3PLBA

Bovine trypsin variant x(tripleile227) in complex with small molecule inhibitor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plbA02
1GJ6A 2AYWA 1O3PB 2CGAA 3D65E 3A7XA 4MTBA 3RU4D 2P59A 3SV8A 1GBAA 1ANDA 2FOFA 2O8UA 1HAOH 2K1QA 3SQEE 1GMDG 3B23B 1IQJA 5IDKA 1AD8H 4BAKB 1BMMH 1FY4A 1O2PA 4MNXA 2SFAA 3Q76A 2EEKA 4TWYA 5EG4A 1SQAA 1BTYA 4NWLA 3T27A 2FDAA 3BTQE 1FAXA 1T8NA 1DUAA 1BTPA 1P10A 4JZIA 4BAHB 1HJAB 2Z9IA 1B0EA 4ESTE 1ZGVA 4UFFH 1DDJA 3T5FH 4RKOB 1TX8A 2ZTZA 1V2NT 1P2NA 1PPFE 5DP4A 1KLIH 2Q6DA 8KME2 5J4QA 3TGJE 3SGBE 3NXPA 1P06A 1XUGA 2ZF0H 1TRMA 4AX9H 1C5YB 3D23A 5T6FA 1K21H 1TBRH 4FUFA 2CF9H 3O8DA 3ZZBA 2FI3E 1BTUA 3V0XA 1O34A 2VIWA 3T2NA 4YO9A 4JYVH 2QCYA 4U32A 4NIXA 3KQEA 1P04A 2WPLS 1AFEH 2A1DB 3C27B 1ZMJA 2HWLB 1H8DH 1HYLA 2Y80A 1IQIA 1CSOE 5EGMA 3A8DA 1WBGB 2VIOA 3HGPA 4K1EA 1CE5A 1YLDA 4ZKOU 2OTVA 2NU0E 3D49H 3UPEA 1OS8A 4NWKA 1O2LA 3GOVB 2XBVA 1HAVB 3QDZB 1KLJH 3EA7A 2BB4A 4BTTB 1NRSH 1EPTA 1W13U 4ABFA 2ANYA 1TGCA 2SNVA 2AS9A 5C5OA 1GGDB 1IQGA 3R0FA 1YPGH 4X2VA 2A31A 1TIOA 5AFYH 1OKXA 1HRTH 4HFPB 7KMEH 1ETTH 2P93A 3VFEA 3SJ8A 1AFQC 5E2PA 1GJ4H 2R0KA 4AYVB 2R2WU 4WMDA 1EP5A 3RDZA 1LVBA 2FX4A 3OY6U 1GI6A 2A7CA 2OC7A 2ZGJA 2GKVE 4NA8A 2FP7B 3OYPA 3DD2H 1KTTB 2QXHA 3U1JB 1S0RA 2Z7FE 3FZDA 4XE4A 5DO4H 2A4RA 2FOCA 2H5DA 1IQEA 5H4IB 2F91A 1RD3B 3P8FA 3P6ZB 1BRBE 1MAYA 2R9PA 2QIQA 1FY5A 2CMYA 1PQ7A 1KXAA 1W14U 3P95A 4TWWA 2GCHF 4AG1A 3SU0A 1LTOA 1DPOA 1TA6A 3GYLB 5GXPA 3H7OA 1F0UA 2XNIA 5LGOA 3GYMA 2XXLA 3AASA 1O2ZA 1O31A 1WCZA 3IWMA 3T25A 4CR9A 2BD4A 3WY8A 1TRYA 3VB7A 3E91A 3PYHA 1MKXK 3SUDA 2J4IA 1O3DA 4ZHLU 1EP6A 1ELCA 2IN2A 1X7AC 4BXWA 3RXKA 1CVWH 4BAOB 1XUFA 2OP9A 3BTTE 1RTKA 1TNIA 1FDPA 2Q6GA 1GMHG 1Z8RA 2ZG0H 4K60A 3ZYDA 4B2BA 1G3CA 3QLPH 1EUFA 3SI3H 3M3SA 2FLBH 1BTWA 1W0YH 3ZVGA 1C2KA 6CHAB 3P8NA 4XBCA 3SV6A 1KXEA 1MQ6A 2OUAA 2I6SA 1FY3A 4CBOA 2THFB 2BDCA 2ZIQH 5A0AE 2ZDKA 2ZU1A 1D6WA 1TPOA 1EJMA 2A5KA 3GISB 3LJJA 4MLFB 1V2ST 2BVXH 1W12U 4OS4A 1L2EA 1NFWA 1GDNA 3F9HA 1AMHA 5T6DA 4QT8C 4YT7H 2OQ5A 4B1TA 2LNCA 4UFDH 4D7GA 2IOTA 3F9GA 3FAOA 1LQDB 1OWKA 2F9PA 4K8BA 3TK9A 1SGQE 2Q1JA 1AVGH 4MNYA 3TVJB 4H4FA 2SNWA 1DLEA 3K65B 5FBEA 3VPKA 2HPQH 1O2XA 2BQWB 1NFXA 3S7KB 1S84A 1TE0A 1CGJE 2CXVA 1QIXB 4WF8A 4OS1A 1AQ7A 3GICB 3PM3A 1V2QT 3TNSA 1C5XB 4NIWA 1SGCA 1TBZH 1QR3E 3ZYEA 3SNCA 1MD7A 1ETRH 1LVMA 5A09A 1BMNH 1Z71A 3RXIA 3QGNB 1P02A 2ZGCA 3S9BA 2SGQE 3L6PA 2VIDA 3ZV8A 1W3CA 1LVYA 2FIRH 2QV1A 3SJIA 3MU8A 2OD3B 2A2XH 4BAMB 4D9QA 1C5WB 1YPHC 2XYAA 4IN2A 2Z9LA 2VH0A 2ZFQH 1LQEA 1QRXA 4K3JA 3SI4H 1PPGE 5GIBA 3RXEA 1O2HA 3SU5A 1RXPA 1KXFA 4JZDH 1YPEH 2PKSB 1AWHB 1GG6C 1P01A 1QQUA 1V3XA 3LONA 1C5UA 1TNGA 3ZZ7A 2Y5FA 3P17H 1EQ9A 2G00A 3RC6A 4ABGA 1VCQA 1O2NA 1HV7A 2G4TA 3LGUA 4ZHAA 1FY8E 2G81E 3RXLA 2ZGBH 3O8BA 4MPWA 2PWXA 2BD9A 3UQOA 4I8GA 3BTWE 1NY22 1HAVA 3SU1A 3GDUA 3A7ZA 1EAXA 3SHCH 1ELVA 4O3UA 2PGQB 1SFIA 1P03A 2ZU5A 1T31A 2A4GA 1GL1A 3GY7A 1EZQA 1JRSA 1P3EA 2SGAA 1HAXB 2P3TB 2Y7ZA 3GCTG 1SLWB 2VU8E 1EATA 1EKBB 1SGEE 2J92A 2UUFB 4IN1A 1ANEA 1C2DA 1GBJA 3SV7A 3JZ1B 1Y5BT 1Y3YA 2Z9JA 1O3FA 1K1OA 2ZZUH 2BXUH 2HGTH 1C4V2 3S9CA 1OWEA 2A32A 4Q80A 1O3EA 2BTCE 5F03A 2Y5HA 1K1MA 3TJNA 2FS8A 3ZV9A 5CMXH 3A8CA 1WSSH 1SHYA 3ZVFA 3ZVBA 2Z6BD 3HKJB 2D8WA 3L33A 1ZPCA 2BXTH 3MU5A 1TX6A 2FZZA 1XM1A 4X2WA 1O37A 3CENA 2W3KA 1ZSKA 2BOKA 3F1SB 1SG8B 1PPCE 1UTMA 1YPKH 4IMZA 4ASHA 1S6HA 4HI3A 1BIOA 4GHTA 4X1QU 2P8OC 1J9CH 1C5MD 3RXCA 3M5MA 2CN0H 4HGCA 1T4UH 2ZHWH 1VCWA 3QZRA 2YNBA 2EA3A 3LGIA 3M35A 2ZCHP 1CA8B 4O97A 1DM4B 2EI8A 1FV9A 1GJ5H 1QJ7B 1V2PT 4IBLH 2XBYA 1QNJA 1CBWB 4JZ1A 3TJVA 2FYRA 1OP0A 3A7TA 3OSYA 4THNH 4X8TH 3BEFB 1MTVA 1V2RT 2ALPA 1A61H 1BZXE 2QY0B 4WY3A 3FZZA 4B73A 5CE1A 4ABDA 5HMAA 5JBAS 1C5RA 1TMTH 5EU8A 4DURA 3SOSA 3UOUA 1LMWB 2XBXA 4Y10E 4NFFA 1EPTC 2V0BA 1K1LA 2ZFFH 1UVSH 1A1RA 1MU8B 1C1WH 1XXFA 3KNXA 3QK1A 4X6NA 2ILNA 1QBNA 2JKHA 3RLWH 5AFZH 3H5CB 3PMAB 1OOKB 1ZRBA 2C8YB 4GCHG 4ABAA 3SQHE 1SGPE 1V2WT 2GT8A 3FP8E 5FPTA 5GCHG 1FQ3A 2HOBA 2G8TA 5GPIB 1QL7A 4ZHMU 1OX1A 1F0TA 1O3HA 1GI0A 1XUJA 3LGWA 3TGKE 3SORA 1C5OH 3UREA 5ESBA 3F6UH 7ESTE 3ZZ6A 1BRCE 4WXVA 1HXFH 1EX3A 3LC3A 1F0SA 3SV9A 2ZHQH 2VINA 5BPEA 2JH0D 1TPAE 2Z9KA 1GL0E 2OINA 1ZMNA 2AIPA 5JPMH 4O3TA 1YKTA 4CR5A 1IQMA 4WXIA 3NPSA 3M3VA 4BTUB 2FMJA 3T62A 2ODQA 2ZNKH 5SGAE 1J17T 1DSUA 2BD8A 3P8GA 4X8UH 1QGFA 1W0ZU 5L30H 1IQNA 1O2RA 2A7HA 1O2YA 1GCTB 4UDWH 1CHOF 3S7HB 2GDDA 3AAUA 3EA8A 3ODDA 4MPUA 3UR6A 2WV5A 4TY6A 5T3HA 2R2MB 1GBHA 1FIZA 4GPGA 1SPJA 1MZAA 3NCLA 2JH5D 2TGAA 4YT6H 2SGDE 2H6MA 2RDLA 4BNRA 1O2MA 4I8JA 1P09A 4Y76A 1C1MA 4FUBA 3HPTB 1GBMA 1RIWB 3MO3A 1ARCA 1Z8JB 3ENSB 2ZWLH 2DE9A 1S81A 4ZMAH 1O33A 3MH6A 1SR5C 1AO5A 1RGQA 3VGCC 2A0QB 1Y8TA 4B2CA 2D26C 4NA7A 8GCHG 1ELFA 1BB0B 2QF0A 3EE0B 3B9FH 1BJUA 1Z8IB 1BJVA 4Y7BA 2BLOA 1TNKA 2ZDAH 1TQ7B 1W7GH 1YPHE 4MVNA 5FX6A 2JETC 2ZKSA 5EW1H 1GVLA 2IJOB 3A86A 1AY6H 2GV6A 1VGCB 2V6NA 1TMBH 1AE5A 1L0ZA 3MNXA 1TX7A 1NESE 2OQUA 2CHAB 1OYTH 1AZZA 3I77A 1LHEH 3V13A 1C9TA 