3WW7A

Crystal structure of the computationally designed pizza2 protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
82
structure length
82
Chain Sequence
NTQTVLPFTGLNTPNGVAVDSAGTVYVTDHGNNRVVKLAAGSNTQTVLPFTGLNTPNGVAVDSAGTVYVTDHGNNRVVKLAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pizza2 protein
publication title Computational design of a self-assembling symmetrical beta-propeller protein.
pubmed doi rcsb
molecule tags De novo protein
total genus 12
structure length 82
sequence length 82
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-06-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.500 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3ww7A00
5CHBA 3WW7A 5F53A 3WWBA 3WWFA 4ZCNA
chains in the Genus database with same CATH superfamily
1D3TB 4WMDA 3QDZB 5T6GA 3MO6A 1BA8B 1W0ZU 1GDQA 2ZZUH 4NFFA 2KZ4A 2NU2E 2F9NA 2XBXA 1QQ4A 4PROA 5HM9A 3GS9A 1SMFE 2GV6A 3P8NA 4JZEH 1DXPA 2QXHA 1BTHH 2L74A 5ABWA 1W7GH 3E6PH 1ARCA 3M7QA 4X2WA 5A2MH 1E79D 1GPZA 1YPMH 2IN2A 1TONA 4MDSA 5E0JA 4HFPB 3SUGA 4XE4A 4YM9A 1NC6A 1DOJA 1UTLM 3RLYH 2V7QD 2R2MB 4ZKNU 1CT0E 2FODA 2ZDMA 4Q2KA 1Z1JA 1G9IE 3KQ5A 3O8RA 4WMFA 3ATKA 1MQ5A 3A7TA 2BDGA 3LOXA 1XUKA 3OEHD 5K7RA 1AWFH 3U1JB 1FJSA 1Y8TA 1MCVA 4Y71A 1TA6A 4BAHB 3D23A 1GMHF 2CHAB 5EXMA 3D65E 4K5ZA 1H8HD 1QRXA 2OQUA 3BTGE 4OS1A 1G32B 2H5DA 3SJIA 5LPRA 1HAHH 1LVYA 2VIVA 2HGTH 2F91A 3UAIC 3RLWH 1MKWH 1H8IH 2PUXB 2ZCHP 2QXGA 1W3CA 4Y0ZE 5KGOA 1ZMJA 2GP9B 1N8OB 2CJIA 2IOTA 2A4GA 3P8FA 2AIQA 1C1WH 4WF8A 3SV7A 5E0GA 5ESTE 2EY4C 5EOKA 3SQHE 2OC1A 1F2SE 1MTVA 1P09A 3GCTF 1A5IA 1FIWA 1OP8A 1NFUA 3ZVGA 4YXWD 1A46H 4X1NU 1O2WA 5EQSA 3MQKC 3ZVCA 1ELBA 1O2SA 4FUDA 5JBCS 2XWAA 1F0RA 1O2VA 1TNJA 1QIXB 2GGVB 3BTDE 2ODYB 3LPRA 3SV8A 3BTTE 3F1SB 5EU8A 2ZKSA 3RXSA 1HNEE 5FAHA 1UK3A 2ZP0H 3E8LA 5BRRE 4FU9A 1BUIA 1SLXB 1BDAA 1FXYA 3NCLA 4AB8A 4INKA 2ZTYA 1LVBA 2SGDE 2BDIA 1C1VH 4AORA 1BMMH 1FONA 3HATH 2W26A 1SOZA 1D3QB 5HIZA 1C1QA 3UB0A 2YMSD 1C2JA 5C20A 5HKKD 5F8XA 2FXRA 1DPOA 3ENSB 4TPIZ 1DE7H 2Y82A 2WYJA 2R3UA 1THPB 2TPIZ 2ZDVH 2O8UA 1HDTH 2BTCE 3RXHA 3ELAH 3UFAA 1BTZA 3FKSD 2HVXA 1V2UT 1GHXH 3TLOA 3Q00A 1MTWA 2OCVB 2P8OC 4NGAH 1V2ST 3ZZBA 5HM2A 1O3PB 1ZGIA 1E1RD 5DP7A 1UK2A 3GYMA 1DT2A 2BY7X 2UWLA 2VGCB 3M61U 2VIQA 1KXEA 1W8BH 4XD7D 1FAKH 1N6XA 2BY9X 3PLKA 1QB9A 1CA0B 2JKHA 2OP9A 3DFJA 2SGAA 3AW0A 5LH8A 3SV9A 1A0HB 4ZHLU 1WCZA 1J8AA 1ID5H 1GBIA 1NRNH 4CRAA 1Z8GA 2LP6A 1DWEH 1SGNE 3U69H 5DJ7A 3BEIB 5A8ZA 2A5KA 3MU4A 4O3TA 3PRDA 1VITG 2FESH 2Y6TA 3BIUH 3M5NA 1XKAC 3A8AA 1BBRH 1MD8A 3F9FA 4CHAB 2OXSA 4Y0YE 1YWUA 4AX9H 2Z9JA 3S7KB 1MTSA 3ZZAA 4CH8B 3SYJA 1HIAB 2VNTA 3A83A 2F9VA 1TB6H 1FNIA 1NRQH 1BZXE 1DWBH 4XBBA 3RC6A 4YO9A 4O9VA 2FLBH 1SPJA 1JIMA 2WHXA 3F9GA 3MTYA 4ZXXH 3KIDU 3KL6A 1CVWH 2V3HH 2IJD1 1B5GH 4K8BA 2AEIH 4ISLA 2ZFFH 1GI5A 8GCHG 1C4V2 2P94A 2J34A 1V2OT 2NWNA 5A0BA 2PWXA 1HV7A 4A1VA 4Y79A 5HGGA 1O3HA 1D3PB 2CMYA 3DSOA 2GV7A 1AZ8A 4I8JA 3S9AA 1AD8H 1DSUA 2H1UA 2ZPQA 5H4IB 3TH2H 4XFQA 1EQ9A 1E37B 5ETXA 5L30H 3HGPA 1VGCC 1AO5A 3K65B 1AZZA 3D49H 1FN8A 4NA9H 1QA0A 4GPGA 2XWBI 1FI8A 1O2LA 2A7JA 1YCPK 2RG3A 3OAAD 3QWCH 2ZDKA 1SGPE 2D1JA 1C5WB 1JXPA 1T4VH 2UWPA 3MNSA 4NIWA 1FV9A 3RXUA 3VXFH 2JH6D 2VVUA 5GIBA 1EZQA 8LPRA 2GDDA 2SGEE 4RT0A 1OXGA 2F9UA 1C2MA 2VU8E 2Y5GA 3MU5A 1EX3A 2HNTC 3RXTA 1HFDA 1EAXA 1V3XA 3B23B 3QK1A 2FIRH 2H5CA 3T5FH 4MNXA 2VINA 3P6ZB 2PGBB 4Z6AH 1WAYB 3SI4H 1BBRE 1F0TA 1ANBA 2D8WA 3DT0H 3TH3H 1SBWA 1K28D 1S6HA 2WV4A 4I8HA 2WPKS 1TGSZ 3IG6B 3MH6A 4XBCA 2CGAA 2V0BA 5PTPA 1G3DA 1NM6A 2OK5A 4HGCA 2YNAA 3E0PB 1H4WA 1B0EA 2HLDD 2PTNA 3AAUA 2ZPSA 4TYDA 1ESAA 1X7AC 2Z7FE 7GCHF 2BD2A 4HTCH 2ZFRH 2BD7A 3SHAH 5AFYH 3DA9B 1HAZB 3SU1A 2AFQB 3LT3A 1P8VC 4FUGA 3T26A 2O8LA 1COWD 1SLWB 5A09A 3PMBB 1IQFA 3UWJH 4JYTA 1QNJA 3VB4A 1CT4E 1NRPH 3RXOA 1O5GH 1IQMA 3GCHC 3W94A 3QLPH 2Z94A 1RJXB 3AVZA 3PWCA 1P05A 1GI0A 2OC0A 3SNAA 2PSYA 2PV9B 2PR3A 1W0YH 2VJ1A 1K1IA 3OSYA 6CHAC 1NFWA 2WPMS 4D9RA 4FUFA 1GBLA 1H9IE 3SJ8A 1O3AA 1HLTH 3VG8A 5DK1A 4P02A 3QN7A 4Y8ZA 3V3MA 2Y7ZA 1CE5A 2ASUB 4AYYB 2K0QA 1DWCH 2O8WA 2BD3A 1E36B 1S6LA 1TQ7B 2BDAA 3ZZCA 1E34B 2KAIB 2ZECA 4M9FA 2XOKD 3QGNB 3Q3KA 2ZHQH 2KFWA 4IS5A 3BG4C 3GCOA 3GY6A 1TX7A 3WWBA 4ZAEA 3ZZ6A 1CU1A 4H42U 4X1RU 3ZIAD 1W11U 4Y76A 2EI7A 2OQ5A 1P2NA 1Z7KA 1O2OA 1QBOA 4NSYA 1C4Y2 5A0AE 2ZU1A 3ZVAA 1JRSA 5GNDA 1TBQH 1G2LA 1ELDE 3SORA 5F03A 5L2YH 3MH4A 3BN9A 3WW7A 3EA8A 1Y3XA 1O37A 1GHBF 1EB2A 3K2UA 1RS0A 4OGYA 1K1JA 2WINI 3F0OA 1Q31A 4CRBA 1SC8U 5K0HA 1A0LA 1INCA 1KDQA 2G5VA 2I6QA 4Z1MD 1V2TT 3L6PA 2BQWB 1LQEA 2GCHF 1HAVA 1H1BA 1P57B 1GMHG 2UUYA 1GI1A 3N99A 1P2MA 3F9EA 4JZDH 2A31A 2O8TA 3MU1A 3KF2A 3RP2A 3PM3A 1GVKB 5KECA 3GY4A 1GCTB 4X8VH 2ZIQH 3DSPA 1TLDA 4OS4A 2BZ6H 1V2QT 2DE9A 3KQBA 1YPLH 3BTFE 1Z6EA 4UD9H 5GJ4B 3RXFA 3EE7A 1K1PA 3LGVA 5DP4A 2XRCA 2JJ1D 1BRUP 1K0HA 2GTBA 1MTNC 4JK6A 4DCDA 1T8NA 1T8LA 1A5HA 4TY7A 1OYQA 1ZYOA 5C1YA 3TU7H 1EASA 1O35A 3SJOA 3BTKE 5JB9S 1IQEA 4O97A 4ABAA 2C90B 3TGJE 2QY0B 3JZ2B 4IC6A 1GHWH 1NBMD 3VGCC 4K1EA 3A7XA 4NIVA 2GCTC 3OFND 1YCPM 1PPGE 2BD9A 4U2WA 4ZUHA 1WOFA 2V3OH 1FUJA 2ZFSA 1YLNA 4H4FA 1SGTA 2VIPA 1PPCE 1A7SA 3KEEA 1A3BH 1LKAA 2KCYA 2WPDD 2XC4A 3KYFA 2NU0E 2P3UB 5DP8A 1P9SA 3GOVB 3NPSA 5GDSH 1YPKH 2FOBA 1K1LA 1OWJA 2YMSC 2ALPA 3SNBA 3TGKE 1C1OA 4NCYA 2A7HA 3I77A 1N1LA 1AB9B 1ELCA 1ETRH 2ODQA 1SHYA 4AFUA 1O2MA 1ZMLA 1LHDH 1MKXH 1PQ8A 3ZYEA 1P3CA 2FOMB 5EG4A 3DCLA 4MLFB 2ZTZA 3SU3A 3U98H 4D76A 4B6EA 1LKBA 3T2NA 4FXGH 2HRVA 2R9PA 1BJUA 1GHZA 1H8DH 1IQKA 4A1TA 4X1PU 5IYTA 1LPGB 2A4QA 3MFJA 1WSSH 1O2HA 2ANMH 3F9HA 1SGCA 1YPHC 3GY7A 1PQ7A 1T8MA 3RXRA 1SFQB 3E90B 4KTCA 1HJ8A 4BAOB 2Z3DA 1KTTB 1OWIA 1ZRBA 2XC5A 3OX7U 1F0UA 1Y5AT 2C93B 5A8XA 5C94A 2FX4A 1XXDA 2AYWA 1ZZZA 3ATIA 2HPPH 5JPMH 3TIUA 1F7ZA 1AUJA 1A5GH 1XKBC 2XNIA 