETSH 1SHHB 3FKSD 2XCFA 3RU4D 1H8ED 1WYKA 5DPAA 4A1XA 2RA3A 3URDA 1LHFH 2KCPA 2VIVA 1Y5UT 1YPHE 3NUMA 1TMBH 1ZTJA 1ELDE 1LVYA 2ZFPH 3PV2A 2P95A 3QGJA 1EUFA 2B8OH 1TGCA 3RXGA 3BTQE 2BD2A 3BN9A 1TMTH 3I29A 1TGBA 4A7IB 4CBNA 4F48B 1S6FA 3QUMP 6GCHF 1A46H 2F43B 3M3VA 1Y5AT 4JK5A 3UNQA 1NRRH 1BTYA 3BTEE 4MNYA 5JYIA 3NWUA 1IAUA 1XKBC 3MNXA 1QHRB 5C20A 1XMNB 4TPIZ 1DUEA 1GBHA 1PYTD 1NBMD 3RXKA 3H7OA 4BXWA 4ZHAA 3MNBA 1P9SA 3SHAH 2ZDVH 4Y8YA 1YPHC 3GY8A 1A0LA 3TGIE 2ZA5A 2Y5GA 2GV6A 2VVVA 5GXPA 1VGCC 1XVMA 1TGTA 3PMBB 4Y6DA 2WYGA 1GMDF 3GISB 1UCYK 3AAUA 3P17H 1HV7A 3CS0A 3UFAA 2V7QD 2FYRA 3TK9A 4Y71A 2XWAA 4ESTE 1BHXB 3QZRA 1ELTA 1IHTH 4ISIH 1FX0B 1O5FH 3DUXH 2QXJA 4TSFD 1UW7A 2ZQ2A 1T8MA 1P8VC 1BJUA 2EY4C 3A8BA 3SJKA 1YCPM 1BUIA 2G51A 3SU4A 2ZIQH 1F5LA 3D23A 3TIUA 4AOQA 1NPMA 2GCHF 1YCPH 1YC0A 1QL7A 1GBEA 1ANBA 3GY7A 2A7CA 1O31A 1TQ7B 1G3EA 3ZV9A 2VVUA 1PPFE 5EJLA 2LPRA 3RXVA 4BNRA 1RIWB 5JDUB 1C2EA 1TBQH 2SGEE 3H7TA 3T25A 1C1WH 2ZO3H 1DOJA 1EX3A 1QA0A 1O35A 1F7ZA 2KCOA 4X8UH 2BX4A 1QL8A 3EAJA 4YESB 4AZ2B 2A0QB 3V0XA 2WUBA 3QWCH 1O2KA 3RMMH 3BTGE 2SGDE 1SPJA 1UCYE 1DM4B 5F53A 5EOKA 1O2UA 1SGQE 1LCYA 2GKVE 1JRSA 3PO1C 3TU7H 1GDQA 2QCYA 1NRSH 4VGCB 1E79D 1HIAB 4IN1A 1SBWA 4XBBA 4ABJA 2ZHWH 1O36A 4XFQA 3DFJA 3UPEA 1QIXB 4NZQA 1SFQB 4B71A 2XNIA 1A0JA 3NCLA 1O2LA 2GTBA 3D65E 4DCDA 2PHBA 3U8OH 1AUTC 1D6RA 5C17A 1O39A 3VGCC 2R0KA 4TY7A 1LVBA 2ZPRA 3P92A 4MDSA 1A3BH 3SU6A 1AN1E 1HFDA 2EI7A 4CH8B 3ZZ8A 2ZDMA 1RXPA 3S7HB 4Y11E 1FY3A 1HAZB 4M7GA 1ELCA 2A2XH 4DURA 3KQDA 4TPYA 1O5GH 1GMHG 6CHAB 1KMHB 3DHKH 3E0PB 4E7NA 2JJ2D 2K0QA 4E06H 4ZAEA 2P93A 1OKXA 1L4ZA 1OX1A 3TITA 4A1TA 2ZFFH 1MD7A 4H4FA 1A0HB 2GCTC 4AFUA 1O33A 2CF8H 4X6PA 4P02A 4X1QU 1S6LA 2ZTZA 3SU5A 1DITH 1GI4A 1DLKB 1YBWA 1UTOA 1O2WA 3ZZ9A 1AZ8A 1W14U 1C5PA 4FOUC 5DP7A 3OYPA 1THPB 3A88A 3SUFA 2J98A 7GCHF 1WTHD 3U1JB 5T3HA 1AHTH 1QB1A 3GCHB 8GCHF 4YT6H 3P95A 3FZDA 2OQ5A 3E6PH 1FLEE 1KDQB 1JXPA 1FMGA 2FI4E 1MU6B 2P59A 4YOJA 1T4VH 5B6LA 4XOJA 3TJVA 1L1NA 3M5MA 2CHAB 1AFQB 1AI8H 3UAIC 2ODQA 1C1QA 1FY1A 1O34A 1PPHE 3C1KA 1DWBH 1ETTH 1C2IA 1ZJKA 2H5CA 2BOHB 4IBLH 1GHBF 2VJ1A 1NFXA 1YY3A 2NU2E 4HZHA 1DXWA 2ZHQH 4D9RA 5FBIA 3M7TA 2ZU3A 2CMYA 2YOLA 3LGWA 1TPAE 2STAE 4NIXA 3KYGA 4NA9H 3OY5U 4ABBA 5HMAA 3M37A 4NFFA 1HJ9A 2XBYA 2ZCHP 3MU4A 1C5SA 4LXBH 2AMQA 1XUJA 3ATKA 1RIWC 4X8SH 4I7YH 2XTTB 4ISOA 4FU8A 5T1VA 1DLEA 3M5NA 1FY5A 3PYHA 1OP2A 1UTPA 1A5GH 1KLTA 2QV1A 3DA9B 4D7GA 1K1MA 1NC6A 2VWLA 4J2YB 2AMDA 2BZ6H 1T8OA 3M7UA 2TGTA 3PLBA 2W7SA 3TJNA 1RRKA 2FODA 5BRRE 1XUHA 1O32A 1DSTA 1GHYH 1C2HA 1F92A 1TNLA 3SNDA 2THFB 3SZNA 1NTPA 3MHWU 2BLVA 1HAHH 2VWNA 3EDXB 1GHAF 1SGRE 2Z9LA 3OEED 3VB6A 1CA8B 2H5DA 4VGCC 3CNRA 1Q31A 1QY6A 1K28D 1PPEE 2J97A 4Y8ZA 4QT8C 2J95A 3FAOA 1HAIH 1Y59T 3SGBE 1GVKB 2GJGA 2G5NA 4XSKU 4D9QA 3P8FA 1TMUH 4X6NA 2C3SA 2W6JD 2W7UA 2ANKH 3BTKE 1BQYA 5CE1A 2PGQB 1UTMA 3AW0A 4WF8A 3A7TA 2R9PA 5EQQA 1H9LB 3AAVA 1GG6B 2Z9IA 1GCDA 2TIOA 4X6MA 1EOLA 3E1XB 1GBMA 5E8EH 3BG8A 3RC6A 2P3FH 1QL9A 1ANCA 5ETXA 1E0FD 1MBQA 1DY8A 4ISHH 4D7FA 3ZZ5A 3LJOA 5JPMH 1XVOA 5AFYH 3F3BA 5EU8A 3BV9B 2TGPZ 3U8RH 2KAIA 4Y79A 3M5OA 3FVFB 1QJ1B 1ESBA 2A7JA 5JBAS 4OS2A 2PV9B 4FUEA 1ZGIA 2Q6FA 1GJ5H 1O2NA 3SQHE 3A8AA 1WAYB 2C4FH 2FOCA 2ZG0H 1K2I1 1KTSB 2HVXA 1H4WA 2BD8A 4IMQA 1GPZA 2IJD1 1GMCG 4ABDA 1OWEA 3BTME 1B0FA 2A4OA 5I46H 1FDPA 2HPQH 1TOCB 2CHAC 1V6DA 4F55A 3I78A 4WJG2 2JJ1D 1C2KA 3B8JA 3EGKH 5HM9A 2WUCA 1GHZA 5F8TA 1O5AB 4TY6A 1WQSA 3UR9A 2CF9H 1SGCA 1S85A 1VITG 2Q1JA 4K60A 3BSQA 2G4UA 1CHOG 1D3TB 1J8AA 1K22H 1TX8A 2GZ8A 4Q2KA 1S84A 3PLPA 1H9IE 3S0NA 4X2WA 3AW1A 4O97A 3HPTB 2FYQA 3KN2A 3LIWA 3RXAA 2Z3DA 3MI4A 1OP8A 5BPEA 1C2GA 2VIOA 1LHCH 2F9OA 3QX5H 1W8BH 3RXOA 5A0BA 5TJXA 3ZZCA 5A8ZA 2FTMA 1C5ZB 3SGAE 4J1YA 3SU0A 2VBCA 1GI5A 1SSXA 3A7YA 1D6WA 1SLXB 2WHXA 1DX5M 2O8MA 1BTWA 1ZHRA 4CBOA 5EIYA 1E38B 1G3CA 4WMDA 1UTQA 3LGTA 1O38A 4BANB 5L6NH 4O03A 5DGJA 1YLDA 1YLNA 2PR3A 4WY3A 1Z8RA 2NU0E 1TONA 2VINA 4CH2B 5FCKA 1V2JT 1BIOA 2WV5A 1ZHPA 2BVSH 5F8XA 1QZ8A 4KELA 2K1QA 1FONA 1Z71A 2CK3D 1DWDH 4OS1A 1UVPA 1AKSA 2RFKC 3A7ZA 2EEKA 3TJUA 1OWKA 2KCAA 3B23B 2A4GA 1DFPA 1GBBA 2Y82A 3HKIB 4K1SA 1INCA 1HB0B 1TPSA 2F9UA 2P3UB 2XOKD 1QBNA 1GJ7B 4DY7B 1BITA 4U32A 3ATMA 3MMGA 1O2RA 5FBEA 1H9HE 2QGRA 1EP6A 1ZMLA 1FAKH 1TAWA 3GCTF 1V2WT 3D49H 1SQTA 1YPEH 3RLYH 2BOKA 2ZFTA 3TPIZ 4JZIA 3OFND 3RMLH 4B75A 1G2LA 1O3HA 3ZVAA 2ILNA 2TGAA 1G3DA 1IQGA 2ZGJA 3H09A 3OTPA 3VG8A 4GSOA 4XE4A 1TA6A 3GY6A 1O2HA 1BTUA 1QRWA 2A4RA 3FP7E 1NFWA 5GCHG 1WOFA 3ZVEA 1XKAC 2NWNA 3KF2A 1QBOA 4K69A 2VB0A 3ZVFA 4CRFA 4NA8A 4WXVA 5FX5A 1TALA 2HGTH 3SUDA 1FI8A 2GMTC 3K6ZA 4WMEA 1ARBA 1SGNE 1SGFA 2BMGB 4ACBA 1EJMA 1HYLA 1Y3VA 1Z1IA 1O3FA 4YOIA 1CVWH 1P2QA 1QA7A 1LQEA 3RDZA 2LNCA 2P8OB 2UUJB 4KTSA 2WPMS 3A83A 5GWZA 4INKA 1MKXH 3PTBA 2ZU2A 