1Y3UA

Trypsin inhibitor complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Thermodynamic Characterisation of Protein-Inhibitor-Complexes of Thrombin and Trypsin Inhibitors
rcsb
molecule tags Hydrolase
molecule keywords Trypsin, cationic
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y3uA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y3uA02
1QQ4A 2GX4A 4FUFA 2WPMS 4Y10E 1AFQB 1G3EA 2GD4B 3W95A 1N8OC 3GCHC 3N7OA 3QZQA 2HOBA 1QFKH 1V2VT 1AKSB 1MCTA 3Q3YA 3Q76A 1HJ8A 1BQYA 2AMDA 1EOLA 1TNGA 1GVLA 3O8DA 1DY8A 2XCFA 3PMHB 2FS9A 2VWLA 1V3XA 2XBVA 1O2JA 2OC1A 3PTBA 3EQ0H 3GYMA 2ZDNA 1L4DA 1RIWC 3U8OH 4ISHH 3HK3B 5L6NH 1S0QA 7LPRA 3TK6A 3SV9A 1C4U2 4Z6AH 1NO9H 1JWTA 1P8VC 3OTJE 3STIA 1SPJA 1RD3B 2ZPQA 1SGNE 1YM0A 2STAE 3D65E 1C1WH 1GI6A 3GOVB 5DJ7A 3U8RH 4CHAC 8GCHF 2QIQA 2VVUA 3SU3A 1BHXF 4IGDA 3MMGA 1OP0A 1O3CA 1C5TA 3RM2H 4TWWA 1O3OA 1TQ0B 4BXSA 2FS8A 2QXGA 4R0IA 1UTPA 1VITH 2XBWA 2B7DH 2UWOA 4JZDH 3L3TA 1CO7E 2CN0H 3NXPA 2DE9A 1ELGA 1Y3XA 2C90B 3LT3A 1OX1A 2ZFPH 3SN8A 3SHAH 3U98H 2AGEX 2BXTH 2J9NA 3IITA 5JPMH 1TPAE 1DPOA 2FYRA 3S0NA 2FOGA 3SBKA 1GDUA 2J94A 1YPGH 1AZZA 2Z9LA 1GJ6A 3GISB 1CT4E 1HAVB 2PTNA 3BIVH 1SLUB 5ETXA 1GBEA 1NRSH 1XKBC 1UO6A 5C1YA 1O2LA 1H9IE 1P2MA 1GDQA 3A86A 4WVPE 5AVDA 5C20A 1F7ZA 2DUCA 3UOPA 1ZZZA 3UPEA 4YESB 4AORA 3E1XB 3ESTA 4B71A 2FYQA 1Y3UA 3RMLH 1GI8B 1TNHA 4FUJA 2WPJS 1D3TB 4A92A 3E0NB 1SOTA 4TPIZ 3SO3A 1DITH 1NS3A 3MYWA 4CBOA 1Z8GA 3BTWE 1FV9A 3A8BA 4PROA 1LVYA 2WUCA 1W14U 4UEHH 1LQDB 3DA9B 5AFZH 2XWAA 1GMDG 1TMBH 4U2WA 5IYTA 1Z71A 2H1UA 1VZQH 1TBQH 4ABBA 1FAKH 4DCDA 2GTBA 2ZFTA 5DP3A 3ZYEA 1V2QT 1OWDA 5GCHF 1OP2A 3SUGA 1C1UH 1P2KA 1UVSH 5EOKA 2XWBI 9LPRA 2HALA 1BJVA 3UIRA 2ZU4A 1VITG 1P04A 1QL9A 1ELEE 2Z9GA 2I6SA 3RMNH 4Y8YA 1V2MT 2QC2A 1A3BH 3LJJA 4ZROA 1G2LA 1TPSA 2SNWA 1GPZA 1TONA 2WYJA 2BDCA 1QY6A 2W3KA 1O5AB 1P57B 2HVXA 1YCPH 1K1MA 1LPZB 1GBHA 4WY3A 1CHGA 2EEKA 1GMHG 1F0RA 1TB6H 2W5EA 3E0PB 1LKBA 1PQ8A 1QGFA 1WUNH 3I78A 1HBTH 1MTVA 5FXLA 1MKWK 1VCQA 1OWEA 1SB1H 3M3TA 1NFYA 2FMJA 1TOCB 1O5EH 1TRNA 1YPJH 1TGSZ 4MTBA 2TGTA 2ZKSA 1A0HB 1F92A 4IC5A 1SGPE 1UJ1A 3P6ZB 1FDPA 4AG2A 4X2XA 1HUTH 2NU3E 1MZAA 1OXGA 4D76A 5JYIA 3C27B 2BQ7B 5C5NA 3P8GA 5F03A 3SU0A 1AO5A 4YM9A 1C9TA 4UE7H 1K28D 1DWBH 1CQQA 1FZZA 5EXNA 1WAYB 1HAVA 2FOEA 1DM4B 2OXSA 1SI5H 5EPYA 1ACBE 1UCYH 1GI4A 1JIMA 2FOAA 1EUFA 4CH2B 3SJKA 2O8UA 4JZEH 1ZJDA 1HAPH 3HGNA 4LOYH 3OSYA 2B5TB 1EB2A 4ZUHA 2C8WB 1N1LA 1HAXB 1DSUA 3PO1B 1GG6B 