4PROA 5EXMA 1Y3XA 3HK6B 4LOYH 1GI1A 1LVOA 5EQRA 2ESTE 5J4SA 1DE7H 1BA8B 1QQ4A 2BD7A 4FUIA 5TCAA 4WH6A 3LDXH 3TH2H 2C3SA 3UQVA 1GHBF 1SGYE 2F9VA 4UE7H 4ABHA 2OBOA 2FTLE 3SU4A 2GGVB 2I6QA 3SU3A 1FN6A 4AOQA 1C2LA 4NA9H 2BMGB 2KAIA 2V3HH 5CHAC 4R8TB 3ZVAA 1HNEE 1GBLA 1HAIH 3RXDA 4LXBH 1FAKH 1XUHA 1FZZA 3MFJA 3SJ9A 3ELAH 1ARBA 1O5GH 3V12A 1A3BH 3OX7U 4JYUH 2A5AA 3GY3A 1G37A 2J95A 1QRZA 3HKIB 3KF2A 3GCHC 1J14A 1S6FA 4CHAB 1IQFA 2ZGXH 4NSVA 2GZ7A 1FNIA 2YNAA 3SJKA 1K2I1 4U2WA 3GY5A 1MCVA 4GLYA 3QZQA 1MTUA 5DP6A 3RXPA 2UWPA 4DY7B 1C5TA 3Q3XA 4XOJA 4FVBA 3U1IB 1E35B 1AVXA 1Y3VA 1ZMLA 2RA0A 4AZ2B 2H2ZA 1L4ZA 4KP0A 5EQQA 1PQAA 1LHCH 4A1VA 4O9VA 2JH6D 1ZR0A 1AB9B 1O30A 2HALA 1SGFG 1WTGH 5HYOA 3V3MA 3AAVA 1EAWA 1P0SH 2STBE 2EI7A 1NO9H 4YOJA 4BXSA 4Y8XA 5ETXA 4OS6A 5HM9A 1EZUC 3RMNH 2FOMB 5JYIA 1KXDA 1HAYB 1VCPA 1OWIA 3SUEA 3ZVEA 1SBWA 1O0DH 1W2KH 1VJ9U 2TRMA 2BLVA 1GDUA 4ZKSU 2XC5A 4CREA 1S82A 3F9EA 1P2MA 3H7TA 1P9SA 4YLUA 1INCA 2D1JA 1YCPM 2ZTYA 3SV2H 1NS3A 2ZU4A 1ABIH 1PYTC 1SB1H 3AW0A 1O3OA 1YGCH 3UY9A 2UUYA 1CA0C 4AORA 3VXEH 2G51A 3MTYA 3MHWU 1H9IE 1ELGA 3QO6A 3KQBA 2BX3A 1DICA 4IS5A 1Z7KA 3MYWA 3FP7E 4O03A 4UFEH 1BDAA 3E90B 1JOUB 1IAUA 3NKKA 5EQSA 2ZDNA 1EOJA 1GBKA 1TOCB 2ULLA 1ABJH 3BTGE 1GVKB 1UCYK 5C20A 1TPPA 1GJAB 3UUZA 1QB9A 1AZ8A 3U98H 4X8VH 4OGYA 2GZ8A 5F6MA 2XCNA 2HRVA 1LCYA 1UTQA 2ZP0H 2J38A 1UTKA 1O2TA 1T4VH 4FU8A 3U9AH 1GBCA 2BDAA 1MTNC 3V7TA 3MOCA 1BBRH 1UVTH 1BMLA 2C93B 4IGDA 1KLTA 2ZGHA 5DP3A 1EZSC 2G52A 1Z1JA 2BDBA 1EZXC 3BEIB 3TIUA 6CHAC 1LHGH 1V2LT 3TK5A 3SU6A 5EOKA 3FFGA 3QUMP 3E6PH 1BQYA 3A84A 3W95A 3BEUA 1BITA 2ZC9H 2QA9E 5C67A 1DVAH 2FOEA 2AMDA 1TNHA 1CT4E 1DANH 1O5CB 2B5TB 1P3CA 3Q00A 1BCUH 1F7ZA 5TJXA 2DE8A 5JDUB 1C1NA 1SI5H 1ZGIA 3G01A 1XMNB 3P8OA 2Z9GA 3EYDA 2ZDVH 1UVOA 1O38A 5AHGH 2A45B 1FI8A 2GVFA 1UK4A 1WAYB 2OLGA 1GHAG 3K9XB 1V2KT 2FEQH 3SNEA 1C1SA 1V6DA 3DT0H 2CF8H 4YM9A 5EPNA 1YCPK 5E0JA 1GMCF 1LKBA 1FJSA 5C1YA 4WJG2 1SC8U 2ZO3H 1DXPA 2GZ9A 5F8ZA 1Q31A 3BG4C 4DOQA 2BZAA 3UFAA 4AN7A 1UTNA 5LPRA 1SGNE 5DP7A 1E38B 3DHKH 2F83A 1A7SA 1GI8B 4I7YH 1H8IH 4D8NA 1TRNA 2P94A 3PTNA 2O9QA 3ZZDA 1OP8A 1A0LA 3JZ2B 3KIDU 1GBFA 1DY8A 4BAQB 2XRCA 1DXWA 1VITF 4JK5A 1GMHF 1THRH 1LPGB 3O8CA 3P70B 1YPMH 2IPHA 2ZEBA 2OC0A 4GHQA 4DCDA 3MO9A 2A7JA 2PKAB 2B8OH 1QJ6B 3KQDA 1GI2A 1O3JA 3A80A 4HZHA 4Z6AH 1T8OA 1O3NA 1SSXA 2G5VA 1O5AB 1C5LH 1MBQA 2P95A 2ZFRH 3UR9A 3KL6A 1C2JA 1O5DH 1VJAU 3L3TA 3PLPA 1ZTKA 2FODA 4Y6DA 2NU2E 1C1TA 1PYTD 1FN8A 2FO9A 3LT3A 4X6OA 4JMYA 2PHBA 2PR3A 1DLKB 3BV9B 2Z3EA 4INLA 1Q2WA 2BVSH 2Y82A 3LPRA 1S0QA 4KKDA 5DJ7A 3TJUA 3RXGA 4IMQA 1SGFA 3MU1A 5IYTA 3GDVA 1P8VC 3BTFE 1ZOMA 2G4UA 1RRKA 1NRRH 3URCA 1O3CA 1QBVH 2CJIA 2F9NA 3NZIA 1TB6H 3GDSA 4KTUA 2AFQB 1TALA 2ZHDA 1O32A 1N8OC 4Y8YA 5PTPA 3ESTA 3QTVH 4GAWA 5DP8A 2FXRA 1ELBA 3HK3B 1BT7A 3A7WA 1GI5A 3UNQA 5C2ZA 3O8RA 1D3QB 1T7CA 5GWZA 4ABIA 3EGKH 3BTDE 3AW1A 4I8KA 1DWCH 1BTHH 1HAGE 1DWBH 1ZTJA 4K5ZA 1K1IA 3SN8A 1D3TB 1GG6B 4OGXA 1C1VH 3SU2A 2W26A 1QB6A 1XKBC 1L4DA 1MAXA 4J1YA 1W11U 1C1PA 1Y3UA 1MTWA 2WYGA 3GCOA 3MO6A 1GHWH 1WV7H 1OWDA 2WUBA 1BMAA 3PO1C 1BBRK 1P2JA 4M7GA 2FOGA 8LPRA 2GCTC 4VGCC 1A46H 2SGEE 1TFXA 4ISHH 3SO3A 2GDEH 4BTIB 1HLTH 1W10U 1GHYH 2VGCC 3RXQA 1WYKA 1BHXF 4K1SA 4XSKU 2FESH 2XC4A 4FU7A 3BIVH 5DGJA 1UJ1A 3TH4H 5K0HA 1MZDA 1TGBA 4ABEA 1NU9A 1GJDB 4Q7YA 2FPZA 3MH5A 4AFUA 1ZPZA 2BD2A 4YZUA 3OU0A 4FXGH 3KHVA 3A82A 1HXEH 1LPZB 3K6YA 1UTJA 2FM2A 3RXTA 2KAIB 4IC6A 1YYY1 2QXIA 3CS0A 1G36A 2XCFA 3E8LA 1O2KA 1YPJH 1O5BB 2XWAA 3GCTF 1O3LA 2BDIA 2ZCKP 2A5IA 1CO7E 5FXLA 1C4U2 2UUKB 2WUCA 2BD5A 2ZCLP 3TH3H 5LH8A 3PV4A 1UTLM 1V2UT 3PMHB 3RXOA 4YOGA 1DITH 3ZVDA 1HBTH 4X1RU 6GCHF 1A2CH 1QBOA 2RCEA 1ZSLA 1MCTA 3LJOA 1C1UH 2Y81A 1ZJDA 3RP2A 1NRNH 4D7FA 2PUXB 4LZ4B 1HGTH 1A4WH 3RM2H 3E16B 2FOHA 3M7QA 5E0HA 5GJ4B 2NU1E 1MUEB 1EJNA 1TABE 1C4Y2 1P2QA 2O8LA 3BTKE 2R3YA 1O2VA 1HFDA 3W94A 1TGTA 2GMTC 2P8OB 2NWNA 4TPYA 3Q3YA 4WMEA 2YOLA 2C8ZB 3A8BA 1O2OA 4DJZB 3RU4T 4DW2U 1EOLA 1DSTA 1TONA 3ATWA 2SGFE 3A7VA 1DX5M 2QGRA 3TLOA 3RMLH 1O3KA 3U8OH 4E7NA 1H4WA 3LC5A 1GI7B 4I33A 1GI9B 1O39A 4INHA 4K8YA 1SGRE 3UWIA 1PJPA 3M5NA 3B8JA 1PPEE 1YLCA 2D2DA 3M61U 1O2JA 1G2LA 2ZQ1A 4JCNA 1C5VA 2BY7X 1J16A 1GPZA 3T28A 5L6NH 3RXFA 4AGJA 3M5OA 6LPRA 1NFUA 2AERH 1GBIA 4BOHA 3LU9B 4INKA 2PKAA 3TJOA 2AGGX 3RC5A 3BF6H 1L1JA 2ZTXA 5ESTE 5FBIA 2VIVA 3IG6B 1D3PB 1HAHH 1ELEE 5C5NA 1UO6A 2OBQA 4J2YB 4K69A 1ACBE 2VIPA 1RIWC 1FLEE 4CH8B 1FIWA 1SQOA 3PLKA 4NIVA 2ZFTA 1OSSA 7GCHG 1MU6B 1RTLA 3DFLA 2BOHB 2ZPQA 1WUNH 1LHDH 1DT2A 1H9LB 1O35A 2DUCA 2TIOA 1CGIE 2ZQ2A 1JBUH 4ZUHA 5GCHF 2BDGA 1ZPBA 1JMOH 4CBNA 3F68H 1F5KU 2AMQA 4E7RG 3E0PB 1PPZA 3A87A 3BIUH 1NFYA 1E36B 1EB1H 2PTCE 3SNAA 4CH2B 2XBWA 3NUMA 1QL8A 4B75A 4B74A 2GP9B 2ZFPH 5E8EH 1C2FA 1P05A 3ATMA 3LGYA 1SQTA 4ZROA 1UCYH 2BY5X 4A5TS 1DFPA 3EAJA 1AGJA 2P16A 4ZKRU 1V2VT 2CHAC 3T26A 1GHBG 1WTHD 1IHSH 2GTBA 1LDTT 2HLCA 2ZI2H 2FOAA 4A92A 2O8WA 3RXAA 4X1SU 1Y5AT 5FPSA 1AIXH 1NRPH 2BX4A 4NIYA 5AVDA 3UTUH 4Y0ZE 