4UE7H 1CT2E 1OYTH 2NU4E 3RXBA 1W12U 1MTNB 2WPDD 4Y0ZE 1O2MA 4E05H 3R0FA 1P03A 1C5YB 3MH5A 3SO3A 1EJNA 3GOVB 1NS3A 2ZU1A 5DN6D 2HALA 4CRDA 2Q6DA 4U30A 2RDEA 2B7DH 1LQDB 3F9EA 4FUGA 1TNGA 3PB1E 2ZHFH 4FUDA 1B0EA 4NIWA 5GIBA 3TNTA 1PQ7A 2CGAA 4OS7A 1TRNA 3UREA 1ETRH 1VZQH 1C1PA 2ZHEH 1AWFH 3HGPA 2O8TA 1IQHA 1W7GH 4HFPB 3ZZ6A 1PQAA 4Y7BA 4ZKSU 3T29A 3QTOH 4I8GA 2HOBA 3FZZA 1KY9A 1L1JA 4AGKA 2QN5T 1MTUA 1S82A 1J16A 2W5EA 2WYJA 1JWTA 1O3PB 3SJ8A 1EZXC 2XWBI 4CHAC 1FNIA 1AIXH 1BRCE 2FP7B 4NGAH 3RMNH 2OBQA 2AGEX 3RC4A 1A3EH 1KXFA 1CGHA 1NY22 1BB0B 4MPVA 1ZSKA 1IQKA 2UWPA 4XBCA 2ZZUH 4ZKRU 1D3PB 4Q7YA 1SR5C 5EPNA 1OXGA 4ZHLU 1UK4A 1JBUH 1KIGH 1YLCA 2FMJA 4K8YA 3TVJB 2WV9A 4YXWD 2AGIX 4GUXA 1G9IE 5C67A 4NZLA 4CRAA 4I8KA 3F0OA 1WBGB 3V12A 1MKWH 2VGCB 3GCOA 5EXMA 5GDSH 4CRGA 1WDIA 1K0HA 1O3CA 1H8IH 5HIZA 1ZRKA 1C2LA 1SOTA 4FU7A 2ULLA 3HATH 2ODYB 5C1UA 1AFEH 3GY4A 1FZZA 1AGJA 1O2QA 1Y5BT 3MWIU 3SNEA 2C8YB 1MZAA 1LHEH 1GL1A 2ZDLA 2C90B 1GBKA 1K1JA 4GHTA 2AERH 5DK1A 4CRBA 3BTDE 2ZECA 3T28A 2XYAA 2ZCKP 1ZTKA 1D3QB 1IQIA 1SL3A 1WXRA 4MNWA 2J92A 1OS8A 1O2ZA 2BLWA 4OM9A 1PQ5A 1GMDG 1GBIA 3DSGA 1ABIH 2ANWA 2O9QA 4WMFA 3GDSA 1C1VH 2Z3CA 2UUFB 2PSXA 2ZDAH 3VFEA 2SGPE 1GI8B 1COWD 3WY8A 1UTJA 2GT7A 2XCNA 3EA9A 1QTFA 5DP8A 3NKKA 4ZHMU 4KGAA 1GBLA 2XXLA 4XDEA 2ODPA 4ABHA 3BEIB 2CV3A 3QZQA 4HGCA 1IQLA 5C1YA 1V2UT 1O3DA 1O2TA 2GCHG 4Q4LA 3ZV8A 1PPZA 4I8HA 1S0QA 4D76A 3F6UH 1T8NA 2J2UA 1ACBE 5C5OA 3PTNA 2YNBA 2ZTYA 4B1TA 2STBE 2ZEBA 1ABJH 2BDHA 1SQOA 2D26C 4RSPA 1SGIB 3SHCH 2ZFRH 1K1OA 1CGJE 5EXNA 2D1JA 1ZPBA 3RXFA 3A89A 1VKYA 1QFKH 3GICB 3A8CA 4ZROA 1Z6EA 1ZSLA 4X6OA 2SNWA 2BM2A 2HRVA 1TGNA 1OWJA 2DUCA 2VIWA 3LH3A 3ZYDA 5A0AE 4X1RU 3NK8A 4K8BA 3DFLA 4I32A 3RXHA 3OTJE 2HPPH 2OC1A 3NZIA 3KNXA 5F6MA 1KXBA 4ZXYH 3KQBA 4GLYA 1HIAA 1XUIA 1ORFA 2ALVA 4NIYA 1SI5H 4JK6A 1C2DA 2P94A 2BZAA 1HNEE 3OY6U 1RGQA 1BTHH 2AS9A 1OP0A 1IOEA 2G52A 1KXDA 2BHGA 1Z6JH 1EAIA 1KLJH 3VB3A 1HAXB 2FOFA 4I86A 2J5UA 4ABIA 2Y7ZA 1SQAA 2VIDA 1RTLA 1T32A 1TX7A 5C94A 3RXTA 4Q63A 1G36A 2XBWA 3ZYEA 4XBDA 2XW9A 4JZDH 1ZZZA 1DT2A 1ELEE 1V2MT 1FN6A 1CO7E 3U69H 3Q00A 2A32A 2JH5D 4NFEA 3VXEH 2EQNA 2V35A 2WPHS 2F4LA 1UCYH 2O8WA 3MYWA 3U9AH 1S6HA 2FX4A 5C0UA 2J94A 2NU3E 4YLQH 3TK6A 4MPUA 1V2TT 3M61U 2OQUA 4FUFA 3KQEA 4AORA 7GCHG 4NWKA 1VCQA 1O2IA 1EZSC 4X8TH 2BTCE 2Z9GA 3RP2A 4IN2A 5HGGA 2CXVA 1QCPA 4F4OC 3EE7A 3LT3A 1KDQA 2FDAA 5B6OA 4YOGA 1NESE 4AC9A 1TBRH 4AYYB 1CSOE 2BD4A 1WQVH 3LGIA 4SGAE 3URCA 5JBCS 1AO5A 1GHBG 2BXTH 1CBWB 3BEFB 4BAOB 3QTVH 4PROA 2ZPSA 3Q76A 2ZI2H 4AB9A 5ESBA 3SNCA 3BTTE 3ESTA 1HXEH 4JZEH 5SGAE 1C9TA 3KL6A 3N99A 1NO9H 4RKJB 3E8LA 1DS2E 4IC5A 2FIRH 3HKJB 5EQSA 2VH0A 1C1RA 1C1TA 1E37B 5DP4A 2AEIH 5A0CA 1O3LA 1PPGE 1FQ3A 3DT0H 1IQMA 5LH8A 2FI3E 2R3YA 2GVFA 1U6QA 2M5TA 4ASUD 2FOAA 1W3CA 3V3MA 3WWFA 2FX6A 1A61H 5LPFA 3STJA 3V13A 4MVNA 1IQJA 5IYTA 3PMAB 3RXEA 1UVTH 5HM2A 1YYY1 2FEQH 1P02A 3PM3A 1AD8H 2AIPA 4I8JA 3RXQA 5LPEA 2C8XB 2AHME 2OINA 1MBMA 1NN6A 2PUQH 1V2NT 2BD3A 3MU1A 3UWIA 1GHAG 3LOXA 1V2PT 3SOSA 4ABAA 4CR5A 2JETB 1S83A 2XBVA 1WU1A 1IQNA 1WSSH 4TWWA 2JKHA 1O37A 2PWXA 4THNH 4HI3A 1AMHA 4DGJA 1TE0A 4U01A 1LKAA 2PKAA 1CA0B 5J4SA 1GDNA 1HCGA 4YO9A 1DWCH 1JIMA 3SGQE 2QF5A 1E34B 3UOUA 1C5QA 1ELBA 1P09A 5EODA 3SW2B 9ESTA 3EA8A 4INLA 4A92A 3MU8A 1NRPH 1YPMH 4ZCNA 1TRYA 2R3UA 4UEHH 1ZLRA 2FLBH 2SNVA 2LELA 4FETA 1BOQA 1CU1A 4Y10E 2BQWB 1EAWA 1HDTH 3PRBA 1QURH 2ZC9H 5C3NA 5H4IB 1GI2A 3FANA 4RT0A 3UWJH 1TPPA 2K8IA 1C1MA 1LPGB 2F3CE 1GI6A 4KTUA 3P6ZB 3HK3B 3WWBA 1GJDB 3ZIAD 1TNHA 2QE7D 1C9PA 1L0ZA 1OHHD 5A09A 4X1NU 3RXUA 3L6PA 3UY9A 1TABE 6CHAC 2LP6A 4BTUB 1YPGH 4LZ4B 1G2MA 2ZDKA 3SV2H 5DO4H 1EXFA 2I6QA 2A7HA 2A5AA 1O3AA 3LH1A 1JMOH 2BD5A 2VWOA 1YKTA 3MFJA 5LPRA 4ZKNU 1AE5A 1ZMJA 4H6TA 3VPKA 3UQVA 1A1RA 3F9HA 3BG4B 5HIYA 2OUAA 2QF0A 2QA9E 4XRNA 3GCHC 3OX7U 5L30H 2ZGCA 2FXRA 1KYNA 3ENSB 1Z1JA 2AFQB 5T6GA 3F2HA 1AFQC 1A5HA 4A5TS 2GGVB 1NRQH 3P8NA 1ELAA 3HGNA 4K2YA 1G37A 1C2JA 1P10A 3E90B 1GI1A 1C5TA 1HUTH 4ZKOU 1UTNA 3OE7D 4DG4A 3PV4A 2SGQE 3O8RA 1PQ8A 2BDBA 5PTPA 2XC5A 2Z9KA 3CS7A 4UDWH 1GJ4H 1ESTA 2KAIB 2OC7A 1UTLM 2DE8A 2Z3EA 3KHVA 5FHTA 2W6ID 1ZHMA 3EA7A 4Z6AH 1A2CH 4MNVA 3PWCA 3UIRA 1AVXA 1C5RA 3UB0A 4B2BA 5EJ1A 2Q6GA 1AB9B 4X2YA 2BY6X 2C93B 3BF6H 3A7XA 3BTHE 3DSPA 3ODDA 4BAMB 4KKDA 4FU9A 2KR7A 2JETC 2AYWA 4RN6A 1GGDB 3VEQB 1C5VA 4Z1MD 2JIZD 1EJAA 1THRH 4LOYH 2BDCA 2FTLE 3RXJA 3LGYA 2PKSB 1P57B 1NFUA 3UTUH 3OU0A 4TWYA 1BJVA 5E0GA 5DSFA 2O8LA 5GPIB 1TX6A 2F91A 4WXIA 2IN2A 4NSYA 9LPRA 2WINI 2G81E 1XXDA 1TBZH 2F9NA 1E36B 1ZGVA 1BDAA 1TOMH 1TQ0B 1FY8E 1RTKA 1ZPCA 4K3JA 1NM6A 1LHGH 3OSYA
chains in the Genus database with same CATH topology