1UVTH 2Z3DA 2QYIA 3KQBA 1XUGA 2RG3A 4X0WU 5C3NA 1GGDC 2AYWA 1DX5M 2SGAA 1HAZB 2VIVA 1NN6A 1OWJA 1RTLA 1D6RA 4Q7XA 4WF8A 1GHBG 2UUYA 1G30B 1S81A 1B7XB 4OS5A 1P3CA 1BCUH 1QCPA 1TRYA 1BB0B 1BTZA 2ZPSA 1A5GH 3EE0B 5A8XA 1AWHB 2I6QA 2P8OB 2W26A 3SJ9A 1GBMA 1O2QA 5JB9S 2QV1A 1G9IE 4FUBA 4RKJB 5DGJA 1EAWA 2G51A 2EI6A 1ZPZA 3SGQE 5EGMA 2BTCE 3JZ2B 1T32A 5GXPA 4MPXA 1BTXA 2ZHQH 5IDKA 4XSKU 1AY6H 1AUJA 3HKJB 6GCHG 1H8DH 3ZYDA 2ZFSA 1K1OA 3A85A 1G37A 1TNIA 1C2DA 5G4BA 1UK3A 1C2GA 3HATH 4RSPA 2ILNA 2GCTB 3LH1A 1OWHA 1SGTA 2JETC 3TNTA 5FCKA 1DDJA 4Y0ZE 1LTOA 1Y3VA 1O2SA 4FU8A 5E2OA 1UTKA 1ELTA 2ZP0H 2HNTF 3BG4C 1BA8B 4NWLA 1O3NA 2VWNA 3MU0A 1LHCH 1CGHA 1GI0A 1Y59T 3A82A 4AYYB 2FOHA 2XYAA 2ZHFH 3BSQA 3M7QA 4JYVH 1T4VH 3ZZ5A 4MQAA 1UTJA 4ZKNU 1P9UA 2PTCE 2J34A 5DP5A 2ZHDA 1ZMLA 1CGIE 3UREA 4X2WA 3WY8A 1GBKA 1GBAA 1XX9A 1LHDH 4B75A 3OU0A 3RXIA 2G00A 1T8LA 1NFUA 3C1KA 1BBRE 5EPNA 4UONA 3ODDA 4XE4A 5GJ4B 1C5XB 3V0XA 1MUEB 1NC6A 2W3IA 1GVZA 4FUCA 9ESTA 3GCTG 1SL3A 1F5RA 1GJBB 2OUAA 2ZFQH 4FVDA 5DP7A 4FXGH 3QUMP 1QBOA 2G52A 2BLQA 3K2UA 2IOTA 4DIIH 3RXHA 2R0KA 2BMGB 1JRTA 3SI3H 3QX5H 3RC6A 1KXAA 1HJAC 3PO1C 1W0YH 1J9CH 2PWXA 4JZFH 1YKTA 1EXFA 1IQLA 3AW1A 3CS7A 4HFPB 1A5HA 1XUJA 4E05H 1AD8H 1TNKA 1AVGH 1Q31A 2PKSC 4O97A 4CRBA 1ZTJA 1KLTA 3ZV8A 2ZU3A 3ZV9A 4X6OA 1AGJA 2O9QA 1GI7B 1OWIA 1AE8H 3RXAA 3U8TH 4HTCH 1ZRKA 1J17T 3LGWA 3SUFA 5TCCA 4HGCA 4H6TA 4JZ1A 1O2KA 3V13A 5E0GA 1A0JA 1TNJA 3G01A 2H9EH 4TWYA 1SC8U 1KLIH 3SOSA 1W0ZU 4FUGA 4D9QA 1HAHH 3UNSA 1BRUP 2G81E 4ISOA 3Q77A 1O0DH 5EQSA 3W94A 2CXVA 3V3MA 1ZSLA 3GDVA 2ZTZA 1D4PB 5A8YA 1EZUC 2XC4A 1C2LA 3VPKA 4CHAB 2FDAA 1C5YB 1TA2A 2VU8E 3PROA 4FVBA 3MNBA 4DT7B 1PPGE 2FO9A 5FPYA 3RLWH 2BD9A 1S5SA 1HIAB 1HLTH 2VJ1A 3LDXH 1HAOH 5I25A 1MKWH 1NFWA 1J8AA 1WQSA 5DO4H 1C2JA 3BEIB 4Y71A 5LGOA 1GBFA 2BD5A 2HNTC 8GCHG 1V2UT 2ZHWH 2WYGA 2F9PA 3PMAB 4H42U 1O30A 1MCVA 4ZHMU 1BHXB 2FTMA 2YOLA 3GCTF 4Q7ZA 4SGBE 1O2UA 1YCPK 1ELVA 2BY5X 3BTTE 2OTVA 3K65B 3MOCA 2OQ5A 3URDA 3AAVA 4XOJA 7ESTE 1C2IA 3UQVA 4BXWA 4LZ4B 4JCNA 2G5VA 3T29A 3TJNA 3SV7A 2Z3EA 3T25A 1V2LT 2ANMH 1C1SA 3UUZA 1B0EA 1G3DA 1TGBA 4AOQA 2A0QB 3SJ8A 3A7TA 2TGPZ 2XXLA 4ABFA 4A1XA 2A2QH 7GCHF 3PTNA 4ABEA 2ZGJA 1KXFA 4ISNA 2VH0A 1XXDA 4KELA 4NCYA 3RXSA 1HAIH 2TPIZ 3B9FH 1A3EH 1HCGA 1K1NA 2VVVA 2C8ZB 1KY9A 2FOFA 4JK6A 3SU1A 4ZHLU 3E16B 1FI8A 1GBBA 3Q00A 1QBNA 1XVMA 1GI3A 3A8AA 4BTTB 5LPFA 2BDAA 4KP0A 1EZQA 1P12E 1RRKA 1GI2A 3ZVEA 3VXFH 1DWDH 3PWBA 2WUBA 1AI8H 