3PLBA

Bovine trypsin variant x(tripleile227) in complex with small molecule inhibitor
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCAGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGIYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Correlating structure and ligand affinity in drug discovery: a cautionary tale involving second shell residues.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-11-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plbA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3plbA02
3S0NA 3GYMA 2BDIA 2BQ6B 1ELDE 2ZNKH 3VGCC 5E0GA 1TGTA 4U32A 4Y8YA 5T6FA 3UREA 5A0BA 2H1UA 1BTYA 1NZQH 1O3KA 3RU4E 1ZZZA 1GI4A 1O39A 4I32A 4CRBA 1FZZA 1YPKH 3E0PB 1HAIH 1SB1H 5JBCS 2F3CE 5JDUB 1C4Y2 1EJMA 3RM0H 1TMUH 1JIMA 1KXAA 1GJDB 1SGFG 2EEKA 2B0FA 3TH2H 2G52A 1V2KT 1FPCH 1DLKB 1NT1A 1QCPA 1V2WT 1LHFH 1NFWA 5DO4H 1O2YA 1TBZH 3AAUA 2ZFRH 2IPHA 4ABGA 1IQFA 1HJAB 4Q7YA 5BPEA 3UR9A 1C2MA 4FU8A 5T3HA 2QA9E 3TIUA 1AZ8A 1VR1H 1A7SA 1PJPA 4HTCH 3SGBE 3TK6A 2BX4A 3VFEA 3D62A 1ZOMA 1BMMH 1CGJE 1H9HE 5C1UA 3BTKE 1GHBG 1EXFA 1ANCA 1A61H 1BJVA 1O37A 1LHEH 3ZZ8A 2QIQA 1MCVA 1GI7B 1ZR0A 2OBOA 2C90B 2KAIA 4K1TA 1HDTH 3FFGA 1ANEA 3V13A 2OCVB 2H9HA 3KIDU 1BTZA 1ZPCA 1SLXB 3GY2A 3K2UA 2QGRA 4I8KA 3VEQB 2VH6A 3MU8A 2CMYA 3KN2A 1V2VT 1ZPBA 1GJBB 5ESBA 2HPQH 3LGVA 1LTOA 3A7TA 1S85A 1GBLA 2R3UA 4ABIA 2V0BA 5A8YA 1S82A 1P02A 4E7RG 1E35B 1MCTA 1SLVB 1UK4A 1AIXH 2G4TA 2Z94A 4Y6DA 4YOJA 3SHCH 2R2MB 4OS6A 2FIRH 2TGDA 1G3BA 1SL3A 2A2QH 4OGYA 4JYUH 5GCHG 1C4U2 2PUQH 3BIUH 3SN8A 3ZV9A 2UWPA 1T7CA 1NS3A 1CT2E 3KGPA 2NU1E 1XX9A 1BBRH 1LPZB 2G55A 1MTNB 2WYJA 1TWXB 1HAVA 1EPTC 3TK9A 4DURA 2AYWA 3PTNA 1D6WA 1TNHA 4OS4A 3SQHE 3M36A 2GCTB 2FS8A 1AD8H 1YCPM 3GCNA 4O9VA 5EOKA 4ISLA 2BMGB 3M7QA 3UQOA 1YPLH 4IMQA 3PB1E 3STIA 5L2YH 1TA2A 4CR5A 1F0TA 2FO9A 2PKSC 1SGYE 4K69A 1LPGB 2J4IA 4NA7A 5DP5A 1O5CB 5F8TA 1FXYA 2UUYA 3RLWH 2FOMB 1G30B 6ESTA 4YTAA 5J4SA 4K3JA 4NGAH 4ZHMU 7KMEH 1DE7H 1O2NA 2BDAA 3BTGE 2VINA 5JB8S 4AYVB 3LGWA 1QA7A 3A82A 1UHBB 3MU4A 2FOFA 4WWYA 3PMHB 4ESTE 2A7HA 2XXLA 2J92A 3I29A 3BTME 3KNXA 3NK8A 3IG6B 1BTHH 1A0JA 3M3SA 2KAIB 2TBSA 1YBWA 2ZFSA 5L30H 4UDWH 1RGQA 1FI8A 1UVTH 4GUXA 3NCLA 1J16A 4K8YA 4Y7AA 2Q1JA 3URCA 4ZUHA 1MAXA 2JH5D 1KLTA 1SGIB 1TE0A 4X2XA 2C8YB 4ABDA 4YOGA 4AGJA 1HUTH 2GCHG 4O97A 1W14U 1P9SA 1P05A 2RA0A 4AFUA 3BIVH 1GI5A 4FUCA 1TNKA 1MAYA 2ZU3A 3SNEA 3M7TA 2F9NA 3MFJA 3T62A 4RKJB 1C1RA 1BQYA 1SBWA 1TONA 1PQ8A 1NU9A 1G2MA 5C5OA 2FOGA 2A5AA 1GCTB 1GG6B 1NY22 3EQ0H 3LC5A 4MNXA 1PPGE 1SQOA 1BOQA 2BHGA 3GICB 1Q2WA 3F68H 3RM2H 1JIRA 5GJ4B 2BVXH 4WMFA 4IMZA 1O3JA 4CR9A 2PTNA 1THSH 3KCGH 1TX7A 2XW9A 3Q00A 4MLFB 4A1XA 1G36A 4FU9A 5LPEA 1NC6A 5FCKA 1KLIH 1CGHA 1HBTH 5TCAA 6CHAC 2BDCA 2OINA 4Y0ZE 2WV5A 1O3FA 2THFB 2Y81A 1V2JT 2EI7A 1CT0E 3FP7E 2ZDVH 3SHAH 1Z6JH 1FN8A 1SHYA 4I31A 1NM6A 1EKBB 2C8XB 2C93B 1C2HA 1P12E 1C1PA 3RXQA 4A5TS 1O3LA 3QK1A 1QB1A 1DANH 1O2LA 5EXLA 1TGCA 2HNTF 3DFLA 2WUBA 1DUEA 2Y7XA 3E90B 3CENA 4D7GA 1EOJA 1SGEE 1DWDH 4IBLH 1GI8B 1C5PA 1IHSH 1HLTH 4NIWA 3PLKA 2BVSH 4CRDA 2ZDLA 4INLA 3PO1C 3TJNA 3VB5A 1VITG 4TPIZ 3E91A 4MPUA 1WSSH 3P8OA 4NZQA 3T27A 4FUDA 4I8LA 3U1IB 3P8FA 1DXWA 3ESTA 2XBWA 3VGCB 1GBJA 2ZI2H 1BTUA 2VH0A 2D1JA 1WU1A 1P57B 1P2IA 2W5EA 5DKMA 2PSYA 1O2QA 5C3NA 4U30A 2FI4E 4AN7A 3EGKH 1GCTC 4NWKA 1EX3A 1QIXB 2A4OA 2GDEH 1AE5A 1MH0A 5C5NA 4BXWA 3KQEA 4X1SU 1K1IA 1QFKH 3SUEA 1GBCA 5F03A 2Z6BD 1Z8RA 1ABJH 2QXGA 3MU1A 1S0QA 1DWCH 3RXKA 1IQJA 1J8AA 2QXHA 2XTTB 3A8DA 3RXDA 1EZXC 1E36B 1EOLA 1MD8A 4YOIA 1ARCA 1HAZB 2PSXA 1VITF 3LC3A 1BTWA 1IHTH 1O32A 1OS8A 2IOTA 3O8BA 4KP0A 1IAUA 3ZZCA 1LKAA 1DXPA 1AKSA 1O2HA 2QC2A 4NWLA 1XM1A 4HGCA 1TMBH 4WH8A 2J94A 1BJUA 3MHWU 3S9CA 1GL1A 3LGTA 3RXMA 3D49H 3MO9A 1O35A 4D76A 3RXGA 1CA0C 5AVDA 1Z7KA 3RXAA 3B9FH 5T6GA 3VB7A 4BTTB 1YPEH 2F9OA 1OX1A 1SVPA 1EJAA 3VXEH 1B0EA 5EPNA 1EB2A 2LNCA 1A5HA 1ZRKA 2PGQB 2AMPA 4BAOB 2A4QA 2A5KA 5JBTA 2P3FH 3GY3A 4UFDH 3HK6B 1SGNE 3F1SB 3KQCA 1B7XB 3A7ZA 1ZTLA 4NFFA 1MU6B 4KELA 1HNEE 1WAYB 1DM4B 2J9NA 1KXBA 1F7ZA 3RXJA 2BLVA 4Q7XA 2FOEA 3UOUA 2AMDA 5SGAE 3BEFB 3RXPA 8LPRA 4BTUB 2W3IA 1H8DH 5HYOA 1K9OE 1Y5UT 3FP6E 2ZCLP 1EAIA 1F92A 3QDZB 3T25A 2RDLA 1QL7A 1XMNB 1QGFA 1NESE 5IYTA 1P11E 3UY9A 1SGPE 2QN5T 1S0RA 3AAVA 1O2GH 4AGKA 1C1SA 5L2ZH 4I33A 2ZGCA 1WCZA 3GY6A 4LOYH 3L3TA 1P03A 1AZZA 2P93A 2GMTB 5CMXH 2O8TA 3BTFE 2AGGX 4CHAC 2Y6TA 3NZIA 1S5SA 3UTUH 3M5OA 4XOJA 4ABJA 1C5QA 3LGIA 1EAUA 2W26A 4CH8B 1HAOH 3RP2A 1PPZA 1ELFA 4Y10E 4A6LA 3HPTB 4WMEA 4B2BA 1TGNA 2PLXA 1CQQA 2ZFPH 2D26C 2BY7X 4M7GA 1P01A 3RXEA 2O8LA 4ABHA 4NIVA 1OWHA 1SGFA 1AFQC 4KTSA 3KF2A 2F9PA 3RXIA 2EI6A 1ZMJA 5LPRA 2VGCC 3NPSA 1BRBE 2B9LA 1EZQA 1O2MA 4ZXYH 3EDXB 2AGIX 1GMDF 2SGEE 5A8ZA 1C5SA 2BXUH 1F0UA 4IS5A 4DY7B 2V3HH 3ENSB 1HGTH 1ESBA 2GZ8A 1GDQA 3ZZ4A 3HK3B 1VITH 3MU0A 3NUMA 4Y8XA 3O8CA 1UTOA 3MI4A 2PGBB 2ZPQA 1GBHA 2SGAA 1GHYH 1HJ9A 1P04A 3ZV8A 4AFSA 3ZZ9A 4FU7A 1ANBA 1NRRH 3Q77A 4VGCC 1VJAU 4WXIA 3OU0A 1MTUA 4CHAB 1GVLA 2GKVE 4FUBA 1P2MA 5FAHA 5F6MA 1K22H 5EQRA 