4F55A 1SKYE 4NWLA 3F2GA 3OEHD 2JJ1D 5EPYA 2OBOA 3H09A 3OTPA 5EQSA 3VG8A 2WV9A 4YXWD 5T1VA 4JMYA 4K8BA 3M5NA 4WH6A 2F43B 2OK5A 3SYJA 1E1QD 1E79D 2GVFA 3F0OA 4I32A 1W0JD 2A4RA 4XD7D 4ASUD 2OC1A 5FPYA 1W3CA 2QV1A 3KF2A 1A1RA 5GNDA 3KNXA 3OAAD 3P8OA 3SV8A 3WWFA 3SV7A 3KEEA 5FPTA 1NBMD 4RI0A 3SUDA 4B71A 2XNIA 2A4QA 2IJOB 1MABB 5C17A 3F2HA 1RGQA 2QF4A 4I33A 3O8BA 2GGVB 3KN2A 3P8NA 4KTCA 5FL7D 3SU6A 1BMFD 3EYDA 3WW7A 2AHME 3SV9A 3OEED 3SU3A 3SUEA 4A1VA 2OINA 4I31A 2J5UA 3E90B 3SU2A 3OE7D 1DXPA 1RTLA 3O8RA 3SU0A 1WXRA 2WPDD 3LOXA 3AK5A 3DSOA 2VBCA 1EFRD 2KZ4A 3O8CA 4Q63A 4OM9A 2V7QD 3PV5A 4B6FA 1KMHB 4B6EA 2OC7A 1NS3A 2JJ2D 2K0QA 5FPSA 2W6ID 2WHXA 2W6JD 5C0TA 3DCLA 2O8MA 3F2FA 1FX0B 5DN6D 2WSSD 4A1TA 4U01A 2YMSB 5IK2D 2KCYA 2XNDD 3FOAA 4TSFD 2F4LA 3W1EA 4R8TB 5HKKD 3FN8A 1S6LA 3GS9A 3SU5A 1COWD 4B74A 5EQQA 2QF5A 3UB0A 2XCNA 4WH8A 1BT7A 5C0UA 3SUGA 2KM0A 3N7EA 3OYPA 3PRDA 2FM2A 3SUFA 1NBME 3SU4A 3U1JB 3DSPA 2HLDD 4DT4A 3FO8D 2KFWA 4TYDA 4A92A 2WZQA 4ZCNA 2KR7A 4TT3D 2OC0A 5CHBA 3RC6A 3RC5A 3O8DA 2LELA 4FETA 5GJ4B 3SZEA 4NWKA 2K1QA 5ETXA 4M9FA 3LKWA 1JXPA 2L6OA 2P59A 1CU1A 2CK3D 4Z1MD 3SU1A 5B6LA 1DY8A 2JIZD 2YMSD 4Q4LA 3M5MA 3PRBA 4B76A 2YMSC 2KCAA 5H4IB 3F3BA 2A4GA 2M2AA 2JDID 3U1IB 3M5OA 5DSFA 5GPIB 1E1RD 2K8IA 1H8HD 1W0KD 2F9UA 2XOKD 3F0PA 2KCOA 2FOMB 1DXWA 3FKSD 3LONA 2XCFA 5CDFE 3WWBA 1H8ED 4A1XA 2OC8A 3ZIAD 2FP7B 1DY9A 5IDKA 2OBQA 2QE7D 2KCPA 3RC4A 1OHHD 2YOLA 3SV6A 3N7DA 3L6PA 3PV2A 3NRLA 2IJD1 5ESBA 2F9VA 4WF8A 5F53A 4B73A 3M5LA 3OFND 3N99A 5EPNA 5EQRA 4B75A 1N1LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WWB A;  3WWF A;  4ZCN A;  5F53 A;  5CHB A;  3WW7 A; 
#chains in the Genus database with same CATH topology
 3GCT G;  4RT1 A;  5KGO A;  3OEH D;  1N6Y A;  1WCZ A;  1FV9 A;  1GCT B;  1GBT A;  1P2J A;  2ZFS A;  3AAS A;  4U2W A;  4D8N A;  3UNR A;  1GG6 C;  1IQE A;  1VCP A;  4Y7A A;  3NXP A;  3OAA D;  3MO6 A;  3S7K B;  3GYL B;  1EQ9 A;  1O3J A;  2VNT A;  1GBC A;  4I8L A;  2FES H;  1GWA A;  4JZF H;  3RXD A;  1SC8 U;  3E91 A;  3A85 A;  4AN7 A;  1RS0 A;  2GDE H;  2ZGH A;  2OCV B;  4KTC A;  5AVD A;  5FL7 D;  5T6D A;  2TBS A;  1N8O B;  1PJP A;  1A4W H;  3FP8 E;  1QB9 A;  1GDU A;  1MD8 A;  1UK3 A;  3JZ1 B;  3K2U A;  3SU3 A;  2QAA A;  4GCH F;  2ZU4 A;  1DXP A;  1K1I A;  1AKS B;  2EA3 A;  1O3I A;  3RXM A;  3O8C A;  3LDX H;  8LPR A;  1BBR K;  1ANE A;  2EI6 A;  1O3E A;  1YPK H;  1O2V A;  2XBX A;  1P2N A;  1C1N A;  1TPO A;  1EP5 A;  4R0I A;  4AGJ A;  1TWX B;  1NFY A;  5CHA B;  1HAP H;  2I6S A;  5IK2 D;  2XC4 A;  1EPT B;  2KCY A;  2ZHD A;  1Y3X A;  3FOA A;  5K7R A;  2CJI A;  3MQK C;  3FN8 A;  2BDA A;  1W7X H;  1F5K U;  2ZP0 H;  5DJ7 A;  1AY6 H;  3NPS A;  1HAG E;  2KFW A;  3M36 A;  4OS6 A;  1BRA A;  5GJ4 B;  1VJ9 U;  1HJA B;  4YZU A;  3Q3K A;  4AX9 H;  2YMS D;  1B5G H;  1JRT A;  3M7Q A;  4HG6 A;  3QK1 A;  1P2I A;  1JIR A;  2OD3 B;  1ZJD A;  4BOH A;  2Y80 A;  3LGU A;  1VGC B;  1E1R D;  2W26 A;  3RMO H;  4OS5 A;  1SFI A;  1DWE H;  1ZTL A;  3BIV H;  1YP9 A;  1P9U A;  2GT8 A;  1UK2 A;  1C4U 2;  3SV6 A;  5KEC A;  3TGJ E;  3MH4 A;  2WV4 A;  1XUF A;  1SMF E;  2ZGB H;  2F9V A;  1C2F A;  1BBR E;  1SKY E;  1C5U A;  1BHX F;  1V2R T;  1PPB H;  2G4T A;  2A1D B;  2FLR H;  3UUZ A;  1Z8J B;  2OK5 A;  3T26 A;  1OSS A;  1UHB A;  3A84 A;  3ATI A;  3U8T H;  1SGT A;  2BDI A;  3KYF A;  1HAV B;  4LK4 A;  3RXP A;  1O3O A;  1P04 A;  4P00 A;  4ZH8 A;  2AGG X;  5HXF A;  5ABW A;  4RI0 A;  1T8L A;  1GBF A;  3TH4 H;  1P05 A;  2A4Q A;  1IHS H;  1XX9 A;  4Q7Z A;  2QF3 A;  1G3B A;  4MPW A;  1UVS H;  1QRX A;  4O9V A;  1RJX B;  3WW7 A;  1MQ5 A;  1VCW A;  1O3K A;  1GCT C;  3BIU H;  1MQ6 A;  2NU1 E;  3LC5 A;  1GHW H;  3ZZ7 A;  5F8Z A;  1P01 A;  5DP6 A;  2FPZ A;  2BD9 A;  1G32 B;  1MH0 A;  4BAQ B;  4OS4 A;  6GCH G;  2FS8 A;  2ASU B;  4DVA U;  1TIO A;  1AND A;  2QXH A;  1O5E H;  2Z7F E;  3DCL A;  4ISN A;  1SOZ A;  3MOC A;  3ZZD A;  3BEU A;  5EST E;  2WSS D;  1O5B B;  5AFZ H;  2HWL B;  1BTZ A;  2Z94 A;  1YCP K;  3S9A A;  1P3C A;  3ZZB A;  2GZ7 A;  2ANY A;  1ELG A;  1T4U H;  3PLK A;  3E0N B;  2GX4 A;  4ZXX H;  4DII H;  4AG1 A;  1PPC E;  5AHG H;  3PRD A;  1WTG H;  2C8W B;  2KX4 A;  2HVY B;  2HNT E;  1BMM H;  1TYN A;  1OWI A;  4YT7 H;  3H5C B;  2UWO A;  1V2V T;  3CP7 A;  1NRN H;  3IIT A;  4O3U A;  1UO6 A;  3IG6 B;  2Y6T A;  4RKO B;  4DJZ B;  3A82 A;  5C1X A;  1KSN A;  5TCC A;  1GVZ A;  3VGC B;  3T5F H;  5CHA C;  1J17 T;  1C5W B;  2TPI Z;  1O30 A;  1EPT C;  3QN7 A;  3Q3X A;  1GI3 A;  2JDI D;  1LMW B;  1WUN H;  1J15 A;  2P8O C;  2PGB B;  1FY4 A;  1Z8I B;  3U28 C;  1C5O H;  1V2Q T;  2B9L A;  2WPJ S;  3GDU A;  2QC2 A;  4AFS A;  2PW8 H;  3MTY A;  2ZF0 H;  1T31 A;  4X8V H;  1MTN C;  4IW4 E;  1Z7K A;  1LTO A;  3N7O A;  3SJI A;  2QXG A;  4WWY A;  3N7D A;  3STI A;  4CR9 A;  1HJA C;  1C5N H;  1VIT H;  1BRB E;  4B73 A;  3F9F A;  3MU0 A;  2HNT C;  1O0D H;  1C1S A;  4SGB E;  1FUJ A;  2GCT