3PLBA

Bovine trypsin variant x(tripleile227) in complex with small molecule inhibitor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plbA02
1O3GA 1G2LA 1O2NA 4AORA 1SGTA 5A8ZA 1BTWA 3RXCA 4THNH 1O5BB 1TPAE 2H5DA 1P09A 7LPRA 1JIMA 3EDXB 3KGPA 3M35A 5EQQA 2G81E 3HATH 4Y6DA 3FZZA 5A8XA 4WVPE 2UWOA 1K21H 5JBAS 3L3TA 1H1BA 1W8BH 1ZPBA 4I8GA 4X8SH 3ZZ3A 5HMAA 2ANYA 3MOCA 4AX9H 2AFQB 3A7VA 4UD9H 2FZZA 1P11E 2FP7B 3A86A 1A5GH 3PROA 1W13U 3F9GA 2Z9KA 1P12E 6GCHG 4YOGA 4ZROA 3A83A 4PROA 1WQSA 2BLQA 2QN5T 4CH2B 5DKMA 1FN8A 3U8RH 1V2UT 2V6NA 5CHAC 1GI8B 3LGVA 1TWXB 2A32A 3M7TA 3NK8A 3KQDA 3GY4A 4ABAA 3CENA 2G52A 4BAHB 1BMMH 2ZGBH 3A88A 3MH6A 1BZXE 3T27A 5FHTA 3SN8A 2ZDVH 5L2YH 2J38A 2PW8H 2UWLA 1P01A 1KIGH 4I32A 1W2KH 2GT8A 1IQHA 2ODQA 1NFXA 1Y3XA 1JOUB 9LPRA 3B9FH 1MBQA 1QURH 3RXUA 1SLXB 1LQEA 1OWDA 2FI3E 2P94A 1AUJA 1OP8A 5GJ4B 2ZP0H 5FBEA 3T62A 2ZGJA 4D7FA 4JYTA 3M3SA 2QV1A 1TOMH 2FOBA 2P3TB 4U30A 3RLYH 2QY0B 1OXGA 1CA0B 3Q76A 1C5SA 5DP9A 1GVLA 4YOJA 1YF4A 3AAVA 1DWBH 1Z7KA 2KAIB 3P17H 3MU5A 3LDXH 2W7SA 3U1JB 2GP9B 1TMTH 2ZPSA 1GBIA 1Y5AT 1O33A 4GHTA 4M7GA 1X7AC 1MTNC 3DFLA 2P3UB 2PKAA 2J9NA 1NC6A 2SGPE 1INCA 2ZTYA 4B74A 3TK5A 3MHWU 1P06A 2FDAA 3SZNA 1W0ZU 4ZKNU 2ANKH 3SNAA 4Y8XA 1KSNA 2EI7A 2OUAA 1N1LA 2BD9A 3UOUA 1AFQB 1F0SA 4TWWA 1IQGA 1UTQA 2FI5E 3KNXA 1AGJA 1ELGA 4X1NU 1SGRE 1XKAC 1TGTA 3A8CA 4A1XA 1BRBE 1CT4E 2EEKA 1C2DA 2A31A 3HGPA 3TNTA 4ZXYH 1SQTA 4ZHLU 3MH5A 1O0DH 4BTIB 1ZGIA 1C1TA 1V2PT 4CR9A 3V13A 2Z9GA 2BY6X 1YP9A 1MH0A 2EI8A 2QXIA 2A4OA 3BN9A 2BDBA 2XWAA 3KF2A 3SGAE 2TGPZ 1GHWH 1KYNA 4DY7B 1QB6A 2Y81A 4K1TA 5JB8S 1GDUA 3RXMA 2SGEE 2ZFQH 3SU4A 1LPKB 1QTFA 1Y3WA 2PSXA 1LO6A 2FX4A 1AE8H 1J16A 4HZHA 4K1EA 1LHFH 1P2MA 4B2BA 1SL3A 5DO4H 2SGAA 1XX9A 2ULLA 4Y8ZA 6CHAB 1HAPH 1GJCB 4DVAU 1H8DH 1L1NA 4XSKU 4MNVA 1S0QA 1MTUA 1GJ7B 1GHAG 5PTPA 2FOEA 2PR3A 1IQIA 3TJUA 1SGPE 1NFUA 1NY22 1V2QT 2VIVA 1GCTC 1TRYA 1FONA 1GHVH 4FU9A 1E35B 2J94A 3MU1A 1TRNA 1NRQH 3K65B 4UDWH 2R3UA 5C20A 1A4WH 2XBXA 2TRMA 2BLOA 1B0EA 2HGTH 3UY9A 4B73A 2R0LA 1TNHA 1KDQA 4NGAH 4OS1A 2ZCHP 3SNBA 4D9QA 1H9LB 1EAXA 5C1YA 5G4BA 1HLTH 3VB7A 1ZSKA 1G3EA 2JETC 4NG9H 3TVJB 7GCHF 5GXPA 4HFPB 5EW1H 1O5AB 1BRUP 2XXLA 2O8LA 3A89A 3JZ2B 4GAWA 1OPHB 3DT0H 2PWXA 4ZH8A 2R3YA 1ZJKA 4OS7A 4B1TA 4FUDA 5FCRA 3R0FA 1S6FA 7KMEH 1HJ8A 2TGTA 1GCDA 4ZMAH 4H6SB 3BG4B 1J8AA 3SGBE 1XUFA 1MCTA 2BDIA 2IN2A 1SGQE 2J4IA 4FUHA 4BAKB 1ANEA 1EP5A 2J92A 1GJ6A 2W3KA 3GY5A 3T2NA 1TALA 3HK6B 2BVSH 4JZIA 2FTMA 4ABHA 3LH3A 3ZVDA 3GISB 1EZSC 1ZZZA 1O3JA 2ZGCA 1FIWA 1D9IA 2WYGA 1CBWC 1P03A 1ESTA 1O5FH 1Q3XA 1WOFA 3GCTG 1LHGH 1QQ4A 1GGDB 1IQNA 3NXPA 2ODYB 1QIXB 1KY9A 1YYY1 3UQOA 1EAIA 3GY2A 1C1UH 1BTYA 1HBTH 2A2QH 3QWCH 1ZGVA 3SU5A 2Y5FA 2RA0A 2UUJB 4CHAC 1FXYA 4K8YA 2ZA5A 3BTQE 3VGCC 4NWLA 2VWMA 1KXBA 1N6XA 2A4RA 3S69A 3I77A 1TNJA 2ZCKP 3GCOA 3S0NA 1DICA 4Y0YE 1O2QA 1EB2A 1C5WB 2D2DA 5E0GA 4GSOA 1ELCA 1HDTH 4KGAA 1C2HA 1TGSZ 1CHOF 4AB9A 4AOQA 3OTJE 1UCYK 1DLEA 1NZQH 4XDEA 1MUEB 1SGIB 5I46H 1EZXC 5F8XA 1GJ9B 2HRVA 3SNEA 3LU9B 1RIWC 1O3BA 1NESE 1HAYB 1K1LA 1YBWA 1A5HA 1N6YA 2Y82A 1BTXA 3F9EA 2G55A 2FOMB 1BIOA 3A87A 4BTUB 1G2MA 4BXSA 1QA7A 2BY7X 2B9LA 3KQEA 1G3BA 3BIVH 3PMJA 1UTKA 3QGNB 2OC8A 3SU0A 1F0RA 4LZ1H 3RLWH 2OC1A 1AZZA 3TK6A 1A7SA 1K1OA 1ZHRA 1BJUA 4WMFA 1V2RT 3FFGA 1TX8A 4ZUHA 1QBVH 3M61U 4IC6A 1GBMA 4A92A 3ZZ8A 4ISLA 1K1PA 2Z9LA 1ANBA 1GBFA 1OWIA 1YC0A 3RC5A 5GWZA 2Y5GA 1TX7A 4NFFA 1OYTH 2YNBA 1XUJA 2FS8A 4O3UA 1T4UH 1V2LT 1N8OC 1J14A 2FOHA 2JH6D 4MG3A 2H9HA 3BEIB 3SNCA 1IQJA 1XM1A 2HPPH 1OWJA 1YPEH 3O8RA 1TQ0B 1BHXF 1XUKA 4B2AA 4B76A 1IAUA 4IBLH 1IQMA 3GOVB 3ATLA 1QCPA 1O2JA 4MPXA 5CE1A 3EE0B 3PYHA 1Z6JH 1O3KA 3ZZDA 3LJOA 3OY6U 1ESAA 1HAZB 4WMDA 1LTOA 2KAIA 1C4V2 1K1IA 2J95A 1BBRH 1LVBA 2BB4A 2VB0A 5C1UA 2FYQA 1N8OB 1QR3E 3UREA 3NPSA 1KLTA 2OXSA 1UMAH 1DWEH 2RCEA 2BD4A 4AB8A 1O3EA 1DXWA 1FZZA 2A2XH 4BAMB 1EJAA 5ABWA 1AWFH 2ZFSA 3RXAA 1S85A 1C5YB 3PLPA 2AMDA 3Q3KA 4I8LA 3IG6B 3RMMH 2VIDA 2H5CA 4YO9A 2GZ7A 1K1NA 1WUNH 1MTWA 3A85A 1YGCH 4Y76A 2ZDKA 1QB1A 3MNBA 1GBDA 1UCYE 1GBKA 4D9RA 1H9HE 1EKBB 3ZZ4A 5SGAE 3T25A 4CREA 4X2YA 3P8FA 3RXTA 3RXPA 5GIBA 3KL6A 1TGNA 1OWHA 2HLCA 2C8XB 3EA7A 1TE0A 2XNIA 1AKSB 5E2PA 1EB1H 3T26A 3JZ1B 3UWJH 1XVOA 1TABE 1C4Y2 1LHCH 1DSUA 4X6PA 1ABIH 4Y8YA 1QB9A 2PGBB 3GYMA 2BXTH 3IWMA 3MU4A 4KKDA 1ZPZA 3K6ZA 4FVDA 2CV3A 3T28A 1PPEE 2CF8H 2PLXA 1FN6A 2QF3A 3DHKH 2O8WA 3KCGH 1UTMA 2VVVA 3GY3A 3Q77A 1DUAA 2H2ZA 3OU0A 3VFEA 3AW1A 3M7QA 2OC7A 3F1SB 1KTTB 2FS9A 2J34A 1O2HA 5GCHF 2HALA 3AVZA 3VB6A 1TGBA 2ZEBA 3BTDE 2G00A 3UNSA 4WH6A 5TCCA 3RC4A 2FOCA 1C5QA 1O5GH 3TGIE 1XKBC 1TONA 2PHBA 2VIQA 4ABEA 5JBBS 4MVNA 1O2UA 1DUEA 2Y6TA 3OY5U 2ZDLA 2OBOA 1F0UA 1T4VH 3M5NA 1YPHC 1GL1A 2FOFA 1KXFA 4JZEH 2ZKSA 4XBDA 3TIUA 3BTEE 3FP7E 2FMJA 1QJ7B 3F9FA 4BOHA 1O2ZA 1SBWA 2ZU3A 1S6HA 4D76A 3RP2A 1O3PB 1TNKA 4UFEH 1C5PA 1RJXB 1UTOA 1ETRH 4X2VA 1L1JA 1MD7A 3SV7A 1OP0A 3TNSA 3E0PB 4FUJA 1O36A 1NPMA 4JZFH 1TGCA 3I78A 1C1VH 3ODDA 2BY5X 4O9VA 1SGEE 4O97A 