1MBQA

Anionic trypsin from pacific chum salmon
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
220
structure length
220
Chain Sequence
IVGGYECKAYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKSATLNTYVQPVALPSSCAPAGTMCTVSGWGNTMSSTADKNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Nucleotide Sequence of an Anionic Trypsin from Chum Salmon (Oncorhynchus keta) in Comparison with Atlantic Salmon (Salmo salar) and Bovine Trypsin
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords Trypsin
total genus 51
structure length 220
sequence length 220
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2002-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mbqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mbqA02
3EA9A 4O3TA 3E1XB 1G37A 1E0FD 4BXSA 2ZO3H 3RLWH 3UY9A 1K28D 2QV1A 3F1SB 2FOAA 3PWBA 1C1MA 5EPYA 4X8SH 1F7ZA 3TU7H 4HI3A 2A2XH 1AHTH 5DKMA 2PSYA 4M7GA 2OC0A 1ELEE 1SGCA 4Y8YA 3MH4A 3T25A 5F8TA 1DLKB 1C5LH 2FX6A 1GG6C 1QR3E 1T8MA 1WSSH 1C1UH 1C5PA 2Y6TA 1P2OA 1PPBH 3AW0A 3T28A 2BLOA 1TNJA 3FVFB 4BTUB 3B9FH 1A0JA 3SUFA 1OWEA 3QZQA 1MTNB 5DP5A 3PLKA 2CJIA 2PFEA 3KQDA 1PQ7A 2HALA 2ZWLH 1YC0A 2P95A 2R2WU 2TGPZ 3OU0A 4GSOA 1K1OA 2Y82A 2GT8A 3M5LA 1CA0B 1GJDB 3MH7A 4CRAA 3ZV9A 2BQWB 3BTME 1XUJA 3CS7A 3MH5A 4CHAB 4DW2U 1AGJA 2P3TB 2Z9LA 3MU1A 3E0NB 1C1QA 3RXHA 1AFEH 1SL3A 1SVPA 5AVDA 2BQ6B 3OTJE 1LVOA 2W26A 3ODDA 1N1LA 4A92A 1ZRBA 3QGNB 5E2PA 4AYVB 1TA2A 1O34A 4Y10E 5DP9A 3UWIA 1LHEH 1P2KA 1QB1A 3T26A 1V6DA 3AAVA 1CGJE 2W3IA 1CA0C 4WH6A 1L0ZA 1F0RA 4X2VA 1UK4A 1PPCE 2WYGA 1SFIA 3VFEA 1SGEE 1YLDA 1GI1A 1HPGA 4J1YA 3B8JA 1CE5A 3RMOH 2D26C 5EXLA 1O2XA 2VIWA 1A3BH 1FONA 1LPKB 1QL7A 4MG3A 5FXLA 1G32B 1O2RA 2GV7A 1CT2E 2HGTH 2VJ1A 2ZA5A 3AAUA 1XVMA 3T2NA 1Q3XA 4BAHB 4Y76A 5F8ZA 1C2FA 1GBKA 1HV7A 1SLVB 2QC2A 1AE5A 1INCA 1HJ9A 3O8DA 3Q3KA 3S9AA 1FLEE 4ZH8A 2OC7A 1O2WA 4ISHH 1L2EA 3HATH 3RXJA 1LPZB 1Y59T 4KTCA 1ZGVA 3TK5A 1PJPA 1TMTH 2B9LA 1M9UA 5AFZH 1MKXH 4KTUA 1HJAB 3F9GA 2ZGJA 4FU8A 3SJOA 1TBRH 3F9EA 1DXWA 4XBBA 1SLWB 3C27B 2OINA 3RXSA 3T29A 3BG4B 1O2OA 3LOXA 4ABAA 1DANH 1UTOA 1Q2WA 2WPKS 3GY7A 1GBLA 3B23B 1BB0B 1C1RA 3KEEA 3TIUA 3RLYH 3FZDA 2G8TA 3VB4A 1TOCB 6CHAC 1Z1JA 2O8LA 1SGFA 1MQ5A 3SORA 1O2LA 5DPAA 8KME2 3M7QA 1GBTA 1PFXC 1VGCC 4O3UA 1E35B 2C4FH 1MH0A 4OS4A 4ZKOU 4X1PU 4ZAEA 1THRH 3SV2H 1Y3UA 4AN7A 1QJ6B 5L6NH 4FUHA 1IQNA 1JWTA 2J95A 1BCUH 1D9IA 2ZZUH 2THFB 2DE9A 1RJXB 1SI5H 4CBNA 1O2PA 1V2PT 3U1JB 1LTOA 2Q6FA 1J8AA 1NFUA 2RG3A 1HB0B 1Z7KA 3RXEA 2H1UA 1VITF 1DY8A 1Y3WA 1YPMH 2DUCA 4Y11E 2BD7A 3RU4E 2CHAB 4CH2B 3GDUA 3ZZ9A 2LPRA 3PMAB 1XUKA 2WPMS 4NA9H 2PWXA 3IG6B 2F9OA 2O8MA 1H8DH 5CHAB 4J2YB 1O30A 2BHGA 1XKBC 1QRZA 5JB9S 2FTLE 3FAOA 1PYTC 1IOEA 2UUYA 2BDHA 3EDXB 3TJNA 1VITH 4ABFA 2GV6A 2F9UA 2BMGB 1OP0A 5AFYH 3A7VA 1BRBE 4I31A 2ANWA 2QA9E 2H9TH 1C1WH 5EQSA 1P3EA 3LH3A 8LPRA 4MVNA 2XWBI 1D6WA 1NU9A 3GDSA 2AGEX 1YCPM 4WXVA 4AFSA 2BM2A 2CN0H 2A7HA 3S9CA 4IN1A 4WVPE 5LPRA 3VGCC 7ESTE 2QN5T 2ZDKA 4I33A 2VVVA 2O8TA 1EPTA 4TPIZ 1ELBA 2VGCB 5C5NA 3LJOA 3H7OA 4TWWA 1BJUA 3FZZA 3DD2H 3GYMA 1UHBB 2ZFTA 4FUEA 1NRPH 4X8VH 3LGWA 1C5ZB 5AHGH 2FPZA 2VIPA 1QY6A 1UHBA 5A8XA 4ZMAH 4BAMB 1ZMNA 2V6NA 3UFAA 1KLIH 1ZSJA 3VB3A 4X2WA 3RXLA 3LGVA 3ZYEA 2J2UA 1O2HA 4NFFA 2OC1A 2VH0A 3LGIA 3GY2A 3L33A 1C2LA 4B71A 1HXFH 2ZU5A 8GCHG 2PTCE 2BVXH 1A5GH 5HGGA 4VGCC 1S82A 2F9NA 3M5NA 5E2OA 4DCDA 1MKWK 3PWCA 1H9LB 1GHWH 5EOKA 4D8NA 1DUEA 2A5KA 3KL6A 3MWIU 1KLTA 2F91A 1AU8A 3ATWA 3URDA 2HRVA 2AFQB 2YNBA 2BLQA 4I8KA 4JMYA 2GZ8A 5GJ4B 1TOMH 4B2BA 4XE4A 4H42U 1NFWA 3GICB 3SJ9A 2BD8A 3ZVFA 2ZQ1A 1WCZA 3ATIA 3BSQA 3PYHA 1A46H 1HAXB 3RXGA 1GDNA 2ZFFH 4HZHA 2H9EH 2BDCA 1YCPK 1D3PB 4VGCB 2SGPE 2Y5FA 1OP8A 5FX6A 1OX1A 3TH3H 1O5CB 4DY7B 1GJAB 3Q00A 1LHCH 2A31A 5C2ZA 4AGKA 2BTCE 5IYTA 3VB6A 1IQJA 4GUXA 1KXDA 5L2ZH 5J4SA 4A6LA 1C5MD 2ZFRH 3DUXH 1DPOA 3D49H 3NCLA 1B5GH 2TRMA 4MQAA 1TPAE 5GCHG 1XMNB 1BRAA 1UTQA 4FUJA 3RM2H 1GBEA 1G3CA 2OLGA 1FMGA 3K6ZA 3TPIZ 1GJ8B 1ARCA 1ZRKA 4MLFB 1BHXF 2G81E 1PPGE 3E91A 1NZQH 1EPTC 2GZ9A 2XBWA 1O36A 1VCQA 3M3SA 1C2KA 1DX5M 3SBKA 1O3OA 2M5TA 3RXOA 3WY8A 1PPFE 5C5OA 1LVBA 1TRYA 3S69A 1FY1A 3OYPA 2FLRH 4IGDA 1CT4E 4IS5A 4RSPA 1GBCA 1HAGE 3NXPA 1SOTA 2FS9A 5F6MA 5C3NA 4QT8C 2G00A 4Y79A 3QWCH 1Z6JH 5A2MH 2GDEH 2J9NA 5JBCS 4X8UH 1Y5UT 1O2GH 2SGEE 2A45B 4JZDH 2R0KA 2GTBA 1MTUA 1C2EA 3VB7A 3BG8A 1P9SA 3SQHE 3F9HA 3SHAH 2ZPRA 4ISNA 5FBEA 3UOPA 1NY22 1Z71A 5LH8A 1LKAA 1CQQA 1ELTA 2VINA 3SJKA 1W13U 4FUGA 3RMLH 2Z3EA 3ZZ8A 1NRRH 4ASHA 2D8WA 1O33A 4YZUA 3O8BA 3UNQA 3PROA 2H5CA 1VZQH 5CHAC 1DVAH 3M7TA 4D9QA 1KYNA 4KELA 1KXEA 3MU0A 1UVPA 2NWNA 2FS8A 2BD5A 3SU1A 1O2ZA 2BZ6H 3U69H 1TABE 2ALPA 2ZHFH 1SSXA 1O2UA 8GCHF 2PHBA 1DLEA 3W94A 5J4QA 3HKIB 1GCDA 1V2JT 1Z8GA 1TWXB 1V2UT 2BB4A 1QBVH 3NKKA 2GD4B 4Y71A 2JH6D 1VR1H 3TJOA 3FFGA 4K1SA 2AH4X 4AX9H 2ZEBA 1D3DB 2B8OH 3ITIA 5C20A 4NGAH 1MTSA 1GJ9B 4K8YA 2O8WA 3VGCB 1GMDG 4E7NA 3EQ0H 1AKSA 2QXGA 2P3UB 1AB9B 1VCPA 1C1OA 4CRFA 3MYWA 1IQMA 2CF8H 2P3FH 3GCHC 2AS9A 3QGJA 3RU4T 4D9RA 2SNWA 3PM3A 5FHTA 3SU4A 1TPOA 2PR3A 3TGIE 