1MBQA

Anionic trypsin from pacific chum salmon
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
220
structure length
220
Chain Sequence
IVGGYECKAYSQPHQVSLNSGYHFCGGSLVNENWVVSAAHCYKSRVEVRLGEHNIKVTEGSEQFISSSRVIRHPNYSSYNIDNDIMLIKLSKSATLNTYVQPVALPSSCAPAGTMCTVSGWGNTMSSTADKNKLQCLNIPILSYSDCNNSYPGMITNAMFCAGYLEGGKDSCQGDSGGPVVCNGELQGVVSWGYGCAEPGNPGVYAKVCIFNDWLTSTMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin
publication title Crystal Structure and Nucleotide Sequence of an Anionic Trypsin from Chum Salmon (Oncorhynchus keta) in Comparison with Atlantic Salmon (Salmo salar) and Bovine Trypsin
pubmed doi rcsb
total genus 51
structure length 220
sequence length 220
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2002-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mbqA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1mbqA02
4ZXXH 4OGXA 4F49A 3VB3A 1ZSLA 4R0IA 2D8WA 4WMFA 1SGQE 3TPIZ 3KL6A 4FU7A 4AGJA 1P9SA 4D8NA 2ZDNA 1D3DB 2RDLA 1GBFA 2ZDMA 1HDTH 3SUFA 1AQ7A 1O3EA 2W3IA 4XOJA 3SV6A 1O33A 4NZQA 3RXOA 2BQ6B 2EI8A 1MQ5A 1HLTH 1AWHB 1UK4A 2RA3A 4JZ1A 4ABGA 4H6SB 3LGWA 2ANYA 3T27A 3RXPA 1KYNA 3A88A 4ABEA 1XM1A 3LOXA 2NU3E 2ZFQH 2BY7X 1ZPBA 1ZJDA 2NU1E 1OYQA 1EOJA 1WTHD 2HALA 1W14U 3NXPA 5DP4A 4K8YA 1O5DH 2HNTC 2B0FA 1ELDE 1KLTA 1RS0A 2ZFPH 3SHCH 4Y79A 3TJOA 2VGCC 1CT0E 2BDGA 1VITG 4KKDA 3SV7A 4RN6A 1AZ8A 5C20A 1YPEH 2BZAA 1ETRH 3G01A 4Y8XA 3UNQA 1GDQA 2D1JA 1LKBA 3TGJE 4GVUA 1TGBA 1VJ9U 1ANDA 1QRXA 2QA9E 3MNSA 3LKWA 1HRTH 3CS7A 4MPUA 1A2CH 3LGVA 2ZGXH 1C2LA 4DJZB 1C1UH 1S5SA 1UVOA 4INHA 4A1XA 4CHAC 1BTPA 1C5RA 1P03A 1KDQB 2QXJA 4CBOA 1ZRBA 3T25A 2XNIA 1D6RA 1QL9A 1ELTA 1Z1JA 2NU4E 1CE5A 2G51A 4ISNA 1XUHA 1SFQB 2VWNA 2Y6TA 2FTLE 3RU4D 3PWBA 3RMMH 1GHBF 2QXHA 5FPSA 5L30H 1AVGH 1GBDA 2XTTB 2Y7ZA 1L1JA 3UOPA 1O5GH 2BD9A 1W0YH 1TGNA 3MO9A 5EQQA 3QDZB 1GCTB 1MCTA 1UCYK 3VB7A 1TX8A 5BPEA 3VXFH 4X2XA 2F9PA 3LDXH 1GBTA 3SI3H 1SL3A 1OP8A 3QN7A 4X8SH 4DT7B 1NC6A 5FBIA 1HGTH 4YLUA 1UHBB 6CHAC 2A4OA 4A1TA 1CU1A 4JYVH 3O8RA 1QB1A 4BAHB 4R8TB 1THSH 2GDDA 2ZPQA 1EZQA 1TYNA 3PLBA 1C4V2 4TPIZ 2BDBA 2ZO3H 1IQEA 1UTOA 3STIA 3GCTG 3P92A 2NU2E 2P8OC 3HATH 1DM4B 1NO9H 4Y8YA 1UCYE 1FPHH 2VIVA 1V2VT 4K60A 3TJVA 1Y3XA 1LDTT 5FBEA 1FIZA 3LGIA 3PM3A 1XX9A 3L33A 1ZMLA 2R2MB 1AU8A 3QK1A 4TPYA 4Y76A 1OYTH 2KAIB 1C2HA 2BDIA 1GBIA 1P02A 1G9IE 5A8ZA 1M9UA 4BANB 2WUBA 2FI5E 4YZUA 3W94A 4GSOA 1MD8A 4DCDA 2FWWA 3SI4H 4A1VA 1ZGIA 3UTUH 1LHDH 1O30A 3GICB 3KF2A 1CVWH 3ZZ3A 2ODYB 1A0HB 3ZVBA 1RJXB 1AFQC 2H2ZA 1BTXA 5AFYH 4BTUB 1SMFE 3A7VA 2XBWA 4BXSA 4DGJA 4DURA 5L6NH 2OC7A 4DOQA 3E8LA 1Z7KA 3MH5A 1WQSA 1HAOH 5HM9A 1AY6H 1O2NA 1PYTD 2ZG0H 1V2WT 1QBNA 1GPZA 1L4DA 5CHAB 1J14A 3SJOA 5J4QA 3OU0A 4XDEA 5AHGH 4AZ2B 5F8TA 5LPEA 1GHVH 1BJUA 3HK6B 1TRMA 2HLCA 1P2JA 3S7HB 1ZPCA 2ANWA 2BOKA 1Y3UA 1TA6A 1P09A 5DPAA 2FYQA 5E2OA 1FY1A 2AYWA 3O8BA 2AIPA 4ABAA 1EAIA 2C93B 2A0QB 1EB1H 4ABHA 1QB9A 3QLPH 2OD3B 4XBDA 2D2DA 1OWHA 3MNBA 2F9UA 1PPEE 3MU0A 1QQUA 4IC6A 1H8DH 1C1RA 1Q3XA 3T5FH 1SQAA 1CHOG 2FI4E 1P8VC 1VGCC 4X1SU 1NTPA 3PO1C 1P57B 3LH1A 1F5KU 1O5AB 4ZUHA 4IN1A 1V2TT 3S69A 3ZVFA 1O2GH 2CF8H 1PQ8A 3OSYA 2JETC 2A5KA 3K65B 2ZPSA 3RLYH 1S83A 1K1OA 1PPBH 2PTCE 2BXTH 2XCFA 3PMJA 1MMJN 4X8TH 1N6XA 2CMYA 2ZTZA 1BCUH 1DE7H 2WV4A 2EA3A 3GCNA 1UCYH 3D65E 1UVTH 1ZMJA 4JK5A 3PMBB 1QFKH 1TWXB 2K1QA 1OPHB 1ZRKA 4UFEH 6GCHG 1ESTA 1ETTH 5E0HA 1O3CA 4O3UA 1KTSB 3LJOA 2VVCA 3A8AA 1J15A 1ESBA 3ZYEA 2F9BH 3K2UA 2CHAC 2AGGX 5GPIB 3RXRA 3RXIA 2ALVA 4YLQH 1V2NT 2ZECA 1KIGH 4UFGH 4AFUA 1F7ZA 1F0RA 1HUTH 5CMXH 2CJIA 1Z8RA 2ZHEH 5C1XA 6LPRA 1P9UA 1Z71A 2B7DH 1NU9A 3KCGH 3Q00A 3NKKA 1XMNB 5FCKA 1RIWB 3BTWE 2OINA 5A0BA 1TX7A 1MBQA 1FN8A 1Z6JH 3MU5A 2EI6A 2FODA 2GD4B 3MU1A 5EPYA 2W5EA 1N1LA 3K6YA 5G4BA 1O3OA 1O3JA 4WMDA 1C5XB 5HGGA 4DVAU 1EP6A 3BEIB 5DKMA 1BOQA 2BX3A 4GAWA 1V2ST 5EQRA 2GDEH 3MWIU 1K1MA 2VIWA 1WSSH 3MU4A 2ZFSA 2JH6D 3HKIB 3SU6A 3D49H 4X6OA 2V3HH 1K28D 3MNCA 3EQ0H 2FS8A 2SGDE 2Z6BD 1F0UA 1C5OH 3HK3B 1ANEA 2BD5A 1C1NA 5C2ZA 3ZZ6A 3RXFA 2EEKA 3PTBA 4MG3A 4NIYA 4O97A 2FLBH 2A45B 1UK2A 1WAYB 4UEHH 2R3YA 4AOQA 2ZF0H 1TNJA 1AUTC 4IBLH 1MTWA 1ELEE 3OTJE 1ZMNA 2UUKB 3QO6A 2V0BA 8KME2 1D3TB 2BD2A 5IYTA 1P05A 1NN6A 3MH7A 4I32A 3ODDA 1GVZA 5DK1A 3MMGA 4MNYA 3AAUA 4FUCA 3PV4A 1TONA 1T8MA 1TBRH 1TQ0B 2Z94A 2ULLA 1C2MA 4Y10E 4I7YH 1OS8A 1MAXA 3M5MA 3NZIA 4Q7XA 4IMQA 1INCA 3EA8A 1NRNH 4GHQA 2OC8A 2R0KA 3UQOA 1ANCA 3MOCA 2BLWA 1O2QA 2AGEX 4MVNA 3T62A 2OLGA 2HNTE 4KTCA 4X1PU 4X6PA 1BZXE 4D9RA 2PKAB 1Y8TA 1SLXB 4ABDA 1EAUA 4ZMAH 1DY9A 1CT2E 3RU4E 2I6QA 1ZHRA 2GZ7A 1K1JA 3Q77A 2FXRA 3TIUA 1YPLH 2WPLS 2BTCE 3BTQE 2IPHA 1EZUC 1QBVH 1SQTA 2ODQA 4NG9H 2VGCB 3TU7H 3FP6E 2ZDKA 1KXFA 3A7XA 3M37A 4CR5A 3ATLA 2ZFRH 1AKSB 4YO9A 3M5OA 1MUEB 1EP5A 3MFJA 2J4IA 4O9VA 4X2YA 1DXPA 5ETXA 1O3KA 5EOKA 2ZIQH 5A2MH 2ZU2A 1O3DA 1SLVB 4B2CA 1GJ6A 2ZU1A 2ALPA 2R0LA 3RXAA 1AN1E 4CHAB 1MD7A 1Z8GA 4IW4E 1BTUA 3SQEE 1O39A 2ZQ2A 1O2KA 1TBQH 1C4Y2 1H9IE 1TGCA 2P3TB 2F3CE 2O9QA 4UFDH 4ZROA 3ZVEA 2A4RA 1YYY1 5DP9A 8LPRA 2WPMS 3BG4C 1D4PB 2FMJA 4QT8C 7KMEH 1CHOF 1C1WH 1N8OC 