3Q3XA 3EA9A 2I6QA 2AS9A 4ZHAA 1ZPCA 2A5KA 3UWIA 1V2WT 4ZKOU 4DT7B 1W3CA 3A80A 1ELAA 1O39A 2D26C 1VITG 5A0BA 1GMHG 2AMPA 2GCHF 2LPRA 1F0TA 3H5CB 3A7ZA 4AGJA 1CT2E 2ZO3H 5E0JA 1QY6A 3ZZCA 1ELDE 2UUFB 3QDZB 3UIRA 4CH8B 2BLVA 3VPKA 3ODFA 1K1MA 3MU0A 2LNCA 2ZI2H 3UNQA 2PFEA 7GCHG 1ZR0A 1TNLA 5K7RA 1SGYE 1O34A 2WYJA 4NFEA 2HNTC 2VIPA 3O8CA 3TJOA 4JZ1A 1T7CA 3ATWA 1NROH 4NA9H 2AIPA 1V2JT 1ACBE 1TFXA 5JPMH 2GTBA 1Z6EA 5BPEA 3E16B 4NA8A 3QGJA 3LT3A 2FPZA 1P10A 1LHEH 4ZKSU 2ZZUH 4YLQH 5T6GA 1HIAA 3KEEA 4RSPA 1OKXA 3MO6A 2BM2A 1BHXB 1O35A 2ZC9H 2XYAA 4Y10E 4NIWA 4FXGH 3UQVA 2VU8E 1A0HB 2OTVA 2BX4A 1ZHPA 5C5OA 3UTUH 1L4ZA 2VH0A 1CA0C 1YPHE 1Z1JA 1YKTA 1HAXB 1VR1H 5FAHA 1FMGA 2A5IA 3MNXA 5E2OA 1OP2A 3ZVGA 4B75A 2GV7A 4JZDH 5F6MA 1PPGE 1DVAH 1EAUA 4J2YB 3URCA 1SR5C 4FUEA 2SGFE 2BVXH 1BTHH 2VJ1A 1UTJA 2DE9A 1P2QA 5A0CA 2BLWA 2BMGB 3W94A 4AGKA 4TY6A 3TJNA 1O3AA 1AFQC 1O5EH 8ESTE 1IQLA 1FY8E 3RU4D 3LC5A 3E3TA 1BMNH 1ID5H 1CU1A 3KN2A 8LPRA 1MBMA 1KTSB 5FXLA 4A1TA 3PWCA 4GHQA 5GPIB 1ELTA 1C2JA 1DWCH 1B5GH 1C2MA 1D6WA 1TMUH 1PJPA 1CO7E 1P2NA 2BVRH 4FUCA 1NN6A 4KP0A 1TLDA 4H4FA 1LQDB 3LOXA 3S9CA 3R3GB 1C9TA 4KTCA 3VB4A 1GDQA 2ZGXH 2NU2E 1G9IE 2XW9A 4ABGA 2HNTE 1ZMJA 1IHSH 3M3VA 3QX5H 4U01A 1FJSA 2EC9H 5EQRA 1SQAA 5F8TA 1UO6A 4Q7ZA 3A84A 4CRCA 4A1VA 1AMHA 4JMYA 1ETSH 1H4WA 4D8NA 3A7WA 1DX5M 1CE5A 3PM3A 3L6PA 1IOEA 2BD8A 2FTLE 2V0BA 3BEUA 3FP6E 1C2LA 3E1XB 1GJBB 1BB0B 3H7OA 1S82A 1W10U 6CHAC 1GMDF 1Q31A 3EAJA 4GCHF 4ZKRU 2XBYA 3CP7A 1HJAB 1GBTA 5EGMA 1NRSH 1T31A 3MYWA 3SOSA 3BTWE 1QBOA 2OC0A 4WY3A 1TMBH 3MO9A 1AVGH 2Z3EA 1C5TA 1C1WH 4X8TH 1WBGB 4UFFH 1BQYA 2Q1JA 4Y7BA 4X2WA 2RG3A 1FPCH 1O32A 1O3CA 1O2WA 4NCYA 1SC8U 4LOYH 1TBRH 2PUXB 2HVXA 2F91A 1SLUB 2FWWA 3GCHB 3TGJE 4I31A 1P05A 3FP8E 4ABFA 3MNSA 1KLJH 2CN0H 2G8TA 2VIWA 5FPSA 3C1KA 4X1RU 3A81A 1TQ7B 1O38A 1PPFE 1G36A 2A7JA 1NRRH 3MNCA 1LPZB 2IJOB 5HM2A 2QF0A 1GBLA 1PFXC 2QA9E 1WYKA 1HGTH 4E7NA 3LGIA 1AQ7A 2Z3CA 2GV6A 3SU3A 3TH3H 4DJZB 1SHYA 2JKHA 4ZXXH 3GICB 3BG4C 5LPEA 1ZYOA 1CVWH 3HKJB 4INHA 4CRGA 4R0IA 2C8WB 1DT2A 4AFZA 1MKWK 1HB0B 2ZU1A 1THSH 2DE8A 1AFEH 2FYRA 1TYNA 3UPEA 1P8VC 1U6QA 1D6RA 5BRRE 5T6FA 4BANB 1C2GA 4KTUA 1ZTJA 1M9UA 3Q00A 3U9AH 3K6YA 5AFYH 1ANCA 1EPTB 3QTVH 1AIXH 3QN7A 1LVOA 1NRPH 2BOHB 2VH6A 2F83A 2BY8X 4AFSA 3AW0A 5EW2H 1G37A 1HUTH 5DP5A 1NRNH 2OQUA 4I8KA 1P9UA 3MH4A 1P0SH 1O2LA 1GI2A 4XOJA 2BD7A 3BTFE 1UTNA 4VGCB 4Q80A 1GGDC 1GBAA 5EPYA 1HPGA 2AGEX 2QIQA 1C4U2 1C1QA 2D8WA 1YPGH 3A8DA 3DFJA 3F6UH 1C1SA 5E8EH 8KME2 2C8ZB 2JH0D 1FQ3A 1HAVA 6GCHF 4ESTE 1W7XH 2VIOA 2ZTZA 5DP6A 2BD2A 1NU9A 3CS0A 1SSXA 1C1MA 3RXJA 4FUFA 1D3TB 1AZ8A 1DOJA 2AGGX 4GVUA 4UEHH 5J4SA 3CS7A 1BT7A 2AGIX 3SV9A 2OQ5A 3RDZA 1XXFA 5GCHG 1Y59T 1GJAB 1V2NT 2O8UA 2SNVA 4E7RG 3SU6A 1A3EH 2I6SA 1PQAA 1E0FD 1LDTT 1RTLA 3E8LA 1PYTD 5HXFA 1PQ7A 3LIWA 1O3OA 3TU7H 1MKWH 1Z8GA 4NSYA 2K1QA 1WAYB 1GG6B 1AWHB 1V2ST 2BQ6B 1DM4B 1MTSA 1BRAA 3D49H 1SMFE 1CGJE 5FPYA 2VNTA 2ZPQA 4DW2U 2B8OH 1P2IA 4CRDA 3TGKE 4MTBA 3BTTE 1O2OA 3LPRA 2ZFRH 3M5MA 4IN1A 1W7GH 3N7OA 2CXVA 2FIRH 1RTKA 3ZVCA 4SGBE 5LPRA 1EXFA 1MKXK 1O3HA 1ZRBA 2OLGA 3GDVA 2Z94A 4WWYA 1G30B 3OYPA 5FCKA 1ZSLA 4ASHA 1GMCG 3LGYA 1C2KA 4GLYA 4OS5A 4E05H 1MZDA 2TPIZ 2XCNA 1AB9B 2NU1E 2PKSC 1FY1A 2PGQB 2R9PA 1ELBA 1Z8JB 4ISHH 4BXWA 2AERH 3GYLB 1GHBG 2BD5A 4CRAA 5FX6A 1O2YA 4NZLA 4WMEA 2ANWA 1AY6H 3LONA 3ZVFA 3KQBA 4CR5A 3PMHB 1LKBA 3P70B 1GBBA 4CRFA 2BX3A 1EASA 4XBCA 3NUMA 1SPJA 1MQ5A 1FV9A 1FUJA 1Z71A 3BIUH 4FUGA 3SQEE 3D65E 4LXBH 3ZZBA 1V2MT 5EXMA 2ZNKH 1YCPK 2FOAA 4AFQA 1JIRA 3D23A 1O5CB 4H42U 5HM9A 1NTPA 1GBEA 1FIZA 2F9NA 1CA8B 3LC3A 2PKSB 1ORFA 2AMQA 1SB1H 2B0FA 4BAQB 5GDSH 4WJG2 1FY3A 3RXVA 3EGKH 3F9HA 1V3XA 2F9OA 3A7YA 1Y5UT 2F9VA 5DP4A 2CGAA 2RA3A 2FX6A 3BEFB 5FX5A 4Z6AH 2QXJA 1OWEA 4JYVH 1EP6A 1TNIA 3KQCA 2FESH 3B8JA 2PKAB 4DCDA 1J17T 2VGCB 1O2PA 3V0XA 1WU1A 4NIYA 1SG8B 1UCYH 2V35A 3RXGA 3RXBA 3IITA 2AH4X 4ABDA 1UK4A 3PMAB 4GPGA 4INLA 2FLBH 6LPRA 5J4QA 3QO6A 1PQ8A 2FXRA 1KXCA 1BJVA 4X6MA 2BDCA 1DY9A 2FLRH 1FNIA 3VXFH 4YT7H 1FI8A 5C2ZA 2WPLS 1ELEE 2GZ8A 4H6TA 1V2VT 3VEQB 3ZYEA 2ZHQH 3ZV8A 2W3IA 4DIHH 2ANMH 2FI4E 1LVYA 3LJJA 1GHAF 2O8MA 2IPHA 1HYLA 2P8OB 4ABJA 1GJ5H 4RKJB 2ALPA 2STAE 3SJOA 2C8YB 1KLIH 2BYAX 2GKVE 4A7IB 1EAWA 2ZFPH 1ZSJA 2FOGA 3EQ0H 5JYIA 3RXEA 3SORA 4X1PU 3WY8A 4DURA 4FU8A 3MI4A 2WPIS 1UHBB 4HGCA 2QGRA 2YOLA 1JRSA 1TBQH 2GCTB 3PTNA 1VITH 3OX7U 1P2OA 2PV9B 5IDKA 1BTZA 1SVPA 4ISOA 4R8TB 1GPZA 3SQHE 3VB5A 1GI4A 1GI1A 1HV7A 2SNWA 4SGAE 1P3CA 3M36A 2IOTA 2A7CA 2WUCA 4D7GA 1Z8IB 3UOPA 4IN2A 2BQ7B 2B7DH 1SFIA 1O3FA 4LZ4B 5DGJA 5FPTA 1O2SA 2TGAA 3M5OA 3O8DA 2NU3E 1AHTH 1P2JA 5EPNA 1AUTC 3RXKA 1AN1E 1EATA 1QQUA 4MLFB 3S9AA 4K5ZA 1GI5A 1QBNA 4MDSA 3UR6A 1HFDA 1AI8H 2AIQA 3M37A 3NWUA 1VJ9U 2BD3A 1IQKA 4NIVA 5TJXA 1YPKH 3V7TA 2FM2A 1SLVB 1EJMA 1O2VA 1YPJH 4XFQA 1YPLH 1EX3A 2VVUA 3PB1E 4K2YA 4LK4A 1KDQB 1O3IA 1SGFG 1F5LA 1LVMA 4TPIZ 3DUXH 1OX1A 3BF6H 1T8LA 2H9EH 3QTOH 3UUZA 1A61H 4OS6A 2Y5HA 3BTGE 4YZUA 1BTUA 2XBWA 1C5UA 