1TE0A 1GDQA 4FUIA 1ABIH 4Q7ZA 1MZDA 1MQ6A 1G3DA 2XTTB 1GHBF 4B74A 1AKSB 2QYIA 5C1XA 1DWCH 2UUKB 3SV6A 1VGCB 1HJAC 4R0IA 4YTAA 1QL8A 1WV7H 3DFJA 1F5LA 9ESTA 1OWKA 2OD3B 1F2SE 3ZZ6A 1D6RA 3ZZ5A 3SZNA 1B0FA 1F0SA 1W3CA 3SOSA 3U8OH 1SGIB 2EA3A 3S7HB 1J16A 2GGVB 1UK2A 2BVRH 3UWJH 5JBTA 4FUFA 4OS5A 1GI2A 4E7RG 4FUCA 4IMQA 1SOZA 5EG4A 1BTXA 2C93B 5E0GA 3RXKA 3VPKA 1IQEA 1TGNA 4FUDA 3SNBA 4AB9A 1C1VH 1F5RA 4MPUA 5DP6A 5HMAA 3GY3A 2BXUH 2FODA 1NFXA 5EODA 1G9IE 3NZIA 3A83A 3UOUA 4BNRA 3F6UH 2JETB 3SU2A 3KQEA 2FX4A 2Z6BD 3UR9A 4WF8A 2AGGX 2AMPA 4I8HA 1HAIH 1LKBA 3A81A 1RGQA 3SJ8A 3SUDA 1DSUA 1W10U 2W7UA 2Z3DA 3BG4C 1O3EA 2F9BH 1ZTKA 3ZZ4A 1ESTA 1XM1A 3SU0A 1TBZH 4A1TA 2XNIA 4A5TS 1SQOA 1C2MA 1O2KA 1RIWB 1SGRE 1LQDB 1JMOH 1DT2A 1JXPA 2A5IA 2SGQE 2HPQH 3MNBA 5FX5A 4CR9A 4ABDA 1JIMA 3S0NA 1GI9B 1TX8A 3KQBA 1QA0A 1RTFB 2XC4A 3KHVA 1GI6A 1O5FH 2PTNA 3L3TA 4JCNA 4XOJA 3ZZBA 1O2IA 1YCPH 5DG6A 1LHGH 1CGIE 1DS2E 1GI7B 1P10A 1MU8B 1P3CA 1B0EA 1O31A 3LDXH 2J34A 4I8JA 4DIHH 3PTNA 1AB9C 1C5XB 2ZDAH 4BTIB 2ZFQH 3F9FA 1SHHB 3ZZ7A 1FIZA 2ZPSA 4B75A 2R2MB 3TH4H 1PPHE 2BDYA 5C67A 2ZGCA 1TGBA 4AFQA 1BTPA 1T7CA 2KAIB 4AG2A 4XBDA 2ZTXA 4IN2A 3KQCA 2BY9X 1FY3A 3CS0A 3RC6A 1K1JA 4DIIH 1B7XB 1O2MA 1SR5C 3QN7A 2V3HH 3HPTB 1EB2A 2Y5GA 2VH6A 3V13A 1W7XH 1H8IH 1OKXA 1ZPBA 4F49A 1C5SA 1GMCG 1GVKB 4UFEH 3ZVGA 1GI5A 2P94A 5JYIA 2FOFA 1AFQC 1S5SA 2AYWA 2OCVB 3LONA 1AY6H 1AE8H 1XXFA 1MMJN 1J9CH 1OWDA 5HM9A 2VVUA 1H4WA 5SGAE 1ZZZA 2FI3E 1O3GA 4IC5A 4DVAU 1BHXB 5JBBS 3EA7A 5C1UA 1C5OH 1S0QA 1YKTA 1CHOF 1GHAG 1P12E 2BZAA 2I6SA 1P02A 3FANA 3LC3A 8ESTE 5A0AE 1YPJH 1DM4B 1W0YH 2P16A 1G3BA 4Y8XA 1O2QA 2XC0A 3RXUA 1BRCE 1NFYA 3CP7A 4INHA 1ELFA 1TONA 3EGKH 2A5AA 1V2KT 1QFKH 3ATLA 1FY8E 1SGPE 4JK6A 4MPWA 1MAYA 1N8OB 1EPTB 4D7GA 2LNCA 4MNYA 2BY8X 1XUIA 2ZTYA 1AFQB 3EA8A 3GCTF 1CBWC 1XXDA 3RXAA 2WPJS 1ZMLA 1SQTA 5TJXA 1C9TA 1ESBA 2G51A 1F5KU 3GISB 1SHYA 1GMCF 1T4UH 1EKBB 1U6QA 5LGOA 1QB9A 5DGJA 1OYTH 3AVZA 2XYAA 2VIVA 4R8TB 1UTMA 1V2MT 2FOCA 4B2CA 5DO4H 3DT0H 3TGJE 3HK3B 4MNXA 4NZLA 3MI4A 5JBAS 2G4UA 3VB5A 3I29A 2OBQA 1MKWH 4K2YA 2PW8H 3RXIA 3LPRA 4AB8A 4ABHA 1RFNA 5F03A 1BMAA 1S81A 1UK3A 5GXPA 2ZTZA 1KDQB 5HYOA 2CHAC 1YGCH 2QAAA 1FAXA 4KTSA 2QY0B 4INKA 4X6MA 3QTVH 4CRDA 3MOCA 4AOQA 4Y6DA 3P8GA 4CRGA 1O2NA 2Z9GA 3RU4D 4DURA 2BYAX 1CGHA 3ZZDA 2ZDNA 2ZP0H 2O8UA 3M3VA 1ELAA 3SU3A 1V2VT 3SO3A 4X6PA 1PQAA 2ZNKH 3GCOA 4PROA 1C9PA 2D2DA 4YT6H 2SGAA 5GPIB 1BQYA 4ZROA 4NIYA 1RS0A 3QX5H 3NK8A 3GY8A 2JKHA 1Y3XA 3F68H 3URCA 1GI4A 2WV5A 2UUJB 4JYTA 1K1IA 1A5IA 3DA9B 1GI3A 2CV3A 1EAXA 3LJJA 2SGDE 2VIQA 3Q3YA 1TRMA 1CHOG 1GHAF 1GJ7B 1CHGA 1TA6A 3NWUA 2Z7FE 2PLXA 1IHSH 1CT0E 1O2VA 2P8OC 1A7SA 2BQ7B 3PO1C 3A7YA 1KXBA 2ULLA 1P2QA 1ORFA 3OY6U 4XSKU 1TLDA 3SU5A 3A8DA 1TPPA 1O3BA 4UEHH 3RP2A 4Z0KA 1EZSC 1GVLA 3I77A 2J94A 3A7ZA 4AFUA 4A1XA 1GL0E 1O39A 1EOLA 1DE7H 1LMWB 1SQAA 1C4Y2 1O3LA 1K9OE 1QURH 1EJNA 5JB8S 3G01A 1DICA 1DWDH 2F9PA 4HFPB 1NROH 4JZEH 1VCWA 2G5NA 2UWLA 1SG8B 3GCNA 4GHTA 2AGIX 1GL1A 3T62A 3MHWU 2SNVA 2QGRA 1LO6A 3FP8E 2VIOA 5A8YA 3GYLB 4CR5A 1EZUC 3BTHE 2ZGXH 4U01A 3K9XB 2GX4A 1ABJH 2GCHG 2XCFA 5FBIA 1TGSZ 3CENA 2HNTE 2A4OA 1KLJH 2ZC9H 3PO1B 2WPHS 4B76A 4K8BA 1TMBH 3NPSA 3Q76A 1EQ9A 2RDLA 1P2JA 2Z9KA 4ZHLU 1SGTA 4X1RU 1H9IE 1O32A 4I32A 3MNXA 1PPEE 3T5FH 1Z6EA 5B6OA 4BXWA 1GDUA 2HNTC 1BITA 4K60A 1IQLA 1UCYK 1DWBH 2F83A 1QRWA 4I8LA 3UQOA 1OSSA 2GCTB 3A8CA 5ETXA 4IBLH 3M7UA 3P70B 1NM6A 1XUHA 1AVGH 2VVCA 4H6TA 1E37B 4YO9A 3SV9A 2TGAA 1QB6A 4BAQB 3UUZA 4K1TA 1ETRH 6ESTA 2STAE 5ESTE 1FJSA 1Z8RA 4FU9A 3RXDA 5T6GA 1BJVA 2D1JA 2H2ZA 1N8OC 1ZHRA 4X6NA 2ZDVH 4DGJA 1MUEB 3IITA 3VXEH 2UWPA 1O5EH 3UR6A 1ELDE 1JRTA 3Q77A 1VJAU 1TIOA 3O8RA 1BBRH 1CO7E 1GBFA 1FXYA 2BX4A 1THSH 2QF3A 3BF6H 1S6FA 1RTLA 2G52A 1QJ1B 2FZZA 2Y81A 4KGAA 3TVJB 2QXIA 1L1GA 3RXCA 4XDEA 3BTKE 3O8CA 4CBOA 4JZIA 1GHXH 1O2JA 1ZMJA 4NIWA 1C1SA 1C4U2 1OP2A 3U1IB 2R0LA 1GJBB 5FPYA 2WV4A 1DDJA 4K69A 1MD7A 1NT1A 1QCPA 1ANEA 3LGTA 1WQSA 2QXHA 2RA0A 3HKJB 1GHZA 1HGTH 1A2CH 3RUOA 1NS3A 2ALVA 1OS8A 1BTWA 4TY7A 2XCNA 2ZG0H 1BOQA 1C5QA 4KP0A 3A8BA 2BY6X 2FOMB 2V3OH 2J38A 1HRTH 2FIRH 1V2LT 2EI8A 7GCHF 2GCHF 5L2YH 3A7WA 4UFGH 1TGCA 3C1KA 4ZXYH 1AUTC 5FAHA 3TJUA 4HTCH 6GCHG 3D23A 2JH5D 3SGAE 2ZQ2A 5PTPA 1EX3A 1K2I1 3E90B 1GJCB 2XXLA 3AASA 1NESE 1HIAB 1GPZA 3A85A 1YBWA 5I46H 4LZ4B 4ISOA 2GZ7A 3IWMA 2C8ZB 2Y7XA 2JH0D 1C5UA 2KAIA 3MU4A 3T27A 1MD8A 1ZTJA 2FM2A 1SGDE 1MZAA 1UTLM 1FV9A 1O5DH 2CXVA 2Q1JA 4YOJA 4X8TH 1FDPA 1H1BA 4WY3A 1S84A 4IMZA 2BY7X 1IHTH 1C5TA 3V12A 1GMHF 2VIDA 1QTFA 2PGBB 3SNEA 4AFZA 1HJ8A 1HLTH 2WYJA 4BANB 1HAYB 2K1QA 2P8OB 2W3KA 4MDSA 2XW9A 1DFPA 1DXPA 1ZJDA 2WUBA 4B1TA 2A4RA 3ELAH 1BBRK 3STJA 5EW2H 2FOHA 1WTHD 4GCHF 2HNTF 3FP6E 1ZR0A 1KTSB 4RN6A 5GWZA 2OQ5A 1GG6B 3GOVB 1AVXA 4YT7H 1C2DA 2CGAA 2ILNA 2SFAA 1O3JA 2J4IA 3BV9B 3EAJA 3W95A 1EUFA 3DHKH 3SNCA 2ZCKP 3HGPA 4JYUH 1P01A 1LHDH 1KIGH 1P2NA 4NSYA 2BD2A 5ABWA 1FZZA 5JPMH 1W2KH 2ESTE 3BTGE 1KXAA 1GMDF 2Y80A 4AZ2B 3MO3A 1HFDA 1W7GH 2FI5E 3GCTG 1V2QT 1LPGB 1HIAA 2BXTH 3OX7U 1KSNA 5C1YA 2BDGA 4NCYA 2ZGHA 1SPJA 1ZHPA 