1X7AC 2A5IA 2BD8A 3SUDA 1W2KH 4O03A 4CRDA 4X2VA 4K1SA 1SQTA 4FU9A 5A0CA 3M61U 1E37B 3LU9B 1T7CA 1Y5BT 1YP9A 4R8TB 4I33A 3TH3H 1C5VA 1FN6A 2D1JA 1GI1A 1K1LA 4YOIA 4BAQB 3M3SA 5I46H 2F9BH 3RP2A 1G2MA 3EAJA 3M5MA 3RXPA 1NPMA 3P8FA 2HLCA 2ZFRH 1GG6C 1FY5A 2OLGA 4FUIA 2Y5HA 2V0BA 4NFFA 1K1PA 1C5SA 4ZKSU 1W11U 3MFJA 1KXBA 3VGCB 2F91A 3GDSA 1Z7KA 2BX3A 1NESE 2ZNKH 3VEQB 1VITF 1DICA 4BAMB 4GHTA 2PHBA 2CJIA 3BTDE 2WINI 1XUKA 3GY2A 3U1IB 1SGFG 3MNCA 1LPGB 1CBWB 1CGJE 1LHGH 1QJ7B 2G4TA 2Y7ZA 1BRCE 2P8OC 1DUEA 1O5GH 1P2IA 1O2GH 1IQGA 4NA7A 4ZAEA 3ATKA 5CHAC 1K9OE 1GJ4H 1AWFH 2FXRA 4CRCA 1FN8A 1HIAA 2BOKA 3T27A 1OP8A 2ZDAH 4ZKRU 1C5PA 3MI4A 3GY7A 1O3PB 2VIDA 1ZGIA 2Z9KA 1B5GH 3BTME 1OSSA 1LMWB 2BXUH 3TJUA 1MAXA 3CP7A 1FJSA 3RU4D 4XBBA 2M5TA 3LJOA 4I8KA 3SV8A 1G3BA 3P8NA 4ZH8A 3M37A 2OQUA 2PGQB 5EXMA 4ESTE 2ANKH 1TWXB 5B6OA 1QIXB 1O31A 5CE1A 1BUIA 3GCNA 1QRZA 1TOMH 3M36A 2O8TA 3ZVGA 1DANH 2C8XB 1YBWA 1RTKA 4FUHA 4MNXA 1LDTT 4K5ZA 3RLYH 3F6UH 4AFQA 3AW0A 1NFXA 3I29A 2AIQA 3FVFB 4YLQH 2P93A 4K3JA 5GPIB 1UK2A 1S82A 3ZZ3A 4WMDA 3GCOA 3SGAE 2GGVB 2VWMA 1PFXC 2EI7A 2ZHEH 3MO3A 5PTPA 3FZDA 1H1BA 4Q7YA 5LPRA 5AFYH 1JXPA 3SZNA 3A88A 3EA9A 3ZZ8A 1KIGH 3RXRA 1DWEH 1QL7A 3PLKA 2ASUB 1D3QB 4X8UH 3RXUA 4RKOB 4U01A 2BYAX 1BDAA 1D6WA 1UTNA 3KCGH 1D9IA 1EPTA 5EQRA 3SNEA 2CV3A 1FIWA 3S9CA 3KF2A 3FANA 5GDSH 1O3JA 4I31A 5FPSA 2VB0A 2DE8A 1FAXA 3QN7A 4B1TA 4O9VA 1P06A 5DPAA 2J38A 3E8LA 1C1NA 2HNTE 2D2DA 1GHXH 3A7YA 3LC3A 3P17H 3MHWU 1SBWA 1SGYE 1A2CH 2Y81A 3S9BA 3IG6B 2UWPA 4IN1A 1CSOE 2BDIA 8LPRA 2A4RA 1JOUB 2BDYA 4RN6A 4GCHF 1AFQC 4I8GA 4MG3A 2JKHA 1AN1E 1Z6EA 5T3HA 1L4ZA 2ODYB 3TGJE 4DVAU 3STJA 1F0UA 1ZSJA 2PSXA 5ABWA 1ETRH 1O3IA 4FU7A 2HPPH 5E2PA 1O2NA 1GJ8B 2H5CA 3SJOA 1UTLM 2WPHS 1FPHH 2ZCLP 1XMNB 2ZU5A 1PQ5A 5J4SA 1Y3YA 3HGPA 5JB8S 3S69A 3M35A 3LONA 4ASHA 2GMTC 1S0RA 1KSNA 1KXDA 2P94A 4B76A 2A4QA 1RJXB 1MKXH 2XRCA 1P2JA 4KTUA 1EAIA 2G4UA 3NPSA 5T6DA 3ITIA 2O8WA 1S6FA 4OGYA 3O8RA 1QURH 2ZGCA 1P2OA 3RM0H 4A6LA 1G3CA 7KMEH 4A5TS 1BBRK 1BITA 3BTHE 3EGKH 2V6NA 3MH5A 1Z1IA 4INLA 2BD3A 2XC5A 4UFFH 2GT7A 1O34A 2HRVA 4YT7H 2A31A 4B2BA 2GDEH 3MH4A 3ATWA 1F5LA 2BY8X 4HZHA 1GJAB 2TIOA 1F5KU 3FP6E 3M7UA 4FUEA 3SUEA 3TH4H 4YLUA 4OS6A 4KTCA 1MTNB 3P92A 1RTFB 2BLVA 1EPTC 1TA6A 2ZQ2A 3F9GA 4ABHA 2ZQ1A 2ZA5A 1LKAA 2BVSH 3T5FH 5JDUB 1EASA 4F49A 1QJ1B 3KNXA 1HPGA 1ABJH 1GMHF 2PR3A 6ESTA 1QB1A 2O8MA 4X6PA 5DP4A 4OS7A 2O8LA 2TGDA 1EB1H 5E8EH 1OPHB 2BY7X 2CF9H 5BPEA 1TRMA 5T6FA 3LKWA 