4Y7AA 1O2SA 3SZNA 1Q2WA 3VB6A 4MNXA 1JRSA 2OCVB 1EKBB 1GL0E 3BTME 5DP3A 3TK6A 4IC5A 2Y81A 2TIOA 4OS7A 5C3NA 3TGKE 1GG6C 5GCHF 2IOTA 3M5LA 4NFEA 1LTOA 3RXHA 1TOMH 1GI5A 2BXUH 1O34A 1V2LT 2QYIA 6CHAB 1P3EA 1EPTB 2FOBA 4CRCA 4B2BA 1VITH 4AB9A 1ZOMA 1GI7B 5EG4A 2P8OB 1CA8B 2ZPRA 3ODFA 2ZHQH 1HNEE 1QNJA 2H1UA 1BTYA 2W7UA 3GY3A 1GBCA 1EJAA 3GCHC 1UTPA 2SGPE 4CR9A 1C4U2 1NFXA 2G00A 2Y82A 2QF0A 9ESTA 3TK9A 4X8VH 3FP8E 1HFDA 2THFB 2XC4A 5A8XA 1LHEH 1IQHA 5TCAA 1Z8IB 4IN2A 1MZAA 3U1JB 1NESE 3SNEA 3LGYA 2O8LA 2C8YB 2TGAA 4LK4A 1D6WA 4ZHAA 1V2JT 4U32A 3PWCA 3O8DA 2XC5A 1C5QA 1C2KA 1EXFA 3MI4A 3RMLH 1AFQB 1UO6A 3SV8A 2ZGCA 3M7TA 1QHRB 4MDSA 1TB6H 2CN0H 2GKVE 3GDSA 4Z6AH 2H9TH 1MKWK 2WYJA 1BHXF 4GHTA 1JXPA 2FTMA 1C5ZB 5FCRA 2SGAA 4KTSA 1YBWA 1G30B 2VVUA 1VR1H 1P06A 1BITA 1IQJA 1ORFA 3F68H 9LPRA 1ARCA 1EJNA 1B5GH 2O8UA 2OC0A 5EW1H 2C8ZB 1ABJH 3V3MA 1V2UT 4ZKNU 1QJ6B 2BD3A 2NU0E 1NRSH 3IWMA 2PFEA 5E2PA 4WWYA 3E6PH 2VINA 1RTLA 1H9LB 2ZTYA 1Y5UT 2CXVA 3ITIA 2QN5T 5GJ4B 2PLXA 5J4SA 1TPPA 1QBOA 4UONA 1S0RA 1ABIH 1DX5M 1SGFG 1UTMA 3KQCA 4ZXYH 1RTKA 3LU9B 4I8LA 1DANH 3URDA 1C1MA 2EC9H 2H6MA 3K6ZA 2O8MA 2P93A 1BIOA 1T4VH 1PFXC 2VWLA 2VH6A 1GVKB 3ZVAA 1A46H 4X2WA 1VGCB 1GBKA 3CENA 4K1EA 1QRZA 1RD3B 1F5RA 1C2IA 2Z9LA 3T2NA 1QB6A 1FLEE 1BTZA 2BMGB 2O8TA 3E1XB 3ZZDA 1OWKA 3E91A 1LQEA 1O5FH 1OOKB 1V2OT 1WOFA 3A7ZA 1GJ4H 1HAIH 1UVPA 1GDUA 2J94A 3VGCB 4A5TS 1CSOE 5T6GA 3UIRA 1TOCB 1LVMA 1TFXA 3P8NA 2Y5HA 3I77A 5IDKA 3ZZ5A 3U98H 1CO7E 1FI8A 4BTIB 1SQOA 1Y5AT 2WPKS 1XXFA 4D7FA 1KLIH 5EQSA 3UNRA 2Q6DA 1JRTA 1Z8JB 1GL1A 1ZR0A 2CHAB 5DO4H 1LPKB 3RXDA 5EPNA 1AVXA 1P11E 2QC2A 4KTUA 1P2IA 4JZFH 3C27B 3FANA 1QR3E 1XUIA 1FMGA 2PHBA 4ABJA 3MO3A 2RG3A 2ZDAH 1BMNH 4A7IB 2VNTA 2ZTXA 3L6PA 3LC3A 3VPKA 2FX6A 3RUOA 3GY7A 2XYAA 1SLUB 2W3KA 3BG8A 1BA8B 1GHZA 4NIWA 1XXDA 2PW8H 3LONA 1AHTH 5C5OA 2QXGA 2VIPA 2SNVA 1GHXH 1NFYA 4GCHG 3DHKH 2SNWA 2P3UB 3UY9A 8GCHF 2LPRA 3P8GA 1LHGH 4YESB 5ABWA 2GCTB 1F5LA 2ODPA 3RU4T 1O32A 1YPKH 3F9HA 5B6OA 5GWZA 3KN2A 1GHWH 2TRMA 4FUBA 5K0HA 1FXYA 1FAXA 1O2UA 2RA0A 3SJIA 1TMBH 3PROA 4XSKU 4X1RU 1B7XB 1WBGB 3SJ9A 1H8IH 3GOVB 3M3TA 1PJPA 2QGRA 4OS1A 1LKAA 2QY0B 1KXCA 1TMTH 1MKWH 4I33A 1TGSZ 1O3NA 1ZHPA 2FM2A 3ELAH 3ZVDA 2SGFE 4WY3A 1PPGE 4NIVA 3ENSB 4NSYA 3S9AA 1FDPA 5C5NA 1G3BA 3S9CA 1YC0A 1VCPA 1GMHF 1CGIE 1SGEE 4JCNA 5EXLA 2FOMB 1MTVA 4B75A 4SGAE 1DICA 1QL7A 2ZGBH 5C67A 2R9PA 4Z0KA 3SJKA 4B1TA 2B8OH 2G4UA 2Q6FA 3BTFE 2PKSC 4Q2KA 3ZZAA 3AW1A 1SG8B 1AWFH 1O3BA 4WH6A 3JZ2B 1EUFA 2GVFA 1JOUB 3TJNA 4MLFB 3F9FA 2Z9JA 2P16A 4CRBA 1K1LA 4JZEH 2A32A 3A84A 1HAHH 1FY8E 1MTNC 1C5MD 3A8CA 1E37B 3ATMA 1ZSKA 1GI4A 1THRH 2GX4A 3UPEA 1D3QB 1O2HA 4E7NA 3SNAA 2Z3CA 1GI9B 1YPHC 1W3CA 1EQ9A 1OXGA 3SORA 2TGTA 1P0SH 1QQ4A 3U1IB 2PR3A 1T8LA 8ESTE 5JB9S 3ZV9A 1NS3A 2A5IA 3RMOH 1TPOA 2FO9A 2PWXA 2G8TA 1BTHH 2OXSA 1TGTA 2ZA5A 1BT7A 1HXFH 2XBYA 3QWCH 1QJ7B 1DSUA 2UWLA 1B0FA 1LHFH 1O0DH 1ZSJA 1N6YA 1ZZZA 1BJVA 3ZYDA 2WINI 1O2WA 3R0FA 1ETSH 2F91A 1THPB 1FY4A 4AB8A 1NRPH 2WYGA 1C5PA 1GJBB 5F03A 3ATIA 1H4WA 4HZHA 5JB8S 2ZHFH 3PLKA 1K1NA 3ZZ9A 5LH8A 1ZTKA 2I6SA 1OP2A 1XUFA 3MU8A 3UNSA 2BYAX 2J2UA 2ILNA 1O2OA 3O8CA 1GDNA 5EGMA 4Q7ZA 5FPYA 3RXGA 4JZIA 2XRCA 1FZZA 1HAZB 1QURH 1IQGA 4NZLA 1VJAU 2SGQE 1QA0A 4FUDA 4RKOB 1TABE 2XWAA 3BG4B 3QZQA 4NSVA 1W13U 4I31A 1HJ9A 4ZAEA 2OBQA 4DIIH 1E38B 1F0SA 3TH4H 3ZVGA 1P3CA 1HJ8A 1S84A 2J9NA 3AVZA 1SOTA 4MTBA 2QAAA 2ZGHA 5JDUB 1VITF 1WQVH 1GG6B 3T28A 4J1YA 1SLWB 2FIRH 3EAJA 3TK5A 1HAVA 2R3UA 1QCPA 1O3FA 2GCHG 3B23B 2STAE 2XWBI 1HB0B 2PGQB 1GHAG 2Z3EA 5AF9H 2OC1A 2QF3A 5EODA 4TWWA 3LGTA 4B2AA 3UR6A 1VZQH 3A8DA 2AMPA 1J9CH 1SHYA 1Q31A 1XVOA 1MU6B 5LGOA 5C1YA 4AX9H 5E0GA 4DW2U 3RLWH 1BB0B 1HAGE 1EB2A 1UMAH 2J95A 3A86A 4THNH 3SGQE 4BAQB 1DXWA 1CQQA 3I29A 4YOIA 2ZDVH 5AFZH 1TLDA 1A1RA 3NCLA 1ACBE 3M35A 1SB1H 2AS9A 1ELVA 1WUNH 1CT4E 2GV7A 4Y0YE 3UQVA 3GCHB 1NU7B 1O2YA 4INLA 1O2PA 3V0XA 2SFAA 1JMOH 2VH0A 1Y3VA 4NIXA 3IITA 2ZC9H 1AFEH 1PQ5A 4UD9H 4K3JA 1XUGA 1Z1IA 5A0AE 1BBRK 1YP9A 5DP8A 3W95A 4LZ1H 1DOJA 4ESTE 2DE8A 5A8YA 4FUJA 3MO6A 5EW2H 1G2MA 1HAXB 1F92A 4YM9A 1O3IA 3EA7A 4HGCA 2QIQA 4I8GA 4OS5A 4BXWA 1DFPA 1Y59T 4CRFA 1NFWA 3ZZ8A 1UVSH 1O5BB 4JZDH 3N7OA 4XE4A 3SQHE 1TMUH 3KHVA 1O2VA 1HJAC 3M61U 1X7AC 2BX4A 2HPPH 5DP7A 3RXMA 3MYWA 3BTGE 1BBRE 5AVDA 1O3PB 1WV7H 2PV9B 3GCTF 3MNXA 1S82A 4ISOA 3GY2A 1Y3WA 4NWLA 4ZHMU 3TNSA 2A5AA 4IGDA 2TPIZ 5K7RA 3TVJB 2BY9X 2ZEBA 4BOHA 4ASHA 3CS0A 2NWNA 2G5VA 2W26A 4DG4A 4I8JA 2WPJS 4X8UH 2C3SA 1C9PA 2AH4X 1A5GH 1W10U 1HAPH 1GJ9B 4KP0A 1GJ8B 5SGAE 3V12A 4J2YB 1EZXC 3S7KB 3GYMA 1A7SA 1DDJA 1QA7A 3RDZA 1TALA 3BIUH 1O2JA 3PTNA 4U2WA 3RXTA 1NT1A 3A80A 1ESAA 1GI6A 1HIAA 4OS6A 1O5EH 2HPQH 4AFSA 2C4FH 3UOUA 4CREA 3ZZ7A 1NROH 1OWEA 2UUJB 1S0QA 4ZH8A 3CP7A 1GMDG 1YLDA 3SJ8A 1AZZA 4CH8B 3ZV8A 1P2QA 3LC5A 1K22H 2F9NA 2BVSH 1TNKA 3RXSA 2ZFTA 3MH4A 3A82A 3HGNA 4DIHH 4MPWA 1TNHA 1LPZB 1L4ZA 3KGPA 3HGPA 4K2YA 2J38A 4INKA 2F83A 1GHBG 1YKTA 3GY5A 2ZCHP 3GDUA 3JZ1B 2UUYA 5E8EH 2YNBA 4IS5A 4K1TA 2TGDA 4AN7A 2HGTH 4GPGA 4ISHH 2SGEE 1ANBA 2C90B 4FU9A 3A7YA 2ZFFH 3M36A 1FUJA 3U8RH 1EAWA 