3U1IB 1BRCE 3RXMA 2SGPE 1G2MA 4ISIH 4NZQA 1ZPBA 3PO1B 1FY1A 4NWLA 3UOPA 2ZDLA 1KLIH 1QB6A 1EOJA 3CS0A 3P8GA 1YKTA 1C5MD 1GWAA 2ANYA 2ZCLP 1GDNA 1V2NT 1P04A 2BLOA 1C1UH 4ABDA 1UMAH 2G4TA 2WV9A 5CHAC 1GBFA 4KTSA 1C5OH 1XXFA 3M35A 1HXFH 2J5UA 2TGTA 4I31A 1PQ5A 3BEUA 5HYOA 2ZQ1A 3SJKA 1CT2E 3TK5A 4X2VA 2XNDD 1BOQA 1H9HE 5EQQA 5EXNA 3LGIA 1VZQH 2CK3D 3LGWA 1TNGA 4E05H 1BRBE 1CHOG 1QZ8A 2O9QA 3ESTA 1QL8A 1IQHA 1E38B 1P06A 1BIOA 1FY8E 1P2JA 1UVTH 1ZR0A 3DSGA 3TNSA 3B8JA 3ITIA 1T31A 4U30A 4JYUH 4X1SU 3CENA 1LO6A 4DG4A 1WYKA 1TPPA 2R0KA 2BOKA 3VFEA 4ACBA 4ZCNA 2ZTXA 2BDHA 3QTOH 1HXEH 5C1UA 1VJAU 1GBKA 1XUGA 1O3NA 4GCHF 1GG6B 3M7UA 2ULLA 2ZU4A 1CO7E 1SQAA 5CDFE 1SG8B 4AZ2B 3LH3A 1AVWA 1UTMA 4NIXA 4ABBA 5IK2D 1RIWB 4B73A 1AFQC 1ZMNA 3GY2A 1DXWA 3LC3A 1MZDA 1O5EH 1O31A 4ABFA 2VBCA 4X8UH 1WU1A 1Y5UT 3VB6A 1OS8A 3O8BA 3PV4A 2WV5A 4TY6A 2EI8A 2VH6A 1GBDA 3TK6A 2ILNA 2O8MA 3EGKH 4Q80A 1OHHD 2TGAA 1NRRH 2WPHS 1P9UA 1LHCH 1GGDC 2SGFE 4ABIA 1UVOA 5F53A 3RXVA 1GHYH 4IMQA 4ACAA 1CBWB 1GMDG 2CN0H 1YF4A 1AI8H 1DUEA 1K22H 2BOHB 1G37A 1TE0A 2AHME 2JH0D 2NU1E 1AE8H 1H9LB 2AERH 2RDEA 1QURH 1AU8A 1K2I1 5EJLA 5LPEA 3P95A 7GCHG 2F4LA 5CHBA 2JETC 3RC4A 1ABJH 3N7DA 2ZHWH 1G30B 5FCKA 1D3DB 2FS8A 1HUTH 1S0RA 3SNEA 2RDLA 5GCHG 1ELAA 3FP6E 3DHKH 4F4OC 3RU4T 3BTME 1PQAA 3TJNA 5C5NA 1BTWA 3NWUA 1GJAB 2ZEBA 2EI6A 1L1GA 3ATMA 1GJ4H 3KGPA 5E0HA 1GMCG 4I86A 1YLCA 2HNTF 2ZGCA 4WH6A 4LZ4B 2TRMA 1RFNA 1E1QD 1T8OA 1O3DA 1NFXA 1BTXA 4VGCC 2BD8A 1AGJA 4NSVA 2C8ZB 1W13U 1BITA 4GLYA 4B1TA 1A0JA 1PYTD 2CXVA 1FX0B 1FAXA 1C5NH 3HKJB 3A86A 3OEED 5LGOA 3SZEA 1ORFA 2BD4A 1O2KA 2J97A 2F83A 1J17T 2QXJA 3G01A 1KLJH 3BG8A 3D62A 1UTOA 1EB1H 1IQLA 1EZSC 1GI7B 1JOUB 1XM1A 3STIA 1ANCA 1S83A 1ELFA 1KY9A 3GY8A 5GWZA 2QGRA 1TPAE 1IQNA 1ELTA 4B2BA 4KELA 4OS5A 2BD5A 4KP0A 3MO3A 1SVPA 2C3SA 3MU8A 2P93A 2ZPRA 3SUDA 2A45B 4Y11E 1OP0A 1GBCA 1KXCA 2WZQA 3UOUA 4YOGA 1NS3A 4GHQA 3P70B 3F2GA 2QF0A 2KX4A 3AW1A 3GY3A 3OTJE 1P0SH 4DIHH 3RXIA 4K60A 1SGYE 1DM4B 2P16A 4MNYA 1G3CA 1GHBG 3SU2A 1TBZH 1GVLA 1M9UA 3ZVDA 2XCNA 1Y59T 3PB1E 2R0LA 3SU0A 1NY22 1AFQB 1SGQE 4XSKU 2Q1JA 1YPHE 3RXJA 1ELEE 2FOCA 2H9TH 1LMWB 3V12A 1GI6A 6GCHF 1HAGE 1FY4A 4OS6A 2ZDAH 3OYPA 4H6TA 3A81A 3OTPA 4CR5A 4YTAA 2IPHA 1UTJA 3RXAA 2JIZD 1KXAA 1V2LT 5F8TA 1J15A 1GGDB 4BTIB 1N6YA 1VITH 1CGHA 2ZGHA 1ZJKA 3ZVEA 3OE7D 3GYLB 2XCFA 3QZRA 2RA0A 3E1XB 2ZHFH 1WTGH 2FLRH 4ZROA 3U9AH 2VIWA 3UREA 3GICB 1L0ZA 3UUZA 3QZQA 3F6UH 1A3EH 1BT7A 3UR6A 5E2OA 4ISNA 1GHAF 2STAE 1TALA 3MYWA 2TGDA 4BNRA 1O3CA 3K9XB 4M7GA 3B9FH 5B6OA 1QJ6B 2KR7A 5EODA 3MO9A 2BDBA 5DG6A 2F9BH 1EOLA 2OC8A 3RMOH 2ZO3H 1O2XA 1L4DA 1DLKB 3UTUH 2UUFB 1Z8IB 1TX6A 5T6DA 1TNHA 2AGIX 3ZZ9A 1OX1A 1C5TA 1T32A 2PW8H 3A84A 4R8TB 2BQ7B 4BANB 4X2YA 1Y3VA 2WPLS 2J92A 2XXLA 1GL1A 3S9CA 1MAYA 2F9PA 1O2IA 1THRH 2HVYB 5HMAA 2PFEA 4THNH 3U8TH 1EP5A 3SJ9A 5GXPA 4Q4LA 2FOGA 1L2EA 4X6MA 3QGJA 1P01A 1UO6A 2WPIS 3TJOA 4K2YA 3JZ1B 3Q3YA 4DOQA 3BIVH 1P03A 2ZF0H 1UTPA 3MH7A 3O8CA 3A80A 5TJXA 3OY6U 4Y7AA 4AB9A 2FI4E 4ZHAA 3SNCA 5E2PA 2FM2A 3A85A 3SZNA 5DP5A 1O30A 1YCPH 3A7ZA 1UHBA 1Z6JH 1GJ6A 1ZGVA 2GZ9A 3ZV8A 3A8BA 5FL7D 5AFZH 1C4U2 2K8IA 3KQEA 3STJA 3E16B 1NESE 3T27A 3K6YA 2M5TA 2OD3B 1WDIA 2BLVA 1O3OA 2NU4E 4X6PA 1KDQB 1DITH 1K9OE 1SGFA 2QN5T 2PKSC 2GMTC 4X2XA 2A4OA 2H2ZA 2Z6BD 4Y6DA 1HAVB 2P8OB 3A7VA 1KXBA 4CRFA 1OOKB 1FLEE 4K69A 4MPWA 5HIYA 4B74A 1C1TA 1SFIA 1WTHD 3UIRA 5GPIB 1CGIE 3GDVA 4TWWA 1GVZA 1HAXB 1XUIA 1SGDE 1D6WA 3GDUA 3NKKA 2WYGA 3EDXB 1RTKA 1SGIB 1FMGA 1S0QA 1BTUA 2A7CA 1IQJA 2Q6FA 3M5OA 2C8XB 1DY9A 5C2ZA 1C9TA 4FUIA 1OWHA 4ABGA 1AWHB 1HAOH 1MU6B 2A5AA 2UWOA 3TGIE 4ESTE 2AGGX 2BVSH 2STBE 1GBBA 3LDXH 3F0PA 1O2TA 3VEQB 3EYDA 3SN8A 4FUEA 3H09A 2WSSD 3LH1A 1AKSA 1ZHMA 1VCQA 4ABHA 4O03A 2P3FH 4FU7A 4ZMAH 1ZRKA 3LGUA 1TBRH 1GBEA 1NU9A 1UCYK 2KCPA 1F0SA 3TNTA 3L33A 2RA3A 1HJ9A 1DX5M 2BMGB 1O2QA 1O2PA 1OWEA 5AHGH 1D6RA 1SSXA 2QF4A 3FVFB 3ZVBA 2HPQH 4OS7A 1GI9B 2G81E 4KTUA 4D7FA 1EKBB 5AVDA 1QRWA 5DGJA 4YESB 2FI5E 4U32A 1OSSA 4GHTA 3PRBA 1GJ9B 3RC5A 3F3BA 4BXWA 7ESTE 1S85A 2GT8A 4RKOB 1G3BA 4KKDA 3M3VA 1DS2E 4MNVA 3DD2H 4IN2A 4AC9A 2C8YB 1VGCB 2V6NA 1W12U 1W0JD 4A6LA 1Q2WA 1BRAA 4FUBA 4H6SB 1QA7A 4LOYH 4YLUA 1L1JA 1NN6A 1S82A 4NZLA 1W0KD 1P3EA 1SR5C 4D8NA 1ESBA 1BQYA 3AASA 4WJG2 1HJAC 1LHGH 4Y7BA 1BMNH 4JZ1A 2W7UA 3A7WA 4AFQA 1V2PT 2BQ6B 2F43B 1NT1A 2R3YA 3TVJB 1S81A 1WUNH 1IQGA 1XUFA 2FMJA 3DFLA 1GJ7B 4SGBE 4DIIH 5FX6A 2ZGJA 1C5SA 1SQRA 4I7YH 5DPAA 1C5LH 3MU0A 4WMEA 1UTKA 2G52A 4WWYA 5EIYA 1F5LA 1ESTA 6ESTA 1EPTC 5EJZA 4ZXYH 2B7DH 1BJVA 2QCYA 3ZVFA 4U01A 1C1MA 4IN1A 1LVOA 1DVAH 1L4ZA 1C2LA 2KCAA 2TIOA 2WPJS 1EAWA 4X8TH 1O3FA 1C9PA 4Z0KA 4B2CA 1KMHB 2BVXH 3U28C 1NPMA 3GCTG 3A8CA 2HALA 2HOBA 4YOIA 1FQ3A 2BY5X 3T25A 1J16A 3A87A 1JIRA 1PPHE 1SI5H 2D26C 4CH2B 2YOLA 2VIOA 2GT7A 3NRLA 1WQVH 1QJ7B 4DT7B 2EC9H 1OP2A 4UE7H 4ZHMU 4AGKA 3PLBA 2BLQA 3RXPA 1NBME 2VB0A 3IWMA 2D2DA 1PYTC 4ABEA 2ALVA 3GCHB 1E0FD 4MPUA 4DURA 1Y5BT 2FO9A 4UFFH 1S5SA 4WVPE 2J2UA 4UONA 3N7OA 4CREA 4MTBA 6CHAB 2ZU2A 4I8GA 1K1MA 2Y80A 3MHWU 9LPRA 1RD3B 2RCEA 1Z8RA 1F5RA 4X6NA 1IQIA 4YZUA 1AN1E 2XBYA 1CSOE 4X0WU 3MH5A 1MKXK 1SGEE 1QBVH 2GX4A 1AVGH 1QB1A 2BXTH 4BAMB 1C5RA 2OBOA 3TK9A 5IDKA 1P02A 2R2WU 4Y10E 3URDA 3BG4B 2ZFPH 3RXLA 1UVPA 2J94A 1YGCH 1O0DH 1YBWA 1NZQH 3SBKA 3PV5A 4NA8A 4X6OA 1C1SA 1PPZA 3PWBA 1YPGH 1WV7H 1DFPA 1S84A 2ZI2H 1GBJA 5DP3A 5C67A 2BZAA 6LPRA 4BOHA 1TAWA 2OC7A 3C27B 2QXIA 4UEHH 1UTQA 1QL7A 2FOFA 2CHAC 1GBAA 4K8YA 1HPGA 2J98A 1VKYA 3RXGA 3RXKA 1O5FH 3RM0H 1DUAA 3SQEE 5T1VA 3ATLA 1EAUA 3UNSA 3SU6A 2C4FH 2OBQA 1O33A 2DE8A 3SUEA 1J9CH 4BAQB 3FP7E 3SU4A 1C1PA 1TNKA 1N8OC 3NXPA 4ZH8A 1DY8A 3ZV9A 3M37A 1O2NA 4JZFH 3MNXA 2AS9A 4FUHA 1QTFA 1EUFA 4TPYA 3U8RH 2BHGA 3FZDA 4ASHA 2L6OA 1BMAA 1ETTH 4UFDH 2QF5A 1YLDA 2W6ID 4UDWH 4GUXA 