1P2KA 3T29A 1WQSA 1M9UA 1PPBH 2A4QA 2Y6TA 1P12E 3LH3A 4UEHH 4Y8ZA 5FPYA 5L2YH 3ZZ9A 1WOFA 2FS9A 4TYDA 1O3MA 1LHFH 2R3UA 1HPGA 2ZECA 2Y5GA 3KCGH 4DGJA 1GWAA 2V3OH 4OS7A 2UWLA 3Q77A 5HXFA 1G3DA 1TGSZ 3ZZCA 4AFZA 1QTFA 1V2TT 3GY8A 4AB8A 4CRDA 1THSH 4ZKNU 3QTOH 1HJAC 5JBTA 1KTSB 2BY6X 2TGTA 1HDTH 1H1BA 1Y3WA 1YCPH 1DY9A 2JETB 4R0IA 1O36A 5BRRE 4BANB 1HAZB 2FYQA 1FXYA 1GBDA 3N7OA 4NZQA 2ZHEH 2HVXA 1KDQA 1BUIA 4H42U 2Z94A 1QRWA 3SGQE 4CRCA 4I31A 1DWDH 5FAHA 1C5SA 1UVPA 3A88A 4KGAA 2ANWA 2PFEA 2Z3CA 4KTCA 1FPCH 3GCNA 1T8MA 4I8HA 4A1TA 5I46H 1AB9C 3R3GB 1TA2A 5A8ZA 5JBCS 3CP7A 1WU1A 4A7IB 1GJBB 1U6QA 1C1OA 2W5EA 3I78A 2G5NA 3ZVCA 5TCCA 5F8XA 1N6YA 1MKWK 3BSQA 3M36A 2VVVA 3M37A 3AVZA 3BTHE 5CHAB 1O3IA 1GBEA 2ODPA 1QHRB 5FX5A 1CU1A 2VWNA 8ESTE 3NK8A 5DP9A 1FPHH 2QN5T 2BQ7B 5JB9S 4MG3A 1LKAA 1BTXA 1GGDC 1GMDF 2WPHS 3UWJH 3KGPA 3EQ0H 1L1NA 2B7DH 2WINI 3MNBA 3SGAE 1G30B 2STAE 3SZNA 3MH4A 1UHBB 3M3TA 3GCHB 1T8LA 5F8TA 3TGIE 1E0FD 1P2IA 1CGHA 3LH1A 1F5RA 1ZHPA 4ZH8A 2GV7A 4LK4A 1E34B 3ITIA 1YP9A 3PWCA 1C9PA 1IQLA 4MQAA 1N1LA 5DKMA 1B7XB 3D62A 2OXSA 4X1PU 1ZJKA 1AKSB 1IQKA 2GCHG 4DVAU 3ODFA 1JIRA 3A8AA 3FP6E 1J8AA 1CT2E 1EAIA 1OWJA 3PB1E 4X2XA 1DWEH 1Z1IA 1ZLRA 4H6SB 1PPHE 1RS0A 2V35A 4A6LA 1O3AA 3STIA 2ZDMA 2W7UA 1KXCA 1OXGA 1HCGA 5K7RA 2VWMA 4DT7B 3PROA 4DIHH 1G3BA 2QC2A 3RM0H 3F9FA 1XVOA 1GI4A 1QURH 1ELAA 3RU4E 4ISLA 1DOJA 2OCVB 4TPIZ 1H9HE 4NG9H 4AB9A 1P2OA 1C5QA 1DS2E 3LOXA 1NM6A 2PUQH 2ZFSA 3DFJA 3QX5H 1ZSJA 3RXSA 3U8RH 4A1XA 3K6ZA 1RJXB 1VZQH 2TBSA 2AH4X 1QCPA 1O3GA 4FVDA 2TGPZ 1AFQB 1QY6A 4FUEA 1CA0B 2VNTA 1FY1A 2AEIH 1GMCG 1GVZA 1ESAA 1ZRKA 1Y5UT 3QWCH 3Q3KA 2W3IA 4XFQA 1VITH 5EXLA 4E06H 3M7TA 1AE8H 1EASA 2RA3A 1C1QA 4Y11E 3BN9A 4MPVA 4AYYB 1F0RA 4ZAEA 5B6OA 3MU0A 1NTPA 3E0NB 2BLQA 1MH0A 1QJ1B 3VB3A 5E2OA 1HB0B 1ESTA 1SFQB 4IC5A 1E37B 1ESBA 3EA9A 1UTPA 2PGBB 2AIQA 3RXRA 2WPIS 2HPPH 1O2SA 1SL3A 1XX9A 3LGTA 5FCKA 1YPLH 4U30A 4D76A 4TY7A 1VITG 1L1GA 1O2UA 1MTNB 1NN6A 3E1XB 2F9BH 2ZDLA 2GX4A 4UD9H 1A5IA 2VJ1A 2XW9A 3A7YA 4B2AA 1AU8A 1C2HA 4Y0YE 1ELTA 1G9IE 3QN7A 9ESTA 3PWBA 2BVRH 1JWTA 1LO6A 3TNTA 2ODYB 1EXFA 2PLXA 2VVCA 3VB6A 2R0LA 5HM2A 1ANCA 4FUJA 3I29A 2TPIZ 1NRQH 3KN2A 3SJOA 2FWWA 3MI4A 2ZU3A 2PV9B 4KELA 5DP5A 4FUHA 4LZ1H 5E0GA 2FLRH 1UCYE 4XBBA 1NROH 4Z0KA 1XUKA 3CS7A 1F92A 3MNCA 3TU7H 3ATKA 1NU7B 1GJ8B 1TMUH 1RFNA 1SGTA 2XTTB 1JIMA 3ZZ8A 2FI4E 1O2IA 4NZLA 1KXBA 1GI3A 3IITA 3SW2B 3A81A 4X2YA 2C8XB 2J94A 3HATH 3RXVA 3RMOH 9LPRA 1RTFB 1FUJA 2XC0A 2PKSC 1JRTA 3MMGA 4CRFA 3BG4B 1XKAC 1GHAF 3LKWA 4RKJB 4AFQA 3SUGA 1ZHMA 5L2ZH 3S9AA 4I8LA 5G4BA 1S85A 1SGIB 5JB8S 4FUCA 2WV4A 3RXJA 1UMAH 1AN1E 2HNTC 4MNVA 1O5FH 1XUIA 4YESB 1GDQA 1O5EH 4X1NU 3NWUA 4DG4A 2ANKH 5JBBS 3ATLA 2OC1A 3VB4A 1CHGA 4CRAA 3MU4A 1D3DB 1QL9A 3A83A 3S0NA 1XXDA 1ORFA 4SGAE 1MBMA 1FMGA 1BRUP 1IOEA 4ISOA 1W7XH 2WPJS 1MMJN 3GY2A 1THPB 2A2QH 2VWLA 1TOMH 1UHBA 4WH8A 4ISIH 4NFEA 4YLQH 1UVUH 2H5CA 2WPKS 2UWOA 2RG3A 1BHXB 2ALVA 3STJA 1TPSA 1Z8GA 3RUOA 3TK6A 2AMPA 2AGIX 2BY8X 3PMBB 1J15A 1C5ZB 4X6PA 1OWHA 3A89A 1AI8H 1HJ9A 4AG2A 3FVFB 2CV3A 2BYAX 5LPEA 1EB2A 1ID5H 1AKSA 1TQ0B 1KSNA 4X6MA 2WPMS 1YC0A 5C3NA 2Z3DA 3RMMH 2PSYA 3A85A 2WYJA 3VXFH 2BZ6H 2QAAA 2AGEX 1G32B 2NU4E 1K9OE 1SOTA 4MDSA 2BQ6B 5A0BA 4Y71A 4Q2KA 1G3EA 1SGDE 3SBKA 1MQ5A 1N8OB 3QGJA 1FONA 2BDHA 2PW8H 2HNTF 4U01A 3UIRA 1KIGH 1KYNA 2ZPRA 2XWBI 4MNWA 1GJ7B 1TLDA 2FTMA 1V2MT 2BD3A 2BY9X 6GCHG 3RXMA 2FI5E 4H6TA 4GVUA 2ASUB 5GDSH 1GHZA 1K1NA 4JZEH 1QA0A 3C1KA 1HIAB 4K2YA 1CBWC 2EC9H 1NT1A 2PSXA 2BLWA 4RN6A 1TAWA 2W7SA 2C4FH 3RC4A 3U8TH 4F4OC 1C2MA 1KDQB 2B9LA 1D9IA 1YBWA 4AFSA 1W8BH 5FHTA 4OS2A 3PO1B 2ZPSA 2GCTB 4VGCB 4X8SH 1D6RA 1YM0A 5I25A 2VGCB 4E05H 1N6XA 5AF9H 2B0FA 4NCYA 1G2MA 1C2IA 4SGBE 5EPYA 1CT0E 4XBDA 1ZZZA 1C2EA 1TNJA 1BOQA 3URDA 4CRBA 1TYNA 5DPAA 1SLVB 1ZTLA 1C5PA 1GHVH 4Y79A 4YTAA 1DUEA 3OY5U 1TNLA 1Z6JH 5DK1A 1XVMA 1GBTA 4F49A 4RSPA 4AGKA 2VVUA 4IW4E 1NPMA 1QB1A 1YF4A 1HAPH 2A4OA 1O2WA 1S83A 1LPKB 3M7UA 4WWYA 1A5HA 2FOBA 2H9TH 2BHGA 1WQVH 3ZZ5A 1AUTC 2M5TA 1O2GH 3KEEA 5LPFA 1D4PB 3UNSA 2ZU2A 2TGDA 2VB0A 2QXJA 2J2UA 3RXBA 1B0FA 1BBRE 1A0JA 2O8TA 1K1PA 4HTCH 1NC6A 5EW2H 1GBBA 1UK2A 1CHOG 1AVWA 1O3BA 2Y7XA 1KY9A 1MKWH 3HGNA 1MD8A 1IHTH 5ABWA 1BTZA 5A2MH 1EAUA 1ZYOA 1GCTC 3ZZ4A 1SHHB 1S5SA 3GY6A 3SUFA 1ZHRA 1QA7A 1OP2A 4FU9A 4GSOA 2H9HA 1Y59T 4NGAH 1O2QA 3VEQB 4UFGH 1A0HB 1V2JT 3ZZAA 3EDXB 1B5GH 4D9RA 3LGVA 3FANA 1CQQA 2GMTB 5FCRA 1EPTB 3K2UA 3RXHA 4ABBA 3TITA 1P11E 2GT7A 1A5GH 2OC8A 2PTNA 1PQ5A 5A0CA 3PLBA 1V2OT 3RLYH 2ANMH 1SLXB 2QYIA 2VIQA 2BDYA 2H1UA 4Y7AA 1EJAA 2Q6FA 2FX6A 4GCHF 4DIIH 4I32A 2GD4B 1GHXH 3PTBA 2P3FH 1VR1H 1BRAA 2BM2A 1F2SE 3ATIA 3TPIZ 1OPHB 4K1TA 6ESTA 1K28D 5C1UA 4Q7XA 1HUTH 1P9UA 5EXNA 1TBQH 1SOZA 1AHTH 1SMFE 1IQHA 1MTSA 5A8YA 2SGPE 1Q3XA 5EODA 3LIWA 1C1RA 2LPRA 4WVPE 4UONA 1GCDA 3E3TA 4JYTA 4ZXYH 3MH7A 2J34A 4MPXA 1K1JA 2ZHFH 1K22H 1VGCC 1SLUB 2F9OA 2QF3A 4X0WU 1NZQH 3BTME 4B71A 1C2GA 2C8WB 1A3EH 3DUXH 2G55A 4ABJA 2H9EH 3BTEE 1GJ9B 4B76A 1UTOA 2P3UB 1C5NH 3M5LA 4YOIA 5C1XA 1QFKH 3BG8A 4FUGA 3SHAH 7LPRA 3SNDA 2F9UA 1AUJA 3DA9B 3UNRA 4WMFA 3GY4A 2HNTE 1PQ8A 3MNSA 1P57B 4ISNA 7GCHF 1F5LA 3MWIU 1TGNA 5A8XA 3U69H 1SVPA 2QXGA 4ZXXH 3KQCA 1TWXB 1ELDE 4NSYA 3PMJA 5DG6A 3OTJE 1OYQA 1JXPA 2UUJB 3VB5A 3VGCB 2O8MA 1GJCB 5HGGA 3RXUA 4JK6A 1AWFH 2VWOA 1ANBA 1MKXH 1T32A 4JZFH 1Z6EA 2C90B 2EI6A 1HJ8A 2F3CE 3ZZ3A 5T6GA 2VH6A 4CRGA 3P92A 4XDEA 2J9NA 4OS5A 4GUXA 4KTSA 1PFXC 8GCHF 2NU3E 1ETSH 4Q7ZA 3S69A 1UK3A 3SNBA 3UOPA 1HIAA 4CHAC 4FUDA 2ZA5A