2FO9A 2Z3CA 3L6PA 4GAWA 1TQ0B 2GP9B 3RMNH 1UTPA 2AIPA 2ASUB 4AYYB 4THNH 2EI7A 4HGCA 2GT7A 1GGDC 1UTKA 2TGDA 3ZYDA 2ZFSA 3M3TA 5DJ7A 3RXPA 2OC8A 4NA7A 3M35A 2ODYB 4JYVH 3OSYA 1C2GA 4IW4E 3U8RH 3ZVEA 1GJ5H 1BBRE 4UFDH 1G2LA 4Y0ZE 1QBNA 4ZKSU 1QJ7B 2BLWA 1GHBG 4ZXXH 1W12U 1FN6A 3E16B 4A7IB 2GVFA 1ZOMA 2P59A 2GKVE 2FYRA 3BIVH 2IOTA 3BTDE 3M5OA 4MNWA 4WWYA 4LZ1H 3M61U 1O35A 1K1NA 3QK1A 4NIVA 3GY4A 3PMJA 2EI6A 1O5GH 1Z1IA 1MTNC 3ZZ3A 3LGYA 1BA8B 2VWOA 1O3NA 1CSOE 4ABIA 4SGBE 5DP3A 1RTKA 1LVMA 1W14U 1WOFA 1AD8H 3MH6A 2IN2A 1P2IA 2F9VA 7GCHG 5HXFA 1CU1A 3D65E 1P03A 1AO5A 1TQ7B 1D3QB 3PTBA 4I7YH 4O03A 3ENSB 4BAKB 2GMTC 3TJVA 2WINI 1QHRB 1YPHE 2BOHB 3JZ2B 2A4QA 1RIWC 3SUEA 3RMMH 2HPPH 1O3FA 2CMYA 5A8ZA 2HOBA 4YLUA 5LPEA 2PSXA 1EZQA 3UIRA 2ZHWH 1O3DA 3BTEE 1BRUP 1V2ST 2PKSC 1N6YA 2FESH 5GIBA 4KKDA 2FLBH 3A7XA 4H6SB 2G55A 1ACBE 1TNHA 1S85A 3GY5A 4WMDA 3ZVAA 1A0LA 5GCHF 1YPHC 1XUFA 5CMXH 1UVSH 1N6XA 3BTQE 5H4IB 3E3TA 4YOIA 1GHVH 4DT7B 2DE8A 2W7SA 1GJ4H 2IPHA 3UNSA 1MAXA 5BRRE 2OP9A 2ZCHP 1GWAA 1HXEH 1QQ4A 1UVOA 3U98H 1AN1E 3A89A 1SGNE 1TGTA 2FP7B 3SN8A 2C3SA 1C5VA 2BOKA 1EJAA 3TLOA 4TWYA 3V7TA 1DY9A 1GHYH 2Y5HA 2PUXB 4B2AA 3STIA 1GBDA 1L4DA 2ZU3A 3VXFH 1ETTH 4LXBH 1IQKA 3A88A 1T8NA 3KGPA 5EXMA 2C90B 1P9UA 1G36A 1Q31A 4IC6A 4WMFA 2ZU1A 2ZHQH 2GCTC 3V3MA 1FPCH 1BDAA 3MMGA 1S0RA 4FVDA 1T8LA 1DSTA 3RXQA 2AEIH 2FEQH 5EQQA 1IAUA 1LHFH 1RXPA 1AI8H 2G5VA 5EU8A 3MTYA 2VNTA 1O3IA 1XUGA 4CRBA 4YM9A 1PQ8A 1LVYA 5DP7A 2OBOA 1C5YB 4GCHG 1TALA 1P05A 3DFLA 4RKJB 1LQEA 2B5TB 2TBSA 5I25A 2ZU2A 1PYTD 2Z9IA 1WU1A 3M5MA 1C1PA 1YM0A 4CH8B 1O2TA 1T8OA 2ODPA 1G3EA 1QQUA 1V2TT 1UJ1A 2QF0A 4CREA 4B73A 1OPHB 3P17H 1E38B 1EAWA 1YPEH 4DOQA 7KMEH 1OWHA 1ELGA 1P11E 1HBTH 1G2MA 1J15A 7LPRA 2NU3E 4I8GA 1WUNH 4CHAC 1MBMA 1UVTH 1SLUB 4F4OC 4MNVA 1DITH 4ZHAA 2FOBA 1J14A 3A86A 2BDBA 2ZIQH 3P8FA 1ANCA 1NU7B 2ZFPH 3RM0H 3VEQB 6GCHF 1O38A 3QO6A 1OWIA 2JETC 1YYY1 1NC6A 4K3JA 5IDKA 1O3AA 5FPSA 1G30B 1HAPH 3RXFA 4O97A 1A3EH 5EGMA 1O2SA 2Q6DA 3H5CB 1O5BB 1O3CA 1ANDA 5FPTA 3P6ZB 1W11U 1K1MA 4NFEA 5A0CA 2VWLA 2OTVA 3R3GB 4XBCA 1AUJA 1YF4A 1UVUH 3A7TA 4OGYA 1A61H 2PGQB 1TNLA 2FXRA 1FY4A 1HAHH 2UWOA 3N7OA 1VITG 3PB1E 3P8NA 1BMMH 3P8OA 1KDQA 1O3MA 3EYDA 2YNAA 1UMAH 4A1VA 4X6OA 1T31A 1MCTA 1FUJA 1WBGB 2EC9H 4YLQH 4OS7A 2XC5A 2FTMA 2R3UA 1ZTLA 2OXSA 5DK1A 1K1LA 5GDSH 1ELVA 4RKOB 1C5RA 1TX6A 3PV4A 1ZLRA 1O37A 4D7FA 1HCGA 1C2IA 1ZGIA 2ZPQA 3ZZCA 1IQIA 3Q3XA 4K1EA 3PMHB 1BMLA 3A84A 4LK4A 3MU5A 2IJOB 1HYLA 1YLCA 2Z94A 1UTNA 4X2XA 1ZPZA 2FYQA 4BTTB 4UFFH 1ETSH 1K1PA 2V0BA 1ID5H 4ABBA 3BEIB 3SV7A 1LDTT 2VWNA 1V2RT 1C4V2 3LT3A 1NRQH 3SU6A 4Y7BA 2A7CA 1GBIA 1O2YA 1C1NA 3RDZA 1BTUA 3RXMA 4Q80A 4TY6A 1ZYOA 3SI4H 4NA8A 1C1TA 1TRNA 3BTTE 4UDWH 2A0QB 1QIXB 1Y5AT 3ZZAA 3TNTA 2QCYA 4LOYH 3SNDA 9LPRA 1V2NT 1MTWA 5T6DA 1P04A 2YOLA 3U8TH 2ZCLP 4WJG2 3GCHB 3LIWA 4ABGA 1GBAA 3SUGA 5LPFA 2V35A 2OUAA 1GGDB 2FDAA 2PKAB 4UE7H 3TH2H 6CHAB 5DP4A 1JOUB 1FPHH 3RC5A 1W8BH 2A32A 2HVXA 4X1QU 2A4GA 1KY9A 1V3XA 2STBE 2J92A 1TMUH 1VJ9U 4FXGH 1QGFA 1IQHA 3A82A 3A80A 3BTFE 4ZUHA 4ZKRU 3A87A 3ZVDA 1BTHH 2XRCA 4JK5A 4UD9H 4GPGA 1S6HA 1EB1H 3QZRA 3KCGH 2AMDA 1MBQA 4GLYA 2BY5X 4Z6AH 4NIXA 5JDUB 1T32A 1RD3B 4O9VA 5EXNA 1DOJA 3SGBE 4ABEA 4Y0YE 1GCTC 2BDAA 2PKAA 3UQVA 2B0FA 2ZHEH 3TK6A 1HAZB 4ESTE 3QTOH 1CBWB 3ATKA 3HK6B 3SJIA 2H9HA 3PLBA 1FQ3A 1P57B 2XBVA 1XX9A 2ZU4A 5E0HA 3K6YA 5AF9H 1GBMA 4FVBA 2ZDMA 2P93A 1TNGA 1EZXC 1C2HA 2AERH 1GJ6A 4MTBA 1QL9A 3M36A 1V2WT 2WPIS 4OGXA 1THPB 4ZHMU 2NU0E 2XBXA 2W5EA 2H6MA 2ZKSA 4AORA 1O0DH 1YP9A 3PLPA 1GCTB 1EP5A 1WAYB 2NU1E 4Y7AA 3AW1A 2ANYA 2AIQA 3RC4A 1K22H 1GI8B 1NRSH 1TX7A 2HWLB 1TYNA 2O9QA 4JZ1A 3ZVBA 3RXVA 3MFJA 1O5AB 4Y8ZA 4E06H 1NRNH 3A8AA 2EEKA 3QUMP 5K0HA 1T4VH 2BD9A 1SC8U 2VB0A 2WPLS 5T6FA 1YPGH 4WMEA 1DWEH 2GDDA 3K2UA 1BT7A 5G4BA 4TYDA 1SB1H 5EW1H 1ZHMA 1FAKH 4SGAE 1HUTH 3E0PB 2B7DH 2FWWA 1OOKB 2NU4E 3E8LA 1TFXA 4X2YA 1A0HB 4WXIA 1P8VC 1TPSA 4BOHA 1SGQE 1EASA 3LH1A 1SFQB 3E6PH 2ANKH 3SHCH 1TB6H 4UONA 4X1SU 5K7RA 1P2MA 3LGUA 1P06A 4Q7XA 5TCCA 3FP7E 1HAOH 2FMJA 1D3TB 3NUMA 1ELCA 3P92A 1AIXH 3GY6A 1NTPA 1BUIA 4XFQA 1GBBA 3MU8A 3KNXA 1HAVB 3MNSA 1AZZA 1L1NA 1A1RA 1MU6B 4TPYA 2I6QA 2SGFE 2WUCA 2PV9B 5TCAA 3UPEA 5DP8A 1AMHA 1ZSLA 2Z9JA 1YPKH 1D4PB 2TGTA 1O3KA 1GBJA 3S9BA 1J17T 1QBOA 1Y3YA 2OQUA 2Q6GA 1BMNH 3K65B 3EE0B 4FUBA 1NN6A 5E0JA 1ANBA 3LC5A 1QNJA 5L30H 1QA7A 5F8XA 1EAUA 1CA8B 1TNKA 3QDZB 1TAWA 2GMTB 3ATMA 1WYKA 4MPXA 3S7KB 3MO6A 5HM2A 1ARBA 1C5NH 1C2JA 2ZI2H 1K21H 1QRXA 2AMQA 3ODFA 1EATA 4MPVA 3LU9B 1AZ8A 5A0BA 1C5WB 1MTVA 2RA3A 1O3PB 6LPRA 4U32A 4NG9H 1FN8A 1WTGH 1L4ZA 3BIUH 1HAVA 2ZF0H 1GI0A 1AQ7A 1GVZA 1BZXE 1SGFG 4DJZB 3TGKE 1OXGA 2ZDLA 2XWAA 5FCKA 1ZSKA 1RRKA 1Y5BT 3BN9A 1A5HA 1SGYE 1NO9H 1AWHB 1ZJKA 1GMHG 1FIWA 4E05H 4AGJA 2BX3A 1BIOA 3BTWE 4GVUA 5A09A 2TPIZ 1GBHA 4FU7A 2A2QH 4K5ZA 2R9PA 3P95A 4Q2KA 1KTTB 1KXFA 2FI4E 2C8YB 1Z8JB 3MO9A 3SV8A 1P09A 3SI3H 3SQEE 1BTZA 1DUAA 1IQFA 2FOGA 1ZPCA 3KIDU 1OYQA 2CF9H 5EQRA 4ABJA 4D76A 3ZVCA 4ISIH 1PQ5A 2F3CE 1XKAC 2ZGBH 4OS2A 3LKWA 4H4FA 4ISLA 4AG1A 3R0FA 2Y7ZA 2VWMA 4JZFH 