1G3EA 1MQ6A 1P2MA 1ZJKA 2FEQH 3RXJA 1V2KT 1HYLA 4X1NU 3ZZBA 1KXDA 5T3HA 2Y80A 5DP5A 1TRNA 4A6LA 2H5DA 4BAOB 4CRGA 2BQWB 1TA2A 1OWDA 3E90B 5DG6A 1VCQA 3SV2H 5CE1A 1J8AA 3SN8A 1P2NA 2WPIS 2STBE 3RXLA 1W7GH 3K9XB 2PSYA 1QJ1B 1BBRH 4NGAH 3UWJH 3SGBE 3U8TH 3P8FA 4U30A 2FOGA 1NRQH 1Y5BT 2FDAA 3V13A 1IAUA 1K2I1 1H9HE 5GXPA 2XCNA 3F9EA 1NM6A 2BD7A 6GCHF 4CRAA 4MNVA 1BRAA 1O3LA 1S6HA 2PSXA 1LHCH 3DFJA 1AD8H 2GTBA 1P01A 1C5TA 4I8HA 1YCPK 1WYKA 2GT7A 3KIDU 1FJSA 4BAKB 1MTUA 1RIWC 4E05H 2Z9IA 4FUHA 1P04A 4AFQA 1CHGA 1C5YB 1V2PT 4FVDA 4SGBE 1NY22 4AG2A 2LNCA 2VVVA 1RGQA 1EATA 4KELA 2ZU3A 1A0LA 4A92A 1GI8B 1SGYE 1VCWA 3FVFB 1OSSA 2YNAA 4CRDA 2ZWLH 5A0CA 4O03A 1ELCA 1FY5A 2GGVB 4ZKSU 1KTTB 5F8XA 1SI5H 3ESTA 1B0EA 5DJ7A 3KQEA 2AFQB 1L2EA 2P3FH 3LJJA 2PUQH 3BSQA 1C5VA 2PKSB 3EA9A 4WF8A 2BVXH 2GT8A 4B76A 1C5WB 4YOJA 2BM2A 5H4IB 3HKJB 3OY5U 1C1PA 3URCA 2Y5FA 3RXCA 2FX4A 3SNBA 4H4FA 2IJOB 1MTNB 3M5NA 3Q3KA 1GJ7B 3GY6A 2BD8A 3PB1E 1BMMH 3P17H 1G37A 1OWIA 1K1PA 1KXAA 1C5UA 2Z7FE 3VEQB 5EXMA 3D62A 3PMAB 3LIWA 2VJ1A 2EI7A 4M7GA 3BF6H 5HYOA 4JYUH 2UWPA 3SV9A 3F9GA 2JH5D 5HMAA 1C2JA 4FUIA 4OGYA 2DUCA 2PGBB 2D26C 1ID5H 1U6QA 2O8WA 4AG1A 3EYDA 1W0ZU 5L2YH 3U69H 2HRVA 3SU3A 1BRUP 4X1QU 2A2XH 2BY6X 1ZGVA 3RXKA 3GCOA 2JKHA 2ZGJA 3PO1B 2A7HA 1C5NH 5FPTA 3SUEA 1K21H 5FHTA 1RTFB 2B5TB 1G3DA 1ZTJA 1JIRA 2ZDLA 2FZZA 1FQ3A 1O3HA 2JETB 3Q3YA 5E0JA 4FXGH 2WUCA 1C9TA 4CBNA 1NPMA 3A87A 5TJXA 2J34A 4FUFA 4NCYA 1GBJA 1YGCH 1OKXA 3QX5H 2C8WB 3DD2H 4Y8ZA 1ZHMA 2FESH 3PYHA 2OP9A 3P95A 1NZQH 2BQ7B 4AYVB 4XFQA 5F8ZA 3IG6B 1EASA 1CA0C 4DY7B 4O3TA 1PPCE 3T29A 2ZHWH 3STJA 1C2GA 1AB9C 2Y7XA 1G3CA 1QY6A 1MTSA 2H5CA 1IQMA 2WV5A 2ZNKH 1BRCE 4ZKRU 1GGDC 4D7GA 1DLKB 2G55A 5HXFA 2A2QH 2B9LA 1DT2A 3DFLA 1GMDF 4ISIH 4MNWA 1UTJA 1QGFA 2XXLA 2CGAA 1YCPH 2BLOA 1CBWC 1UVUH 2FI3E 1MBMA 3TGIE 3H7OA 3TITA 2BLVA 3A7TA 4H42U 1DPOA 3B8JA 1WTGH 4X6NA 1AE5A 3HPTB 1BMLA 3T26A 3DA9B 2ZU4A 1GJDB 3RXQA 1ARBA 1S85A 1DY8A 1SR5C 5T6FA 4YT7H 5I46H 4YTAA 1FIWA 3EE0B 1UTKA 2XC0A 1GBBA 3VB5A 1O2IA 1YPJH 3BTEE 1BHXB 1PPFE 2H9HA 3RC6A 3FZDA 4WJG2 2GMTC 2P59A 4ISLA 1GJCB 2A7JA 2AMDA 4ABBA 3RM2H 1V2QT 1AUJA 3BTDE 5TCCA 2J92A 2A1DB 1KDQA 1SGDE 1O2MA 1SOZA 1G2LA 1O3GA 3GY4A 1FNIA 1SHHB 4K1SA 5DGJA 1EOLA 3TH2H 1EPTC 1J16A 3OYPA 3UUZA 1KY9A 3KNXA 1C2FA 1FY3A 4WH8A 2Y5GA 3BV9B 5F6MA 1ELGA 1ELAA 1O37A 1W2KH 3EGKH 2BLQA 1V2RT 1DS2E 2JH0D 4VGCC 1Y3YA 5ESBA 1P10A 1TQ7B 1HJAB 1HXEH 1K1IA 4HFPB 1UK3A 4B74A 1SGPE 1T31A 2Z9GA 1T32A 1XVMA 1BRBE 1PYTC 1EAXA 4IMZA 2OQUA 4Q7YA 1C5SA 4MPXA 2Q1JA 4XBCA 1KLJH 4TWYA 4UDWH 1W11U 1EX3A 4HTCH 2FOEA 5HM2A 1DUAA 4AGKA 3PLPA 2PTNA 3L3TA 3KQBA 3RXBA 3M7UA 1C2DA 1MZDA 2BDYA 1UHBA 4JMYA 1P2OA 1FN6A 2AMQA 3FP7E 2VWMA 3BN9A 4NA7A 5JBTA 1MCVA 3P6ZB 1TAWA 3QTVH 2AEIH 4UFFH 1LMWB 5I25A 5EXNA 1EJMA 4RSPA 3SBKA 1BTWA 3FAOA 1GJAB 4ABIA 4FUGA 1O31A 3NWUA 1SGIB 3M3SA 1FV9A 3UWIA 1O36A 4H6TA 1GWAA 3KEEA 5FX6A 1CGHA 4AYYB 1C1QA 2QV1A 1SPJA 1QL8A 4NA9H 3ZVCA 2GZ9A 2ZU5A 1DUEA 2KAIA 3RC5A 2QXIA 4X2VA 3PMHB 2P94A 2Z3DA 5GDSH 5JYIA 1QTFA 2ASUB 3A89A 2XBVA 4PROA 1AVWA 1RXPA 2ZKSA 3RXEA 1PPHE 1V2MT 2ESTE 1OX1A 3AAVA 1LVBA 2ANMH 1GI3A 1YM0A 3DT0H 4JK6A 3SUDA 3RXUA 2AIQA 1HAVB 3P8OA 4FVBA 3BTTE 3B9FH 4MQAA 2P95A 1GBAA 4U01A 3TNTA 2BOHB 1GVLA 1T7CA 1UTQA 3BEFB 3Q3XA 3SU0A 1O2XA 4NWKA 3UFAA 3TH3H 1YPGH 1AI8H 4AORA 2ZCKP 7ESTE 1SVPA 2BVRH 3ATWA 1DSTA 2A7CA 1QRWA 2OBOA 3QUMP 4BNRA 5GCHG 2ANKH 2UUFB 1N8OB 2VWOA 3VGCC 3P70B 4HI3A 3SNDA 4TY6A 1SFIA 5DP6A 7GCHG 2V35A 1YLCA 2ZCLP 3A83A 2OQ5A 2W7SA 3TLOA 1GBEA 4ZHLU 3SHAH 4I8KA 1E36B 2HNTF 2VB0A 4LZ4B 1LVYA 1DWDH 3FFGA 3SU5A 1GI2A 1GBMA 2UWOA 1ZPZA 3GY8A 3V7TA 2GV6A 3QTOH 1GCDA 2VIQA 3KQDA 1BDAA 2GZ8A 1NFUA 2G81E 5C1UA 3RC4A 4OS4A 2GP9B 3LH3A 4KGAA 4TYDA 4YT6H 3RXVA 1ELBA 3SO3A 1LVOA 1W8BH 2A4GA 3AASA 4X6MA 1GCTC 1C5LH 1C1VH 2TGPZ 3E16B 2OTVA 4Y0ZE 1HCGA 2FOFA 3SGAE 1LO6A 2HWLB 3VXEH 1KSNA 2GCTC 4B71A 1FAKH 1GMCG 1FONA 3RMNH 5FX5A 7LPRA 1GBLA 4Y11E 1PQ7A 4GCHF 3H7TA 1AGJA 1EZSC 3OY6U 3UR9A 2RCEA 1L0ZA 2BZ6H 5PTPA 4NA8A 4LXBH 1O2ZA 1MH0A 1C2EA 3OX7U 3M3VA 1IHSH 3AW0A 2F9VA 2BD4A 1W7XH 1F0TA 1HIAB 1A61H 1NRRH 2A4QA 1AE8H 1HAYB 1O5CB 1G36A 1DVAH 1F2SE 4FU8A 2VU8E 3QGNB 3NK8A 3SU4A 3LT3A 3BEUA 1E0FD 1T8NA 4E06H 4K5ZA 4D9QA 3A8BA 4UE7H 4K69A 2XBXA 4OS2A 1P2KA 1WU1A 3WY8A 1UTLM 1O2TA 5JBBS 2QCYA 2FYRA 2VIDA 2M5TA 2ZZUH 3RP2A 4GUXA 5LPRA 4B73A 1G32B 2BDHA 1ZLRA 5L2ZH 3LPRA 5JPMH 1C1OA 4X0WU 1L1GA 1PQAA 3SNCA 4Y7BA 3QGJA 2H9EH 2XW9A 4NFFA 1O2LA 2BY8X 4WMEA 1IQNA 1LPGB 5CHAC 1A5HA 1SSXA 1GI0A 2V3OH 1SBWA 1IQKA 3SU2A 2FOHA 1XKAC 1SGNE 1HPGA 1IQLA 4WXVA 4MPVA 1L1NA 1W12U 1MKXK 2C8XB 4YOGA 3MTYA 3BTKE 6ESTA 3MH6A 1J17T 4FUEA 3LGUA 1C1SA 2ZP0H 2F9OA 2CV3A 2BDCA 1TE0A 1KXBA 2ZHDA 1DWCH 3C1KA 1JIMA 3FZZA 1CA0B 1GJ5H 1SGFA 3S9BA 4GLYA 1AB9B 3A85A 4WVPE 1O38A 1TRYA 1GI1A 1GGDB 1JWTA 1YPMH 3TJUA 4BTTB 4BAMB 3D23A 4ABFA 1YF4A 4LOYH 3BIVH 3U9AH 1KXEA 1UTNA 3UREA 1A0JA 3GISB 1AO5A 1CBWB 5A09A 1A3BH 1LQDB 2PKAA 3M7QA 2WPHS 8GCHG 1K9OE 3GYLB 2HOBA 2VIOA 1JBUH 1ZTLA 1S81A 1BMAA 2CF9H 4F4OC 1RFNA 4K8BA 1GHYH 1S6FA 4Y71A 1T4UH 5GIBA 1A4WH 