chains in the Genus database with same CATH superfamily
1GJ6A 2AYWA 1O3PB 2CGAA 3D65E 3A7XA 4MTBA 3RU4D 2P59A 3DSOA 3SV8A 1GBAA 1ANDA 2FOFA 2O8UA 3KQ5A 2WSSD 2K1QA 4ZCNA 1HAOH 3SQEE 1GMDG 3B23B 1IQJA 5IDKA 1AD8H 4BAKB 1BMMH 1FY4A 1O2PA 4MNXA 3PRDA 2SFAA 3Q76A 2EEKA 4TWYA 3UB0A 5EG4A 5CDFE 1SQAA 1BTYA 4NWLA 3T27A 2FDAA 3BTQE 1FAXA 4HG6A 1T8NA 1DUAA 1BTPA 1P10A 4JZIA 4BAHB 1HJAB 2Z9IA 1B0EA 4ESTE 1ZGVA 4UFFH 1DDJA 3T5FH 4RKOB 1TX8A 2ZTZA 1V2NT 1P2NA 1PPFE 5DP4A 1KLIH 2Q6DA 8KME2 5J4QA 3TGJE 3SGBE 3NXPA 1P06A 1XUGA 2ZF0H 1TRMA 4AX9H 1C5YB 3D23A 5T6FA 1K21H 1TBRH 4FUFA 2CF9H 3O8DA 3ZZBA 2FI3E 1BTUA 3V0XA 1O34A 2VIWA 2VBCA 3T2NA 4YO9A 4JYVH 2QCYA 4U32A 4NIXA 3KQEA 1P04A 2WPLS 1AFEH 2A1DB 3C27B 1ZMJA 2HWLB 1H8DH 1HYLA 2Y80A 1IQIA 1CSOE 5EGMA 3A8DA 1WBGB 2VIOA 3HGPA 4K1EA 3OTPA 1CE5A 1YLDA 4ZKOU 2OTVA 2NU0E 3D49H 3UPEA 1OS8A 4NWKA 1O2LA 2IJD1 2XBVA 1HAVB 3GOVB 3QDZB 4TT3D 1KLJH 3EA7A 2BB4A 4BTTB 1NRSH 1EPTA 1W13U 4ABFA 2ANYA 1TGCA 1W0KD 2SNVA 2AS9A 5C5OA 1GGDB 1IQGA 3R0FA 1YPGH 4X2VA 2W6JD 2A31A 1TIOA 5AFYH 1OKXA 1HRTH 4HFPB 7KMEH 1ETTH 2P93A 3VFEA 3SJ8A 1AFQC 5E2PA 1GJ4H 2R0KA 4AYVB 2R2WU 4WMDA 1EP5A 3RDZA 1LVBA 2FX4A 3OY6U 1GI6A 2A7CA 2OC7A 2ZGJA 2GKVE 4NA8A 2FP7B 3OYPA 3DD2H 1KTTB 2QXHA 3U1JB 1S0RA 2Z7FE 3FZDA 4XE4A 5DO4H 2A4RA 2FOCA 2H5DA 1IQEA 5H4IB 2F91A 1RD3B 3P8FA 3P6ZB 1BRBE 1MAYA 2R9PA 2QIQA 1FY5A 2CMYA 1PQ7A 1KXAA 1W14U 3P95A 4TWWA 2GCHF 4AG1A 3WW7A 3SU0A 1LTOA 1DPOA 1TA6A 3GYLB 5GXPA 3H7OA 1F0UA 2XNIA 5LGOA 3GYMA 2XXLA 3AASA 1O2ZA 1O31A 1WCZA 3IWMA 3T25A 4CR9A 2BD4A 3WY8A 1TRYA 3VB7A 3E91A 3PYHA 1MKXK 3SUDA 2J4IA 1O3DA 4ZHLU 1EP6A 1ELCA 2IN2A 1X7AC 4BXWA 3RXKA 1CVWH 4BAOB 3SYJA 1XUFA 2OP9A 3BTTE 1RTKA 1TNIA 1FDPA 2Q6GA 1GMHG 1Z8RA 2ZG0H 4K60A 3ZYDA 4B2BA 4XRNA 1G3CA 3QLPH 1EUFA 3SI3H 3M3SA 2FLBH 1BTWA 1W0YH 3ZVGA 1C2KA 2F4LA 6CHAB 3P8NA 4XBCA 3SV6A 1KXEA 1MQ6A 2OUAA 2I6SA 1FY3A 4CBOA 2THFB 2BDCA 2ZIQH 5A0AE 2ZDKA 2ZU1A 1D6WA 1TPOA 1EJMA 2A5KA 3GISB 3LJJA 4MLFB 1V2ST 2BVXH 1W12U 4OS4A 1L2EA 1NFWA 1GDNA 3F9HA 1AMHA 5T6DA 4QT8C 4YT7H 2OQ5A 4B1TA 1NBME 2LNCA 4UFDH 4D7GA 2IOTA 3F9GA 3FAOA 1LQDB 1E1RD 1OWKA 2F9PA 4K8BA 3TK9A 1SGQE 2Q1JA 1AVGH 4MNYA 3TVJB 4H4FA 2SNWA 1DLEA 3K65B 5FBEA 3VPKA 2HPQH 1O2XA 2BQWB 1NFXA 3S7KB 1S84A 1TE0A 1CGJE 2CXVA 1QIXB 3F0OA 4WF8A 4OS1A 1AQ7A 2KX4A 3GICB 3PM3A 2AHME 2JIZD 2J5UA 1V2QT 3TNSA 1C5XB 4NIWA 1SGCA 1TBZH 1QR3E 3ZYEA 3SNCA 1MD7A 1ETRH 1LVMA 5A09A 1BMNH 1Z71A 2PP6A 3RXIA 3QGNB 1P02A 2L6OA 3PV5A 2ZGCA 3S9BA 2QF4A 2SGQE 3L6PA 2VIDA 3ZV8A 1W3CA 1LVYA 2FIRH 2QV1A 3SJIA 3MU8A 2OD3B 2A2XH 4BAMB 4D9QA 1C5WB 1YPHC 2XYAA 4IN2A 2Z9LA 2VH0A 2ZFQH 3N7EA 1LQEA 1QRXA 5KECA 4K3JA 3SI4H 1PPGE 5GIBA 3RXEA 1O2HA 3SU5A 1RXPA 1KXFA 4JZDH 1YPEH 1AWHB 1GG6C 1P01A 1QQUA 1V3XA 2PKSB 3LONA 1C5UA 1TNGA 3WWFA 3ZZ7A 2Y5FA 3P17H 1EQ9A 2G00A 3RC6A 4ABGA 2EQNA 1VCQA 1O2NA 1HV7A 2G4TA 3LGUA 4ZHAA 1FY8E 2G81E 3RXLA 2ZGBH 3O8BA 4MPWA 2PWXA 3OE7D 2BD9A 3UQOA 4I8GA 3BTWE 1NY22 1HAVA 3SU1A 3GDUA 3A7ZA 1EAXA 3SHCH 2HLDD 1ELVA 4O3UA 2PGQB 1SFIA 1P03A 2ZU5A 1T31A 2A4GA 1GL1A 3GY7A 1EZQA 1JRSA 1P3EA 2SGAA 1HAXB 2P3TB 2Y7ZA 3GCTG 1SLWB 2VU8E 1EATA 1EKBB 1SGEE 2J92A 2UUFB 4IN1A 1ANEA 1C2DA 1GBJA 3SV7A 2JJ2D 3JZ1B 1Y5BT 4RT0A 1Y3YA 2Z9JA 1O3FA 1K1OA 2ZZUH 2BXUH 2HGTH 1C4V2 3S9CA 1OWEA 2A32A 4Q80A 1O3EA 2BTCE 5F03A 2Y5HA 1K1MA 3TJNA 2WZQA 2FS8A 3ZV9A 5CMXH 3A8CA 1WSSH 1SHYA 2HVYB 3ZVFA 3NRLA 3ZVBA 2Z6BD 3HKJB 4I86A 2D8WA 3L33A 1ZPCA 2BXTH 3MU5A 1TX6A 2FZZA 2V7QD 1XM1A 4X2WA 1O37A 3CENA 2W3KA 1ZSKA 2BOKA 1H8HD 3F1SB 1SG8B 1PPCE 1UTMA 1YPKH 4IMZA 4ASHA 1S6HA 4HI3A 1BIOA 4GHTA 4X1QU 2P8OC 1J9CH 1C5MD 3RXCA 3M5MA 2CN0H 4HGCA 1T4UH 2ZHWH 1VCWA 3QZRA 2YNBA 2EA3A 3F2GA 3LGIA 3M35A 2ZCHP 1CA8B 4O97A 1DM4B 2EI8A 1FV9A 1GJ5H 1QJ7B 1V2PT 4IBLH 2XBYA 1QNJA 1CBWB 4JZ1A 3TJVA 2FYRA 3OAAD 1OP0A 3A7TA 3OSYA 4THNH 2LP6A 4X8TH 3BEFB 1MTVA 1V2RT 2ALPA 1A61H 1BZXE 2QY0B 4WY3A 3FZZA 4B73A 5CE1A 4ABDA 5HMAA 5JBAS 1C5RA 1TMTH 5EU8A 4DURA 3SOSA 3UOUA 1LMWB 2XBXA 2K0QA 4Y10E 4NFFA 1EPTC 2V0BA 1K1LA 2ZFFH 1UVSH 1A1RA 1MU8B 1C1WH 1XXFA 3KNXA 3QK1A 4X6NA 2ILNA 1QBNA 2JKHA 3RLWH 5AFZH 3H5CB 3PMAB 1OOKB 4B6EA 1ZRBA 2C8YB 4GCHG 4ABAA 3SQHE 1SGPE 1V2WT 2GT8A 3FP8E 5FPTA 5GCHG 1FQ3A 2HOBA 2G8TA 5GPIB 1QL7A 4ZHMU 3MQKC 1OX1A 1F0TA 1O3HA 1GI0A 1XUJA 3LGWA 3TGKE 3SORA 1C5OH 3UREA 5ESBA 3F6UH 7ESTE 3ZZ6A 1BRCE 4WXVA 1HXFH 1EX3A 3LC3A 1F0SA 3SV9A 2ZHQH 2VINA 5BPEA 2JH0D 1TPAE 2Z9KA 1GL0E 2OINA 1ZMNA 2AIPA 5JPMH 4O3TA 1YKTA 4CR5A 1IQMA 4WXIA 3NPSA 