2FEQH 2J9NA 3GCNA 1O5CB 1TABE 3C1KA 1C5QA 3UY9A 1LCYA 4WH8A 4YOJA 1XUJA 1YPEH 1O5AB 2FI3E 1MTUA 4BTTB 1TX8A 1MBMA 3MMGA 4OM9A 3URCA 1MTNB 1Y3UA 5C3NA 3SOSA 2WUBA 3F68H 2GZ8A 1O3IA 1TGTA 1FIZA 2OTVA 2ZDNA 5JDUB 1O34A 3KYGA 4JYVH 2OINA 4XBDA 4J1YA 1HYLA 3FOAA 4TSFD 2AMPA 2VWNA 2PKAA 3H7TA 4CBNA 3VB5A 3SGBE 5FCRA 2LPRA 2A32A 2BDYA 1ANEA 2P95A 3NK8A 5A8YA 3VGCB 1W10U 1YY3A 5I46H 1SL3A 1TRMA 2GCTB 2Z9LA 4WY3A 3H7OA 3UQVA 1SB1H 3LU9B 2F3CE 4AG1A 3PMAB 1IHSH 5FBEA 5DP6A 1JRTA 2XBVA 3SGAE 1NFYA 1DSTA 2W3IA 4D9QA 1RTLA 3BTWE 4BTUB 3QX5H 2YMSB 5I25A 5KEDA 2W6JD 4FVDA 1O2JA 1QCPA 1QQUA 1EZUC 2P59A 3UR9A 1IAUA 1B7XB 1O36A 1FDPA 1YPJH 4I8LA 3TH4H 1O5DH 2AMDA 4BXSA 2A5IA 1NO9H 3FN8A 2FX6A 1LVMA 2VGCC 4AYVB 3A89A 2CV3A 1VCWA 3CP7A 1W7XH 3S7HB 4Q63A 5AF9H 3ZZ5A 2HWLB 2H9EH 2BXUH 4DW2U 1CA0C 1GCDA 4A92A 1GJ5H 3BV9B 3UNQA 4NFEA 1AFEH 3P17H 1Y3YA 4QT8C 1DICA 1V2JT 3VB7A 5HXFA 2ZG0H 3EA7A 1GHVH 1MKWK 2G4UA 1TIOA 1TMUH 1CA8B 5CE1A 5JBAS 2P3TB 2GZ7A 1C1RA 3M36A 1RXPA 2FOAA 3A7YA 5A0CA 4CHAC 3TPIZ 1HGTH 5FPTA 2V3MA 2Z9IA 1V2VT 1KLTA 2VWLA 4K1SA 3OY5U 1C2KA 1EPTA 3Q3XA 1AE5A 2ZNKH 4DVAU 4Q7ZA 1F92A 2H9HA 2G8TA 4ZKSU 4FOUC 2ZFQH 3M3TA 4A1XA 3Q77A 1O2UA 3BSQA 2PTCE 1V2MT 1GI8B 2FWWA 5DO4H 4E7RG 2W5EA 1W14U 3RM2H 2OLGA 1C5PA 3WWFA 4F48B 1ZTLA 4RSPA 4WXVA 4B71A 4YT7H 3BTHE 1C2GA 2FOHA 5LPFA 2Q6GA 1A2CH 1ZJDA 3MOCA 1EJMA 3MNCA 5CHAB 4Y8XA 1DWDH 4F49A 1FY3A 3ODDA 4IGDA 3BEFB 1TMBH 1KXFA 2UUJB 1AY6H 1TA2A 4A7IB 2BY6X 4B2AA 4B76A 4CRDA 2CF9H 4CRGA 3U8OH 1JMOH 1TFXA 3Q76A 3T29A 5JBBS 5J4SA 3FFGA 3M3SA 2B0FA 5C0TA 3R3GB 4LZ1H 2A4RA 2C8WB 1BTPA 3M7TA 2XYAA 1LHEH 4MG3A 2FTMA 1LDTT 2V35A 1UJ1A 3PROA 1FZZA 2BDCA 1IHTH 7LPRA 1NU7B 4KGAA 4FETA 1BHXF 4ISHH 1TGCA 4HG6A 1UHBB 1UK4A 1EJNA 2DUCA 1ACBE 4MVNA 2VIDA 2FZZA 3CS7A 4NG9H 1ZSLA 4CR9A 5FPSA 3BF6H 1UVUH 2BYAX 5TCCA 1RTFB 2M2AA 3LKWA 4OGXA 1GI4A 4E7NA 2GCHG 3PTBA 1TQ0B 4HI3A 1SGRE 1TNIA 2GVFA 2ZHDA 1GBMA 1ELVA 1C2FA 1CQQA 3RDZA 3SI3H 3KQCA 4Q7YA 1IOEA 1MCTA 3E3TA 5FX5A 2SNWA 1WBGB 3EQ0H 1BBRK 5DP9A 3RXBA 1XX9A 2VVCA 2G51A 1Z71A 2BLWA 2ESTE 2FS9A 3ODFA 5B6LA 4GSOA 2B8OH 2JJ2D 1C2IA 1FPHH 5T6FA 1Z1IA 1JBUH 2A1DB 3RMMH 1ANDA 2JETB 1BMFD 2PSXA 1O5BB 1TPOA 3QO6A 4B6FA 3SGQE 3NZIA 2NU3E 3WY8A 1XMNB 1SGFG 4XOJA 2KM0A 4E06H 4OS2A 1O3BA 5EJ1A 2TBSA 2QF3A 2I6SA 3AAVA 3EA9A 1AKSB 2Y81A 3V13A 3ZZ8A 3FO8D 2EA3A 1C5VA 1EATA 3A82A 4JCNA 3LONA 4IBLH 1GBTA 3RMNH 1HBTH 1D4PB 2BM2A 1GJ8B 3I78A 4VGCB 3ZZ7A 3KN2A 4JZIA 5SGAE 1EAIA 1UVSH 4P00A 1XVOA 3W1EA 3F2HA 1U6QA 5EQRA 1AMHA 3RXDA 3I29A 1CHOF 1LPKB 1PFXC 5EW1H 4K3JA 1P12E 2FDAA 3SU5A 5E8EH 1P2QA 4B75A 2Y5HA 1THSH 3ZZ3A 1O2RA 1P2OA 3UNRA 4RI0A 4O3UA 2YNBA 1MUEB 1MZAA 3MWIU 1V2KT 4AG2A 9ESTA 1C2EA 2THFB 1TOMH 1K1OA 4X1QU 2GDEH 4FVBA 3PTNA 1QFKH 1HRTH 4DGJA 2G00A 1TGBA 2FYQA 1ZPZA 1TMTH 2CF8H 3KCGH 2QC2A 7KMEH 1MBQA 1P11E 3S69A 1BTYA 3PMHB 3QUMP 1G36A 4TWYA 3V7TA 4I33A 4YLQH 2B9LA 5L2ZH 2ZHEH 3PV2A 1T7CA 1BMLA 1A1RA 2BVRH 1GCTC 2AH4X 2BX4A 2B5TB 2W7SA 2Z3EA 5EPNA 1OYTH 4TT3D 4LXBH 2Z3CA 4FU8A 5EXLA 1AIXH 3R0FA 1GMDF 1HAYB 4ABJA 1RRKA 2PP6A 1TWXB 3HKIB 1MQ6A 1D9IA 1QR3E 5F6MA 3QTVH 1O3EA 3SUFA 1ETSH 1GJBB 1ZTJA 1NRSH 2RFKC 4Y8YA 2J4IA 2J95A 4R0IA 2WUCA 1JWTA 1YM0A 2ZU3A 3AK5A 2XBWA 5F8ZA 1VR1H 3W95A 1C2HA 1C5YB 3RXEA 2UUKB 4RKJB 3RMLH 4XRNA 3SO3A 1HIAA 5GCHF 4DY7B 1C1NA 2QA9E 3RUOA 2ZFTA 4FUCA 1O3MA 1K1NA 2QIQA 2ZCKP 4J2YB 4CBOA 1LHFH 2JH5D 1MMJN 4A5TS 3MNBA 3T28A 3SHCH 1GMCF 1YYY1 2Y5FA 4AGJA 1AHTH 1KIGH 5FHTA 3ATWA 2PGQB 4GAWA 1OKXA 2PLXA 2Z9KA 3NUMA 5JYIA 2XC0A 4AOQA 2VVVA 5FBIA 1ZTKA 1TPSA 1GL0E 2K1QA 1AB9C 1GJDB 2ANWA 3FAOA 5EGMA 3HPTB 3LGTA 1GBHA 2LELA 1F5KU 1UCYH 4GCHG 1O3KA 4INLA 1TRYA 3GY5A 4AFSA 1O32A 8KME2 4AN7A 4FUJA 4NWKA 5DKMA 4HZHA 1AUTC 4GVUA 1AVXA 2Q6DA 1PPBH 1KTSB 3HK6B 5J4QA 1ZHPA 1AQ7A 1TOCB 2J38A 1EFRD 3GISB 3N7EA 1DANH 1LTOA 3P8OA 1S6FA 3RXCA 1O2YA 1XUHA 1PJPA 2FYRA 2GD4B 2SGQE 2XW9A 2VWOA 4MPVA 3SW2B 1QJ1B 3K6ZA 3GDSA 3LGYA 3FZZA 1KSNA 5JB8S 1TNLA 2VH0A 2J98B 1NTPA 1O3JA 1SLVB 4RT1A 2PUQH 5CMXH 4K1TA 4SGAE 5FPYA 1FPCH 5DN6D 2OUAA 5EW2H 3F2FA 3BTEE 1DDJA 1ZPCA 4IC5A 1TRNA 3P92A 3VXEH 1TYNA 3IITA 1E35B 4F55A 2PKSB 2GMTB 2VWMA 3PO1C 5C5OA 5L6NH 1QBNA 3TJUA 2XTTB 4UFGH 2ODPA 1L1NA 3RU4D 1V2WT 1H8ED 1PPEE 4LK4A 1A4WH 1MAXA 3HGNA 1C2DA 3RU4E 2LNCA 1CHGA 3TJVA 1YC0A 1ZLRA 1VITF 1UW7A 2G55A 3OU0A 1QGFA 4ZKOU 5C1XA 4MNWA 1UCYE 2AMQA 1O39A 3SV6A 1GI2A 4JMYA 1HAIH 8ESTE 2FTLE 1P2IA 2QYIA 2BY8X 1VCPA 2FPZA 1WXRA 3KQDA 2EQNA 3UPEA 3M5LA 1QY6A 2IJOB 2ZGXH 4MQAA 4RN6A 3EE0B 3T62A 2QV1A 5DSFA 3PLPA 1XVMA 1BHXB 3SNDA 2Y7XA 2IPQX 3A88A 3V0XA 1GI3A 2A2XH 1C5UA 4DJZB 2GKVE 3FANA 3FP8E 1NROH 1EJAA 4BAKB 1EXFA 2PKAB 1C5ZB 1B0FA 8GCHF 1A61H 2ZGBH 2GJGA 2W3KA 1ZHRA 1LPZB 2PHBA 3L3TA 5C17A 1EP6A 4NIYA 1GG6C 1K21H 2ZQ2A 1KXDA 2QAAA 3KHVA 2A0QB 2KAIA 1SHHB 3LC5A 1OWDA 3TITA 1UTNA 1BB0B 1MU8B 1RIWC 1EZXC 1SKYE 2G5NA 3VPKA 1HCGA 2A2QH 5TCAA 1FY5A 3M5MA 1QL9A 1ARBA 3PYHA 3A8DA 2KCOA 1J14A 1DLEA 3LJJA 4MPXA 1VJ9U 3O8DA 3LIWA 2H6MA 1T4UH 2Z9GA 1QRZA 1FN6A 1O2ZA 2BB4A 4UFEH 2BX3A 3PMJA 3CNRA 2FP7B 1OPHB 2HLCA 2AIPA 1ZOMA 4INHA 1MABB 1G3EA 4I32A 1ZSJA 1CBWC 1RGQA 3UWIA 6GCHG 2ZWLH 1TGNA 2TGPZ 1HJAB 1ABIH 1MH0A 1SQOA 1W2KH 3H5CB 2HNTE 1C5XB 5C0UA 2F9OA 1O2GH 4X8SH 5EPYA 2SNVA 4ZKRU 1ELGA 3VB3A 3UQOA 2ZU5A 4Q7XA 1V6DA 1YP9A 1PPFE 4YT6H 3HK3B 1P10A 1ZSKA 3BTQE 1SLUB 3ZZDA 1CGJE 1LQDB 4JK5A 1GJCB 4ASUD 2AGEX 3E91A 1Y3WA 5JBTA 1EPTB 1O3LA 4WXIA 2FOEA 4CRCA 3E0NB 1GHAG 1O3GA 1HB0B 2EEKA 4DT4A 4IW4E 4ISOA 1SQTA 2ZC9H 1Z8JB 3DUXH 2ZA5A 3RXQA 4D7GA 4IMZA 2SFAA 2JDID 4AFZA 1QHRB 1SOTA 4NA7A 3S0NA 5FXLA 2ANKH 4I8KA 1HAPH 1MD7A 5BPEA 1P2KA 1OWKA 2QE7D 3MI4A 3SV2H 5G4BA 1WQSA 1O38A 1V2RT 1GDUA 3S9BA 3KNXA 3LJOA 5ESBA 3EAJA 5T3HA 4XDEA 1BCUH 1KYNA 3ZYDA 3ZZ4A 1Q3XA
chains in the Genus database with same CATH topology