5H4IB 1GBTA 4GAWA 1UK3A 2A4RA 2FP7B 1C2IA 1PQAA 1O5GH 1HAXB 1BTXA 3SV9A 1EPTA 1QB9A 3ZVFA 3TGIE 1G3EA 1UVOA 1P0SH 4O03A 3A8BA 1NN6A 5F8ZA 3IWMA 3LDXH 1OXGA 3OY6U 1SHHB 3ATMA 3RU4D 5HMAA 2AEIH 3O8DA 2WPLS 1RJXB 4X6MA 2VWNA 1QB6A 1O3GA 1CSOE 3F6UH 1GI3A 3UNQA 3SI3H 1TALA 5G4BA 1OP0A 3LT3A 2VWMA 2Q6DA 5JPMH 2HVXA 4ABEA 1GHBF 2R0LA 3S7HB 3A83A 2STBE 1O2PA 1F0SA 1WBGB 1C2EA 2OC1A 3ZYDA 2HNTE 4DG4A 1THPB 2GT8A 2SGDE 1CO7E 2SGPE 2ZECA 3SUGA 3RXFA 4HZHA 2H2ZA 5HGGA 1N6XA 2J2UA 4U2WA 2FX4A 3HKJB 3P92A 1ZPZA 4WF8A 3ATWA 1V2MT 1UTPA 1UTJA 1OWJA 1ELAA 1CHGA 3SV8A 3SU2A 1TBRH 3SJ9A 3ZVAA 4YZUA 3HATH 2QXJA 2Z7FE 3ZVEA 1TPAE 1ZSLA 3TLOA 1W13U 5DPAA 3KQBA 3HKIB 3ZZ5A 2OLGA 4ZH8A 2BLQA 4MPVA 2OQ5A 4YT6H 1AO5A 1HV7A 1HYLA 4NZLA 1GMCF 1TA6A 2FI5E 1YP9A 1TIOA 1XUGA 3QGJA 1L1NA 3FAOA 3ELAH 2FOHA 4LZ1H 2ZC9H 3SJIA 4BTIB 1O34A 2AIQA 2GGVB 4K2YA 1LVYA 1MTWA 2Z3DA 1K1PA 4LXBH 3RXLA 2PR3A 1P2NA 4ABAA 1AUJA 1GJ6A 4SGBE 1XUJA 2C4FH 2QV1A 1O38A 4HI3A 1FY5A 2AERH 4CH2B 1G3DA 1D3TB 1LVOA 1QJ6B 4FUGA 1GHWH 4Q80A 3BEUA 2HRVA 2ZHDA 3M5NA 1KXDA 4AZ2B 2FESH 1O5BB 2FXRA 1AHTH 1E38B 3GCOA 3RXUA 2Y7ZA 1P09A 5DP4A 2H9TH 1HIAA 1LVBA 2F9VA 2ZG0H 2P8OC 2AH4X 5C2ZA 1S6HA 5FBIA 2XCNA 4SGAE 2BZAA 1O3PB 2GZ7A 1Y59T 2BLWA 2HLCA 2VJ1A 3FANA 1ETRH 2BXTH 3LOXA 1WTHD 3AW0A 1PPCE 3RMOH 1P2JA 1D3DB 1NU7B 4GPGA 4JMYA 1HAYB 4UFFH 4NA9H 3PMAB 1JOUB 1QBOA 4UONA 1P10A 1MZAA 4Z6AH 1C5ZB 1GBAA 1BMLA 1TABE 2Z3CA 2ZDKA 5ETXA 1T31A 5K7RA 3KQDA 1O31A 1TX6A 1KSNA 2FS9A 2CN0H 2BD8A 1GL0E 8KME2 1G3CA 2VWLA 1GWAA 1NFXA 1BDAA 2ODQA 1AQ7A 5A0AE 5DP3A 2CHAC 3PV4A 4AB8A 4B74A 7ESTE 1ACBE 1XUIA 1FY8E 2GDDA 2XC5A 3B8JA 1QJ7B 2CV3A 2Z9KA 1RIWC 3AASA 2PFEA 3P8NA 1BHXF 1V2UT 2VIVA 3SUDA 1C1OA 1QQUA 2DE9A 1SPJA 4FUJA 2ZCHP 1NTPA 4WVPE 1QRZA 1ESAA 2UUJB 4F4OC 3TVJB 4GCHF 4B76A 4D7FA 2RA3A 1GBMA 4YO9A 1FDPA 3R3GB 4XBCA 4IN1A 1Z1JA 1A5GH 5AFZH 2FI3E 2ZGJA 1TRMA 1O3NA 1T8NA 1TPPA 2G8TA 1XXDA 5GXPA 3ATIA 4X0WU 1S84A 5J4QA 4Y0YE 1NRSH 3RC4A 1ZMLA 1SGCA 3GDVA 3ZYEA 1MBQA 2V35A 2XBXA 4RKOB 1YPMH 4XSKU 3ODFA 2VVUA 2DUCA 2XCFA 1PFXC 3MU5A 3S7KB 1O0DH 1KXFA 1GJ5H 5EW2H 5AF9H 4OS7A 1DY8A 1Y3WA 1FQ3A 4JZFH 1AKSB 3HGNA 1ZJDA 1ELTA 1ZTKA 1UTKA 1FV9A 3U8RH 1L2EA 1SGTA 1ZHMA 2O8WA 2ZTXA 5EQQA 2Y5FA 2YNAA 3T26A 8GCHG 5HM9A 1PPEE 1TBQH 1O3EA 1B5GH 4INKA 3QX5H 1DOJA 1GMHF 1QJ1B 2OUAA 4Y79A 1NFUA 2BY5X 1XKBC 3C1KA 2D2DA 4Y8ZA 2OC8A 1Y3UA 2J34A 4NG9H 1UO6A 1ZHPA 1QQ4A 2Y5GA 2ZTYA 3RXTA 4FVDA 1O2OA 1J15A 1EAWA 5LH8A 2CJIA 5DP8A 2CF8H 1QNJA 2FDAA 1W0ZU 1C4V2 1FONA 1GDUA 2QCYA 3A8CA 3LIWA 2M5TA 1C5OH 2AMQA 5A8XA 2HWLB 1EZUC 4MPWA 1TRYA 1O3OA 2WPHS 2BDYA 1O3MA 2ZQ1A 1F5LA 1Z8GA 3EA8A 1UHBA 3Q3KA 1TRNA 2Z9IA 1HAPH 3A7XA 2FTLE 4E7NA 1O2IA 2BTCE 1FJSA 4BAMB 4X1QU 3BTDE 1KDQB 2ZIQH 2R3YA 1V2RT 2HALA 1N8OC 1BA8B 1A0LA 1LHCH 4JYTA 3SOSA 3A8AA 1C5VA 1IQGA 5ABWA 2J38A 1O2VA 3A86A 1PYTD 1TFXA 4JCNA 5E0HA 5FCRA 1UTMA 1W7XH 3SORA 3VB4A 2XC4A 1LHGH 4MVNA 1T8OA 5E2OA 1AN1E 1WUNH 4E05H 5EQSA 3BTWE 1GDNA 3DFJA 1F2SE 2FX6A 1O2UA 1ZLRA 1QRXA 1GMDG 1GBKA 2FTMA 4J1YA 1O3IA 3MH5A 3ODDA 4KTUA 1GI9B 1GJ7B 1D9IA 3KL6A 1EPTB 3LPRA 5FX6A 2ODPA 3OTJE 4LZ4B 4B75A 1PPHE 2BX3A 3GCTG 1A2CH 4JZ1A 2P16A 2EA3A 3RUOA 2QAAA 2ZA5A 2LPRA 3SGAE 2SNWA 1SLUB 1D3PB 1FPHH 3H7OA 3TH3H 5DJ7A 4FUIA 2GCTC 2UUFB 2XWAA 3A81A 2AIPA 4BOHA 2ESTE 2OQUA 1T8MA 4A7IB 1GBEA 4X8VH 2ZDAH 3BSQA 2XRCA 1ELBA 2VIWA 2FZZA 2OTVA 3U9AH 1S81A 3M3TA 1RRKA 1Y8TA 3D23A 4NCYA 5DG6A 1MZDA 1H9LB 1QBNA 1RIWB 2JKHA 2FEQH 1SFQB 3ZZDA 4ABFA 4CRGA 1FNIA 4X6PA 3ZVDA 2ZWLH 3RXOA 5E8EH 4GHQA 1FY4A 1O5AB 2V3OH 4UEHH 3ZZ3A 1HFDA 4X8TH 3UPEA 2I6QA 1C5MD 1QA0A 1ID5H 1O2ZA 1A46H 2FLRH 3K6ZA 4TY6A 1CT4E 3PMJA 2A4GA 1K1JA 3MYWA 2ALVA 5EODA 1SLWB 2HNTC 3F9FA 1XKAC 3TJVA 1W2KH 4TYDA 1PPBH 3TPIZ 1N6YA 3ZZBA 2SNVA 2NU0E 2ZO3H 2BDHA 3SUFA 3TU7H 3H7TA 4BXSA 1P2KA 2XC0A 5FHTA 3BN9A 1O3AA 4ISHH 5B6OA 1O3HA 1MKXH 1AUTC 1QTFA 2STAE 3BTQE 3QWCH 4X2YA 4DW2U 1DWEH 1C5XB 2F9BH 5C1YA 4UD9H 2PKAA 2ZDNA 1K1NA 3LU9B 1OWIA 2F83A 1HPGA 1EZSC 1Q31A 1VJ9U 1TLDA 1MTVA 1GG6C 1V2LT 3T2NA 2P59A 2SFAA 1GJAB 3PWCA 3PTBA 4Y71A 1CU1A 5JBBS 2ALPA 4HFPB 1WQVH 4CBNA 1RD3B 2BD9A 1BITA 3LH3A 2ZHWH 1K28D 1DDJA 1TGSZ 1CVWH 2TPIZ 2ZKSA 3MO3A 2NU4E 2FOBA 2VVCA 3E1XB 1GBBA 4AB9A 4B2CA 3I77A 3FP8E 1W8BH 2TRMA 5K0HA 5AFYH 5EW1H 2A7CA 1K1LA 2A5IA 2EI8A 1CHOG 2A32A 1NPMA 4NA8A 4GSOA 3PYHA 1Z6EA 1DVAH 3V7TA 2ANKH 2IJOB 4H42U 1TPOA 1E0FD 5LPFA 2FODA 1KXEA 4O3UA 5BRRE 3K6YA 2YNBA 1RTKA 2XYAA 3H5CB 3P70B 3VXFH 5C67A 4YLQH 1O30A 2G5VA 1C5YB 1FY3A 3TJUA 2PHBA 4A1TA 4ZMAH 2QF0A 2ANWA 4TY7A 3U98H 1TYNA 1X7AC 1ANDA 1JMOH 6GCHF 4X8UH 4J2YB 1WOFA 3E16B 1GVZA 1V2PT 4VGCB 1FLEE 2ZHQH 3GCHB 4XFQA 4CRAA 4Y11E 2BD4A 3RC6A 1ZRBA 1IQLA 3RXBA 4FVBA 2ZFFH 1GBDA 1QR3E 2BOKA 2BZ6H 2ZPSA 3QGNB 2ZF0H 1HXEH 1ZSJA 2VB0A 5EXNA 2ZP0H 4OS2A 3A85A 3UIRA 1KIGH 3UQVA 2K1QA 3A88A 2CXVA 1ELGA 3K9XB 4I7YH 1HRTH 2ZFQH 4KGAA 1MUEB 5GIBA 1FUJA 5FX5A 1GJCB 4JZDH 1YPJH 4DVAU 1BB0B 1GVKB 1TNGA 1SQTA 2A1DB 1LO6A 3OYPA 5E2PA 2ZPRA 1P3CA 3MH4A 3GY7A 4I8GA 2ASUB 1O2RA 3SZNA 1MTNC 5FXLA 1E34B 1TOCB 4K1EA 