3M3VA 4BTUB 2FMJA 3T62A 2ODQA 2ZNKH 5SGAE 1J17T 1DSUA 2BD8A 3P8GA 4X8UH 1QGFA 1W0ZU 5L30H 1IQNA 1O2RA 2A7HA 1O2YA 1GCTB 4UDWH 1CHOF 3S7HB 2GDDA 3AAUA 3EA8A 3ODDA 4MPUA 3UR6A 1K0HA 2WV5A 4TY6A 5T3HA 2R2MB 1GBHA 1FIZA 4GPGA 1SPJA 1MZAA 3NCLA 2JH5D 2TGAA 3PRBA 4YT6H 2SGDE 2H6MA 2RDLA 4BNRA 1O2MA 4I8JA 1P09A 4Y76A 1C1MA 4FUBA 3HPTB 1GBMA 1RIWB 3MO3A 1ARCA 1Z8JB 3ENSB 2ZWLH 2YMSB 1YWUA 2DE9A 1S81A 5EJLA 4ZMAH 1O33A 3MH6A 1SR5C 1AO5A 1RGQA 3VGCC 2A0QB 1Y8TA 4B2CA 2D26C 4NA7A 8GCHG 1ELFA 1BB0B 2QF0A 4OM9A 5EIYA 3EE0B 3B9FH 1BJUA 1Z8IB 1BJVA 4Y7BA 2BLOA 1TNKA 2ZDAH 1TQ7B 1W7GH 1YPHE 4MVNA 5FX6A 2JETC 2ZKSA 5EW1H 1GVLA 2IJOB 3A86A 1MABB 1AY6H 2GV6A 1VGCB 2V6NA 2J98B 1TMBH 1AE5A 1L0ZA 3MNXA 1TX7A 1NESE 2OQUA 2CHAB 1OYTH 1AZZA 3I77A 1LHEH 3V13A 1C9TA 4PROA 5EXMA 1Y3XA 3HK6B 4LOYH 1GI1A 1LVOA 2OK5A 5EQRA 2ESTE 5J4SA 1DE7H 1BA8B 1QQ4A 2BD7A 4FUIA 5TCAA 4WH6A 3LDXH 3TH2H 2C3SA 3UQVA 1GHBF 1SGYE 2F9VA 4UE7H 2K8IA 4ABHA 2OBOA 2FTLE 3SU4A 2GGVB 4YXWD 2I6QA 3SU3A 1FN6A 4AOQA 1C2LA 4NA9H 2BMGB 2KAIA 2V3HH 5CHAC 4R8TB 3ZVAA 1HNEE 1GBLA 1HAIH 3RXDA 4M9FA 4LXBH 1FAKH 1XUHA 1FZZA 3MFJA 3SJ9A 3ELAH 1ARBA 1O5GH 3V12A 1A3BH 3OX7U 3PV2A 4JYUH 2A5AA 3GY3A 1G37A 2J95A 1QRZA 3HKIB 3KF2A 3GCHC 1J14A 1S6FA 4CHAB 1IQFA 2ZGXH 4NSVA 2GZ7A 1FNIA 2YNAA 3SJKA 1K2I1 4U2WA 3GY5A 1MCVA 4GLYA 3QZQA 1MTUA 5DP6A 3RXPA 2UWPA 4DY7B 1C5TA 3Q3XA 4XOJA 4FVBA 3U1IB 1E35B 1AVXA 1Y3VA 1ZMLA 2RA0A 4AZ2B 5T1VA 2H2ZA 4F48B 1L4ZA 2KCOA 4KP0A 5EQQA 1PQAA 1LHCH 4A1VA 4O9VA 2JH6D 1ZR0A 1AB9B 1UW7A 1O30A 2HALA 1SGFG 1WTGH 5HYOA 3V3MA 3AAVA 1EAWA 1P0SH 2STBE 2EI7A 1NO9H 4YOJA 4BXSA 4Y8XA 5ETXA 4OS6A 5HM9A 1EZUC 3RMNH 2FOMB 5JYIA 1KXDA 1HAYB 1VCPA 1OWIA 3SUEA 3DCLA 3ZVEA 1SBWA 1O0DH 1W2KH 1VJ9U 2TRMA 2BLVA 1GDUA 4ZKSU 2XC5A 4CREA 1S82A 3F9EA 1P2MA 3H7TA 1NBMD 5KEDA 1P9SA 4YLUA 1INCA 2D1JA 1YCPM 2ZTYA 3SV2H 1NS3A 2ZU4A 1ABIH 1PYTC 1SB1H 3AW0A 1O3OA 1YGCH 3UY9A 2UUYA 1CA0C 4AORA 3VXEH 2G51A 3MTYA 3MHWU 1H9IE 1ELGA 3QO6A 3KQBA 5F53A 2BX3A 1DICA 4IS5A 1Z7KA 3MYWA 3FP7E 4O03A 4UFEH 1BDAA 3E90B 1JOUB 1IAUA 3NKKA 4RI0A 5EQSA 2ZDNA 1EOJA 1GBKA 1TOCB 2ULLA 1ABJH 2KR7A 3BTGE 1GVKB 1UCYK 2J97A 1TPPA 5C20A 1GJAB 3UUZA 1QB9A 1AZ8A 3U98H 4X8VH 4OGYA 2GZ8A 5C17A 5F6MA 2XCNA 2HRVA 1LCYA 1UTQA 2ZP0H 2J38A 1UTKA 1O2TA 1T4VH 4FU8A 3U9AH 1GBCA 2BDAA 1MTNC 3V7TA 5FL7D 3MOCA 3OFND 1BBRH 1UVTH 1BMLA 2C93B 1EFRD 4IGDA 1KLTA 2ZGHA 5DP3A 1EZSC 2G52A 1Z1JA 2BDBA 1EZXC 3BEIB 3N99A 3TIUA 1LHGH 6CHAC 1V2LT 3TK5A 2EY4C 3SU6A 5EOKA 3FFGA 3QUMP 3E6PH 1BQYA 3A84A 3W95A 3BEUA 1BITA 2ZC9H 2QA9E 1S6LA 5C67A 1DVAH 2FOEA 2AMDA 1TNHA 3DSPA 1CT4E 1DANH 1O5CB 2B5TB 2XOKD 1P3CA 3FOAA 3Q00A 1BCUH 1F7ZA 5TJXA 2DE8A 5JDUB 1C1NA 1SI5H 1ZGIA 1OHHD 3G01A 1XMNB 3P8OA 2Z9GA 3EYDA 2ZDVH 1UVOA 1O38A 5AHGH 2A45B 1FI8A 2GVFA 1UK4A 1WAYB 2OLGA 1GHAG 2J98A 3K9XB 1V2KT 2FEQH 3SNEA 1C1SA 1V6DA 3DT0H 2CF8H 4YM9A 5EPNA 1YCPK 5E0JA 1GMCF 1LKBA 1FJSA 5C1YA 4WJG2 1SC8U 2ZO3H 1DXPA 2GZ9A 5F8ZA 1Q31A 3BG4C 4DOQA 2BZAA 3UFAA 4AN7A 1UTNA 5LPRA 1SGNE 3KYGA 5DP7A 1E38B 3DSGA 3DHKH 2F83A 1A7SA 1GI8B 4ACBA 4I7YH 1H8IH 4D8NA 1TRNA 2P94A 3PTNA 2O9QA 3ZZDA 1OP8A 1A0LA 3JZ2B 3KIDU 1GBFA 1DY8A 4BAQB 2XRCA 1DXWA 1VITF 4JK5A 1GMHF 1THRH 1LPGB 3O8CA 3P70B 1YPMH 2IPHA 2WPDD 2ZEBA 2OC0A 4GHQA 4DCDA 3MO9A 2A7JA 1YLNA 2PKAB 2B8OH 1QJ6B 3KQDA 1GI2A 1O3JA 3A80A 4HZHA 4Z6AH 1T8OA 4DT4A 1O3NA 1SSXA 2G5VA 1O5AB 2QE7D 1C5LH 1MBQA 2P95A 2ZFRH 3UR9A 3KL6A 1C2JA 1O5DH 1VJAU 3L3TA 3PLPA 1ZTKA 2FODA 4Y6DA 2NU2E 1C1TA 1PYTD 1FN8A 2FO9A 3LT3A 4X6OA 2QF5A 4JMYA 5KGOA 2PHBA 2PR3A 1DLKB 3BV9B 2Z3EA 4INLA 4XD7D 3VG8A 1Q2WA 2BVSH 2Y82A 3LPRA 1S0QA 4KKDA 5DJ7A 3TJUA 3RXGA 2M2AA 4IMQA 1SGFA 3MU1A 5IYTA 3GDVA 1P8VC 3BTFE 1ZOMA 2G4UA 1RRKA 5DSFA 1NRRH 3URCA 1O3CA 1QBVH 2CJIA 2F9NA 3NZIA 2W6ID 1TB6H 3GDSA 4KTUA 5C0UA 2AFQB 1TALA 2ZHDA 2CK3D 1O32A 1N8OC 4Y8YA 5PTPA 3ESTA 3QTVH 4GAWA 5DP8A 4Q4LA 2FXRA 3ZIAD 1ELBA 3HK3B 1BT7A 3A7WA 1GI5A 3UNQA 5C2ZA 3F2HA 3O8RA 1D3QB 1T7CA 5GWZA 4ABIA 3EGKH 3BTDE 3AW1A 4I8KA 1DWCH 1BTHH 1HAGE 1DWBH 1ZTJA 4K5ZA 1K1IA 3SN8A 1D3TB 1GG6B 4OGXA 1C1VH 3SU2A 2W26A 1QB6A 1XKBC 2KM0A 1L4DA 1MAXA 4J1YA 1W11U 1C1PA 1Y3UA 1MTWA 2WYGA 3GCOA 3MO6A 1GHWH 1WV7H 1OWDA 4B6FA 2WUBA 1BMAA 3PO1C 1BBRK 1P2JA 4M7GA 2FOGA 8LPRA 2GCTC 4VGCC 1A46H 2SGEE 1TFXA 4ISHH 3SO3A 2GDEH 4BTIB 1HLTH 1W10U 1GHYH 2VGCC 1E79D 3RXQA 1WYKA 1BHXF 4K1SA 4XSKU 2FESH 2XC4A 4FU7A 3BIVH 5DGJA 1UJ1A 3TH4H 5K0HA 1MZDA 1TGBA 4ABEA 1NU9A 1GJDB 4Q7YA 2FPZA 3MH5A 4AFUA 1ZPZA 2BD2A 4YZUA 3OU0A 4FXGH 3KHVA 3A82A 1HXEH 1LPZB 3K6YA 1UTJA 2FM2A 3RXTA 2KAIB 4IC6A 1YYY1 2QXIA 3CS0A 1G36A 3CNRA 2XCFA 3E8LA 1O2KA 1YPJH 1O5BB 2XWAA 3OEHD 3GCTF 1O3LA 2BDIA 2ZCKP 2A5IA 1CO7E 5FXLA 5DN6D 1C4U2 2UUKB 2WUCA 2BD5A 2ZCLP 3TH3H 5LH8A 3PV4A 1UTLM 1V2UT 5EJ1A 3PMHB 3RXOA 1SKYE 4YOGA 1DITH 3ZVDA 1HBTH 4X1RU 6GCHF 1A2CH 1QBOA 2RCEA 1ZSLA 1MCTA 3LJOA 1C1UH 2Y81A 1ZJDA 3RP2A 1NRNH 4D7FA 2PUXB 4LZ4B 1HGTH 1A4WH 3RM2H 3E16B 2FOHA 3M7QA 5E0HA 5GJ4B 2NU1E 2IPQX 3FKSD 2RDEA 1MUEB 1EJNA 1TABE 1C4Y2 1P2QA 