2IJD1 4FETA 4NWLA 2JIZD 4K8BA 4B74A 4Q63A 2OC7A 4NWKA 5GPIB 2OC0A 4A1VA 4A92A 3OE7D 5FPSA 2GGVB 1SKYE 3DSOA 2XCFA 3SV8A 2KZ4A 2WV9A 2M2AA 3LKWA 3M5MA 5H4IB 1EFRD 3VG8A 1NBMD 2J5UA 3N7EA 2KCOA 5ETXA 5T1VA 4I31A 3GS9A 3M5OA 3P8NA 3P8OA 4U01A 1DY9A 3OFND 1DXPA 3SU6A 2K0QA 1BT7A 2KCAA 2OBQA 3O8DA 3SUEA 2GVFA 4WH6A 2XNDD 4I33A 1S6LA 1E1QD 3SU4A 5EQQA 3UB0A 2YMSD 1DY8A 2XOKD 4M9FA 3KEEA 2FP7B 5HKKD 1KMHB 2KCYA 2KR7A 2CK3D 2WPDD 3PV2A 1MABB 2KFWA 4I32A 1A1RA 1E79D 3OAAD 1RGQA 5FPTA 2OC8A 3F0PA 3SUGA 2L6OA 1JXPA 5EPNA 3WWBA 2QF5A 2YMSC 3EYDA 5FPYA 3H09A 2W6ID 2WSSD 2V7QD 4TT3D 5DN6D 1CU1A 2YOLA 3F2FA 1FX0B 3FKSD 3ZIAD 3NRLA 1N1LA 3OEED 3SZEA 5C0UA 5B6LA 4ZCNA 2JJ2D 4R8TB 4A1XA 2F9UA 5EPYA 3O8RA 4F55A 2KCPA 4WH8A 1NBME 3SUFA 1E1RD 3LOXA 3OEHD 2FOMB 1BMFD 5GNDA 3U1JB 1H8ED 4OM9A 2QF4A 4B6FA 4XD7D 5CDFE 3AK5A 3DCLA 3SU3A 3WWFA 4B71A 3WW7A 2OINA 4B6EA 4Q4LA 1H8HD 4ASUD 5IK2D 3SUDA 2KM0A 3FOAA 4B73A 1DXWA 4TSFD 3F0OA 4A1TA 2WZQA 3PRBA 3RC5A 3N7DA 3F3BA 2VBCA 3SV9A 4Z1MD 3L6PA 2A4QA 3SV6A 2OK5A 3FO8D 1NS3A 3O8BA 3O8CA 4JMYA 2HLDD 3F2GA 4DT4A 1WXRA 2O8MA 3LONA 4TYDA 3M5LA 4B76A 1W3CA 2IJOB 1OHHD 2QV1A 3E90B 2FM2A 3N99A 1W0JD 5DSFA 4KTCA 3PRDA 3SU2A 3M5NA 2A4GA 2JDID 2OBOA 2XCNA 3KN2A 5IDKA 5FL7D 3KF2A 4WF8A 5C0TA 1RTLA 1W0KD 5F53A 3W1EA 2K8IA 3F2HA 3SU1A 3SV7A 5EQRA 2A4RA 3SU0A 2OC1A 3DSPA 2AHME 3SYJA 2YMSB 2K1QA 3PV5A 2QE7D 1COWD 2F9VA 2W6JD 4YXWD 2P59A 2F43B 5EQSA 2LELA 3SU5A 4B75A 3RC6A 2XNIA 3U1IB 5GJ4B 2F4LA 3OYPA 5CHBA 3KNXA 3OTPA 4RI0A 5ESBA 2WHXA 3RC4A 5C17A 3FN8A 2JJ1D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CHB A;  3WW7 A;  5F53 A;  3WWB A;  3WWF A;  4ZCN A; 
#chains in the Genus database with same CATH topology
 1D3T B;  4WMD A;  3QDZ B;  5T6G A;  3MO6 A;  1BA8 B;  1W0Z U;  1GDQ A;  2ZZU H;  4NFF A;  2KZ4 A;  2NU2 E;  2F9N A;  2XBX A;  1QQ4 A;  4PRO A;  5HM9 A;  3GS9 A;  1SMF E;  2GV6 A;  3P8N A;  4JZE H;  1DXP A;  2QXH A;  1BTH H;  2L74 A;  5ABW A;  1W7G H;  3E6P H;  1ARC A;  3M7Q A;  4X2W A;  5A2M H;  1E79 D;  1GPZ A;  1YPM H;  2IN2 A;  1TON A;  4MDS A;  5E0J A;  4HFP B;  3SUG A;  4XE4 A;  4YM9 A;  1NC6 A;  1DOJ A;  1UTL M;  3RLY H;  2V7Q D;  2R2M B;  4ZKN U;  1CT0 E;  2FOD A;  2ZDM A;  4Q2K A;  1Z1J A;  1G9I E;  3KQ5 A;  3O8R A;  4WMF A;  3ATK A;  1MQ5 A;  3A7T A;  2BDG A;  3LOX A;  1XUK A;  3OEH D;  5K7R A;  1AWF H;  3U1J B;  1FJS A;  1Y8T A;  1MCV A;  4Y71 A;  1TA6 A;  4BAH B;  3D23 A;  1GMH F;  2CHA B;  5EXM A;  3D65 E;  4K5Z A;  1H8H D;  1QRX A;  2OQU A;  3BTG E;  4OS1 A;  1G32 B;  2H5D A;  3SJI A;  5LPR A;  1HAH H;  1LVY A;  2VIV A;  2HGT H;  2F91 A;  3UAI C;  3RLW H;  1MKW H;  1H8I H;  2PUX B;  2ZCH P;  2QXG A;  1W3C A;  4Y0Z E;  5KGO A;  1ZMJ A;  2GP9 B;  1N8O B;  2CJI A;  2IOT A;  2A4G A;  3P8F A;  2AIQ A;  1C1W H;  4WF8 A;  3SV7 A;  5E0G A;  5EST E;  2EY4 C;  5EOK A;  3SQH E;  2OC1 A;  1F2S E;  1MTV A;  1P09 A;  3GCT F;  1A5I A;  1FIW A;  1OP8 A;  1NFU A;  3ZVG A;  4YXW D;  1A46 H;  4X1N U;  1O2W A;  5EQS A;  3MQK C;  3ZVC A;  1ELB A;  1O2S A;  4FUD A;  5JBC S;  2XWA A;  1F0R A;  1O2V A;  1TNJ A;  1QIX B;  2GGV B;  3BTD E;  2ODY B;  3LPR A;  3SV8 A;  3BTT E;  3F1S B;  5EU8 A;  2ZKS A;  3RXS A;  1HNE E;  5FAH A;  1UK3 A;  2ZP0 H;  3E8L A;  5BRR E;  4FU9 A;  1BUI A;  1SLX B;  1BDA A;  1FXY A;  3NCL A;  4AB8 A;  4INK A;  2ZTY A;  1LVB A;  2SGD E;  2BDI A;  1C1V H;  4AOR A;  1BMM H;  1FON A;  3HAT H;  2W26 A;  1SOZ A;  1D3Q B;  5HIZ A;  1C1Q A;  3UB0 A;  2YMS D;  1C2J A;  5C20 A;  5HKK D;  5F8X A;  2FXR A;  1DPO A;  3ENS B;  4TPI Z;  1DE7 H;  2Y82 A;  2WYJ A;  2R3U A;  1THP B;  2TPI Z;  2ZDV H;  2O8U A;  1HDT H;  2BTC E;  3RXH A;  3ELA H;  3UFA A;  1BTZ A;  3FKS D;  2HVX A;  1V2U T;  1GHX H;  3TLO A;  3Q00 A;  1MTW A;  2OCV B;  2P8O C;  4NGA H;  1V2S T;  3ZZB A;  5HM2 A;  1O3P B;  1ZGI A;  1E1R D;  5DP7 A;  1UK2 A;  3GYM A;  1DT2 A;  2BY7 X;  2UWL A;  2VGC B;  3M61 U;  2VIQ A;  1KXE A;  1W8B H;  4XD7 D;  1FAK H;  1N6X A;  2BY9 X;  3PLK A;  1QB9 A;  1CA0 B;  2JKH A;  2OP9 A;  3DFJ A;  2SGA A;  3AW0 A;  5LH8 A;  3SV9 A;  1A0H B;  4ZHL U;  1WCZ A;  1J8A A;  1ID5 H;  1GBI A;  1NRN H;  4CRA A;  1Z8G A;  2LP6 A;  1DWE H;  1SGN E;  3U69 H;  5DJ7 A;  3BEI B;  5A8Z A;  2A5K A;  3MU4 A;  4O3T A;  3PRD A;  1VIT G;  2FES H;  2Y6T A;  3BIU H;  3M5N A;  1XKA C;  3A8A A;  1BBR H;  1MD8 A;  3F9F A;  4CHA B;  2OXS A;  4Y0Y E;  1YWU A;  4AX9 H;  2Z9J A;  3S7K B;  1MTS A;  3ZZA A;  4CH8 B;  3SYJ A;  1HIA B;  2VNT A;  3A83 A;  2F9V A;  1TB6 H;  1FNI A;  1NRQ H;  1BZX E;  1DWB H;  4XBB A;  3RC6 A;  4YO9 A;  4O9V A;  2FLB H;  1SPJ A;  1JIM A;  2WHX A;  3F9G A;  3MTY A;  4ZXX H;  3KID U;  3KL6 A;  1CVW H;  2V3H H;  2IJD 1;  1B5G H;  4K8B A;  2AEI H;  4ISL A;  2ZFF H;  1GI5 A;  8GCH G;  1C4V 2;  2P94 A;  2J34 A;  1V2O T;  2NWN A;  5A0B A;  2PWX A;  1HV7 A;  4A1V A;  4Y79 A;  5HGG A;  1O3H A;  1D3P B;  2CMY A;  3DSO A;  2GV7 A;  1AZ8 A;  4I8J A;  3S9A A;  1AD8 H;  1DSU A;  2H1U A;  2ZPQ A;  5H4I B;  3TH2 H;  4XFQ A;  1EQ9 A;  1E37 B;  5ETX A;  5L30 H;  3HGP A;  1VGC C;  1AO5 A;  3K65 B;  1AZZ A;  3D49 H;  1FN8 A;  4NA9 H;  1QA0 A;  4GPG A;  2XWB I;  1FI8 A;  1O2L A;  2A7J A;  1YCP K;  2RG3 A;  3OAA D;  3QWC H;  2ZDK A;  1SGP E;  2D1J A;  1C5W B;  1JXP A;  1T4V H;  2UWP A;  3MNS A;  4NIW A;  1FV9 A;  3RXU A;  3VXF H;  2JH6 D;  2VVU A;  5GIB A;  1EZQ A;  8LPR A;  2GDD A;  2SGE E;  4RT0 A;  1OXG A;  2F9U A;  1C2M A;  2VU8 E;  2Y5G A;  3MU5 A;  1EX3 A;  2HNT C;  3RXT A;  1HFD A;  1EAX A;  1V3X A;  3B23 B;  3QK1 A;  2FIR H;  2H5C A;  3T5F H;  4MNX A;  2VIN A;  3P6Z B;  2PGB B;  4Z6A H;  1WAY B;  3SI4 H;  1BBR E;  1F0T A;  1ANB A;  2D8W A;  3DT0 H;  3TH3 H;  1SBW A;  1K28 D;  1S6H A;  2WV4 A;  4I8H A;  2WPK S;  1TGS Z;  3IG6 B;  3MH6 