3UREA 1JRSA 1H9HE 1HNEE 1EAIA 2BDIA 1SMFE 1CVWH 2ZECA 1F0TA 2BD3A 4U30A 1E34B 2C8XB 1MKXK 2UUFB 1NPMA 1X7AC 4NWKA 5CE1A 3KF2A 1FY5A 2PUQH 4NZQA 2R3YA 1TBQH 1F0UA 2BVSH 2PKSB 4GHQA 4X1NU 2TIOA 4BAOB 3MNCA 1YPLH 3SGQE 3SNAA 1WQVH 2BLVA 1AVWA 4WH8A 3RXRA 3HGNA 1SBWA 1V2OT 3UNRA 5BPEA 1L1JA 1S83A 2RCEA 1UTJA 1ESAA 5FCRA 1EXFA 3BEFB 4CRCA 1EJMA 1JIRA 2C8WB 3OY5U 1O3HA 1EOJA 1UO6A 1LCYA 4INLA 4NSVA 4X0WU 1Z8IB 1UCYH 2H5DA 4YOGA 4U2WA 1Y3VA 2BD4A 2VU8E 1MCVA 3U9AH 4DG4A 2A7JA 3I78A 2XBYA 2FOEA 2NU2E 5ESBA 1FI8A 1EP6A 1Y8TA 3RXBA 1P0SH 3M37A 4OS6A 1SLXB 4OS1A 1TNIA 3GDVA 5EPNA 1AWFH 3H7TA 4YESB 3TITA 2ANMH 3RXTA 2VGCC 3TNSA 3V0XA 1BTYA 2QIQA 3BEUA 1A4WH 3JZ1B 4NWLA 1JBUH 5E8EH 1IQGA 1FNIA 2HLCA 2G4TA 3PMBB 1HDTH 3SW2B 2ZHDA 1F92A 1PPZA 1XVOA 1KXCA 3UTUH 1W0ZU 3TK9A 3ZV8A 3D62A 5T3HA 1OWJA 2ODQA 2QXJA 3KN2A 4ZKNU 3ESTA 1UCYE 4Q7YA 2A1DB 3QLPH 1E36B
chains in the Genus database with same CATH superfamily
3EA9A 4O3TA 3E1XB 1G37A 1E0FD 4BXSA 2ZO3H 3RLWH 3UY9A 1K28D 2QV1A 3F1SB 2FOAA 3PWBA 1C1MA 5EPYA 4X8SH 1F7ZA 3TU7H 4HI3A 2A2XH 1AHTH 4XRNA 2PSYA 4M7GA 2OC0A 5DKMA 3ZIAD 1ELEE 1SGCA 4Y8YA 3MH4A 3T25A 5F8TA 1DLKB 1C5LH 2FX6A 1GG6C 1QR3E 1T8MA 1WSSH 1C1UH 1C5PA 2Y6TA 1P2OA 1PPBH 3AW0A 3T28A 2BLOA 1TNJA 3FVFB 4BTUB 3B9FH 1A0JA 3SUFA 1OWEA 3QZQA 4AC9A 1MTNB 5DP5A 3PLKA 2CJIA 2PFEA 3KQDA 1PQ7A 2HALA 2ZWLH 1YC0A 2P95A 2R2WU 2TGPZ 4ACBA 3OU0A 4GSOA 5HIZA 1K1OA 2Y82A 2GT8A 1YWUA 3M5LA 1CA0B 1GJDB 3MH7A 4CRAA 3ZV9A 2BQWB 3BTME 1XUJA 3CS7A 3MH5A 4CHAB 4DW2U 1AGJA 2P3TB 2Z9LA 3MU1A 3E0NB 1C1QA 1H8ED 3PRDA 3RXHA 1AFEH 1SL3A 1SVPA 5AVDA 2BQ6B 3OTJE 1LVOA 2W26A 3ODDA 1N1LA 4A92A 1ZRBA 3QGNB 5E2PA 4AYVB 1TA2A 1O34A 4Y10E 5DP9A 3UWIA 1LHEH 1P2KA 1QB1A 3T26A 1V6DA 3AAVA 1CGJE 2W3IA 1CA0C 4WH6A 1L0ZA 1F0RA 4X2VA 1UK4A 1PPCE 2WYGA 1SFIA 3VFEA 1SGEE 5HIYA 1YLDA 1GI1A 1HPGA 4J1YA 3B8JA 1CE5A 3RMOH 2D26C 5EXLA 1O2XA 2VIWA 1A3BH 1FONA 1LPKB 1QL7A 4MG3A 5FXLA 5B6LA 1G32B 1O2RA 2GV7A 1K0HA 1CT2E 4F48B 2HGTH 2VJ1A 2ZA5A 3AAUA 1XVMA 3T2NA 1Q3XA 4BAHB 4Y76A 5F8ZA 1C2FA 1GBKA 1HV7A 1SLVB 2QC2A 1AE5A 1INCA 1HJ9A 3O8DA 3Q3KA 3S9AA 1FLEE 4ZH8A 2OC7A 1O2WA 4ISHH 1L2EA 3HATH 3RXJA 4XD7D 1LPZB 1Y59T 4KTCA 1ZGVA 3TK5A 1PJPA 1TMTH 2B9LA 3OFND 1M9UA 5AFZH 1MKXH 4KTUA 1HJAB 3F9GA 2ZGJA 4FU8A 3SJOA 1TBRH 3F9EA 1DXWA 4XBBA 1SLWB 3C27B 2OINA 3RXSA 3T29A 4YXWD 3BG4B 1O2OA 5C0TA 3LOXA 4ABAA 1DANH 1UTOA 1Q2WA 1WDIA 2WPKS 3GY7A 3KYGA 1GBLA 3B23B 1BB0B 1C1RA 3KEEA 3TIUA 3RLYH 3FZDA 2G8TA 3VB4A 1TOCB 6CHAC 1Z1JA 2O8LA 1SGFA 1MQ5A 3SORA 1O2LA 4Q63A 5DPAA 8KME2 3M7QA 1GBTA 1PFXC 1VGCC 2RFKC 4O3UA 1E35B 2C4FH 1MH0A 3FKSD 4OS4A 4ZKOU 4X1PU 4ZAEA 1THRH 3SV2H 1Y3UA 3OEED 1QJ6B 4AN7A 5L6NH 4FUHA 1IQNA 1JWTA 2J95A 1BCUH 1D9IA 2ZZUH 2THFB 2DE9A 1RJXB 1SI5H 4CBNA 1O2PA 1V2PT 3U1JB 1LTOA 2Q6FA 1UW7A 1J8AA 1NFUA 2RG3A 1HB0B 1Z7KA 3RXEA 2H1UA 1VITF 1DY8A 1Y3WA 1YPMH 2RDEA 2DUCA 4Y11E 2BD7A 3RU4E 2CHAB 4CH2B 3GDUA 3ZZ9A 2LPRA 3PMAB 1XUKA 2WPMS 4NA9H 2PWXA 3IG6B 2F9OA 2O8MA 1H8DH 5CHAB 4J2YB 1O30A 2BHGA 5DN6D 1XKBC 1QRZA 5JB9S 2FTLE 3FAOA 1PYTC 1IOEA 2UUYA 2BDHA 3EDXB 3TJNA 1VITH 4ABFA 2GV6A 2F9UA 2BMGB 1OP0A 5AFYH 3A7VA 1BRBE 4I31A 2ANWA 2QA9E 2H9TH 2QF4A 1C1WH 5EQSA 1P3EA 2F4LA 3LH3A 8LPRA 4MVNA 2XWBI 1D6WA 1NU9A 3GDSA 2AGEX 1YCPM 4WXVA 4AFSA 2BM2A 2LP6A 2CN0H 2A7HA 3S9CA 4IN1A 4WVPE 5LPRA 3VGCC 7ESTE 2QN5T 2ZDKA 4I33A 2VVVA 2O8TA 1EPTA 4TPIZ 1ELBA 2VGCB 5C5NA 3LJOA 3H7OA 4TWWA 1BJUA 3FZZA 3DD2H 3GYMA 1UHBB 2ZFTA 4FUEA 1NRPH 4X8VH 3LGWA 1C5ZB 3U28C 5AHGH 2FPZA 2VIPA 1QY6A 1UHBA 5A8XA 4ZMAH 4BAMB 1ZMNA 4I86A 2V6NA 3UFAA 1KLIH 1ZSJA 3VB3A 4X2WA 3RXLA 3LGVA 3ZYEA 2J2UA 1O2HA 4NFFA 2OC1A 2VH0A 3LGIA 3GY2A 3L33A 1C2LA 4B71A 1HXFH 2ZU5A 8GCHG 2PTCE 2BVXH 1A5GH 5HGGA 4VGCC 1S82A 2F9NA 3M5NA 5E2OA 4DCDA 1MKWK 3PWCA 1H9LB 1GHWH 5EOKA 4D8NA 1DUEA 2A5KA 3WWBA 3KL6A 3MWIU 1KLTA 2F91A 1AU8A 3ATWA 3URDA 2HRVA 2AFQB 2YNBA 2BLQA 4I8KA 4JMYA 2GZ8A 5GJ4B 1TOMH 4B2BA 4XE4A 4H42U 1NFWA 3GICB 3SJ9A 3F2GA 2BD8A 3ZVFA 2ZQ1A 1WCZA 3ATIA 3BSQA 3PYHA 1A46H 1HAXB 3RXGA 1GDNA 2L74A 1EFRD 2ZFFH 4HZHA 2H9EH 2BDCA 1YCPK 1D3PB 4VGCB 2SGPE 2Y5FA 2K0QA 5CDFE 1OP8A 5FX6A 2L6OA 1OX1A 3TH3H 1O5CB 4DY7B 1GJAB 3Q00A 1LHCH 2A31A 5C2ZA 4AGKA 2BTCE 5IYTA 3VB6A 1IQJA 4GUXA 4P02A 1KXDA 5L2ZH 5J4SA 4A6LA 1C5MD 2ZFRH 3DUXH 1DPOA 3D49H 3NCLA 1B5GH 2TRMA 4MQAA 1TPAE 4RT1A 5GCHG 1XMNB 1BRAA 1UTQA 4FUJA 3RM2H 1GBEA 1G3CA 2OLGA 1FMGA 3K6ZA 3TPIZ 1GJ8B 1ARCA 1ZRKA 4MLFB 1BHXF 2G81E 1PPGE 3E91A 1NZQH 1EPTC 2GZ9A 1O36A 1VCQA 2XBWA 3M3SA 1C2KA 2KCYA 1DX5M 3SBKA 1O3OA 2M5TA 3RXOA 3WY8A 1PPFE 2KCPA 5C5OA 1LVBA 1TRYA 3S69A 1FY1A 3OYPA 2FLRH 4IGDA 1CT4E 4IS5A 4RSPA 1GBCA 1HAGE 3NXPA 2FS9A 1SOTA 5F6MA 5C3NA 4QT8C 2G00A 4Y79A 3QWCH 1Z6JH 5A2MH 2KCOA 2GDEH 2J9NA 5JBCS 4X8UH 1Y5UT 1O2GH 2SGEE 2A45B 4JZDH 2R0KA 2GTBA 1MTUA 3OTPA 1C2EA 3VB7A 3BG8A 1P9SA 3SQHE 3F9HA 3SHAH 2ZPRA 4ISNA 5FBEA 3UOPA 1NY22 1Z71A 5LH8A 1LKAA 1CQQA 1ELTA 2VINA 3SJKA 1W13U 4FUGA 3RMLH 2Z3EA 3PV2A 3ZZ8A 1NRRH 4ASHA 2D8WA 1O33A 4YZUA 3O8BA 3UNQA 3PROA 2H5CA 1VZQH 5CHAC 1DVAH 3M7TA 4D9QA 1KYNA 4KELA 1KXEA 2WHXA 1UVPA 