3LGYA 1OP2A 3VB6A 2JH6D 5IDKA 1PQ5A 3ITIA 4O3TA 2BQWB 2FYRA 3MMGA 4IGDA 1IQEA 9LPRA 1UTLM 2D8WA 4ZHAA 1M9UA 4INHA 2QYIA 5TJXA 1NRNH 1HAGE 3OX7U 4CBOA 1YKTA 1V2OT 3DUXH 4A1VA 1P06A 2FLBH 4QT8C 2ZQ2A 1TNJA 1DT2A 3F9HA 3SU0A 3JZ2B 3MH6A 1SOZA 4CRCA 1TNIA 5JYIA 1AVXA 4ISNA 4ZKRU 2W3KA 5FPSA 3UOPA 5LGOA 2OXSA 1C1WH 1L0ZA 1K1MA 3KHVA 1SFIA 1W12U 1AWFH 1OP8A 1KXCA 1BCUH 1D6RA 2TGPZ 1S83A 1DS2E 1C5UA 1UVPA 3MTYA 4B73A 1FAXA 1GHAG 3L6PA 2ZFTA 5EG4A 1PYTC 4GVUA 1AU8A 4CREA 3F9EA 1QBVH 3DT0H 1MKWH 1LCYA 1VCPA 2BD5A 4UFGH 4ZROA 1ABIH 3SGQE 4MTBA 3SQEE 1DPOA 4NFEA 3SW2B 2AFQB 3RXHA 3M3VA 1DY9A 1SG8B 1DLEA 1ORFA 3A7WA 3U69H 1FMGA 2PKSB 2P94A 1ELCA 2ULLA 1IQKA 1SC8U 1XVOA 1LKBA 1O3DA 1H4WA 3T5FH 5FPTA 4Q7ZA 2RCEA 2UUKB 4IN2A 4K1SA 3UWIA 3A7VA 1W0YH 3GDUA 1ZGVA 2ZU5A 1Y3XA 2RG3A 1TQ0B 1GHAF 3QZQA 3M37A 1IQHA 9ESTA 1C5WB 1CHOF 4DIHH 4TPYA 2TGAA 1H1BA 3EA7A 4FUEA 3FZDA 1WV7H 3R0FA 2I6SA 3V3MA 2SGFE 2A7JA 2NWNA 3SV6A 1ARBA 3EAJA 3IITA 1Y5BT 1P8VC 2OBQA 1IOEA 2ZHEH 4X8SH 1HXFH 1A5IA 3RDZA 2BVRH 1RTLA 1KTSB 3SV2H 3GY5A 2FOAA 3GY8A 4JZEH 2ILNA 1OWKA 1RFNA 3DD2H 1LDTT 1FN6A 2ZHFH 1SQAA 1O3CA 1MD7A 3TK5A 3ZVCA 1Q3XA 5GCHF 1TMTH 4DJZB 2OC7A 4BAHB 2FOCA 4AG2A 1V3XA 2TGTA 1UJ1A 3QTVH 4BNRA 3SU1A 3ZVGA 3S9AA 1BBRE 3QO6A 3SV7A 2W7UA 2BY8X 4B1TA 1DWBH 4THNH 1ELVA 1AB9C 1OWEA 1GI0A 3I78A 5AHGH 3TH4H 2GV6A 1XUFA 1C1VH 1F0RA 3QLPH 1HCGA 5DP9A 4YESB 2BQ7B 3RMMH 2GV7A 4X1NU 2W7SA 3KEEA 3UNSA 3RXCA 3MNXA 3OSYA 4K5ZA 4ZXXH 3VPKA 3TNTA 2PV9B 4KTCA 2SGQE 1QRWA 5DP7A 5DP6A 5CHAC 3P95A 3JZ1B 1BT7A 3BF6H 4LK4A 1NROH 3UFAA 3EA9A 5FPYA 1O2XA 2BDBA 1SMFE 6CHAB 1N1LA 4MQAA 2BYAX 1OWDA 5HM2A 1DSTA 4AORA 5A09A 1QL8A 1HJ8A 4JK5A 4E06H 1XXFA 3MWIU 4ZHLU 2WPJS 2ZDMA 3GOVB 3QN7A 1BBRK 2WUCA 1H8IH 4ASHA 5ESTE 4TWYA 4X6OA 3SU6A 2FYQA 3SNAA 2NU3E 2ZU1A 1MTSA 1FIZA 1JRTA 2ZZUH 5TCCA 5I25A 1G9IE 1NRQH 5GPIB 1SI5H 3PO1B 4DT7B 3V0XA 3F9GA 1GI1A 1O33A 1D3QB 2XNIA 2ZEBA 1C1MA 2XBYA 4WXVA 1XUHA 2PWXA 3MNSA 1UTNA 1YGCH 2H5CA 1EP5A 2H9EH 3ATKA 1UCYH 3SNBA 1VZQH 3TJOA 3A87A 1PPFE 2VIDA 4WMDA 2HPPH 4U01A 4KKDA 2BD7A 3P8GA 1HIAB 7GCHF 1YCPH 4YLUA 3Q76A 1GHZA 1OKXA 1MU8B 3TNSA 1W7GH 3GYLB 4AFQA 1KYNA 8ESTE 3E8LA 1CBWC 2QXIA 4DIIH 4WJG2 5E0JA 2JETC 1CGIE 1K1OA 1ZGIA 1P2QA 3PM3A 1INCA 3U8TH 1J9CH 2R2WU 1LHDH 7GCHG 2G4UA 1GJ4H 1EJNA 2H5DA 2R9PA 2WPKS 1GGDB 2WINI 1AB9B 3AVZA 5I46H 5HXFA 3CS7A 5CHAB 1Z1IA 3O8RA 1TOMH 4UFEH 2P3TB 4YM9A 3FZZA 1JRSA 1Y3VA 2EC9H 5DK1A 1W11U 1GCDA 2HGTH 3BV9B 3M35A 1FY1A 4I8HA 3BTTE 2FWWA 1GPZA 1TPSA 4Z0KA 3RC5A 5C20A 3RU4T 5EXMA 1AVGH 1ZMNA 1ZSKA 2Z9GA 4F49A 1GJ9B 1ZTJA 1Z8JB 3SJ8A 3W95A 1O36A 1ETTH 4K8BA 4JZIA 3A7YA 1SGQE 2C3SA 2R0KA 3GCHC 1EAXA 1C2LA 5F8XA 1HAHH 1P3EA 3MO6A 4IC5A 2AGEX 4XE4A 1UK2A 2CHAB 1FIWA 1TB6H 2QY0B 4XBBA 2GMTC 3RXVA 3S9BA 3LGUA 1HJAC 3DA9B 2BD2A 3P6ZB 3UUZA 4BAQB 3WY8A 4H6TA 2Z3EA 2C8WB 4NIYA 4OS1A 2A45B 2O8UA 1DUAA 3RLYH 2OD3B 2BD3A 4K60A 1ESTA 1Y3YA 5JB9S 1V2QT 3L33A 1CBWB 1MMJN 1T8LA 1C5LH 2ZTZA 3K65B 1GMHG 3QTOH 1C2JA 1QHRB 3BTHE 1AI8H 1IQIA 1YM0A 2B7DH 4MG3A 1IQNA 4JYVH 5GWZA 2ZCKP 1YPHE 1AGJA 1KTTB 3SU4A 1OYTH 1DITH 1LQEA 1GI2A 4BAKB 4ZKSU 1W10U 3M5LA 4ABBA 3NKKA 4B2AA 1V6DA 5CE1A 3PWBA 3M61U 1YCPK 3D65E 3P17H 1K21H 1TGBA 2GZ9A 4XDEA 4ZAEA 3UNRA 5GDSH 4AG1A 4A92A 2BLOA 3EYDA 1G32B 1O2WA 1MBMA 3MH7A 3AW1A 3SU3A 2VIOA 4ZKNU 1UCYE 4Y76A 1F5KU 4I8JA 4RSPA 5C1XA 3GCTF 4NSVA 1PQ7A 2HOBA 2Z9LA 3SNCA 4ISOA 4AYYB 4WY3A 3S69A 2B8OH 2O8MA 1O5FH 1O2JA 3SNDA 1A1RA 1ZYOA 1ZJKA 4FUHA 3EE0B 1O2TA 1EATA 1K2I1 3FVFB 4OS5A 1SOTA 2VVVA 3TGKE 1C1TA 4MNYA 4NIXA 2VNTA 1O5DH 2Y82A 1MKWK 5A0CA 2BDGA 4X2WA 1O2SA 1BUIA 1YLCA 1XUKA 3BG8A 1QL9A 2ZGHA 2J95A 2A2XH 1BZXE 1C5TA 1JWTA 1CA8B 6LPRA 1WYKA 4JK6A 4NSYA 2ODYB 1EUFA 2O9QA 1RTFB 1C2KA 1KY9A 3DHKH 1C1QA 4AFZA 6GCHG 2VIPA 3W94A 4MNWA 2JETB 4XBDA 4AOQA 3MNCA 1GHVH 1KDQA 1T4VH 3QZRA 1YPGH 1XVMA 1HB0B 1O2KA 3GISB 3PLPA 1C2DA 2G81E 2WPIS 3RXRA 1A3BH 1WQSA 2WYGA 4DGJA 2G51A 1G2LA 1HAVB 3RMNH 4RN6A 1OPHB 1Z71A 1A4WH 3BG4C 2OP9A 4MPXA 5PTPA 1WTGH 3CS0A 3SU5A 4H6SB 1S6FA 1VCQA 1C2FA 1BMAA 4GLYA 3SJKA 1BRAA 2VWOA 2ZU4A 1A3EH 1J17T 1EASA 2BY6X 3ZVBA 1Z8IB 5DGJA 1DSUA 1T32A 2F91A 1C5NH 1KLJH 8GCHF 3OY5U 1ZHRA 1SGRE 3PMBB 1C5RA 1D4PB 1BTPA 2Y5HA 1GBIA 1FAKH 2FMJA 3TITA 3M5MA 1LQDB 2XBVA 1V2ST 4Q2KA 1UTQA 3M7UA 2Q6FA 5EU8A 1YLDA 1DFPA 3U1JB 1NRPH 1CE5A 1TQ7B 3MOCA 1TNLA 1E37B 2GX4A 3GDSA 1GI6A 2ZU2A 2G00A 1C9TA 2C8ZB 3A89A 3PROA 3QUMP 1SSXA 2A31A 1TX8A 2CF9H 3ZZ7A 2NU2E 3NXPA 4TWWA 4B71A 1UMAH 1P9UA 2Q6GA 1DX5M 2ZGXH 3N7OA 3U8OH 4X1RU 4UE7H 5EPYA 1O5EH 1L1GA 1GMCG 1AFQB 2GT7A 1CA0B 1BIOA 1LPKB 1RXPA 4D8NA 1H9IE 2GP9B 4GCHG 1OYQA 1JBUH 1UVSH 4X1PU 3A84A 1V2NT 4MNVA 2VGCB 1MQ6A 2TIOA 1AE8H 4H4FA 2UWLA 2FM2A 3PLBA 1GJ8B 3LJJA 1P2OA 2B5TB 5A2MH 2ANYA 2WV4A 4AX9H 2P3UB 1YC0A 1ELEE 2G5NA 3URDA 1L4DA 1QY6A 2GTBA 1L1JA 3GY4A 3LJOA 4FXGH 1VCWA 4DOQA 2GCHF 2P8OB 3B23B 3LH1A 2H6MA 2ANMH 3LKWA 3STJA 3T29A 1YYY1 1AY6H 1EQ9A 2PUXB 4PROA 1NFYA 1B0FA 3E3TA 2BOHB 4GHTA 3SO3A 1LVMA 1Y5AT 1F5RA 2PKAB 3E0NB 4DCDA 3Q3XA 1O3BA 1A0HB 1V2TT 3T28A 1C1NA 2OC0A 