A;  4XBC A;  2CGA A;  2V0B A;  5PTP A;  1G3D A;  1NM6 A;  2OK5 A;  4HGC A;  2YNA A;  3E0P B;  1H4W A;  1B0E A;  2HLD D;  2PTN A;  3AAU A;  2ZPS A;  4TYD A;  1ESA A;  1X7A C;  2Z7F E;  7GCH F;  2BD2 A;  4HTC H;  2ZFR H;  2BD7 A;  3SHA H;  5AFY H;  3DA9 B;  1HAZ B;  3SU1 A;  2AFQ B;  3LT3 A;  1P8V C;  4FUG A;  3T26 A;  2O8L A;  1COW D;  1SLW B;  5A09 A;  3PMB B;  1IQF A;  3UWJ H;  4JYT A;  1QNJ A;  3VB4 A;  1CT4 E;  1NRP H;  3RXO A;  1O5G H;  1IQM A;  3GCH C;  3W94 A;  3QLP H;  2Z94 A;  1RJX B;  3AVZ A;  3PWC A;  1P05 A;  1GI0 A;  2OC0 A;  3SNA A;  2PSY A;  2PV9 B;  2PR3 A;  1W0Y H;  2VJ1 A;  1K1I A;  3OSY A;  6CHA C;  1NFW A;  2WPM S;  4D9R A;  4FUF A;  1GBL A;  1H9I E;  3SJ8 A;  1O3A A;  1HLT H;  3VG8 A;  5DK1 A;  4P02 A;  3QN7 A;  4Y8Z A;  3V3M A;  2Y7Z A;  1CE5 A;  2ASU B;  4AYY B;  2K0Q A;  1DWC H;  2O8W A;  2BD3 A;  1E36 B;  1S6L A;  1TQ7 B;  2BDA A;  3ZZC A;  1E34 B;  2KAI B;  2ZEC A;  4M9F A;  2XOK D;  3QGN B;  3Q3K A;  2ZHQ H;  2KFW A;  4IS5 A;  3BG4 C;  3GCO A;  3GY6 A;  1TX7 A;  3WWB A;  4ZAE A;  3ZZ6 A;  1CU1 A;  4H42 U;  4X1R U;  3ZIA D;  1W11 U;  4Y76 A;  2EI7 A;  2OQ5 A;  1P2N A;  1Z7K A;  1O2O A;  1QBO A;  4NSY A;  1C4Y 2;  5A0A E;  2ZU1 A;  3ZVA A;  1JRS A;  5GND A;  1TBQ H;  1G2L A;  1ELD E;  3SOR A;  5F03 A;  5L2Y H;  3MH4 A;  3BN9 A;  3WW7 A;  3EA8 A;  1Y3X A;  1O37 A;  1GHB F;  1EB2 A;  3K2U A;  1RS0 A;  4OGY A;  1K1J A;  2WIN I;  3F0O A;  1Q31 A;  4CRB A;  1SC8 U;  5K0H A;  1A0L A;  1INC A;  1KDQ A;  2G5V A;  2I6Q A;  4Z1M D;  1V2T T;  3L6P A;  2BQW B;  1LQE A;  2GCH F;  1HAV A;  1H1B A;  1P57 B;  1GMH G;  2UUY A;  1GI1 A;  3N99 A;  1P2M A;  3F9E A;  4JZD H;  2A31 A;  2O8T A;  3MU1 A;  3KF2 A;  3RP2 A;  3PM3 A;  1GVK B;  5KEC A;  3GY4 A;  1GCT B;  4X8V H;  2ZIQ H;  3DSP A;  1TLD A;  4OS4 A;  2BZ6 H;  1V2Q T;  2DE9 A;  3KQB A;  1YPL H;  3BTF E;  1Z6E A;  4UD9 H;  5GJ4 B;  3RXF A;  3EE7 A;  1K1P A;  3LGV A;  5DP4 A;  2XRC A;  2JJ1 D;  1BRU P;  1K0H A;  2GTB A;  1MTN C;  4JK6 A;  4DCD A;  1T8N A;  1T8L A;  1A5H A;  4TY7 A;  1OYQ A;  1ZYO A;  5C1Y A;  3TU7 H;  1EAS A;  1O35 A;  3SJO A;  3BTK E;  5JB9 S;  1IQE A;  4O97 A;  4ABA A;  2C90 B;  3TGJ E;  2QY0 B;  3JZ2 B;  4IC6 A;  1GHW H;  1NBM D;  3VGC C;  4K1E A;  3A7X A;  4NIV A;  2GCT C;  3OFN D;  1YCP M;  1PPG E;  2BD9 A;  4U2W A;  4ZUH A;  1WOF A;  2V3O H;  1FUJ A;  2ZFS A;  1YLN A;  4H4F A;  1SGT A;  2VIP A;  1PPC E;  1A7S A;  3KEE A;  1A3B H;  1LKA A;  2KCY A;  2WPD D;  2XC4 A;  3KYF A;  2NU0 E;  2P3U B;  5DP8 A;  1P9S A;  3GOV B;  3NPS A;  5GDS H;  1YPK H;  2FOB A;  1K1L A;  1OWJ A;  2YMS C;  2ALP A;  3SNB A;  3TGK E;  1C1O A;  4NCY A;  2A7H A;  3I77 A;  1N1L A;  1AB9 B;  1ELC A;  1ETR H;  2ODQ A;  1SHY A;  4AFU A;  1O2M A;  1ZML A;  1LHD H;  1MKX H;  1PQ8 A;  3ZYE A;  1P3C A;  2FOM B;  5EG4 A;  3DCL A;  4MLF B;  2ZTZ A;  3SU3 A;  3U98 H;  4D76 A;  4B6E A;  1LKB A;  3T2N A;  4FXG H;  2HRV A;  2R9P A;  1BJU A;  1GHZ A;  1H8D H;  1IQK A;  4A1T A;  4X1P U;  5IYT A;  1LPG B;  2A4Q A;  3MFJ A;  1WSS H;  1O2H A;  2ANM H;  3F9H A;  1SGC A;  1YPH C;  3GY7 A;  1PQ7 A;  1T8M A;  3RXR A;  1SFQ B;  3E90 B;  4KTC A;  1HJ8 A;  4BAO B;  2Z3D A;  1KTT B;  1OWI A;  1ZRB A;  2XC5 A;  3OX7 U;  1F0U A;  1Y5A T;  2C93 B;  5A8X A;  5C94 A;  2FX4 A;  1XXD A;  2AYW A;  1ZZZ A;  3ATI A;  2HPP H;  5JPM H;  3TIU A;  1F7Z A;  1AUJ A;  1A5G H;  1XKB C;  2XNI A;  3U1I B;  1BRC E;  3RXM A;  2SGP E;  1G2M A;  4ISI H;  4NZQ A;  1ZPB A;  3PO1 B;  1FY1 A;  4NWL A;  3UOP A;  2ZDL A;  1KLI H;  1QB6 A;  1EOJ A;  3CS0 A;  3P8G A;  1YKT A;  1C5M D;  1GWA A;  2ANY A;  2ZCL P;  1GDN A;  1V2N T;  1P04 A;  2BLO A;  1C1U H;  4ABD A;  1UMA H;  2G4T A;  2WV9 A;  5CHA C;  1GBF A;  4KTS A;  1C5O H;  1XXF A;  3M35 A;  1HXF H;  2J5U A;  2TGT A;  4I31 A;  1PQ5 A;  3BEU A;  5HYO A;  2ZQ1 A;  3SJK A;  1CT2 E;  3TK5 A;  4X2V A;  2XND D;  1BOQ A;  1H9H E;  5EQQ A;  5EXN A;  3LGI A;  1VZQ H;  2CK3 D;  3LGW A;  1TNG A;  4E05 H;  1BRB E;  1CHO G;  1QZ8 A;  2O9Q A;  3EST A;  1QL8 A;  1IQH A;  1E38 B;  1P06 A;  1BIO A;  1FY8 E;  1P2J A;  1UVT H;  1ZR0 A;  3DSG A;  3TNS A;  3B8J A;  3ITI A;  1T31 A;  4U30 A;  4JYU H;  4X1S U;  3CEN A;  1LO6 A;  4DG4 A;  1WYK A;  1TPP A;  2R0K A;  2BOK A;  3VFE A;  4ACB A;  4ZCN A;  2ZTX A;  2BDH A;  3QTO H;  1HXE H;  5C1U A;  1VJA U;  1GBK A;  1XUG A;  1O3N A;  4GCH F;  1GG6 B;  3M7U A;  2ULL A;  2ZU4 A;  1CO7 E;  1SQA A;  5CDF E;  1SG8 B;  4AZ2 B;  3LH3 A;  1AVW A;  1UTM A;  4NIX A;  4ABB A;  5IK2 D;  1RIW B;  4B73 A;  1AFQ C;  1ZMN A;  3GY2 A;  1DXW A;  3LC3 A;  1MZD A;  1O5E H;  1O31 A;  4ABF A;  2VBC A;  4X8U H;  1WU1 A;  1Y5U T;  3VB6 A;  1OS8 A;  3O8B A;  3PV4 A;  2WV5 A;  4TY6 A;  2EI8 A;  2VH6 A;  1GBD A;  3TK6 A;  2ILN A;  2O8M A;  3EGK H;  4Q80 A;  1OHH D;  2TGA A;  1NRR H;  2WPH S;  1P9U A;  1LHC H;  1GGD C;  2SGF E;  4ABI A;  1UVO A;  5F53 A;  3RXV A;  1GHY H;  4IMQ A;  4ACA A;  1CBW B;  1GMD G;  2CN0 H;  1YF4 A;  1AI8 H;  1DUE A;  1K22 H;  2BOH B;  1G37 A;  1TE0 A;  2AHM E;  2JH0 D;  2NU1 E;  1AE8 H;  1H9L B;  2AER H;  2RDE A;  1QUR H;  1AU8 A;  1K2I 1;  5EJL A;  5LPE A;  3P95 A;  7GCH G;  2F4L A;  5CHB A;  2JET C;  3RC4 A;  1ABJ H;  3N7D A;  2ZHW H;  1G30 B;  5FCK A;  1D3D B;  2FS8 A;  1HUT H;  1S0R A;  3SNE A;  2RDL A;  5GCH G;  1ELA A;  3FP6 E;  3DHK H;  4F4O C;  3RU4 T;  3BTM E;  1PQA A;  3TJN A;  5C5N A;  1BTW A;  3NWU A;  1GJA B;  2ZEB A;  2EI6 A;  1L1G A;  3ATM A;  1GJ4 H;  3KGP A;  5E0H A;  1GMC G;  4I86 A;  1YLC A;  2HNT F;  2ZGC A;  4WH6 A;  4LZ4 B;  2TRM A;  1RFN A;  1E1Q D;  1T8O A;  1O3D A;  1NFX A;  1BTX A;  4VGC C;  2BD8 A;  1AGJ A;  4NSV A;  2C8Z B;  1W13 U;  1BIT A;  4GLY A;  4B1T A;  1A0J A;  1PYT D;  2CXV A;  1FX0 B;  1FAX A;  1C5N H;  3HKJ B;  3A86 A;  