3PLBA

Bovine trypsin variant x(tripleile227) in complex with small molecule inhibitor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGIYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plbA02
1KXEA 2QF0A 2ZFTA 2P3UB 1RGQA 2Z94A 2XBVA 3T25A 3FZZA 2B9LA 1LHGH 2HGTH 1S6HA 1Y59T 1Y5BT 3SU5A 2ZU3A 2Z9JA 1GJDB 3GDVA 1GVLA 2VIQA 1BITA 1C2JA 2UUFB 1V3XA 1K28D 4YOIA 3RXBA 1FY1A 3ZYDA 2P93A 4D9QA 5F8XA 1SGFG 3GYMA 1WAYB 1TB6H 3EA8A 5L30H 2GVFA 3TK9A 1J9CH 2RCEA 3PLKA 2WUBA 1LHCH 1HAOH 2BLWA 5T6GA 4D8NA 4BAHB 1GBDA 1UTKA 1GBAA 3SV8A 1NZQH 5J4QA 2AMDA 3SU4A 3GYLB 5K7RA 1ZHRA 1XXDA 1EPTA 2V6NA 4AB8A 1O3BA 1XM1A 1DANH 1Y3VA 2C8WB 2PV9B 4MPXA 4ABEA 1C5TA 3MHWU 2CV3A 4MTBA 2A5AA 5JBAS 3F9FA 4ASHA 1G36A 1FZZA 2VVCA 2VIDA 2FX6A 2ZO3H 7GCHF 1ELEE 2WV4A 8GCHG 4D9RA 3E1XB 5EOKA 3RC4A 3QWCH 2XC0A 2RA3A 2XWAA 2UWPA 2BQ7B 3M5MA 1MUEB 1W3CA 1RJXB 3PLPA 1Q31A 1KSNA 1A1RA 4Y0ZE 2DUCA 3VB7A 4MNXA 2FI3E 5A2MH 1SQOA 1O32A 4GAWA 2BM2A 2ZC9H 1B7XB 1DWDH 2O8LA 4A1VA 1UTPA 1C5UA 1S0QA 1QGFA 4JYTA 2Z9KA 2ZNKH 7KMEH 2ULLA 3STJA 1O2SA 2EC9H 3V7TA 3MU5A 1SGNE 3MO6A 3TU7H 5L2ZH 2PLXA 3P17H 4JZEH 2Z7FE 3DA9B 1P11E 1Y3WA 5G4BA 2EA3A 2J95A 4AFQA 1P09A 1YCPK 2LPRA 1YKTA 1P0SH 4FU7A 2YOLA 4H6TA 1JRTA 1NTPA 1O38A 4MNVA 1SOTA 1KLIH 1UTLM 1CA0B 1SGRE 1W13U 2VWOA 3RXRA 2IPHA 1CU1A 1S83A 2BX4A 1Z6JH 4R8TB 1C2GA 4FUBA 1BHXF 1EATA 2FTMA 1PQ5A 1CSOE 1ZTLA 3SN8A 1F0UA 2Z3CA 3VFEA 5HXFA 2K1QA 2HNTC 2ZHWH 2W7UA 4BOHA 1MQ5A 2FOBA 1O2UA 1CA0C 5F6MA 1SR5C 1AZZA 1LTOA 2VH6A 1GCTB 1BJVA 2FOHA 4LOYH 3A80A 4NFEA 3A81A 1F7ZA 2FESH 4CRFA 1WQVH 3D65E 1GI9B 2ZTXA 1PJPA 1YPHC 4NCYA 5DP9A 1V2NT 3EDXB 3BTEE 3IWMA 1MZDA 1GCTC 4NIWA 1CGJE 3ZZ9A 4AYYB 1NRRH 3RP2A 3LDXH 4KGAA 1GVKB 2QC2A 1QRZA 1G3BA 1L4ZA 2YNBA 2ZEBA 1GMCG 3LKWA 1PFXC 3RXPA 3LT3A 3RXHA 2GT7A 1ZMLA 2ODYB 1GHAG 1F92A 2F91A 3MO9A 1BRBE 3KQBA 3T26A 1DVAH 3PYHA 1SVPA 5E2PA 5JDUB 1A7SA 1A4WH 1KXBA 1F0SA 1S82A 5A0AE 3HK3B 1C2FA 5JB8S 2XCNA 3GY8A 4WXIA 3U9AH 3MH5A 3HGNA 2AERH 1WTHD 2FI4E 3CS7A 4X1PU 2OCVB 3SOSA 1Q2WA 4DURA 3MMGA 1O39A 4X8SH 1IHTH 1EOJA 1GI5A 1X7AC 4X1RU 4A92A 1AO5A 1GWAA 4J1YA 1TMBH 4VGCB 5DP3A 1N1LA 2J34A 4YZUA 1V2ST 2QAAA 1QQUA 3P8GA 5FX6A 1DITH 2H9TH 2HNTE 1D9IA 1NU7B 5FX5A 3MFJA 1HCGA 1PPFE 2G5NA 1NC6A 5DPAA 2FI5E 1O3LA 5ETXA 3NPSA 3UQOA 2NWNA 2OC0A 1S6FA 4WXVA 2A7JA 4OS4A 4TPIZ 1AVXA 3A84A 1QL9A 4MPWA 2GDEH 1GI7B 1YPHE 2ZGBH 4OS2A 3BTDE 1AFQB 3RMLH 1V2WT 5LPRA 1DPOA 1O2WA 2IJOB 1H1BA 2SNVA 1DFPA 3SORA 2BY5X 1WOFA 5AF9H 1FAKH 3GCNA 2AGIX 4WJG2 4A1TA 1HAVA 1AFQC 1LVYA 2F9BH 2XW9A 3SGBE 1EX3A 2OXSA 1Y3YA 2ANYA 3TH3H 4ZH8A 2CF9H 2B7DH 1W7XH 3MU0A 2PFEA 3ODFA 3ZZ3A 1QRWA 4Y8ZA 5GDSH 5EPNA 2GMTC 1D6RA 2BD2A 3O8DA 4ABDA 1HB0B 2A2XH 3CS0A 1YPJH 3ATMA 2ZGHA 2OC7A 1QY6A 1D3TB 1EP6A 2R3YA 3D23A 1FPHH 3U69H 1BOQA 4D76A 5C2ZA 2PHBA 3RXMA 1O33A 4NZQA 3ZVDA 1HNEE 1MAXA 1QL7A 1GMDG 2IN2A 5DP6A 1THSH 4NIYA 1O2HA 2Y5GA 3LGWA 4IC6A 2BLQA 5H4IB 1GG6B 1K1JA 3LGUA 1L2EA 4OS1A 2CGAA 4Y79A 2VGCB 3AW0A 1S81A 1GJBB 5C1XA 4WY3A 1TONA 2F9NA 3BTQE 2ZQ2A 3VB6A 4DVAU 4WMFA 5ABWA 1BJUA 1SBWA 1SGTA 1O2RA 2VU8E 2PW8H 1C9PA 3HKIB 1GG6C 4RKOB 2BQ6B 1FUJA 3UOPA 3TJUA 2PTNA 1P2NA 4QT8C 1AQ7A 1TNKA 1YBWA 3M3SA 7GCHG 3M7QA 2ZFQH 3TK6A 1SMFE 3E8LA 2BY6X 2ZHQH 3GY7A 2BLVA 3RXJA 3LOXA 3MNBA 1NN6A 1WSSH 3HKJB 1YP9A 3BTGE 2OLGA 4IC5A 4FXGH 2OBOA 1O3GA 1BDAA 1HXEH 2AS9A 1K1MA 3M5OA 1YGCH 1XKAC 1P12E 4CBOA 1IQMA 4ZHAA 1ZPCA 2GKVE 1ETTH 3GCHB 1HUTH 1O5GH 1YYY1 4FU9A 1PPEE 1IQNA 2FP7B 3RU4T 3RXVA 3SNBA 1C5NH 1VJAU 2RA0A 2Z9LA 1XUKA 3ESTA 2XC5A 4X6NA 3A89A 1G30B 1EQ9A 1RTKA 4E7RG 1SL3A 3GCHC 2C8ZB 4X2XA 1N8OC 5C5NA 3UFAA 2BXUH 2OBQA 4CR5A 3SHAH 3PM3A 1ZRBA 2JH5D 5EQRA 3RXGA 1P9SA 5DP8A 2G81E 3SU0A 1ESTA 1F2SE 3R0FA 3P8OA 1B0EA 3SQHE 1AGJA 1YLDA 4ISLA 1YC0A 1EJMA 4ISOA 3H5CB 1WYKA 1PPHE 3W95A 1TPSA 4FUJA 3KIDU 1B5GH 1CE5A 1EB1H 1ESAA 2JH6D 2F9PA 2J38A 1E38B 1IQEA 3OY6U 3HK6B 3BTWE 2FYQA 1EP5A 1UVTH 5E0HA 4Z6AH 3UTUH 2Z3DA 1HJ9A 3E0PB 1UTQA 4DT7B 1SQAA 5I25A 5AFZH 2BDBA 2UUYA 2KAIA 4A5TS 2FODA 2OQ5A 5A8YA 1SQTA 1TA2A 2FEQH 1TWXB 5EXMA 1A61H 2XWBI 1IHSH 3SUDA 1E37B 1FONA 3ATLA 1BTPA 1SB1H 2G55A 1UTOA 2SGAA 1C1QA 1TNHA 2QIQA 4GHQA 4ZKRU 4AFUA 4BTUB 1BTZA 4ABHA 1GL1A 3GY4A 1O3NA 3ENSB 3T29A 3PB1E 1SGPE 1GBIA 1QFKH 1KXFA 2H2ZA 2F9OA 3ZZ8A 5AHGH 3TGKE 2VIPA 3S7KB 1CVWH 1FN8A 3ZZBA 2I6QA 3QN7A 3RXFA 4ZROA 4JK5A 4K69A 1ANEA 4FU8A 1QJ6B 1E0FD 1O30A 5LPEA 1GI8B 4H42U 2PSXA 2OUAA 2BYAX 2ZU2A 3C27B 4CRCA 1ACBE 1G37A 1AN1E 1TPOA 3TITA 1SSXA 2XC4A 2ZGXH 4IMZA 4YO9A 1ARCA 5DG6A 1O3EA 1AMHA 3ATKA 1GHBF 4X2YA 3ZZCA 4OGYA 3SU2A 3SHCH 3EYDA 3Q00A 1UCYE 2BDGA 4H4FA 5A0CA 2SNWA 3PWBA 2UUJB 1VR1H 3A7TA 8LPRA 1C5YB 2GT8A 4GLYA 5C20A 1TALA 1O5CB 4Q7XA 1TBRH 4ABFA 3PMHB 4DG4A 5IDKA 2BMGB 1PYTC 4FUHA 3DT0H 4DIHH 1LPGB 3KL6A 3TIUA 1MKXH 3KQDA 1V2LT 2D1JA 4ISHH 4AN7A 1QQ4A 1MD8A 2R2MB 1P01A 5GCHF 3LPRA 4K1SA 3O8CA 2ZU5A 4XDEA 2LNCA 2CN0H 2NU3E 2ZDMA 1SLWB 3UREA 2H1UA 2UWLA 4K8BA 4NFFA 1UHBA 1LCYA 4AORA 3P8NA 4DCDA 1P2QA 3PWCA 2BD8A 1CHOF 1NS3A 2D26C 