3VB3A 2Y80A 1UVUH 1UCYK 4ISIH 2IN2A 1C2GA 4R0IA 4D9QA 2WPMS 4MDSA 5FBEA 4D9RA 4ZKOU 2QF3A 3SJOA 1C9PA 2V6NA 1QURH 2PTCE 3CP7A 5L6NH 2VIQA 4Y7BA 1GHXH 3TGJE 1T4UH 3ZZAA 2GD4B 3MNBA 1EB1H 1W3CA 3NWUA 1U6QA 2YOLA 1SGDE 2FPZA 1VGCB 3BTEE 1IQMA 1TAWA 3V12A 4FUFA 3RMLH 1BRUP 2GVFA 2BB4A 1AFEH 1OSSA 2VU8E 2BM2A 1J14A 1VGCC 3A80A 4IW4E 3ZZ6A 2Z9JA 1N8OB 3G01A 4BANB 2AS9A 3UWJH 1MQ5A 1C1UH 1BRCE 4R8TB 1SR5C 1GBFA 1L4ZA 7LPRA 3C27B 1AWHB 1EP6A 1GGDC 1YF4A 1NO9H 4IC6A 1LMWB 2XWBI 4X2VA 3E6PH 1RS0A 2PW8H 3LONA 3HGPA 1AVWA 2UWOA 3Q3YA 1G37A 1BHXB 1YPHC 4CRFA 2A0QB 3BEIB 1JXPA 4YT7H 5JBAS 2F9UA 2ZGBH 4OGXA 1THRH 3UR6A 1DICA 1AMHA 3SI4H 2CGAA 1ETSH 2BY9X 2DE8A 2JH0D 5T6DA 3SBKA 4WH6A 5EGMA 3RXSA 1MKXK 1OOKB 3ATLA 4X6NA 2P95A 3BG4B 1BMNH
chains in the Genus database with same CATH superfamily
3S0NA 3GYMA 2BDIA 2BQ6B 1ELDE 2ZNKH 3VGCC 5E0GA 1TGTA 4U32A 4Y8YA 5T6FA 3UREA 5A0BA 2H1UA 1BTYA 1NZQH 1O3KA 3RU4E 1ZZZA 1GI4A 1O39A 4I32A 4CRBA 1FZZA 2CK3D 1YPKH 3E0PB 1HAIH 1SB1H 5JBCS 2F3CE 5JDUB 1C4Y2 1EJMA 3RM0H 1TMUH 1JIMA 5C0TA 1KXAA 1GJDB 1SGFG 2EEKA 2B0FA 3TH2H 2G52A 1V2KT 1FPCH 2LELA 1DLKB 1NT1A 1QCPA 1V2WT 1LHFH 1NFWA 5DO4H 1O2YA 1TBZH 3AAUA 2KR7A 2ZFRH 2IPHA 4ABGA 1IQFA 1HJAB 4Q7YA 5BPEA 3UR9A 1C2MA 4FU8A 5T3HA 2QA9E 3TIUA 1AZ8A 1VR1H 1A7SA 1PJPA 4HTCH 3SGBE 3TK6A 2BX4A 3VFEA 3D62A 1ZOMA 1BMMH 1CGJE 1H9HE 5C1UA 3BTKE 1GHBG 1EXFA 1ANCA 1A61H 1BJVA 1O37A 1LHEH 3ZZ8A 2QIQA 1MCVA 1GI7B 1ZR0A 2OBOA 2C90B 4ZCNA 2KAIA 4K1TA 1HDTH 3FFGA 1ANEA 3V13A 2OCVB 2H9HA 3KIDU 1BTZA 1ZPCA 1SLXB 3GY2A 3K2UA 2QGRA 3FOAA 4I8KA 3VEQB 2VH6A 3MU8A 2CMYA 3KN2A 1V2VT 1ZPBA 1GJBB 5ESBA 2HPQH 3LGVA 1LTOA 3A7TA 1S85A 1GBLA 2R3UA 4ABIA 2V0BA 5A8YA 1S82A 1P02A 4E7RG 1E35B 1MCTA 5IK2D 3CNRA 1SLVB 1UK4A 1AIXH 2G4TA 2Z94A 4Y6DA 4YOJA 3SHCH 2R2MB 4OS6A 2FIRH 2TGDA 1G3BA 1SL3A 2A2QH 4OGYA 4JYUH 5GCHG 1C4U2 2PUQH 3BIUH 3SN8A 3ZV9A 2UWPA 1T7CA 1NS3A 1CT2E 3KGPA 2NU1E 1XX9A 1BBRH 1LPZB 2EQNA 2G55A 1MTNB 2WYJA 1TWXB 1HAVA 1EPTC 3TK9A 4DURA 2AYWA 3PTNA 1D6WA 1TNHA 4OS4A 3SQHE 3M36A 2GCTB 2F43B 3DCLA 2FS8A 1AD8H 1YCPM 3GCNA 4O9VA 5EOKA 4ISLA 2BMGB 3M7QA 3UQOA 1YPLH 4IMQA 3PB1E 3STIA 5L2YH 1TA2A 4CR5A 1F0TA 2FO9A 2PKSC 1SGYE 4K69A 1LPGB 2J4IA 4NA7A 5DP5A 1O5CB 5F8TA 1FXYA 2UUYA 3RLWH 2FOMB 1G30B 6ESTA 4YTAA 5J4SA 4K3JA 4NGAH 4ZHMU 7KMEH 1DE7H 1O2NA 2BDAA 3BTGE 2VINA 5JB8S 4AYVB 3LGWA 1QA7A 1E1RD 3A82A 1UHBB 3MU4A 1NBME 2FOFA 2WHXA 3PMHB 4WWYA 4ESTE 2A7HA 2XXLA 2J92A 5CDFE 3I29A 3BTME 3KNXA 3NK8A 3IG6B 1BTHH 1A0JA 3M3SA 2KAIB 2TBSA 5F53A 1YBWA 2ZFSA 3F0OA 4UDWH 5L30H 1RGQA 1FI8A 1UVTH 4GUXA 3NCLA 1J16A 4K8YA 1KMHB 4Y7AA 2Q1JA 2GJGA 1UW7A 3URCA 4ZUHA 1MAXA 2JH5D 3SZEA 1KLTA 1SGIB 1TE0A 4FETA 4X2XA 2C8YB 4ABDA 4YOGA 4AGJA 1HUTH 2GCHG 4O97A 1W14U 1P9SA 1P05A 2RA0A 4AFUA 3BIVH 4B6EA 1GI5A 4FUCA 1TNKA 1MAYA 2ZU3A 3NRLA 3SNEA 3M7TA 2F9NA 3MFJA 3T62A 4RKJB 1C1RA 1BQYA 1SBWA 1TONA 1PQ8A 1NU9A 1G2MA 5C5OA 2FOGA 2A5AA 5KGOA 1GCTB 1GG6B 1NY22 3EQ0H 5EJZA 3LC5A 4MNXA 1PPGE 1SQOA 1BOQA 2BHGA 3GICB 1Q2WA 3F68H 3RM2H 1QZ8A 1JIRA 5GJ4B 2BVXH 4WMFA 4IMZA 1O3JA 4CR9A 2PTNA 1THSH 3KCGH 1TX7A 2XW9A 3Q00A 4MLFB 4A1XA 1G36A 4FU9A 5LPEA 1NC6A 3OEED 5FCKA 1KLIH 3WWFA 1CGHA 1HBTH 5TCAA 6CHAC 2BDCA 2OINA 4Y0ZE 2WV5A 1O3FA 2THFB 2Y81A 1V2JT 2EI7A 1CT0E 3FP7E 2ZDVH 3SHAH 1Z6JH 1FN8A 1SHYA 4I31A 1NM6A 1EKBB 2C8XB 2C93B 1C2HA 1P12E 3OTPA 1C1PA 5EJLA 2QF4A 3RXQA 4A5TS 1O3LA 3QK1A 1QB1A 1DANH 1O2LA 5EXLA 1TGCA 2HNTF 3DFLA 2WUBA 1DUEA 2Y7XA 4F48B 3E90B 3CENA 4D7GA 1EOJA 1SGEE 1DWDH 4IBLH 1GI8B 1C5PA 1IHSH 1HLTH 4NIWA 3PLKA 2BVSH 4CRDA 2ZDLA 4INLA 3PO1C 3TJNA 3VB5A 1VITG 4TPIZ 3E91A 4MPUA 1WSSH 3P8OA 4NZQA 3T27A 4FUDA 4I8LA 3U1IB 3W1EA 3P8FA 1DXWA 3ESTA 2XBWA 2IPQX 3VGCB 1GBJA 2ZI2H 1BTUA 2VH0A 2D1JA 1WU1A 1P57B 1P2IA 2W5EA 5DKMA 3ZIAD 2PSYA 1O2QA 5C3NA 4U30A 2FI4E 4AN7A 3EGKH 1GCTC 4NWKA 1EX3A 1QIXB 2A4OA 2GDEH 1AE5A 1MH0A 5C5NA 4BXWA 3KQEA 4X1SU 1K1IA 1QFKH 3SUEA 1GBCA 5F03A 2Z6BD 1Z8RA 1EFRD 1ABJH 2QXGA 3MU1A 1S0QA 1DWCH 3RXKA 1IQJA 4HG6A 1J8AA 2QXHA 2XTTB 3A8DA 3RXDA 1EZXC 1E36B 1EOLA 1MD8A 4YOIA 1ARCA 1HAZB 2PSXA 1VITF 3LC3A 1BTWA 1IHTH 1O32A 1OS8A 2IOTA 3O8BA 4KP0A 1IAUA 3ZZCA 1LKAA 1DXPA 1AKSA 1O2HA 2QC2A 4NWLA 1XM1A 4HGCA 1TMBH 4WH8A 2J94A 1BJUA 3MHWU 3S9CA 1GL1A 3LGTA 3RXMA 3D49H 3MO9A 1O35A 4D76A 3RXGA 1CA0C 5AVDA 1Z7KA 3RXAA 3B9FH 5T6GA 3VB7A 4BTTB 1YPEH 2F9OA 1OX1A 1SVPA 1EJAA 3VXEH 1B0EA 5EPNA 1EB2A 2LNCA 1A5HA 1ZRKA 2PGQB 2AMPA 4BAOB 2A4QA 2A5KA 5JBTA 2P3FH 3GY3A 4UFDH 3HK6B 1SGNE 3F1SB 3KQCA 1B7XB 3A7ZA 1ZTLA 4NFFA 1MU6B 4KELA 2JDID 1HNEE 1WAYB 1DM4B 2J9NA 1KXBA 1F7ZA 3RXJA 2BLVA 4Q7XA 1W0KD 2FOEA 3UOUA 2AMDA 5SGAE 3BEFB 3RXPA 8LPRA 4BTUB 2W3IA 2VBCA 1H8DH 5HYOA 1K9OE 1Y5UT 3FP6E 2ZCLP 1EAIA 1F92A 3QDZB 3T25A 2RDLA 5HIZA 1QL7A 1XMNB 1QGFA 1NESE 5IYTA 1P11E 3UY9A 1SGPE 2QN5T 1S0RA 3AAVA 1O2GH 4AGKA 1C1SA 5L2ZH 4XD7D 4I33A 2ZGCA 1WCZA 3GY6A 4LOYH 3L3TA 1P03A 1AZZA 2P93A 2GMTB 5CMXH 2O8TA 3BTFE 2AGGX 4CHAC 2Y6TA 3NZIA 1S5SA 3UTUH 3M5OA 4XOJA 4ABJA 1C5QA 3LGIA 1EAUA 2W26A 4CH8B 1HAOH 3RP2A 1PPZA 1ELFA 4Y10E 4A6LA 