B;  5EPY A;  1QJ7 B;  1VR1 H;  1Y3Y A;  3S9C A;  3BTF E;  4Q80 A;  3RXS A;  1GHV H;  4XD7 D;  1C5L H;  3PRO A;  3SI4 H;  1UVU H;  2V0B A;  3FFG A;  1Q3X A;  6LPR A;  5GND A;  1Y3U A;  5EW2 H;  1SB1 H;  2VVC A;  4JYU H;  2ANM H;  1AVW A;  1O2P A;  1DUA A;  1K9O E;  1QJ6 B;  3SN8 A;  3A7V A;  1F0S A;  3C27 B;  4NCY A;  3ZVG A;  4DIH H;  3L3T A;  3RXL A;  1FPH H;  1YF4 A;  3O8B A;  2IPH A;  4IGD A;  1LDT T;  4BAK B;  3EYD A;  1AE8 H;  1TFX A;  2GZ9 A;  2UUY A;  1SLV B;  2IOT A;  3A87 A;  5FCR A;  1A7S A;  1LVO A;  2VWM A;  2SGF E;  4LZ1 H;  2BDG A;  3P70 B;  3LU9 B;  3KID U;  1EFR D;  1TNI A;  1FN8 A;  4FUI A;  3TH2 H;  2BYA X;  1SGP E;  1HRT H;  3MNS A;  2BY5 X;  1SGY E;  2QY0 B;  3MO3 A;  3F2F A;  1LPK B;  3ODF A;  1XM1 A;  1ID5 H;  1XUG A;  1AUJ A;  1S5S A;  3QDZ B;  3RM0 H;  4JYT A;  3W1E A;  3GS9 A;  2ZPQ A;  1DIC A;  1VJA U;  3EQ0 H;  2JH0 D;  1SHY A;  1MMJ N;  2FZZ A;  2VGC C;  1BCU H;  3I77 A;  2VH6 A;  2D2D A;  3O8D A;  7LPR A;  5LGO A;  3B9F H;  1O2S A;  3T27 A;  2JH6 D;  1OYQ A;  2R2M B;  2Y81 A;  3SU1 A;  1W0Y H;  4K5Z A;  2ZDN A;  3GDV A;  3UQO A;  4B76 A;  2OP9 A;  3TLO A;  3UNS A;  4AB8 A;  1IQF A;  2GD4 B;  3KQC A;  2WPL S;  5EJZ A;  4OGY A;  1RFN A;  2FOB A;  4MNX A;  3AVZ A;  2O8U A;  5FX6 A;  5EW1 H;  3EE0 B;  1HBT H;  2TGD A;  3JZ2 B;  5E2O A;  1EZQ A;  3LON A;  3PWB A;  4JZ1 A;  2F9B H;  1XXF A;  3RLW H;  1AWH B;  3VXF H;  1DY9 A;  2WPI S;  2P16 A;  4Q7X A;  3VB7 A;  1UVO A;  1P11 E;  5J4Q A;  1UJ1 A;  5EQR A;  4NWL A;  8GCH G;  1Q2W A;  4GAW A;  5TCA A;  4WH6 A;  1NT1 A;  2XRC A;  1KLI H;  3LC3 A;  2BVX H;  1K21 H;  2ZQ1 A;  5FPY A;  2J38 A;  2VIP A;  3A81 A;  3LPR A;  1EAU A;  1W2K H;  2FO9 A;  3SV7 A;  1EB1 H;  3KEE A;  2F83 A;  4ISL A;  2AH4 X;  5E0H A;  2ZNK H;  3ZVD A;  2H1U A;  2QF4 A;  3ZVB A;  4Y8X A;  1NRO H;  1BMF D;  3ATW A;  2B5T B;  3SUE A;  2AIQ A;  3ZZ3 A;  1GMH F;  1QRZ A;  5L2Z H;  1NU7 B;  3AK5 A;  4A6L A;  1GJ9 B;  3DSO A;  2A5K A;  2KZ4 A;  2BD7 A;  2EI8 A;  5JBT A;  1MTS A;  3MNC A;  1MTV A;  3ZZ4 A;  4CRE A;  2Z9J A;  1K1P A;  3M3S A;  4GVU A;  2YMS B;  1J9C H;  2J98 B;  4R8T B;  2G8T A;  2AMP A;  1V2O T;  4WH8 A;  3T62 A;  1GJB B;  2QYI A;  2HLC A;  1SQR A;  2HLD D;  1C1U H;  1FPC H;  1TNK A;  4FXG H;  4TYD A;  2GDD A;  3UOP A;  1ZOM A;  1L2E A;  1V2K T;  4UFD H;  2OLG A;  2V6N A;  4GHQ A;  1DSU A;  1EOJ A;  3P8G A;  1M9U A;  2V3H H;  2Y7X A;  3CEN A;  2A5I A;  2G55 A;  1K1L A;  1PFX C;  1AVG H;  1C5X B;  2V3M A;  1RD3 B;  4YM9 A;  2A2Q H;  4CRC A;  1H8H D;  3R3G B;  2FOM B;  1QR3 E;  4NSV A;  5CDF E;  2C8Z B;  1A5I A;  1E35 B;  4JYV H;  1GBJ A;  2PTN A;  2IPQ X;  5JB8 S;  3TH3 H;  1GI9 B;  1NZQ H;  3SNA A;  3A7W A;  4K1E A;  1BML A;  3E3T A;  2QXI A;  3L33 A;  1D4P B;  1CE5 A;  4BTT B;  3F2G A;  2XC0 A;  3SOR A;  3FP6 E;  1Z8G A;  2WPK S;  4JMY A;  1HJ8 A;  3SYJ A;  3GYM A;  2VIQ A;  2YNA A;  1MAY A;  1C4V 2;  1W0J D;  1JOU B;  1WV7 H;  2J34 A;  3RUO A;  2H2Z A;  2EC9 H;  2BQ7 B;  3ITI A;  3K65 B;  3LJJ A;  1K1N A;  2BVR H;  1TRM A;  2PKA B;  1MCV A;  1UMA H;  1FIW A;  1MAB B;  5A8Y A;  2OXS A;  1YPJ H;  1HXF H;  1W10 U;  2BY8 X;  1W11 U;  2PUX B;  4I33 A;  1GJA B;  4H6S B;  2QIQ A;  4YTA A;  4ZMA H;  3IWM A;  2BXU H;  1AQ7 A;  1HPG A;  4MTB A;  1EAS A;  3ELA H;  1GVL A;  3S69 A;  1L4D A;  1HAO H;  4I31 A;  3TNS A;  1L1G A;  1C2M A;  4X2V A;  1QQU A;  4AFZ A;  1D3D B;  4MG3 A;  2FWW A;  4FUB A;  2H6M A;  3QLP H;  2L74 A;  1CBW C;  2ZFQ H;  4B6E A;  2RG3 A;  4UON A;  1W13 U;  2PP6 A;  2OTV A;  1H1B A;  1SVP A;  2EST E;  4INH A;  3K9X B;  5G4B A;  2BQ6 B;  1F5R A;  4FVB A;  5HKK D;  4WVP E;  2DE9 A;  1F0T A;  1UTK A;  1GBD A;  4IC6 A;  3N7E A;  3DD2 H;  2FM2 A;  1C4Y 2;  1ZPZ A;  2H9E H;  4DW2 U;  2WZQ A;  3KCG H;  4TT3 D;  2OC0 A;  1KXA A;  3RC5 A;  3SBK A;  3SZE A;  3SI3 H;  2B0F A;  2GMT B;  2L6O A;  3PMH B;  5T6F A;  1CT0 E;  1HAY B;  3S9B A;  2YMS C;  1SGF G;  2BLO A;  2Y5H A;  7EST E;  3U1I B;  2F9P A;  1X7A C;  1SGD E;  1GHX H;  2FOH A;  4OGX A;  2ZCL P;  5C5N A;  3RU4 T;  3VB4 A;  3HK6 B;  1LPZ B;  7KME H;  1GMC F;  1GJ8 B;  2OC8 A;  3TGK E;  1V2S T;  3VB5 A;  4FUJ A;  5JB9 S;  1O3N A;  5DG6 A;  3M3T A;  4UD9 H;  1F0U A;  3NRL A;  2BDY A;  4DT7 B;  1ZMN A;  4BTI B;  4DOQ A;  1HGT H;  2FOG A;  2ZKS A;  1N1L A;  3F68 H;  2BLQ A;  5CMX H;  5DP3 A;  6EST A;  1VIT F;  1CA0 C;  4YLU A;  2HNT F;  3A8D A;  4AYV B;  1FIZ A;  1CHO F;  3A80 A;  1ARC A;  1MZD A;  2PLX A;  3UR6 A;  1Y8T A;  4ABE A;  2VU8 E;  3SV8 A;  4ABF A;  4GPG A;  2W3I A;  1TGS Z;  3SNB A;  1P0S H;  4X1P U;  2RCE A;  2UWL A;  5FPT A;  3PMJ A;  3W95 A;  1MKX K;  2IJO B;  4NIV A;  1GJ6 A;  3RXI A;  1DVA H;  1V3X A;  3QGN B;  1KXC A;  1KXE A;  1O2Y A;  4IMZ A;  4ASH A;  1QQ4 A;  1OOK B;  3RU4 E;  