5T6DA 1IHTH 1FPCH 3NPSA 3Q76A 3S0NA 1GBHA 1XUKA 1QIXB 3QZRA 3DUXH 2BY5X 1AKSA 1O35A 3ATKA 4AFZA 3R3GB 1XKBC 1UJ1A 1HBTH 1BUIA 2BDAA 3A7WA 4WXIA 3EDXB 3VB4A 1DWEH 2HVXA 2FS9A 1TNGA 2FOAA 3E0PB 1TPAE 1TX6A 2GMTB 1O2RA 2G52A 1IQFA 1A5IA 2AERH 1Z6EA 1TBZH 1SGRE 4XBBA 2FP7B 3NUMA 7GCHF 2FLRH 3A81A 1T8OA 1GMHG 1E35B 1SC8U 4Y6DA 1MAYA 3MHWU 1AMHA 1ZYOA 1H1BA 1DWBH 1IOEA 2G4TA 5JBAS 2GCHF 1OWJA 3F1SB 3SUGA 3SOSA 3SW2B 1V6DA 1GHAF 4E7RG 4CH2B 3GDVA 3BTHE 1XUJA 3ZZ4A 1OP0A 1ELFA 2A31A 1CGJE 1SGCA 1C1TA 2IN2A 4VGCB 2AGIX 4ZKOU 4JYTA 4TY7A 4RKJB 2FPZA 1TPSA 3SU1A 1YCPM 1TIOA 1O3AA 5ESTE 5JBCS 3E3TA 3I78A 1TNIA 1RRKA 4D76A 3RM0H 1AIXH 1BQYA 1E34B 2V6NA 2TBSA 1IQIA 1YPHE 3VFEA 5FAHA 5BRRE 1WCZA 2DE9A 5LPFA 2ZI2H 3F6UH 2YOLA 1TNLA 4Q80A 1EPTA 1LCYA 1V3XA 1PPZA 2BB4A 2BHGA 3ZZCA 3U8OH 1A3EH 1D9IA 5FXLA 1P12E 2R2WU 2Q6GA 2ZQ1A 3E0NB 1GMCF 1DLEA 1MU8B 1SGTA 2Z9KA 2FOCA 1MKXH 1DITH 2OUAA 5EU8A 1HV7A 3H5CB 2G5NA 2PUXB 1O3MA 1D3PB
chains in the Genus database with same CATH superfamily
4ZXXH 4OGXA 4F49A 3VB3A 1ZSLA 4R0IA 2D8WA 4WMFA 1SGQE 3TPIZ 3KL6A 4FU7A 4AGJA 1P9SA 1WDIA 4D8NA 2ZDNA 1D3DB 2RDLA 1GBFA 2ZDMA 1HDTH 3SUFA 1AQ7A 1O3EA 2W3IA 4XOJA 3SV6A 1O33A 4NZQA 3RXOA 2BQ6B 2EI8A 1MQ5A 1HLTH 1AWHB 5IK2D 1UK4A 2YMSC 2RA3A 4JZ1A 1E1RD 4ABGA 4H6SB 3LGWA 2ANYA 3T27A 3RXPA 1KYNA 3A88A 4ABEA 1XM1A 3LOXA 5EJZA 2NU3E 2ZFQH 2BY7X 2PP6A 1ZPBA 1EFRD 1ZJDA 1OYQA 1EOJA 2NU1E 1WTHD 2HALA 1W14U 3NXPA 5DP4A 4K8YA 1O5DH 2HNTC 2B0FA 1ELDE 1KLTA 1RS0A 2ZFPH 3SHCH 4Y79A 3TJOA 2VGCC 1CT0E 2BDGA 1VITG 4KKDA 3SV7A 4RN6A 1AZ8A 5C20A 1YPEH 2BZAA 1ETRH 3G01A 2JDID 4Y8XA 3UNQA 2YMSD 1GDQA 2D1JA 1LKBA 3TGJE 4GVUA 1TGBA 1VJ9U 1ANDA 1QRXA 2QA9E 3MNSA 3LKWA 1HRTH 3CS7A 4MPUA 1A2CH 3LGVA 2ZGXH 1C2LA 4DJZB 1C1UH 1S5SA 1UVOA 4INHA 4A1XA 4CHAC 1BTPA 1C5RA 1P03A 1KDQB 2QXJA 4CBOA 1ZRBA 3T25A 2XNIA 3FKSD 1D6RA 1QL9A 1ELTA 1Z1JA 2NU4E 1CE5A 2G51A 4ISNA 1XUHA 1SFQB 2VWNA 2Y6TA 2FTLE 3RU4D 2J5UA 3PWBA 3RMMH 1GHBF 2HVYB 2QXHA 5FPSA 5L30H 1AVGH 1GBDA 3FOAA 2XTTB 2Y7ZA 1L1JA 3UOPA 1O5GH 2BD9A 1W0YH 1TGNA 3MO9A 5EQQA 3QDZB 1GCTB 1MCTA 1UCYK 3VB7A 1TX8A 5BPEA 3VXFH 4X2XA 2F9PA 3LDXH 1GBTA 3SI3H 1SL3A 2XOKD 1OP8A 3QN7A 4X8SH 4DT7B 1NC6A 5FBIA 1HGTH 3EE7A 4YLUA 1UHBB 6CHAC 2A4OA 4A1TA 1CU1A 4JYVH 3O8RA 1QB1A 4BAHB 4R8TB 1THSH 2GDDA 2ZPQA 1EZQA 1TYNA 3PLBA 1C4V2 4TPIZ 2BDBA 2ZO3H 1IQEA 1UTOA 3STIA 3GCTG 3P92A 2NU2E 2P8OC 3HATH 1DM4B 1NO9H 4Y8YA 1UCYE 1FPHH 2VIVA 1V2VT 4K60A 3TJVA 4B6FA 1Y3XA 1LDTT 5FBEA 2JJ2D 1FIZA 3LGIA 3PM3A 2J97A 1XX9A 3L33A 1ZMLA 2R2MB 1AU8A 3QK1A 4TPYA 4Y76A 1OYTH 2KAIB 1C2HA 2BDIA 5T1VA 1GBIA 1P02A 1G9IE 5A8ZA 1M9UA 4BANB 2WUBA 2FI5E 4YZUA 3W94A 4GSOA 1MD8A 4DCDA 2FWWA 3SI4H 4A1VA 1ZGIA 3UTUH 1LHDH 1O30A 3GICB 3KF2A 1CVWH 3ZZ3A 2ODYB 1A0HB 3ZVBA 1RJXB 4Q63A 1AFQC 2H2ZA 2LP6A 1BTXA 5AFYH 4BTUB 1SMFE 3A7VA 2XBWA 4BXSA 2KM0A 4DGJA 4DURA 5L6NH 2OC7A 4DOQA 3E8LA 1Z7KA 3MH5A 1WQSA 1HAOH 5HM9A 1AY6H 1O2NA 1PYTD 2ZG0H 1V2WT 1QBNA 1GPZA 1L4DA 5CHAB 1J14A 3SJOA 5J4QA 3OU0A 4XDEA 5AHGH 4AZ2B 5F8TA 5LPEA 1GHVH 1BJUA 3N7DA 3KQ5A 3HK6B 1TRMA 2HLCA 1P2JA 3S7HB 1ZPCA 2ANWA 2BOKA 1Y3UA 2LELA 1TA6A 1P09A 5DPAA 2FYQA 5E2OA 1FY1A 3DSOA 2AYWA 3O8BA 2AIPA 4ABAA 1EAIA 1SKYE 2C93B 2A0QB 1EB1H 4ABHA 1QB9A 3QLPH 2OD3B 4XBDA 2D2DA 1OWHA 3MNBA 2F9UA 1PPEE 1S6LA 1QQUA 2W6ID 3MU0A 4IC6A 1H8DH 1C1RA 1Q3XA 3T5FH 1SQAA 5C0TA 1CHOG 2FI4E 1P8VC 1VGCC 1E79D 1NTPA 4X1SU 3PO1C 2QE7D 1P57B 3LH1A 1F5KU 1O5AB 4ZUHA 4IN1A 1V2TT 3S69A 1H8ED 3ZVFA 3F0PA 1O2GH 2CF8H 1PQ8A 3OSYA 2JETC 1COWD 2A5KA 3K65B 2ZPSA 3RLYH 1S83A 1K1OA 1PPBH 2PTCE 4Q4LA 2BXTH 2XCFA 3PMJA 1MMJN 4X8TH 1N6XA 2CMYA 2ZTZA 3PV5A 1BCUH 1DE7H 2WV4A 2EA3A 3GCNA 1UCYH 3D65E 1UVTH 1ZMJA 4JK5A 3PMBB 1QFKH 1TWXB 2K1QA 1OPHB 1ZRKA 4UFEH 6GCHG 1ESTA 1ETTH 5E0HA 1O3CA 4O3UA 1KTSB 4B6EA 3LJOA 2VVCA 3A8AA 1J15A 1ESBA 3ZYEA 2F9BH 3K2UA 2CHAC 4I86A 2AGGX 5GPIB 3RXRA 3RXIA 2ALVA 2WHXA 4YLQH 1V2NT 2ZECA 1KIGH 4UFGH 4AFUA 1F7ZA 3AK5A 1F0RA 1HUTH 5CMXH 2CJIA 1Z8RA 2ZHEH 5C1XA 6LPRA 1P9UA 1Z71A 2B7DH 1NU9A 3KCGH 3Q00A 3NKKA 1XMNB 5FCKA 1RIWB 3BTWE 2OINA 5A0BA 1TX7A 1MBQA 1FN8A 1Z6JH 3MU5A 2EI6A 2FODA 2GD4B 3MU1A 5EPYA 2W5EA 1N1LA 4AC9A 3K6YA 5G4BA 1O3OA 1O3JA 4WMDA 1C5XB 5HGGA 4DVAU 1EP6A 3BEIB 2K0QA 5DKMA 1BOQA 2BX3A 4GAWA 1V2ST 5EQRA 2GDEH 3MWIU 1K1MA 2VIWA 1WSSH 3MU4A 2ZFSA 2JH6D 3HKIB 1QZ8A 3SU6A 3D49H 3OFND 4X6OA 2V3HH 1K28D 3MNCA 3EQ0H 2FS8A 2SGDE 2Z6BD 1F0UA 1C5OH 2J98A 3HK3B 4XRNA 1ANEA 2BD5A 1C1NA 5C2ZA 4F55A 3ZZ6A 3RXFA 2EEKA 3PTBA 4MG3A 4NIYA 4O97A 2FLBH 2A45B 1UK2A 1WAYB 4UEHH 2R3YA 4AOQA 2ZF0H 1TNJA 1AUTC 4IBLH 1MTWA 1ELEE 3OTJE 1ZMNA 2UUKB 3QO6A 2V0BA 8KME2 1D3TB 2BD2A 3MQKC 5IYTA 1P05A 2KCYA 1NN6A 3MH7A 4I32A 3ODDA 1GVZA 5DK1A 3MMGA 3F0OA 4MNYA 3AAUA 4FUCA 3PV4A 1TONA 5FL7D 1T8MA 1TBRH 1TQ0B 2Z94A 2ULLA 1C2MA 4Y10E 4I7YH 1OS8A 1MAXA 3M5MA 3NZIA 4Q7XA 4IMQA 1INCA 3EA8A 1NRNH 4GHQA 2OC8A 2R0KA 3UQOA 1ANCA 3MOCA 2BLWA 1O2QA 2AGEX 4MVNA 4ASUD 3T62A 2OLGA 2HNTE 4KTCA 2YMSB 4X1PU 4RT0A 4X6PA 1BZXE 4D9RA 2PKAB 1Y8TA 1SLXB 4ABDA 1EAUA 4ZMAH 3N7EA 1DY9A 1CT2E 3RU4E 2I6QA 1ZHRA 2GZ7A 1K1JA 3Q77A 5CHBA 3SYJA 