3HPTB 4WMEA 4B2BA 1TGNA 2PLXA 1CQQA 2ZFPH 2D26C 2BY7X 4M7GA 1P01A 3RXEA 2O8LA 4ABHA 4NIVA 1OWHA 1SGFA 3OAAD 1AFQC 4KTSA 5FL7D 3KF2A 2F9PA 3RXIA 2EI6A 1ZMJA 5LPRA 2VGCC 3NPSA 1BRBE 2B9LA 1EZQA 1O2MA 4ZXYH 3EDXB 2AGIX 1GMDF 2SGEE 3F2FA 5A8ZA 1C5SA 2BXUH 1F0UA 4IS5A 4DY7B 2V3HH 3ENSB 1HGTH 1ESBA 2GZ8A 1GDQA 3ZZ4A 3HK3B 1VITH 3MU0A 3NUMA 4Y8XA 3O8CA 1UTOA 3MI4A 2PGBB 2ZPQA 1GBHA 2SGAA 1GHYH 1HJ9A 1P04A 3ZV8A 4AFSA 3ZZ9A 4FU7A 1ANBA 1NRRH 2WZQA 3Q77A 4VGCC 1VJAU 4WXIA 3OU0A 1MTUA 4CHAB 1GVLA 2GKVE 4FUBA 3FN8A 1P2MA 5FAHA 5F6MA 1K22H 5EQRA 5H4IB 1GBTA 3MQKC 4GAWA 1UK3A 2A4RA 2FP7B 1C2IA 1PQAA 1O5GH 4P02A 1HAXB 1BTXA 3SV9A 1EPTA 1QB9A 3ZVFA 3TGIE 1G3EA 1UVOA 1P0SH 4O03A 3A8BA 1NN6A 5F8ZA 3IWMA 3LDXH 1OXGA 3OY6U 1SHHB 3ATMA 3F0PA 3RU4D 5HMAA 2AEIH 3O8DA 2WPLS 1RJXB 4X6MA 5EJ1A 2VWNA 1QB6A 1O3GA 1CSOE 3F6UH 3F3BA 1E79D 1GI3A 3UNQA 3SI3H 1TALA 5G4BA 1OP0A 3LT3A 2VWMA 2Q6DA 5JPMH 2HVXA 4ABEA 1GHBF 2R0LA 1FX0B 3S7HB 3A83A 2STBE 1O2PA 1F0SA 1WBGB 1C2EA 2OC1A 3ZYDA 2HNTE 4DG4A 1THPB 2GT8A 2SGDE 1CO7E 2SGPE 2ZECA 3SUGA 3RXFA 4HZHA 2H2ZA 5HGGA 1N6XA 2J2UA 4U2WA 2FX4A 3HKJB 3P92A 1ZPZA 4WF8A 3ATWA 1V2MT 1UTPA 2RDEA 1UTJA 1OWJA 1ELAA 4FOUC 1CHGA 3SV8A 3SU2A 1TBRH 3SJ9A 3ZVAA 4YZUA 3HATH 2QXJA 2Z7FE 3ZVEA 1TPAE 1ZSLA 3TLOA 1W13U 5DPAA 3KQBA 3HKIB 3ZZ5A 2OLGA 4ZH8A 2BLQA 4MPVA 2OQ5A 4YT6H 1AO5A 1HV7A 1HYLA 4NZLA 1GMCF 1TA6A 2FI5E 1YP9A 3AK5A 1TIOA 1XUGA 3QGJA 1L1NA 4ACBA 3FAOA 3ELAH 2FOHA 4LZ1H 2ZC9H 3PRDA 3SJIA 2J98A 4BTIB 1O34A 1S6LA 2AIQA 2GGVB 4K2YA 1LVYA 1MTWA 2Z3DA 1K1PA 4LXBH 3RXLA 2PR3A 1P2NA 4ABAA 1AUJA 1GJ6A 4SGBE 1XUJA 2C4FH 2QV1A 1O38A 4HI3A 1FY5A 2AERH 4CH2B 1G3DA 1D3TB 1LVOA 1QJ6B 4FUGA 2KFWA 1GHWH 4Q80A 3BEUA 2HRVA 2ZHDA 3M5NA 1KXDA 4AZ2B 2FESH 1O5BB 2FXRA 1AHTH 1E38B 3GCOA 3RXUA 2Y7ZA 1P09A 5DP4A 2H9TH 1HIAA 1LVBA 2F9VA 2ZG0H 2P8OC 2AH4X 5C2ZA 1S6HA 5FBIA 2XCNA 4SGAE 2BZAA 1O3PB 2GZ7A 1Y59T 2BLWA 2HLCA 2VJ1A 3FANA 1ETRH 2BXTH 3LOXA 1WTHD 3AW0A 1PPCE 3RMOH 1P2JA 1D3DB 1NU7B 4GPGA 4JMYA 1HAYB 4UFFH 4NA9H 3PMAB 1JOUB 1QBOA 4UONA 1P10A 1MZAA 4Z6AH 1C5ZB 1GBAA 1BMLA 1TABE 2Z3CA 2ZDKA 5ETXA 1T31A 5K7RA 3KQDA 1O31A 1TX6A 1KSNA 2FS9A 2CN0H 2BD8A 1GL0E 8KME2 1G3CA 2VWLA 1GWAA 1NFXA 1BDAA 2ODQA 1AQ7A 5A0AE 5DP3A 2CHAC 3PV4A 4AB8A 4B74A 7ESTE 1ACBE 1XUIA 1FY8E 2GDDA 2XC5A 3B8JA 4RT0A 1QJ7B 2CV3A 2Z9KA 3DSOA 1RIWC 1YLNA 3AASA 2PFEA 3P8NA 1BHXF 1V2UT 2VIVA 3PV2A 3SUDA 1C1OA 2KX4A 1QQUA 2DE9A 1SPJA 4FUJA 2ZCHP 1NTPA 4WVPE 1QRZA 1ESAA 2UUJB 4Z1MD 4F4OC 3TVJB 4GCHF 4B76A 4D7FA 2RA3A 1GBMA 4YO9A 1FDPA 3R3GB 4XBCA 4IN1A 1Z1JA 1A5GH 5AFZH 2WV9A 2FI3E 2ZGJA 1TRMA 1O3NA 1T8NA 1TPPA 2G8TA 1XXDA 5GXPA 3ATIA 4RI0A 4X0WU 1S84A 5J4QA 4Y0YE 1NRSH 3RC4A 1ZMLA 1SGCA 3GDVA 3ZYEA 1MBQA 2V35A 2XBXA 4RKOB 1YPMH 4XSKU 3ODFA 2VVUA 2DUCA 2XCFA 1PFXC 3MU5A 3S7KB 1O0DH 1KXFA 1GJ5H 5EW2H 5AF9H 4OS7A 1DY8A 1Y3WA 1FQ3A 3EE7A 4JZFH 1AKSB 3HGNA 1ZJDA 1ELTA 1ZTKA 1UTKA 1FV9A 2L74A 1L2EA 3U8RH 1SGTA 1ZHMA 2O8WA 2ZTXA 5EQQA 2Y5FA 2YNAA 3T26A 8GCHG 5HM9A 1PPEE 1TBQH 1O3EA 1B5GH 4INKA 3QX5H 1DOJA 1GMHF 1QJ1B 2OUAA 4Y79A 1NFUA 2BY5X 1XKBC 3C1KA 2D2DA 4Y8ZA 2OC8A 1Y3UA 2J34A 4NG9H 1UO6A 1ZHPA 1QQ4A 2Y5GA 2ZTYA 3RXTA 4FVDA 1O2OA 1J15A 1EAWA 2J97A 5LH8A 2CJIA 5DP8A 2CF8H 5C17A 1QNJA 2FDAA 1W0ZU 1C4V2 1FONA 1GDUA 2QCYA 3A8CA 3LIWA 2M5TA 1C5OH 2AMQA 5A8XA 2HWLB 1EZUC 4MPWA 1TRYA 1O3OA 2WPHS 2QF5A 2BDYA 1O3MA 2ZQ1A 3PRBA 1F5LA 5HIYA 1Z8GA 3EA8A 1UHBA 3Q3KA 1TRNA 2WPDD 2Z9IA 1HAPH 3A7XA 2FTLE 4E7NA 1O2IA 2BTCE 1FJSA 4BAMB 2K8IA 4X1QU 3BTDE 1KDQB 2ZIQH 2R3YA 1V2RT 2HALA 1N8OC 1BA8B 1A0LA 1LHCH 4JYTA 3SOSA 3A8AA 1C5VA 1IQGA 5ABWA 2J38A 1COWD 1O2VA 3A86A 1PYTD 1TFXA 4JCNA 5E0HA 5FCRA 1UTMA 1W7XH 3OEHD 3SORA 3VB4A 1LHGH 2XC4A 4MVNA 1T8OA 5E2OA 1AN1E 1WUNH 4E05H 5EQSA 3BTWE 1GDNA 3DFJA 1F2SE 2FX6A 4P00A 1O2UA 1ZLRA 1QRXA 1GMDG 1GBKA 2FTMA 4J1YA 1O3IA 3MH5A 3ODDA 4KTUA 1GI9B 1GJ7B 1D9IA 3KL6A 1EPTB 3LPRA 5FX6A 2ODPA 3OTJE 4LZ4B 4B75A 1PPHE 3FKSD 2BX3A 3GCTG 1A2CH 4JZ1A 2P16A 2EA3A 2KCOA 3RUOA 2QAAA 2ZA5A 2LPRA 3SGAE 2SNWA 1SLUB 1D3PB 1FPHH 3H7OA 3TH3H 5DJ7A 4FUIA 2GCTC 2UUFB 2XWAA 3A81A 2AIPA 4BOHA 2ESTE 2OQUA 1T8MA 4A7IB 1GBEA 4X8VH 2ZDAH 3BSQA 2XRCA 1ELBA 2VIWA 2FZZA 2OTVA 3U9AH 1S81A 3M3TA 1RRKA 1Y8TA 3D23A 4NCYA 5DG6A 1MZDA 1H9LB 1QBNA 5EIYA 1RIWB 2JKHA 2FEQH 1SFQB 3ZZDA 4ABFA 4CRGA 1FNIA 4X6PA 3ZVDA 2ZWLH 3RXOA 2L6OA 5E8EH 4GHQA 1FY4A 5B6LA 1O5AB 2V3OH 4UEHH 3ZZ3A 1HFDA 4X8TH 3UPEA 2I6QA 1C5MD 4ASUD 1QA0A 1ID5H 1O2ZA 1A46H 2FLRH 3K6ZA 4TY6A 1CT4E 3PMJA 2A4GA 3FO8D 1K1JA 3MYWA 2ALVA 5EODA 1SLWB 2HNTC 3F9FA 1XKAC 3TJVA 1W2KH 4TYDA 1PPBH 3TPIZ 1N6YA 3ZZBA 1WXRA 2SNVA 2NU0E 2ZO3H 2BDHA 3SUFA 3TU7H 3H7TA 4BXSA 1P2KA 2XC0A 5FHTA 3BN9A 1O3AA 4ISHH 5B6OA 1O3HA 1MKXH 1AUTC 1QTFA 2STAE 3BTQE 3QWCH 4X2YA 4DW2U 1DWEH 1C5XB 2F9BH 5C1YA 4UD9H 2PKAA 2ZDNA 1K1NA 3LU9B 1OWIA 2F83A 1K0HA 1HPGA 1EZSC 1Q31A 1VJ9U 1TLDA 1MTVA 1GG6C 1V2LT 3T2NA 2P59A 2SFAA 1GJAB 3PWCA 3PTBA 4Y71A 1CU1A 5JBBS 3KYGA 2ALPA 4HFPB 1WQVH 4CBNA 2JJ1D 1RD3B 2BD9A 1BITA 3LH3A 2ZHWH 3H09A 1K28D 1DDJA 1TGSZ 1CVWH 2TPIZ 2ZKSA 3MO3A 5CHBA 4F55A 