1FAX A;  3SV9 A;  5DKM A;  4FUC A;  3SQE E;  1YPL H;  2ZU5 A;  1BZX E;  1BTP A;  5K0H A;  4CHA B;  3A86 A;  4GCH G;  1QBV H;  1ELF A;  1YM0 A;  4B2C A;  2P3T B;  5E0J A;  3MU5 A;  2BB4 A;  1O3M A;  5C0T A;  1P2M A;  2G5V A;  3V7T A;  3SJ9 A;  3T2N A;  5JBB S;  3Q77 A;  1C5M D;  2PFE A;  2BY7 X;  4Y0Y E;  1P2K A;  2J4I A;  1BTX A;  1QB6 A;  4MQA A;  5F03 A;  1LKB A;  2ZWL H;  3ZZA A;  4B2A A;  3SUG A;  1GBA A;  3F1S B;  4NG9 H;  1EPT A;  4E7R G;  4BAH B;  1NBM E;  3FO8 D;  5AF9 H;  1AU8 A;  1O2X A;  3BG4 C;  4X0W U;  1FJS A;  1EB2 A;  4HTC H;  3GY2 A;  3LKW A;  3KQ5 A;  1P3E A;  3RXR A;  4K1T A;  3RXC A;  1AZZ A;  1O3G A;  3ZVC A;  1MTW A;  1V2L T;  1SLU B;  1Y3W A;  1N6X A;  1P2O A;  1LHD H;  1F2S E;  2M2A A;  2TRM A;  1SLW B;  3MH7 A;  2A45 B;  1O3B A;  3M35 A;  4IS5 A;  1ZYO A;  1EAX A;  8EST E;  3G01 A;  2R0L A;  5HYO A;  1W0K D;  3F0P A;  4UFG H;  3GCN A;  1O5D H;  1O2J A;  2H9T H;  1MCT A;  1P06 A;  3GY3 A;  5IDK A;  1O5C B;  3K6Y A;  5FAH A;  3MO9 A;  2ZTX A;  2Z6B D;  2BX3 A;  2FI5 E;  1MAX A;  1O2O A;  2PTC E;  4Y76 A;  2RDL A;  1PYT C;  1ELV A;  1C1O A;  1OPH B;  1SGE E;  1P12 E;  1MKW K;  1S0R A;  3BTW E;  1FXY A;  2G00 A;  3M5L A;  4Z0K A;  5I25 A;  1H8D H;  1BMN H;  1CHG A;  5A8X A;  1D9I A;  2OBO A;  5GCH F;  5L2Y H;  1TLD A;  2R2W U;  1J14 A;  1E1Q D;  1EKB B;  1W0Z U;  4MLF B;  4ZUH A;  1AB9 C;  1ESA A;  2GV7 A;  1NU9 A;  2D8W A;  1YGC H;  1ZRB A;  2J9N A;  3P8O A;  1MU8 B;  5DP9 A;  1DAN H;  1KTT B;  1TB6 H;  1HLT H;  3TJO A;  3LGV A;  1HAV A;  1GGD C;  4O3T A;  1MUE B;  1ZSJ A;  5FXL A;  1EZU C;  1T7C A;  3D62 A;  2A31 A;  1GI0 A;  2PKS C;  3E16 B;  3W94 A;  2CN0 H;  4UFF H;  2SFA A;  1TA2 A;  4A1V A;  2PSY A;  3F9G A;  3RM2 H;  3GY5 A;  4KP0 A;  3SU2 A;  1GL0 E;  4AG2 A;  1LO6 A;  3ATL A;  8KME 2;  4H42 U;  3KGP A;  1OWH A;  1G30 B;  1CGI E;  1S81 A;  3PV5 A;  5EGM A;  5DP5 A;  4B6F A;  1ZR0 A;  1O2G H;  2V3O H;  2H9H A;  5FPS A;  1XUK A;  4FUH A;  2RA0 A;  2UUK B;  1F0R A;  1LVM A;  2XND D;  5EG4 A;  2W3K A;  4B74 A;  1BBR H;  2GP9 B;  1DPO A;  1BT7 A;  3U98 H;  1DDJ A;  1EAT A;  2KM0 A;  1DE7 H;  3MH6 A;  3QO6 A;  1SG8 B;  4MPX A;  1CQQ A;  5A2M H;  3Q3Y A;  4DT4 A;  4AFQ A;  1QGF A;  1GI7 B;  2FS9 A;  4X1S U;  5CHB A;  2Y5F A;  1GJC B;  4NA7 A;  4X2X A;  4M9F A;  5E2P A;  1QNJ A;  1THS H;  1BRU P;  1UHB B;  1CT4 E;  4JCN A;  1B7X B;  5KED A;  2FOE A;  3SJO A;  2ALP A;  1BMA A;  4UFE H;  2ZGX H;  3PO1 B;  4F49 A;  3TK5 A;  1TNJ A;  4BXS A;  4FVD A;  1RTF B;  1N8O C;  2BY9 X;  1BA8 B;  1YWU A;  4ABG A;  1OWD A;  4ACA A;  2SGA A;  5EXL A;  5C2Z A;  1ETS H;  1SHH B;  3FKS D;  2XCF A;  3RU4 D;  1H8E D;  1WYK A;  5DPA A;  4A1X A;  2RA3 A;  3URD A;  1LHF H;  2KCP A;  2VIV A;  1Y5U T;  1YPH E;  3NUM A;  1TMB H;  1ZTJ A;  1ELD E;  1LVY A;  2ZFP H;  3PV2 A;  2P95 A;  3QGJ A;  1EUF A;  2B8O H;  1TGC A;  3RXG A;  3BTQ E;  2BD2 A;  3BN9 A;  1TMT H;  3I29 A;  1TGB A;  4A7I B;  4CBN A;  4F48 B;  1S6F A;  3QUM P;  6GCH F;  1A46 H;  2F43 B;  3M3V A;  1Y5A T;  4JK5 A;  3UNQ A;  1NRR H;  1BTY A;  3BTE E;  4MNY A;  5JYI A;  3NWU A;  1IAU A;  1XKB C;  3MNX A;  1QHR B;  5C20 A;  1XMN B;  4TPI Z;  1DUE A;  1GBH A;  1PYT D;  1NBM D;  3RXK A;  3H7O A;  4BXW A;  4ZHA A;  3MNB A;  1P9S A;  3SHA H;  2ZDV H;  4Y8Y A;  1YPH C;  3GY8 A;  1A0L A;  3TGI E;  2ZA5 A;  2Y5G A;  2GV6 A;  2VVV A;  5GXP A;  1VGC C;  1XVM A;  1TGT A;  3PMB B;  4Y6D A;  2WYG A;  1GMD F;  3GIS B;  1UCY K;  3AAU A;  3P17 H;  1HV7 A;  3CS0 A;  3UFA A;  2V7Q D;  2FYR A;  3TK9 A;  4Y71 A;  2XWA A;  4EST E;  1BHX B;  3QZR A;  1ELT A;  1IHT H;  4ISI H;  1FX0 B;  1O5F H;  3DUX H;  2QXJ A;  4TSF D;  1UW7 A;  2ZQ2 A;  1T8M A;  1P8V C;  1BJU A;  2EY4 C;  3A8B A;  3SJK A;  1YCP M;  1BUI A;  2G51 A;  3SU4 A;  2ZIQ H;  1F5L A;  3D23 A;  3TIU A;  4AOQ A;  1NPM A;  2GCH F;  1YCP H;  1YC0 A;  1QL7 A;  1GBE A;  1ANB A;  3GY7 A;  2A7C A;  1O31 A;  1TQ7 B;  1G3E A;  3ZV9 A;  2VVU A;  1PPF E;  5EJL A;  2LPR A;  3RXV A;  4BNR A;  1RIW B;  5JDU B;  1C2E A;  1TBQ H;  2SGE E;  3H7T A;  3T25 A;  1C1W H;  2ZO3 H;  1DOJ A;  1EX3 A;  1QA0 A;  1O35 A;  1F7Z A;  2KCO A;  4X8U H;  2BX4 A;  1QL8 A;  3EAJ A;  4YES B;  4AZ2 B;  2A0Q B;  3V0X A;  2WUB A;  3QWC H;  1O2K A;  3RMM H;  3BTG E;  2SGD E;  1SPJ A;  1UCY E;  1DM4 B;  5F53 A;  5EOK A;  1O2U A;  1SGQ E;  1LCY A;  2GKV E;  1JRS A;  3PO1 C;  3TU7 H;  1GDQ A;  2QCY A;  1NRS H;  4VGC B;  1E79 D;  1HIA B;  4IN1 A;  1SBW A;  4XBB A;  4ABJ A;  2ZHW H;  1O36 A;  4XFQ A;  3DFJ A;  3UPE A;  1QIX B;  4NZQ A;  1SFQ B;  4B71 A;  2XNI A;  1A0J A;  3NCL A;  1O2L A;  2GTB A;  3D65 E;  4DCD A;  2PHB A;  3U8O H;  1AUT C;  1D6R A;  5C17 A;  1O39 A;  3VGC C;  2R0K A;  4TY7 A;  1LVB A;  2ZPR A;  3P92 A;  4MDS A;  1A3B H;  3SU6 A;  1AN1 