2FXRA 3TIUA 1YPLH 2WPLS 2BTCE 3BTQE 4YXWD 2IPHA 1EZUC 1QBVH 1SQTA 2ODQA 4NG9H 2VGCB 3TU7H 3VG8A 3FP6E 2ZDKA 1KXFA 3A7XA 3M37A 4CR5A 3ATLA 2ZFRH 1AKSB 4YO9A 3M5OA 1MUEB 1EP5A 3MFJA 2J4IA 4O9VA 4X2YA 1DXPA 5ETXA 1O3KA 5EOKA 2ZIQH 5A2MH 1W0JD 2ZU2A 1O3DA 1SLVB 4B2CA 1GJ6A 2ZU1A 2ALPA 2R0LA 3RXAA 1AN1E 4FETA 2EQNA 4CHAB 1MD7A 1Z8GA 4IW4E 1BTUA 3SQEE 1O39A 2ZQ2A 1O2KA 1TBQH 1C4Y2 1W0KD 1H9IE 1TGCA 2P3TB 2F3CE 2O9QA 4UFDH 4ZROA 3ZVEA 2A4RA 1YYY1 5DP9A 2M2AA 2WPMS 8LPRA 3BG4C 1D4PB 2FMJA 4QT8C 7KMEH 1CHOF 1C1WH 1N8OC 4Y7AA 1O2SA 3SZNA 1Q2WA 2OK5A 3VB6A 4MNXA 1JRSA 2OCVB 1EKBB 1GL0E 3BTME 5DP3A 3TK6A 4IC5A 2Y81A 2TIOA 4OS7A 5C3NA 3TGKE 1GG6C 5GCHF 3OE7D 2IOTA 2XNDD 3M5LA 4NFEA 1LTOA 3RXHA 1TOMH 1GI5A 2BXUH 1O34A 1V2LT 2QYIA 6CHAB 1P3EA 1EPTB 2FOBA 4CRCA 4B2BA 2KCAA 1VITH 4AB9A 1ZOMA 1GI7B 5EG4A 2P8OB 1CA8B 2ZPRA 3ODFA 2ZHQH 1HNEE 1QNJA 2H1UA 1BTYA 2W7UA 3GY3A 1GBCA 1EJAA 3GCHC 1UTPA 2F4LA 2SGPE 4CR9A 1C4U2 1NFXA 2G00A 2Y82A 2QF0A 9ESTA 3TK9A 4X8VH 3FP8E 1HFDA 2THFB 2XC4A 5A8XA 1LHEH 1IQHA 5TCAA 1Z8IB 4IN2A 1MZAA 3U1JB 1NESE 3SNEA 3LGYA 2O8LA 2C8YB 2TGAA 4LK4A 1D6WA 4ZHAA 1V2JT 4U32A 3PWCA 4TT3D 3O8DA 2XC5A 1C5QA 5KEDA 1C2KA 1EXFA 3MI4A 3RMLH 1AFQB 1UO6A 3SV8A 2ZGCA 3M7TA 1QHRB 4MDSA 1TB6H 2CN0H 2GKVE 3GDSA 4Z6AH 2H9TH 1MKWK 2WYJA 1BHXF 4GHTA 1JXPA 2FTMA 1C5ZB 5FCRA 2SGAA 4KTSA 1YBWA 1G30B 2VVUA 1VR1H 1P06A 1BITA 1IQJA 1ORFA 3F68H 9LPRA 1ARCA 1EJNA 1B5GH 2O8UA 2OC0A 5EW1H 2C8ZB 1ABJH 3V3MA 1V2UT 4ZKNU 1QJ6B 2BD3A 2RDEA 2NU0E 1NRSH 3IWMA 2PFEA 5E2PA 4WWYA 3E6PH 2VINA 1RTLA 1H9LB 2ZTYA 1Y5UT 2CXVA 3ITIA 2QN5T 5DN6D 5GJ4B 2PLXA 5J4SA 1TPPA 1QBOA 4UONA 1S0RA 1ABIH 1DX5M 1SGFG 1UTMA 3KQCA 4ZXYH 1RTKA 3LU9B 4I8LA 1DANH 3URDA 1C1MA 2EC9H 2H6MA 3K6ZA 2O8MA 2P93A 1BIOA 1T4VH 1PFXC 2VWLA 2VH6A 1GVKB 3ZVAA 1A46H 4X2WA 1VGCB 1GBKA 3CENA 4K1EA 1QRZA 1RD3B 1F5RA 1C2IA 2Z9LA 3T2NA 1QB6A 3H09A 4ACAA 1FLEE 3PRBA 1BTZA 2BMGB 2O8TA 3E1XB 3ZZDA 1OWKA 3E91A 1LQEA 1O5FH 1OOKB 1V2OT 1WOFA 3A7ZA 1GJ4H 1HAIH 1UVPA 1GDUA 2J94A 3VGCB 4A5TS 1CSOE 5T6GA 3UIRA 1TOCB 1LVMA 1TFXA 3P8NA 2Y5HA 3I77A 5IDKA 3ZZ5A 3U98H 1CO7E 1FI8A 4BTIB 1SQOA 1Y5AT 2WPKS 3OTPA 2KZ4A 1XXFA 4D7FA 1KLIH 5EQSA 3UNRA 2Q6DA 3F2GA 1JRTA 1Z8JB 1GL1A 1ZR0A 2CHAB 5DO4H 1LPKB 3RXDA 5EPNA 1AVXA 1P11E 2QC2A 4KTUA 1P2IA 4JZFH 3C27B 3FANA 1QR3E 1XUIA 1FMGA 2PHBA 4ABJA 3MO3A 2RG3A 2ZDAH 1BMNH 2WSSD 4A7IB 2VNTA 2ZTXA 3L6PA 3LC3A 3VPKA 2FX6A 3RUOA 3GY7A 2XYAA 5B6LA 1SLUB 2W3KA 3BG8A 1BA8B 1GHZA 4NIWA 1VKYA 1XXDA 2PW8H 3LONA 5HIZA 1AHTH 5C5OA 2QXGA 2VIPA 2SNVA 1GHXH 1NFYA 4GCHG 3DHKH 2SNWA 2P3UB 3UY9A 8GCHF 2LPRA 3P8GA 1LHGH 4YESB 5ABWA 3F2FA 2GCTB 1F5LA 2ODPA 3RU4T 1O32A 1YPKH 3F9HA 5B6OA 5GWZA 3KN2A 1GHWH 2TRMA 4FUBA 5K0HA 1FXYA 1FAXA 1O2UA 2RA0A 3SJIA 1TMBH 3PROA 4XSKU 4X1RU 1YWUA 1B7XB 1WBGB 3SJ9A 1H8IH 2IPQX 3GOVB 3M3TA 1PJPA 2QGRA 4OS1A 1LKAA 2QY0B 1KXCA 1TMTH 1MKWH 2F43B 1TGSZ 1O3NA 4I33A 1ZHPA 2FM2A 3ELAH 3ZVDA 2SGFE 4WY3A 1PPGE 4NIVA 4ACBA 3ENSB 4NSYA 3S9AA 1FDPA 5C5NA 1G3BA 3S9CA 1YC0A 3FO8D 1VCPA 1GMHF 1CGIE 1SGEE 3UB0A 4JCNA 5EXLA 2FOMB 1MTVA 2GJGA 4B75A 4SGAE 1DICA 1QL7A 2ZGBH 5C67A 2R9PA 4Z0KA 3SJKA 4B1TA 2B8OH 2G4UA 2Q6FA 4XD7D 3BTFE 2PKSC 4Q2KA 5HIYA 3ZZAA 3AW1A 1SG8B 1AWFH 1O3BA 4WH6A 3JZ2B 1EUFA 2GVFA 1JOUB 3TJNA 4MLFB 3F9FA 2Z9JA 2P16A 4CRBA 1K1LA 4JZEH 2A32A 3A84A 1HAHH 1FY8E 1MTNC 1C5MD 3A8CA 1E37B 3ATMA 1ZSKA 1GI4A 1THRH 2GX4A 3UPEA 1D3QB 1O2HA 4E7NA 3SNAA 2Z3CA 1GI9B 1YPHC 4TSFD 1W3CA 1EQ9A 1OXGA 3SORA 2TGTA 1P0SH 1QQ4A 3U1IB 2PR3A 1T8LA 8ESTE 5EJLA 5JB9S 3ZV9A 2IJD1 1NS3A 2A5IA 3RMOH 1TPOA 2FO9A 2PWXA 2G8TA 1BTHH 2OXSA 1TGTA 2ZA5A 1BT7A 1HXFH 2XBYA 3QWCH 1QJ7B 1DSUA 2UWLA 1B0FA 1LHFH 1O0DH 5DSFA 1ZSJA 1N6YA 1ZZZA 1BJVA 3FN8A 3ZYDA 2WINI 1O2WA 3R0FA 1ETSH 2F91A 1THPB 1FY4A 4AB8A 1NRPH 2WYGA 1C5PA 1GJBB 5F03A 3ATIA 1H4WA 4HZHA 5JB8S 2ZHFH 3PLKA 1K1NA 3ZZ9A 5LH8A 1ZTKA 2I6SA 1OP2A 1XUFA 3MU8A 3UNSA 2BYAX 2J2UA 2ILNA 1O2OA 2JJ1D 3O8CA 1GDNA 5EGMA 4Q7ZA 5FPYA 1UW7A 4JZIA 3RXGA 2XRCA 1FZZA 1HAZB 1QURH 1IQGA 3PV2A 4NZLA 1VJAU 2SGQE 1QA0A 4FUDA 4RKOB 1TABE 2XWAA 3BG4B 3QZQA 4NSVA 1W13U 4I31A 1HJ9A 4ZAEA 3F3BA 2OBQA 4DIIH 1E38B 1F0SA 4ZCNA 3TH4H 3ZVGA 1P3CA 1HJ8A 1S84A 2J9NA 3AVZA 1SOTA 4MTBA 2QAAA 2ZGHA 5JDUB 1VITF 1WQVH 1GG6B 3T28A 4J1YA 1SLWB 2FIRH 3EAJA 3TK5A 1OHHD 1HAVA 2R3UA 1QCPA 1O3FA 2GCHG 3B23B 2STAE 2XWBI 1HB0B 2PGQB 1GHAG 2J98B 2Z3EA 5AF9H 2OC1A 2QF3A 5EODA 4TWWA 3LGTA 4B2AA 3UR6A 1VZQH 3A8DA 2AMPA 1J9CH 1SHYA 3N99A 1Q31A 1XVOA 1MU6B 5LGOA 5C1YA 4AX9H 5E0GA 4DW2U 3RLWH 1BB0B 1HAGE 1EB2A 1UMAH 2J95A 3A86A 4THNH 3SGQE 4BAQB 1DXWA 1CQQA 3I29A 4YOIA 2ZDVH 5AFZH 1TLDA 1A1RA 3NCLA 1MABB 1ACBE 3M35A 5EJ1A 1SB1H 2AS9A 5C94A 1ELVA 1WUNH 1CT4E 2GV7A 4Y0YE 3UQVA 3GCHB 1NU7B 1O2YA 4INLA 1O2PA 4M9FA 3V0XA 2SFAA 1JMOH 2VH0A 1Y3VA 4NIXA 3IITA 2ZC9H 1AFEH 4FOUC 1PQ5A 4UD9H 4K3JA 1XUGA 1Z1IA 5A0AE 1BBRK 1YP9A 5DP8A 3W95A 4LZ1H 1DOJA 4ESTE 2DE8A 5A8YA 4FUJA 3MO6A 3GS9A 5EW2H 1H8HD 1G2MA 1HAXB 1F92A 4YM9A 4OM9A 1O3IA 3EA7A 4HGCA 2QIQA 4I8GA 4OS5A 4BXWA 1DFPA 1Y59T 4CRFA 1NFWA 3ZZ8A 1UVSH 4F48B 1O5BB 4JZDH 3N7OA 4XE4A 3SQHE 2QF4A 1TMUH 3KHVA 1O2VA 