2O8LA 3BTKE 2R3YA 1O2VA 1HFDA 3W94A 1TGTA 2GMTC 2P8OB 2NWNA 4TPYA 3Q3YA 4WMEA 2YOLA 2C8ZB 3A8BA 1O2OA 4DJZB 3RU4T 4DW2U 1EOLA 1DSTA 3UAIC 1TONA 3ATWA 2SGFE 3A7VA 1DX5M 5CHBA 2QGRA 3TLOA 3RMLH 2JDID 1O3KA 3U8OH 4E7NA 1H4WA 3LC5A 1GI7B 4I33A 1GI9B 1O39A 4INHA 4K8YA 1SGRE 3UWIA 1PJPA 3M5NA 3B8JA 1PPEE 1YLCA 3SZEA 2D2DA 3M61U 1O2JA 1G2LA 2ZQ1A 1QZ8A 4JCNA 1C5VA 2BY7X 1J16A 1GPZA 3T28A 5L6NH 2F43B 3RXFA 4AGJA 3M5OA 6LPRA 1NFUA 2AERH 1GBIA 4BOHA 3LU9B 4INKA 2PKAA 3TJOA 2AGGX 3RC5A 3BF6H 1L1JA 2ZTXA 5ESTE 5FBIA 2VIVA 3IG6B 1D3PB 1HAHH 1ELEE 5C5NA 1UO6A 2OBQA 4J2YB 4K69A 1ACBE 2VIPA 1RIWC 1FLEE 4CH8B 1FIWA 1SQOA 3PLKA 4NIVA 1COWD 2ZFTA 2YMSC 1OSSA 7GCHG 1MU6B 1RTLA 3DFLA 2BOHB 2ZPQA 1WUNH 1LHDH 1DT2A 5C94A 1H9LB 1O35A 2DUCA 2TIOA 4RT1A 1CGIE 2ZQ2A 1JBUH 4ZUHA 5GCHF 2BDGA 1ZPBA 1JMOH 4CBNA 3F68H 1F5KU 2AMQA 1VKYA 4E7RG 3E0PB 1PPZA 3A87A 3BIUH 1NFYA 1E36B 1EB1H 2PTCE 3SNAA 4CH2B 2XBWA 3NUMA 1QL8A 4B75A 2GJGA 4B74A 2GP9B 2ZFPH 5E8EH 1C2FA 1P05A 3ATMA 3LGYA 1SQTA 4ZROA 1UCYH 2BY5X 4A5TS 1DFPA 3EAJA 1AGJA 2P16A 4ASUD 4ZKRU 1V2VT 2CHAC 3T26A 1GHBG 1WTHD 1IHSH 2GTBA 1LDTT 2HLCA 2ZI2H 2FOAA 4A92A 2O8WA 3RXAA 4X1SU 1Y5AT 5FPSA 1AIXH 4Z1MD 1NRPH 2BX4A 4NIYA 5AVDA 3UTUH 4Y0ZE 1P2KA 3T29A 1WQSA 1M9UA 1PPBH 2A4QA 2Y6TA 1P12E 3LH3A 4UEHH 4Y8ZA 5FPYA 5L2YH 3ZZ9A 1WOFA 2FS9A 2V3MA 4TYDA 1O3MA 1LHFH 2R3UA 1HPGA 2ZECA 2Y5GA 3KCGH 4DGJA 1GWAA 2V3OH 4OS7A 2UWLA 3Q77A 5HXFA 1G3DA 1TGSZ 3ZZCA 4AFZA 1QTFA 1V2TT 3GY8A 4AB8A 4CRDA 1THSH 4ZKNU 3QTOH 1HJAC 5JBTA 1KTSB 2BY6X 2TGTA 1HDTH 1H1BA 1Y3WA 1YCPH 1DY9A 2JETB 4R0IA 1O36A 3EE7A 5BRRE 4BANB 1HAZB 2FYQA 1FXYA 1GBDA 3N7OA 4NZQA 2ZHEH 2HVXA 1KDQA 1BUIA 4H42U 2Z94A 1QRWA 3SGQE 4CRCA 4I31A 1DWDH 5FAHA 1C5SA 1UVPA 3A88A 1WDIA 4KGAA 2ANWA 2PFEA 2Z3CA 4KTCA 1FPCH 3GCNA 1T8MA 3F0PA 4I8HA 4A1TA 4P00A 5I46H 1AB9C 3R3GB 1TA2A 5A8ZA 5JBCS 3CP7A 1WU1A 4A7IB 1GJBB 1U6QA 1C1OA 2W5EA 3I78A 2G5NA 5HIZA 3ZVCA 5TCCA 5F8XA 1N6YA 1MKWK 3BSQA 3M36A 2VVVA 3M37A 3AVZA 3BTHE 5CHAB 1O3IA 1GBEA 2LELA 2ODPA 1QHRB 5FX5A 1CU1A 2VWNA 8ESTE 3NK8A 5DP9A 1FPHH 2QN5T 2BQ7B 5JB9S 4MG3A 1LKAA 1BTXA 2YMSD 1GGDC 1GMDF 2WPHS 3UWJH 3KGPA 3EQ0H 1L1NA 2B7DH 2WINI 3MNBA 3SGAE 5HKKD 1G30B 2STAE 3SZNA 4AC9A 3MH4A 2KFWA 1UHBB 3M3TA 3GCHB 1T8LA 5F8TA 3TGIE 1E0FD 1P2IA 1CGHA 3LH1A 1F5RA 1ZHPA 4ZH8A 2GV7A 4LK4A 1E34B 3ITIA 1YP9A 3PWCA 1C9PA 1IQLA 4MQAA 1N1LA 5DKMA 1B7XB 3D62A 2OXSA 2XNDD 4X1PU 1ZJKA 1AKSB 1IQKA 2GCHG 4DVAU 3ODFA 1JIRA 3A8AA 3FP6E 1J8AA 1CT2E 1EAIA 1OWJA 3PB1E 4X2XA 1DWEH 1Z1IA 1ZLRA 4H6SB 1PPHE 1RS0A 2V35A 4A6LA 1O3AA 3STIA 2ZDMA 2W7UA 1KXCA 4FETA 1OXGA 1HCGA 5K7RA 2VWMA 4DT7B 3PROA 4DIHH 1G3BA 2QC2A 3RM0H 3F9FA 1XVOA 1GI4A 1QURH 1ELAA 3RU4E 4ISLA 3OEED 1DOJA 2OCVB 4TPIZ 4F55A 1H9HE 4NG9H 4AB9A 1P2OA 1C5QA 1DS2E 3LOXA 1NM6A 2PUQH 2ZFSA 3DFJA 3QX5H 1ZSJA 3RXSA 3U8RH 4A1XA 3K6ZA 1RJXB 1VZQH 2TBSA 2AH4X 1QCPA 1O3GA 3F3BA 4FVDA 2TGPZ 1AFQB 1QY6A 4FUEA 1CA0B 2VNTA 1FY1A 2AEIH 1GMCG 1GVZA 1ESAA 1ZRKA 1Y5UT 3QWCH 3Q3KA 2W3IA 4XFQA 1VITH 5EXLA 4E06H 3M7TA 1AE8H 1EASA 2RA3A 1C1QA 4Y11E 3BN9A 4MPVA 4AYYB 4P02A 1F0RA 4ZAEA 5B6OA 3MU0A 1NTPA 3E0NB 1FX0B 2BLQA 1MH0A 1QJ1B 3VB3A 5E2OA 1HB0B 1ESTA 1SFQB 4IC5A 1E37B 1ESBA 3EA9A 1UTPA 2PGBB 2AIQA 3RXRA 2WPIS 2HPPH 1O2SA 1SL3A 1XX9A 3LGTA 5FCKA 1YPLH 4U30A 4D76A 4TY7A 1VITG 1L1GA 1O2UA 1KMHB 1MTNB 1NN6A 3E1XB 2F9BH 2ZDLA 2GX4A 4UD9H 1A5IA 2VJ1A 4TSFD 2XW9A 3A7YA 4B2AA 1AU8A 1C2HA 4Y0YE 1ELTA 1G9IE 3QN7A 9ESTA 5GNDA 3PWBA 2BVRH 1JWTA 1LO6A 3TNTA 2ODYB 1EXFA 2PLXA 2VVCA 3VB6A 2R0LA 5HM2A 1ANCA 4FUJA 3I29A 2TPIZ 1NRQH 3KN2A 3SJOA 2FWWA 3MI4A 2ZU3A 2PV9B 4KELA 5DP5A 4FUHA 4LZ1H 5E0GA 2FLRH 1UCYE 4XBBA 1NROH 4Z0KA 1XUKA 3CS7A 1F92A 3MNCA 3TU7H 3U28C 3ATKA 1NU7B 1GJ8B 1TMUH 1RFNA 1SGTA 2XTTB 1JIMA 3ZZ8A 2FI4E 1O2IA 4NZLA 1KXBA 1GI3A 3IITA 3SW2B 3A81A 4X2YA 2C8XB 2J94A 1BMFD 4FOUC 3HATH 3RXVA 3RMOH 9LPRA 1RTFB 1FUJA 2XC0A 2PKSC 1JRTA 3MMGA 4CRFA 3BG4B 1XKAC 1GHAF 3LKWA 4RKJB 4AFQA 3SUGA 3AK5A 1ZHMA 5L2ZH 3S9AA 4I8LA 5G4BA 1S85A 1SGIB 5JB8S 4FUCA 2WV4A 3RXJA 1UMAH 1AN1E 2HNTC 4MNVA 1O5FH 1XUIA 4YESB 1GDQA 1O5EH 4X1NU 3NWUA 4DG4A 2ANKH 3KYFA 5JBBS 2KCYA 3ATLA 2OC1A 3VB4A 1CHGA 4CRAA 3MU4A 1D3DB 1QL9A 3A83A 3S0NA 1XXDA 1ORFA 4SGAE 1MBMA 1FMGA 1BRUP 1IOEA 4ISOA 1W7XH 2L74A 2WPJS 3W1EA 1MMJN 3GY2A 1THPB 2A2QH 2VWLA 1TOMH 1UHBA 1YY3A 3FO8D 4WH8A 4ISIH 4NFEA 4YLQH 1UVUH 2H5CA 2WPKS 2UWOA 2RG3A 1BHXB 2ALVA 3STJA 1TPSA 1Z8GA 3RUOA 3TK6A 2AMPA 5HIYA 2AGIX 2BY8X 3PMBB 1J15A 1C5ZB 4X6PA 1OWHA 3A89A 1AI8H 1HJ9A 4AG2A 3FVFB 2CV3A 2BYAX 5LPEA 1EB2A 1E1QD 1ID5H 1AKSA 1TQ0B 1KSNA 4X6MA 2WPMS 4ACAA 1YC0A 5C3NA 2Z3DA 3RMMH 2PSYA 3A85A 2WYJA 3VXFH 2BZ6H 2QAAA 2AGEX 1G32B 2NU4E 1K9OE 1SOTA 4MDSA 2BQ6B 5A0BA 4Y71A 4Q2KA 1G3EA 1SGDE 3SBKA 1MQ5A 1N8OB 3QGJA 1FONA 2BDHA 2PW8H 2HNTF 4U01A 3UIRA 1KIGH 1KYNA 2ZPRA 2XWBI 4MNWA 1GJ7B 1TLDA 2FTMA 1V2MT 1WXRA 2BD3A 2BY9X 6GCHG 3RXMA 2FI5E 4H6TA 4GVUA 2ASUB 5GDSH 1GHZA 1K1NA 4JZEH 2WHXA 1QA0A 3C1KA 1HIAB 4K2YA 1CBWC 2EC9H 1NT1A 2PSXA 2BLWA 4RN6A 1TAWA 