E;  1HFD A;  2EI7 A;  4CH8 B;  3ZZ8 A;  2ZDM A;  1RXP A;  3S7H B;  4Y11 E;  1FY3 A;  1HAZ B;  4M7G A;  1ELC A;  2A2X H;  4DUR A;  3KQD A;  4TPY A;  1O5G H;  1GMH G;  6CHA B;  1KMH B;  3DHK H;  3E0P B;  4E7N A;  2JJ2 D;  2K0Q A;  4E06 H;  4ZAE A;  2P93 A;  1OKX A;  1L4Z A;  1OX1 A;  3TIT A;  4A1T A;  2ZFF H;  1MD7 A;  4H4F A;  1A0H B;  2GCT C;  4AFU A;  1O33 A;  2CF8 H;  4X6P A;  4P02 A;  4X1Q U;  1S6L A;  2ZTZ A;  3SU5 A;  1DIT H;  1GI4 A;  1DLK B;  1YBW A;  1UTO A;  1O2W A;  3ZZ9 A;  1AZ8 A;  1W14 U;  1C5P A;  4FOU C;  5DP7 A;  3OYP A;  1THP B;  3A88 A;  3SUF A;  2J98 A;  7GCH F;  1WTH D;  3U1J B;  5T3H A;  1AHT H;  1QB1 A;  3GCH B;  8GCH F;  4YT6 H;  3P95 A;  3FZD A;  2OQ5 A;  3E6P H;  1FLE E;  1KDQ B;  1JXP A;  1FMG A;  2FI4 E;  1MU6 B;  2P59 A;  4YOJ A;  1T4V H;  5B6L A;  4XOJ A;  3TJV A;  1L1N A;  3M5M A;  2CHA B;  1AFQ B;  1AI8 H;  3UAI C;  2ODQ A;  1C1Q A;  1FY1 A;  1O34 A;  1PPH E;  3C1K A;  1DWB H;  1ETT H;  1C2I A;  1ZJK A;  2H5C A;  2BOH B;  4IBL H;  1GHB F;  2VJ1 A;  1NFX A;  1YY3 A;  2NU2 E;  4HZH A;  1DXW A;  2ZHQ H;  4D9R A;  5FBI A;  3M7T A;  2ZU3 A;  2CMY A;  2YOL A;  3LGW A;  1TPA E;  2STA E;  4NIX A;  3KYG A;  4NA9 H;  3OY5 U;  4ABB A;  5HMA A;  3M37 A;  4NFF A;  1HJ9 A;  2XBY A;  2ZCH P;  3MU4 A;  1C5S A;  4LXB H;  2AMQ A;  1XUJ A;  3ATK A;  1RIW C;  4X8S H;  4I7Y H;  2XTT B;  4ISO A;  4FU8 A;  5T1V A;  1DLE A;  3M5N A;  1FY5 A;  3PYH A;  1OP2 A;  1UTP A;  1A5G H;  1KLT A;  2QV1 A;  3DA9 B;  4D7G A;  1K1M A;  1NC6 A;  2VWL A;  4J2Y B;  2AMD A;  2BZ6 H;  1T8O A;  3M7U A;  2TGT A;  3PLB A;  2W7S A;  3TJN A;  1RRK A;  2FOD A;  5BRR E;  1XUH A;  1O32 A;  1DST A;  1GHY H;  1C2H A;  1F92 A;  1TNL A;  3SND A;  2THF B;  3SZN A;  1NTP A;  3MHW U;  2BLV A;  1HAH H;  2VWN A;  3EDX B;  1GHA F;  1SGR E;  2Z9L A;  3OEE D;  3VB6 A;  1CA8 B;  2H5D A;  4VGC C;  3CNR A;  1Q31 A;  1QY6 A;  1K28 D;  1PPE E;  2J97 A;  4Y8Z A;  4QT8 C;  2J95 A;  3FAO A;  1HAI H;  1Y59 T;  3SGB E;  1GVK B;  2GJG A;  2G5N A;  4XSK U;  4D9Q A;  3P8F A;  1TMU H;  4X6N A;  2C3S A;  2W6J D;  2W7U A;  2ANK H;  3BTK E;  1BQY A;  5CE1 A;  2PGQ B;  1UTM A;  3AW0 A;  4WF8 A;  3A7T A;  2R9P A;  5EQQ A;  1H9L B;  3AAV A;  1GG6 B;  2Z9I A;  1GCD A;  2TIO A;  4X6M A;  1EOL A;  3E1X B;  1GBM A;  5E8E H;  3BG8 A;  3RC6 A;  2P3F H;  1QL9 A;  1ANC A;  5ETX A;  1E0F D;  1MBQ A;  1DY8 A;  4ISH H;  4D7F A;  3ZZ5 A;  3LJO A;  5JPM H;  1XVO A;  5AFY H;  3F3B A;  5EU8 A;  3BV9 B;  2TGP Z;  3U8R H;  2KAI A;  4Y79 A;  3M5O A;  3FVF B;  1QJ1 B;  1ESB A;  2A7J A;  5JBA S;  4OS2 A;  2PV9 B;  4FUE A;  1ZGI A;  2Q6F A;  1GJ5 H;  1O2N A;  3SQH E;  3A8A A;  1WAY B;  2C4F H;  2FOC A;  2ZG0 H;  1K2I 1;  1KTS B;  2HVX A;  1H4W A;  2BD8 A;  4IMQ A;  1GPZ A;  2IJD 1;  1GMC G;  4ABD A;  1OWE A;  3BTM E;  1B0F A;  2A4O A;  5I46 H;  1FDP A;  2HPQ H;  1TOC B;  2CHA C;  1V6D A;  4F55 A;  3I78 A;  4WJG 2;  2JJ1 D;  1C2K A;  3B8J A;  3EGK H;  5HM9 A;  2WUC A;  1GHZ A;  5F8T A;  1O5A B;  4TY6 A;  1WQS A;  3UR9 A;  2CF9 H;  1SGC A;  1S85 A;  1VIT G;  2Q1J A;  4K60 A;  3BSQ A;  2G4U A;  1CHO G;  1D3T B;  1J8A A;  1K22 H;  1TX8 A;  2GZ8 A;  4Q2K A;  1S84 A;  3PLP A;  1H9I E;  3S0N A;  4X2W A;  3AW1 A;  4O97 A;  3HPT B;  2FYQ A;  3KN2 A;  3LIW A;  3RXA A;  2Z3D A;  3MI4 A;  1OP8 A;  5BPE A;  1C2G A;  2VIO A;  1LHC H;  2F9O A;  3QX5 H;  1W8B H;  3RXO A;  5A0B A;  5TJX A;  3ZZC A;  5A8Z A;  2FTM A;  1C5Z B;  3SGA E;  4J1Y A;  3SU0 A;  2VBC A;  1GI5 A;  1SSX A;  3A7Y A;  1D6W A;  1SLX B;  2WHX A;  1DX5 M;  2O8M A;  1BTW A;  1ZHR A;  4CBO A;  5EIY A;  1E38 B;  1G3C A;  4WMD A;  1UTQ A;  3LGT A;  1O38 A;  4BAN B;  5L6N H;  4O03 A;  5DGJ A;  1YLD A;  1YLN A;  2PR3 A;  4WY3 A;  1Z8R A;  2NU0 E;  1TON A;  2VIN A;  4CH2 B;  5FCK A;  1V2J T;  1BIO A;  2WV5 A;  1ZHP A;  2BVS H;  5F8X A;  1QZ8 A;  4KEL A;  2K1Q A;  1FON A;  1Z71 A;  2CK3 D;  1DWD H;  4OS1 A;  1UVP A;  1AKS A;  2RFK C;  3A7Z A;  2EEK A;  3TJU A;  1OWK A;  2KCA A;  3B23 B;  2A4G A;  1DFP A;  1GBB A;  2Y82 A;  3HKI B;  4K1S A;  1INC A;  1HB0 B;  1TPS A;  2F9U A;  2P3U B;  2XOK D;  1QBN A;  1GJ7 B;  4DY7 B;  1BIT A;  4U32 A;  3ATM A;  3MMG A;  1O2R A;  5FBE A;  1H9H E;  2QGR A;  1EP6 A;  1ZML A;  1FAK H;  1TAW A;  3GCT F;  1V2W T;  3D49 H;  1SQT A;  1YPE H;  3RLY H;  2BOK A;  2ZFT A;  3TPI Z;  4JZI A;  3OFN D;  3RML H;  4B75 A;  1G2L A;  1O3H A;  3ZVA A;  2ILN A;  2TGA A;  1G3D A;  1IQG A;  2ZGJ A;  3H09 A;  3OTP A;  3VG8 A;  4GSO A;  4XE4 A;  1TA6 A;  3GY6 A;  1O2H A;  1BTU A;  1QRW A;  2A4R A;  3FP7 E;  1NFW A;  5GCH G;  1WOF A;  3ZVE A;  1XKA C;  2NWN A;  3KF2 A;  1QBO A;  4K69 A;  2VB0 A;  3ZVF A;  4CRF A;  4NA8 A;  4WXV A;  5FX5 A;  1TAL A;  2HGT H;  3SUD A;  1FI8 A;  2GMT C;  3K6Z A;  4WME A;  1ARB A;  1SGN E;  1SGF