1HJAC 3M61U 1X7AC 2BX4A 2HPPH 5DP7A 3RXMA 3MYWA 3BTGE 1BBRE 5AVDA 1O3PB 1WV7H 2PV9B 3GCTF 3MNXA 1S82A 4ISOA 3GY2A 5C17A 1Y3WA 4NWLA 4ZHMU 3TNSA 2A5AA 4IGDA 2TPIZ 5K7RA 3TVJB 2BY9X 2ZEBA 4BOHA 4DT4A 4ASHA 3CS0A 2NWNA 2G5VA 2W26A 4DG4A 4I8JA 4P02A 2WPJS 4X8UH 2C3SA 1C9PA 2AH4X 1A5GH 1W10U 1HAPH 1GJ9B 3DSGA 4KP0A 4RT1A 1GJ8B 5SGAE 1YLNA 3V12A 4J2YB 1EZXC 3S7KB 2V7QD 3GYMA 1A7SA 1DDJA 1QA7A 3RDZA 1TALA 3BIUH 1O2JA 3PTNA 2AHME 4U2WA 1NT1A 3A80A 1ESAA 1GI6A 1HIAA 3RXTA 4OS6A 1O5EH 2HPQH 4AFSA 3F2HA 2C4FH 3UOUA 4CREA 3ZZ7A 1NROH 1OWEA 2UUJB 1S0QA 4ZH8A 3CP7A 1GMDG 3OEED 1YLDA 3SJ8A 1AZZA 4CH8B 3ZV8A 1P2QA 3LC5A 2CK3D 1K22H 2F9NA 2BVSH 1TNKA 3RXSA 2ZFTA 3MH4A 3A82A 3HGNA 4DIHH 4MPWA 1TNHA 1LPZB 1L4ZA 3KGPA 5CDFE 3HGPA 4K2YA 2J38A 4INKA 2F83A 1GHBG 1YKTA 3GY5A 2ZCHP 3GDUA 3JZ1B 2UUYA 5E8EH 2YNBA 4IS5A 4K1TA 2TGDA 4AN7A 2HGTH 4GPGA 4ISHH 2SGEE 1ANBA 2K8IA 2C90B 4FU9A 3A7YA 2ZFFH 3M36A 1FUJA 3U8RH 1EAWA 1G3EA 1MQ6A 1P2MA 1ZJKA 2FEQH 3RXJA 1V2KT 1HYLA 4X1NU 3ZZBA 1KXDA 5T3HA 2Y80A 5DP5A 1TRNA 4A6LA 2H5DA 4BAOB 4CRGA 2BQWB 2QF5A 1TA2A 1OWDA 3E90B 5DG6A 2RFKC 5F53A 1VCQA 3SV2H 5CE1A 5GNDA 1J8AA 3SN8A 1P2NA 2WPIS 2STBE 3RXLA 1W7GH 3K9XB 2PSYA 1QJ1B 1BBRH 4NGAH 3UWJH 3SGBE 3U8TH 3P8FA 4U30A 2FOGA 1NRQH 1Y5BT 2FDAA 3V13A 1IAUA 1K2I1 1H9HE 5GXPA 2XCNA 3F9EA 1NM6A 2BD7A 6GCHF 4CRAA 4MNVA 1BRAA 1O3LA 1S6HA 2PSXA 1LHCH 3DFJA 1AD8H 2GTBA 1P01A 1C5TA 4I8HA 1YCPK 1WYKA 2GT7A 3KIDU 1FJSA 3OEHD 4BAKB 1MTUA 1RIWC 4E05H 2Z9IA 1WXRA 4FUHA 1P04A 4AFQA 1CHGA 1C5YB 1V2PT 4FVDA 4SGBE 1NY22 4AG2A 2LNCA 2VVVA 1RGQA 3PRDA 1EATA 4KELA 2ZU3A 1A0LA 4A92A 1GI8B 1SGYE 1VCWA 3FVFB 1OSSA 2YNAA 4CRDA 2ZWLH 5A0CA 4O03A 1ELCA 1FY5A 2GGVB 4ZKSU 1KTTB 5F8XA 1SI5H 3ESTA 3KYFA 1B0EA 5DJ7A 3KQEA 2AFQB 1L2EA 2P3FH 3LJJA 2PUQH 3BSQA 1C5VA 2PKSB 3EA9A 4WF8A 2BVXH 2KCPA 2GT8A 4B76A 1C5WB 4YOJA 2BM2A 5H4IB 3HKJB 3OY5U 1C1PA 3URCA 2Y5FA 3RXCA 2FX4A 3SNBA 4H4FA 2IJOB 1MTNB 3M5NA 3Q3KA 1GJ7B 3GY6A 2BD8A 3PB1E 1BMMH 3P17H 1G37A 1OWIA 1K1PA 1KXAA 2WV9A 1C5UA 2Z7FE 3VEQB 5EXMA 3D62A 3PMAB 3LIWA 2VJ1A 2EI7A 4M7GA 3BF6H 5HYOA 4JYUH 2UWPA 3SV9A 3F9GA 2JH5D 5HMAA 1C2JA 4FUIA 4OGYA 2DUCA 2PGBB 2D26C 2L74A 1ID5H 1U6QA 2O8WA 4AG1A 3EYDA 1W0ZU 5L2YH 3U69H 2HRVA 3SU3A 1BRUP 3U28C 4X1QU 2A2XH 2BY6X 1ZGVA 3RXKA 3GCOA 2JKHA 2ZGJA 3PO1B 2A7HA 1C5NH 5FPTA 3SUEA 1K21H 5FHTA 1RTFB 2B5TB 1G3DA 1ZTJA 1JIRA 2ZDLA 2FZZA 1FQ3A 1O3HA 2JETB 3Q3YA 5E0JA 4FXGH 2WUCA 1C9TA 4CBNA 1NPMA 3SZEA 3A87A 5TJXA 2J34A 4FUFA 4NCYA 1GBJA 1YGCH 3NRLA 1OKXA 3QX5H 2C8WB 1E1QD 3DD2H 4Y8ZA 1ZHMA 2FESH 3PYHA 2OP9A 2W6JD 3P95A 1NZQH 2BQ7B 4AYVB 4XFQA 5F8ZA 1YY3A 4Z1MD 3IG6B 1EASA 1CA0C 4DY7B 4O3TA 1PPCE 3T29A 2ZHWH 3STJA 1C2GA 1AB9C 2Y7XA 1G3CA 1QY6A 1MTSA 2H5CA 1IQMA 2WV5A 2ZNKH 1BRCE 4ZKRU 1GGDC 4D7GA 1DLKB 2G55A 5HXFA 2A2QH 2B9LA 1DT2A 3DFLA 1GMDF 4ISIH 4MNWA 1UTJA 1QGFA 2XXLA 2CGAA 1YCPH 2BLOA 1CBWC 1UVUH 2FI3E 1MBMA 3TGIE 3H7OA 3TITA 2BLVA 3A7TA 4H42U 1DPOA 3B8JA 1WTGH 4X6NA 1AE5A 3HPTB 1BMLA 3T26A 3DA9B 3CNRA 2ZU4A 1GJDB 3RXQA 1ARBA 1S85A 1DY8A 1SR5C 5T6FA 4YT7H 5I46H 4YTAA 3DSPA 1FIWA 3EE0B 1UTKA 2XC0A 1GBBA 3VB5A 1O2IA 1YPJH 3BTEE 1BHXB 1PPFE 2H9HA 3RC6A 3FZDA 4WJG2 2GMTC 2P59A 3DCLA 4ISLA 1GJCB 2A7JA 2AMDA 4ABBA 3RM2H 1V2QT 1AUJA 3BTDE 5TCCA 2J92A 2A1DB 1KDQA 1SGDE 1O2MA 1SOZA 1G2LA 1O3GA 3GY4A 1FNIA 1SHHB 4K1SA 5DGJA 1EOLA 3TH2H 1EPTC 1K0HA 1J16A 3OYPA 3UUZA 2KCOA 1KY9A 3KNXA 1C2FA 1FY3A 4WH8A 2Y5GA 3BV9B 5F6MA 1ELGA 1ELAA 1O37A 1W2KH 3EGKH 2BLQA 1V2RT 1DS2E 2JH0D 4VGCC 1Y3YA 5ESBA 1P10A 1TQ7B 1HJAB 1HXEH 1K1IA 4HFPB 1UK3A 4B74A 1SGPE 1T31A 2Z9GA 1T32A 1XVMA 1BRBE 1PYTC 1EAXA 4IMZA 2OQUA 4Q7YA 1C5SA 4MPXA 2Q1JA 4XBCA 1KLJH 4TWYA 4UDWH 1W11U 1EX3A 4HTCH 2FOEA 5HM2A 1DUAA 4AGKA 3PLPA 2PTNA 3L3TA 3KQBA 3RXBA 3M7UA 1C2DA 1MZDA 2BDYA 1UHBA 4JMYA 1P2OA 1FN6A 2AMQA 3FP7E 2VWMA 3BN9A 4NA7A 5JBTA 1MCVA 3P6ZB 1TAWA 3QTVH 2AEIH 3WW7A 4UFFH 1LMWB 5I25A 1NBME 5EXNA 1EJMA 4RSPA 3SBKA 1BTWA 3FAOA 1GJAB 4ABIA 4FUGA 1O31A 3NWUA 1SGIB 3M3SA 1FV9A 3UWIA 1O36A 2WZQA 4H6TA 1GWAA 3KEEA 5FX6A 1CGHA 4AYYB 1C1QA 4P00A 2QV1A 1SPJA 1QL8A 4NA9H 3ZVCA 2GZ9A 2ZU5A 1DUEA 2KAIA 3RC5A 2QXIA 4X2VA 3PMHB 2P94A 2Z3DA 5GDSH 5JYIA 1QTFA 2ASUB 3A89A 2HLDD 2XBVA 4PROA 1AVWA 1RXPA 2ZKSA 3OAAD 3RXEA 1PPHE 1V2MT 2ESTE 1OX1A 3AAVA 1LVBA 2ANMH 1GI3A 1YM0A 3DT0H 4JK6A 3SUDA 3RXUA 2AIQA 1HAVB 3P8OA 4FVBA 3BTTE 3B9FH 4MQAA 2P95A 1GBAA 4U01A 3TNTA 2BOHB 1GVLA 1T7CA 1UTQA 3BEFB 3Q3XA 3SU0A 1O2XA 4NWKA 3UFAA 3TH3H 1YPGH 1AI8H 4AORA 2ZCKP 7ESTE 1SVPA 2BVRH 3ATWA 1DSTA 2A7CA 1QRWA 2OBOA 3QUMP 4BNRA 5GCHG 2ANKH 2UUFB 1N8OB 2VWOA 3VGCC 3P70B 4HI3A 3SNDA 4TY6A 1SFIA 5DP6A 7GCHG 2V35A 1YLCA 2ZCLP 3A83A 2OQ5A 2W7SA 3TLOA 1GBEA 4ZHLU 3SHAH 4I8KA 3ZIAD 1E36B 2HNTF 2VB0A 4LZ4B 1LVYA 1DWDH 3FFGA 3SU5A 1GI2A 1GBMA 1FX0B 2UWOA 1ZPZA 3GY8A 3V7TA 2GV6A 3QTOH 1GCDA 2VIQA 3KQDA 1BDAA 2GZ8A 1NFUA 2G81E 5C1UA 3RC4A 4OS4A 5C0UA 2GP9B 3LH3A 4KGAA 4TYDA 4YT6H 3RXVA 1ELBA 3SO3A 1LVOA 1W8BH 2A4GA 3AASA 4X6MA 1GCTC 1C5LH 1C1VH 2TGPZ 3E16B 2OTVA 4Y0ZE 1HCGA 2FOFA 3SGAE 1LO6A 2HWLB 2EY4C 3VXEH 1KSNA 2GCTC 4B71A 1FAKH 1GMCG 1FONA 3RMNH 5EIYA 