1SLWB 1GDNA 4OGYA 3ZVBA 1SQOA 5JDUB 5B6OA 1UVSH 1P02A 1NM6A 1OYQA 3GCTF 1PPCE 3LGWA 5HGGA 4Y79A 3STIA 1LKAA 2ZDMA 4X8UH 4DOQA 4AYYB 1RTFB 3SI4H 1FPHH 4IC5A 3E91A 2TGDA 2ZDNA 4A6LA 1RGQA 1YCPM 5FBIA 1WV7H 4CBNA 2GGVB 1WTGH 1GHZA 1O3NA 2P95A 1XUHA 9ESTA 1DY8A 3PTBA 1C5OH 5LGOA 1V2TT 2EI6A 1GJ4H 3BG8A 4K60A 3RM0H 1EOJA 2W26A 2VINA 3SJ9A 1CQQA 1FY4A 1ZOMA 1DS2E 2GMTB 1GI3A 4AN7A 3STJA 1AE5A 1BTPA 1ZTKA 2A4QA 4FVBA 1RS0A 4TYDA 4ABIA 1GBJA 3SJIA 2ODPA 2CHAB 1GHXH 1AVWA 1Y5BT 1Z1IA 2ALVA 3OSYA 2BDAA 3ZZ6A 2A7HA 2HWLB 4B2CA 4K69A 3K9XB 2W5EA 1QRZA 2A5AA 3SUDA 1E37B 1FDPA 4IS5A 4AG2A 5EXNA 3VXEH 1K9OE 1GVKB 2UUKB 3MFJA 4X0WU 1MMJN 1FAXA 1UK2A 2Y7ZA 1XUIA 1DPOA 1EJNA 1GI0A 1LMWB 1AD8H 5AVDA 4X6OA 1VGCB 1A5IA 5IYTA 5A09A 2ZDAH 1ZRKA 3URDA 1K22H 2ZU2A 5EG4A 5JBTA 5L2ZH 2CJIA 2FEQH 4NIXA 3NCLA 1ANDA 1TA6A 5K0HA 1G3CA 2D1JA 2QYIA 4FUBA 3SBKA 2WV4A 1TA2A 4MPWA 1MD8A 1C5VA 1GI6A 1L2EA 1S0RA 1UVUH 4WF8A 5JBCS 2ZIQH 1Y3UA 2ZTXA 1VCPA 1PPZA 1RRKA 3UNRA 1MQ6A 1K28D 2P3FH 4K3JA 1IHTH 2GDDA 2C4FH 1C1OA 2WINI 3SI3H 3MWIU 1DITH 1SHHB 4X1SU 1S83A 3RXHA 1C2IA 1J15A 1HXEH 1KXDA 3MO3A 4OS4A 5DG6A 4JK6A 1GBHA 1TBZH 1P57B 2C3SA 5EQSA 1LHDH 1T8NA 2OD3B 2ZPRA 1RXPA 1WTHD 4Y7AA 1O37A 3ENSB 3SUEA 1P3EA 2R0KA 4YLUA 1HRTH 3C27B 3SV6A 4X2XA 4IW4E 2P93A 2PTNA 2SFAA 3W95A 5C67A 1C5XB 3U69H 2Y80A 4OGXA 4JK5A 5CHAB 3GCNA 1CHOG 2O9QA 3RC6A 2ZQ1A 3A8BA 3PLKA 1T8MA 3GDUA 4UFDH 2XC0A 1TIOA 3ZV9A 1C5MD 1GHYH 3O8BA 3SHAH 4AYVB 1OSSA 1SGFA 2WPKS 3PWBA 1HJAC 1UVOA 1HNEE 1F2SE 1EUFA 1JMOH 3U8TH 4MNWA 4MPUA 1LCYA 4YM9A 1QL9A 1DDJA 2WPHS 1BITA 3TK9A 1SOTA 3T5FH 3RXOA 4DG4A 1SGDE 2BDYA 4INKA 2ZFFH 5DJ7A 4YTAA 1EQ9A 3E6PH 3SU1A 3GCHC 1ZTLA 1QA0A 4J1YA 3QLPH 2G4TA 1QHRB 1W0YH 4F4OC 1ABJH 3SUFA 2H6MA 6ESTA 1QNJA 4CBOA 4MNXA 1NO9H 1BRCE 7ESTE 3DD2H 3UFAA 1CGIE 3LGTA 1EOLA 3ATIA 4YT6H 1O3LA 1K1JA 4X8VH 3ZZAA 3BTHE 2Z9IA 1LPGB 1MTNB 1OWKA 5C5NA 1S5SA 3L33A 1QRXA 1YPMH 3EYDA 1SGNE 1XMNB 2UWPA 2ZG0H 1Y3VA 3EA8A 1DE7H 2ZHEH 2A45B 3ZZ9A 1PQ5A 3TH2H 1BMLA 3BTKE 1UHBA 1O2MA 3RXDA 5F03A 2GT7A 4O03A 1UVPA 2BQWB 8GCHF 2J2UA 4WH8A 1AU8A 3SUGA 1EPTC 3MU8A 4CRBA 5EU8A 4IMQA 5DK1A 2ZHFH 1AKSA 1FLEE 1WQVH 5EOKA 2G4UA 5HYOA 4JCNA 1TOCB 4HI3A 1A46H 3TPIZ 1YLDA 2F9PA 1C1PA 1C2FA 2ASUB 4VGCC 2Z9JA 1RFNA 3RMNH 1F5RA 4NZQA 1VCQA 1C9PA 1DSTA 4AZ2B 3ATKA 5T3HA 3ZYDA 3SJKA 1YM0A 1ELFA 1L4DA 2NWNA 3FANA 4B71A 1HXFH 1P9SA 1O30A 1NFWA 4IGDA 5H4IB 3RXFA 2CF9H 2XC5A 1V2KT 5CMXH 2OCVB 1ZLRA 1VITF 5AF9H 3F68H 1GMHF 1XXDA 2BZAA 1Z8RA 5F8ZA 1JRTA 1NFYA 1OS8A 5LPFA 1IQEA 1TPOA 1CSOE 2F9UA 1GL0E 3NKKA 4I8HA 4GUXA 1T8OA 3GY6A 5A0AE 2GDEH 2BOKA 4QT8C 1GBCA 3G01A 2Q6GA 3RXLA 5C1XA 2QC2A 2VVCA 1GCTB 1GG6C 3SU2A 1E34B 1O3MA 3FZDA 4XBBA 2ZQ2A 1SGCA 3RXQA 1GVZA 3H7TA 3RMLH 3BTME 1T32A 1Y8TA 3SGQE 2QXGA 5ETXA 3HPTB 1UTPA 4U32A 5A8YA 1BDAA 1DXPA 5ESTE 4RKOB 4Y0ZE 3RXIA 4ZAEA 1ESBA 3U1IB 1C5LH 2W7UA 3D62A 4TWYA 3HGNA 2A0QB 3TITA 1O2KA 3LGUA 4OS2A 4F49A 2JETB 1MAXA 1E36B 1BOQA 1KXAA 3TLOA 2PSYA 2JH5D 3SO3A 3PV4A 3LH1A 2P59A 1AB9C 5E0HA 3A7XA 2XWBI 1F7ZA 1NS3A 1G32B 1F92A 1OOKB 4K8BA 3SW2B 1W12U 1QJ6B 1GI9B 4HTCH 1DANH 1JBUH 4I33A 3M3TA 2ZF0H 1D3DB 3GY8A 1C5ZB 2ZWLH 2VWNA 2GVFA 2XCFA 3ITIA 1IQFA 1MCVA 2B5TB 1GJ8B 1SOZA 3SV8A 4I8JA 3SHCH 4WXIA 1B0FA 4UE7H 3ZVEA 1THRH 3ZVAA 1HIAB 4WXVA 1C2EA 1C1NA 1J9CH 2P16A 1A0JA 3P8GA 5A2MH 1FAKH 2AEIH 3A8AA 3HKIB 2ZHDA 3P6ZB 1HAHH 3DA9B 4ABBA 1CBWB 1P04A 2G51A 4U2WA 2BTCE 4A5TS 1S84A 3E90B 5I25A 1GJDB 1CHGA 2F9BH 1EZQA 2WV5A 4UFGH 2GZ9A 1UK3A 3U8OH 1QL7A 1TPPA 3P95A 1WCZA 2A4GA 2GCHG 4JYUH 1BBRK 5JB9S 1TX6A 2WPMS 2XC4A 2BY9X 4CHAB 4UONA 2VGCC 4BTTB 1A0LA 1KXEA 1MZAA 3VGCB 3MTYA 3RU4E 1MU8B 5TCAA 3M5LA 2WPJS 1W14U 1XUGA 3QUMP 2PUQH 1B7XB 2F3CE 3GDSA 1C5NH 3P92A 2FO9A 2PTCE 4Q2KA 1VZQH 1SFQB 1E38B 2ZFTA 1ARCA 1HCGA 1L1GA 1PPBH 1PPHE 3ZZ7A 2G5VA 3TH4H 1O31A 3FAOA 1O2IA 3BSQA 1JWTA 4E06H 1RIWB 2M5TA 2HPQH 1MKXH 2P8OC 2ILNA 2THFB 1BA8B 2FODA 1D4PB 1GWAA 1MU6B 2WUBA 1NT1A 1Y3YA 3SV2H 2O8TA 1ARBA 2Q6FA 3NZIA 4Q7XA 2SGQE 2QXHA 1O2TA 1C1RA 4X6NA 2HOBA 4Z0KA 2XBVA 2AYWA 2BZ6H 2R2WU 1S81A 1ZMLA 1UTLM 3S7HB 3SNDA 2GCTC 4AFUA 3KHVA 5L30H 3S9BA 3QZQA 4DGJA 4RN6A 2ZU5A 3QK1A 1O5DH 2HNTF 5DPAA 3V12A 3K2UA 3A82A 4FUIA 1TB6H 3A7TA 1VCWA 2V3OH 2C90B 1V6DA 2DUCA 2OINA 2TIOA 1YCPH 3PMBB 3QZRA 4MPVA 4TY7A 2Z3DA 2SGDE 4AG1A 2ESTE 1CT0E 5LH8A 2C93B 3ATMA 2BDHA 1BMAA 1P2KA 4BAOB 1DFPA 3BV9B 1XVMA 1K2I1 3M7UA 2H1UA 1PYTC 1O2GH 1HJ9A 1JXPA 2TBSA 3Q3YA 3E0NB 1VJAU 3MH7A 2STBE 3V3MA 1C5RA 1BCUH 1QFKH 2VWLA 4BNRA 1AO5A 1F5KU 3FVFB 4Y11E 3KIDU 4ISIH 3B23B 1UJ1A 4Q7YA 2BDGA 1BUIA 4YESB 3AASA 1ELVA 2QAAA 3GY7A 4NWKA 3I29A 1H9IE 1HAGE 3RXSA 2R2MB 1BBRE 1FY5A 2ZCLP 4Y71A 1TAWA 1QGFA 2GX4A 1HAOH 4O3TA 4TPYA 1MTVA 4FU7A 1ETTH 1QL8A 5DP7A 1UVTH 2OBQA 2V3HH 4XE4A 1A3BH 1V2OT 1CGHA 3MMGA 4KELA 1O3DA 1DWDH 1GMDG 1Q2WA 3RU4T 4GCHG 4ZHMU 5DP3A 2H9TH 1QJ1B 3TJVA 4I7YH 1A2CH 2Z7FE 1TRMA 3UR9A 2EA3A 4DIIH 1GI7B 1AVXA 2ZU4A 4MNYA 1QRWA 2ZGHA 5EODA 4X1QU 5T6DA 3SJ8A 5AHGH 1ZJDA 2CMYA 2RDLA 1TNGA 3P8OA 3RMOH 3PLBA 1O2RA 3T29A 1A1RA 1SI5H 4NSVA 5ESBA 2GMTC 3AAUA 3ESTA 2YNAA 3PO1C 1O2XA 5EXLA 4YOIA 1EZUC 2QCYA 3HK3B 2Z6BD 2XTTB 1THPB 5AFZH 2OP9A 2A1DB 1H8IH 2Y7XA 3VB3A 3RM2H 5L6NH 2CHAC 2XRCA 1EPTA 2G5NA 1MAYA 1HAIH 5DP8A 8GCHG 1HAVB 2GD4B 4MQAA 1D3PB 1W11U 2NU4E 1G3DA 1NU7B 3RUOA 1WSSH 1ZHMA 2Q6DA 2VWOA 3S7KB 4ISNA 1RD3B 1D3QB 2UUYA 2ZECA 1GMCF 2BHGA 1YLCA 3RXRA 3ELAH 2BXUH 4KTSA 5C3NA 3LKWA 3P8NA 4K1SA 2ZHWH 3ZZ5A 3PO1B 3U98H 1DLKB 2NU0E 4IMZA 1TPSA 1VGCC 1L0ZA 1ZMNA 4NA7A 1GHBF