1NRNH 3RMOH 4JYUH 2HGTH 4B2CA 2GT8A 3F9FA 1O3MA 1O5DH 4K8BA 1HAGE 1V2JT 1WTGH 1FY1A 1OWKA 2ZEBA 1AB9B 1EKBB 2C3SA 1IQMA 2F9NA 2H6MA 1KDQA 2R2WU 1SLVB 2BVRH 1UTQA 3BIUH 4AFSA 4AN7A 4OS1A 3A7WA 2PFEA 1GHWH 3VB3A 1O3KA 4CBNA 1A46H 3LGUA 2A4OA 4CR9A 2A2XH 2H2ZA 1MD8A 1WQVH 4MNVA 1E34B 3TH2H 1SR5C 1W7GH 1KDQB 3SU6A 3V12A 4Y6DA 1T4UH 1TBZH 1HFDA 4JMYA 3KEEA 2ZWLH 2CHAB 2AIPA 2R2MB 2ANWA 2HPQH 2ZDVH 2ZZUH 3A7VA 5EXLA 3KQDA 1MMJN 1FY3A 3P8OA 2OC0A 1FLEE 1J14A 5EQQA 6GCHF 1BMAA 3AASA 4MPUA 3SNDA 3ATLA 1YPMH 4X6MA 1ELDE 1GBTA 1GL1A 1DWCH 1RFNA 1V6DA 3PWCA 1UVUH 2GMTB 1TGNA 1E36B 3PYHA 2AGIX 1P10A 1PPEE 2CF8H 3MU8A 4NWKA 5F8XA 4AX9H 2ZTYA 4Q2KA 3RC5A 3RXCA 3OX7U 3FP8E 1QA7A 3O8CA 3ZZAA 3ZZ9A 3LPRA 2R0LA 1ELAA 2FLBH 3MH6A 1NM6A 4KGAA 3KQCA 1A5IA 1SHYA 1UTOA 4NA8A 5EODA 4CRAA 1E38B 1MQ6A 1GBIA 5K7RA 1EP6A 1NRQH 1SGDE 1FONA 3K6YA 1ANCA 2BZ6H 5TCAA 1TFXA 3ZZ4A 3VB6A 4HI3A 4ISLA 3F1SB 1W3CA 1IHTH 2WV5A 3UWJH 2W7UA 3S7KB 4A1VA 1QL8A 1MU6B 1C1TA 1TX7A 4TYDA 1PYTD 3LC5A 1TGCA 2IJOB 5JBAS 1FQ3A 2AS9A 1ZPBA 3SU5A 2OC7A 4OS4A 4Y7AA 3H5CB 3UY9A 2OC8A 2FOCA 1Q2WA 2A45B 2BLOA 1QRXA 1AFEH 2XCNA 4Y8XA 2P95A 1QB9A 2QF0A 5JBTA 2JH6D 2VGCC 3ZVAA 4X8SH 4I8JA 1EJMA 1YPKH 1O3DA 5FX6A 7GCHG 3SGBE 2IN2A 4B73A 1DS2E 1P09A 1VR1H 3QGNB 2VIQA 4MDSA 1GCDA 2QXIA 1S6HA 1O2RA 2OCVB 3T26A 3RMMH 3D49H 2WV4A 3H7TA 2FP7B 1CT0E 3BV9B 3ZZ6A 1CBWC 2HWLB 8KME2 4MVNA 1FPCH 4UFDH 1HRTH 1LCYA 4DY7B 1L1JA 2ZPRA 4AB9A 4LZ1H 1EX3A 2Y5GA 5T6GA 3ZVDA 3MWIU 3QO6A 1Z1JA 3QTVH 4B74A 2SGDE 1UCYE 1OYQA 1AIXH 1C5QA 4DGJA 3F9HA 1QB6A 1GJCB 2PSYA 1MD7A 2BD2A 4O3TA 1S85A 1YYY1 2IPHA 1E35B 4X1NU 1G36A 2VIWA 1TAWA 1IQHA 4XBDA 2R3YA 1LO6A 1H4WA 5DP8A 6LPRA 2ANYA 4AG1A 2P3FH 4TY6A 2QXJA 5FAHA 2BM2A 2Z6BD 1DXWA 3R3GB 3S7HB 2BOHB 1SMFE 1SLXB 4ABGA 1S83A 2PKAB 1P02A 1NRPH 2AH4X 1W13U 5FBIA 5EW2H 1O2HA 4DIHH 3RXMA 1K21H 2NU4E 4X8TH 2SGFE 1IAUA 1PPZA 2AFQB 1NROH 2PKAA 4IS5A 3B23B 2GDDA 2KAIB 1EAUA 2P59A 1GCTC 2D26C 4AZ2B 1F0SA 3RXFA 1OYTH 2OP9A 4YT6H 1Q3XA 1CA8B 2ZDLA 5DG6A 3BTEE 1K1JA 1O38A 4GPGA 1XKAC 3QGJA 3VFEA 5C1UA 1BTWA 1QRWA 1VCWA 1ZJKA 5FPTA 5H4IB 3QZRA 2V35A 1C5MD 4KTSA 1YLCA 1WSSH 3A8DA 3HKIB 3ZZDA 2FX4A 3BEUA 1AE5A 5F8ZA 1SGQE 4Y7BA 3VGCC 1Y5UT 1TIOA 4X1RU 1YPHE 4LXBH 3RXBA 1HDTH 1VJAU 1O3AA 3SNBA 1GDNA 3F9EA 2BLWA 2AMPA 2OBQA 1K1IA 2WPIS 4CRGA 5HM2A 3IWMA 3RXTA 2F9OA 3DFJA 3SJIA 4E7RG 1INCA 4ZHAA 1KXCA 4XDEA 4DURA 1UK4A 3SV6A 1PPHE 2ZFFH 1SGRE 4ZXYH 3TGKE 1ZHPA 3RC4A 3OY6U 1JBUH 3RU4E 1GHZA 3A8CA 