3OEE D;  5LGO A;  3SZE A;  1ORF A;  2BD4 A;  1O2K A;  2J97 A;  2F83 A;  1J17 T;  2QXJ A;  3G01 A;  1KLJ H;  3BG8 A;  3D62 A;  1UTO A;  1EB1 H;  1IQL A;  1EZS C;  1GI7 B;  1JOU B;  1XM1 A;  3STI A;  1ANC A;  1S83 A;  1ELF A;  1KY9 A;  3GY8 A;  5GWZ A;  2QGR A;  1TPA E;  1IQN A;  1ELT A;  4B2B A;  4KEL A;  4OS5 A;  2BD5 A;  4KP0 A;  3MO3 A;  1SVP A;  2C3S A;  3MU8 A;  2P93 A;  2ZPR A;  3SUD A;  2A45 B;  4Y11 E;  1OP0 A;  1GBC A;  1KXC A;  2WZQ A;  3UOU A;  4YOG A;  1NS3 A;  4GHQ A;  3P70 B;  3F2G A;  2QF0 A;  2KX4 A;  3AW1 A;  3GY3 A;  3OTJ E;  1P0S H;  4DIH H;  3RXI A;  4K60 A;  1SGY E;  1DM4 B;  2P16 A;  4MNY A;  1G3C A;  1GHB G;  3SU2 A;  1TBZ H;  1GVL A;  1M9U A;  3ZVD A;  2XCN A;  1Y59 T;  3PB1 E;  2R0L A;  3SU0 A;  1NY2 2;  1AFQ B;  1SGQ E;  4XSK U;  2Q1J A;  1YPH E;  3RXJ A;  1ELE E;  2FOC A;  2H9T H;  1LMW B;  3V12 A;  1GI6 A;  6GCH F;  1HAG E;  1FY4 A;  4OS6 A;  2ZDA H;  3OYP A;  4H6T A;  3A81 A;  3OTP A;  4CR5 A;  4YTA A;  2IPH A;  1UTJ A;  3RXA A;  2JIZ D;  1KXA A;  1V2L T;  5F8T A;  1J15 A;  1GGD B;  4BTI B;  1N6Y A;  1VIT H;  1CGH A;  2ZGH A;  1ZJK A;  3ZVE A;  3OE7 D;  3GYL B;  2XCF A;  3QZR A;  2RA0 A;  3E1X B;  2ZHF H;  1WTG H;  2FLR H;  4ZRO A;  3U9A H;  2VIW A;  3URE A;  3GIC B;  1L0Z A;  3UUZ A;  3QZQ A;  3F6U H;  1A3E H;  1BT7 A;  3UR6 A;  5E2O A;  4ISN A;  1GHA F;  2STA E;  1TAL A;  3MYW A;  2TGD A;  4BNR A;  1O3C A;  3K9X B;  4M7G A;  3B9F H;  5B6O A;  1QJ6 B;  2KR7 A;  5EOD A;  3MO9 A;  2BDB A;  5DG6 A;  2F9B H;  1EOL A;  2OC8 A;  3RMO H;  2ZO3 H;  1O2X A;  1L4D A;  1DLK B;  3UTU H;  2UUF B;  1Z8I B;  1TX6 A;  5T6D A;  1TNH A;  2AGI X;  3ZZ9 A;  1OX1 A;  1C5T A;  1T32 A;  2PW8 H;  3A84 A;  4R8T B;  2BQ7 B;  4BAN B;  4X2Y A;  1Y3V A;  2WPL S;  2J92 A;  2XXL A;  1GL1 A;  3S9C A;  1MAY A;  2F9P A;  1O2I A;  1THR H;  2HVY B;  5HMA A;  2PFE A;  4THN H;  3U8T H;  1EP5 A;  3SJ9 A;  5GXP A;  4Q4L A;  2FOG A;  1L2E A;  4X6M A;  3QGJ A;  1P01 A;  1UO6 A;  2WPI S;  3TJO A;  4K2Y A;  3JZ1 B;  3Q3Y A;  4DOQ A;  3BIV H;  1P03 A;  2ZF0 H;  1UTP A;  3MH7 A;  3O8C A;  3A80 A;  5TJX A;  3OY6 U;  4Y7A A;  4AB9 A;  2FI4 E;  4ZHA A;  3SNC A;  5E2P A;  2FM2 A;  3A85 A;  3SZN A;  5DP5 A;  1O30 A;  1YCP H;  3A7Z A;  1UHB A;  1Z6J H;  1GJ6 A;  1ZGV A;  2GZ9 A;  3ZV8 A;  3A8B A;  5FL7 D;  5AFZ H;  1C4U 2;  2K8I A;  3KQE A;  3STJ A;  3E16 B;  1NES E;  3T27 A;  3K6Y A;  2M5T A;  2OD3 B;  1WDI A;  2BLV A;  1O3O A;  2NU4 E;  4X6P A;  1KDQ B;  1DIT H;  1K9O E;  1SGF A;  2QN5 T;  2PKS C;  2GMT C;  4X2X A;  2A4O A;  2H2Z A;  2Z6B D;  4Y6D A;  1HAV B;  2P8O B;  3A7V A;  1KXB A;  4CRF A;  1OOK B;  1FLE E;  4K69 A;  4MPW A;  5HIY A;  4B74 A;  1C1T A;  1SFI A;  1WTH D;  3UIR A;  5GPI B;  1CGI E;  3GDV A;  4TWW A;  1GVZ A;  1HAX B;  1XUI A;  1SGD E;  1D6W A;  3GDU A;  3NKK A;  2WYG A;  3EDX B;  1RTK A;  1SGI B;  1FMG A;  1S0Q A;  1BTU A;  2A7C A;  1IQJ A;  2Q6F A;  3M5O A;  2C8X B;  1DY9 A;  5C2Z A;  1C9T A;  4FUI A;  1OWH A;  4ABG A;  1AWH B;  1HAO H;  1MU6 B;  2A5A A;  2UWO A;  3TGI E;  4EST E;  2AGG X;  2BVS H;  2STB E;  1GBB A;  3LDX H;  3F0P A;  1O2T A;  3VEQ B;  3EYD A;  3SN8 A;  4FUE A;  3H09 A;  2WSS D;  3LH1 A;  1AKS A;  1ZHM A;  1VCQ A;  4ABH A;  4O03 A;  2P3F H;  4FU7 A;  4ZMA H;  1ZRK A;  3LGU A;  1TBR H;  1GBE A;  1NU9 A;  1UCY K;  2KCP A;  1F0S A;  3TNT A;  3L33 A;  2RA3 A;  1HJ9 A;  1DX5 M;  2BMG B;  1O2Q A;  1O2P A;  1OWE A;  5AHG H;  1D6R A;  1SSX A;  2QF4 A;  3FVF B;  3ZVB A;  2HPQ H;  4OS7 A;  1GI9 B;  2G81 E;  4KTU A;  4D7F A;  1EKB B;  5AVD A;  1QRW A;  5DGJ A;  4YES B;  2FI5 E;  4U32 A;  1OSS A;  4GHT A;  3PRB A;  1GJ9 B;  3RC5 A;  3F3B A;  4BXW A;  7EST E;  1S85 A;  2GT8 A;  4RKO B;  1G3B A;  4KKD A;  3M3V A;  1DS2 E;  4MNV A;  3DD2 H;  4IN2 A;  4AC9 A;  2C8Y B;  1VGC B;  2V6N A;  1W12 U;  1W0J D;  4A6L A;  1Q2W A;  1BRA A;  4FUB A;  4H6S B;  1QA7 A;  4LOY H;  4YLU A;  1L1J A;  1NN6 A;  1S82 A;  4NZL A;  1W0K D;  1P3E A;  1SR5 C;  4D8N A;  1ESB A;  1BQY A;  3AAS A;  4WJG 2;  1HJA C;  1LHG H;  4Y7B A;  1BMN H;  4JZ1 A;  2W7U A;  3A7W A;  4AFQ A;  1V2P T;  2BQ6 B;  2F43 B;  1NT1 A;  2R3Y A;  3TVJ B;  1S81 A;  1WUN H;  1IQG A;  1XUF A;  2FMJ A;  3DFL A;  1GJ7 B;  4SGB E;  4DII H;  5FX6 A;  2ZGJ A;  1C5S A;  1SQR A;  4I7Y H;  5DPA A;  1C5L H;  3MU0 A;  4WME A;  1UTK A;  2G52 A;  4WWY A;  5EIY A;  1F5L A;  1EST A;  6EST A;  1EPT C;  5EJZ A;  4ZXY H;  2B7D H;  1BJV A;  2QCY A;  3ZVF A;  4U01 A;  1C1M A;  4IN1 A;  1LVO A;  1DVA H;  1L4Z A;  1C2L A;  2KCA A;  2TIO A;  2WPJ S;  1EAW A;  4X8T H;  1O3F A;  1C9P A;  4Z0K A;  4B2C A;  1KMH B;  2BVX H;  3U28 C;  1NPM A;  3GCT G;  3A8C A;  2HAL A;  2HOB A;  4YOI A;  1FQ3 A;  2BY5 X;  3T25 A;  1J16 A;  3A87 A;  1JIR A;  1PPH E;  1SI5 H;  2D26 C;  4CH2 B;  2YOL A;  2VIO A;  2GT7 A;  3NRL A;  1WQV H;  1QJ7 B;  4DT7 B;  2EC9 H;  1OP2 A;  4UE7 H;  4ZHM U;  4AGK A;  3PLB A;  2BLQ A;  3RXP A;  1NBM E;  2VB0 A;  3IWM A;  2D2D A;  1PYT C;  4ABE A;  2ALV A;  3GCH B;  1E0F D;  4MPU A;  4DUR A;  1Y5B T;  2FO9 A;  4UFF H;  1S5S A;  4WVP E;  2J2U A;  4UON A;  3N7O A;  4CRE A;  4MTB A;  6CHA B;  2ZU2 A;  4I8G A;  1K1M A;  2Y80 A;  3MHW U;  9LPR A;  1RD3 B;  2RCE A;  1Z8R A;  1F5R A;  4X6N A;  1IQI A;  4YZU A;  1AN1 E;  2XBY A;  1CSO E;  4X0W U;  3MH5 A;  1MKX K;  1SGE E;  1QBV H;  2GX4 A;  1AVG H;  1QB1 A;  2BXT H;  4BAM B;  1C5R A;  2OBO A;  3TK9 A;  5IDK A;  1P02 A;  2R2W U;  4Y10 E;  3URD A;  3BG4 B;  2ZFP H;  3RXL A;  1UVP A;  2J94 A;  1YGC H;  1O0D H;  1YBW A;  1NZQ H;  3SBK A;  3PV5 A;  4NA8 A;  4X6O A;  1C1S A;  1PPZ A;  3PWB A;  1YPG H;  1WV7 H;  1DFP A;  1S84 A;  2ZI2 H;  1GBJ A;  5DP3 A;  5C67 A;  2BZA A;  6LPR A;  4BOH A;  1TAW A;  2OC7 A;  3C27 B;  2QXI A;  4UEH H;  1UTQ A;  1QL7 A;  2FOF