chains in the Genus database with same CATH superfamily
1O3GA 1G2LA 1O2NA 4AORA 1SGTA 5A8ZA 2KCPA 1BTWA 3RXCA 4THNH 1O5BB 1TPAE 2H5DA 1P09A 7LPRA 1JIMA 3EDXB 3KGPA 3M35A 5EQQA 2G81E 3HATH 4Y6DA 3FZZA 5A8XA 4WVPE 2UWOA 1K21H 5JBAS 3F2FA 3L3TA 1H1BA 1W8BH 1ZPBA 4I8GA 4X8SH 3ZZ3A 5HMAA 2ANYA 3MOCA 4RT1A 2AFQB 3A7VA 4AX9H 4UD9H 4F55A 2FZZA 1P11E 2FP7B 3A86A 1A5GH 3PROA 1W13U 3F9GA 2Z9KA 1P12E 6GCHG 4YOGA 4ZROA 3A83A 4PROA 1WQSA 2BLQA 2QN5T 4CH2B 5DKMA 1FN8A 3U8RH 1V2UT 2V6NA 5CHAC 1GI8B 3LGVA 1TWXB 2A32A 3M7TA 3U28C 3NK8A 3KQDA 3GY4A 4ABAA 3CENA 2G52A 4BAHB 1BMMH 2ZGBH 3A88A 5HKKD 1YLNA 3MH6A 1BZXE 3T27A 5FHTA 3SN8A 2ZDVH 5EIYA 5L2YH 2J38A 2PW8H 2UWLA 1P01A 1KIGH 4I32A 1W2KH 4YXWD 2GT8A 3N7DA 1IQHA 2ODQA 1NFXA 1Y3XA 2RFKC 1JOUB 9LPRA 3B9FH 1MBQA 1QURH 3RXUA 1SLXB 1LQEA 1OWDA 2FI3E 2P94A 4P00A 1AUJA 1OP8A 5GJ4B 2ZP0H 5FBEA 3T62A 2ZGJA 4D7FA 4JYTA 3M3SA 2QV1A 1TOMH 2FOBA 2P3TB 4U30A 3RLYH 2QY0B 1OXGA 1CA0B 3Q76A 1C5SA 5DP9A 1GVLA 4YOJA 2HVYB 1YF4A 3AAVA 1DWBH 1Z7KA 2KAIB 3P17H 3MU5A 3LDXH 2W7SA 4I86A 2GP9B 3U1JB 4RI0A 1TMTH 2ZPSA 1GBIA 1Y5AT 1O33A 4GHTA 4M7GA 1X7AC 1MTNC 3DFLA 2P3UB 2PKAA 2J9NA 1NC6A 2SGPE 3WWBA 1INCA 2ZTYA 4B74A 3TK5A 3MHWU 1P06A 2FDAA 3SZNA 1W0ZU 4ZKNU 2ANKH 3SNAA 4Y8XA 1KSNA 2EI7A 2OUAA 1N1LA 2BD9A 3UOUA 1AFQB 1F0SA 4TWWA 1IQGA 1UTQA 2FI5E 3KNXA 1AGJA 1ELGA 4X1NU 1SGRE 1XKAC 1TGTA 3A8CA 5HIZA 4A1XA 1BRBE 1CT4E 4ASUD 2EEKA 1C2DA 2A31A 3HGPA 3TNTA 4ZXYH 1SQTA 4ZHLU 3MH5A 1O0DH 4BTIB 1ZGIA 1C1TA 1V2PT 4CR9A 1WXRA 3V13A 2Z9GA 2BY6X 1YP9A 1MH0A 2EI8A 2QXIA 2A4OA 2XNDD 3BN9A 2BDBA 2XWAA 3KF2A 3SGAE 2TGPZ 3DSGA 1GHWH 1KYNA 4DY7B 1QB6A 2Y81A 4K1TA 5JB8S 1GDUA 3RXMA 2SGEE 2ZFQH 3SU4A 1LPKB 1QTFA 1Y3WA 5CHBA 2PSXA 1LO6A 2FX4A 1AE8H 3CNRA 1J16A 4HZHA 4K1EA 1LHFH 1P2MA 4B2BA 1SL3A 5DO4H 2SGAA 1XX9A 2ULLA 4Y8ZA 6CHAB 1HAPH 1GJCB 4DVAU 1H8DH 1L1NA 4XSKU 4MNVA 1S0QA 1MTUA 1EFRD 1GJ7B 2YMSD 1GHAG 5PTPA 2FOEA 2PR3A 1IQIA 3TJUA 1SGPE 1NFUA 1NY22 1V2QT 2VIVA 1GCTC 1TRYA 1FONA 1GHVH 4FU9A 1E35B 2J94A 3MU1A 1TRNA 1NRQH 3K65B 4UDWH 2R3UA 2QF5A 5C20A 2KZ4A 1A4WH 2XBXA 2TRMA 2BLOA 1B0EA 2HGTH 3UY9A 4B73A 2R0LA 1TNHA 1KDQA 4NGAH 4OS1A 2ZCHP 2LP6A 3SNBA 4D9QA 1H9LB 1EAXA 5C1YA 5G4BA 1HLTH 3VB7A 1ZSKA 1G3EA 2JETC 4NG9H 3TVJB 7GCHF 5GXPA 4HFPB 5EW1H 1O5AB 1BRUP 2XXLA 2O8LA 3A89A 3JZ2B 4GAWA 1OPHB 3DT0H 2PWXA 4ZH8A 2R3YA 1ZJKA 4OS7A 4B1TA 4FUDA 5FCRA 3R0FA 1S6FA 7KMEH 1HJ8A 2TGTA 1GCDA 4ZMAH 4H6SB 3BG4B 1J8AA 3SGBE 1XUFA 1MCTA 2BDIA 2IN2A 1SGQE 2J4IA 4FUHA 4BAKB 1ANEA 1EP5A 2J92A 1GJ6A 2W3KA 3GY5A 3T2NA 1TALA 3HK6B 2BVSH 5B6LA 4JZIA 2FTMA 4ABHA 3LH3A 3ZVDA 3GISB 1EZSC 1NBME 1ZZZA 1O3JA 2ZGCA 1FIWA 1D9IA 2WYGA 1CBWC 1P03A 1ESTA 1O5FH 1Q3XA 1WOFA 3GCTG 1LHGH 1QQ4A 1GGDB 1IQNA 3NXPA 2ODYB 1QIXB 1KY9A 1YYY1 3UQOA 1EAIA 3GY2A 1C1UH 1BTYA 1HBTH 2A2QH 3QWCH 1FX0B 1ZGVA 3SU5A 2WV9A 2Y5FA 2RA0A 2UUJB 2KCOA 4CHAC 1FXYA 4K8YA 2ZA5A 3BTQE 3VGCC 4NWLA 2VWMA 1KXBA 1N6XA 2A4RA 3S69A 3I77A 1TNJA 2ZCKP 3GCOA 3S0NA 1DICA 4Y0YE 1O2QA 1EB2A 1C5WB 2D2DA 5E0GA 4GSOA 1ELCA 1HDTH 4KGAA 2K8IA 1C2HA 1TGSZ 1CHOF 4AB9A 4AOQA 3OTJE 1UCYK 1DLEA 1NZQH 1W0KD 4XDEA 1MUEB 1SGIB 5I46H 1EZXC 5F8XA 1GJ9B 2HRVA 3SNEA 3LU9B 2WZQA 1RIWC 1O3BA 1NESE 1HAYB 1K1LA 1YBWA 1A5HA 1N6YA 2Y82A 1BTXA 3F9EA 3FO8D 2G55A 2FOMB 1BIOA 3A87A 4BTUB 1G2MA 4BXSA 1QA7A 2BY7X 2B9LA 3KQEA 1G3BA 3BIVH 3PMJA 1UTKA 3QGNB 2OC8A 3SU0A 1F0RA 4LZ1H 3RLWH 2OC1A 1AZZA 3TK6A 1A7SA 1K1OA 1ZHRA 1BJUA 2KCYA 4WMFA 1V2RT 3FFGA 1TX8A 4ZUHA 1QBVH 3M61U 4IC6A 1GBMA 4A92A 3ZZ8A 4ISLA 1K1PA 2Z9LA 1ANBA 1GBFA 1OWIA 1YC0A 3RC5A 5GWZA 2Y5GA 1TX7A 4NFFA 1OYTH 2YNBA 1YWUA 1XUJA 2FS8A 4O3UA 1T4UH 1V2LT 1N8OC 1J14A 3F2GA 2FOHA 2JH6D 4MG3A 2H9HA 2L74A 3BEIB 3SNCA 1IQJA 1XM1A 2HPPH 1OWJA 1YPEH 3O8RA 1TQ0B 1BHXF 1XUKA 4B2AA 4B76A 1IAUA 4IBLH 1IQMA 3GOVB 3ATLA 1QCPA 1O2JA 4MPXA 5CE1A 3EE0B 2YMSB 3PYHA 1Z6JH 1O3KA 3ZZDA 3LJOA 3OY6U 1ESAA 4OM9A 1HAZB 4WMDA 1LTOA 2KAIA 1C4V2 1K1IA 2J95A 5DSFA 1BBRH 1LVBA 2BB4A 2VB0A 5C1UA 2FYQA 1SQRA 1N8OB 1QR3E 3UREA 3NPSA 1KLTA 2OXSA 1BMFD 1UMAH 1DWEH 2RCEA 2BD4A 4AB8A 1O3EA 2L6OA 1DXWA 1FZZA 2A2XH 4BAMB 1EJAA 5ABWA 1AWFH 2ZFSA 3RXAA 1S85A 1C5YB 3PLPA 2AMDA 3Q3KA 4I8LA 3IG6B 3RMMH 2VIDA 2H5CA 5DN6D 4YO9A 5KECA 2GZ7A 1K1NA 1WUNH 1MTWA 3A85A 1YGCH 4Y76A 2ZDKA 1QB1A 3MNBA 1GBDA 1UCYE 1GBKA 4D9RA 1H9HE 1EKBB 3ZZ4A 5SGAE 3T25A 2QF4A 4CREA 4X2YA 3P8FA 3RXTA 3RXPA 2JDID 5GIBA 3KL6A 1TGNA 1OWHA 2HLCA 2C8XB 3EA7A 3F2HA 1TE0A 2XNIA 1AKSB 5E2PA 1EB1H 3T26A 3JZ1B 3UWJH 1XVOA 1TABE 1C4Y2 