3MU0A 2NWNA 2FS8A 2BD5A 3SU1A 1O2ZA 2BZ6H 3U69H 1TABE 2ALPA 2ZHFH 1SSXA 1O2UA 8GCHF 2PHBA 1DLEA 3W94A 5J4QA 3HKIB 1GCDA 1V2JT 1Z8GA 1TWXB 1V2UT 2BB4A 1QBVH 3NKKA 2GD4B 4Y71A 2JH6D 3N7EA 1VR1H 3TJOA 3FFGA 4K1SA 2AH4X 4AX9H 2ZEBA 1D3DB 2B8OH 3ITIA 5C20A 4NGAH 1MTSA 1GJ9B 4K8YA 2O8WA 3VGCB 1GMDG 4E7NA 3EQ0H 1AKSA 3PRBA 2QXGA 2P3UB 3DSGA 1AB9B 1VCPA 1C1OA 4CRFA 3MYWA 1IQMA 2CF8H 2P3FH 3GCHC 2AS9A 3QGJA 3RU4T 4D9RA 2SNWA 3PM3A 5FHTA 3SU4A 1TPOA 2PR3A 3TGIE 1TE0A 1GDQA 4FUIA 1ABIH 4Q7ZA 1MZDA 1MQ6A 1G3DA 2XTTB 1GHBF 4B74A 1AKSB 2QYIA 5C1XA 1DWCH 2UUKB 3SV6A 1VGCB 1HJAC 4R0IA 4YTAA 1QL8A 1WV7H 3DFJA 1F5LA 9ESTA 1OWKA 2OD3B 1F2SE 3ZZ6A 1D6RA 3ZZ5A 3SZNA 1B0FA 1F0SA 1W3CA 3SOSA 3U8OH 4RI0A 1SGIB 2EA3A 3S7HB 1J16A 2GGVB 1UK2A 2BVRH 3UWJH 5JBTA 1E1QD 4FUFA 4OS5A 1GI2A 4E7RG 4FUCA 4FETA 1NBMD 4IMQA 1SOZA 5EG4A 1BTXA 2AHME 2C93B 5E0GA 3MQKC 3RXKA 3VPKA 1IQEA 1TGNA 4FUDA 3SNBA 4AB9A 1C1VH 1F5RA 4MPUA 5DP6A 5HMAA 3GY3A 2BXUH 2FODA 1NFXA 5EODA 1G9IE 3GS9A 3A83A 3NZIA 3UOUA 3F6UH 4BNRA 2JETB 3SU2A 3KQEA 2FX4A 2Z6BD 3UR9A 4WF8A 2AGGX 2AMPA 4I8HA 1HAIH 1LKBA 3A81A 1RGQA 3SJ8A 3SUDA 1DSUA 1W10U 2W7UA 2Z3DA 3BG4C 1O3EA 2F9BH 1ZTKA 3ZZ4A 1ESTA 4M9FA 1XM1A 3SU0A 1TBZH 4A1TA 2XNIA 4A5TS 1SQOA 1H8HD 3KYFA 1C2MA 1O2KA 1RIWB 1SGRE 1LQDB 1JMOH 1DT2A 1JXPA 2A5IA 2SGQE 2HPQH 3MNBA 5FX5A 4CR9A 4ABDA 1JIMA 3S0NA 1GI9B 1TX8A 3KQBA 5T1VA 1QA0A 1RTFB 2XC4A 5KEDA 3KHVA 2XOKD 1GI6A 1O5FH 2PTNA 3L3TA 4JCNA 4XOJA 3ZZBA 1O2IA 1YCPH 5DG6A 1LHGH 1CGIE 1DS2E 1GI7B 1P10A 1MU8B 1P3CA 1B0EA 1O31A 3LDXH 2J34A 4I8JA 4DIHH 3PTNA 1AB9C 1C5XB 2ZDAH 4BTIB 2KM0A 2WPDD 2ZFQH 3F9FA 1SHHB 3ZZ7A 1FIZA 2ZPSA 4B75A 2R2MB 3TH4H 1PPHE 2BDYA 5C67A 2ZGCA 1TGBA 4AFQA 1BTPA 1T7CA 2KAIB 4AG2A 4XBDA 2ZTXA 4IN2A 3KQCA 2VBCA 2BY9X 5DSFA 1FY3A 3CS0A 3RC6A 1K1JA 4DIIH 1B7XB 1O2MA 1SR5C 2KX4A 3QN7A 2V3HH 3HPTB 1EB2A 2Y5GA 2VH6A 3V13A 1W7XH 1QZ8A 1H8IH 1OKXA 1ZPBA 4F49A 1C5SA 1GMCG 1GVKB 4UFEH 3ZVGA 1GI5A 2P94A 5JYIA 2FOFA 1AFQC 1S5SA 2AYWA 2OCVB 3LONA 1AY6H 1AE8H 1XXFA 1MMJN 1J9CH 1OWDA 5HM9A 2VVUA 1H4WA 5SGAE 1ZZZA 2FI3E 1O3GA 4IC5A 4DVAU 1BHXB 5JBBS 3UAIC 3EA7A 5C1UA 1C5OH 1S0QA 1YKTA 1CHOF 1GHAG 1E79D 1P12E 2BZAA 2I6SA 1P02A 3FANA 3LC3A 8ESTE 5A0AE 3F2FA 2KZ4A 1YPJH 4F55A 1DM4B 1W0YH 2P16A 1G3BA 1MABB 4Y8XA 1O2QA 2XC0A 3RXUA 1BRCE 1NFYA 3CP7A 4INHA 1ELFA 1TONA 3EGKH 4RT0A 2A5AA 1V2KT 1QFKH 3ATLA 1FY8E 1SGPE 4DT4A 4JK6A 4MPWA 1MAYA 4Z1MD 1N8OB 1EPTB 4D7GA 2LNCA 4MNYA 2BY8X 1XUIA 2ZTYA 1AFQB 3EA8A 3GCTF 1CBWC 1XXDA 3RXAA 2WPJS 1ZMLA 1SQTA 5TJXA 1C9TA 1ESBA 2G51A 1F5KU 3GISB 1SHYA 1GMCF 1T4UH 1EKBB 1U6QA 5LGOA 1QB9A 5DGJA 1OYTH 3AVZA 2XYAA 2VIVA 2KCAA 4R8TB 1UTMA 1V2MT 2FOCA 4B2CA 5DO4H 2V3MA 3DT0H 3TGJE 3HK3B 4MNXA 4NZLA 3MI4A 5JBAS 2G4UA 3VB5A 3I29A 2OBQA 1MKWH 4K2YA 2PW8H 3RXIA 3LPRA 4AB8A 4ABHA 1RFNA 5F03A 1BMAA 1S81A 1UK3A 5GXPA 2ZTZA 1KDQB 5HYOA 2CHAC 1YGCH 3NRLA 2JJ2D 2QAAA 1FAXA 4KTSA 2QY0B 4INKA 4X6MA 3QTVH 4CRDA 3MOCA 4AOQA 4Y6DA 3P8GA 4CRGA 1O2NA 2Z9GA 3RU4D 4DURA 2BYAX 1CGHA 3ZZDA 2ZDNA 2ZP0H 2O8UA 3M3VA 1ELAA 3SU3A 1V2VT 3SO3A 4X6PA 1PQAA 2HVYB 2ZNKH 3GCOA 4PROA 1C9PA 1W0KD 2D2DA 4YT6H 2SGAA 5GPIB 1BQYA 4ZROA 4NIYA 1RS0A 3EE7A 3QX5H 3NK8A 3DSPA 3GY8A 2JKHA 1Y3XA 3F68H 3URCA 1GI4A 5EJZA 5FL7D 2WV5A 2UUJB 4JYTA 1K1IA 4B6FA 1A5IA 3DA9B 1GI3A 2CV3A 1EAXA 3LJJA 2SGDE 2VIQA 3Q3YA 1TRMA 1CHOG 1GHAF 1GJ7B 1CHGA 1TA6A 3NWUA 2Z7FE 2PLXA 1IHSH 1CT0E 1O2VA 2P8OC 1A7SA 2LELA 2BQ7B 3PO1C 3A7YA 1KXBA 2ULLA 1P2QA 1ORFA 3OY6U 4XSKU 1TLDA 3SU5A 3A8DA 1TPPA 1O3BA 4UEHH 3RP2A 4Z0KA 3F2HA 1EZSC 1GVLA 3I77A 5C0UA 2J94A 3A7ZA 4AFUA 1W0JD 4A1XA 1GL0E 1O39A 2W6ID 1EOLA 1DE7H 1LMWB 1SQAA 1C4Y2 1O3LA 1K9OE 1QURH 1EJNA 5JB8S 3G01A 1DICA 1DWDH 2F9PA 4HFPB 1NROH 4JZEH 1VCWA 2G5NA 2UWLA 1SG8B 3GCNA 4GHTA 2PP6A 2AGIX 1GL1A 3T62A 3MHWU 2SNVA 2QGRA 2JJ1D 1LO6A 3FP8E 2VIOA 5A8YA 3GYLB 4CR5A 1EZUC 3BTHE 2ZGXH 4U01A 3K9XB 2GX4A 1ABJH 2GCHG 2XCFA 5FBIA 1TGSZ 3CENA 2HNTE 2A4OA 1KLJH 2ZC9H 3OE7D 3PO1B 2WPHS 4B76A 4TSFD 4K8BA 1TMBH 3NPSA 3Q76A 1EQ9A 2RDLA 1P2JA 2Z9KA 4ZHLU 1SGTA 4X1RU 1H9IE 1O32A 1WXRA 4I32A 2WV9A 3MNXA 1PPEE 2W6JD 3T5FH 1Z6EA 5B6OA 4BXWA 1GDUA 2HNTC 1BITA 4K60A 1IQLA 1UCYK 5KECA 1DWBH 2F83A 1QRWA 4I8LA 3UQOA 1OHHD 1OSSA 2GCTB 3A8CA 5ETXA 4IBLH 3M7UA 3P70B 1NM6A 1XUHA 1AVGH 2VVCA 4H6TA 1E37B 4YO9A 1E1RD 3SV9A 2TGAA 1QB6A 4BAQB 3UUZA 4K1TA 3OEHD 1ETRH 6ESTA 2STAE 5ESTE 1FJSA 1Z8RA 4FU9A 3RXDA 5T6GA 1BJVA 2D1JA 2H2ZA 1N8OC 1ZHRA 4X6NA 2ZDVH 2J98A 4DGJA 1MUEB 3IITA 3VXEH 2UWPA 1O5EH 3UR6A 3SZEA 1ELDE 1JRTA 3Q77A 1VJAU 1TIOA 3O8RA 1BBRH 1CO7E 4ACAA 1GBFA 1FXYA 2BX4A 2YMSC 1THSH 3F0OA 2QF3A 3BF6H 1S6FA 1RTLA 2G52A 1QJ1B 2FZZA 2Y81A 4KGAA 3TVJB 2QXIA 3N99A 1L1GA 4TT3D 4XDEA 3BTKE 3RXCA 3O8CA 4CBOA 4JZIA 1GHXH 1O2JA 1ZMJA 4NIWA 1C1SA 4B6EA 1C4U2 1OP2A 3U1IB 2R0LA 3FO8D 1GJBB 4OM9A 5FPYA 2WV4A 1DDJA 4K69A 1MD7A 1NT1A 1QCPA 1ANEA 3LGTA 1WQSA 2QXHA 2RA0A 3HKJB 1GHZA 1HGTH 1A2CH 3RUOA 1NS3A 2ALVA 1OS8A 1BTWA 4TY7A 2XCNA 2ZG0H 1BOQA 1C5QA 3F3BA 4KP0A 3A8BA 2BY6X 2FOMB 2V3OH 2J38A 1HRTH 2FIRH 1V2LT 5EJ1A 2EI8A 7GCHF 2GCHF 5C17A 3A7WA 5L2YH 4UFGH 1TGCA 