1WTHD 5JBCS 1ESBA 1O32A 1BJUA 2F3CE 4JZIA 2FI4E 1C1MA 4I8HA 5LPEA 1DLKB 1GWAA 1SGEE 3EYDA 4NG9H 4YO9A 4J2YB 3ATIA 2FX6A 3UTUH 4DW2U 2QN5T 2UUJB 1V2NT 2CMYA 3EA7A 4DG4A 2PV9B 1EZXC 1C1QA 4DJZB 2Y7XA 5A0BA 2XBXA 4Q80A 4WWYA 5A0AE 1AKSA 1IQJA 1ELCA 3BN9A 1QR3E 1V2RT 2FODA 5HXFA 2VIOA 4GSOA 4ISIH 3VB5A 4F4OC 3NK8A 2FM2A 4NIWA 3UFAA 3LIWA 3A84A 5EU8A 4TY7A 3ZZBA 3B8JA 1AB9C 1BIOA 2QF3A 1THRH 1TNLA 1VGCC 3ODFA 3SQHE 3A81A 4X1PU 3E90B 3GY6A 1O36A 2ZGHA 4K8YA 2Z9IA 2QA9E 1TE0A 1LVBA 2A7CA 4AGJA 3ZZ7A 2ZCHP 4GLYA 1ID5H 2JETB 1QTFA 1V2KT 4I32A 4AFZA 1IQEA 1NY22 1SFIA 1DSTA 2XBYA 2ULLA 2ZU1A 1L2EA 3BTGE 1O2ZA 3FZZA 1DY9A 3EA8A 3SNAA 1TBRH 2RCEA 2TBSA 4O3UA 4GUXA 1V2OT 2R9PA 1C1OA 1S84A 3QDZB 1SSXA 1MU8B 3Q3XA 1BTUA 3UNRA 3KGPA 1TGTA 4X1SU 2F83A 1O2YA 1CU1A 4WMEA 3TK9A 2ODPA 3FP7E 5BRRE 1XXFA 4MPWA 1L0ZA 3MU5A 1ZPCA 4YOJA 1HGTH 1GI9B 4TPYA 4ZXXH 1OS8A 1O2OA 3M3VA 4BTUB 1VGCB 2A7HA 1EZSC 1DOJA 3UR9A 1YLDA 1ESAA 2UWLA 2ZGBH 2H9HA 1O5BB 1TMUH 2EA3A 2G8TA 4WMFA 1NZQH 1EP5A 1SGCA 1WBGB 1IQNA 3AAUA 4FUDA 6CHAC 2Z9JA 3V7TA 3A89A 1WOFA 2Q1JA 2BZAA 1BZXE 2EI8A 2XTTB 4Y11E 1WU1A 1XVOA 1GBCA 2F9VA 3PV4A 4WH8A 2K1QA 4IC6A 2CHAC 2LNCA 4XFQA 5AF9H 4BNRA 1O37A 4IW4E 4ABJA 4Y76A 3E3TA 3D23A 1P01A 1ELFA 2FIRH 1P2NA 3P95A 2BY9X 1IQIA 3ZVFA 4ABIA 4H6SB 1QQUA 2ZU2A 4MNWA 2FESH 1O35A 3SV2H 2FPZA 1C1PA 3GY3A 5DP6A 5A2MH 3F68H 2NU0E 3RDZA 1L1NA 5JBBS 5DK1A 3GDUA 3MO9A 4U32A 5FBEA 1SGIB 3CS0A 2JH0D 1JIRA 1HJ9A 1K22H 1V2PT 3KL6A 3A87A 4MLFB 1O5CB 4WXVA 5C2ZA 1OOKB 2Q6DA 2JH5D 1E0FD 1UVPA 5GCHG 1Z8RA 3MNSA 1O2PA 1AHTH 2QGRA 3BTQE 1TX8A 2FZZA 3ATMA 5EW1H 3MU1A 3BEFB 1TALA 3ENSB 2AGGX 1MTNC 4Y0YE 2XW9A 1MQ5A 1O2MA 2BDGA 3RXQA 1T8OA 1EJNA 1NRRH 3MH7A 3GICB 2P3UB 3A7XA 4LK4A 3SU2A 5F6MA 4JYTA 2VNTA 2EC9H 1GHAF 1WYKA 2Z7FE 2NU1E 1AU8A 3E91A 2ZTXA 1DXPA 4NZQA 4UDWH 2AEIH 4SGAE 2Q6FA 1A4WH 1SOZA 2BVXH 4GHQA 3TJOA 1C5LH 1SLWB 1GMDF 3DUXH 2FLRH 1FUJA 2C8YB 2ZC9H 1C5NH 2GZ9A 1GJDB 1C2MA 1M9UA 3H7OA 3RXLA 4K1TA 4K60A 3RXEA 1XM1A 2TRMA 4B2AA 1YC0A 1ZMJA 1O3FA 3HPTB 4J1YA 4WXIA 2RA3A 1C2EA 2ALPA 4IBLH 1OKXA 1GMCF 1V2ST 3AVZA 4D7FA 1ETTH 3HK6B 4YTAA 3UNQA 3NWUA 3PMJA 1EPTB 4YZUA 1TPOA 2ALVA 2QCYA 2GZ8A 1N8OB 3GCHB 4I8LA 1HJAB 2ZO3H 1NTPA 2VIPA 4WJG2 2SGPE 3QTOH 1XUIA 1EQ9A 1BOQA 1D3DB 3RXVA 3K6ZA 4IMZA 1QJ6B 4ZKOU 1FXYA 1MTUA 3CENA 3MU4A 2ZGXH 3ELAH 2B0FA 1XUHA 1ARCA 1O2WA 1YCPM 1J15A 1W8BH 3A7ZA 2FI3E 2YNAA 1VJ9U 1DUAA 8ESTE 3TGIE 3SU4A 1LQEA 4Y79A 1PPBH 1LHFH 1T8NA 5AHGH 1MTSA 4UD9H 