2W7SA 2C4FH 3RC4A 3U8TH 5IK2D 4F4OC 1C2MA 1KDQB 2B9LA 1D9IA 1YBWA 4AFSA 1W8BH 5FHTA 4OS2A 3PO1B 2ZPSA 2GCTB 4VGCB 4X8SH 1D6RA 1YM0A 5I25A 2VGCB 4E05H 1N6XA 5AF9H 2B0FA 4NCYA 1G2MA 1C2IA 4SGBE 5EPYA 1CT0E 4XBDA 1ZZZA 1C2EA 1TNJA 1BOQA 3URDA 4CRBA 1TYNA 5DPAA 1H8ED 1SLVB 1ZTLA 1C5PA 1GHVH 4Y79A 4YTAA 1DUEA 5C0TA 3OY5U 1TNLA 1Z6JH 5DK1A 1XVMA 1GBTA 4F49A 4RSPA 4AGKA 2KCPA 2VVUA 4IW4E 1NPMA 1QB1A 1YF4A 1HAPH 2A4OA 1O2WA 1S83A 1LPKB 3M7UA 4WWYA 1A5HA 2FOBA 2H9TH 2BHGA 1WQVH 3ZZ5A 1AUTC 2M5TA 1O2GH 3KEEA 5LPFA 1D4PB 3UNSA 2ZU2A 2TGDA 2VB0A 2QXJA 2J2UA 2JJ1D 3RXBA 1B0FA 1BBRE 1A0JA 2O8TA 1K1PA 4HTCH 1NC6A 5EW2H 1GBBA 1UK2A 1CHOG 1AVWA 3FN8A 1O3BA 2Y7XA 1KY9A 1MKWH 2KCAA 3HGNA 1MD8A 1IHTH 5ABWA 1BTZA 5A2MH 1EAUA 1ZYOA 1GCTC 3ZZ4A 1SHHB 1S5SA 3WWBA 3GY6A 3SUFA 1ZHRA 1QA7A 1OP2A 4FU9A 4GSOA 2H9HA 1Y59T 5EJZA 2RFKC 4NGAH 1O2QA 3VEQB 4UFGH 1A0HB 1V2JT 3ZZAA 3EDXB 1B5GH 4D9RA 3LGVA 3FANA 1CQQA 2GMTB 5FCRA 1EPTB 3K2UA 3RXHA 4ABBA 3TITA 1P11E 2GT7A 1A5GH 2OC8A 2PTNA 1PQ5A 5A0CA 3PLBA 1V2OT 1SQRA 3RLYH 2ANMH 1SLXB 2QYIA 2VIQA 2BDYA 2H1UA 3GS9A 4Y7AA 1EJAA 2Q6FA 2FX6A 2WV9A 4GCHF 4DIIH 4I32A 2GD4B 1GHXH 3PTBA 2P3FH 1VR1H 1BRAA 2BM2A 1F2SE 3ATIA 3TPIZ 1OPHB 4K1TA 3N7DA 6ESTA 1K28D 5C1UA 4Q7XA 1HUTH 1P9UA 5EXNA 1TBQH 1SOZA 1AHTH 1SMFE 1IQHA 1MTSA 5A8YA 2SGPE 1Q3XA 5EODA 3LIWA 1C1RA 2LPRA 4WVPE 4UONA 1GCDA 3E3TA 4JYTA 4ZXYH 3MH7A 2J34A 4MPXA 1K1JA 3H09A 2ZHFH 1K22H 1VGCC 1SLUB 2F9OA 2QF3A 4X0WU 1NZQH 3BTME 4B71A 1C2GA 2C8WB 1A3EH 3DUXH 2G55A 4ABJA 2H9EH 3BTEE 1GJ9B 4B76A 1UTOA 2P3UB 1C5NH 3M5LA 4YOIA 5C1XA 1QFKH 3BG8A 4FUGA 1W0JD 3SHAH 7LPRA 3SNDA 2F9UA 1AUJA 3DA9B 3UNRA 4WMFA 3GY4A 2HNTE 1PQ8A 3MNSA 1P57B 4ISNA 7GCHF 1F5LA 3MWIU 2KZ4A 1TGNA 4Q63A 5A8XA 3U69H 1SVPA 2QXGA 4ZXXH 3KQCA 1TWXB 1ELDE 4NSYA 3PMJA 5DG6A 3OTJE 1OYQA 1JXPA 2UUJB 3VB5A 3VGCB 2O8MA 1GJCB 5HGGA 3RXUA 4JK6A 1AWFH 2VWOA 1ANBA 5B6LA 1MKXH 1T32A 4JZFH 1Z6EA 2C90B 2EI6A 1HJ8A 2F3CE 3ZZ3A 3F2FA 5T6GA 2VH6A 4CRGA 3P92A 4XDEA 2J9NA 4OS5A 4GUXA 4KTSA 1PFXC 8GCHF 2NU3E 1ETSH 4Q7ZA 3S69A 1UK3A 3SNBA 3UOPA 1HIAA 4CHAC 4FUDA 2ZA5A
chains in the Genus database with same CATH topology
1GJ6A 2AYWA 1O3PB 2CGAA 3D65E 3A7XA 4MTBA 3RU4D 2P59A 3SV8A 1GBAA 1ANDA 2FOFA 2O8UA 1HAOH 2K1QA 3SQEE 1GMDG 3B23B 1IQJA 5IDKA 1AD8H 4BAKB 1BMMH 1FY4A 1O2PA 4MNXA 2SFAA 3Q76A 2EEKA 4TWYA 5EG4A 1SQAA 1BTYA 4NWLA 3T27A 2FDAA 3BTQE 1FAXA 1T8NA 1DUAA 1BTPA 1P10A 4JZIA 4BAHB 1HJAB 2Z9IA 1B0EA 4ESTE 1ZGVA 4UFFH 1DDJA 3T5FH 4RKOB 1TX8A 2ZTZA 1V2NT 1P2NA 1PPFE 5DP4A 1KLIH 2Q6DA 8KME2 5J4QA 3TGJE 3SGBE 3NXPA 1P06A 1XUGA 2ZF0H 1TRMA 4AX9H 1C5YB 3D23A 5T6FA 1K21H 1TBRH 4FUFA 2CF9H 3O8DA 3ZZBA 2FI3E 1BTUA 3V0XA 1O34A 2VIWA 3T2NA 4YO9A 4JYVH 2QCYA 4U32A 4NIXA 3KQEA 1P04A 2WPLS 1AFEH 2A1DB 3C27B 1ZMJA 2HWLB 1H8DH 1HYLA 2Y80A 1IQIA 1CSOE 5EGMA 3A8DA 1WBGB 2VIOA 3HGPA 4K1EA 1CE5A 1YLDA 4ZKOU 2OTVA 2NU0E 3D49H 3UPEA 1OS8A 4NWKA 1O2LA 3GOVB 2XBVA 1HAVB 3QDZB 1KLJH 3EA7A 2BB4A 4BTTB 1NRSH 1EPTA 1W13U 4ABFA 2ANYA 1TGCA 2SNVA 2AS9A 5C5OA 1GGDB 1IQGA 3R0FA 1YPGH 4X2VA 2A31A 1TIOA 5AFYH 1OKXA 1HRTH 4HFPB 7KMEH 1ETTH 2P93A 3VFEA 3SJ8A 1AFQC 5E2PA 1GJ4H 2R0KA 4AYVB 2R2WU 4WMDA 1EP5A 3RDZA 1LVBA 2FX4A 3OY6U 1GI6A 2A7CA 2OC7A 2ZGJA 2GKVE 4NA8A 2FP7B 3OYPA 3DD2H 1KTTB 2QXHA 3U1JB 1S0RA 2Z7FE 3FZDA 4XE4A 5DO4H 2A4RA 2FOCA 2H5DA 1IQEA 5H4IB 2F91A 1RD3B 3P8FA 3P6ZB 1BRBE 1MAYA 2R9PA 2QIQA 1FY5A 2CMYA 1PQ7A 1KXAA 1W14U 3P95A 4TWWA 2GCHF 4AG1A 3SU0A 1LTOA 1DPOA 1TA6A 3GYLB 5GXPA 3H7OA 1F0UA 2XNIA 5LGOA 3GYMA 2XXLA 3AASA 1O2ZA 1O31A 1WCZA 3IWMA 3T25A 4CR9A 2BD4A 3WY8A 1TRYA 3VB7A 3E91A 3PYHA 1MKXK 3SUDA 2J4IA 1O3DA 4ZHLU 1EP6A 1ELCA 2IN2A 1X7AC 4BXWA 3RXKA 1CVWH 4BAOB 1XUFA 2OP9A 3BTTE 1RTKA 1TNIA 1FDPA 2Q6GA 1GMHG 1Z8RA 2ZG0H 4K60A 3ZYDA 4B2BA 1G3CA 3QLPH 1EUFA 3SI3H 3M3SA 2FLBH 1BTWA 1W0YH 3ZVGA 1C2KA 6CHAB 3P8NA 4XBCA 3SV6A 1KXEA 1MQ6A 2OUAA 2I6SA 1FY3A 4CBOA 2THFB 2BDCA 2ZIQH 5A0AE 2ZDKA 2ZU1A 1D6WA 1TPOA 1EJMA 2A5KA 3GISB 3LJJA 4MLFB 1V2ST 2BVXH 1W12U 4OS4A 1L2EA 1NFWA 1GDNA 3F9HA 1AMHA 5T6DA 4QT8C 4YT7H 2OQ5A 4B1TA 2LNCA 4UFDH 4D7GA 2IOTA 3F9GA 3FAOA 1LQDB 1OWKA 2F9PA 4K8BA 3TK9A 1SGQE 2Q1JA 1AVGH 4MNYA 3TVJB 4H4FA 2SNWA 1DLEA 3K65B 5FBEA 3VPKA 2HPQH 1O2XA 2BQWB 1NFXA 3S7KB 1S84A 1TE0A 1CGJE 2CXVA 1QIXB 4WF8A 4OS1A 1AQ7A 3GICB 3PM3A 1V2QT 3TNSA 1C5XB 4NIWA 1SGCA 1TBZH 1QR3E 3ZYEA 3SNCA 1MD7A 1ETRH 1LVMA 5A09A 1BMNH 1Z71A 3RXIA 3QGNB 1P02A 2ZGCA 3S9BA 2SGQE 3L6PA 2VIDA 3ZV8A 1W3CA 1LVYA 2FIRH 2QV1A 3SJIA 3MU8A 2OD3B 2A2XH 4BAMB 4D9QA 1C5WB 1YPHC 2XYAA 4IN2A 2Z9LA 2VH0A 2ZFQH 1LQEA 1QRXA 4K3JA 3SI4H 1PPGE 5GIBA 3RXEA 1O2HA 3SU5A 1RXPA 1KXFA 4JZDH 1YPEH 2PKSB 1AWHB 1GG6C 1P01A 1QQUA 1V3XA 3LONA 1C5UA 1TNGA 3ZZ7A 2Y5FA 3P17H 1EQ9A 2G00A 3RC6A 4ABGA 1VCQA 1O2NA 1HV7A 2G4TA 3LGUA 4ZHAA 1FY8E 2G81E 3RXLA 2ZGBH 3O8BA 4MPWA 2PWXA 2BD9A 3UQOA 4I8GA 3BTWE 1NY22 1HAVA 3SU1A 3GDUA 3A7ZA 1EAXA 3SHCH 1ELVA 4O3UA 2PGQB 1SFIA 1P03A 2ZU5A 1T31A 2A4GA 1GL1A 3GY7A 1EZQA 1JRSA 1P3EA 2SGAA 1HAXB 2P3TB 2Y7ZA 3GCTG 1SLWB 