2NU4E 2FOBA 2VVCA 3E1XB 1GBBA 4AB9A 4B2CA 3I77A 3OFND 3FP8E 1W8BH 2TRMA 5K0HA 5AFYH 5EW1H 2A7CA 1K1LA 2A5IA 2EI8A 1CHOG 2A32A 1NPMA 4NA8A 4GSOA 3PYHA 1Z6EA 1DVAH 3V7TA 2ANKH 2IJOB 4H42U 1TPOA 1E0FD 5LPFA 2FODA 1KXEA 4O3UA 5BRRE 3K6YA 2YNBA 1RTKA 2XYAA 3H5CB 3P70B 3VXFH 5C67A 4YLQH 1O30A 2G5VA 1C5YB 1FY3A 3TJUA 2KCPA 2PHBA 4A1TA 4ZMAH 2QF0A 2ANWA 4TY7A 3U98H 1TYNA 1X7AC 1ANDA 1JMOH 6GCHF 4X8UH 4J2YB 1WOFA 3E16B 2OK5A 1GVZA 1V2PT 4VGCB 1FLEE 2ZHQH 3GCHB 4XFQA 4CRAA 4Y11E 2BD4A 3RC6A 1ZRBA 1IQLA 3RXBA 4FVBA 2ZFFH 4XRNA 2RFKC 1GBDA 1QR3E 2BOKA 2BZ6H 2ZPSA 3QGNB 2ZF0H 1HXEH 1ZSJA 2VB0A 5EXNA 2ZP0H 4OS2A 3A85A 3UIRA 1KIGH 3UQVA 2K1QA 3A88A 2CXVA 1ELGA 3K9XB 4I7YH 1HRTH 5KEDA 2ZFQH 4KGAA 1MUEB 5GIBA 3PV5A 1FUJA 5FX5A 1GJCB 4JZDH 1YPJH 4DVAU 1BB0B 2KM0A 1GVKB 1TNGA 2M2AA 1SQTA 2A1DB 1LO6A 2W6JD 3OYPA 5E2PA 2ZPRA 1P3CA 3MH4A 1MABB 4I86A 3GY7A 4I8GA 2ASUB 1O2RA 3SZNA 2EY4C 1MTNC 2WSSD 5FXLA 2KCAA 3U28C 1E34B 1TOCB 4K1EA 3LGYA 1OP2A 3VB6A 2JH6D 5IDKA 1PQ5A 3ITIA 5T1VA 4O3TA 2BQWB 2FYRA 3MMGA 4IGDA 1IQEA 9LPRA 1UTLM 2D8WA 4ZHAA 1M9UA 4INHA 2QYIA 5TJXA 1NRNH 1HAGE 3N7EA 3OX7U 4CBOA 2YMSC 1YKTA 1V2OT 4Q63A 3DUXH 4A1VA 1P06A 2FLBH 4QT8C 2ZQ2A 1TNJA 1DT2A 3F9HA 3SU0A 1W0JD 3JZ2B 3MH6A 1SOZA 4CRCA 1TNIA 5JYIA 1AVXA 4ISNA 4ZKRU 2W3KA 5FPSA 3UOPA 5LGOA 2OXSA 1C1WH 1L0ZA 1K1MA 3KHVA 1SFIA 1W12U 1AWFH 1OP8A 1KXCA 1BCUH 1D6RA 2TGPZ 1S83A 1DS2E 1C5UA 1UVPA 2F4LA 3MTYA 4B73A 1FAXA 1GHAG 3L6PA 3OE7D 2ZFTA 5EG4A 1PYTC 4GVUA 1AU8A 4CREA 2XNDD 3F9EA 1QBVH 3DT0H 1MKWH 1LCYA 1VCPA 2BD5A 4UFGH 4ZROA 1ABIH 3SGQE 4MTBA 3SQEE 1DPOA 4NFEA 3SW2B 2AFQB 3RXHA 3M3VA 1DY9A 1SG8B 1DLEA 1ORFA 3A7WA 3U69H 1FMGA 2PKSB 3VG8A 2P94A 1ELCA 2ULLA 1IQKA 1SC8U 1XVOA 1LKBA 1O3DA 1H4WA 3T5FH 5FPTA 4Q7ZA 2RCEA 2UUKB 4IN2A 4K1SA 3UWIA 3A7VA 1W0YH 3GDUA 1ZGVA 5KECA 2ZU5A 1Y3XA 2RG3A 1TQ0B 1GHAF 3QZQA 3M37A 1IQHA 9ESTA 1H8ED 1C5WB 1CHOF 4DIHH 3KQ5A 4TPYA 2TGAA 1VKYA 1H1BA 3EA7A 4FUEA 3FZDA 1WV7H 3R0FA 2I6SA 3V3MA 2SGFE 2A7JA 2NWNA 3SV6A 3UAIC 1ARBA 1BMFD 3EAJA 3IITA 1Y5BT 1P8VC 2OBQA 1IOEA 2ZHEH 4X8SH 1HXFH 2W6ID 1A5IA 3RDZA 2BVRH 1RTLA 1KTSB 3SV2H 3GY5A 2FOAA 3GY8A 3N7DA 4JZEH 2ILNA 1OWKA 2JIZD 1RFNA 3DD2H 1LDTT 1FN6A 2ZHFH 1SQAA 1O3CA 1MD7A 3TK5A 3ZVCA 1Q3XA 5GCHF 1TMTH 4DJZB 2OC7A 4BAHB 2FOCA 4AG2A 1V3XA 2TGTA 1UJ1A 3QTVH 4BNRA 3SU1A 3ZVGA 1YY3A 3S9AA 1BBRE 3QO6A 3SV7A 2W7UA 2BY8X 4B1TA 1DWBH 4THNH 1ELVA 1AB9C 1OWEA 1GI0A 3I78A 4M9FA 5AHGH 3TH4H 2GV6A 1XUFA 1C1VH 1F0RA 3QLPH 1HCGA 1E1QD 5DP9A 4YESB 2BQ7B 2V7QD 3RMMH 2GV7A 4X1NU 2W7SA 3KEEA 3UNSA 3RXCA 3MNXA 3OSYA 4K5ZA 4ZXXH 3VPKA 3TNTA 2PV9B 4KTCA 2SGQE 1QRWA 5DP7A 1SQRA 5DP6A 5CHAC 3P95A 3JZ1B 1BT7A 3BF6H 4LK4A 1NROH 3UFAA 3EA9A 2KZ4A 5FPYA 1O2XA 2BDBA 4B6FA 4TT3D 1SMFE 6CHAB 2V3MA 1N1LA 4MQAA 2BYAX 1OWDA 5HM2A 1DSTA 4AORA 5A09A 1QL8A 1HJ8A 4JK5A 4E06H 1XXFA 3MWIU 4ZHLU 2WPJS 2ZDMA 3GOVB 3QN7A 1BBRK 2WUCA 1H8IH 4ASHA 5ESTE 4TWYA 4X6OA 3WW7A 3SU6A 2FYQA 3SNAA 2NU3E 2ZU1A 1MTSA 1FIZA 1JRTA 2ZZUH 5TCCA 5I25A 1G9IE 1NRQH 5GPIB 1SI5H 3PO1B 4DT7B 3V0XA 3F9GA 1GI1A 1O33A 1D3QB 2XNIA 2ZEBA 1C1MA 2XBYA 4WXVA 1XUHA 2PWXA 3MNSA 1UTNA 1YGCH 2H5CA 1EP5A 2H9EH 3ATKA 1UCYH 3SNBA 3DSGA 1VZQH 3TJOA 3A87A 1PPFE 2VIDA 4WMDA 2HPPH 4U01A 4KKDA 2BD7A 3P8GA 1HIAB 7GCHF 1YCPH 4YLUA 2J5UA 3Q76A 1GHZA 1OKXA 1MU8B 3TNSA 1W7GH 3GYLB 4AFQA 1KYNA 8ESTE 3E8LA 1CBWC 2QXIA 4DIIH 4WJG2 5E0JA 2JETC 1CGIE 1K1OA 1ZGIA 1P2QA 3PM3A 1INCA 3U8TH 1J9CH 2R2WU 1LHDH 7GCHG 2G4UA 1GJ4H 1EJNA 2H5DA 2R9PA 5HKKD 2WPKS 1GGDB 2WINI 1AB9B 5DN6D 3AVZA 5I46H 5HXFA 3CS7A 5CHAB 1Z1IA 3O8RA 1TOMH 4UFEH 2P3TB 4YM9A 3FZZA 1JRSA 2AHME 1Y3VA 2EC9H 5DK1A 1W11U 1NBMD 1GCDA 2HGTH 3BV9B 3M35A 1FY1A 4I8HA 3BTTE 2FWWA 1GPZA 1TPSA 4Z0KA 3RC5A 5C20A 3RU4T 5EXMA 2KCYA 1AVGH 1ZMNA 1ZSKA 2Z9GA 4F49A 1GJ9B 1ZTJA 1Z8JB 3SJ8A 3W95A 1O36A 1ETTH 4K8BA 4JZIA 3A7YA 1SGQE 2C3SA 2R0KA 3GCHC 1EAXA 1C2LA 5F8XA 1HAHH 1P3EA 3MO6A 4IC5A 2AGEX 4XE4A 1UK2A 2CHAB 1FIWA 1TB6H 2QY0B 4XBBA 2GMTC 3DSPA 3RXVA 3S9BA 3LGUA 1HJAC 3DA9B 2BD2A 3P6ZB 3UUZA 4BAQB 3WY8A 4H6TA 2Z3EA 2C8WB 4NIYA 4OS1A 2A45B 2O8UA 1DUAA 3RLYH 2OD3B 2BD3A 4K60A 1ESTA 1Y3YA 2JJ2D 5JB9S 1V2QT 3L33A 1CBWB 1MMJN 1T8LA 1C5LH 2ZTZA 3K65B 1GMHG 3QTOH 1C2JA 1QHRB 3KYFA 3BTHE 1AI8H 1IQIA 1YM0A 2B7DH 4MG3A 1IQNA 4JYVH 5GWZA 2ZCKP 1YPHE 1AGJA 1KTTB 3SU4A 1OYTH 1DITH 1LQEA 1GI2A 3F2GA 4BAKB 4ZKSU 1W10U 3M5LA 4ABBA 3NKKA 4B2AA 1V6DA 5CE1A 3PWBA 3M61U 1YCPK 3D65E 3P17H 1K21H 1TGBA 2GZ9A 4XDEA 4ZAEA 3UNRA 5GDSH 4AG1A 5DSFA 4A92A 2BLOA 3EYDA 1G32B 1O2WA 1MBMA 3MH7A 3AW1A 3SU3A 2VIOA 4RT1A 4ZKNU 1UCYE 4Y76A 1F5KU 4I8JA 4RSPA 5C1XA 3GCTF 4NSVA 1PQ7A 2HOBA 2Z9LA 3SNCA 4ISOA 4AYYB 4WY3A 3S69A 2B8OH 2O8MA 1O5FH 1O2JA 3SNDA 1A1RA 1ZYOA 3GS9A 1ZJKA 3F2HA 4FUHA 3EE0B 1O2TA 1EATA 1K2I1 3FVFB 5C0UA 4OS5A 1SOTA 2VVVA 3TGKE 1C1TA 4MNYA 4NIXA 2VNTA 1O5DH 2Y82A 1MKWK 4ACAA 1H8HD 5A0CA 2BDGA 4X2WA 1O2SA 1BUIA 1YLCA 1XUKA 3BG8A 1QL9A 2ZGHA 2J95A 2A2XH 1BZXE 1C5TA 1JWTA 1CA8B 6LPRA 1WYKA 4JK6A 4NSYA 2ODYB 1EUFA 2O9QA 1RTFB 1C2KA 1KY9A 3DHKH 1C1QA 4AFZA 6GCHG 1SKYE 2VIPA 3W94A 4MNWA 