3TU7H 2C93B 3QK1A 2D8WA 2SGQE 4E06H 2OBOA 1SQOA 1O2IA 4GCHG 1CA0B 3SI4H 1RXPA 1O3LA 2GV7A 2Z94A 1AVXA 1QHRB 1UMAH 1YGCH 1O5FH 1MAYA 1W12U 1AMHA 3GY4A 4BTIB 2THFB 1BRAA 2R3UA 4CR5A 5C1XA 3LOXA 1CE5A 1P3EA 3TLOA 2H5DA 3D62A 5SGAE 3LGYA 2W7SA 1HYLA 1UCYK 2H9TH 1GHAG 1EJAA 4BANB 2A4GA 1P0SH 1PQAA 1O3HA 1KTTB 1HXEH 1J16A 2GCHF 3GYLB 4VGCC 1C5OH 1K2I1 3MNXA 2OD3B 2ZIQH 2BD7A 4NIXA 1A61H 2FWWA 4ZMAH 1TMTH 1ZYOA 3TJVA 1ZLRA 4ABAA 1W10U 1FY8E 5GWZA 3GY8A 1GHVH 2BDHA 1O2TA 4A1TA 1G32B 2BQ6B 3SQEE 1FMGA 1O33A 3I77A 4BOHA 2YNBA 1T8MA 5DP9A 3KHVA 1LVMA 1HAYB 1TPPA 3A83A 3TPIZ 1PQ7A 2GV6A 1C5ZB 2WPLS 4BAKB 3SHCH 4CREA 1GMCG 1HB0B 1O3EA 1SG8B 3BF6H 2Z3CA 1GJ9B 5FCRA 3RXOA 2QAAA 5J4QA 3FAOA 1FNIA 1U6QA 1PPCE 1HXFH 3P70B 4MPVA 1CA0C 4INKA 4AB8A 4D9RA 3MO6A 1H9LB 1ARBA 2P16A 1GHBF 3KIDU 1C2HA 3M5OA 1WCZA 1HNEE 3EDXB 6CHAB 1MBQA 4JK5A 3OYPA 3L6PA 4GAWA 2NU2E 1Z8IB 3T28A 3TNSA 5EG4A 1HV7A 1ZHMA 5E0HA 1SQAA 1THPB 4KKDA 1C5WB 5FX5A 1A7SA 2SGEE 1O39A 3LGIA 2NWNA 3BG4B 3PLBA 3TITA 1TX6A 2QXHA 2BB4A 5HGGA 3SNCA 4E7NA 2GVFA 1P11E 2VINA 3U69H 1ELBA 1C5UA 1P2QA 2Y5FA 4CH8B 3BTKE 4INHA 1N6YA 1DFPA 1IOEA 1LVOA 3TIUA 3L33A 2OINA 4NFEA 3NUMA 1AQ7A 1GHYH 1P9SA 3U1JB 2A7JA 3VXEH 2BDBA 1UTMA 2GCHG 1C1VH 3E6PH 1DE7H 2BHGA 1H8IH 5K0HA 1ABIH 1CT2E 1SGFA 1GL0E 1O3BA 3MTYA 1GCTB 3NZIA 1C9PA 1EAXA 2CGAA 1FIZA 1ANEA 1C4Y2 1NT1A 3UWIA 2F9UA 2PUXB 1H9HE 2V3HH 2BY6X 4X1QU 1EOJA 4Y8ZA 1BTYA 2PGBB 4X6NA 2FOMB 3M5NA 1UVOA 1IQFA 1QA0A 3PMBB 1SHHB 4D7GA 5FHTA 3PLPA 2J2UA 1BMMH 1UHBB 1GGDB 4NSVA 4XBCA 5A09A 4QT8C 5L30H 2GZ7A 2LPRA 1GJ7B 2B9LA 2Y80A 4YOGA 3T62A 1V2TT 1C2FA 5C5OA 1AUTC 2FOBA 2B8OH 2VWOA 2SNVA 2Y82A 1UHBA 1ZRBA 2ZDMA 4X2YA 1PPFE 3RXGA 4NGAH 2ZECA 3RU4T 4ABDA 5HM9A 1CHOG 5TJXA 2FI5E 3ZVCA 4NSYA 1F2SE 1KTSB 3BG8A 2XNIA 1ANDA 1C1RA 2A5KA 4K69A 1RGQA 3UQOA 2ESTE 2GKVE 1TLDA 2P3TB 1VCPA 3A80A 4CRFA 1MBMA 2AERH 2FTLE 4NIYA 3TVJB 3ZVBA 1LPKB 4NZLA 3RXDA 1EATA 4THNH 1ESTA 1BTPA 1KYNA 1ANBA 2SFAA 2G55A 2G5NA 3PM3A 1GVKB 1BT7A 2BD4A 2V3OH 1KXEA 3KQEA 3R0FA 1GBLA 1A1RA 1IQKA 1JRSA 4IMQA 1C2KA 3O8BA 1THSH 2GP9B 1ZGVA 5HMAA 5GIBA 2ZG0H 1KLJH 3RXJA 1BBRH 4AYVB 2VGCB 2PKSB 1ORFA 5L2ZH 4A7IB 2QY0B 1ZTKA 3U9AH 3PB1E 2ZF0H 1YF4A 4IN2A 3LGVA 1NU7B 1A0LA 1MKXK 5CMXH 1O2VA 1JMOH 2A1DB 2UUKB 1N6XA 3UR6A 2ODQA 5F8TA 1QNJA 3VB7A 4H4FA 5C67A 4NA9H 3K9XB 5E0JA 4NIVA 3DFLA 1ZHRA 1GBJA 4U30A 1YPHC 2J95A 5CHAB 1RS0A 3SORA 1IHSH 1SVPA 2A5AA 4D8NA 1ZR0A 1PYTC 2J92A 1V2WT 3DHKH 1GJ5H 1L1GA 2XC0A 1W7XH 