2VU8E 1EATA 1EKBB 1SGEE 2J92A 2UUFB 4IN1A 1ANEA 1C2DA 1GBJA 3SV7A 3JZ1B 1Y5BT 1Y3YA 2Z9JA 1O3FA 1K1OA 2ZZUH 2BXUH 2HGTH 1C4V2 3S9CA 1OWEA 2A32A 4Q80A 1O3EA 2BTCE 5F03A 2Y5HA 1K1MA 3TJNA 2FS8A 3ZV9A 5CMXH 3A8CA 1WSSH 1SHYA 3ZVFA 3ZVBA 2Z6BD 3HKJB 2D8WA 3L33A 1ZPCA 2BXTH 3MU5A 1TX6A 2FZZA 1XM1A 4X2WA 1O37A 3CENA 2W3KA 1ZSKA 2BOKA 3F1SB 1SG8B 1PPCE 1UTMA 1YPKH 4IMZA 4ASHA 1S6HA 4HI3A 1BIOA 4GHTA 4X1QU 2P8OC 1J9CH 1C5MD 3RXCA 3M5MA 2CN0H 4HGCA 1T4UH 2ZHWH 1VCWA 3QZRA 2YNBA 2EA3A 3LGIA 3M35A 2ZCHP 1CA8B 4O97A 1DM4B 2EI8A 1FV9A 1GJ5H 1QJ7B 1V2PT 4IBLH 2XBYA 1QNJA 1CBWB 4JZ1A 3TJVA 2FYRA 1OP0A 3A7TA 3OSYA 4THNH 4X8TH 3BEFB 1MTVA 1V2RT 2ALPA 1A61H 1BZXE 2QY0B 4WY3A 3FZZA 4B73A 5CE1A 4ABDA 5HMAA 5JBAS 1C5RA 1TMTH 5EU8A 4DURA 3SOSA 3UOUA 1LMWB 2XBXA 4Y10E 4NFFA 1EPTC 2V0BA 1K1LA 2ZFFH 1UVSH 1A1RA 1MU8B 1C1WH 1XXFA 3KNXA 3QK1A 4X6NA 2ILNA 1QBNA 2JKHA 3RLWH 5AFZH 3H5CB 3PMAB 1OOKB 1ZRBA 2C8YB 4GCHG 4ABAA 3SQHE 1SGPE 1V2WT 2GT8A 3FP8E 5FPTA 5GCHG 1FQ3A 2HOBA 2G8TA 5GPIB 1QL7A 4ZHMU 1OX1A 1F0TA 1O3HA 1GI0A 1XUJA 3LGWA 3TGKE 3SORA 1C5OH 3UREA 5ESBA 3F6UH 7ESTE 3ZZ6A 1BRCE 4WXVA 1HXFH 1EX3A 3LC3A 1F0SA 3SV9A 2ZHQH 2VINA 5BPEA 2JH0D 1TPAE 2Z9KA 1GL0E 2OINA 1ZMNA 2AIPA 5JPMH 4O3TA 1YKTA 4CR5A 1IQMA 4WXIA 3NPSA 3M3VA 4BTUB 2FMJA 3T62A 2ODQA 2ZNKH 5SGAE 1J17T 1DSUA 2BD8A 3P8GA 4X8UH 1QGFA 1W0ZU 5L30H 1IQNA 1O2RA 2A7HA 1O2YA 1GCTB 4UDWH 1CHOF 3S7HB 2GDDA 3AAUA 3EA8A 3ODDA 4MPUA 3UR6A 2WV5A 4TY6A 5T3HA 2R2MB 1GBHA 1FIZA 4GPGA 1SPJA 1MZAA 3NCLA 2JH5D 2TGAA 4YT6H 2SGDE 2H6MA 2RDLA 4BNRA 1O2MA 4I8JA 1P09A 4Y76A 1C1MA 4FUBA 3HPTB 1GBMA 1RIWB 3MO3A 1ARCA 1Z8JB 3ENSB 2ZWLH 2DE9A 1S81A 4ZMAH 1O33A 3MH6A 1SR5C 1AO5A 1RGQA 3VGCC 2A0QB 1Y8TA 4B2CA 2D26C 4NA7A 8GCHG 1ELFA 1BB0B 2QF0A 3EE0B 3B9FH 1BJUA 1Z8IB 1BJVA 4Y7BA 2BLOA 1TNKA 2ZDAH 1TQ7B 1W7GH 1YPHE 4MVNA 5FX6A 2JETC 2ZKSA 5EW1H 1GVLA 2IJOB 3A86A 1AY6H 2GV6A 1VGCB 2V6NA 1TMBH 1AE5A 1L0ZA 3MNXA 1TX7A 1NESE 2OQUA 2CHAB 1OYTH 1AZZA 3I77A 1LHEH 3V13A 1C9TA 4PROA 5EXMA 1Y3XA 3HK6B 4LOYH 1GI1A 1LVOA 5EQRA 2ESTE 5J4SA 1DE7H 1BA8B 1QQ4A 2BD7A 4FUIA 5TCAA 4WH6A 3LDXH 3TH2H 2C3SA 3UQVA 1GHBF 1SGYE 2F9VA 4UE7H 4ABHA 2OBOA 2FTLE 3SU4A 2GGVB 2I6QA 3SU3A 1FN6A 4AOQA 1C2LA 4NA9H 2BMGB 2KAIA 2V3HH 5CHAC 4R8TB 3ZVAA 1HNEE 1GBLA 1HAIH 3RXDA 4LXBH 1FAKH 1XUHA 1FZZA 3MFJA 3SJ9A 3ELAH 1ARBA 1O5GH 3V12A 1A3BH 3OX7U 4JYUH 2A5AA 3GY3A 1G37A 2J95A 1QRZA 3HKIB 3KF2A 3GCHC 1J14A 1S6FA 4CHAB 1IQFA 2ZGXH 4NSVA 2GZ7A 1FNIA 2YNAA 3SJKA 1K2I1 4U2WA 3GY5A 1MCVA 4GLYA 3QZQA 1MTUA 5DP6A 3RXPA 2UWPA 4DY7B 1C5TA 3Q3XA 4XOJA 4FVBA 3U1IB 1E35B 1AVXA 1Y3VA 1ZMLA 2RA0A 4AZ2B 2H2ZA 1L4ZA 4KP0A 5EQQA 1PQAA 1LHCH 4A1VA 4O9VA 2JH6D 1ZR0A 1AB9B 1O30A 2HALA 1SGFG 1WTGH 5HYOA 3V3MA 3AAVA 1EAWA 1P0SH 2STBE 2EI7A 1NO9H 4YOJA 4BXSA 4Y8XA 5ETXA 4OS6A 5HM9A 1EZUC 3RMNH 2FOMB 5JYIA 1KXDA 1HAYB 1VCPA 1OWIA 3SUEA 3ZVEA 1SBWA 1O0DH 1W2KH 1VJ9U 2TRMA 2BLVA 1GDUA 4ZKSU 2XC5A 4CREA 1S82A 3F9EA 1P2MA 3H7TA 1P9SA 4YLUA 1INCA 2D1JA 1YCPM 2ZTYA 3SV2H 1NS3A 2ZU4A 1ABIH 1PYTC 1SB1H 3AW0A 1O3OA 1YGCH 3UY9A 2UUYA 1CA0C 4AORA 3VXEH 2G51A 3MTYA 3MHWU 1H9IE 1ELGA 3QO6A 3KQBA 2BX3A 1DICA 4IS5A 1Z7KA 3MYWA 3FP7E 4O03A 4UFEH 1BDAA 3E90B 1JOUB 1IAUA 3NKKA 5EQSA 2ZDNA 1EOJA 1GBKA 1TOCB 2ULLA 1ABJH 3BTGE 1GVKB 1UCYK 5C20A 1TPPA 1GJAB 3UUZA 1QB9A 1AZ8A 3U98H 4X8VH 4OGYA 2GZ8A 5F6MA 2XCNA 2HRVA 1LCYA 1UTQA 2ZP0H 2J38A 1UTKA 1O2TA 1T4VH 4FU8A 3U9AH 1GBCA 2BDAA 1MTNC 3V7TA 3MOCA 1BBRH 1UVTH 1BMLA 2C93B 4IGDA 1KLTA 2ZGHA 5DP3A 1EZSC 2G52A 1Z1JA 2BDBA 1EZXC 3BEIB 3TIUA 6CHAC 1LHGH 1V2LT 3TK5A 3SU6A 5EOKA 3FFGA 3QUMP 3E6PH 1BQYA 3A84A 3W95A 3BEUA 1BITA 2ZC9H 2QA9E 5C67A 1DVAH 2FOEA 2AMDA 1TNHA 1CT4E 1DANH 1O5CB 2B5TB 1P3CA 3Q00A 1BCUH 1F7ZA 5TJXA 2DE8A 5JDUB 1C1NA 1SI5H 1ZGIA 3G01A 1XMNB 3P8OA 2Z9GA 3EYDA 2ZDVH 1UVOA 1O38A 5AHGH 2A45B 1FI8A 2GVFA 1UK4A 1WAYB 2OLGA 1GHAG 3K9XB 1V2KT 2FEQH 3SNEA 1C1SA 1V6DA 3DT0H 2CF8H 4YM9A 5EPNA 1YCPK 5E0JA 1GMCF 1LKBA 1FJSA 5C1YA 4WJG2 1SC8U 2ZO3H 1DXPA 2GZ9A 5F8ZA 1Q31A 3BG4C 4DOQA 2BZAA 3UFAA 4AN7A 1UTNA 5LPRA 1SGNE 5DP7A 1E38B 3DHKH 2F83A 1A7SA 1GI8B 4I7YH 1H8IH 4D8NA 1TRNA 2P94A 3PTNA 2O9QA 3ZZDA 1OP8A 1A0LA 3JZ2B 3KIDU 1GBFA 1DY8A 4BAQB 2XRCA 1DXWA 1VITF 4JK5A 1GMHF 1THRH 1LPGB 3O8CA 3P70B 1YPMH 2IPHA 2ZEBA 2OC0A 4GHQA 4DCDA 3MO9A 2A7JA 2PKAB 2B8OH 1QJ6B 3KQDA 1GI2A 1O3JA 3A80A 4HZHA 4Z6AH 1T8OA 1O3NA 1SSXA 2G5VA 1O5AB 1C5LH 1MBQA 2P95A 2ZFRH 3UR9A 3KL6A 1C2JA 1O5DH 1VJAU 3L3TA 3PLPA 1ZTKA 2FODA 4Y6DA 2NU2E 1C1TA 1PYTD 1FN8A 2FO9A 3LT3A 4X6OA 4JMYA 2PHBA 2PR3A 1DLKB 3BV9B 2Z3EA 4INLA 1Q2WA 2BVSH 2Y82A 3LPRA 1S0QA 4KKDA 5DJ7A 3TJUA 3RXGA 4IMQA 1SGFA 3MU1A 5IYTA 3GDVA 1P8VC 3BTFE 1ZOMA 2G4UA 1RRKA 1NRRH 3URCA 1O3CA 1QBVH 2CJIA 2F9NA 3NZIA 1TB6H 3GDSA 4KTUA 2AFQB 1TALA 2ZHDA 1O32A 1N8OC 4Y8YA 5PTPA 3ESTA 3QTVH 4GAWA 5DP8A 2FXRA 1ELBA 3HK3B 1BT7A 3A7WA 1GI5A 3UNQA 5C2ZA 3O8RA 1D3QB 1T7CA 5GWZA 4ABIA 3EGKH 3BTDE 3AW1A 4I8KA 1DWCH 1BTHH 1HAGE 1DWBH 1ZTJA 4K5ZA 1K1IA 3SN8A 1D3TB 1GG6B 4OGXA 1C1VH 3SU2A 2W26A