3C1KA 4ZXYH 1AUTC 5FAHA 2YMSB 3TJUA 4HTCH 3PV5A 6GCHG 3D23A 2J97A 2JH5D 3SGAE 2ZQ2A 5PTPA 1EX3A 1K2I1 3E90B 1GJCB 2XXLA 3AASA 1NESE 1HIAB 1GPZA 3A85A 1YBWA 5CHBA 5I46H 4ISOA 2GZ7A 3IWMA 4LZ4B 2C8ZB 2Y7XA 2QF5A 2JH0D 1C5UA 3UB0A 2KAIA 3MU4A 3T27A 1MD8A 1ZTJA 2FM2A 1SGDE 1MZAA 3N7DA 1UTLM 1FV9A 1O5DH 2CK3D 2CXVA 2Q1JA 4YOJA 4X8TH 1FDPA 1H1BA 4WY3A 1S84A 4IMZA 2BY7X 1IHTH 1C5TA 3V12A 1GMHF 2VIDA 1QTFA 2PGBB 3SNEA 4AFZA 1HJ8A 1HLTH 2WYJA 4BANB 1HAYB 2K1QA 2P8OB 2W3KA 4MDSA 2XW9A 1DFPA 1DXPA 1ZJDA 2WUBA 4B1TA 2A4RA 3ELAH 1BBRK 3STJA 5EW2H 2FOHA 1WTHD 4GCHF 2HNTF 3FP6E 1ZR0A 1KTSB 4RN6A 5GWZA 2OQ5A 1GG6B 3GOVB 1AVXA 4YT7H 1C2DA 2CGAA 2ILNA 2SFAA 1O3JA 2J4IA 3BV9B 3EAJA 3FN8A 3W95A 1EUFA 3DHKH 1VKYA 3SNCA 3VG8A 2ZCKP 3HGPA 4JYUH 1P01A 1LHDH 1KIGH 1P2NA 4NSYA 2BD2A 5ABWA 3WWFA 1FZZA 5JPMH 1W2KH 2ESTE 3BTGE 1KXAA 1GMDF 2Y80A 4AZ2B 3MO3A 1HFDA 1W7GH 2FI5E 3GCTG 1V2QT 1LPGB 1HIAA 2BXTH 3OX7U 1KSNA 5C1YA 2BDGA 4NCYA 5EIYA 2ZGHA 3F0PA 1SPJA 1ZHPA 2FO9A 2Z3CA 3L6PA 4GAWA 1TQ0B 2GP9B 3RMNH 1UTPA 2AIPA 2ASUB 4AYYB 4THNH 2EI7A 4HGCA 2GT7A 1GGDC 1UTKA 2TGDA 3ZYDA 2ZFSA 3M3TA 5DJ7A 3RXPA 2OC8A 4NA7A 3M35A 2ODYB 4JYVH 3OSYA 3W1EA 1C2GA 4IW4E 3U8RH 3ZVEA 1GJ5H 1BBRE 4UFDH 1G2LA 4Y0ZE 1QBNA 4ZKSU 1QJ7B 2BLWA 1GHBG 4ZXXH 1W12U 1FN6A 3E16B 4A7IB 2J98B 2GVFA 1S6LA 4ZCNA 1ZOMA 2P59A 2GKVE 2FYRA 3BIVH 2IOTA 3BTDE 3M5OA 4MNWA 2QE7D 4WWYA 4LZ1H 3M61U 1O35A 1K1NA 3QK1A 4NIVA 3GY4A 3PMJA 2EI6A 1O5GH 1Z1IA 1MTNC 3ZZ3A 3LGYA 1BA8B 2VWOA 1O3NA 1CSOE 4ABIA 4SGBE 5DP3A 1RTKA 1LVMA 2V7QD 1W14U 1WOFA 1AD8H 3MH6A 2IN2A 1P2IA 2F9VA 7GCHG 5HXFA 1CU1A 3D65E 1P03A 1AO5A 1TQ7B 1D3QB 3PTBA 4I7YH 4O03A 3ENSB 4BAKB 2GMTC 3TJVA 2WINI 1QHRB 1YPHE 2BOHB 3JZ2B 2A4QA 1RIWC 3SUEA 3RMMH 2HPPH 1O3FA 2CMYA 5A8ZA 2HOBA 4YLUA 5LPEA 2PSXA 1EZQA 3UIRA 2ZHWH 1O3DA 3BTEE 1BRUP 1V2ST 2PKSC 1N6YA 2FESH 5GIBA 4KKDA 2FLBH 3A7XA 4H6SB 2G55A 2OK5A 5EJLA 1ACBE 1TNHA 1S85A 3GY5A 4WMDA 3ZVAA 1A0LA 5GCHF 1YPHC 1BMFD 1XUFA 5CMXH 1UVSH 1N6XA 3BTQE 5H4IB 3E3TA 4YOIA 1GHVH 4DT7B 2DE8A 2W7SA 1GJ4H 2IPHA 3UNSA 1MAXA 5BRRE 2OP9A 2ZCHP 1GWAA 1HXEH 1QQ4A 1UVOA 3U98H 1AN1E 3A89A 1SGNE 2EY4C 1TGTA 2FP7B 3SN8A 2C3SA 1C5VA 2BOKA 1EJAA 3TLOA 4TWYA 3V7TA 1DY9A 1GHYH 2Y5HA 2PUXB 4B2AA 3STIA 1GBDA 1L4DA 2ZU3A 1COWD 3VXFH 1ETTH 4LXBH 1IQKA 4Q4LA 3A88A 1T8NA 3KGPA 5EXMA 2C90B 1P9UA 1G36A 1Q31A 4IC6A 4WMFA 5HKKD 2ZU1A 2ZHQH 3KQ5A 2JDID 2GCTC 3V3MA 1FPCH 1BDAA 3MMGA 1S0RA 4FVDA 1T8LA 1DSTA 3RXQA 2AEIH 2FEQH 5EQQA 1IAUA 1LHFH 1RXPA 1AI8H 2G5VA 5EU8A 3MTYA 2VNTA 1O3IA 1XUGA 4CRBA 4YM9A 1PQ8A 1LVYA 5DP7A 2OBOA 1C5YB 4GCHG 1TALA 1P05A 3DFLA 4RKJB 1LQEA 2B5TB 2TBSA 5I25A 2ZU2A 1PYTD 2Z9IA 1WU1A 3M5MA 1C1PA 1YM0A 4CH8B 1O2TA 1T8OA 2ODPA 1G3EA 1QQUA 1V2TT 1UJ1A 3OAAD 2QF0A 4CREA 4B73A 1OPHB 3P17H 1E38B 1EAWA 1YPEH 4DOQA 7KMEH 1OWHA 2IJD1 1ELGA 1P11E 1HBTH 1G2MA 1J15A 7LPRA 2NU3E 4I8GA 1WUNH 4CHAC 1MBMA 1UVTH 1SLUB 4F4OC 4MNVA 1DITH 4ZHAA 2FOBA 1J14A 3A86A 2BDBA 2ZIQH 3P8FA 1ANCA 1NU7B 2ZFPH 2F43B 3RM0H 3VEQB 6GCHF 1O38A 3QO6A 1OWIA 2JETC 1YYY1 3AK5A 1NC6A 4K3JA 5IDKA 1O3AA 5FPSA 1G30B 1HAPH 3RXFA 4O97A 1A3EH 5EGMA 1O2SA 2Q6DA 3H5CB 1O5BB 1O3CA 5GNDA 1ANDA 5FPTA 3P6ZB 1W11U 1K1MA 4NFEA 3CNRA 2VWLA 2OTVA 5A0CA 3R3GB 4XBCA 1AUJA 1YF4A 1UVUH 3A7TA 4OGYA 1A61H 2PGQB 1TNLA 2FXRA 4FOUC 1FY4A 1HAHH 2UWOA 3N7OA 1VITG 3PB1E 3P8NA 1BMMH 3P8OA 1KDQA 1O3MA 3EYDA 2YNAA 1UMAH 4A1VA 4X6OA 1T31A 1MCTA 1FUJA 1WBGB 2EC9H 4YLQH 4OS7A 2XC5A 2FTMA 2R3UA 1YLNA 1ZTLA 2OXSA 5DK1A 1K1LA 5GDSH 1ELVA 4RKOB 1C5RA 1TX6A 3PV4A 1ZLRA 1O37A 4D7FA 1HCGA 1C2IA 1ZGIA 2ZPQA 3ZZCA 1IQIA 3Q3XA 4K1EA 3PMHB 1BMLA 3A84A 4LK4A 3MU5A 2IJOB 2WZQA 1HYLA 1YLCA 5C94A 2Z94A 1UTNA 4X2XA 1ZPZA 2FYQA 4BTTB 4UFFH 1ETSH 1K1PA 2V0BA 1ID5H 4ABBA 3BEIB 3SV7A 1LDTT 2VWNA 1V2RT 1C4V2 2J5UA 3LT3A 1NRQH 3SU6A 4Y7BA 2A7CA 1GBIA 1O2YA 1C1NA 3RDZA 1BTUA 3RXMA 4Q80A 4TY6A 1ZYOA 3SI4H 4NA8A 1C1TA 1TRNA 3BTTE 3FOAA 4UDWH 2A0QB 1QIXB 1Y5AT 3ZZAA 3TNTA 2QCYA 4LOYH 3SNDA 9LPRA 1V2NT 1MTWA 5T6DA 1P04A 2YOLA 3U8TH 2ZCLP 1YY3A 4WJG2 3GCHB 3LIWA 4ABGA 1GBAA 3SUGA 5LPFA 2V35A 3H09A 2HLDD 2OUAA 1GGDB 2FDAA 2PKAB 4UE7H 3TH2H 6CHAB 5DP4A 1JOUB 1FPHH 3RC5A 1W8BH 2A32A 2HVXA 4X1QU 2A4GA 1KY9A 1V3XA 2STBE 2J92A 1TMUH 1VJ9U 4FXGH 1QGFA 1IQHA 3A82A 3A80A 3BTFE 4ZUHA 4ZKRU 3A87A 3ZVDA 1BTHH 2XRCA 4JK5A 4UD9H 4GPGA 1S6HA 1EB1H 3QZRA 3KCGH 2AMDA 1MBQA 4GLYA 2BY5X 4Z6AH 4NIXA 5JDUB 1T32A 1RD3B 4O9VA 5EXNA 1DOJA 3SGBE 4ABEA 4Y0YE 1GCTC 2BDAA 2PKAA 3UQVA 2B0FA 3SYJA 2ZHEH 3TK6A 1HAZB 4ESTE 3QTOH 1CBWB 3ATKA 3HK6B 3SJIA 2H9HA 3PLBA 1FQ3A 1P57B 1XX9A 2XBVA 2ZU4A 2KFWA 3K6YA 5E0HA 5AF9H 1GBMA 4FVBA 2ZDMA 2P93A 1TNGA 1EZXC 1C2HA 2AERH 1GJ6A 4MTBA 1QL9A 3M36A 1V2WT 2WPIS 4OGXA 1THPB 4ZHMU 2NU0E 2XBXA 2W5EA 2H6MA 2ZKSA 4AORA 1O0DH 1YP9A 3PLPA 1GCTB 1EP5A 1WAYB 2NU1E 4Y7AA 3AW1A 2GJGA 2ANYA 2AIQA 3RC4A 1K22H 1GI8B 1NRSH 1TX7A 2HWLB 1TYNA 2O9QA 4JZ1A 3ZVBA 5IK2D 3RXVA 3MFJA 1O5AB 4Y8ZA 4E06H 1NRNH 3A8AA 2EEKA 3QUMP 5K0HA 1T4VH 2BD9A 1SC8U 2VB0A 2WPLS 5T6FA 1YPGH 4WMEA 1DWEH 2GDDA 3K2UA 1BT7A 5G4BA 4TYDA 1SB1H 5EW1H 1ZHMA 1FAKH 4SGAE 1HUTH 3E0PB 2B7DH 