1LHCH 1DSUA 4X6PA 1ABIH 4Y8YA 1QB9A 2PGBB 3GYMA 2BXTH 3IWMA 3MU4A 4TT3D 3WWFA 4KKDA 1ZPZA 3K6ZA 4FVDA 2CV3A 3T28A 1PPEE 2CF8H 2PLXA 1FN6A 2QF3A 3DHKH 2O8WA 3KCGH 1UTMA 2VVVA 3GY3A 3Q77A 3UAIC 1DUAA 2H2ZA 3OU0A 3VFEA 3SZEA 3AW1A 3M7QA 2OC7A 3F1SB 1KTTB 2FS9A 2J34A 1O2HA 5GCHF 2HALA 3AVZA 5C17A 3VB6A 1TGBA 2ZEBA 3BTDE 2G00A 3MQKC 3UNSA 4WH6A 5TCCA 3RC4A 2FOCA 1C5QA 1O5GH 3TGIE 3OTPA 1XKBC 2K0QA 1TONA 2PHBA 2VIQA 4ABEA 1OHHD 5JBBS 4MVNA 1O2UA 1DUEA 2Y6TA 3OY5U 2ZDLA 2OBOA 1F0UA 1T4VH 3M5NA 1YPHC 1GL1A 2FOFA 1KXFA 4JZEH 2ZKSA 4XBDA 3TIUA 3EE7A 3BTEE 3FP7E 2FMJA 1QJ7B 3F9FA 4BOHA 1O2ZA 1SBWA 2ZU3A 1S6HA 4D76A 3RP2A 1O3PB 1TNKA 4UFEH 1C5PA 1RJXB 1UTOA 1ETRH 4X2VA 1L1JA 1MD7A 3SV7A 1OP0A 3TNSA 3E0PB 4FUJA 1O36A 1NPMA 4JZFH 1TGCA 3I78A 1C1VH 3ODDA 2BY5X 4O9VA 1SGEE 4O97A 3Q3XA 3EA9A 2I6QA 2AS9A 4ZHAA 1ZPCA 2A5KA 3UWIA 1V2WT 4ZKOU 4DT7B 1W3CA 3A80A 2J97A 1ELAA 1O39A 2D26C 1VITG 5A0BA 1GMHG 2AMPA 2GCHF 2LPRA 1F0TA 3H5CB 3A7ZA 4AGJA 1CT2E 2ZO3H 5E0JA 5FL7D 1QY6A 3ZZCA 1ELDE 2UUFB 3QDZB 3UIRA 4CH8B 2BLVA 3VPKA 3ODFA 1K1MA 3MU0A 2RDEA 2LNCA 3N7EA 2ZI2H 3UNQA 2PFEA 7GCHG 1ZR0A 1TNLA 5K7RA 1SGYE 1O34A 2WYJA 4NFEA 2HNTC 2VIPA 3O8CA 3TJOA 4JZ1A 1T7CA 3ATWA 1NROH 4NA9H 2AIPA 1V2JT 1ACBE 1TFXA 5JPMH 2GTBA 1Z6EA 5BPEA 3E16B 4NA8A 3QGJA 3LT3A 2FPZA 1P10A 1LHEH 4ZKSU 2ZZUH 4YLQH 5T6GA 1HIAA 3KEEA 4RSPA 1OKXA 3MO6A 3AK5A 2BM2A 1BHXB 1O35A 2ZC9H 2XYAA 4Y10E 4NIWA 4FXGH 3UQVA 2VU8E 1A0HB 2OTVA 2BX4A 1ZHPA 5C5OA 3UTUH 1L4ZA 2VH0A 1CA0C 1YPHE 1Z1JA 1YKTA 1HAXB 1VR1H 5FAHA 1FMGA 2A5IA 3MNXA 5E2OA 1OP2A 3ZVGA 4B75A 2GV7A 4JZDH 5F6MA 1PPGE 1DVAH 1EAUA 4J2YB 4ACAA 2JJ1D 3URCA 1SR5C 4FUEA 2SGFE 2BVXH 1BTHH 2VJ1A 1UTJA 4HG6A 2DE9A 1P2QA 5A0CA 2BLWA 2KCAA 2BMGB 3PRDA 3W94A 5KEDA 4AGKA 4TY6A 3TJNA 1O3AA 1AFQC 1O5EH 8ESTE 1IQLA 1FY8E 2PP6A 3RU4D 2JIZD 3LC5A 3E3TA 1BMNH 1ID5H 1CU1A 3KN2A 8LPRA 1MBMA 1KTSB 5FXLA 1MABB 4A1TA 3PWCA 4GHQA 5GPIB 1ELTA 2M2AA 1C2JA 1DWCH 1B5GH 1C2MA 1D6WA 1TMUH 1PJPA 1CO7E 1P2NA 2BVRH 4FUCA 1NN6A 4KP0A 1TLDA 4H4FA 1LQDB 3LOXA 3S9CA 3R3GB 1C9TA 4KTCA 3VB4A 1GDQA 2ZGXH 2NU2E 1G9IE 2XW9A 4ABGA 2HNTE 1ZMJA 1IHSH 3M3VA 3QX5H 4U01A 1FJSA 2EC9H 5EQRA 1SQAA 5F8TA 5C94A 1UO6A 4Q7ZA 3A84A 4CRCA 4A1VA 1AMHA 4JMYA 1ETSH 1H4WA 4D8NA 3A7WA 2J98B 1DX5M 1CE5A 3PM3A 3L6PA 1E1QD 1IOEA 2BD8A 2FTLE 2V0BA 3BEUA 3FP6E 1C2LA 3E1XB 1GJBB 1BB0B 3H7OA 1S82A 1W10U 6CHAC 1GMDF 1Q31A 3EAJA 4GCHF 4ZKRU 3OFND 2XBYA 3CP7A 1HJAB 1GBTA 5EGMA 1NRSH 1T31A 3MYWA 2KX4A 3SOSA 3BTWE 1QBOA 2OC0A 4WY3A 1TMBH 3MO9A 1AVGH 2Z3EA 1C5TA 1C1WH 4X8TH 1WBGB 4UFFH 1BQYA 2Q1JA 4Y7BA 4X2WA 2RG3A 1FPCH 1O32A 1O3CA 1O2WA 4NCYA 1SC8U 4LOYH 1TBRH 2PUXB 2HVXA 2F91A 1SLUB 2FWWA 3GCHB 3TGJE 3W1EA 4I31A 1P05A 3FP8E 4ABFA 3MNSA 1KLJH 2CN0H 2G8TA 2VIWA 5FPSA 3C1KA 4X1RU 3A81A 1TQ7B 1O38A 1PPFE 1G36A 2A7JA 3PV5A 1NRRH 3MNCA 1LPZB 2IJOB 5HM2A 2QF0A 1GBLA 1PFXC 2QA9E 1WYKA 1HGTH 4E7NA 3LGIA 1AQ7A 2Z3CA 2GV6A 3SU3A 3TH3H 4DJZB 1SHYA 2JKHA 4ZXXH 3GICB 3BG4C 5LPEA 1ZYOA 1CVWH 3KYFA 3HKJB 4INHA 4CRGA 4R0IA 2C8WB 1DT2A 4AFZA 1MKWK 1HB0B 2ZU1A 1THSH 2DE8A 1AFEH 2FYRA 1TYNA 3UPEA 1P8VC 1U6QA 1D6RA 5IK2D 5BRRE 5T6FA 4BANB 1C2GA 4KTUA 1ZTJA 1M9UA 3Q00A 3U9AH 3K6YA 5AFYH 1ANCA 1EPTB 3QTVH 1AIXH 3QN7A 1LVOA 1NRPH 2BOHB 2VH6A 2F83A 2BY8X 4AFSA 3AW0A 5EW2H 1G37A 4Q63A 1HUTH 5DP5A 1KMHB 1NRNH 2OQUA 4I8KA 1P9UA 3MH4A 1P0SH 1O2LA 1GI2A 4XOJA 2BD7A 3BTFE 1UTNA 4VGCB 4Q80A 1GGDC 2J5UA 1GBAA 5EPYA 1HPGA 2AGEX 2QIQA 1C4U2 1C1QA 2D8WA 1YPGH 3A8DA 3DFJA 3F6UH 1C1SA 5E8EH 8KME2 2C8ZB 2JH0D 1FQ3A 1HAVA 6GCHF 4ESTE 1W7XH 2VIOA 2ZTZA 5DP6A 2BD2A 1NU9A 3CS0A 1SSXA 1C1MA 3RXJA 4FUFA 2IPQX 1D3TB 1AZ8A 1DOJA 2AGGX 4GVUA 4UEHH 5J4SA 3CS7A 1BT7A 2AGIX 3SV9A 2OQ5A 3RDZA 1XXFA 5GCHG 1Y59T 1GJAB 1V2NT 2O8UA 2SNVA 4E7RG 3SU6A 1A3EH 2I6SA 1PQAA 1E0FD 1LDTT 1RTLA 3E8LA 1PYTD 5HXFA 1PQ7A 3LIWA 1O3OA 3TU7H 1MKWH 1Z8GA 4NSYA 2K1QA 1WAYB 1GG6B 1AWHB 1V2ST 2BQ6B 1DM4B 1MTSA 1BRAA 3D49H 1SMFE 1CGJE 4TSFD 2VNTA 2ZPQA 5FPYA 4DW2U 2B8OH 1P2IA 4CRDA 3TGKE 4MTBA 3BTTE 1O2OA 3LPRA 2ZFRH 3M5MA 4IN1A 1W7GH 3N7OA 2CXVA 2FIRH 1RTKA 3ZVCA 4SGBE 5LPRA 1EXFA 1MKXK 1O3HA 1ZRBA 2OLGA 3GDVA 2Z94A 4WWYA 1G30B 3OYPA 5FCKA 1ZSLA 4ASHA 1GMCG 2QE7D 3LGYA 1C2KA 4GLYA 4OS5A 4E05H 1MZDA 2TPIZ 2XCNA 1AB9B 2NU1E 2PKSC 1FY1A 2PGQB 2R9PA 1ELBA 1Z8JB 4ISHH 4BXWA 2AERH 3GYLB 1GHBG 2BD5A 4CRAA 5FX6A 1O2YA 4NZLA 4WMEA 2ANWA 1AY6H 3LONA 3OEHD 3KQBA 3ZVFA 4CR5A 3PMHB 1LKBA 3P70B 1GBBA 4CRFA 2BX3A 1EASA 4XBCA 3NUMA 1SPJA 1MQ5A 1FV9A 1FUJA 1Z71A 3BIUH 4FUGA 3SQEE 3D65E 4LXBH 2YMSC 3ZZBA 1V2MT 5EXMA 2ZNKH 1YCPK 2FOAA 4AFQA 1JIRA 3D23A 3DCLA 1O5CB 4H42U 5HM9A 1NTPA 4Q4LA 1GBEA 1FIZA 2F9NA 1CA8B 3LC3A 2PKSB 1ORFA 2AMQA 1SB1H 2B0FA 4BAQB 5GDSH 4WJG2 1FY3A 2EY4C 3RXVA 3EGKH 3F9HA 1V3XA 2F9OA 3A7YA 1Y5UT 2F9VA 1H8ED 5DP4A 2CGAA 2RA3A 2FX6A 3BEFB 5FX5A 4Z6AH 2QXJA 1OWEA 4JYVH 1EP6A 1TNIA 3KQCA 2FESH 3B8JA 2PKAB 4DCDA 1J17T 2VGCB 1O2PA 3V0XA 1WU1A 4NIYA 1SG8B 1UCYH 2V35A 3RXGA 3RXBA 3F0OA 3IITA 2AH4X 4ABDA 1UK4A 3PMAB 4GPGA 4INLA 1QZ8A 2FLBH 6LPRA 