5FX5A 7LPRA 1GBLA 4Y11E 1PQ7A 4GCHF 3H7TA 1AGJA 1EZSC 3OY6U 3UR9A 2RCEA 1L0ZA 2BZ6H 5PTPA 4NA8A 4LXBH 1O2ZA 1MH0A 1C2EA 3OX7U 3M3VA 1IHSH 3AW0A 2F9VA 2BD4A 1W7XH 1F0TA 1HIAB 1A61H 2KFWA 1NRRH 4RI0A 2A4QA 1AE8H 1HAYB 1O5CB 2VBCA 1G36A 1DVAH 1F2SE 4FU8A 3WWBA 2VU8E 3QGNB 3NK8A 3SU4A 3LT3A 3BEUA 1E0FD 1T8NA 4E06H 4K5ZA 4D9QA 3A8BA 4UE7H 4K69A 2XBXA 4OS2A 1P2KA 1WU1A 3WY8A 1UTLM 1O2TA 5JBBS 2QCYA 2FYRA 2VIDA 2M5TA 2ZZUH 3RP2A 4GUXA 5LPRA 4B73A 1G32B 2BDHA 1ZLRA 5L2ZH 3LPRA 5JPMH 1C1OA 4X0WU 1L1GA 1PQAA 3SNCA 4Y7BA 3UAIC 3QGJA 2H9EH 2XW9A 4NFFA 1O2LA 2BY8X 4WMEA 1IQNA 1LPGB 5CHAC 1A5HA 1SSXA 1GI0A 2V3OH 1SBWA 1IQKA 3SU2A 2FOHA 1XKAC 1SGNE 1HPGA 1IQLA 4WXVA 4MPVA 1L1NA 1W12U 1MKXK 2C8XB 4YOGA 3MTYA 3BTKE 6ESTA 3MH6A 1J17T 4FUEA 3LGUA 1C1SA 2ZP0H 2F9OA 2CV3A 2BDCA 1TE0A 1KXBA 2ZHDA 1DWCH 3C1KA 1JIMA 3FZZA 1CA0B 1GJ5H 1SGFA 3S9BA 4GLYA 1AB9B 3A85A 4WVPE 1O38A 1TRYA 1GI1A 4HG6A 1GGDB 1JWTA 1YPMH 3TJUA 4BTTB 4BAMB 2KX4A 3D23A 4ABFA 1NBMD 1YF4A 4LOYH 1BMFD 3BIVH 3U9AH 1KXEA 1UTNA 3UREA 3WWFA 1A0JA 3GISB 1AO5A 1CBWB 5A09A 1A3BH 1LQDB 5HKKD 2PKAA 3M7QA 2WPHS 8GCHG 1K9OE 3GYLB 2HOBA 3W1EA 2VIOA 2L6OA 3KYGA 1JBUH 1ZTLA 2V3MA 1S81A 1BMAA 2CF9H 4F4OC 1RFNA 4K8BA 1GHYH 1S6FA 4Y71A 1T4UH 5GIBA 1A4WH 5T6DA 1IHTH 1FPCH 3NPSA 3Q76A 3S0NA 1GBHA 1XUKA 1QIXB 3QZRA 3DUXH 2BY5X 1AKSA 1O35A 3ATKA 4AFZA 3R3GB 1XKBC 1UJ1A 1HBTH 1BUIA 2BDAA 3A7WA 4WXIA 3EDXB 3VB4A 1DWEH 2HVXA 2FS9A 1TNGA 2FOAA 3E0PB 1TPAE 1TX6A 2GMTB 1O2RA 2G52A 1IQFA 1A5IA 2AERH 1Z6EA 1TBZH 1SGRE 4XBBA 2FP7B 3NUMA 7GCHF 2FLRH 2WPDD 1T8OA 3A81A 1GMHG 1E35B 5KECA 1SC8U 4Y6DA 2KR7A 1MAYA 3MHWU 1AMHA 1ZYOA 1H1BA 1DWBH 1IOEA 2G4TA 5JBAS 2GCHF 1OWJA 3F1SB 3SUGA 3SOSA 3SW2B 1V6DA 1GHAF 4E7RG 4CH2B 3GDVA 3BTHE 1XUJA 3ZZ4A 1OP0A 1ELFA 2A31A 1CGJE 1SGCA 1C1TA 2IN2A 4VGCB 2AGIX 4ZKOU 4JYTA 4TY7A 1SQRA 4RKJB 2FPZA 1TPSA 3SU1A 1YCPM 1TIOA 1O3AA 5ESTE 5JBCS 3E3TA 1KMHB 1TNIA 1RRKA 3I78A 2JIZD 4D76A 3RM0H 1AIXH 1BQYA 1E34B 2V6NA 2TBSA 1IQIA 1YPHE 3VFEA 5FAHA 5BRRE 1WCZA 2DE9A 5LPFA 2ZI2H 3F6UH 2YOLA 1TNLA 4Q80A 1EPTA 1LCYA 1V3XA 1PPZA 2BB4A 2BHGA 3ZZCA 3U8OH 1A3EH 1D9IA 5FXLA 1P12E 2R2WU 2Q6GA 2ZQ1A 3E0NB 1GMCF 1DLEA 1MU8B 1SGTA 2Z9KA 2FOCA 1MKXH 1DITH 2OUAA 5EU8A 5KGOA 1HV7A 3H5CB 2G5NA 2PUXB 1O3MA 1D3PB
chains in the Genus database with same CATH topology
4ZXXH 4OGXA 4F49A 3VB3A 1ZSLA 4R0IA 2D8WA 4WMFA 1SGQE 3TPIZ 3KL6A 4FU7A 4AGJA 1P9SA 4D8NA 2ZDNA 1D3DB 2RDLA 1GBFA 2ZDMA 1HDTH 3SUFA 1AQ7A 1O3EA 2W3IA 4XOJA 3SV6A 1O33A 4NZQA 3RXOA 2BQ6B 2EI8A 1MQ5A 1HLTH 1AWHB 1UK4A 2RA3A 4JZ1A 4ABGA 4H6SB 3LGWA 2ANYA 3T27A 3RXPA 1KYNA 3A88A 4ABEA 1XM1A 3LOXA 2NU3E 2ZFQH 2BY7X 1ZPBA 1ZJDA 2NU1E 1OYQA 1EOJA 1WTHD 2HALA 1W14U 3NXPA 5DP4A 4K8YA 1O5DH 2HNTC 2B0FA 1ELDE 1KLTA 1RS0A 2ZFPH 3SHCH 4Y79A 3TJOA 2VGCC 1CT0E 2BDGA 1VITG 4KKDA 3SV7A 4RN6A 1AZ8A 5C20A 1YPEH 2BZAA 1ETRH 3G01A 4Y8XA 3UNQA 1GDQA 2D1JA 1LKBA 3TGJE 4GVUA 1TGBA 1VJ9U 1ANDA 1QRXA 2QA9E 3MNSA 3LKWA 1HRTH 3CS7A 4MPUA 1A2CH 3LGVA 2ZGXH 1C2LA 4DJZB 1C1UH 1S5SA 1UVOA 4INHA 4A1XA 4CHAC 1BTPA 1C5RA 1P03A 1KDQB 2QXJA 4CBOA 1ZRBA 3T25A 2XNIA 1D6RA 1QL9A 1ELTA 1Z1JA 2NU4E 1CE5A 2G51A 4ISNA 1XUHA 1SFQB 2VWNA 2Y6TA 2FTLE 3RU4D 3PWBA 3RMMH 1GHBF 2QXHA 5FPSA 5L30H 1AVGH 1GBDA 2XTTB 2Y7ZA 1L1JA 3UOPA 1O5GH 2BD9A 1W0YH 1TGNA 3MO9A 5EQQA 3QDZB 1GCTB 1MCTA 1UCYK 3VB7A 1TX8A 5BPEA 3VXFH 4X2XA 2F9PA 3LDXH 1GBTA 3SI3H 1SL3A 1OP8A 3QN7A 4X8SH 4DT7B 1NC6A 5FBIA 1HGTH 4YLUA 1UHBB 6CHAC 2A4OA 4A1TA 1CU1A 4JYVH 3O8RA 1QB1A 4BAHB 4R8TB 1THSH 2GDDA 2ZPQA 1EZQA 1TYNA 3PLBA 1C4V2 4TPIZ 2BDBA 2ZO3H 1IQEA 1UTOA 3STIA 3GCTG 3P92A 2NU2E 2P8OC 3HATH 1DM4B 1NO9H 4Y8YA 1UCYE 1FPHH 2VIVA 1V2VT 4K60A 3TJVA 1Y3XA 1LDTT 5FBEA 1FIZA 3LGIA 3PM3A 1XX9A 3L33A 1ZMLA 2R2MB 1AU8A 3QK1A 4TPYA 4Y76A 1OYTH 2KAIB 1C2HA 2BDIA 1GBIA 1P02A 1G9IE 5A8ZA 1M9UA 4BANB 2WUBA 2FI5E 4YZUA 3W94A 4GSOA 1MD8A 4DCDA 2FWWA 3SI4H 4A1VA 1ZGIA 3UTUH 1LHDH 1O30A 3GICB 3KF2A 1CVWH 3ZZ3A 2ODYB 1A0HB 3ZVBA 1RJXB 1AFQC 2H2ZA 1BTXA 5AFYH 4BTUB 1SMFE 3A7VA 2XBWA 4BXSA 4DGJA 4DURA 5L6NH 2OC7A 4DOQA 3E8LA 1Z7KA 3MH5A 1WQSA 1HAOH 5HM9A 1AY6H 1O2NA 1PYTD 2ZG0H 1V2WT 1QBNA 1GPZA 1L4DA 5CHAB 1J14A 3SJOA 5J4QA 3OU0A 4XDEA 5AHGH 4AZ2B 5F8TA 5LPEA 1GHVH 1BJUA 3HK6B 1TRMA 2HLCA 1P2JA 3S7HB 1ZPCA 2ANWA 2BOKA 1Y3UA 1TA6A 1P09A 5DPAA 2FYQA 5E2OA 1FY1A 2AYWA 3O8BA 2AIPA 4ABAA 1EAIA 2C93B 2A0QB 1EB1H 4ABHA 1QB9A 3QLPH 2OD3B 4XBDA 2D2DA 1OWHA 3MNBA 2F9UA 1PPEE 3MU0A 1QQUA 4IC6A 1H8DH 1C1RA 1Q3XA 3T5FH 1SQAA 1CHOG 2FI4E 1P8VC 1VGCC 4X1SU 1NTPA 3PO1C 1P57B 3LH1A 1F5KU 1O5AB 4ZUHA 4IN1A 1V2TT 3S69A 3ZVFA 1O2GH 2CF8H 1PQ8A 3OSYA 2JETC 2A5KA 3K65B 2ZPSA 3RLYH 1S83A 1K1OA 1PPBH 2PTCE 2BXTH 2XCFA 3PMJA 1MMJN 4X8TH 1N6XA 2CMYA 2ZTZA 1BCUH 1DE7H 2WV4A 2EA3A 3GCNA 1UCYH 3D65E 1UVTH 1ZMJA 4JK5A 3PMBB 1QFKH 1TWXB 2K1QA 1OPHB 1ZRKA 4UFEH 6GCHG 1ESTA 1ETTH 5E0HA 1O3CA 4O3UA 1KTSB 3LJOA 2VVCA 3A8AA 1J15A 1ESBA 3ZYEA 2F9BH 3K2UA 2CHAC 2AGGX 5GPIB 3RXRA 3RXIA 2ALVA 4YLQH 1V2NT 2ZECA 1KIGH 4UFGH 4AFUA 1F7ZA 1F0RA 1HUTH 5CMXH 2CJIA 1Z8RA 2ZHEH 5C1XA 6LPRA 1P9UA 1Z71A 2B7DH 1NU9A 3KCGH 3Q00A 3NKKA 1XMNB 5FCKA 