1Y5AT 3M5LA 4UFEH 3KN2A 2WPKS 1QBVH 4WH6A 4VGCB 1ZMNA 1CVWH 3ZZCA 3GY5A 5ESBA 1YPEH 4GVUA 4AFUA 2ZDKA 2TGAA 2GCTC 2BQWB 1MTWA 1ZTLA 1XUFA 2FEQH 3S9AA 3T2NA 1CHOF 1O2XA 1YPLH 2J4IA 2RDLA 5L2YH 2PUQH 3M7TA 4AGKA 4K1EA 3FFGA 2PW8H 3LH3A 2VVCA 3SW2B 2KAIA 1TABE 1DVAH 5ESTE 4OGXA 3NCLA 1Y3WA 2A32A 5LH8A 2ZI2H 4UFGH 1MZDA 1DLEA 1F0TA 3TK5A 1C5RA 3URCA 2RA0A 4MNYA 1SFQB 1MH0A 4BAHB 1PJPA 4BAOB 3Q3KA 1BMNH 3QLPH 3LGTA 4DOQA 1TQ7B 1O3GA 1Y8TA 1AZ8A 2STBE 2AMQA 1BRBE 2Q6GA 1BTHH 2BX4A 3BTFE 3UOUA 3RUOA 1NU9A 2PLXA 1BMLA 1FY4A 2C4FH 4X8VH 1ZOMA 3RXKA 1B0FA 3DT0H 3QWCH 1T31A 1ZSKA 1RIWB 4K2YA 1D3PB 1C4V2 2ZCKP 1DT2A 2Y6TA 1P03A 1GI5A 1P05A 4I7YH 1Z6JH 2VH6A 4OS2A 3VB4A 1Z8JB 1GBDA 1LHEH 4Z0KA 5HYOA 1ETSH 4M7GA 5DKMA 1WV7H 2UUFB 3NKKA 3JZ1B 3DD2H 1AVWA 1TYNA 3OY5U 5A8ZA
chains in the Genus database with same CATH superfamily
1QQ4A 2GX4A 4FUFA 2WPMS 4Y10E 1AFQB 1G3EA 2GD4B 3W95A 5C0TA 1N8OC 3GCHC 3N7OA 3QZQA 2HOBA 1QFKH 1V2VT 1AKSB 1MCTA 3Q3YA 3Q76A 1HJ8A 1BQYA 2AMDA 1EOLA 1TNGA 4XD7D 1GVLA 3O8DA 3FO8D 1DY8A 2XCFA 3PMHB 2FS9A 2VWLA 1V3XA 2XBVA 1O2JA 2OC1A 3PTBA 3EQ0H 3GYMA 2ZDNA 1L4DA 1RIWC 3U8OH 4ISHH 3HK3B 5L6NH 1S0QA 7LPRA 3TK6A 3SV9A 1C4U2 4Z6AH 1NO9H 1JWTA 1P8VC 3OTJE 3STIA 1SPJA 1RD3B 2ZPQA 1SGNE 1YM0A 2STAE 3D65E 1C1WH 1GI6A 3GOVB 5DJ7A 3U8RH 4CHAC 8GCHF 2QIQA 2VVUA 3SU3A 1BHXF 4IGDA 3MMGA 1OP0A 1O3CA 1C5TA 3RM2H 4TWWA 1O3OA 1TQ0B 4BXSA 2FS8A 2QXGA 3WWBA 4R0IA 1UTPA 1VITH 2XBWA 2B7DH 2UWOA 4JZDH 3L3TA 1CO7E 2CN0H 3NXPA 2DE9A 1ELGA 1Y3XA 2C90B 3LT3A 1OX1A 3U28C 2ZFPH 3SN8A 3SHAH 3U98H 3PRDA 2AGEX 2BXTH 2J9NA 3IITA 5JPMH 1TPAE 1DPOA 2FYRA 3S0NA 2FOGA 3SBKA 2V3MA 1GDUA 2J94A 1YPGH 5CDFE 1AZZA 2Z9LA 1GJ6A 3GISB 1CT4E 1HAVB 2PTNA 3BIVH 4DT4A 1SLUB 5ETXA 1GBEA 1NRSH 1XKBC 1COWD 1UO6A 5C1YA 1O2LA 1H9IE 1P2MA 1GDQA 3A86A 4WVPE 5AVDA 5C20A 1F7ZA 2DUCA 3UOPA 1ZZZA 3UPEA 1H8HD 4YESB 4AORA 3E1XB 3ESTA 4B71A 2FYQA 1Y3UA 3RMLH 1GI8B 1TNHA 4FUJA 2WPJS 1D3TB 4A92A 3E0NB 3F3BA 1SOTA 1E1RD 4TPIZ 3SO3A 1DITH 1NS3A 3MYWA 4CBOA 1Z8GA 3BTWE 1FV9A 3A8BA 4PROA 1LVYA 2WUCA 1W14U 4UEHH 1LQDB 2JDID 3DA9B 5AFZH 2XWAA 1GMDG 5C17A 1TMBH 4U2WA 5IYTA 1E1QD 1Z71A 2H1UA 1VZQH 3OE7D 1TBQH 4ABBA 1FAKH 4DCDA 2KR7A 2GTBA 1VKYA 2ZFTA 5DP3A 3ZYEA 1V2QT 1OWDA 5GCHF 1OP2A 3SUGA 1C1UH 1P2KA 1UVSH 5EOKA 2XWBI 9LPRA 2HALA 1BJVA 3UIRA 2XOKD 2ZU4A 1VITG 1P04A 1QL9A 1ELEE 2Z9GA 2I6SA 3RMNH 4Y8YA 1V2MT 2QC2A 1A3BH 3LJJA 4ZROA 1G2LA 1TPSA 2SNWA 1GPZA 1TONA 2WYJA 3PV5A 2BDCA 5GNDA 1QY6A 2W3KA 