3A88A 1HAXB 1HJ8A 1K1LA 1BTUA 2BVRH 3GOVB 2ESTE 4Q2KA 1TABE 3F68H 5DGJA 3JZ2B 2PGQB 1MKXK 2WPIS 3A7ZA 6GCHG 4DOQA 1QNJA 1UVPA 3P6ZB 3HPTB 1ZSLA 5EW2H 4O97A 3VXFH 1FLEE 2GV6A 1MD7A 2BOHB 3NCLA 3NWUA 4X1SU 3SV2H 1SLVB 1Y5UT 4NA7A 5TJXA 1IQKA 5E8EH 1QA0A 3SNAA 1SGFA 1L1NA 5LH8A 1XVMA 3DFLA 1VITG 3TPIZ 1AHTH 1UK2A 2ILNA 1LPZB 1DDJA 1V2MT 4LZ4B 1NRPH 2ASUB 6LPRA 4I31A 2W3KA 4X8UH 1TA6A 1OP8A 2YNAA 4GHTA 1C5ZB 1V2OT 6ESTA 1GJ4H 2BD7A 3M3VA 4ZKSU 3QTVH 4IBLH 1QJ1B 4ZMAH 2V0BA 4MLFB 1VGCB 2HWLB 1INCA 2QN5T 1S85A 2WINI 1HAPH 3RC5A 5LPFA 3P95A 3RXSA 1G3EA 1ZLRA 2SGFE 4LZ1H 1AZ8A 3OYPA 2QCYA 2XYAA 4R0IA 1FAXA 4IS5A 1ID5H 1H8IH 1VGCC 2R9PA 3M37A 2ZG0H 4E06H 1P2IA 3A83A 4Y11E 4RKJB 5FHTA 5FPSA 2VVUA 3RXIA 1NFXA 1ORFA 1NU9A 1O5BB 3DHKH 1QB6A 5HMAA 1H4WA 4BXWA 2BY9X 1FNIA 1IQGA 3T5FH 1O2ZA 3CP7A 5FCKA 1NO9H 3FP7E 4KP0A 4WH6A 3M7UA 2O8WA 1C2DA 4OS6A 3UNSA 3KQEA 1YCPH 5HM9A 1QHRB 2FOGA 3AASA 5ESTE 4X1QU 3NUMA 5HM2A 1RFNA 3SJ9A 3URCA 1OWJA 5E0JA 1O3DA 1ZZZA 3FAOA 1ZMNA 4OGXA 2PR3A 4YLUA 1LVBA 1LDTT 1YLCA 5TCAA 2BX3A 4JZIA 2HALA 3A7XA 3I78A 2STBE 1GI0A 4U01A 3FANA 5FPTA 3RXKA 3UIRA 2H5DA 3PV4A 5E0GA 1P10A 4O3TA 1O2NA 2GV7A 3SNCA 1C5QA 1SHYA 1DS2E 5PTPA 3LJJA 2W3IA 2BXTH 1GBMA 3LGTA 3M3TA 4ZUHA 1FDPA 4I8KA 4M7GA 1EJAA 2AGGX 3LIWA 3RU4E 1GJ6A 3RXEA 1C1PA 1TX7A 2V3OH 2Y80A 3VB3A 1AY6H 1O5AB 1TE0A 3BIUH 4A7IB 4ABAA 1AU8A 2VB0A 3SI3H 4TY7A 1VCPA 2A7CA 1OWKA 1W12U 4E05H 1AWFH 1RRKA 1DUAA 2GD4B 1BRCE 1YF4A 3LGVA 4ESTE 1MH0A 4FUIA 1W0ZU 2AIPA 3A8DA 3RXAA 3V13A 3KNXA 3BG4B 1AUJA 4YOGA 2WPMS 4BTIB 9ESTA 2ZDNA 3LGYA 5GJ4B 1MZAA 1QL8A 2OQUA 3ZZ4A 2RDLA 1MKWH 4Y8XA 1BZXE 1HXFH 3BIVH 3BG4C 5DJ7A 1F5KU 5CMXH 1UTMA 3SU1A 4K5ZA 1DSTA 2A2QH 3ZV9A 2XBWA 1TMUH 1F5RA 2ODQA 3GICB 4MQAA 3QDZB 4X0WU 1OXGA 1ANBA 1ESBA 1ELDE 1Y8TA 1C1MA 1FPCH 2P94A 3HATH 1AIXH 3QX5H 5T6DA 1ELAA 1P06A 1OSSA 4TYDA 1MKWK 4JK6A 4TY6A 1C5MD 1TIOA 5T6FA 1FXYA 2PKSB 1WQSA 3EGKH 1Z8GA 5EQQA 4AGJA 3LH3A 3M36A 2J4IA 3U1JB 4BAOB 4WMEA 1MU6B 3RC6A 2NU0E 1P57B 2PKSC 5JBTA 1AVWA 1NFYA 1Z8RA 1EB2A 1G3CA 1GHVH 3FVFB 2H6MA 1GBLA 2ZZUH 3ELAH 1ZOMA 1OS8A 3F9EA 4LXBH 5EXLA 2O8UA 1V2RT 2C4FH 1T31A 3TH4H 3UUZA 3MH6A 4FUDA 1QBNA 1O2OA 1QTFA 1MCTA 1WUNH 3BTHE 3SV6A 1BQYA 2Y7XA 1C5WB 1ZTKA 3MI4A 1EAXA 2HVXA 3W94A 1SGCA 4CR9A 3OSYA 4ABGA 2ANKH 1JWTA 1ZJDA 2PKAB 2TBSA 2GX4A 5L6NH 5GCHG 3RXDA 3QGJA 2QA9E 3SQEE 2F83A 2D2DA 3SGQE 3UR9A 1AE8H 1HBTH 1CHOG 1CT4E 1HAYB 5A09A 2J9NA 3F1SB 1Z8IB 2TGDA 1GDQA 1TOMH 2GMTB 1C5PA 4XFQA 2FOAA 1O2GH 4X8VH 3P70B 2A45B 2STAE 3NZIA 4I32A 1ZPZA 2Y5HA 4X2WA 1ZGVA 1FMGA 1Y5AT 4ZAEA 4X6PA 1ZPBA 4BAMB 4K1EA 1C4Y2 5BPEA 1DY8A 1TQ7B 4FVDA 1SGYE 2ZQ1A 2V3HH 4LK4A 2AEIH 3QZRA 2M5TA 3ATWA 1C2IA 2AIQA 3RXUA 1J15A 1GHYH 2PTCE 3FZDA 1TNJA 1GBTA 4DGJA 5TCCA 3TNSA 5EU8A 1LHDH 1TGSZ 1O34A 1ELGA 2QYIA 1LKAA 1QB1A 4UE7H 2XNIA 1OWHA 1BMMH 4AFZA 3EAJA 2BDYA 2ZFSA 4NA9H 2GCTB 2Q6DA 4JYVH 2ZI2H 1AWHB 1KDQB 2ZDKA 4RSPA 1T8OA 1BCUH 4TWWA 4WVPE 2W7SA 2FOFA 4AGKA 2BDAA 1K1IA 3SO3A 3ZV8A 1AD8H 3ITIA 1BB0B 1GI4A 2C3SA 2GCTC 5K0HA 4MNYA 3RXOA 1C1VH 1XUJA 2QGRA 1TPPA 4X8TH 2HRVA 4OS5A 3NK8A 4KTUA 4B73A 1P05A 1W14U 5C67A 1C2EA 4XBCA 1C4V2 1NRQH 3GY2A 4Y8YA 1LMWB 3BEUA 4FUEA 2SGEE 1AI8H 1V6DA 2ZFRH 2A31A 4ZXYH 4INHA 3ZZAA 1D4PB 2PGBB 4F4OC 1EASA 4MDSA 8ESTE 1EOLA 3GY5A 2XBXA 1J16A 1C1RA 1PPCE 1AUTC 2ALVA 3M5LA 4YLQH 1NROH 1O2XA 2Z6BD 1D3PB 1N8OB 3AW1A 2OC8A 2PWXA 1O3KA 1L4DA 3GISB 1CT2E 4Z0KA 1IQLA 4Y6DA 1C9TA 1PPBH 2BDHA 1BA8B 1OPHB 2P59A 1RS0A 2VIOA 1BHXB 2FX4A 1P2KA 4IMQA 1PYTD 3HGPA 3UY9A 1KY9A 2QXHA 4DJZB 2TGTA 3H7TA 1SFIA 3BEIB 3MO3A 1GJ7B 1TGNA 1V2TT 4ZHLU 2XXLA 1KXDA 1GI3A 1C1WH 2SGPE 4A6LA 1TRNA 1O2VA 1YPLH 4ZKNU 3MYWA 1KTTB 1SGDE 3JZ1B 1FN6A 2FLRH 4AG2A 1O2IA 1Z7KA 5FAHA 2NU1E 4IN2A 2FM2A 5GPIB 1H9LB 1O3OA 2G00A 2JH0D 1DM4B 1S84A 3KGPA 1AVGH 3IG6B 5EW1H 1GDNA 4AYVB 4ABBA 2P95A 2ZU4A 1E35B 1TGCA 3BF6H 1QB9A 2FTLE 2BVSH 1DOJA 3A8BA 1GJAB 3H7OA 1RD3B 4FVBA 1EAWA 1FY4A 1AKSB 2W26A 1UTNA 5CHAB 4XBBA 1UCYH 2HPQH 1ZR0A 1GMHF 1A2CH 1ELTA 2BQWB 1GDUA 2BLOA 3V0XA 3RU4D 1B0FA 1ANDA 1HAZB 3RXLA 1QRXA 1MTNB 2VIWA 4WH8A 2A0QB 5CHAC 2WPLS 3ZVEA 3K6YA 2PUXB 5AFYH 3B8JA 3RM0H 2R0LA 1GVZA 1JMOH 2BOKA 3U8RH 3RLWH 3E0NB 1TX6A 2W5EA 1MTNC 1SGQE 2CMYA 5A8ZA 4YTAA 1C5LH 1TRYA 3Q76A 1EJNA 4GVUA 1UCYK 4WF8A 3PMBB 1K22H 1O3HA 2BZAA 4ABIA 2ALPA 2B5TB 4Y71A 1GJ5H 1TNGA 4K60A 3RXQA 3LGIA 1LHEH 2VWNA 3S9BA 3SJOA 1QR3E 2AMPA 3D62A 5A8XA 3VXEH 3FP8E 3OY5U 4B74A 3ZZ7A 1DWCH 1TQ0B 3M7TA 4XOJA 4O9VA 1O3FA 1O5EH 2O9QA 3GY3A 2QV1A 2WPJS 2Z9IA 2ZPRA 5GXPA 1JOUB 3A86A 1OP0A 2ZU1A 4YT6H 1O3CA 4SGAE 3B9FH 4JZFH 4AG1A 1CBWB 2P3FH 1KXAA 1W0YH 1Z71A 4YM9A 1ELBA 1RTFB 1T8MA 1TNLA 3UNQA 3DFJA 3BN9A 1A0HB 2QY0B 4MVNA 1GBFA 3EE0B 1O2PA 1O3PB 3SGAE 3A8AA 3A87A 1CBWC 1BTYA 1O3AA 1NM6A 3SJIA 2ZPSA 1SHHB 2BD4A 3LJOA 1O3MA 6CHAB 1W7GH 3MH7A 1W2KH 3AAUA 1D3DB 3PROA 2BD5A 2P8OB 1L1GA 1MBMA 4B71A 3Q77A 4IW4E 4JZ1A 4AX9H 1IOEA 3GDUA 3TGJE 4U32A 4CH2B 1DY9A 1V2VT 1GBEA 4MPUA 1LO6A 2G5VA 2OTVA 4K1TA 6CHAC 4Q7ZA 2BB4A 3MNCA 