3QO6A 5J4QA 1PQ8A 2FXRA 1KXCA 2WHXA 1BJVA 4X6MA 2BDCA 1DY9A 2FLRH 1FNIA 3VXFH 4YT7H 1FI8A 5C2ZA 2WPLS 4B6FA 1ELEE 2GZ8A 4H6TA 3OE7D 1V2VT 3VEQB 3ZYEA 2ZHQH 3ZV8A 2W3IA 4DIHH 2ANMH 2FI4E 1LVYA 3LJJA 1GHAF 2O8MA 2W6ID 2IPHA 1HYLA 2P8OB 3ZIAD 4ABJA 4AC9A 1GJ5H 4RKJB 2ALPA 2STAE 3SJOA 2C8YB 1KLIH 2BYAX 2GKVE 4A7IB 1EAWA 4ZCNA 2ZFPH 3F0PA 1ZSJA 2FOGA 3EQ0H 5JYIA 3RXEA 3SORA 4X1PU 3WY8A 4DURA 4FU8A 3MI4A 2WPIS 1UHBB 4HGCA 4DT4A 2QGRA 2YOLA 1JRSA 1TBQH 2GCTB 3PTNA 1VITH 3OX7U 1P2OA 3F3BA 2PV9B 5IDKA 1BTZA 1SVPA 4ISOA 4R8TB 1GPZA 3SQHE 3OEED 3VB5A 1GI4A 1GI1A 1HV7A 2SNWA 2KR7A 4SGAE 5EJZA 1P3CA 3M36A 2IOTA 2A7CA 2WUCA 4D7GA 1Z8IB 3UOPA 1VKYA 4IN2A 2BQ7B 2V7QD 3OAAD 2B7DH 1SFIA 1O3FA 4LZ4B 5DGJA 5FPTA 1O2SA 2TGAA 3M5OA 3O8DA 5GNDA 2NU3E 1AHTH 1P2JA 5EPNA 1AUTC 3RXKA 1AN1E 1EATA 1QQUA 4MLFB 3S9AA 4K5ZA 1GI5A 1QBNA 4MDSA 3UR6A 1HFDA 1AI8H 2AIQA 3M37A 3NWUA 1VJ9U 2BD3A 1IQKA 4NIVA 5TJXA 1YPKH 3V7TA 2FM2A 1SLVB 1EJMA 1O2VA 1YPJH 4XFQA 1YPLH 1EX3A 2VVUA 3PB1E 4K2YA 4LK4A 1KDQB 1O3IA 1SGFG 1F5LA 1LVMA 4TPIZ 3DUXH 1OX1A 3BF6H 1T8LA 2H9EH 2KFWA 3QTOH 3UUZA 1A61H 4OS6A 2Y5HA 3BTGE 4XRNA 4YZUA 1BTUA 2XBWA 1C5UA 1SLWB 1GDNA 4OGYA 3ZVBA 1SQOA 5JDUB 5B6OA 1UVSH 1P02A 1NM6A 1OYQA 3GCTF 1PPCE 3LGWA 5HGGA 4Y79A 3STIA 1LKAA 2ZDMA 4X8UH 4DOQA 4AYYB 1RTFB 4M9FA 3SI4H 1FPHH 4IC5A 3E91A 2TGDA 2ZDNA 4A6LA 1RGQA 1YCPM 5FBIA 1WV7H 4CBNA 2GGVB 1WTGH 1GHZA 1O3NA 2P95A 1XUHA 9ESTA 1DY8A 3PTBA 1C5OH 5LGOA 1V2TT 2EI6A 1GJ4H 3BG8A 4K60A 2V3MA 3RM0H 1EOJA 2WSSD 2W26A 2VINA 3SJ9A 1CQQA 1FY4A 1ZOMA 1DS2E 2GMTB 1GI3A 4AN7A 3STJA 1AE5A 1BTPA 1ZTKA 2A4QA 4FVBA 1RS0A 4TYDA 4ABIA 1GBJA 3SJIA 2ODPA 2CHAB 1GHXH 3SYJA 1AVWA 1Y5BT 2CK3D 1Z1IA 2ALVA 3OSYA 2BDAA 3ZZ6A 2A7HA 2HWLB 4B2CA 1E79D 4K69A 3K9XB 2W5EA 1QRZA 2A5AA 3SUDA 1E37B 1FDPA 4IS5A 1NBMD 4AG2A 5EXNA 3VXEH 1K9OE 4F48B 1GVKB 2UUKB 3MFJA 4X0WU 1MMJN 1FAXA 1UK2A 2Y7ZA 1XUIA 1DPOA 1EJNA 1GI0A 1LMWB 1AD8H 5AVDA 2F4LA 1VGCB 1A5IA 4X6OA 5IYTA 5A09A 2ZDAH 1ZRKA 3URDA 1K22H 2ZU2A 5EG4A 5JBTA 5L2ZH 2CJIA 2FEQH 4NIXA 1UW7A 3NCLA 1ANDA 1TA6A 5K0HA 1G3CA 2D1JA 2QYIA 4FUBA 3SBKA 2WV4A 1TA2A 4MPWA 1MD8A 1C5VA 1GI6A 1L2EA 1S0RA 1UVUH 4WF8A 5JBCS 2ZIQH 1Y3UA 2ZTXA 1VCPA 1PPZA 1RRKA 3UNRA 1MQ6A 1K28D 2P3FH 4K3JA 1IHTH 2GDDA 2C4FH 1C1OA 2WINI 3SI3H 3MWIU 1DITH 1SHHB 4X1SU 1S83A 3RXHA 1C2IA 1J15A 1HXEH 1KXDA 3MO3A 4OS4A 5DG6A 4JK6A 5T1VA 1GBHA 1TBZH 1P57B 2C3SA 5EQSA 1LHDH 1T8NA 2OD3B 2KM0A 2ZPRA 1RXPA 1WTHD 4Y7AA 1O37A 4FETA 3ENSB 3SUEA 1P3EA 2R0KA 4XD7D 2AHME 4YLUA 1HRTH 3C27B 3WW7A 3SV6A 2VBCA 4IW4E 2P93A 2PTNA 2SFAA 4X2XA 3W95A 5C67A 1C5XB 3U69H 2Y80A 4OGXA 4JK5A 5CHAB 3PRBA 3GCNA 1CHOG 2O9QA 3RC6A 2ZQ1A 1S6LA 3A8BA 3PLKA 1T8MA 3GDUA 4UFDH 2XC0A 1TIOA 3ZV9A 1C5MD 1GHYH 3O8BA 3SHAH 4AYVB 1OSSA 1SGFA 2WPKS 3PWBA 1HJAC 1UVOA 1HNEE 1F2SE 1EUFA 1JMOH 3U8TH 5C0UA 4MNWA 4MPUA 1LCYA 4YM9A 1QL9A 1DDJA 2WPHS 1BITA 3TK9A 1SOTA 3T5FH 3RXOA 4DG4A 1SGDE 2BDYA 4INKA 2ZFFH 5DJ7A 4YTAA 1EQ9A 3E6PH 3SU1A 3GCHC 1ZTLA 1QA0A 4J1YA 3QLPH 2G4TA 1QHRB 1W0YH 4F4OC 1ABJH 4RT0A 2H6MA 3SUFA 1QNJA 6ESTA 4CBOA 4MNXA 1NO9H 1BRCE 7ESTE 3DD2H 3UFAA 1CGIE 3LGTA 1EOLA 3ATIA 4YT6H 1O3LA 1K1JA 4X8VH 3ZZAA 3BTHE 1YY3A 2Z9IA 1LPGB 3DSOA 1MTNB 1OWKA 5C5NA 1S5SA 3L33A 1QRXA 1YPMH 3EYDA 1SGNE 3KQ5A 1XMNB 2UWPA 2ZG0H 1Y3VA 3EA8A 1DE7H 2ZHEH 2A45B 3ZZ9A 1PQ5A 3TH2H 1BMLA 3BTKE 1UHBA 1O2MA 3RXDA 5F03A 2GT7A 4O03A 1UVPA 2BQWB 8GCHF 5EJLA 2J2UA 4WH8A 1AU8A 3SUGA 4B6EA 1EPTC 3MU8A 4CRBA 5EU8A 4IMQA 5DK1A 2ZHFH 1AKSA 1FLEE 1WQVH 5EOKA 2G4UA 5HYOA 4JCNA 1TOCB 4HI3A 1A46H 3TPIZ 1YLDA 2F9PA 2EQNA 1C1PA 1C2FA 2ASUB 1SKYE 4VGCC 2Z9JA 1RFNA 3RMNH 1F5RA 4NZQA 1VCQA 1C9PA 1DSTA 4AZ2B 3ATKA 5T3HA 3ZYDA 3SJKA 1YM0A 1ELFA 1L4DA 2NWNA 3FANA 4B71A 1HXFH 1P9SA 1O30A 1NFWA 4IGDA 5H4IB 3RXFA 2CF9H 2XC5A 1V2KT 5CMXH 2OCVB 1ZLRA 1VITF 5KGOA 3F68H 1GMHF 1XXDA 2BZAA 5AF9H 1Z8RA 5F8ZA 1JRTA 1NFYA 1OS8A 5LPFA 1IQEA 1TPOA 1CSOE 3PV2A 2F9UA 1GL0E 3NKKA 3H09A 4I8HA 2XOKD 4GUXA 1T8OA 3GY6A 5A0AE 2GDEH 2BOKA 4QT8C 5F53A 1GBCA 3G01A 2Q6GA 3RXLA 5C1XA 2QC2A 2VVCA 1GCTB 1GG6C 3SU2A 1E34B 1O3MA 3FZDA 4XBBA 2ZQ2A 1SGCA 3RXQA 1GVZA 3H7TA 3RMLH 3BTME 1T32A 1Y8TA 3SGQE 2QXGA 5ETXA 3HPTB 1UTPA 4U32A 5A8YA 1BDAA 1DXPA 5ESTE 4RKOB 4Y0ZE 3RXIA 4ZAEA 1ESBA 3U1IB 1C5LH 2W7UA 3D62A 4TWYA 3HGNA 3KYGA 2A0QB 3TITA 1O2KA 3LGUA 4OS2A 4F49A 2WPDD 2JETB 1MAXA 1E36B 1BOQA 1KXAA 3TLOA 2PSYA 2JH5D 3SO3A 3PV4A 3LH1A 2P59A 1AB9C 5E0HA 3A7XA 2XWBI 1F7ZA 1NS3A 1G32B 1F92A 1OOKB 4K8BA 3SW2B 1W12U 1QJ6B 1GI9B 4HTCH 1DANH 2IJD1 1JBUH 4I33A 3M3TA 2ZF0H 1D3DB 3GY8A 3N99A 1C5ZB 2ZWLH 2VWNA 2GVFA 2XCFA 3ITIA 1IQFA 1MCVA 2B5TB 3GS9A 1GJ8B 1SOZA 3SV8A 4I8JA 3SHCH 4WXIA 1B0FA 4UE7H 3ZVEA 1THRH 3ZVAA 1HIAB 4WXVA 1C2EA 1C1NA 1J9CH 3NRLA 2P16A 1A0JA 3P8GA 5A2MH 1FAKH 2AEIH 2LELA 3A8AA 3HKIB 1WDIA 2ZHDA 3P6ZB 1HAHH 3UB0A 3DA9B 4ABBA 1CBWB 1P04A 2G51A 4U2WA 2BTCE 4A5TS 1S84A 3E90B 5I25A 1GJDB 1CHGA 2F9BH 1EZQA 2WV5A 4UFGH 2GZ9A 1UK3A 3U8OH 1QL7A 1TPPA 3P95A 1WCZA 2A4GA 2GCHG 4JYUH 1BBRK 5JB9S 1TX6A 2WPMS 