A;  2CHA C;  1GBA A;  4K8Y A;  1HPG A;  2J98 A;  1VKY A;  3RXG A;  3RXK A;  1O5F H;  3RM0 H;  1DUA A;  3SQE E;  5T1V A;  3ATL A;  1EAU A;  3UNS A;  3SU6 A;  2C4F H;  2OBQ A;  1O33 A;  2DE8 A;  3SUE A;  1J9C H;  4BAQ B;  3FP7 E;  3SU4 A;  1C1P A;  1TNK A;  1N8O C;  3NXP A;  4ZH8 A;  1DY8 A;  3ZV9 A;  3M37 A;  1O2N A;  4JZF H;  3MNX A;  2AS9 A;  4FUH A;  1QTF A;  1EUF A;  4TPY A;  3U8R H;  2BHG A;  3FZD A;  4ASH A;  2L6O A;  1BMA A;  1ETT H;  4UFD H;  2QF5 A;  1YLD A;  2W6I D;  4UDW H;  4GUX A;  2FEQ H;  2J9N A;  3GCN A;  1O5C B;  1TAB E;  3C1K A;  1C5Q A;  3UY9 A;  1LCY A;  4WH8 A;  4YOJ A;  1XUJ A;  1YPE H;  1O5A B;  2FI3 E;  1MTU A;  4BTT B;  1TX8 A;  1MBM A;  3MMG A;  4OM9 A;  3URC A;  1MTN B;  1Y3U A;  5C3N A;  3SOS A;  2WUB A;  3F68 H;  2GZ8 A;  1O3I A;  1TGT A;  1FIZ A;  2OTV A;  2ZDN A;  5JDU B;  1O34 A;  3KYG A;  4JYV H;  2OIN A;  4XBD A;  4J1Y A;  1HYL A;  3FOA A;  4TSF D;  2AMP A;  2VWN A;  2PKA A;  3H7T A;  4CBN A;  3VB5 A;  3SGB E;  5FCR A;  2LPR A;  2A32 A;  2BDY A;  1ANE A;  2P95 A;  3NK8 A;  5A8Y A;  3VGC B;  1W10 U;  1YY3 A;  5I46 H;  1SL3 A;  1TRM A;  2GCT B;  2Z9L A;  4WY3 A;  3H7O A;  3UQV A;  1SB1 H;  3LU9 B;  2F3C E;  4AG1 A;  3PMA B;  1IHS H;  5FBE A;  5DP6 A;  1JRT A;  2XBV A;  3SGA E;  1NFY A;  1DST A;  2W3I A;  4D9Q A;  1RTL A;  3BTW E;  4BTU B;  3QX5 H;  2YMS B;  5I25 A;  5KED A;  2W6J D;  4FVD A;  1O2J A;  1QCP A;  1QQU A;  1EZU C;  2P59 A;  3UR9 A;  1IAU A;  1B7X B;  1O36 A;  1FDP A;  1YPJ H;  4I8L A;  3TH4 H;  1O5D H;  2AMD A;  4BXS A;  2A5I A;  1NO9 H;  3FN8 A;  2FX6 A;  1LVM A;  2VGC C;  4AYV B;  3A89 A;  2CV3 A;  1VCW A;  3CP7 A;  1W7X H;  3S7H B;  4Q63 A;  5AF9 H;  3ZZ5 A;  2HWL B;  2H9E H;  2BXU H;  4DW2 U;  1CA0 C;  1GCD A;  4A92 A;  1GJ5 H;  3BV9 B;  3UNQ A;  4NFE A;  1AFE H;  3P17 H;  1Y3Y A;  4QT8 C;  1DIC A;  1V2J T;  3VB7 A;  5HXF A;  2ZG0 H;  3EA7 A;  1GHV H;  1MKW K;  2G4U A;  1TIO A;  1TMU H;  1CA8 B;  5CE1 A;  5JBA S;  2P3T B;  2GZ7 A;  1C1R A;  3M36 A;  1RXP A;  2FOA A;  3A7Y A;  5A0C A;  4CHA C;  3TPI Z;  1HGT H;  5FPT A;  2V3M A;  2Z9I A;  1V2V T;  1KLT A;  2VWL A;  4K1S A;  3OY5 U;  1C2K A;  1EPT A;  3Q3X A;  1AE5 A;  2ZNK H;  4DVA U;  4Q7Z A;  1F92 A;  2H9H A;  2G8T A;  4ZKS U;  4FOU C;  2ZFQ H;  3M3T A;  4A1X A;  3Q77 A;  1O2U A;  3BSQ A;  2PTC E;  1V2M T;  1GI8 B;  2FWW A;  5DO4 H;  4E7R G;  2W5E A;  1W14 U;  3RM2 H;  2OLG A;  1C5P A;  3WWF A;  4F48 B;  1ZTL A;  4RSP A;  4WXV A;  4B71 A;  4YT7 H;  3BTH E;  1C2G A;  2FOH A;  5LPF A;  2Q6G A;  1A2C H;  1ZJD A;  3MOC A;  1EJM A;  3MNC A;  5CHA B;  4Y8X A;  1DWD H;  4F49 A;  1FY3 A;  3ODD A;  4IGD A;  3BEF B;  1TMB H;  1KXF A;  2UUJ B;  1AY6 H;  1TA2 A;  4A7I B;  2BY6 X;  4B2A A;  4B76 A;  4CRD A;  2CF9 H;  4CRG A;  3U8O H;  1JMO H;  1TFX A;  3Q76 A;  3T29 A;  5JBB S;  5J4S A;  3FFG A;  3M3S A;  2B0F A;  5C0T A;  3R3G B;  4LZ1 H;  2A4R A;  2C8W B;  1BTP A;  3M7T A;  2XYA A;  1LHE H;  4MG3 A;  2FTM A;  1LDT T;  2V35 A;  1UJ1 A;  3PRO A;  1FZZ A;  2BDC A;  1IHT H;  7LPR A;  1NU7 B;  4KGA A;  4FET A;  1BHX F;  4ISH H;  1TGC A;  4HG6 A;  1UHB B;  1UK4 A;  1EJN A;  2DUC A;  1ACB E;  4MVN A;  2VID A;  2FZZ A;  3CS7 A;  4NG9 H;  1ZSL A;  4CR9 A;  5FPS A;  3BF6 H;  1UVU H;  2BYA X;  5TCC A;  1RTF B;  2M2A A;  3LKW A;  4OGX A;  1GI4 A;  4E7N A;  2GCH G;  3PTB A;  1TQ0 B;  4HI3 A;  1SGR E;  1TNI A;  2GVF A;  2ZHD A;  1GBM A;  1ELV A;  1C2F A;  1CQQ A;  3RDZ A;  3SI3 H;  3KQC A;  4Q7Y A;  1IOE A;  1MCT A;  3E3T A;  5FX5 A;  2SNW A;  1WBG B;  3EQ0 H;  1BBR K;  5DP9 A;  3RXB A;  1XX9 A;  2VVC A;  2G51 A;  1Z71 A;  2BLW A;  2EST E;  2FS9 A;  3ODF A;  5B6L A;  4GSO A;  2B8O H;  2JJ2 D;  1C2I A;  1FPH H;  5T6F A;  1Z1I A;  1JBU H;  2A1D B;  3RMM H;  1AND A;  2JET B;  1BMF D;  2PSX A;  1O5B B;  1TPO A;  3QO6 A;  4B6F A;  3SGQ E;  3NZI A;  2NU3 E;  3WY8 A;  1XMN B;  1SGF G;  4XOJ A;  2KM0 A;  4E06 H;  4OS2 A;  1O3B A;  5EJ1 A;  2TBS A;  2QF3 A;  2I6S A;  3AAV A;  3EA9 A;  1AKS B;  2Y81 A;  3V13 A;  3ZZ8 A;  3FO8 D;  2EA3 A;  1C5V A;  1EAT A;  3A82 A;  4JCN A;  3LON A;  4IBL H;  1GBT A;  3RMN H;  1HBT H;  1D4P B;  2BM2 A;  1GJ8 B;  3I78 A;  4VGC B;  3ZZ7 A;  3KN2 A;  4JZI A;  5SGA E;  1EAI A;  1UVS H;  4P00 A;  1XVO A;  3W1E A;  3F2H A;  1U6Q A;  5EQR A;  1AMH A;  3RXD A;  3I29 A;  1CHO F;  1LPK B;  1PFX C;  5EW1 H;  4K3J A;  1P12 E;  2FDA A;  3SU5 A;  5E8E H;  1P2Q A;  4B75 A;  2Y5H A;  1THS H;  3ZZ3 A;  1O2R A;  1P2O A;  3UNR A;  4RI0 A;  4O3U A;  2YNB A;  1MUE B;  1MZA A;  3MWI U;  1V2K T;  4AG2 A;  9EST A;  1C2E A;  2THF B;  1TOM H;  1K1O A;  4X1Q U;  2GDE H;  4FVB A;  3PTN A;  1QFK H;  1HRT H;  4DGJ A;  2G00 A;  1TGB A;  2FYQ A;  1ZPZ A;  1TMT H;  2CF8 H;  3KCG H;  2QC2 A;  7KME H;  1MBQ A;  1P11 E;  3S69 A;  1BTY A;  3PMH B;  3QUM P;  1G36 A;  4TWY A;  3V7T A;  4I33 A;  4YLQ H;  2B9L A;  5L2Z H;  2ZHE H;  3PV2 A;  1T7C A;  1BML A;  1A1R A;  2BVR H;  1GCT C;  2AH4 X;  2BX4 A;  2B5T B;  2W7S A;  2Z3E A;  5EPN A;  1OYT H;  4TT3 D;  4LXB H;  2Z3C A;  4FU8 A;  5EXL A;  1AIX H;  3R0F A;  1GMD F;  1HAY B;  4ABJ A;  1RRK A;  2PP6 A;  1TWX B;  3HKI B;  1MQ6 A;  1D9I A;  1QR3 E;  5F6M A;  3QTV H;  1O3E A;  3SUF A;  1ETS H;  1GJB B;  1ZTJ A;  1NRS H;  2RFK C;  4Y8Y A;  2J4I A;  2J95 A;  4R0I A;  2WUC A;  1JWT A;  1YM0 A;  2ZU3 A;  3AK5 A;  2XBW A;  5F8Z A;  1VR1 H;  3W95 A;  1C2H A;  1C5Y B;  3RXE A;  2UUK B;  4RKJ B;  3RML H;  4XRN A;  3SO3 A;  1HIA A;  5GCH F;  4DY7 B;  1C1N A;  2QA9 E;  3RUO A;  2ZFT A;  4FUC A;  1O3M A;  1K1N A;  2QIQ A;  2ZCK P;  4J2Y B;  4CBO A;  1LHF H;  2JH5 D;  1MMJ N;  4A5T S;  3MNB A;  3T28 A;  3SHC H;  1GMC F;  1YYY 1;  2Y5F A;  4AGJ A;  1AHT H;  1KIG H;  5FHT A;  3ATW A;  2PGQ B;  4GAW A;  1OKX A;  2PLX A;  2Z9K A;  3NUM A;  5JYI