1D6WA 1T7CA 4JCNA 1GBKA 1HRTH 1OP2A 1HYLA 1XX9A 2P8OC 1UVOA 1JBUH 1GBBA 3RDZA 1BMLA 3RUOA 1A3BH 4U2WA 1P02A 1PPGE 4MPVA 4ZXXH 7LPRA 1V2QT 1GI2A 1Z1JA 1EXFA 1QURH 2BZ6H 1GGDB 1GL0E 1N6XA 2BDCA 1S0RA 2CHAB 3UNRA 1ETRH 4U30A 1UVUH 2CJIA 1AE5A 1VCWA 5EGMA 5BRRE 2FXRA 5JPMH 1WTGH 1FI8A 1GGDC 4D7FA 1O2JA 2VIVA 1THRH 1TBQH 1CA8B 1HIAB 1V2PT 2R2WU 4ISIH 3TNTA 2CHAC 3S7HB 1GBJA 1S5SA 3BG8A 1UK3A 1ELVA 1HJAB 1DXPA 1SI5H 2HLCA 1BBRK 1DLEA 3L6PA 1DWBH 1NFWA 4YT7H 3UQVA 1OOKB 1XUFA 1AB9B 5EQSA 1VITH 1THPB 1N6YA 2BTCE 1D3QB 2D8WA 5T3HA 1F0TA 1HJAC 1MQ6A 1PQ7A 2A5IA 2G4TA 3NKKA 1GMDF 3WY8A 2Q1JA 1C4U2 1Z8JB 1MTWA 3I29A 1AB9C 2ZGCA 1UVSH 3K9XB 1BBRE 1YPGH 3R3GB 5JYIA 1KLTA 1DUEA 2FS9A 2FWWA 1G2MA 1GBHA 4NSYA 2GTBA 1HAHH 2XTTB 1Q3XA 3AVZA 5DP5A 1RTLA 1A5HA 1MMJN 2JKHA 1EPTB 2JETB 1ANCA 1BTHH 4RN6A 2IOTA 4NSVA 3PMJA 3GCOA 4GSOA 3RMMH 3E3TA 4IGDA 1XMNB 1ZSKA 5EXNA 1H9HE 1XUIA 2CXVA 3A85A 5C3NA 4SGBE 5EPYA 1H9IE 4WMDA 3QGNB 2JETC 1EPTC 1T4VH 2QXJA 1T8LA 3Q3XA 3U8OH 3AAVA 1SOZA 3GY6A 1A3EH 3G01A 3A82A 3STIA 1JXPA 1GI6A 3OU0A 4JYUH 3SZNA 3UWJH 1BTXA 2VNTA 4X2VA 4K8YA 2BY7X 4ZKOU 1OX1A 2FMJA 1K2I1 1LKBA 2OC1A 2R3UA 2VVVA 3T62A 1EAIA 5C1YA 3RXTA 3UWIA 2XCFA 2PSYA 2SGDE 1T8NA 2ZCHP 1C5VA 1NT1A 4UFEH 3T2NA 2VJ1A 4WWYA 1LHFH 4FUGA 5ESBA 1C5SA 2EI7A 3MH4A 1P3CA 2WYJA 3LU9B 2WYGA 5FBEA 1HAIH 1GHZA 1OKXA 1ZJKA 2Y7ZA 2ZHFH 1FIWA 1CT0E 2G52A 1F0RA 4GPGA 1DICA 3BEFB 3EA7A 1JRSA 5JBCS 1PPZA 3RMOH 2BVXH 2EI8A 2WUCA 1W10U 1FY3A 2CF8H 3OX7U 1JIRA 1DX5M 1TNIA 2ZDLA 2ANMH 4FUCA 1C2LA 1FV9A 3KEEA 3ZZDA 3QUMP 1TYNA 1GMHG 3SI4H 2AMQA 3O8RA 1QBOA 1VJ9U 1YM0A 4THNH 4NWKA 3NXPA 1EKBB 1OWIA 1C5RA 3RMNH 2A1DB 4FUFA 2BD9A 3S0NA 1LQEA 3M5NA 2VWLA 1JIMA 3SUFA 5B6OA 2QXIA 3T27A 4B76A 1T4UH 1GHWH 5DP4A 3F9HA 4YESB 1FY8E 4KTSA 4HFPB 1TRMA 3TJNA 5FCRA 3SU3A 1TPAE 1A0LA 2THFB 4K2YA 2BDIA 4I8JA 4NGAH 1EUFA 3E90B 1J14A 2A4GA 3RXCA 4CBNA 2FOCA 2FPZA 3P8FA 1QA7A 2G4UA 1SLUB 3SUGA 3RM2H 5L2YH 1ZHMA 1BTWA 3QTOH 2Y81A 2G8TA 2BD3A 2F9VA 1GHBG 2FOMB 2A7HA 3GCTF 1HDTH 4GCHF 7ESTE 1O36A 4NG9H 1H8DH 1MTVA 1SGEE 2ZECA 3L33A 4ISNA 1TLDA 1IQJA 1ELCA 1PQ8A 1SFQB 5FPYA 5E2OA 1O2LA 4BAKB 3DD2H 1KTSB 1WU1A 1Y3XA 5HYOA 3SJKA 4D7GA 1QBVH 2C93B 5J4SA 1W8BH 3A7WA 4XE4A 3QLPH 2FDAA 2P16A 4UFDH 2ZHEH 2PKAA 4Y0YE 1SPJA 2UUKB 3CENA 2GCHF 4BAQB 1A5IA 1K9OE 3PMAB 4HGCA 2F3CE 1MTUA 3EQ0H 3KCGH 4X6MA 1RIWB 1NRSH 1XVOA 2BHGA 2GP9B 3TJOA 3SV9A 1NESE 3E16B 1C1TA 1O2KA 3ZVFA 4Q80A 2A4OA 2GDDA 4VGCC 4IN1A 1DWEH 3BSQA 3F9GA 5I46H 3U8TH 1FY5A 1RIWC 2Y6TA 1Z1IA 5GWZA 1Z6EA 1K1OA 1G2LA 4Y7AA 5A0BA 2Q6FA 4BANB 1C1SA 1UMAH 1XXFA 1OYTH 4B2AA 3VB4A 4MG3A 1TGTA 9LPRA 2AFQB 4UONA 1SGIB 4O3UA 2H5CA 4UFFH 2C90B 2R0KA 2G51A 3LONA 2ZCLP 1BT7A 3S69A 2ZFFH 1TGBA 3K65B 2WPHS 1HAGE 1K1NA 3M61U 4KELA 2ZDAH 1ABIH 3MU8A 2ZHDA 3UPEA 2ZIQH 3DUXH 2ZFPH 2ZPQA 1BMNH 1BMAA 2J92A 1DT2A 1TFXA 1C1NA 1HAVB 5IYTA 3ZYEA 1BIOA 2ZKSA 2HOBA 1HFDA 1YPMH 3S9CA 2H9HA 2ZCKP 3MNXA 3N7OA 6GCHF 1GBCA 1L1JA 1DE7H 3K2UA 1KDQA 1V2UT 1A5GH 1WCZA 1K21H 1NY22 1O37A 2ZA5A 1YPEH 2DE8A 1XUGA 1O5FH 4NZLA 1KYNA 3PLBA 1NFUA 4K3JA 1VITF 4I8GA 1QIXB 2GZ9A 1SLXB 4UFGH 3PTNA 3E6PH 1NRNH 3VPKA 3FP6E 3ATIA 1ETSH 1WBGB 1VCQA 3SNEA 5JB9S 3K6ZA 4DW2U 2Y5FA 2FYRA 2DE9A 2QXGA 2ANWA 1MTSA 4ZHMU 1HV7A 4AOQA 3MOCA 2RG3A 1ARBA 1TX8A 2PUQH 1O2TA 2WV5A 5HGGA 3P92A 2GZ7A 2HPPH 1G9IE 2TGPZ 1GPZA 4MNWA 1O5DH 2VH0A 1O35A 1P2OA 2J94A 1O31A 5EG4A 1LVMA 4I7YH 2VGCC 3C1KA 3I77A 1BUIA 4YOJA 1P3EA 3ODDA 4Y7BA 1P8VC 5DK1A 4X1NU 1UJ1A 1E34B 1KIGH 2A4RA 2ZP0H 1SG8B 8KME2 1T32A 3KF2A 1CGHA 3Q3KA 1Y3UA 4JZDH 4DIIH 2Z9GA 2AGEX 3QO6A 1M9UA 8GCHF 1FIZA 2TGAA 2ZWLH 3OTJE 4INKA 3TJVA 5C1UA 4X6OA 1TOCB 1ZTJA 5F03A 3VEQB 2TIOA 2B8OH 1OWDA 3VGCB 3GDSA 4CRGA 1VZQH 1A46H 3TK5A 1LQDB 1ZGIA 5FXLA 2WPKS 3IITA 2FOEA 1P03A 4KKDA 1ZYOA 4UEHH 1XKBC 2H9EH 5F8TA 3L3TA 4TWYA 1G32B 1C5XB 1O3JA 1YPKH 5SGAE 3VGCC 1ZRKA 5C5OA 5DKMA 5AVDA 1K1PA 2BY8X 4BTTB 1GJ9B 2J2UA 4INLA 1UTJA 1ZHPA 3TH2H 4AB9A 1O2QA 1IAUA 2NU2E 1TAWA 1OWEA 1YCPM 1KXCA 1LPKB 1QJ7B 3MNSA 3U1IB 1ABJH 2Q6GA 2UWOA 4I33A 1GJCB 4TPYA 1MAYA 4CRAA 4OS7A 1AKSA 2Z3EA 3D49H 1QCPA 1C2KA 1IQFA 2Y82A 4JMYA 4AZ2B 3SV7A 4F49A 1NPMA 2A5KA 2ZF0H 2FLBH 1GI1A 3V12A 4HI3A 2HNTF 3KHVA 3MU1A 3MWIU 4PROA 5F8ZA 1P2JA 4CREA 4E7NA 3BTFE 3QK1A 5JBBS 1GHXH 4KTCA 3LC5A 1OYQA 1O3IA 4B2CA 1V2KT 2SFAA 2SGQE 3VB5A 2VWMA 4B1TA 1UK4A 1KLJH 1SC8U 4UDWH 4NIVA 1J8AA 1C1OA 1TBZH 3SBKA 1AFEH 3S9AA 2KAIB 3ZVCA 1MCVA 3V3MA 4HTCH 3BTKE 1BRUP 3U98H 1FJSA 4NWLA 3E91A 2GGVB 3TVJB 2ODPA 3SJ8A 4I8HA 1EAUA 3UR6A 3SU6A 1C2HA 4AFSA 2ZGJA 4BNRA 1DLKB 4Y10E 5CE1A 1GMCF 1P04A 3Q3YA 3A8CA 1TMTH 1ZMJA 1C2MA 3GCTG 3PTBA 4GCHG 2QF3A 5DO4H 3SNDA 1EZQA 1GHAF 1V2JT 2ZTZA 1O2MA 2O8MA 1EZSC 1EZXC 3F6UH 1MBQA 3KQCA 3A7VA 2EI6A 2FIRH 1G3DA 4Y76A 1P2MA 4HZHA 3ZVAA 1F5LA 2VINA 3ZVBA 2TPIZ 4B75A 1FQ3A 1RXPA 1U6QA 1DXWA 1ELFA 1C1UH 4CHAB 4I8LA 2FZZA 2P3TB 3MTYA 1CO7E 1XUHA 3URDA 1A0JA 2XRCA 3LH1A 2OD3B 4GUXA 2GCHG 3BTME 4NA8A 4CRBA 5LGOA 5DP7A 1GCDA 2C8YB 1LVOA 2A4QA 4NIXA 4CHAC 2AYWA 4CRDA 2XBYA 1C5OH 3KN2A 3MU4A 1MU8B 3LC3A 1WV7H 2NU4E 5GIBA 4XBDA 1CHGA 3ZZ5A 2AH4X 2O8TA 1HLTH 4J2YB 5EODA 2EEKA 1GJ8B 3SUEA 1IQIA 1EZUC 4H6SB 4O03A 2I6SA 3SW2B 2TRMA 4ABJA 3FFGA 1CGIE 1O2YA 4UD9H 1P9UA 1UO6A 4DY7B 2FS8A 3B23B 3RLYH 2C8XB 3PO1B 1HGTH 3A7YA 3TGIE 3ZZ6A 4BXSA 3O8BA 2ZDVH 1BBRH 1L0ZA 2V35A 3UOUA 3BV9B 1W11U 2GZ8A 2F9UA 3TLOA 1UHBB 2B0FA 1ZSJA 3M35A 3QZQA 2FO9A 2ZTYA 1J17T 1CQQA 1PQAA 4A1XA 3PO1C 2OP9A 4XSKU 1O0DH 3BTTE 3T28A 1DSUA 2OINA 3EA9A 1E36B 1HIAA 5FBIA 2A32A 4B2BA 1HPGA 1IQHA 4CH8B 4Q7YA 3ZVGA 1BRAA