2JETB 4XBDA 4AOQA 3MNCA 1GHVH 1KDQA 1T4VH 3QZRA 1YPGH 1XVMA 1HB0B 1O2KA 3GISB 3PLPA 1C2DA 2G81E 2WPIS 3RXRA 1A3BH 1WQSA 2WYGA 4DGJA 2G51A 2XOKD 1G2LA 1HAVB 3RMNH 4RN6A 1OPHB 1Z71A 1A4WH 1YWUA 1WDIA 3BG4C 2OP9A 4MPXA 5PTPA 1WTGH 3CS0A 3SU5A 4H6SB 1S6FA 1VCQA 1C2FA 4OM9A 1BMAA 4GLYA 3SJKA 1BRAA 2VWOA 2ZU4A 1A3EH 1J17T 1EASA 2BY6X 3ZVBA 1Z8IB 5DGJA 1DSUA 1T32A 2F91A 1C5NH 1KLJH 8GCHF 3OY5U 1ZHRA 1SGRE 3PMBB 1C5RA 1D4PB 1BTPA 2Y5HA 1GBIA 1FAKH 2FMJA 3TITA 3M5MA 1LQDB 2XBVA 1V2ST 4Q2KA 1UTQA 3M7UA 2Q6FA 5EU8A 1YLDA 4Q4LA 1DFPA 3U1JB 1NRPH 2J98B 1CE5A 1TQ7B 3MOCA 1TNLA 1E37B 2GX4A 3GDSA 1GI6A 2ZU2A 2G00A 1C9TA 2C8ZB 2HVYB 3A89A 3PROA 3QUMP 1SSXA 2A31A 1TX8A 2CF9H 3ZZ7A 2NU2E 3NXPA 4TWWA 4B71A 1UMAH 1P9UA 2Q6GA 1DX5M 2ZGXH 3N7OA 3U8OH 4X1RU 4UE7H 5EPYA 1O5EH 1L1GA 1GMCG 1AFQB 2GT7A 1CA0B 1BIOA 1LPKB 2QE7D 1RXPA 4D8NA 1H9IE 2GP9B 4GCHG 1OYQA 1JBUH 1UVSH 4X1PU 3A84A 1V2NT 4MNVA 1MQ6A 2TIOA 2VGCB 1AE8H 4H4FA 2UWLA 2FM2A 3PLBA 1GJ8B 4AC9A 3LJJA 1P2OA 2B5TB 5A2MH 4TSFD 2ANYA 2WV4A 4AX9H 2P3UB 1YC0A 1ELEE 2G5NA 3URDA 1L4DA 1QY6A 2GTBA 1L1JA 3GY4A 3LJOA 4FXGH 1VCWA 4DOQA 2GCHF 2P8OB 3B23B 5GNDA 3LH1A 3WWBA 2H6MA 2ANMH 3LKWA 3STJA 3T29A 1YYY1 1AY6H 1EQ9A 2PUXB 4PROA 2YMSB 1NFYA 1B0FA 3E3TA 2BOHB 4GHTA 3SO3A 1LVMA 1Y5AT 1F5RA 2PKAB 3E0NB 4DCDA 3Q3XA 1O3BA 1OHHD 1A0HB 1V2TT 3T28A 1C1NA 2OC0A 3VB3A 2Y80A 1UVUH 1UCYK 4ISIH 2IN2A 1C2GA 4R0IA 4D9QA 2WPMS 4MDSA 5FBEA 4D9RA 4ZKOU 2QF3A 3SJOA 1C9PA 2V6NA 1QURH 2PTCE 4YXWD 3CP7A 5L6NH 2VIQA 4Y7BA 1GHXH 3TGJE 2YMSD 1T4UH 3ZZAA 2GD4B 3MNBA 1EB1H 1W3CA 3NWUA 1U6QA 2YOLA 1SGDE 2K0QA 2FPZA 5C94A 1VGCB 3BTEE 1IQMA 1TAWA 3V12A 4FUFA 3RMLH 1BRUP 2GVFA 2BB4A 1AFEH 1OSSA 2VU8E 2BM2A 1J14A 1VGCC 3A80A 4IW4E 3ZZ6A 3UB0A 2Z9JA 3N99A 1N8OB 3G01A 4BANB 2AS9A 3UWJH 1MQ5A 1C1UH 1BRCE 4R8TB 1SR5C 1GBFA 1L4ZA 7LPRA 3C27B 1AWHB 1EP6A 1GGDC 1YF4A 1NO9H 4IC6A 1LMWB 2XWBI 4X2VA 2HLDD 3E6PH 1RS0A 2PW8H 3LONA 3HGPA 1AVWA 2UWOA 3Q3YA 1G37A 1BHXB 1YPHC 4CRFA 3SYJA 2A0QB 4DT4A 3BEIB 1JXPA 4YT7H 5JBAS 2F9UA 2ZGBH 4OGXA 1THRH 3UR6A 1DICA 2LP6A 1AMHA 3SI4H 2CGAA 1ETSH 2BY9X 2DE8A 2JH0D 5T6DA 3SBKA 4WH6A 5EGMA 3RXSA 1MKXK 1OOKB 3ATLA 4X6NA 2P95A 2PP6A 3BG4B 2IJD1 1BMNH
chains in the Genus database with same CATH topology
3S0NA 3GYMA 2BDIA 2BQ6B 1ELDE 2ZNKH 3VGCC 5E0GA 1TGTA 4U32A 4Y8YA 5T6FA 3UREA 5A0BA 2H1UA 1BTYA 1NZQH 1O3KA 3RU4E 1ZZZA 1GI4A 1O39A 4I32A 4CRBA 1FZZA 1YPKH 3E0PB 1HAIH 1SB1H 5JBCS 2F3CE 5JDUB 1C4Y2 1EJMA 3RM0H 1TMUH 1JIMA 1KXAA 1GJDB 1SGFG 2EEKA 2B0FA 3TH2H 2G52A 1V2KT 1FPCH 1DLKB 1NT1A 1QCPA 1V2WT 1LHFH 1NFWA 5DO4H 1O2YA 1TBZH 3AAUA 2ZFRH 2IPHA 4ABGA 1IQFA 1HJAB 4Q7YA 5BPEA 3UR9A 1C2MA 4FU8A 5T3HA 2QA9E 3TIUA 1AZ8A 1VR1H 1A7SA 1PJPA 4HTCH 3SGBE 3TK6A 2BX4A 3VFEA 3D62A 1ZOMA 1BMMH 1CGJE 1H9HE 5C1UA 3BTKE 1GHBG 1EXFA 1ANCA 1A61H 1BJVA 1O37A 1LHEH 3ZZ8A 2QIQA 1MCVA 1GI7B 1ZR0A 2OBOA 2C90B 2KAIA 4K1TA 1HDTH 3FFGA 1ANEA 3V13A 2OCVB 2H9HA 3KIDU 1BTZA 1ZPCA 1SLXB 3GY2A 3K2UA 2QGRA 4I8KA 3VEQB 2VH6A 3MU8A 2CMYA 3KN2A 1V2VT 1ZPBA 1GJBB 5ESBA 2HPQH 3LGVA 1LTOA 3A7TA 1S85A 1GBLA 2R3UA 4ABIA 2V0BA 5A8YA 1S82A 1P02A 4E7RG 1E35B 1MCTA 1SLVB 1UK4A 1AIXH 2G4TA 2Z94A 4Y6DA 4YOJA 3SHCH 2R2MB 4OS6A 2FIRH 2TGDA 1G3BA 1SL3A 2A2QH 4OGYA 4JYUH 5GCHG 1C4U2 2PUQH 3BIUH 3SN8A 3ZV9A 2UWPA 1T7CA 1NS3A 1CT2E 3KGPA 2NU1E 1XX9A 1BBRH 1LPZB 2G55A 1MTNB 2WYJA 1TWXB 1HAVA 1EPTC 3TK9A 4DURA 2AYWA 3PTNA 1D6WA 1TNHA 4OS4A 3SQHE 3M36A 2GCTB 2FS8A 1AD8H 1YCPM 3GCNA 4O9VA 5EOKA 4ISLA 2BMGB 3M7QA 3UQOA 1YPLH 4IMQA 3PB1E 3STIA 5L2YH 1TA2A 4CR5A 1F0TA 2FO9A 2PKSC 1SGYE 4K69A 1LPGB 2J4IA 4NA7A 5DP5A 1O5CB 5F8TA 1FXYA 2UUYA 3RLWH 2FOMB 1G30B 6ESTA 4YTAA 5J4SA 4K3JA 4NGAH 4ZHMU 7KMEH 1DE7H 1O2NA 2BDAA 3BTGE 2VINA 5JB8S 4AYVB 3LGWA 1QA7A 3A82A 1UHBB 3MU4A 2FOFA 4WWYA 3PMHB 4ESTE 2A7HA 2XXLA 2J92A 3I29A 3BTME 3KNXA 3NK8A 3IG6B 1BTHH 1A0JA 3M3SA 2KAIB 2TBSA 1YBWA 2ZFSA 5L30H 4UDWH 1RGQA 1FI8A 1UVTH 4GUXA 3NCLA 1J16A 4K8YA 4Y7AA 2Q1JA 3URCA 4ZUHA 1MAXA 2JH5D 1KLTA 1SGIB 1TE0A 4X2XA 2C8YB 4ABDA 4YOGA 4AGJA 1HUTH 2GCHG 4O97A 1W14U 1P9SA 1P05A 2RA0A 4AFUA 3BIVH 1GI5A 4FUCA 1TNKA 1MAYA 2ZU3A 3SNEA 3M7TA 2F9NA 3MFJA 3T62A 4RKJB 1C1RA 1BQYA 1SBWA 1TONA 1PQ8A 1NU9A 1G2MA 5C5OA 2FOGA 2A5AA 1GCTB 1GG6B 1NY22 3EQ0H 3LC5A 4MNXA 1PPGE 1SQOA 1BOQA 2BHGA 3GICB 1Q2WA 3F68H 3RM2H 1JIRA 5GJ4B 2BVXH 4WMFA 4IMZA 1O3JA 4CR9A 2PTNA 1THSH 3KCGH 1TX7A 2XW9A 3Q00A 4MLFB 4A1XA 1G36A 4FU9A 5LPEA 1NC6A 5FCKA 1KLIH 1CGHA 1HBTH 5TCAA 6CHAC 2BDCA 2OINA 4Y0ZE 2WV5A 1O3FA 2THFB 2Y81A 1V2JT 2EI7A 1CT0E 3FP7E 2ZDVH 3SHAH 1Z6JH 1FN8A 1SHYA 4I31A 1NM6A 1EKBB 2C8XB 2C93B 1C2HA 1P12E 1C1PA 3RXQA 4A5TS 1O3LA 3QK1A 1QB1A 1DANH 1O2LA 5EXLA 1TGCA 2HNTF 3DFLA 2WUBA 1DUEA 2Y7XA 3E90B 3CENA 4D7GA 1EOJA 1SGEE 1DWDH 4IBLH 1GI8B 1C5PA 1IHSH 1HLTH 4NIWA 3PLKA 2BVSH 4CRDA 2ZDLA 4INLA 3PO1C 3TJNA 3VB5A 1VITG 4TPIZ 3E91A 4MPUA 1WSSH 3P8OA 4NZQA 3T27A 4FUDA 4I8LA 3U1IB 3P8FA 1DXWA 3ESTA 2XBWA 3VGCB 1GBJA 2ZI2H 1BTUA 2VH0A 2D1JA 1WU1A 1P57B 1P2IA 2W5EA 5DKMA 2PSYA 1O2QA 5C3NA 4U30A 2FI4E 4AN7A 3EGKH 1GCTC 4NWKA 1EX3A 1QIXB 