1RIWB 3BTWE 2OINA 5A0BA 1TX7A 1MBQA 1FN8A 1Z6JH 3MU5A 2EI6A 2FODA 2GD4B 3MU1A 5EPYA 2W5EA 1N1LA 3K6YA 5G4BA 1O3OA 1O3JA 4WMDA 1C5XB 5HGGA 4DVAU 1EP6A 3BEIB 5DKMA 1BOQA 2BX3A 4GAWA 1V2ST 5EQRA 2GDEH 3MWIU 1K1MA 2VIWA 1WSSH 3MU4A 2ZFSA 2JH6D 3HKIB 3SU6A 3D49H 4X6OA 2V3HH 1K28D 3MNCA 3EQ0H 2FS8A 2SGDE 2Z6BD 1F0UA 1C5OH 3HK3B 1ANEA 2BD5A 1C1NA 5C2ZA 3ZZ6A 3RXFA 2EEKA 3PTBA 4MG3A 4NIYA 4O97A 2FLBH 2A45B 1UK2A 1WAYB 4UEHH 2R3YA 4AOQA 2ZF0H 1TNJA 1AUTC 4IBLH 1MTWA 1ELEE 3OTJE 1ZMNA 2UUKB 3QO6A 2V0BA 8KME2 1D3TB 2BD2A 5IYTA 1P05A 1NN6A 3MH7A 4I32A 3ODDA 1GVZA 5DK1A 3MMGA 4MNYA 3AAUA 4FUCA 3PV4A 1TONA 1T8MA 1TBRH 1TQ0B 2Z94A 2ULLA 1C2MA 4Y10E 4I7YH 1OS8A 1MAXA 3M5MA 3NZIA 4Q7XA 4IMQA 1INCA 3EA8A 1NRNH 4GHQA 2OC8A 2R0KA 3UQOA 1ANCA 3MOCA 2BLWA 1O2QA 2AGEX 4MVNA 3T62A 2OLGA 2HNTE 4KTCA 4X1PU 4X6PA 1BZXE 4D9RA 2PKAB 1Y8TA 1SLXB 4ABDA 1EAUA 4ZMAH 1DY9A 1CT2E 3RU4E 2I6QA 1ZHRA 2GZ7A 1K1JA 3Q77A 2FXRA 3TIUA 1YPLH 2WPLS 2BTCE 3BTQE 2IPHA 1EZUC 1QBVH 1SQTA 2ODQA 4NG9H 2VGCB 3TU7H 3FP6E 2ZDKA 1KXFA 3A7XA 3M37A 4CR5A 3ATLA 2ZFRH 1AKSB 4YO9A 3M5OA 1MUEB 1EP5A 3MFJA 2J4IA 4O9VA 4X2YA 1DXPA 5ETXA 1O3KA 5EOKA 2ZIQH 5A2MH 2ZU2A 1O3DA 1SLVB 4B2CA 1GJ6A 2ZU1A 2ALPA 2R0LA 3RXAA 1AN1E 4CHAB 1MD7A 1Z8GA 4IW4E 1BTUA 3SQEE 1O39A 2ZQ2A 1O2KA 1TBQH 1C4Y2 1H9IE 1TGCA 2P3TB 2F3CE 2O9QA 4UFDH 4ZROA 3ZVEA 2A4RA 1YYY1 5DP9A 8LPRA 2WPMS 3BG4C 1D4PB 2FMJA 4QT8C 7KMEH 1CHOF 1C1WH 1N8OC 4Y7AA 1O2SA 3SZNA 1Q2WA 3VB6A 4MNXA 1JRSA 2OCVB 1EKBB 1GL0E 3BTME 5DP3A 3TK6A 4IC5A 2Y81A 2TIOA 4OS7A 5C3NA 3TGKE 1GG6C 5GCHF 2IOTA 3M5LA 4NFEA 1LTOA 3RXHA 1TOMH 1GI5A 2BXUH 1O34A 1V2LT 2QYIA 6CHAB 1P3EA 1EPTB 2FOBA 4CRCA 4B2BA 1VITH 4AB9A 1ZOMA 1GI7B 5EG4A 2P8OB 1CA8B 2ZPRA 3ODFA 2ZHQH 1HNEE 1QNJA 2H1UA 1BTYA 2W7UA 3GY3A 1GBCA 1EJAA 3GCHC 1UTPA 2SGPE 4CR9A 1C4U2 1NFXA 2G00A 2Y82A 2QF0A 9ESTA 3TK9A 4X8VH 3FP8E 1HFDA 2THFB 2XC4A 5A8XA 1LHEH 1IQHA 5TCAA 1Z8IB 4IN2A 1MZAA 3U1JB 1NESE 3SNEA 3LGYA 2O8LA 2C8YB 2TGAA 4LK4A 1D6WA 4ZHAA 1V2JT 4U32A 3PWCA 3O8DA 2XC5A 1C5QA 1C2KA 1EXFA 3MI4A 3RMLH 1AFQB 1UO6A 3SV8A 2ZGCA 3M7TA 1QHRB 4MDSA 1TB6H 2CN0H 2GKVE 3GDSA 4Z6AH 2H9TH 1MKWK 2WYJA 1BHXF 4GHTA 1JXPA 2FTMA 1C5ZB 5FCRA 2SGAA 4KTSA 1YBWA 1G30B 2VVUA 1VR1H 1P06A 1BITA 1IQJA 1ORFA 3F68H 9LPRA 1ARCA 1EJNA 1B5GH 2O8UA 2OC0A 5EW1H 2C8ZB 1ABJH 3V3MA 1V2UT 4ZKNU 1QJ6B 2BD3A 2NU0E 1NRSH 3IWMA 2PFEA 5E2PA 4WWYA 3E6PH 2VINA 1RTLA 1H9LB 2ZTYA 1Y5UT 2CXVA 3ITIA 2QN5T 5GJ4B 2PLXA 5J4SA 1TPPA 1QBOA 4UONA 1S0RA 1ABIH 1DX5M 1SGFG 1UTMA 3KQCA 4ZXYH 1RTKA 3LU9B 4I8LA 1DANH 3URDA 1C1MA 2EC9H 2H6MA 3K6ZA 2O8MA 2P93A 1BIOA 1T4VH 1PFXC 2VWLA 2VH6A 1GVKB 3ZVAA 1A46H 4X2WA 1VGCB 1GBKA 3CENA 4K1EA 1QRZA 1RD3B 1F5RA 1C2IA 2Z9LA 3T2NA 1QB6A 1FLEE 1BTZA 2BMGB 2O8TA 3E1XB 3ZZDA 1OWKA 3E91A 1LQEA 1O5FH 1OOKB 1V2OT 1WOFA 3A7ZA 1GJ4H 1HAIH 1UVPA 1GDUA 2J94A 3VGCB 4A5TS 1CSOE 5T6GA 3UIRA 1TOCB 1LVMA 1TFXA 3P8NA 2Y5HA 3I77A 5IDKA 3ZZ5A 3U98H 1CO7E 1FI8A 4BTIB 1SQOA 1Y5AT 2WPKS 1XXFA 4D7FA 1KLIH 5EQSA 3UNRA 2Q6DA 1JRTA 1Z8JB 1GL1A 1ZR0A 2CHAB 5DO4H 1LPKB 3RXDA 5EPNA 1AVXA 1P11E 2QC2A 4KTUA 1P2IA 4JZFH 3C27B 3FANA 1QR3E 1XUIA 1FMGA 2PHBA 4ABJA 3MO3A 2RG3A 2ZDAH 1BMNH 4A7IB 2VNTA 2ZTXA 3L6PA 3LC3A 3VPKA 2FX6A 3RUOA 3GY7A 2XYAA 1SLUB 2W3KA 3BG8A 1BA8B 1GHZA 4NIWA 1XXDA 2PW8H 3LONA 1AHTH 5C5OA 2QXGA 2VIPA 2SNVA 1GHXH 1NFYA 4GCHG 3DHKH 2SNWA 2P3UB 3UY9A 8GCHF 2LPRA 3P8GA 1LHGH 4YESB 5ABWA 2GCTB 1F5LA 2ODPA 3RU4T 1O32A 1YPKH 3F9HA 5B6OA 5GWZA 3KN2A 1GHWH 2TRMA 4FUBA 5K0HA 1FXYA 1FAXA 1O2UA 2RA0A 3SJIA 1TMBH 3PROA 4XSKU 4X1RU 1B7XB 1WBGB 3SJ9A 1H8IH 3GOVB 3M3TA 1PJPA 2QGRA 4OS1A 1LKAA 2QY0B 1KXCA 1TMTH 1MKWH 4I33A 1TGSZ 1O3NA 1ZHPA 2FM2A 3ELAH 3ZVDA 2SGFE 4WY3A 1PPGE 4NIVA 3ENSB 4NSYA 3S9AA 1FDPA 5C5NA 1G3BA 3S9CA 1YC0A 1VCPA 1GMHF 1CGIE 1SGEE 4JCNA 5EXLA 2FOMB 1MTVA 4B75A 4SGAE 1DICA 1QL7A 2ZGBH 5C67A 2R9PA 4Z0KA 3SJKA 4B1TA 2B8OH 2G4UA 2Q6FA 3BTFE 2PKSC 4Q2KA 3ZZAA 3AW1A 1SG8B 1AWFH 1O3BA 4WH6A 3JZ2B 1EUFA 2GVFA 1JOUB 3TJNA 4MLFB 3F9FA 2Z9JA 2P16A 4CRBA 1K1LA 4JZEH 2A32A 3A84A 1HAHH 1FY8E 1MTNC 1C5MD 3A8CA 1E37B 3ATMA 1ZSKA 1GI4A 1THRH 2GX4A 3UPEA 1D3QB 1O2HA 4E7NA 3SNAA 2Z3CA 1GI9B 1YPHC 1W3CA 1EQ9A 1OXGA 3SORA 2TGTA 1P0SH 1QQ4A 3U1IB 2PR3A 1T8LA 8ESTE 5JB9S 3ZV9A 1NS3A 2A5IA 3RMOH 1TPOA 2FO9A 2PWXA 2G8TA 1BTHH 2OXSA 1TGTA 2ZA5A 1BT7A 1HXFH 2XBYA 3QWCH 1QJ7B 1DSUA 2UWLA 1B0FA 1LHFH 1O0DH 1ZSJA 1N6YA 1ZZZA 1BJVA 3ZYDA 2WINI 1O2WA 3R0FA 1ETSH 2F91A 1THPB 1FY4A 4AB8A 1NRPH 2WYGA 1C5PA 1GJBB 5F03A 3ATIA 1H4WA 4HZHA 5JB8S 2ZHFH 3PLKA 1K1NA 3ZZ9A 5LH8A 1ZTKA 2I6SA 1OP2A 1XUFA 3MU8A 3UNSA 2BYAX 2J2UA 2ILNA 1O2OA 3O8CA 1GDNA 5EGMA 4Q7ZA 5FPYA 3RXGA 4JZIA 2XRCA 1FZZA 1HAZB 1QURH 1IQGA 4NZLA 1VJAU 2SGQE 1QA0A 4FUDA 4RKOB 1TABE 2XWAA 3BG4B 3QZQA 4NSVA 1W13U 4I31A 1HJ9A 4ZAEA 2OBQA 4DIIH 1E38B 1F0SA 3TH4H 3ZVGA 1P3CA 1HJ8A 1S84A 2J9NA 3AVZA 1SOTA 4MTBA 2QAAA 2ZGHA 5JDUB 1VITF 1WQVH 1GG6B 3T28A 4J1YA 1SLWB 2FIRH 3EAJA 3TK5A 1HAVA 2R3UA 1QCPA 1O3FA 2GCHG 3B23B 2STAE 2XWBI 1HB0B 2PGQB 1GHAG 2Z3EA 5AF9H 2OC1A 2QF3A 5EODA 4TWWA 3LGTA 4B2AA 3UR6A 1VZQH 3A8DA 2AMPA 1J9CH 1SHYA 1Q31A 1XVOA 1MU6B 5LGOA