chains in the Genus database with same CATH superfamily
1KXEA 2QF0A 2ZFTA 2P3UB 1RGQA 2Z94A 2XBVA 3T25A 3FZZA 2B9LA 1LHGH 2HGTH 1S6HA 1Y59T 2JJ2D 1Y5BT 3SU5A 2ZU3A 2Z9JA 1GJDB 3GDVA 1GVLA 2VIQA 4Z1MD 1BITA 1C2JA 2UUFB 1V3XA 3N7DA 1K28D 4YOIA 3RXBA 1FY1A 3ZYDA 2P93A 4D9QA 5F8XA 3UAIC 1SGFG 3GYMA 1WAYB 1TB6H 3EA8A 5L30H 2GVFA 3TK9A 2K0QA 1J9CH 2RCEA 3PLKA 2WUBA 1LHCH 1HAOH 4Q63A 2BLWA 5T6GA 4D8NA 4BAHB 1GBDA 1UTKA 4YXWD 1GBAA 3SV8A 1NZQH 5J4QA 2AMDA 3SU4A 3GYLB 5K7RA 1ZHRA 1XXDA 1EPTA 2V6NA 4AB8A 1O3BA 1XM1A 1DANH 1Y3VA 2C8WB 2PV9B 4MPXA 4ABEA 1C5TA 3MHWU 2CV3A 4MTBA 2A5AA 5JBAS 3F9FA 4ASHA 1G36A 1FZZA 3VG8A 2VVCA 2VIDA 2FX6A 2ZO3H 7GCHF 1ELEE 2WV4A 8GCHG 4D9RA 3E1XB 5EOKA 3RC4A 3QWCH 3FO8D 2XC0A 2RA3A 5HKKD 2XWAA 2UWPA 2BQ7B 3M5MA 1MUEB 2EQNA 1W3CA 1RJXB 3PLPA 3KYFA 1Q31A 1KSNA 1A1RA 4Y0ZE 2DUCA 3VB7A 4MNXA 2FI3E 5A2MH 1SQOA 1O32A 4GAWA 2BM2A 2ZC9H 1B7XB 1DWDH 2O8LA 4A1VA 1UTPA 1C5UA 1S0QA 1QGFA 2L74A 4JYTA 2Z9KA 2ZNKH 7KMEH 2ULLA 3STJA 1O2SA 2EC9H 3V7TA 3MU5A 1SGNE 3MO6A 3TU7H 5L2ZH 2PLXA 3P17H 4JZEH 2Z7FE 3DA9B 1P11E 1Y3WA 5G4BA 2EA3A 2J95A 4AFQA 1P09A 1YCPK 2LPRA 1YKTA 1P0SH 4FU7A 2YOLA 3FOAA 4H6TA 1JRTA 1NTPA 1O38A 4MNVA 1SOTA 1KLIH 1UTLM 1CA0B 1SGRE 1W13U 2VWOA 3RXRA 2IPHA 1CU1A 1S83A 2BX4A 1Z6JH 2KX4A 4R8TB 1C2GA 2J5UA 1BHXF 4FUBA 1EATA 2FTMA 1PQ5A 1CSOE 1ZTLA 3SN8A 1F0UA 2Z3CA 3VFEA 5HXFA 2K1QA 2HNTC 2ZHWH 2W7UA 4FOUC 4BOHA 1MQ5A 2FOBA 1O2UA 1CA0C 2KCPA 1E79D 5F6MA 1SR5C 1AZZA 1LTOA 2VH6A 1GCTB 1BJVA 2FOHA 4LOYH 3A80A 4NFEA 3A81A 1F7ZA 2FESH 4CRFA 1WQVH 3D65E 1GI9B 2ZTXA 1PJPA 1YPHC 4NCYA 5DP9A 1V2NT 3EDXB 3BTEE 3IWMA 1MZDA 1GCTC 4NIWA 1CGJE 3ZZ9A 4AYYB 1NRRH 3RP2A 3LDXH 4KGAA 1GVKB 2QC2A 1QRZA 1G3BA 1L4ZA 2YNBA 2ZEBA 1GMCG 3LKWA 1PFXC 3RXPA 3LT3A 3RXHA 2GT7A 1ZMLA 2ODYB 1GHAG 1F92A 5F53A 2F91A 3MO9A 3MQKC 1BRBE 3KQBA 3T26A 1DVAH 3PYHA 1SVPA 5E2PA 5JDUB 1A7SA 1A4WH 1KXBA 1F0SA 1S82A 5A0AE 3HK3B 1C2FA 5JB8S 2XCNA 3GY8A 4WXIA 3U9AH 3MH5A 3HGNA 2AERH 1WTHD 2FI4E 3CS7A 4X1PU 2OCVB 3SOSA 1Q2WA 4DURA 3MMGA 1O39A 4X8SH 1IHTH 1EOJA 1GI5A 1X7AC 4X1RU 4A92A 1AO5A 1GWAA 4J1YA 1TMBH 4VGCB 5DP3A 1N1LA 2J34A 2J98B 4YZUA 1V2ST 2XNDD 2QAAA 1QQUA 3P8GA 5FX6A 1DITH 2H9TH 2HNTE 1D9IA 1NU7B 5FX5A 3MFJA 1HCGA 1PPFE 2G5NA 1NC6A 5DPAA 2FI5E 1O3LA 5ETXA 3NPSA 3UQOA 2NWNA 2OC0A 2KFWA 1S6FA 4WXVA 2A7JA 4OS4A 4TPIZ 1AVXA 3A84A 1QL9A 4MPWA 2GDEH 1GI7B 1YPHE 2ZGBH 4OS2A 3BTDE 1AFQB 3RMLH 1V2WT 5LPRA 1DPOA 1O2WA 2IJOB 1H1BA 2SNVA 1DFPA 2V3MA 3SORA 2BY5X 1WOFA 5AF9H 1FAKH 3GCNA 2AGIX 5DSFA 4WJG2 4A1TA 1HAVA 1AFQC 1LVYA 2F9BH 2XW9A 3SGBE 1EX3A 2OXSA 1FX0B 1Y3YA 2ANYA 3TH3H 4ZH8A 2CF9H 2B7DH 1W7XH 3MU0A 2PFEA 3ODFA 3ZZ3A 1QRWA 4Y8ZA 5GDSH 5EPNA 4TSFD 2GMTC 1D6RA 2BD2A 3O8DA 4ABDA 1HB0B 2A2XH 3CS0A 1YPJH 3ATMA 2ZGHA 5IK2D 2OC7A 1QY6A 1D3TB 1S6LA 1EP6A 2R3YA 3D23A 1FPHH 3U69H 1BOQA 4D76A 5C2ZA 2PHBA 3RXMA 1O33A 4NZQA 3ZVDA 1HNEE 1MAXA 1QL7A 1GMDG 2IN2A 5DP6A 4RT1A 1THSH 4NIYA 1O2HA 2Y5GA 3LGWA 4IC6A 2BLQA 5H4IB 1GG6B 1K1JA 2YMSB 3LGUA 1L2EA 4OS1A 2CGAA 4Y79A 2VGCB 3AW0A 1S81A 1GJBB 5C1XA 4WY3A 1TONA 2F9NA 3BTQE 2ZQ2A 3VB6A 4DVAU 4WMFA 5ABWA 1BJUA 1SBWA 1WXRA 1SGTA 1O2RA 2VU8E 2PW8H 1C9PA 3HKIB 1GG6C 1KMHB 2YMSC 4RKOB 2BQ6B 1FUJA 3UOPA 3TJUA 2PTNA 1P2NA 4QT8C 1AQ7A 1TNKA 1YBWA 3M3SA 7GCHG 3EE7A 1H8ED 3M7QA 2ZFQH 3TK6A 1SMFE 3E8LA 2BY6X 2ZHQH 3GY7A 2BLVA 3RXJA 3LOXA 3MNBA 1NN6A 1WSSH 5KEDA 3HKJB 1YP9A 3BTGE 2OLGA 4IC5A 4FXGH 2OBOA 1O3GA 1BDAA 1HXEH 2AS9A 1K1MA 3M5OA 1YGCH 1XKAC 1P12E 4CBOA 1IQMA 4ZHAA 1ZPCA 2GKVE 1ETTH 3GCHB 1HUTH 1O5GH 1YYY1 4FU9A 1PPEE 2RDEA 1IQNA 2FP7B 3RU4T 3RXVA 3SNBA 1C5NH 1VJAU 2RA0A 2Z9LA 1XUKA 3ESTA 2XC5A 4X6NA 3A89A 1G30B 1EQ9A 1RTKA 4E7RG 1SL3A 3GCHC 2C8ZB 4X2XA 1N8OC 5C5NA 3SZEA 3UFAA 2BXUH 2F43B 2OBQA 4CR5A 3SHAH 3PM3A 1ZRBA 2JH5D 5EQRA 3RXGA 1P9SA 5DP8A 1SKYE 2G81E 3SU0A 1ESTA 1F2SE 3R0FA 3P8OA 1B0EA 3SQHE 1AGJA 1YLDA 4ISLA 1YC0A 1EJMA 4ISOA 4Q4LA 3H5CB 1WYKA 1PPHE 3W95A 1TPSA 4FUJA 3KIDU 2J97A 1B5GH 1CE5A 1EB1H 1ESAA 2JH6D 2F9PA 2J38A 1E38B 1IQEA 3OY6U 3HK6B 3BTWE 2FYQA 1EP5A 1UVTH 5E0HA 4Z6AH 3UTUH 2Z3DA 1HJ9A 3E0PB 1UTQA 4DT7B 1SQAA 5I25A 5AFZH 2BDBA 2UUYA 3WWBA 2KAIA 4A5TS 2FODA 2OQ5A 5A8YA 1SQTA 5EJ1A 1TA2A 2FEQH 1TWXB 5EXMA 1A61H 2XWBI 1IHSH 3SUDA 1E37B 1FONA 3ATLA 1BTPA 1SB1H 2G55A 1UTOA 2SGAA 1C1QA 1TNHA 2QIQA 4GHQA 4ZKRU 4AFUA 4BTUB 1BTZA 4ABHA 2JIZD 1GL1A 3GY4A 1O3NA 3ENSB 3T29A 3PB1E 1SGPE 1GBIA 1QFKH 1KXFA 2CK3D 3WWFA 2H2ZA 2F9OA 3ZZ8A 5AHGH 3TGKE 2VIPA 3S7KB 1CVWH 