A;  2BMG B;  4ACB A;  1EJM A;  1HYL A;  1Y3V A;  1Z1I A;  1O3F A;  4YOI A;  1CVW H;  1P2Q A;  1QA7 A;  1LQE A;  3RDZ A;  2LNC A;  2P8O B;  2UUJ B;  4KTS A;  2WPM S;  3A83 A;  5GWZ A;  4INK A;  1MKX H;  3PTB A;  2ZU2 A;  4UE7 H;  1CT2 E;  1OYT H;  2NU4 E;  3RXB A;  1W12 U;  1MTN B;  2WPD D;  4Y0Z E;  1O2M A;  4E05 H;  3R0F A;  1P03 A;  1C5Y B;  3MH5 A;  3SO3 A;  1EJN A;  3GOV B;  1NS3 A;  2ZU1 A;  5DN6 D;  2HAL A;  4CRD A;  2Q6D A;  4U30 A;  2RDE A;  2B7D H;  1LQD B;  3F9E A;  4FUG A;  1TNG A;  3PB1 E;  2ZHF H;  4FUD A;  1B0E A;  4NIW A;  5GIB A;  3TNT A;  1PQ7 A;  2CGA A;  4OS7 A;  1TRN A;  3URE A;  1ETR H;  1VZQ H;  1C1P A;  2ZHE H;  1AWF H;  3HGP A;  2O8T A;  1IQH A;  1W7G H;  4HFP B;  3ZZ6 A;  1PQA A;  4Y7B A;  4ZKS U;  3T29 A;  3QTO H;  4I8G A;  2HOB A;  3FZZ A;  1KY9 A;  1L1J A;  4AGK A;  2QN5 T;  1MTU A;  1S82 A;  1J16 A;  2W5E A;  2WYJ A;  1JWT A;  1O3P B;  3SJ8 A;  1EZX C;  2XWB I;  4CHA C;  1FNI A;  1AIX H;  1BRC E;  2FP7 B;  4NGA H;  3RMN H;  2OBQ A;  2AGE X;  3RC4 A;  1A3E H;  1KXF A;  1CGH A;  1NY2 2;  1BB0 B;  4MPV A;  1ZSK A;  1IQK A;  2UWP A;  4XBC A;  2ZZU H;  4ZKR U;  1D3P B;  4Q7Y A;  1SR5 C;  5EPN A;  1OXG A;  4ZHL U;  1UK4 A;  1JBU H;  1KIG H;  1YLC A;  2FMJ A;  4K8Y A;  3TVJ B;  2WV9 A;  4YXW D;  2AGI X;  4GUX A;  1G9I E;  5C67 A;  4NZL A;  4CRA A;  4I8K A;  3F0O A;  1WBG B;  3V12 A;  1MKW H;  2VGC B;  3GCO A;  5EXM A;  5GDS H;  4CRG A;  1WDI A;  1K0H A;  1O3C A;  1H8I H;  5HIZ A;  1ZRK A;  1C2L A;  1SOT A;  4FU7 A;  2ULL A;  3HAT H;  2ODY B;  5C1U A;  1AFE H;  3GY4 A;  1FZZ A;  1AGJ A;  1O2Q A;  1Y5B T;  3MWI U;  3SNE A;  2C8Y B;  1MZA A;  1LHE H;  1GL1 A;  2ZDL A;  2C90 B;  1GBK A;  1K1J A;  4GHT A;  2AER H;  5DK1 A;  4CRB A;  3BTD E;  2ZEC A;  3T28 A;  2XYA A;  2ZCK P;  1ZTK A;  1D3Q B;  1IQI A;  1SL3 A;  1WXR A;  4MNW A;  2J92 A;  1OS8 A;  1O2Z A;  2BLW A;  4OM9 A;  1PQ5 A;  1GMD G;  1GBI A;  3DSG A;  1ABI H;  2ANW A;  2O9Q A;  4WMF A;  3GDS A;  1C1V H;  2Z3C A;  2UUF B;  2PSX A;  2ZDA H;  3VFE A;  2SGP E;  1GI8 B;  1COW D;  3WY8 A;  1UTJ A;  2GT7 A;  2XCN A;  3EA9 A;  1QTF A;  5DP8 A;  3NKK A;  4ZHM U;  4KGA A;  1GBL A;  2XXL A;  4XDE A;  2ODP A;  4ABH A;  3BEI B;  2CV3 A;  3QZQ A;  4HGC A;  1IQL A;  5C1Y A;  1V2U T;  1O3D A;  1O2T A;  2GCH G;  4Q4L A;  3ZV8 A;  1PPZ A;  4I8H A;  1S0Q A;  4D76 A;  3F6U H;  1T8N A;  2J2U A;  1ACB E;  5C5O A;  3PTN A;  2YNB A;  2ZTY A;  4B1T A;  2STB E;  2ZEB A;  1ABJ H;  2BDH A;  1SQO A;  2D26 C;  4RSP A;  1SGI B;  3SHC H;  2ZFR H;  1K1O A;  1CGJ E;  5EXN A;  2D1J A;  1ZPB A;  3RXF A;  3A89 A;  1VKY A;  1QFK H;  3GIC B;  3A8C A;  4ZRO A;  1Z6E A;  1ZSL A;  4X6O A;  2SNW A;  2BM2 A;  2HRV A;  1TGN A;  1OWJ A;  2DUC A;  2VIW A;  3LH3 A;  3ZYD A;  5A0A E;  4X1R U;  3NK8 A;  4K8B A;  3DFL A;  4I32 A;  3RXH A;  3OTJ E;  2HPP H;  2OC1 A;  3NZI A;  3KNX A;  5F6M A;  1KXB A;  4ZXY H;  3KQB A;  4GLY A;  1HIA A;  1XUI A;  1ORF A;  2ALV A;  4NIY A;  1SI5 H;  4JK6 A;  1C2D A;  2P94 A;  2BZA A;  1HNE E;  3OY6 U;  1RGQ A;  1BTH H;  2AS9 A;  1OP0 A;  1IOE A;  2G52 A;  1KXD A;  2BHG A;  1Z6J H;  1EAI A;  1KLJ H;  3VB3 A;  1HAX B;  2FOF A;  4I86 A;  2J5U A;  4ABI A;  2Y7Z A;  1SQA A;  2VID A;  1RTL A;  1T32 A;  1TX7 A;  5C94 A;  3RXT A;  4Q63 A;  1G36 A;  2XBW A;  3ZYE A;  4XBD A;  2XW9 A;  4JZD H;  1ZZZ A;  1DT2 A;  1ELE E;  1V2M T;  1FN6 A;  1CO7 E;  3U69 H;  3Q00 A;  2A32 A;  2JH5 D;  4NFE A;  3VXE H;  2EQN A;  2V35 A;  2WPH S;  2F4L A;  1UCY H;  2O8W A;  3MYW A;  3U9A H;  1S6H A;  2FX4 A;  5C0U A;  2J94 A;  2NU3 E;  4YLQ H;  3TK6 A;  4MPU A;  1V2T T;  3M61 U;  2OQU A;  4FUF A;  3KQE A;  4AOR A;  7GCH G;  4NWK A;  1VCQ A;  1O2I A;  1EZS C;  4X8T H;  2BTC E;  2Z9G A;  3RP2 A;  4IN2 A;  5HGG A;  2CXV A;  1QCP A;  4F4O C;  3EE7 A;  3LT3 A;  1KDQ A;  2FDA A;  5B6O A;  4YOG A;  1NES E;  4AC9 A;  1TBR H;  4AYY B;  1CSO E;  2BD4 A;  1WQV H;  3LGI A;  4SGA E;  3URC A;  5JBC S;  1AO5 A;  1GHB G;  2BXT H;  1CBW B;  3BEF B;  4BAO B;  3QTV H;  4PRO A;  2ZPS A;  3Q76 A;  2ZI2 H;  4AB9 A;  5ESB A;  3SNC A;  3BTT E;  3EST A;  1HXE H;  4JZE H;  5SGA E;  1C9T A;  3KL6 A;  3N99 A;  1NO9 H;  4RKJ B;  3E8L A;  1DS2 E;  4IC5 A;  2FIR H;  3HKJ B;  5EQS A;  2VH0 A;  1C1R A;  1C1T A;  1E37 B;  5DP4 A;  2AEI H;  5A0C A;  1O3L A;  1PPG E;  1FQ3 A;  3DT0 H;  1IQM A;  5LH8 A;  2FI3 E;  2R3Y A;  2GVF A;  1U6Q A;  2M5T A;  4ASU D;  2FOA A;  1W3C A;  3V3M A;  3WWF A;  2FX6 A;  1A61 H;  5LPF A;  3STJ A;  3V13 A;  4MVN A;  1IQJ A;  5IYT A;  3PMA B;  3RXE A;  1UVT H;  5HM2 A;  1YYY 1;  2FEQ H;  1P02 A;  3PM3 A;  1AD8 H;  2AIP A;  4I8J A;  3RXQ A;  5LPE A;  2C8X B;  2AHM E;  2OIN A;  1MBM A;  1NN6 A;  2PUQ H;  1V2N T;  2BD3 A;  3MU1 A;  3UWI A;  1GHA G;  3LOX A;  1V2P T;  3SOS A;  4ABA A;  