2XC4A 2BY9X 4CHAB 4UONA 2VGCC 4BTTB 1A0LA 1KXEA 1MZAA 3VGCB 3MTYA 3RU4E 1MU8B 5TCAA 3M5LA 2WPJS 1W14U 1XUGA 3QUMP 2PUQH 1B7XB 2F3CE 3GDSA 1C5NH 3P92A 2FO9A 4Z1MD 2PTCE 4Q2KA 1VZQH 1SFQB 1E38B 2ZFTA 1ARCA 1HCGA 1L1GA 1PPBH 1PPHE 3ZZ7A 2G5VA 3TH4H 4ACBA 1O31A 3FAOA 1O2IA 3BSQA 1JWTA 4E06H 1RIWB 2M5TA 2HPQH 1MKXH 2P8OC 2ILNA 2THFB 1BA8B 2FODA 1D4PB 1GWAA 1MU6B 2WUBA 1NT1A 1Y3YA 3SV2H 2O8TA 1ARBA 2Q6FA 3FN8A 3NZIA 4Q7XA 2SGQE 2QXHA 1O2TA 1C1RA 4X6NA 2HOBA 4Z0KA 2XBVA 2AYWA 2BZ6H 2R2WU 1S81A 1ZMLA 1UTLM 3S7HB 3SNDA 2GCTC 4AFUA 3KHVA 5L30H 3S9BA 3QZQA 4DGJA 4RN6A 2ZU5A 3QK1A 1O5DH 2HNTF 5DPAA 3V12A 3K2UA 3A82A 4FUIA 1TB6H 3A7TA 1VCWA 2V3OH 2C90B 1E1RD 1V6DA 2DUCA 2OINA 2TIOA 1YCPH 3PMBB 3VG8A 3FOAA 5CDFE 3QZRA 4MPVA 4TY7A 2Z3DA 2SGDE 4AG1A 2ESTE 1CT0E 2J98A 5LH8A 2C93B 1H8HD 2GJGA 3ATMA 2BDHA 1BMAA 1P2KA 4BAOB 1DFPA 3BV9B 1XVMA 2JJ2D 1K2I1 3M7UA 2H1UA 1PYTC 1O2GH 1HJ9A 1JXPA 2TBSA 3Q3YA 3E0NB 1VJAU 3MH7A 2STBE 5EJ1A 3V3MA 1C5RA 1BCUH 1QFKH 2VWLA 4BNRA 1AO5A 1F5KU 3FVFB 4Y11E 3KIDU 4ISIH 3B23B 1UJ1A 4Q7YA 3FKSD 2BDGA 1BUIA 4YESB 3AASA 1ELVA 1W0JD 2QAAA 3GY7A 4NWKA 3I29A 1H9IE 4P02A 1K0HA 1HAGE 3RXSA 2R2MB 1BBRE 1COWD 1FY5A 2F43B 2ZCLP 4Y71A 1TAWA 1QGFA 2GX4A 1HAOH 4O3TA 4TPYA 1MTVA 4FU7A 1ETTH 1QL8A 5DP7A 1UVTH 2OBQA 2V3HH 4XE4A 1A3BH 1V2OT 1CGHA 3MMGA 4KELA 1O3DA 1DWDH 1GMDG 1Q2WA 3RU4T 4GCHG 4ZHMU 5DP3A 2H9TH 2OK5A 1QJ1B 3TJVA 4I7YH 1A2CH 2Z7FE 1TRMA 3UR9A 2EA3A 4DIIH 1GI7B 5HIYA 1AVXA 2ZU4A 4MNYA 2HLDD 1QRWA 2ZGHA 5EODA 4X1QU 5T6DA 3SJ8A 5AHGH 1ZJDA 2CMYA 2RDLA 1TNGA 3DSPA 3P8OA 3RMOH 3PLBA 1O2RA 3T29A 1A1RA 1SI5H 4NSVA 5ESBA 2GMTC 3AAUA 2W6JD 3ESTA 5C0TA 2YNAA 3PO1C 1O2XA 4FOUC 5EXLA 4YOIA 1EZUC 2QCYA 3HK3B 2Z6BD 2XTTB 1THPB 5AFZH 2OP9A 2A1DB 1H8IH 2Y7XA 3VB3A 3RM2H 5L6NH 2CHAC 2XRCA 1EPTA 2G5NA 1MAYA 1HAIH 5DP8A 8GCHG 1HAVB 2GD4B 4MQAA 1D3PB 1W11U 2NU4E 1G3DA 1NU7B 3RUOA 1WSSH 1ZHMA 2Q6DA 2VWOA 3S7KB 4ISNA 1RD3B 1D3QB 2UUYA 2ZECA 1GMCF 2BHGA 1YLCA 3RXRA 3ELAH 2BXUH 4KTSA 5C3NA 3LKWA 3P8NA 4K1SA 2ZHWH 3ZZ5A 3PO1B 3U98H 1DLKB 2NU0E 4IMZA 1TPSA 1VGCC 1L0ZA 1ZMNA 4NA7A 1GHBF
chains in the Genus database with same CATH topology
1O3GA 1G2LA 1O2NA 4AORA 1SGTA 5A8ZA 1BTWA 3RXCA 4THNH 1O5BB 1TPAE 2H5DA 1P09A 7LPRA 1JIMA 3EDXB 3KGPA 3M35A 5EQQA 2G81E 3HATH 4Y6DA 3FZZA 5A8XA 4WVPE 2UWOA 1K21H 5JBAS 3L3TA 1H1BA 1W8BH 1ZPBA 4I8GA 4X8SH 3ZZ3A 5HMAA 2ANYA 3MOCA 4AX9H 2AFQB 3A7VA 4UD9H 2FZZA 1P11E 2FP7B 3A86A 1A5GH 3PROA 1W13U 3F9GA 2Z9KA 1P12E 6GCHG 4YOGA 4ZROA 3A83A 4PROA 1WQSA 2BLQA 2QN5T 4CH2B 5DKMA 1FN8A 3U8RH 1V2UT 2V6NA 5CHAC 1GI8B 3LGVA 1TWXB 2A32A 3M7TA 3NK8A 3KQDA 3GY4A 4ABAA 3CENA 2G52A 4BAHB 1BMMH 2ZGBH 3A88A 3MH6A 1BZXE 3T27A 5FHTA 3SN8A 2ZDVH 5L2YH 2J38A 2PW8H 2UWLA 1P01A 1KIGH 4I32A 1W2KH 2GT8A 1IQHA 2ODQA 1NFXA 1Y3XA 1JOUB 9LPRA 3B9FH 1MBQA 1QURH 3RXUA 1SLXB 1LQEA 1OWDA 2FI3E 2P94A 1AUJA 1OP8A 5GJ4B 2ZP0H 5FBEA 3T62A 2ZGJA 4D7FA 4JYTA 3M3SA 2QV1A 1TOMH 2FOBA 2P3TB 4U30A 3RLYH 2QY0B 1OXGA 1CA0B 3Q76A 1C5SA 5DP9A 1GVLA 4YOJA 1YF4A 3AAVA 1DWBH 1Z7KA 2KAIB 3P17H 3MU5A 3LDXH 2W7SA 3U1JB 2GP9B 1TMTH 2ZPSA 1GBIA 1Y5AT 1O33A 4GHTA 4M7GA 1X7AC 1MTNC 3DFLA 2P3UB 2PKAA 2J9NA 1NC6A 2SGPE 1INCA 2ZTYA 4B74A 3TK5A 3MHWU 1P06A 2FDAA 3SZNA 1W0ZU 4ZKNU 2ANKH 3SNAA 4Y8XA 1KSNA 2EI7A 2OUAA 1N1LA 2BD9A 3UOUA 1AFQB 1F0SA 4TWWA 1IQGA 1UTQA 2FI5E 3KNXA 1AGJA 1ELGA 4X1NU 1SGRE 1XKAC 1TGTA 3A8CA 4A1XA 1BRBE 1CT4E 2EEKA 1C2DA 2A31A 3HGPA 3TNTA 4ZXYH 1SQTA 4ZHLU 3MH5A 1O0DH 4BTIB 1ZGIA 1C1TA 1V2PT 4CR9A 3V13A 2Z9GA 2BY6X 1YP9A 1MH0A 2EI8A 2QXIA 2A4OA 3BN9A 2BDBA 2XWAA 3KF2A 3SGAE 2TGPZ 1GHWH 1KYNA 4DY7B 1QB6A 2Y81A 4K1TA 5JB8S 1GDUA 3RXMA 2SGEE 2ZFQH 3SU4A 1LPKB 1QTFA 1Y3WA 2PSXA 1LO6A 2FX4A 1AE8H 1J16A 4HZHA 4K1EA 1LHFH 1P2MA 4B2BA 1SL3A 5DO4H 2SGAA 1XX9A 2ULLA 4Y8ZA 6CHAB 1HAPH 1GJCB 4DVAU 1H8DH 1L1NA 4XSKU 4MNVA 1S0QA 1MTUA 1GJ7B 1GHAG 5PTPA 2FOEA 2PR3A 1IQIA 3TJUA 1SGPE 1NFUA 1NY22 1V2QT 2VIVA 1GCTC 1TRYA 1FONA 1GHVH 4FU9A 1E35B 2J94A 3MU1A 1TRNA 1NRQH 3K65B 4UDWH 2R3UA 5C20A 1A4WH 2XBXA 2TRMA 2BLOA 1B0EA 2HGTH 3UY9A 4B73A 2R0LA 1TNHA 1KDQA 4NGAH 4OS1A 2ZCHP 3SNBA 4D9QA 1H9LB 1EAXA 5C1YA 5G4BA 1HLTH 3VB7A 1ZSKA 1G3EA 2JETC 4NG9H 3TVJB 7GCHF 5GXPA 4HFPB 5EW1H 1O5AB 1BRUP 2XXLA 2O8LA 3A89A 3JZ2B 4GAWA 1OPHB 3DT0H 2PWXA 4ZH8A 2R3YA 1ZJKA 4OS7A 4B1TA 4FUDA 5FCRA 3R0FA 1S6FA 7KMEH 1HJ8A 2TGTA 1GCDA 4ZMAH 4H6SB 3BG4B 1J8AA 3SGBE 1XUFA 1MCTA 2BDIA 2IN2A 1SGQE 2J4IA 4FUHA 4BAKB 1ANEA 1EP5A 2J92A 1GJ6A 2W3KA 3GY5A 3T2NA 1TALA 3HK6B 2BVSH 4JZIA 2FTMA 4ABHA 3LH3A 3ZVDA 3GISB 1EZSC 1ZZZA 1O3JA 2ZGCA 1FIWA 1D9IA 2WYGA 1CBWC 1P03A 1ESTA 1O5FH 1Q3XA 1WOFA 3GCTG 1LHGH 1QQ4A 1GGDB 1IQNA 3NXPA 2ODYB 1QIXB 1KY9A 1YYY1 3UQOA 1EAIA 3GY2A 1C1UH 1BTYA 1HBTH 2A2QH 3QWCH 1ZGVA 3SU5A 2Y5FA 2RA0A 2UUJB 4CHAC 1FXYA 4K8YA 2ZA5A 3BTQE 3VGCC 4NWLA 2VWMA 1KXBA 1N6XA 2A4RA 3S69A 3I77A 1TNJA 2ZCKP 3GCOA 3S0NA 1DICA 4Y0YE 1O2QA 1EB2A 1C5WB 2D2DA 5E0GA 4GSOA 1ELCA 1HDTH 4KGAA 1C2HA 1TGSZ 1CHOF 4AB9A 4AOQA 3OTJE 1UCYK 1DLEA 1NZQH 4XDEA 1MUEB 1SGIB 