1FN8A 3ZZBA 2I6QA 3QN7A 3RXFA 4ZROA 4JK5A 1NBME 4K69A 1ANEA 4FU8A 1QJ6B 1E0FD 1O30A 5LPEA 1GI8B 4H42U 2PSXA 2OUAA 2BYAX 2ZU2A 3C27B 4CRCA 2HLDD 1ACBE 1G37A 1AN1E 1TPOA 3TITA 1SSXA 2XC4A 2ZGXH 4IMZA 4YO9A 1ARCA 5DG6A 1O3EA 1AMHA 3ATKA 1GHBF 4X2YA 3ZZCA 4OGYA 3SU2A 3SHCH 3EYDA 3Q00A 1UCYE 2BDGA 4H4FA 5A0CA 2SNWA 3PWBA 2UUJB 2KM0A 1VR1H 3A7TA 8LPRA 1C5YB 2GT8A 4GLYA 5C20A 1TALA 1O5CB 4Q7XA 1TBRH 4ABFA 3PMHB 4DG4A 5IDKA 2BMGB 1PYTC 4FUHA 3DT0H 4DIHH 1LPGB 3KL6A 3TIUA 1MKXH 3KQDA 1V2LT 2D1JA 4ISHH 5EJLA 1QQ4A 1MD8A 4AN7A 2R2MB 1P01A 5GCHF 3LPRA 4K1SA 3O8CA 2ZU5A 4XDEA 2LNCA 2CN0H 2NU3E 2ZDMA 1SLWB 3UREA 2H1UA 2UWLA 4K8BA 4NFFA 1UHBA 1LCYA 4AORA 3P8NA 4DCDA 1P2QA 3PWCA 2BD8A 1CHOF 1NS3A 2D26C 3A88A 2WPDD 1HAXB 3OEHD 1HJ8A 1K1LA 1BTUA 2BVRH 3GOVB 2ESTE 4Q2KA 1TABE 3F68H 5DGJA 3JZ2B 2PGQB 1MKXK 2WPIS 3A7ZA 6GCHG 4DOQA 1QNJA 4ACAA 1UVPA 3P6ZB 3HPTB 1ZSLA 5EW2H 4O97A 3VXFH 1FLEE 2GV6A 1MD7A 2BOHB 3NCLA 3NWUA 4X1SU 3SV2H 1SLVB 5KECA 1Y5UT 3DCLA 4NA7A 5TJXA 1IQKA 5E8EH 1QA0A 3SNAA 1SGFA 1L1NA 5LH8A 1XVMA 3DFLA 1VITG 3TPIZ 1AHTH 1UK2A 2ILNA 2W6ID 1LPZB 1DDJA 1V2MT 4LZ4B 1NRPH 2ASUB 6LPRA 4I31A 2W3KA 4X8UH 1TA6A 1OP8A 2YNAA 4GHTA 1C5ZB 1V2OT 6ESTA 1GJ4H 5C0UA 2BD7A 3M3VA 4ZKSU 3QTVH 4IBLH 1QJ1B 4ZMAH 2V0BA 4MLFB 1VGCB 2HWLB 1INCA 2QN5T 1S85A 2WINI 1HAPH 3RC5A 5LPFA 3P95A 3RXSA 1G3EA 1ZLRA 2SGFE 4LZ1H 1AZ8A 4B6EA 3OYPA 4XRNA 2QCYA 2XYAA 4R0IA 1FAXA 4IS5A 1ID5H 1H8IH 1VGCC 2R9PA 3M37A 2ZG0H 4E06H 1P2IA 3A83A 4Y11E 4RKJB 5FHTA 5FPSA 2VVUA 3RXIA 1NFXA 1ORFA 1NU9A 1O5BB 3DHKH 1QB6A 3AK5A 2L6OA 3UB0A 5HMAA 1H4WA 4BXWA 2BY9X 1FNIA 1IQGA 3T5FH 3F0OA 1O2ZA 3CP7A 5FCKA 1NO9H 3FP7E 2V7QD 4KP0A 4HG6A 4WH6A 3M7UA 2O8WA 1C2DA 2GJGA 4OS6A 3UNSA 3KQEA 1YCPH 5CDFE 5HM9A 1QHRB 2FOGA 3AASA 5ESTE 4X1QU 1E1QD 3NUMA 5HM2A 1RFNA 3SJ9A 3URCA 1OWJA 5E0JA 2VBCA 4I86A 1O3DA 1ZZZA 3FAOA 1ZMNA 4OGXA 2PR3A 4YLUA 1LVBA 1LDTT 1YLCA 5TCAA 2BX3A 4JZIA 2HALA 3A7XA 3I78A 2STBE 1GI0A 4U01A 2IJD1 3FANA 5FPTA 3RXKA 2H5DA 3PV4A 5E0GA 3UIRA 1P10A 2M2AA 4O3TA 1O2NA 2GV7A 3SNCA 1C5QA 1SHYA 1DS2E 5PTPA 3LJJA 2W3IA 2BXTH 1GBMA 3LGTA 3M3TA 3PRDA 4ZUHA 1FDPA 4I8KA 4M7GA 1EJAA 2AGGX 3LIWA 3RU4E 1GJ6A 3RXEA 1C1PA 1TX7A 2V3OH 2Y80A 3VB3A 1AY6H 1O5AB 1TE0A 3BIUH 4A7IB 4ABAA 1AU8A 3DSPA 2VB0A 3SI3H 4TY7A 1VCPA 2A7CA 1OWKA 1W12U 4E05H 1AWFH 1RRKA 1DUAA 2GD4B 1BRCE 1YF4A 3LGVA 4ESTE 1MH0A 4FUIA 1W0ZU 2AIPA 3A8DA 5CHBA 4B6FA 3RXAA 3V13A 3KNXA 3BG4B 1AUJA 4YOGA 2WPMS 4BTIB 9ESTA 2ZDNA 3PV2A 3LGYA 5GJ4B 1MZAA 1QL8A 2OQUA 3ZZ4A 1H8HD 2RDLA 2QF5A 1MKWH 4Y8XA 1BZXE 1HXFH 3BIVH 3BG4C 5DJ7A 1F5KU 5CMXH 1UTMA 3H09A 3SU1A 4K5ZA 1DSTA 2A2QH 3ZV9A 2XBWA 1TMUH 1F5RA 2ODQA 2EY4C 3GICB 4MQAA 3QDZB 4X0WU 1OXGA 1ANBA 1ESBA 1ELDE 1Y8TA 1C1MA 1FPCH 2P94A 3HATH 1AIXH 3QX5H 5T6DA 1ELAA 1P06A 1OSSA 4TYDA 1MKWK 4JK6A 4TY6A 1C5MD 1TIOA 5T6FA 1FXYA 2PKSB 1WQSA 3EGKH 1Z8GA 3DSOA 5EQQA 4AGJA 2YMSD 3LH3A 3M36A 2J4IA 3U1JB 4BAOB 4WMEA 1MU6B 3RC6A 2J98A 2NU0E 1P57B 2PKSC 5JBTA 1AVWA 1NFYA 1Z8RA 1EB2A 2WZQA 1G3CA 1GHVH 3FVFB 2H6MA 1GBLA 2ZZUH 3ELAH 1ZOMA 1OS8A 3F9EA 4LXBH 5EXLA 2O8UA 1V2RT 2C4FH 1T31A 3TH4H 3UUZA 3MH6A 4FUDA 1QBNA 1O2OA 1QTFA 1MCTA 1WUNH 3BTHE 3SV6A 1BQYA 2Y7XA 1C5WB 1ZTKA 3MI4A 1EAXA 2HVXA 1OHHD 3W94A 1SGCA 4CR9A 3OSYA 4ABGA 2ANKH 1JWTA 1ZJDA 2PKAB 2TBSA 2GX4A 5L6NH 5GCHG 1NBMD 3F2FA 3RXDA 5DN6D 3QGJA 2QA9E 3SQEE 2F83A 2D2DA 3SGQE 3UR9A 1AE8H 1HBTH 1CHOG 1CT4E 1HAYB 5A09A 2J9NA 3F1SB 1Z8IB 2TGDA 5GNDA 1GDQA 1TOMH 2GMTB 1C5PA 4XFQA 2FOAA 1O2GH 4X8VH 3P70B 2A45B 2STAE 3NZIA 4I32A 1ZPZA 2Y5HA 4X2WA 1ZGVA 1YLNA 2KCAA 1FMGA 1Y5AT 2WHXA 4ZAEA 4X6PA 1ZPBA 4BAMB 4K1EA 2RFKC 1C4Y2 5BPEA 1DY8A 1TQ7B 4FVDA 1SGYE 2ZQ1A 2V3HH 4LK4A 2AEIH 3QZRA 2M5TA 3ATWA 1C2IA 2AIQA 3RXUA 1J15A 1GHYH 2PTCE 3FZDA 1TNJA 1GBTA 4DGJA 5TCCA 3TNSA 5EU8A 1LHDH 1TGSZ 1O34A 1ELGA 2QYIA 1LKAA 1QB1A 4UE7H 2XNIA 1OWHA 1BMMH 4AFZA 3EAJA 2BDYA 2ZFSA 4NA9H 2GCTB 2Q6DA 4JYVH 2ZI2H 1AWHB 2F4LA 1KDQB 2ZDKA 4RSPA 1T8OA 1BCUH 4TWWA 4WVPE 2W7SA 2FOFA 4AGKA 2BDAA 1K1IA 3OTPA 3SO3A 3ZV8A 1AD8H 3ITIA 1BB0B 1GI4A 2C3SA 2GCTC 5K0HA 4MNYA 3RXOA 1C1VH 1XUJA 2QGRA 1TPPA 4X8TH 2HRVA 4OS5A 2JJ1D 3NK8A 4KTUA 4B73A 1P05A 1W14U 5C67A 1C2EA 4XBCA 4F55A 1C4V2 1NRQH 5C17A 3GY2A 4Y8YA 1LMWB 3BEUA 4FUEA 2SGEE 1AI8H 1V6DA 2ZFRH 2A31A 4ZXYH 4INHA 3ZZAA 3KQ5A 1D4PB 2PGBB 4F4OC 1EASA 4MDSA 8ESTE 1EOLA 3GY5A 2XBXA 1J16A 1C1RA 1PPCE 1AUTC 2ALVA 3M5LA 4YLQH 1NROH 1O2XA 2Z6BD 1D3PB 1N8OB 2QF4A 2OC8A 3AW1A 2PWXA 1O3KA 1L4DA 3GISB 1CT2E 4Z0KA 1IQLA 4Y6DA 1C9TA 1PPBH 2BDHA 1BA8B 1OPHB 3F2GA 2P59A 1RS0A 2VIOA 1BHXB 2FX4A 1P2KA 4IMQA 1PYTD 3HGPA 3UY9A 1KY9A 2QXHA 3DSGA 4DJZB 2TGTA 3H7TA 1SFIA 3BEIB 3MO3A 1GJ7B 1TGNA 1V2TT 1E1RD 4ZHLU 1BMFD 2XXLA 1KXDA 1GI3A 1C1WH 2SGPE 4A6LA 1TRNA 1YWUA 1O2VA 1YPLH 4ZKNU 3MYWA 1KTTB 1SGDE 3JZ1B 1FN6A 2FLRH 2KR7A 4AG2A 1O2IA 1Z7KA 5FAHA 2NU1E 4IN2A 2FM2A 5GPIB 3OFND 1H9LB 1O3OA 2G00A 2JH0D 1DM4B 1S84A 3KGPA 1AVGH 3IG6B 5EW1H 1GDNA 4AYVB 4ABBA 2P95A 2ZU4A 1E35B 1TGCA 3BF6H 1QB9A 2FTLE 2BVSH 1DOJA 3A8BA 1GJAB 3H7OA 