A;  2XC0 A;  4AOQ A;  2VVV A;  5FBI A;  1ZTK A;  1TPS A;  1GL0 E;  2K1Q A;  1AB9 C;  1GJD B;  2ANW A;  3FAO A;  5EGM A;  3HPT B;  3LGT A;  1GBH A;  2LEL A;  1F5K U;  1UCY H;  4GCH G;  1O3K A;  4INL A;  1TRY A;  3GY5 A;  4AFS A;  1O32 A;  8KME 2;  4AN7 A;  4FUJ A;  4NWK A;  5DKM A;  4HZH A;  1AUT C;  4GVU A;  1AVX A;  2Q6D A;  1PPB H;  1KTS B;  3HK6 B;  5J4Q A;  1ZHP A;  1AQ7 A;  1TOC B;  2J38 A;  1EFR D;  3GIS B;  3N7E A;  1DAN H;  1LTO A;  3P8O A;  1S6F A;  3RXC A;  1O2Y A;  1XUH A;  1PJP A;  2FYR A;  2GD4 B;  2SGQ E;  2XW9 A;  2VWO A;  4MPV A;  3SW2 B;  1QJ1 B;  3K6Z A;  3GDS A;  3LGY A;  3FZZ A;  1KSN A;  5JB8 S;  1TNL A;  2VH0 A;  2J98 B;  1NTP A;  1O3J A;  1SLV B;  4RT1 A;  2PUQ H;  5CMX H;  4K1T A;  4SGA E;  5FPY A;  1FPC H;  5DN6 D;  2OUA A;  5EW2 H;  3F2F A;  3BTE E;  1DDJ A;  1ZPC A;  4IC5 A;  1TRN A;  3P92 A;  3VXE H;  1TYN A;  3IIT A;  1E35 B;  4F55 A;  2PKS B;  2GMT B;  2VWM A;  3PO1 C;  5C5O A;  5L6N H;  1QBN A;  3TJU A;  2XTT B;  4UFG H;  2ODP A;  1L1N A;  3RU4 D;  1V2W T;  1H8E D;  1PPE E;  4LK4 A;  1A4W H;  1MAX A;  3HGN A;  1C2D A;  3RU4 E;  2LNC A;  1CHG A;  3TJV A;  1YC0 A;  1ZLR A;  1VIT F;  1UW7 A;  2G55 A;  3OU0 A;  1QGF A;  4ZKO U;  5C1X A;  4MNW A;  1UCY E;  2AMQ A;  1O39 A;  3SV6 A;  1GI2 A;  4JMY A;  1HAI H;  8EST E;  2FTL E;  1P2I A;  2QYI A;  2BY8 X;  1VCP A;  2FPZ A;  1WXR A;  3KQD A;  2EQN A;  3UPE A;  3M5L A;  1QY6 A;  2IJO B;  2ZGX H;  4MQA A;  4RN6 A;  3EE0 B;  3T62 A;  2QV1 A;  5DSF A;  3PLP A;  1XVM A;  1BHX B;  3SND A;  2Y7X A;  2IPQ X;  3A88 A;  3V0X A;  1GI3 A;  2A2X H;  1C5U A;  4DJZ B;  2GKV E;  3FAN A;  3FP8 E;  1NRO H;  1EJA A;  4BAK B;  1EXF A;  2PKA B;  1C5Z B;  1B0F A;  8GCH F;  1A61 H;  2ZGB H;  2GJG A;  2W3K A;  1ZHR A;  1LPZ B;  2PHB A;  3L3T A;  5C17 A;  1EP6 A;  4NIY A;  1GG6 C;  1K21 H;  2ZQ2 A;  1KXD A;  2QAA A;  3KHV A;  2A0Q B;  2KAI A;  1SHH B;  3LC5 A;  1OWD A;  3TIT A;  1UTN A;  1BB0 B;  1MU8 B;  1RIW C;  1EZX C;  1SKY E;  2G5N A;  3VPK A;  1HCG A;  2A2Q H;  5TCA A;  1FY5 A;  3M5M A;  1QL9 A;  1ARB A;  3PYH A;  3A8D A;  2KCO A;  1J14 A;  1DLE A;  3LJJ A;  4MPX A;  1VJ9 U;  3O8D A;  3LIW A;  2H6M A;  1T4U H;  2Z9G A;  1QRZ A;  1FN6 A;  1O2Z A;  2BB4 A;  4UFE H;  2BX3 A;  3PMJ A;  3CNR A;  2FP7 B;  1OPH B;  2HLC A;  2AIP A;  1ZOM A;  4INH A;  1MAB B;  1G3E A;  4I32 A;  1ZSJ A;  1CBW C;  1RGQ A;  3UWI A;  6GCH G;  2ZWL H;  1TGN A;  2TGP Z;  1HJA B;  1ABI H;  1MH0 A;  1SQO A;  1W2K H;  3H5C B;  2HNT E;  1C5X B;  5C0U A;  2F9O A;  1O2G H;  4X8S H;  5EPY A;  2SNV A;  4ZKR U;  1ELG A;  3VB3 A;  3UQO A;  2ZU5 A;  4Q7X A;  1V6D A;  1YP9 A;  1PPF E;  4YT6 H;  3HK3 B;  1P10 A;  1ZSK A;  3BTQ E;  1SLU B;  3ZZD A;  1CGJ E;  1LQD B;  4JK5 A;  1GJC B;  4ASU D;  2AGE X;  3E91 A;  1Y3W A;  5JBT A;  1EPT B;  1O3L A;  4WXI A;  2FOE A;  4CRC A;  3E0N B;  1GHA G;  1O3G A;  1HB0 B;  2EEK A;  4DT4 A;  4IW4 E;  4ISO A;  1SQT A;  2ZC9 H;  1Z8J B;  3DUX H;  2ZA5 A;  3RXQ A;  4D7G A;  4IMZ A;  2SFA A;  2JDI D;  4AFZ A;  1QHR B;  1SOT A;  4NA7 A;  3S0N A;  5FXL A;  2ANK H;  4I8K A;  1HAP H;  1MD7 A;  5BPE A;  1P2K A;  1OWK A;  2QE7 D;  3MI4 A;  3SV2 H;  5G4B A;  1WQS A;  1O38 A;  1V2R T;  1GDU A;  3S9B A;  3KNX A;  3LJO A;  5ESB A;  3EAJ A;  5T3H A;  4XDE A;  1BCU H;  1KYN A;  3ZYD A;  3ZZ4 A;  1Q3X A; 
#chains in the Genus database with same CATH homology
 2IJD 1;  4FET A;  4NWL A;  2JIZ D;  4K8B A;  4B74 A;  4Q63 A;  2OC7 A;  4NWK A;  5GPI B;  2OC0 A;  4A1V A;  4A92 A;  3OE7 D;  5FPS A;  2GGV B;  1SKY E;  3DSO A;  2XCF A;  3SV8 A;  2KZ4 A;  2WV9 A;  2M2A A;  3LKW A;  3M5M A;  5H4I B;  1EFR D;  3VG8 A;  1NBM D;  2J5U A;  3N7E A;  2KCO A;  5ETX A;  5T1V A;  4I31 A;  3GS9 A;  3M5O A;  3P8N A;  3P8O A;  4U01 A;  1DY9 A;  3OFN D;  1DXP A;  3SU6 A;  2K0Q A;  1BT7 A;  2KCA A;  2OBQ A;  3O8D A;  3SUE A;  2GVF A;  4WH6 A;  2XND D;  4I33 A;  1S6L A;  1E1Q D;  3SU4 A;  5EQQ A;  3UB0 A;  2YMS D;  1DY8 A;  2XOK D;  4M9F A;  3KEE A;  2FP7 B;  5HKK D;  1KMH B;  2KCY A;  2KR7 A;  2CK3 D;  2WPD D;  3PV2 A;  1MAB B;  2KFW A;  4I32 A;  1A1R A;  1E79 D;  3OAA D;  1RGQ A;  5FPT A;  2OC8 A;  3F0P A;  3SUG A;  2L6O A;  1JXP A;  5EPN A;  3WWB A;  2QF5 A;  2YMS C;  3EYD A;  5FPY A;  3H09 A;  2W6I D;  2WSS D;  2V7Q D;  4TT3 D;  5DN6 D;  1CU1 A;  2YOL A;  3F2F A;  1FX0 B;  3FKS D;  3ZIA D;  3NRL A;  1N1L A;  3OEE D;  3SZE A;  5C0U A;  5B6L A;  4ZCN A;  2JJ2 D;  4R8T B;  4A1X A;  2F9U A;  5EPY A;  3O8R A;  4F55 A;  2KCP A;  4WH8 A;  1NBM E;  3SUF A;  1E1R D;  3LOX A;  3OEH D;  2FOM B;  1BMF D;  5GND A;  3U1J B;  1H8E D;  4OM9 A;  2QF4 A;  4B6F A;  4XD7 D;  5CDF E;  3AK5 A;  3DCL A;  3SU3 A;  3WWF A;  4B71 A;  3WW7 A;  2OIN A;  4B6E A;  4Q4L A;  1H8H D;  4ASU D;  5IK2 D;  3SUD A;  2KM0 A;  3FOA A;  4B73 A;  1DXW A;  4TSF D;  3F0O A;  4A1T A;  2WZQ A;  3PRB A;  3RC5 A;  3N7D A;  3F3B A;  2VBC A;  3SV9 A;  4Z1M D;  3L6P A;  2A4Q A;  3SV6 A;  2OK5 A;  3FO8 D;  1NS3 A;  3O8B A;  3O8C A;  4JMY A;  2HLD D;  3F2G A;  4DT4 A;  1WXR A;  2O8M A;  3LON A;  4TYD A;  3M5L A;  4B76 A;  1W3C A;  2IJO B;  1OHH D;  2QV1 A;  3E90 B;  2FM2 A;  3N99 A;  1W0J D;  5DSF A;  4KTC A;  3PRD A;  3SU2 A;  3M5N A;  2A4G A;  2JDI D;  2OBO A;  2XCN A;  3KN2 A;  5IDK A;  5FL7 D;  3KF2 A;  4WF8 A;  5C0T A;  1RTL A;  1W0K D;  5F53 A;  3W1E A;  2K8I A;  3F2H A;  3SU1 A;  3SV7 A;  5EQR A;  2A4R A;  3SU0 A;  2OC1 A;  3DSP A;  2AHM E;  3SYJ A;  2YMS B;  2K1Q A;  3PV5 A;  2QE7 D;  1COW D;  2F9V A;  2W6J D;  4YXW D;  2P59 A;  2F43 B;  5EQS A;  2LEL A;  3SU5 A;  4B75 A;  3RC6 A;  2XNI A;  3U1I B;  5GJ4 B;  2F4L A;  3OYP A;  5CHB A;  3KNX A;  3OTP A;  4RI0 A;  5ESB A;  2WHX A;  3RC4 A;  5C17 A;  3FN8 A;  2JJ1 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...