4CR5 A;  2JET B;  1S83 A;  2XBV A;  1WU1 A;  1IQN A;  1WSS H;  4TWW A;  2JKH A;  1O37 A;  2PWX A;  4THN H;  4HI3 A;  1AMH A;  4DGJ A;  1TE0 A;  4U01 A;  1LKA A;  2PKA A;  1CA0 B;  5J4S A;  1GDN A;  1HCG A;  4YO9 A;  1DWC H;  1JIM A;  3SGQ E;  2QF5 A;  1E34 B;  3UOU A;  1C5Q A;  1ELB A;  1P09 A;  5EOD A;  3SW2 B;  9EST A;  3EA8 A;  4INL A;  4A92 A;  3MU8 A;  1NRP H;  1YPM H;  4ZCN A;  1TRY A;  2R3U A;  4UEH H;  1ZLR A;  2FLB H;  2SNV A;  2LEL A;  4FET A;  1BOQ A;  1CU1 A;  4Y10 E;  2BQW B;  1EAW A;  1HDT H;  3PRB A;  1QUR H;  2ZC9 H;  5C3N A;  5H4I B;  1GI2 A;  3FAN A;  4RT0 A;  3UWJ H;  1TPP A;  2K8I A;  1C1M A;  1LPG B;  2F3C E;  1GI6 A;  4KTU A;  3P6Z B;  3HK3 B;  3WWB A;  1GJD B;  3ZIA D;  1TNH A;  2QE7 D;  1C9P A;  1L0Z A;  1OHH D;  5A09 A;  4X1N U;  3RXU A;  3L6P A;  3UY9 A;  1TAB E;  6CHA C;  2LP6 A;  4BTU B;  1YPG H;  4LZ4 B;  1G2M A;  2ZDK A;  3SV2 H;  5DO4 H;  1EXF A;  2I6Q A;  2A7H A;  2A5A A;  1O3A A;  3LH1 A;  1JMO H;  2BD5 A;  2VWO A;  1YKT A;  3MFJ A;  5LPR A;  4ZKN U;  1AE5 A;  1ZMJ A;  4H6T A;  3VPK A;  3UQV A;  1A1R A;  3F9H A;  3BG4 B;  5HIY A;  2OUA A;  2QF0 A;  2QA9 E;  4XRN A;  3GCH C;  3OX7 U;  5L30 H;  2ZGC A;  2FXR A;  1KYN A;  3ENS B;  1Z1J A;  2AFQ B;  5T6G A;  3F2H A;  1AFQ C;  1A5H A;  4A5T S;  2GGV B;  1NRQ H;  3P8N A;  1ELA A;  3HGN A;  4K2Y A;  1G37 A;  1C2J A;  1P10 A;  3E90 B;  1GI1 A;  1C5T A;  1HUT H;  4ZKO U;  1UTN A;  3OE7 D;  4DG4 A;  3PV4 A;  2SGQ E;  3O8R A;  1PQ8 A;  2BDB A;  5PTP A;  2XC5 A;  2Z9K A;  3CS7 A;  4UDW H;  1GJ4 H;  1EST A;  2KAI B;  2OC7 A;  1UTL M;  2DE8 A;  2Z3E A;  3KHV A;  5FHT A;  2W6I D;  1ZHM A;  3EA7 A;  4Z6A H;  1A2C H;  4MNV A;  3PWC A;  3UIR A;  1AVX A;  1C5R A;  3UB0 A;  4B2B A;  5EJ1 A;  2Q6G A;  1AB9 B;  4X2Y A;  2BY6 X;  2C93 B;  3BF6 H;  3A7X A;  3BTH E;  3DSP A;  3ODD A;  4BAM B;  4KKD A;  4FU9 A;  2KR7 A;  2JET C;  2AYW A;  4RN6 A;  1GGD B;  3VEQ B;  1C5V A;  4Z1M D;  2JIZ D;  1EJA A;  1THR H;  4LOY H;  2BDC A;  2FTL E;  3RXJ A;  3LGY A;  2PKS B;  1P57 B;  1NFU A;  3UTU H;  3OU0 A;  4TWY A;  1BJV A;  5E0G A;  5DSF A;  2O8L A;  5GPI B;  1TX6 A;  2F91 A;  4WXI A;  2IN2 A;  4NSY A;  9LPR A;  2WIN I;  2G81 E;  1XXD A;  1TBZ H;  2F9N A;  1E36 B;  1ZGV A;  1BDA A;  1TOM H;  1TQ0 B;  1FY8 E;  1RTK A;  1ZPC A;  4K3J A;  1NM6 A;  1LHG H;  3OSY A; 
#chains in the Genus database with same CATH homology
 4F55 A;  1SKY E;  4NWL A;  3F2G A;  3OEH D;  2JJ1 D;  5EPY A;  2OBO A;  3H09 A;  3OTP A;  5EQS A;  3VG8 A;  2WV9 A;  4YXW D;  5T1V A;  4JMY A;  4K8B A;  3M5N A;  4WH6 A;  2F43 B;  2OK5 A;  3SYJ A;  1E1Q D;  1E79 D;  2GVF A;  3F0O A;  4I32 A;  1W0J D;  2A4R A;  4XD7 D;  4ASU D;  2OC1 A;  5FPY A;  1W3C A;  2QV1 A;  3KF2 A;  1A1R A;  5GND A;  3KNX A;  3OAA D;  3P8O A;  3SV8 A;  3WWF A;  3SV7 A;  3KEE A;  5FPT A;  1NBM D;  4RI0 A;  3SUD A;  4B71 A;  2XNI A;  2A4Q A;  2IJO B;  1MAB B;  5C17 A;  3F2H A;  1RGQ A;  2QF4 A;  4I33 A;  3O8B A;  2GGV B;  3KN2 A;  3P8N A;  4KTC A;  5FL7 D;  3SU6 A;  1BMF D;  3EYD A;  3WW7 A;  2AHM E;  3SV9 A;  3OEE D;  3SU3 A;  3SUE A;  4A1V A;  2OIN A;  4I31 A;  2J5U A;  3E90 B;  3SU2 A;  3OE7 D;  1DXP A;  1RTL A;  3O8R A;  3SU0 A;  1WXR A;  2WPD D;  3LOX A;  3AK5 A;  3DSO A;  2VBC A;  1EFR D;  2KZ4 A;  3O8C A;  4Q63 A;  4OM9 A;  2V7Q D;  3PV5 A;  4B6F A;  1KMH B;  4B6E A;  2OC7 A;  1NS3 A;  2JJ2 D;  2K0Q A;  5FPS A;  2W6I D;  2WHX A;  2W6J D;  5C0T A;  3DCL A;  2O8M A;  3F2F A;  1FX0 B;  5DN6 D;  2WSS D;  4A1T A;  4U01 A;  2YMS B;  5IK2 D;  2KCY A;  2XND D;  3FOA A;  4TSF D;  2F4L A;  3W1E A;  4R8T B;  5HKK D;  3FN8 A;  1S6L A;  3GS9 A;  3SU5 A;  1COW D;  4B74 A;  5EQQ A;  2QF5 A;  3UB0 A;  2XCN A;  4WH8 A;  1BT7 A;  5C0U A;  3SUG A;  2KM0 A;  3N7E A;  3OYP A;  3PRD A;  2FM2 A;  3SUF A;  1NBM E;  3SU4 A;  3U1J B;  3DSP A;  2HLD D;  4DT4 A;  3FO8 D;  2KFW A;  4TYD A;  4A92 A;  2WZQ A;  4ZCN A;  2KR7 A;  4TT3 D;  2OC0 A;  5CHB A;  3RC6 A;  3RC5 A;  3O8D A;  2LEL A;  4FET A;  5GJ4 B;  3SZE A;  4NWK A;  2K1Q A;  5ETX A;  4M9F A;  3LKW A;  1JXP A;  2L6O A;  2P59 A;  1CU1 A;  2CK3 D;  4Z1M D;  3SU1 A;  5B6L A;  1DY8 A;  2JIZ D;  2YMS D;  4Q4L A;  3M5M A;  3PRB A;  4B76 A;  2YMS C;  2KCA A;  5H4I B;  3F3B A;  2A4G A;  2M2A A;  2JDI D;  3U1I B;  3M5O A;  5DSF A;  5GPI B;  1E1R D;  2K8I A;  1H8H D;  1W0K D;  2F9U A;  2XOK D;  3F0P A;  2KCO A;  2FOM B;  1DXW A;  3FKS D;  3LON A;  2XCF A;  5CDF E;  3WWB A;  1H8E D;  4A1X A;  2OC8 A;  3ZIA D;  2FP7 B;  1DY9 A;  5IDK A;  2OBQ A;  2QE7 D;  2KCP A;  3RC4 A;  1OHH D;  2YOL A;  3SV6 A;  3N7D A;  3L6P A;  3PV2 A;  3NRL A;  2IJD 1;  5ESB A;  2F9V A;  4WF8 A;  5F53 A;  4B73 A;  3M5L A;  3OFN D;  3N99 A;  5EPN A;  5EQR A;  4B75 A;  1N1L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...