1RD3B 4FVBA 1EAWA 1FY4A 1AKSB 2W26A 1UTNA 5CHAB 4XBBA 1UCYH 2HPQH 1ZR0A 1GMHF 1A2CH 1ELTA 2BQWB 1GDUA 2BLOA 3V0XA 3RU4D 1B0FA 1ANDA 1HAZB 3RXLA 1QRXA 1MTNB 2VIWA 4WH8A 5EJZA 2A0QB 5CHAC 2WPLS 3ZVEA 3K6YA 2PUXB 5AFYH 3B8JA 3RM0H 4P02A 2R0LA 1GVZA 1JMOH 2BOKA 3U8RH 3RLWH 3E0NB 1TX6A 2W5EA 1MTNC 1SGQE 2CMYA 5A8ZA 4YTAA 1C5LH 1TRYA 3Q76A 1EJNA 4GVUA 1UCYK 4WF8A 3PMBB 1K22H 1O3HA 2BZAA 3ZIAD 4ABIA 2ALPA 2B5TB 4Y71A 1GJ5H 1TNGA 4K60A 3RXQA 3LGIA 1LHEH 2VWNA 3S9BA 3SJOA 1QR3E 2AMPA 3D62A 5A8XA 3VXEH 3FP8E 3OY5U 4B74A 3ZZ7A 1DWCH 1TQ0B 3M7TA 4XOJA 4O9VA 1O3FA 1O5EH 2O9QA 3GY3A 2QV1A 2WPJS 2Z9IA 3N99A 2ZPRA 5GXPA 1JOUB 5C94A 3A86A 1OP0A 2ZU1A 4YT6H 1O3CA 4SGAE 3B9FH 4JZFH 4AG1A 1CBWB 2P3FH 1KXAA 1W0YH 1Z71A 4YM9A 1ELBA 1RTFB 2JDID 1T8MA 1TNLA 3UNQA 3DFJA 3BN9A 1A0HB 2QY0B 4MVNA 1GBFA 3EE0B 1O2PA 4TT3D 1O3PB 3SGAE 2XOKD 3A8AA 1COWD 3A87A 1CBWC 1BTYA 1O3AA 1NM6A 3SJIA 2ZPSA 1SHHB 2BD4A 3LJOA 1O3MA 6CHAB 1W7GH 3MH7A 1W2KH 3AAUA 1D3DB 3PROA 2BD5A 2P8OB 1L1GA 1MBMA 4B71A 2W6JD 3Q77A 4IW4E 4JZ1A 4AX9H 1IOEA 3GDUA 3TGJE 4U32A 4CH2B 1DY9A 1V2VT 1GBEA 4MPUA 1LO6A 2G5VA 2OTVA 4K1TA 6CHAC 4Q7ZA 1VKYA 2BB4A 3MNCA 1D6WA 1T7CA 4JCNA 1GBKA 1HRTH 1OP2A 1HYLA 1XX9A 2P8OC 1UVOA 1JBUH 1GBBA 3RDZA 1BMLA 3RUOA 1A3BH 4U2WA 1P02A 1PPGE 4MPVA 4ZXXH 7LPRA 1V2QT 1GI2A 1Z1JA 1EXFA 1QURH 2BZ6H 1GGDB 1GL0E 1N6XA 2BDCA 1S0RA 2CHAB 3UNRA 1ETRH 4U30A 1UVUH 2CJIA 2QE7D 1AE5A 1VCWA 5EGMA 5BRRE 2FXRA 5JPMH 1WTGH 1FI8A 1GGDC 4D7FA 1O2JA 2VIVA 1THRH 1TBQH 1CA8B 1HIAB 1V2PT 2R2WU 4ISIH 3TNTA 2CHAC 3S7HB 1GBJA 1S5SA 2KCOA 3BG8A 1UK3A 1ELVA 1HJAB 1DXPA 1SI5H 2HLCA 1BBRK 1DLEA 3L6PA 1DWBH 1NFWA 4YT7H 3UQVA 1OOKB 1XUFA 1AB9B 5EQSA 1VITH 1THPB 1N6YA 2BTCE 1D3QB 2D8WA 5T3HA 1F0TA 1HJAC 1MQ6A 1PQ7A 2A5IA 2G4TA 3NKKA 1GMDF 3WY8A 2Q1JA 1C4U2 1Z8JB 1MTWA 3I29A 1AB9C 2ZGCA 1UVSH 3K9XB 1BBRE 1YPGH 3R3GB 5JYIA 1KLTA 1DUEA 2FS9A 2FWWA 1G2MA 1GBHA 4NSYA 2GTBA 1HAHH 2XTTB 1Q3XA 4ZCNA 3AVZA 5DP5A 1RTLA 1A5HA 1MMJN 2JKHA 1EPTB 2JETB 1ANCA 1BTHH 4RN6A 2IOTA 4NSVA 3PMJA 3GCOA 4GSOA 3F2HA 3RMMH 3E3TA 4IGDA 1XMNB 1EFRD 1ZSKA 5EXNA 1H9HE 1XUIA 2CXVA 3A85A 5C3NA 4SGBE 5EPYA 1H9IE 4WMDA 3QGNB 2JETC 1EPTC 1T4VH 2QXJA 1T8LA 3Q3XA 3U8OH 3AAVA 1SOZA 3GY6A 1A3EH 3G01A 3A82A 3STIA 1JXPA 1GI6A 3OU0A 4JYUH 3SZNA 3UWJH 1BTXA 2VNTA 4X2VA 4K8YA 2BY7X 4ZKOU 1OX1A 2FMJA 1K2I1 1LKBA 2OC1A 2R3UA 2VVVA 3T62A 1EAIA 5C1YA 3RXTA 3UWIA 2XCFA 2PSYA 2K8IA 2SGDE 1T8NA 2ZCHP 1C5VA 1NT1A 4UFEH 3T2NA 2VJ1A 3OAAD 4WWYA 1YY3A 1LHFH 4FUGA 5ESBA 1C5SA 2EI7A 3MH4A 1P3CA 2WYJA 3LU9B 2WYGA 5FBEA 1HAIH 1GHZA 1OKXA 1ZJKA 2Y7ZA 3PRBA 4P00A 2ZHFH 1FIWA 1CT0E 2G52A 1F0RA 4GPGA 1DICA 3BEFB 3EA7A 1JRSA 5JBCS 1PPZA 3RMOH 2BVXH 2EI8A 2WUCA 1W10U 1FY3A 2CF8H 3OX7U 1JIRA 1DX5M 1TNIA 2ZDLA 2ANMH 4FUCA 1C2LA 3WW7A 1FV9A 3KEEA 3ZZDA 3N7EA 3QUMP 1TYNA 1GMHG 5KGOA 3SI4H 2AMQA 3O8RA 2AHME 1QBOA 1VJ9U 1YM0A 4THNH 4NWKA 3NXPA 1EKBB 1OWIA 1C5RA 3GS9A 3RMNH 2A1DB 4FUFA 2BD9A 3S0NA 1LQEA 3M5NA 2VWLA 1JIMA 3SUFA 5B6OA 2QXIA 3T27A 4B76A 3PV5A 1T4UH 1GHWH 5DP4A 3F9HA 4YESB 2IPQX 1FY8E 4KTSA 4HFPB 1TRMA 3TJNA 5FCRA 3SU3A 1TPAE 1A0LA 2THFB 4K2YA 2BDIA 4I8JA 4NGAH 1EUFA 2KZ4A 3E90B 1J14A 2A4GA 3RXCA 4CBNA 2FOCA 2FPZA 3P8FA 1SQRA 1QA7A 2G4UA 1SLUB 3SUGA 3RM2H 5L2YH 1ZHMA 4OM9A 1BTWA 3QTOH 2Y81A 2G8TA 2BD3A 2F9VA 1GHBG 2FOMB 2A7HA 3GCTF 1HDTH 4GCHF 7ESTE 1O36A 4NG9H 1H8DH 1MTVA 1SGEE 2ZECA 3L33A 4ISNA 1TLDA 1IQJA 1ELCA 1PQ8A 1SFQB 5FPYA 5E2OA 1O2LA 4BAKB 3DD2H 1KTSB 1WU1A 1Y3XA 5HYOA 1K0HA 3SJKA 4D7GA 1QBVH 2C93B 5J4SA 1W8BH 3A7WA 4XE4A 3QLPH 2FDAA 4ACBA 2P16A 2WSSD 2ZHEH 4UFDH 2PKAA 4Y0YE 5T1VA 1SPJA 2UUKB 3CENA 4RI0A 2GCHF 4BAQB 1A5IA 1K9OE 3PMAB 4HGCA 2F3CE 1MTUA 3EQ0H 3KCGH 4X6MA 1RIWB 1NRSH 1XVOA 2BHGA 3SYJA 2GP9B 5HIYA 3TJOA 3SV9A 1NESE 3E16B 1C1TA 1O2KA 3ZVFA 4Q80A 4F48B 2A4OA 2GDDA 4VGCC 4IN1A 1DWEH 2WV9A 3BSQA 3F9GA 3F0PA 3U8TH 5I46H 1FY5A 1RIWC 2Y6TA 1Z1IA 5HIZA 5GWZA 1Z6EA 1K1OA 1G2LA 4Y7AA 5A0BA 2Q6FA 4BANB 1C1SA 1UMAH 1XXFA 1OYTH 4B2AA 3VB4A 4MG3A 1TGTA 9LPRA 2AFQB 4UONA 1SGIB 4O3UA 2H5CA 4UFFH 2C90B 2R0KA 2G51A 3LONA 2ZCLP 1BT7A 3S69A 2ZFFH 1TGBA 3K65B 2WPHS 1HAGE 1K1NA 3M61U 4KELA 2ZDAH 1ABIH 3MU8A 2ZHDA 1UW7A 3UPEA 2ZIQH 3DUXH 2ZFPH 2ZPQA 1BMNH 1BMAA 2J92A 1DT2A 1TFXA 1C1NA 1HAVB 5IYTA 3ZYEA 1BIOA 2ZKSA 2HOBA 1HFDA 1YPMH 3S9CA 2H9HA 2ZCKP 3MNXA 3N7OA 6GCHF 1GBCA 1L1JA 1DE7H 3K2UA 1KDQA 1V2UT 1A5GH 1WCZA 3OEED 1K21H 1NY22 1O37A 2ZA5A 1YPEH 2LELA 2DE8A 2LP6A 1XUGA 1O5FH 4NZLA 1KYNA 1MABB 3PLBA 1NFUA 4K3JA 1VITF 4I8GA 3FN8A 1QIXB 2GZ9A 3CNRA 1SLXB 4UFGH 3PTNA 3E6PH 1NRNH 3VPKA 3FP6E 3ATIA 1ETSH 1WBGB 1VCQA 3SNEA 5JB9S 3K6ZA 4DW2U 2Y5FA 2FYRA 2DE9A 2QXGA 2ANWA 1MTSA 4ZHMU 1HV7A 4AOQA 5B6LA 3MOCA 2RG3A 1ARBA 1TX8A 1W0JD 2PUQH 1O2TA 2WV5A 5HGGA 3P92A 2OK5A 2GZ7A 2HPPH 1G9IE 2TGPZ 1GPZA 5FL7D 4MNWA 1O5DH 2VH0A 1O35A 1P2OA 2J94A 1O31A 5EG4A 1LVMA 4I7YH 2VGCC 3C1KA 3I77A 1BUIA 4YOJA 1P3EA 3ODDA 4Y7BA 1P8VC 5DK1A 4X1NU 1UJ1A 1E34B 1KIGH 2A4RA 2ZP0H 1SG8B 8KME2 1T32A 3KF2A 1CGHA 3Q3KA 1Y3UA 4JZDH 4DIIH 2Z9GA 2AGEX 3QO6A 