2FWWA 1OOKB 2NU4E 3E8LA 1TFXA 4X2YA 1A0HB 4WXIA 1P8VC 1TPSA 4BOHA 1SGQE 1EASA 3DSOA 3LH1A 1SFQB 1NBME 3E6PH 2ANKH 3SHCH 1TB6H 4UONA 4X1SU 5K7RA 1P2MA 3LGUA 1P06A 4Q7XA 5TCCA 3FP7E 1HAOH 2FMJA 1D3TB 3NUMA 1ELCA 3P92A 1AIXH 3GY6A 1NTPA 1BUIA 4XFQA 1GBBA 3MU8A 3KNXA 1HAVB 4HG6A 3MNSA 1AZZA 1L1NA 1A1RA 1MU6B 4TPYA 2I6QA 2SGFE 2KR7A 2WUCA 2PV9B 5TCAA 3UPEA 5DP8A 1AMHA 1ZSLA 2Z9JA 1YPKH 1D4PB 2IPQX 2YMSD 2TGTA 1O3KA 1GBJA 4P00A 3S9BA 1J17T 1QBOA 1Y3YA 2OQUA 2Q6GA 1BMNH 3K65B 3EE0B 4FUBA 1NN6A 5E0JA 1ANBA 3LC5A 1QNJA 5L30H 1QA7A 5F8XA 1EAUA 1CA8B 1TNKA 3QDZB 1TAWA 2GMTB 3ATMA 1WYKA 4MPXA 3S7KB 3MO6A 5HM2A 1ARBA 1C5NH 1C2JA 2ZI2H 1K21H 1QRXA 2AMQA 3ODFA 1EATA 3DCLA 4MPVA 3LU9B 1AZ8A 5A0BA 1C5WB 1MTVA 2RA3A 1O3PB 6LPRA 4U32A 4NG9H 1FN8A 1WTGH 2K8IA 1L4ZA 3BIUH 1HAVA 2ZF0H 1GI0A 1AQ7A 1GVZA 1BZXE 1SGFG 4DJZB 3TGKE 1OXGA 2ZDLA 2XWAA 5FCKA 1ZSKA 1RRKA 1Y5BT 3BN9A 1A5HA 1SGYE 1NO9H 1AWHB 1ZJKA 1GMHG 1FIWA 4E05H 4AGJA 2BX3A 1BIOA 1SQRA 3BTWE 4GVUA 5A09A 2TPIZ 1GBHA 1KMHB 4FU7A 2A2QH 4K5ZA 2R9PA 3P95A 4Q2KA 1KTTB 1KXFA 2FI4E 2C8YB 1Z8JB 3MO9A 3SV8A 1P09A 3SI3H 3SQEE 1BTZA 1DUAA 1IQFA 2FOGA 1ZPCA 3KIDU 1OYQA 2CF9H 5EQRA 4ABJA 4D76A 3ZVCA 4ISIH 1PQ5A 2F3CE 1XKAC 2ZGBH 4OS2A 3LKWA 4H4FA 4ISLA 4AG1A 3R0FA 2Y7ZA 2VWMA 4JZFH 3UREA 1JRSA 1H9HE 1HNEE 1EAIA 2BDIA 2XNDD 1SMFE 2WSSD 1CVWH 2ZECA 1F0TA 2BD3A 4U30A 1E34B 2C8XB 1MKXK 2UUFB 3WW7A 1NPMA 1X7AC 2M2AA 4NWKA 5CE1A 3KF2A 1FY5A 2PUQH 4NZQA 2R3YA 1TBQH 1F0UA 2BVSH 2PKSB 4GHQA 4X1NU 2TIOA 4BAOB 3MNCA 1YPLH 3SGQE 3SNAA 1WQVH 2BLVA 1AVWA 4WH8A 3RXRA 3HGNA 1SBWA 1V2OT 3UNRA 5BPEA 1L1JA 1S83A 2RCEA 1UTJA 1ESAA 5FCRA 1EXFA 3BEFB 4CRCA 1EJMA 1JIRA 2C8WB 3OY5U 1O3HA 1EOJA 1UO6A 2EQNA 1LCYA 4INLA 4NSVA 4X0WU 1Z8IB 1UCYH 2H5DA 4YOGA 4U2WA 1Y3VA 1FX0B 2BD4A 1MCVA 2VU8E 3U9AH 4ASUD 4DG4A 5F53A 2A7JA 3I78A 2XBYA 2FOEA 2NU2E 5ESBA 1FI8A 5KGOA 1EP6A 1Y8TA 3RXBA 1P0SH 3M37A 4OS6A 1SLXB 4OS1A 1TNIA 3GDVA 5EPNA 1AWFH 3H7TA 4YESB 3TITA 1SKYE 2ANMH 3RXTA 2VGCC 3TNSA 3V0XA 1BTYA 2QIQA 3BEUA 1A4WH 3JZ1B 4NWLA 1JBUH 5E8EH 1IQGA 1FNIA 2HLCA 2G4TA 3PMBB 1HDTH 3SW2B 2ZHDA 1F92A 1PPZA 1XVOA 1KXCA 2JIZD 3UTUH 1W0ZU 3TK9A 3ZV8A 3D62A 5T3HA 1OWJA 2ODQA 2QXJA 3KN2A 4ZKNU 3ESTA 1UCYE 4Q7YA 2A1DB 3QLPH 1E36B
chains in the Genus database with same CATH topology
3EA9A 4O3TA 3E1XB 1G37A 1E0FD 4BXSA 2ZO3H 3RLWH 3UY9A 1K28D 2QV1A 3F1SB 2FOAA 3PWBA 1C1MA 5EPYA 4X8SH 1F7ZA 3TU7H 4HI3A 2A2XH 1AHTH 5DKMA 2PSYA 4M7GA 2OC0A 1ELEE 1SGCA 4Y8YA 3MH4A 3T25A 5F8TA 1DLKB 1C5LH 2FX6A 1GG6C 1QR3E 1T8MA 1WSSH 1C1UH 1C5PA 2Y6TA 1P2OA 1PPBH 3AW0A 3T28A 2BLOA 1TNJA 3FVFB 4BTUB 3B9FH 1A0JA 3SUFA 1OWEA 3QZQA 1MTNB 5DP5A 3PLKA 2CJIA 2PFEA 3KQDA 1PQ7A 2HALA 2ZWLH 1YC0A 2P95A 2R2WU 2TGPZ 3OU0A 4GSOA 1K1OA 2Y82A 2GT8A 3M5LA 1CA0B 1GJDB 3MH7A 4CRAA 3ZV9A 2BQWB 3BTME 1XUJA 3CS7A 3MH5A 4CHAB 4DW2U 1AGJA 2P3TB 2Z9LA 3MU1A 3E0NB 1C1QA 3RXHA 1AFEH 1SL3A 1SVPA 5AVDA 2BQ6B 3OTJE 1LVOA 2W26A 3ODDA 1N1LA 4A92A 1ZRBA 3QGNB 5E2PA 4AYVB 1TA2A 1O34A 4Y10E 5DP9A 3UWIA 1LHEH 1P2KA 1QB1A 3T26A 1V6DA 3AAVA 1CGJE 2W3IA 1CA0C 4WH6A 1L0ZA 1F0RA 4X2VA 1UK4A 1PPCE 2WYGA 1SFIA 3VFEA 1SGEE 1YLDA 1GI1A 1HPGA 4J1YA 3B8JA 1CE5A 3RMOH 2D26C 5EXLA 1O2XA 2VIWA 1A3BH 1FONA 1LPKB 1QL7A 4MG3A 5FXLA 1G32B 1O2RA 2GV7A 1CT2E 2HGTH 2VJ1A 2ZA5A 3AAUA 1XVMA 3T2NA 1Q3XA 4BAHB 4Y76A 5F8ZA 1C2FA 1GBKA 1HV7A 1SLVB 2QC2A 1AE5A 1INCA 1HJ9A 3O8DA 3Q3KA 3S9AA 1FLEE 4ZH8A 2OC7A 1O2WA 4ISHH 1L2EA 3HATH 3RXJA 1LPZB 1Y59T 4KTCA 1ZGVA 3TK5A 1PJPA 1TMTH 2B9LA 1M9UA 5AFZH 1MKXH 4KTUA 1HJAB 3F9GA 2ZGJA 4FU8A 3SJOA 1TBRH 3F9EA 1DXWA 4XBBA 1SLWB 3C27B 2OINA 3RXSA 3T29A 3BG4B 1O2OA 3LOXA 4ABAA 1DANH 1UTOA 1Q2WA 2WPKS 3GY7A 1GBLA 3B23B 1BB0B 1C1RA 3KEEA 3TIUA 3RLYH 3FZDA 2G8TA 3VB4A 1TOCB 6CHAC 1Z1JA 2O8LA 1SGFA 1MQ5A 3SORA 1O2LA 5DPAA 8KME2 3M7QA 1GBTA 1PFXC 1VGCC 4O3UA 1E35B 2C4FH 1MH0A 4OS4A 4ZKOU 4X1PU 4ZAEA 1THRH 3SV2H 1Y3UA 4AN7A 1QJ6B 5L6NH 4FUHA 1IQNA 1JWTA 2J95A 1BCUH 1D9IA 2ZZUH 2THFB 2DE9A 1RJXB 1SI5H 4CBNA 1O2PA 1V2PT 3U1JB 1LTOA 2Q6FA 1J8AA 1NFUA 2RG3A 1HB0B 1Z7KA 3RXEA 2H1UA 1VITF 1DY8A 1Y3WA 1YPMH 2DUCA 4Y11E 2BD7A 3RU4E 2CHAB 4CH2B 3GDUA 3ZZ9A 2LPRA 3PMAB 1XUKA 2WPMS 4NA9H 2PWXA 3IG6B 2F9OA 2O8MA 1H8DH 5CHAB 4J2YB 1O30A 2BHGA 1XKBC 1QRZA 5JB9S 2FTLE 3FAOA 1PYTC 1IOEA 2UUYA 2BDHA 3EDXB 3TJNA 1VITH 4ABFA 2GV6A 2F9UA 2BMGB 1OP0A 5AFYH 3A7VA 1BRBE 4I31A 2ANWA 2QA9E 2H9TH 1C1WH 5EQSA 1P3EA 3LH3A 8LPRA 4MVNA 2XWBI 1D6WA 1NU9A 3GDSA 2AGEX 1YCPM 4WXVA 4AFSA 2BM2A 2CN0H 2A7HA 3S9CA 4IN1A 4WVPE 5LPRA 3VGCC 7ESTE 2QN5T 2ZDKA 4I33A 2VVVA 2O8TA 1EPTA 4TPIZ 1ELBA 2VGCB 5C5NA 3LJOA 3H7OA 4TWWA 1BJUA 3FZZA 3DD2H 3GYMA 1UHBB 2ZFTA 4FUEA 1NRPH 4X8VH 3LGWA 1C5ZB 5AHGH 2FPZA 2VIPA 1QY6A 1UHBA 5A8XA 4ZMAH 4BAMB 1ZMNA 2V6NA 3UFAA 1KLIH 1ZSJA 3VB3A 4X2WA 3RXLA 3LGVA 3ZYEA 2J2UA 1O2HA 4NFFA 2OC1A 2VH0A 3LGIA 3GY2A 3L33A 1C2LA 4B71A 1HXFH 2ZU5A 8GCHG 2PTCE 2BVXH 1A5GH 5HGGA 4VGCC 1S82A 2F9NA 3M5NA 5E2OA 4DCDA 1MKWK 3PWCA 1H9LB 1GHWH 5EOKA 4D8NA 1DUEA 2A5KA 3KL6A 3MWIU 1KLTA 2F91A 1AU8A 3ATWA 3URDA 2HRVA 2AFQB 2YNBA 2BLQA 4I8KA 4JMYA 2GZ8A 5GJ4B 1TOMH 4B2BA 4XE4A 