5I46H 1EZXC 5F8XA 1GJ9B 2HRVA 3SNEA 3LU9B 1RIWC 1O3BA 1NESE 1HAYB 1K1LA 1YBWA 1A5HA 1N6YA 2Y82A 1BTXA 3F9EA 2G55A 2FOMB 1BIOA 3A87A 4BTUB 1G2MA 4BXSA 1QA7A 2BY7X 2B9LA 3KQEA 1G3BA 3BIVH 3PMJA 1UTKA 3QGNB 2OC8A 3SU0A 1F0RA 4LZ1H 3RLWH 2OC1A 1AZZA 3TK6A 1A7SA 1K1OA 1ZHRA 1BJUA 4WMFA 1V2RT 3FFGA 1TX8A 4ZUHA 1QBVH 3M61U 4IC6A 1GBMA 4A92A 3ZZ8A 4ISLA 1K1PA 2Z9LA 1ANBA 1GBFA 1OWIA 1YC0A 3RC5A 5GWZA 2Y5GA 1TX7A 4NFFA 1OYTH 2YNBA 1XUJA 2FS8A 4O3UA 1T4UH 1V2LT 1N8OC 1J14A 2FOHA 2JH6D 4MG3A 2H9HA 3BEIB 3SNCA 1IQJA 1XM1A 2HPPH 1OWJA 1YPEH 3O8RA 1TQ0B 1BHXF 1XUKA 4B2AA 4B76A 1IAUA 4IBLH 1IQMA 3GOVB 3ATLA 1QCPA 1O2JA 4MPXA 5CE1A 3EE0B 3PYHA 1Z6JH 1O3KA 3ZZDA 3LJOA 3OY6U 1ESAA 1HAZB 4WMDA 1LTOA 2KAIA 1C4V2 1K1IA 2J95A 1BBRH 1LVBA 2BB4A 2VB0A 5C1UA 2FYQA 1N8OB 1QR3E 3UREA 3NPSA 1KLTA 2OXSA 1UMAH 1DWEH 2RCEA 2BD4A 4AB8A 1O3EA 1DXWA 1FZZA 2A2XH 4BAMB 1EJAA 5ABWA 1AWFH 2ZFSA 3RXAA 1S85A 1C5YB 3PLPA 2AMDA 3Q3KA 4I8LA 3IG6B 3RMMH 2VIDA 2H5CA 4YO9A 2GZ7A 1K1NA 1WUNH 1MTWA 3A85A 1YGCH 4Y76A 2ZDKA 1QB1A 3MNBA 1GBDA 1UCYE 1GBKA 4D9RA 1H9HE 1EKBB 3ZZ4A 5SGAE 3T25A 4CREA 4X2YA 3P8FA 3RXTA 3RXPA 5GIBA 3KL6A 1TGNA 1OWHA 2HLCA 2C8XB 3EA7A 1TE0A 2XNIA 1AKSB 5E2PA 1EB1H 3T26A 3JZ1B 3UWJH 1XVOA 1TABE 1C4Y2 1LHCH 1DSUA 4X6PA 1ABIH 4Y8YA 1QB9A 2PGBB 3GYMA 2BXTH 3IWMA 3MU4A 4KKDA 1ZPZA 3K6ZA 4FVDA 2CV3A 3T28A 1PPEE 2CF8H 2PLXA 1FN6A 2QF3A 3DHKH 2O8WA 3KCGH 1UTMA 2VVVA 3GY3A 3Q77A 1DUAA 2H2ZA 3OU0A 3VFEA 3AW1A 3M7QA 2OC7A 3F1SB 1KTTB 2FS9A 2J34A 1O2HA 5GCHF 2HALA 3AVZA 3VB6A 1TGBA 2ZEBA 3BTDE 2G00A 3UNSA 4WH6A 5TCCA 3RC4A 2FOCA 1C5QA 1O5GH 3TGIE 1XKBC 1TONA 2PHBA 2VIQA 4ABEA 5JBBS 4MVNA 1O2UA 1DUEA 2Y6TA 3OY5U 2ZDLA 2OBOA 1F0UA 1T4VH 3M5NA 1YPHC 1GL1A 2FOFA 1KXFA 4JZEH 2ZKSA 4XBDA 3TIUA 3BTEE 3FP7E 2FMJA 1QJ7B 3F9FA 4BOHA 1O2ZA 1SBWA 2ZU3A 1S6HA 4D76A 3RP2A 1O3PB 1TNKA 4UFEH 1C5PA 1RJXB 1UTOA 1ETRH 4X2VA 1L1JA 1MD7A 3SV7A 1OP0A 3TNSA 3E0PB 4FUJA 1O36A 1NPMA 4JZFH 1TGCA 3I78A 1C1VH 3ODDA 2BY5X 4O9VA 1SGEE 4O97A 3Q3XA 3EA9A 2I6QA 2AS9A 4ZHAA 1ZPCA 2A5KA 3UWIA 1V2WT 4ZKOU 4DT7B 1W3CA 3A80A 1ELAA 1O39A 2D26C 1VITG 5A0BA 1GMHG 2AMPA 2GCHF 2LPRA 1F0TA 3H5CB 3A7ZA 4AGJA 1CT2E 2ZO3H 5E0JA 1QY6A 3ZZCA 1ELDE 2UUFB 3QDZB 3UIRA 4CH8B 2BLVA 3VPKA 3ODFA 1K1MA 3MU0A 2LNCA 2ZI2H 3UNQA 2PFEA 7GCHG 1ZR0A 1TNLA 5K7RA 1SGYE 1O34A 2WYJA 4NFEA 2HNTC 2VIPA 3O8CA 3TJOA 4JZ1A 1T7CA 3ATWA 1NROH 4NA9H 2AIPA 1V2JT 1ACBE 1TFXA 5JPMH 2GTBA 1Z6EA 5BPEA 3E16B 4NA8A 3QGJA 3LT3A 2FPZA 1P10A 1LHEH 4ZKSU 2ZZUH 4YLQH 5T6GA 1HIAA 3KEEA 4RSPA 1OKXA 3MO6A 2BM2A 1BHXB 1O35A 2ZC9H 2XYAA 4Y10E 4NIWA 4FXGH 3UQVA 2VU8E 1A0HB 2OTVA 2BX4A 1ZHPA 5C5OA 3UTUH 1L4ZA 2VH0A 1CA0C 1YPHE 1Z1JA 1YKTA 1HAXB 1VR1H 5FAHA 1FMGA 2A5IA 3MNXA 5E2OA 1OP2A 3ZVGA 4B75A 2GV7A 4JZDH 5F6MA 1PPGE 1DVAH 1EAUA 4J2YB 3URCA 1SR5C 4FUEA 2SGFE 2BVXH 1BTHH 2VJ1A 1UTJA 2DE9A 1P2QA 5A0CA 2BLWA 2BMGB 3W94A 4AGKA 4TY6A 3TJNA 1O3AA 1AFQC 1O5EH 8ESTE 1IQLA 1FY8E 3RU4D 3LC5A 3E3TA 1BMNH 1ID5H 1CU1A 3KN2A 8LPRA 1MBMA 1KTSB 5FXLA 4A1TA 3PWCA 4GHQA 5GPIB 1ELTA 1C2JA 1DWCH 1B5GH 1C2MA 1D6WA 1TMUH 1PJPA 1CO7E 1P2NA 2BVRH 4FUCA 1NN6A 4KP0A 1TLDA 4H4FA 1LQDB 3LOXA 3S9CA 3R3GB 1C9TA 4KTCA 3VB4A 1GDQA 2ZGXH 2NU2E 1G9IE 2XW9A 4ABGA 2HNTE 1ZMJA 1IHSH 3M3VA 3QX5H 4U01A 1FJSA 2EC9H 5EQRA 1SQAA 5F8TA 1UO6A 4Q7ZA 3A84A 4CRCA 4A1VA 1AMHA 4JMYA 1ETSH 1H4WA 4D8NA 3A7WA 1DX5M 1CE5A 3PM3A 3L6PA 1IOEA 2BD8A 2FTLE 2V0BA 3BEUA 3FP6E 1C2LA 3E1XB 1GJBB 1BB0B 3H7OA 1S82A 1W10U 6CHAC 1GMDF 1Q31A 3EAJA 4GCHF 4ZKRU 2XBYA 3CP7A 1HJAB 1GBTA 5EGMA 1NRSH 1T31A 3MYWA 3SOSA 3BTWE 1QBOA 2OC0A 4WY3A 1TMBH 3MO9A 1AVGH 2Z3EA 1C5TA 1C1WH 4X8TH 1WBGB 4UFFH 1BQYA 2Q1JA 4Y7BA 4X2WA 2RG3A 1FPCH 1O32A 1O3CA 1O2WA 4NCYA 1SC8U 4LOYH 1TBRH 2PUXB 2HVXA 2F91A 1SLUB 2FWWA 3GCHB 3TGJE 4I31A 1P05A 3FP8E 4ABFA 3MNSA 1KLJH 2CN0H 2G8TA 2VIWA 5FPSA 3C1KA 4X1RU 3A81A 1TQ7B 1O38A 1PPFE 1G36A 2A7JA 1NRRH 3MNCA 1LPZB 2IJOB 5HM2A 2QF0A 1GBLA 1PFXC 2QA9E 1WYKA 1HGTH 4E7NA 3LGIA 1AQ7A 2Z3CA 2GV6A 3SU3A 3TH3H 4DJZB 1SHYA 2JKHA 4ZXXH 3GICB 3BG4C 5LPEA 1ZYOA 1CVWH 3HKJB 4INHA 4CRGA 4R0IA 2C8WB 1DT2A 4AFZA 1MKWK 1HB0B 2ZU1A 1THSH 2DE8A 1AFEH 2FYRA 1TYNA 3UPEA 1P8VC 1U6QA 1D6RA 5BRRE 5T6FA 4BANB 1C2GA 4KTUA 1ZTJA 1M9UA 3Q00A 3U9AH 3K6YA 5AFYH 1ANCA 1EPTB 3QTVH 1AIXH 3QN7A 1LVOA 1NRPH 2BOHB 2VH6A 2F83A 2BY8X 4AFSA 3AW0A 5EW2H 1G37A 1HUTH 5DP5A 1NRNH 2OQUA 4I8KA 1P9UA 3MH4A 1P0SH 1O2LA 1GI2A 4XOJA 2BD7A 3BTFE 1UTNA 4VGCB 4Q80A 1GGDC 1GBAA 5EPYA 1HPGA 2AGEX 2QIQA 1C4U2 1C1QA 2D8WA 1YPGH 3A8DA 3DFJA 3F6UH 1C1SA 5E8EH 8KME2 2C8ZB 2JH0D 1FQ3A 1HAVA 6GCHF 4ESTE 1W7XH 2VIOA 2ZTZA 5DP6A 2BD2A 1NU9A 3CS0A 1SSXA 1C1MA 3RXJA 4FUFA 1D3TB 1AZ8A 1DOJA 2AGGX 4GVUA 4UEHH 5J4SA 3CS7A 1BT7A 2AGIX 3SV9A 2OQ5A 3RDZA 1XXFA 5GCHG 1Y59T 1GJAB 1V2NT 2O8UA 2SNVA 4E7RG 3SU6A 1A3EH 2I6SA 1PQAA 1E0FD 1LDTT 1RTLA 3E8LA 1PYTD 5HXFA 1PQ7A 3LIWA 1O3OA 3TU7H 1MKWH 1Z8GA 4NSYA 2K1QA 1WAYB 1GG6B 1AWHB 1V2ST 2BQ6B 1DM4B 1MTSA 1BRAA 3D49H 1SMFE 1CGJE 5FPYA 2VNTA 2ZPQA 4DW2U 2B8OH 1P2IA 4CRDA 3TGKE 4MTBA