1M9UA 8GCHF 1FIZA 2TGAA 2PP6A 2ZWLH 3OTJE 4INKA 1WDIA 3TJVA 5C1UA 4X6OA 1TOCB 1ZTJA 5F03A 3VEQB 2TIOA 2B8OH 1OWDA 5C0TA 3VGCB 3GDSA 4CRGA 1VZQH 1A46H 3TK5A 1LQDB 1ZGIA 5FXLA 2WPKS 3IITA 2FOEA 1P03A 4KKDA 1ZYOA 4UEHH 1XKBC 2H9EH 5F8TA 3L3TA 4TWYA 1G32B 1C5XB 1O3JA 1YPKH 5SGAE 3VGCC 1ZRKA 4ASUD 5C5OA 5DKMA 5AVDA 1K1PA 2BY8X 4BTTB 1GJ9B 2J2UA 4INLA 1UTJA 1ZHPA 3TH2H 4AB9A 1O2QA 1IAUA 2NU2E 1TAWA 1OWEA 1YCPM 1KXCA 1LPKB 1QJ7B 3MNSA 1W0KD 3U1IB 1ABJH 2Q6GA 2UWOA 4I33A 1GJCB 4TPYA 1MAYA 4CRAA 4OS7A 4DT4A 1AKSA 2Z3EA 3D49H 1QCPA 1C2KA 1IQFA 2Y82A 4JMYA 4AZ2B 3SV7A 4F49A 1NPMA 2A5KA 3F3BA 2ZF0H 2FLBH 1GI1A 3V12A 4HI3A 2HNTF 3KHVA 3MU1A 3MWIU 4M9FA 4PROA 5F8ZA 1P2JA 4CREA 4E7NA 3BTFE 3QK1A 5JBBS 1GHXH 4KTCA 3LC5A 1OYQA 1O3IA 4B2CA 1V2KT 2SFAA 2SGQE 3VB5A 2VWMA 4B1TA 1UK4A 1KLJH 1SC8U 4UDWH 4NIVA 1J8AA 1C1OA 1TBZH 3SBKA 1AFEH 3S9AA 2KAIB 3ZVCA 1MCVA 3V3MA 4HTCH 3BTKE 1BRUP 3U98H 1FJSA 4NWLA 3E91A 2GGVB 3TVJB 2ODPA 3OE7D 3SJ8A 2KCYA 4I8HA 1EAUA 3UR6A 3SU6A 1C2HA 4AFSA 2ZGJA 4BNRA 2HVYB 1DLKB 4Y10E 5CE1A 1GMCF 1P04A 3Q3YA 3U28C 3A8CA 1TMTH 1ZMJA 1C2MA 3GCTG 3PTBA 4GCHG 2QF3A 5DO4H 3SNDA 1EZQA 1GHAF 1V2JT 2ZTZA 1O2MA 2O8MA 1EZSC 1EZXC 3F6UH 1MBQA 3KQCA 3A7VA 2EI6A 2FIRH 1G3DA 4Y76A 1P2MA 4HZHA 3ZVAA 1F5LA 2VINA 3W1EA 3ZVBA 2TPIZ 4B75A 1FQ3A 1RXPA 1U6QA 1DXWA 1ELFA 1C1UH 4CHAB 4I8LA 2FZZA 2P3TB 3MTYA 1CO7E 1XUHA 3URDA 1A0JA 2XRCA 3LH1A 2OD3B 4GUXA 2GCHG 3BTME 4NA8A 4CRBA 5LGOA 5DP7A 1GCDA 2C8YB 1LVOA 2A4QA 4NIXA 4CHAC 2AYWA 4CRDA 2XBYA 1C5OH 4RT0A 3KN2A 3MU4A 3NRLA 1MU8B 3LC3A 1WV7H 2NU4E 5GIBA 4XBDA 1CHGA 3ZZ5A 1QZ8A 2AH4X 2O8TA 1HLTH 4J2YB 5EODA 2EEKA 1GJ8B 3SUEA 1IQIA 1EZUC 4H6SB 4O03A 2I6SA 3KYGA 3SW2B 2TRMA 4ABJA 3FFGA 1CGIE 1O2YA 4UD9H 1P9UA 1UO6A 4DY7B 2FS8A 3B23B 4XD7D 3RLYH 2C8XB 3PO1B 4AC9A 1HGTH 3A7YA 4FETA 3TGIE 3ZZ6A 4BXSA 3O8BA 2ZDVH 1BBRH 1L0ZA 2V35A 3UOUA 3BV9B 1W11U 2GZ8A 2F9UA 3TLOA 1UHBB 2B0FA 1ZSJA 3M35A 3QZQA 2FO9A 2ZTYA 1J17T 1CQQA 1PQAA 4A1XA 3PO1C 2OP9A 4XSKU 3FKSD 1O0DH 3BTTE 3T28A 1DSUA 2OINA 3EA9A 1E36B 1HIAA 5FBIA 2A32A 4B2BA 1HPGA 1IQHA 4CH8B 4Q7YA 5EIYA 3ZVGA 1BRAA
chains in the Genus database with same CATH topology
1KXEA 2QF0A 2ZFTA 2P3UB 1RGQA 2Z94A 2XBVA 3T25A 3FZZA 2B9LA 1LHGH 2HGTH 1S6HA 1Y59T 1Y5BT 3SU5A 2ZU3A 2Z9JA 1GJDB 3GDVA 1GVLA 2VIQA 1BITA 1C2JA 2UUFB 1V3XA 1K28D 4YOIA 3RXBA 1FY1A 3ZYDA 2P93A 4D9QA 5F8XA 1SGFG 3GYMA 1WAYB 1TB6H 3EA8A 5L30H 2GVFA 3TK9A 1J9CH 2RCEA 3PLKA 2WUBA 1LHCH 1HAOH 2BLWA 5T6GA 4D8NA 4BAHB 1GBDA 1UTKA 1GBAA 3SV8A 1NZQH 5J4QA 2AMDA 3SU4A 3GYLB 5K7RA 1ZHRA 1XXDA 1EPTA 2V6NA 4AB8A 1O3BA 1XM1A 1DANH 1Y3VA 2C8WB 2PV9B 4MPXA 4ABEA 1C5TA 3MHWU 2CV3A 4MTBA 2A5AA 5JBAS 3F9FA 4ASHA 1G36A 1FZZA 2VVCA 2VIDA 2FX6A 2ZO3H 7GCHF 1ELEE 2WV4A 8GCHG 4D9RA 3E1XB 5EOKA 3RC4A 3QWCH 2XC0A 2RA3A 2XWAA 2UWPA 2BQ7B 3M5MA 1MUEB 1W3CA 1RJXB 3PLPA 1Q31A 1KSNA 1A1RA 4Y0ZE 2DUCA 3VB7A 4MNXA 2FI3E 5A2MH 1SQOA 1O32A 4GAWA 2BM2A 2ZC9H 1B7XB 1DWDH 2O8LA 4A1VA 1UTPA 1C5UA 1S0QA 1QGFA 4JYTA 2Z9KA 2ZNKH 7KMEH 2ULLA 3STJA 1O2SA 2EC9H 3V7TA 3MU5A 1SGNE 3MO6A 3TU7H 5L2ZH 2PLXA 3P17H 4JZEH 2Z7FE 3DA9B 1P11E 1Y3WA 5G4BA 2EA3A 2J95A 4AFQA 1P09A 1YCPK 2LPRA 1YKTA 1P0SH 4FU7A 2YOLA 4H6TA 1JRTA 1NTPA 1O38A 4MNVA 1SOTA 1KLIH 1UTLM 1CA0B 1SGRE 1W13U 2VWOA 3RXRA 2IPHA 1CU1A 1S83A 2BX4A 1Z6JH 4R8TB 1C2GA 4FUBA 1BHXF 1EATA 2FTMA 1PQ5A 1CSOE 1ZTLA 3SN8A 1F0UA 2Z3CA 3VFEA 5HXFA 2K1QA 2HNTC 2ZHWH 2W7UA 4BOHA 1MQ5A 2FOBA 1O2UA 1CA0C 5F6MA 1SR5C 1AZZA 1LTOA 2VH6A 1GCTB 1BJVA 2FOHA 4LOYH 3A80A 4NFEA 3A81A 1F7ZA 2FESH 4CRFA 1WQVH 3D65E 1GI9B 2ZTXA 1PJPA 1YPHC 4NCYA 5DP9A 1V2NT 3EDXB 3BTEE 3IWMA 1MZDA 1GCTC 4NIWA 1CGJE 3ZZ9A 4AYYB 1NRRH 3RP2A 3LDXH 4KGAA 1GVKB 2QC2A 1QRZA 1G3BA 1L4ZA 2YNBA 2ZEBA 1GMCG 3LKWA 1PFXC 3RXPA 3LT3A 3RXHA 2GT7A 1ZMLA 2ODYB 1GHAG 1F92A 2F91A 3MO9A 1BRBE 3KQBA 3T26A 1DVAH 3PYHA 1SVPA 5E2PA 5JDUB 1A7SA 1A4WH 1KXBA 1F0SA 1S82A 5A0AE 3HK3B 1C2FA 5JB8S 2XCNA 3GY8A 4WXIA 3U9AH 3MH5A 3HGNA 2AERH 1WTHD 2FI4E 3CS7A 4X1PU 2OCVB 3SOSA 1Q2WA 4DURA 3MMGA 1O39A 4X8SH 1IHTH 1EOJA 1GI5A 1X7AC 4X1RU 4A92A 1AO5A 1GWAA 4J1YA 1TMBH 4VGCB 5DP3A 1N1LA 2J34A 4YZUA 1V2ST 2QAAA 1QQUA 3P8GA 5FX6A 1DITH 2H9TH 2HNTE 1D9IA 1NU7B 5FX5A 3MFJA 1HCGA 1PPFE 2G5NA 1NC6A 5DPAA 2FI5E 1O3LA 5ETXA 3NPSA 3UQOA 2NWNA 2OC0A 1S6FA 4WXVA 2A7JA 4OS4A 4TPIZ 1AVXA 3A84A 1QL9A 4MPWA 2GDEH 1GI7B 1YPHE 2ZGBH 4OS2A 3BTDE 1AFQB 3RMLH 1V2WT 5LPRA 1DPOA 1O2WA 2IJOB 1H1BA 2SNVA 1DFPA 3SORA 2BY5X 1WOFA 5AF9H 1FAKH 3GCNA 2AGIX 4WJG2 4A1TA 1HAVA 1AFQC 1LVYA 2F9BH 2XW9A 3SGBE 1EX3A 2OXSA 1Y3YA 2ANYA 3TH3H 4ZH8A 2CF9H 2B7DH 1W7XH 3MU0A 2PFEA 3ODFA 3ZZ3A 1QRWA 4Y8ZA 5GDSH 5EPNA 2GMTC 1D6RA 2BD2A 3O8DA 4ABDA 1HB0B 2A2XH 3CS0A 1YPJH 3ATMA 2ZGHA 2OC7A 1QY6A 1D3TB 1EP6A 2R3YA 3D23A 1FPHH 3U69H 1BOQA 4D76A 5C2ZA 2PHBA 3RXMA 1O33A 4NZQA 3ZVDA 1HNEE 1MAXA 1QL7A 1GMDG 2IN2A 5DP6A 1THSH 4NIYA 1O2HA 2Y5GA 3LGWA 4IC6A 2BLQA 5H4IB 1GG6B 1K1JA 3LGUA 1L2EA 4OS1A 2CGAA 4Y79A 2VGCB 3AW0A 1S81A 1GJBB 5C1XA 4WY3A 1TONA 2F9NA 3BTQE 2ZQ2A 3VB6A 4DVAU 