2A4OA 2GDEH 1AE5A 1MH0A 5C5NA 4BXWA 3KQEA 4X1SU 1K1IA 1QFKH 3SUEA 1GBCA 5F03A 2Z6BD 1Z8RA 1ABJH 2QXGA 3MU1A 1S0QA 1DWCH 3RXKA 1IQJA 1J8AA 2QXHA 2XTTB 3A8DA 3RXDA 1EZXC 1E36B 1EOLA 1MD8A 4YOIA 1ARCA 1HAZB 2PSXA 1VITF 3LC3A 1BTWA 1IHTH 1O32A 1OS8A 2IOTA 3O8BA 4KP0A 1IAUA 3ZZCA 1LKAA 1DXPA 1AKSA 1O2HA 2QC2A 4NWLA 1XM1A 4HGCA 1TMBH 4WH8A 2J94A 1BJUA 3MHWU 3S9CA 1GL1A 3LGTA 3RXMA 3D49H 3MO9A 1O35A 4D76A 3RXGA 1CA0C 5AVDA 1Z7KA 3RXAA 3B9FH 5T6GA 3VB7A 4BTTB 1YPEH 2F9OA 1OX1A 1SVPA 1EJAA 3VXEH 1B0EA 5EPNA 1EB2A 2LNCA 1A5HA 1ZRKA 2PGQB 2AMPA 4BAOB 2A4QA 2A5KA 5JBTA 2P3FH 3GY3A 4UFDH 3HK6B 1SGNE 3F1SB 3KQCA 1B7XB 3A7ZA 1ZTLA 4NFFA 1MU6B 4KELA 1HNEE 1WAYB 1DM4B 2J9NA 1KXBA 1F7ZA 3RXJA 2BLVA 4Q7XA 2FOEA 3UOUA 2AMDA 5SGAE 3BEFB 3RXPA 8LPRA 4BTUB 2W3IA 1H8DH 5HYOA 1K9OE 1Y5UT 3FP6E 2ZCLP 1EAIA 1F92A 3QDZB 3T25A 2RDLA 1QL7A 1XMNB 1QGFA 1NESE 5IYTA 1P11E 3UY9A 1SGPE 2QN5T 1S0RA 3AAVA 1O2GH 4AGKA 1C1SA 5L2ZH 4I33A 2ZGCA 1WCZA 3GY6A 4LOYH 3L3TA 1P03A 1AZZA 2P93A 2GMTB 5CMXH 2O8TA 3BTFE 2AGGX 4CHAC 2Y6TA 3NZIA 1S5SA 3UTUH 3M5OA 4XOJA 4ABJA 1C5QA 3LGIA 1EAUA 2W26A 4CH8B 1HAOH 3RP2A 1PPZA 1ELFA 4Y10E 4A6LA 3HPTB 4WMEA 4B2BA 1TGNA 2PLXA 1CQQA 2ZFPH 2D26C 2BY7X 4M7GA 1P01A 3RXEA 2O8LA 4ABHA 4NIVA 1OWHA 1SGFA 1AFQC 4KTSA 3KF2A 2F9PA 3RXIA 2EI6A 1ZMJA 5LPRA 2VGCC 3NPSA 1BRBE 2B9LA 1EZQA 1O2MA 4ZXYH 3EDXB 2AGIX 1GMDF 2SGEE 5A8ZA 1C5SA 2BXUH 1F0UA 4IS5A 4DY7B 2V3HH 3ENSB 1HGTH 1ESBA 2GZ8A 1GDQA 3ZZ4A 3HK3B 1VITH 3MU0A 3NUMA 4Y8XA 3O8CA 1UTOA 3MI4A 2PGBB 2ZPQA 1GBHA 2SGAA 1GHYH 1HJ9A 1P04A 3ZV8A 4AFSA 3ZZ9A 4FU7A 1ANBA 1NRRH 3Q77A 4VGCC 1VJAU 4WXIA 3OU0A 1MTUA 4CHAB 1GVLA 2GKVE 4FUBA 1P2MA 5FAHA 5F6MA 1K22H 5EQRA 5H4IB 1GBTA 4GAWA 1UK3A 2A4RA 2FP7B 1C2IA 1PQAA 1O5GH 1HAXB 1BTXA 3SV9A 1EPTA 1QB9A 3ZVFA 3TGIE 1G3EA 1UVOA 1P0SH 4O03A 3A8BA 1NN6A 5F8ZA 3IWMA 3LDXH 1OXGA 3OY6U 1SHHB 3ATMA 3RU4D 5HMAA 2AEIH 3O8DA 2WPLS 1RJXB 4X6MA 2VWNA 1QB6A 1O3GA 1CSOE 3F6UH 1GI3A 3UNQA 3SI3H 1TALA 5G4BA 1OP0A 3LT3A 2VWMA 2Q6DA 5JPMH 2HVXA 4ABEA 1GHBF 2R0LA 3S7HB 3A83A 2STBE 1O2PA 1F0SA 1WBGB 1C2EA 2OC1A 3ZYDA 2HNTE 4DG4A 1THPB 2GT8A 2SGDE 1CO7E 2SGPE 2ZECA 3SUGA 3RXFA 4HZHA 2H2ZA 5HGGA 1N6XA 2J2UA 4U2WA 2FX4A 3HKJB 3P92A 1ZPZA 4WF8A 3ATWA 1V2MT 1UTPA 1UTJA 1OWJA 1ELAA 1CHGA 3SV8A 3SU2A 1TBRH 3SJ9A 3ZVAA 4YZUA 3HATH 2QXJA 2Z7FE 3ZVEA 1TPAE 1ZSLA 3TLOA 1W13U 5DPAA 3KQBA 3HKIB 3ZZ5A 2OLGA 4ZH8A 2BLQA 4MPVA 2OQ5A 4YT6H 1AO5A 1HV7A 1HYLA 4NZLA 1GMCF 1TA6A 2FI5E 1YP9A 1TIOA 1XUGA 3QGJA 1L1NA 3FAOA 3ELAH 2FOHA 4LZ1H 2ZC9H 3SJIA 4BTIB 1O34A 2AIQA 2GGVB 4K2YA 1LVYA 1MTWA 2Z3DA 1K1PA 4LXBH 3RXLA 2PR3A 1P2NA 4ABAA 1AUJA 1GJ6A 4SGBE 1XUJA 2C4FH 2QV1A 1O38A 4HI3A 1FY5A 2AERH 4CH2B 1G3DA 1D3TB 1LVOA 1QJ6B 4FUGA 1GHWH 4Q80A 3BEUA 2HRVA 2ZHDA 3M5NA 1KXDA 4AZ2B 2FESH 1O5BB 2FXRA 1AHTH 1E38B 3GCOA 3RXUA 2Y7ZA 1P09A 5DP4A 2H9TH 1HIAA 1LVBA 2F9VA 2ZG0H 2P8OC 2AH4X 5C2ZA 1S6HA 5FBIA 2XCNA 4SGAE 2BZAA 1O3PB 2GZ7A 1Y59T 2BLWA 2HLCA 2VJ1A 3FANA 1ETRH 2BXTH 3LOXA 1WTHD 3AW0A 1PPCE 3RMOH 1P2JA 1D3DB 1NU7B 4GPGA 4JMYA 1HAYB 4UFFH 4NA9H 3PMAB 1JOUB 1QBOA 4UONA 1P10A 1MZAA 4Z6AH 1C5ZB 1GBAA 1BMLA 1TABE 2Z3CA 2ZDKA 5ETXA 1T31A 5K7RA 3KQDA 1O31A 1TX6A 1KSNA 2FS9A 2CN0H 2BD8A 1GL0E 8KME2 1G3CA 2VWLA 1GWAA 1NFXA 1BDAA 2ODQA 1AQ7A 5A0AE 5DP3A 2CHAC 3PV4A 4AB8A 4B74A 7ESTE 1ACBE 1XUIA 1FY8E 2GDDA 2XC5A 3B8JA 1QJ7B 2CV3A 2Z9KA 1RIWC 3AASA 2PFEA 3P8NA 1BHXF 1V2UT 2VIVA 3SUDA 1C1OA 1QQUA 2DE9A 1SPJA 4FUJA 2ZCHP 1NTPA 4WVPE 1QRZA 1ESAA 2UUJB 4F4OC 3TVJB 4GCHF 4B76A 4D7FA 2RA3A 1GBMA 4YO9A 1FDPA 3R3GB 4XBCA 4IN1A 1Z1JA 1A5GH 5AFZH 2FI3E 2ZGJA 1TRMA 1O3NA 1T8NA 1TPPA 2G8TA 1XXDA 5GXPA 3ATIA 4X0WU 1S84A 5J4QA 4Y0YE 1NRSH 3RC4A 1ZMLA 1SGCA 3GDVA 3ZYEA 1MBQA 2V35A 2XBXA 4RKOB 1YPMH 4XSKU 3ODFA 2VVUA 2DUCA 2XCFA 1PFXC 3MU5A 3S7KB 1O0DH 1KXFA 1GJ5H 5EW2H 5AF9H 4OS7A 1DY8A 1Y3WA 1FQ3A 4JZFH 1AKSB 3HGNA 1ZJDA 1ELTA 1ZTKA 1UTKA 1FV9A 3U8RH 1L2EA 1SGTA 1ZHMA 2O8WA 2ZTXA 5EQQA 2Y5FA 2YNAA 3T26A 8GCHG 5HM9A 1PPEE 1TBQH 1O3EA 1B5GH 4INKA 3QX5H 1DOJA 1GMHF 1QJ1B 2OUAA 4Y79A 1NFUA 2BY5X 1XKBC 3C1KA 2D2DA 4Y8ZA 2OC8A 1Y3UA 2J34A 4NG9H 1UO6A 1ZHPA 1QQ4A 2Y5GA 2ZTYA 3RXTA 4FVDA 1O2OA 1J15A 1EAWA 5LH8A 2CJIA 5DP8A 2CF8H 1QNJA 2FDAA 1W0ZU 1C4V2 1FONA 1GDUA 2QCYA 3A8CA 3LIWA 2M5TA 1C5OH 2AMQA 5A8XA 2HWLB 1EZUC 4MPWA 1TRYA 1O3OA 2WPHS 2BDYA 1O3MA 2ZQ1A 1F5LA 1Z8GA 3EA8A 1UHBA 3Q3KA 1TRNA 2Z9IA 1HAPH 3A7XA 2FTLE 4E7NA 1O2IA 2BTCE 1FJSA 4BAMB 4X1QU 3BTDE 1KDQB 2ZIQH 2R3YA 1V2RT 2HALA 1N8OC 1BA8B 1A0LA 1LHCH 4JYTA 3SOSA 3A8AA 1C5VA 1IQGA 5ABWA 2J38A 1O2VA 3A86A 1PYTD 1TFXA 4JCNA 5E0HA 5FCRA 1UTMA 1W7XH 3SORA 3VB4A 2XC4A 1LHGH 4MVNA 1T8OA 5E2OA 1AN1E 1WUNH 4E05H 5EQSA 3BTWE 1GDNA 3DFJA 1F2SE 2FX6A 1O2UA 1ZLRA 1QRXA 1GMDG 1GBKA 2FTMA 4J1YA 1O3IA 3MH5A 3ODDA 4KTUA 1GI9B 1GJ7B 1D9IA 3KL6A 1EPTB 3LPRA 5FX6A 2ODPA 3OTJE 4LZ4B 4B75A 1PPHE 2BX3A 3GCTG 1A2CH 4JZ1A 2P16A 2EA3A 3RUOA 2QAAA 2ZA5A 2LPRA 3SGAE 2SNWA 1SLUB 1D3PB 1FPHH 3H7OA 3TH3H 5DJ7A 4FUIA 2GCTC 2UUFB 2XWAA 3A81A 2AIPA 4BOHA 2ESTE 2OQUA 1T8MA 4A7IB 1GBEA 4X8VH 2ZDAH 3BSQA 2XRCA 1ELBA 2VIW