4H42U 1NFWA 3GICB 3SJ9A 2BD8A 3ZVFA 2ZQ1A 1WCZA 3ATIA 3BSQA 3PYHA 1A46H 1HAXB 3RXGA 1GDNA 2ZFFH 4HZHA 2H9EH 2BDCA 1YCPK 1D3PB 4VGCB 2SGPE 2Y5FA 1OP8A 5FX6A 1OX1A 3TH3H 1O5CB 4DY7B 1GJAB 3Q00A 1LHCH 2A31A 5C2ZA 4AGKA 2BTCE 5IYTA 3VB6A 1IQJA 4GUXA 1KXDA 5L2ZH 5J4SA 4A6LA 1C5MD 2ZFRH 3DUXH 1DPOA 3D49H 3NCLA 1B5GH 2TRMA 4MQAA 1TPAE 5GCHG 1XMNB 1BRAA 1UTQA 4FUJA 3RM2H 1GBEA 1G3CA 2OLGA 1FMGA 3K6ZA 3TPIZ 1GJ8B 1ARCA 1ZRKA 4MLFB 1BHXF 2G81E 1PPGE 3E91A 1NZQH 1EPTC 2GZ9A 2XBWA 1O36A 1VCQA 3M3SA 1C2KA 1DX5M 3SBKA 1O3OA 2M5TA 3RXOA 3WY8A 1PPFE 5C5OA 1LVBA 1TRYA 3S69A 1FY1A 3OYPA 2FLRH 4IGDA 1CT4E 4IS5A 4RSPA 1GBCA 1HAGE 3NXPA 1SOTA 2FS9A 5F6MA 5C3NA 4QT8C 2G00A 4Y79A 3QWCH 1Z6JH 5A2MH 2GDEH 2J9NA 5JBCS 4X8UH 1Y5UT 1O2GH 2SGEE 2A45B 4JZDH 2R0KA 2GTBA 1MTUA 1C2EA 3VB7A 3BG8A 1P9SA 3SQHE 3F9HA 3SHAH 2ZPRA 4ISNA 5FBEA 3UOPA 1NY22 1Z71A 5LH8A 1LKAA 1CQQA 1ELTA 2VINA 3SJKA 1W13U 4FUGA 3RMLH 2Z3EA 3ZZ8A 1NRRH 4ASHA 2D8WA 1O33A 4YZUA 3O8BA 3UNQA 3PROA 2H5CA 1VZQH 5CHAC 1DVAH 3M7TA 4D9QA 1KYNA 4KELA 1KXEA 3MU0A 1UVPA 2NWNA 2FS8A 2BD5A 3SU1A 1O2ZA 2BZ6H 3U69H 1TABE 2ALPA 2ZHFH 1SSXA 1O2UA 8GCHF 2PHBA 1DLEA 3W94A 5J4QA 3HKIB 1GCDA 1V2JT 1Z8GA 1TWXB 1V2UT 2BB4A 1QBVH 3NKKA 2GD4B 4Y71A 2JH6D 1VR1H 3TJOA 3FFGA 4K1SA 2AH4X 4AX9H 2ZEBA 1D3DB 2B8OH 3ITIA 5C20A 4NGAH 1MTSA 1GJ9B 4K8YA 2O8WA 3VGCB 1GMDG 4E7NA 3EQ0H 1AKSA 2QXGA 2P3UB 1AB9B 1VCPA 1C1OA 4CRFA 3MYWA 1IQMA 2CF8H 2P3FH 3GCHC 2AS9A 3QGJA 3RU4T 4D9RA 2SNWA 3PM3A 5FHTA 3SU4A 1TPOA 2PR3A 3TGIE 1TE0A 1GDQA 4FUIA 1ABIH 4Q7ZA 1MZDA 1MQ6A 1G3DA 2XTTB 1GHBF 4B74A 1AKSB 2QYIA 5C1XA 1DWCH 2UUKB 3SV6A 1VGCB 1HJAC 4R0IA 4YTAA 1QL8A 1WV7H 3DFJA 1F5LA 9ESTA 1OWKA 2OD3B 1F2SE 3ZZ6A 1D6RA 3ZZ5A 3SZNA 1B0FA 1F0SA 1W3CA 3SOSA 3U8OH 1SGIB 2EA3A 3S7HB 1J16A 2GGVB 1UK2A 2BVRH 3UWJH 5JBTA 4FUFA 4OS5A 1GI2A 4E7RG 4FUCA 4IMQA 1SOZA 5EG4A 1BTXA 2C93B 5E0GA 3RXKA 3VPKA 1IQEA 1TGNA 4FUDA 3SNBA 4AB9A 1C1VH 1F5RA 4MPUA 5DP6A 5HMAA 3GY3A 2BXUH 2FODA 1NFXA 5EODA 1G9IE 3NZIA 3A83A 3UOUA 4BNRA 3F6UH 2JETB 3SU2A 3KQEA 2FX4A 2Z6BD 3UR9A 4WF8A 2AGGX 2AMPA 4I8HA 1HAIH 1LKBA 3A81A 1RGQA 3SJ8A 3SUDA 1DSUA 1W10U 2W7UA 2Z3DA 3BG4C 1O3EA 2F9BH 1ZTKA 3ZZ4A 1ESTA 1XM1A 3SU0A 1TBZH 4A1TA 2XNIA 4A5TS 1SQOA 1C2MA 1O2KA 1RIWB 1SGRE 1LQDB 1JMOH 1DT2A 1JXPA 2A5IA 2SGQE 2HPQH 3MNBA 5FX5A 4CR9A 4ABDA 1JIMA 3S0NA 1GI9B 1TX8A 3KQBA 1QA0A 1RTFB 2XC4A 3KHVA 1GI6A 1O5FH 2PTNA 3L3TA 4JCNA 4XOJA 3ZZBA 1O2IA 1YCPH 5DG6A 1LHGH 1CGIE 1DS2E 1GI7B 1P10A 1MU8B 1P3CA 1B0EA 1O31A 3LDXH 2J34A 4I8JA 4DIHH 3PTNA 1AB9C 1C5XB 2ZDAH 4BTIB 2ZFQH 3F9FA 1SHHB 3ZZ7A 1FIZA 2ZPSA 4B75A 2R2MB 3TH4H 1PPHE 2BDYA 5C67A 2ZGCA 1TGBA 4AFQA 1BTPA 1T7CA 2KAIB 4AG2A 4XBDA 2ZTXA 4IN2A 3KQCA 2BY9X 1FY3A 3CS0A 3RC6A 1K1JA 4DIIH 1B7XB 1O2MA 1SR5C 3QN7A 2V3HH 3HPTB 1EB2A 2Y5GA 2VH6A 3V13A 1W7XH 1H8IH 1OKXA 1ZPBA 4F49A 1C5SA 1GMCG 1GVKB 4UFEH 3ZVGA 1GI5A 2P94A 5JYIA 2FOFA 1AFQC 1S5SA 2AYWA 2OCVB 3LONA 1AY6H 1AE8H 1XXFA 1MMJN 1J9CH 1OWDA 5HM9A 2VVUA 1H4WA 5SGAE 1ZZZA 2FI3E 1O3GA 4IC5A 4DVAU 1BHXB 5JBBS 3EA7A 5C1UA 1C5OH 1S0QA 1YKTA 1CHOF 1GHAG 1P12E 2BZAA 2I6SA 1P02A 3FANA 3LC3A 8ESTE 5A0AE 1YPJH 1DM4B 1W0YH 2P16A 1G3BA 4Y8XA 1O2QA 2XC0A 3RXUA 1BRCE 1NFYA 3CP7A 4INHA 1ELFA 1TONA 3EGKH 2A5AA 1V2KT 1QFKH 3ATLA 1FY8E 1SGPE 4JK6A 4MPWA 1MAYA 1N8OB 1EPTB 4D7GA 2LNCA 4MNYA 2BY8X 1XUIA 2ZTYA 1AFQB 3EA8A 3GCTF 1CBWC 1XXDA 3RXAA 2WPJS 1ZMLA 1SQTA 5TJXA 1C9TA 1ESBA 2G51A 1F5KU 3GISB 1SHYA 1GMCF 1T4UH 1EKBB 1U6QA 5LGOA 1QB9A 5DGJA 1OYTH 3AVZA 2XYAA 2VIVA 4R8TB 1UTMA 1V2MT 2FOCA 4B2CA 5DO4H 3DT0H 3TGJE 3HK3B 4MNXA 4NZLA 3MI4A 5JBAS 2G4UA 3VB5A 3I29A 2OBQA 1MKWH 4K2YA 2PW8H 3RXIA 3LPRA 4AB8A 4ABHA 1RFNA 5F03A 1BMAA 1S81A 1UK3A 5GXPA 2ZTZA 1KDQB 5HYOA 2CHAC 1YGCH 2QAAA 1FAXA 4KTSA 2QY0B 4INKA 4X6MA 3QTVH 4CRDA 3MOCA 4AOQA 4Y6DA 3P8GA 4CRGA 1O2NA 2Z9GA 3RU4D 4DURA 2BYAX 1CGHA 3ZZDA 2ZDNA 2ZP0H 2O8UA 3M3VA 1ELAA 3SU3A 1V2VT 3SO3A 4X6PA 1PQAA 2ZNKH 3GCOA 4PROA 1C9PA 2D2DA 4YT6H 2SGAA 5GPIB 1BQYA 4ZROA 4NIYA 1RS0A 3QX5H 3NK8A 3GY8A 2JKHA 1Y3XA 3F68H 3URCA 1GI4A 2WV5A 2UUJB 4JYTA 1K1IA 1A5IA 3DA9B 1GI3A 2CV3A 1EAXA 3LJJA 2SGDE 2VIQA 3Q3YA 1TRMA 1CHOG 1GHAF 1GJ7B 1CHGA 1TA6A 3NWUA 2Z7FE 2PLXA 1IHSH 1CT0E 1O2VA 2P8OC 1A7SA 2BQ7B 3PO1C 3A7YA 1KXBA 2ULLA 1P2QA 1ORFA 3OY6U 4XSKU 1TLDA 3SU5A 3A8DA 1TPPA 1O3BA 4UEHH 3RP2A 4Z0KA 1EZSC 1GVLA 3I77A 2J94A 3A7ZA 4AFUA 4A1XA 1GL0E 1O39A 1EOLA 1DE7H 1LMWB 1SQAA 1C4Y2 1O3LA 1K9OE 1QURH 1EJNA 5JB8S 3G01A 1DICA 1DWDH 2F9PA 4HFPB 1NROH 4JZEH 1VCWA 2G5NA 2UWLA 1SG8B 3GCNA 4GHTA 2AGIX 1GL1A 3T62A 3MHWU 2SNVA 2QGRA 1LO6A 3FP8E 2VIOA 5A8YA 3GYLB 4CR5A 1EZUC 3BTHE 2ZGXH 4U01A 3K9XB 2GX4A 1ABJH 2GCHG 2XCFA 5FBIA 1TGSZ 3CENA 2HNTE 2A4OA 1KLJH 2ZC9H 3PO1B 2WPHS 4B76A 4K8BA 1TMBH 3NPSA 3Q76A 1EQ9A 2RDLA 1P2JA 2Z9KA 4ZHLU 1SGTA 4X1RU 1H9IE 1O32A 4I32A 3MNXA 1PPEE 3T5FH 1Z6EA 5B6OA 4BXWA 1GDUA 2HNTC 1BITA 4K60A 1IQLA 1UCYK 1DWBH 2F83A 1QRWA 4I8LA 3UQOA 1OSSA 2GCTB 3A8CA 5ETXA 4IBLH 3M7UA 3P70B 1NM6A 1XUHA 1AVGH 2VVCA 4H6TA 1E37B 4YO9A 3SV9A 2TGAA 1QB6A 4BAQB 3UUZA 4K1TA 1ETRH 6ESTA 2STAE 5ESTE 1FJSA 1Z8RA 4FU9A 3RXDA