4WMFA 5ABWA 1BJUA 1SBWA 1SGTA 1O2RA 2VU8E 2PW8H 1C9PA 3HKIB 1GG6C 4RKOB 2BQ6B 1FUJA 3UOPA 3TJUA 2PTNA 1P2NA 4QT8C 1AQ7A 1TNKA 1YBWA 3M3SA 7GCHG 3M7QA 2ZFQH 3TK6A 1SMFE 3E8LA 2BY6X 2ZHQH 3GY7A 2BLVA 3RXJA 3LOXA 3MNBA 1NN6A 1WSSH 3HKJB 1YP9A 3BTGE 2OLGA 4IC5A 4FXGH 2OBOA 1O3GA 1BDAA 1HXEH 2AS9A 1K1MA 3M5OA 1YGCH 1XKAC 1P12E 4CBOA 1IQMA 4ZHAA 1ZPCA 2GKVE 1ETTH 3GCHB 1HUTH 1O5GH 1YYY1 4FU9A 1PPEE 1IQNA 2FP7B 3RU4T 3RXVA 3SNBA 1C5NH 1VJAU 2RA0A 2Z9LA 1XUKA 3ESTA 2XC5A 4X6NA 3A89A 1G30B 1EQ9A 1RTKA 4E7RG 1SL3A 3GCHC 2C8ZB 4X2XA 1N8OC 5C5NA 3UFAA 2BXUH 2OBQA 4CR5A 3SHAH 3PM3A 1ZRBA 2JH5D 5EQRA 3RXGA 1P9SA 5DP8A 2G81E 3SU0A 1ESTA 1F2SE 3R0FA 3P8OA 1B0EA 3SQHE 1AGJA 1YLDA 4ISLA 1YC0A 1EJMA 4ISOA 3H5CB 1WYKA 1PPHE 3W95A 1TPSA 4FUJA 3KIDU 1B5GH 1CE5A 1EB1H 1ESAA 2JH6D 2F9PA 2J38A 1E38B 1IQEA 3OY6U 3HK6B 3BTWE 2FYQA 1EP5A 1UVTH 5E0HA 4Z6AH 3UTUH 2Z3DA 1HJ9A 3E0PB 1UTQA 4DT7B 1SQAA 5I25A 5AFZH 2BDBA 2UUYA 2KAIA 4A5TS 2FODA 2OQ5A 5A8YA 1SQTA 1TA2A 2FEQH 1TWXB 5EXMA 1A61H 2XWBI 1IHSH 3SUDA 1E37B 1FONA 3ATLA 1BTPA 1SB1H 2G55A 1UTOA 2SGAA 1C1QA 1TNHA 2QIQA 4GHQA 4ZKRU 4AFUA 4BTUB 1BTZA 4ABHA 1GL1A 3GY4A 1O3NA 3ENSB 3T29A 3PB1E 1SGPE 1GBIA 1QFKH 1KXFA 2H2ZA 2F9OA 3ZZ8A 5AHGH 3TGKE 2VIPA 3S7KB 1CVWH 1FN8A 3ZZBA 2I6QA 3QN7A 3RXFA 4ZROA 4JK5A 4K69A 1ANEA 4FU8A 1QJ6B 1E0FD 1O30A 5LPEA 1GI8B 4H42U 2PSXA 2OUAA 2BYAX 2ZU2A 3C27B 4CRCA 1ACBE 1G37A 1AN1E 1TPOA 3TITA 1SSXA 2XC4A 2ZGXH 4IMZA 4YO9A 1ARCA 5DG6A 1O3EA 1AMHA 3ATKA 1GHBF 4X2YA 3ZZCA 4OGYA 3SU2A 3SHCH 3EYDA 3Q00A 1UCYE 2BDGA 4H4FA 5A0CA 2SNWA 3PWBA 2UUJB 1VR1H 3A7TA 8LPRA 1C5YB 2GT8A 4GLYA 5C20A 1TALA 1O5CB 4Q7XA 1TBRH 4ABFA 3PMHB 4DG4A 5IDKA 2BMGB 1PYTC 4FUHA 3DT0H 4DIHH 1LPGB 3KL6A 3TIUA 1MKXH 3KQDA 1V2LT 2D1JA 4ISHH 4AN7A 1QQ4A 1MD8A 2R2MB 1P01A 5GCHF 3LPRA 4K1SA 3O8CA 2ZU5A 4XDEA 2LNCA 2CN0H 2NU3E 2ZDMA 1SLWB 3UREA 2H1UA 2UWLA 4K8BA 4NFFA 1UHBA 1LCYA 4AORA 3P8NA 4DCDA 1P2QA 3PWCA 2BD8A 1CHOF 1NS3A 2D26C 3A88A 1HAXB 1HJ8A 1K1LA 1BTUA 2BVRH 3GOVB 2ESTE 4Q2KA 1TABE 3F68H 5DGJA 3JZ2B 2PGQB 1MKXK 2WPIS 3A7ZA 6GCHG 4DOQA 1QNJA 1UVPA 3P6ZB 3HPTB 1ZSLA 5EW2H 4O97A 3VXFH 1FLEE 2GV6A 1MD7A 2BOHB 3NCLA 3NWUA 4X1SU 3SV2H 1SLVB 1Y5UT 4NA7A 5TJXA 1IQKA 5E8EH 1QA0A 3SNAA 1SGFA 1L1NA 5LH8A 1XVMA 3DFLA 1VITG 3TPIZ 1AHTH 1UK2A 2ILNA 1LPZB 1DDJA 1V2MT 4LZ4B 1NRPH 2ASUB 6LPRA 4I31A 2W3KA 4X8UH 1TA6A 1OP8A 2YNAA 4GHTA 1C5ZB 1V2OT 6ESTA 1GJ4H 2BD7A 3M3VA 4ZKSU 3QTVH 4IBLH 1QJ1B 4ZMAH 2V0BA 4MLFB 1VGCB 2HWLB 1INCA 2QN5T 1S85A 2WINI 1HAPH 3RC5A 5LPFA 3P95A 3RXSA 1G3EA 1ZLRA 2SGFE 4LZ1H 1AZ8A 3OYPA 2QCYA 2XYAA 4R0IA 1FAXA 4IS5A 1ID5H 1H8IH 1VGCC 2R9PA 3M37A 2ZG0H 4E06H 1P2IA 3A83A 4Y11E 4RKJB 5FHTA 5FPSA 2VVUA 3RXIA 1NFXA 1ORFA 1NU9A 1O5BB 3DHKH 1QB6A 5HMAA 1H4WA 4BXWA 2BY9X 1FNIA 1IQGA 3T5FH 1O2ZA 3CP7A 5FCKA 1NO9H 3FP7E 4KP0A 4WH6A 3M7UA 2O8WA 1C2DA 4OS6A 3UNSA 3KQEA 1YCPH 5HM9A 1QHRB 2FOGA 3AASA 5ESTE 4X1QU 3NUMA 5HM2A 1RFNA 3SJ9A 3URCA 1OWJA 5E0JA 1O3DA 1ZZZA 3FAOA 1ZMNA 4OGXA 2PR3A 4YLUA 1LVBA 1LDTT 1YLCA 5TCAA 2BX3A 4JZIA 2HALA 3A7XA 3I78A 2STBE 1GI0A 4U01A 3FANA 5FPTA 3RXKA 3UIRA 2H5DA 3PV4A 5E0GA 1P10A 4O3TA 1O2NA 2GV7A 3SNCA 1C5QA 1SHYA 1DS2E 5PTPA 3LJJA 2W3IA 2BXTH 1GBMA 3LGTA 3M3TA 4ZUHA 1FDPA 4I8KA 4M7GA 1EJAA 2AGGX 3LIWA 3RU4E 1GJ6A 3RXEA 1C1PA 1TX7A 2V3OH 2Y80A 3VB3A 1AY6H 1O5AB 1TE0A 3BIUH 4A7IB 4ABAA 1AU8A 2VB0A 3SI3H 4TY7A 1VCPA 2A7CA 1OWKA 1W12U 4E05H 1AWFH 1RRKA 1DUAA 2GD4B 1BRCE 1YF4A 3LGVA 4ESTE 1MH0A 4FUIA 1W0ZU 2AIPA 3A8DA 3RXAA 3V13A 3KNXA 3BG4B 1AUJA 4YOGA 2WPMS 4BTIB 9ESTA 2ZDNA 3LGYA 5GJ4B 1MZAA 1QL8A 2OQUA 3ZZ4A 2RDLA 1MKWH 4Y8XA 1BZXE 1HXFH 3BIVH 3BG4C 5DJ7A 1F5KU 5CMXH 1UTMA 3SU1A 4K5ZA 1DSTA 2A2QH 3ZV9A 2XBWA 1TMUH 1F5RA 2ODQA 3GICB 4MQAA 3QDZB 4X0WU 1OXGA 1ANBA 1ESBA 1ELDE 1Y8TA 1C1MA 1FPCH 2P94A 3HATH 1AIXH 3QX5H 5T6DA 1ELAA 1P06A 1OSSA 4TYDA 1MKWK 4JK6A 4TY6A 1C5MD 1TIOA 5T6FA 1FXYA 2PKSB 1WQSA 3EGKH 1Z8GA 5EQQA 4AGJA 3LH3A 3M36A 2J4IA 3U1JB 4BAOB 4WMEA 1MU6B 3RC6A 2NU0E 1P57B 2PKSC 5JBTA 1AVWA 1NFYA 1Z8RA 1EB2A 1G3CA 1GHVH 3FVFB 2H6MA 1GBLA 2ZZUH 3ELAH 1ZOMA 1OS8A 3F9EA 4LXBH 5EXLA 2O8UA 1V2RT 2C4FH 1T31A 3TH4H 3UUZA 3MH6A 4FUDA 1QBNA 1O2OA 1QTFA 1MCTA 1WUNH 3BTHE 3SV6A 1BQYA 2Y7XA 1C5WB 1ZTKA 3MI4A 1EAXA 2HVXA 3W94A 1SGCA 4CR9A 3OSYA 4ABGA 2ANKH 1JWTA 1ZJDA 2PKAB 2TBSA 2GX4A 5L6NH 5GCHG 3RXDA 3QGJA 2QA9E 3SQEE 2F83A 2D2DA 3SGQE 3UR9A 1AE8H 1HBTH 1CHOG 1CT4E 1HAYB 5A09A 2J9NA 3F1SB 1Z8IB 2TGDA 1GDQA 1TOMH 2GMTB 1C5PA 4XFQA 2FOAA 1O2GH 4X8VH 3P70B 2A45B 2STAE 3NZIA 4I32A 1ZPZA 2Y5HA 4X2WA 1ZGVA 1FMGA 1Y5AT 4ZAEA 4X6PA 1ZPBA 4BAMB 4K1EA 1C4Y2 5BPEA 1DY8A 1TQ7B 4FVDA 1SGYE 2ZQ1A 2V3HH 4LK4A 2AEIH 3QZRA 2M5TA 3ATWA 1C2IA 2AIQA 3RXUA 1J15A 1GHYH 2PTCE 3FZDA 1TNJA 1GBTA 4DGJA 5TCCA 3TNSA 5EU8A 1LHDH 1TGSZ 1O34A 1ELGA 2QYIA 1LKAA 1QB1A 4UE7H 2XNIA 1OWHA 1BMMH 4AFZA 3EAJA 2BDYA 2ZFSA 4NA9H 2GCTB 2Q6DA 4JYVH 2ZI2H 1AWHB 1KDQB 2ZDKA 4RSPA 1T8OA 1BCUH 4TWWA 4WVPE 2W7SA 2FOFA 4AGKA 2BDAA 1K1IA 3SO3A 3ZV8A 1AD8H 3ITIA 1BB0B 1GI4A 2C3SA 2GCTC 5K0HA 4MNYA 3RXOA