1O5AB 1P57B 2HVXA 1YCPH 1K1MA 1LPZB 1GBHA 4WY3A 1CHGA 2EEKA 1GMHG 1F0RA 1TB6H 2W5EA 3E0PB 1LKBA 1PQ8A 1QGFA 1WUNH 3I78A 1HBTH 1MTVA 5FXLA 1MKWK 1VCQA 1OWEA 1SB1H 3M3TA 1NFYA 2FMJA 1TOCB 1O5EH 1TRNA 1YPJH 1TGSZ 1YLNA 4MTBA 2TGTA 2ZKSA 1A0HB 1F92A 2QE7D 4IC5A 1SGPE 1UJ1A 3P6ZB 2KCAA 1FDPA 4AG2A 4X2XA 1HUTH 2NU3E 1MZAA 2EY4C 1OXGA 4D76A 5JYIA 3C27B 2BQ7B 5C5NA 3NRLA 3P8GA 5F03A 3SU0A 1AO5A 4YM9A 1C9TA 4UE7H 1K28D 1DWBH 1CQQA 1FZZA 3FN8A 5EXNA 1WAYB 1HAVA 2FOEA 1DM4B 2OXSA 1SI5H 5EPYA 1ACBE 1UCYH 1GI4A 1JIMA 2FOAA 1EUFA 4CH2B 3SJKA 2O8UA 4JZEH 1ZJDA 1HAPH 3HGNA 4LOYH 3OFND 3OSYA 2B5TB 1EB2A 4ZUHA 2C8WB 1N1LA 1KMHB 1HAXB 1DSUA 3PO1B 1GG6B 1UVTH 2Z3DA 2QYIA 3KQBA 1XUGA 2RG3A 4X0WU 5C3NA 3AK5A 1GGDC 2AYWA 1DX5M 2SGAA 1HAZB 2VIVA 5IK2D 1NN6A 1OWJA 1RTLA 1D6RA 4Q7XA 4WF8A 1GHBG 2UUYA 1G30B 1S81A 1B7XB 4OS5A 1P3CA 3F0PA 1BCUH 1S6LA 1QCPA 1TRYA 1BB0B 1BTZA 2ZPSA 1A5GH 3EE0B 3WWFA 5A8XA 1AWHB 2I6QA 2P8OB 2W26A 3SJ9A 1GBMA 1O2QA 5JB9S 2QV1A 1G9IE 4AC9A 4FUBA 4RKJB 5DGJA 1EAWA 2G51A 2EI6A 1ZPZA 3SGQE 5EGMA 2BTCE 3JZ2B 1T32A 5GXPA 2QF4A 1BTXA 4MPXA 2ZHQH 5IDKA 3WW7A 4XSKU 1AY6H 1AUJA 3HKJB 6GCHG 1H8DH 3ZYDA 2ZFSA 1K1OA 3A85A 1G37A 1TNIA 1C2DA 5G4BA 1UK3A 1C2GA 3HATH 4RSPA 2ILNA 2GCTB 2J97A 3LH1A 1OWHA 1SGTA 2JETC 3TNTA 5FCKA 1DDJA 4Y0ZE 1LTOA 1Y3VA 2L6OA 1O2SA 2WZQA 4FU8A 5E2OA 4TSFD 3SYJA 1UTKA 1ELTA 2ZP0H 2HNTF 3BG4C 1BA8B 4NWLA 1O3NA 2VWNA 3MU0A 1LHCH 1CGHA 1GI0A 1Y59T 3A82A 5HIYA 4AYYB 2FOHA 2XYAA 2ZHFH 3BSQA 3M7QA 4JYVH 1T4VH 3ZZ5A 4MQAA 3MQKC 1UTJA 4ZKNU 1P9UA 2PTCE 2J34A 5DP5A 2ZHDA 1ZMLA 1CGIE 3UREA 4X2WA 3WY8A 1GBKA 1GBAA 1XX9A 1LHDH 4B75A 3OU0A 3RXIA 2G00A 1T8LA 1NFUA 3C1KA 1BBRE 5EPNA 4UONA 3ODDA 4XE4A 2WSSD 5GJ4B 1C5XB 4M9FA 3V0XA 2KCPA 1MUEB 1NC6A 2W3IA 1GVZA 4FUCA 9ESTA 3GCTG 1SL3A 1F5RA 1GJBB 2OUAA 2ZFQH 4FVDA 5DP7A 4FXGH 3QUMP 1QBOA 2G52A 2BLQA 3K2UA 2IOTA 4DIIH 3RXHA 2R0KA 2BMGB 1JRTA 3SI3H 3QX5H 3RC6A 1KXAA 1HJAC 3PO1C 1W0YH 1J9CH 2PWXA 4JZFH 1YKTA 1EXFA 1IQLA 3AW1A 3CS7A 4HFPB 5DSFA 1A5HA 1XUJA 4E05H 2KZ4A 1AD8H 1TNKA 1AVGH 1Q31A 2PKSC 4O97A 2J5UA 4CRBA 1ZTJA 1KLTA 3ZV8A 2ZU3A 3ZV9A 2GJGA 4X6OA 1AGJA 2O9QA 1GI7B 1OWIA 1AE8H 3RXAA 3U8TH 4HTCH 1ZRKA 1J17T 3LGWA 3SUFA 5TCCA 4HGCA 4H6TA 4JZ1A 1O2KA 3V13A 5E0GA 1A0JA 1TNJA 3G01A 2H9EH 4TWYA 1SC8U 1KLIH 3SOSA 1W0ZU 4FUGA 4D9QA 1HAHH 3UNSA 1BRUP 2G81E 4ISOA 3Q77A 2F4LA 1O0DH 5EQSA 3W94A 2CXVA 3V3MA 1ZSLA 3GDVA 2ZTZA 1D4PB 5A8YA 1EZUC 2XC4A 1C2LA 3VPKA 4CHAB 3H09A 2FDAA 1C5YB 1TA2A 2VU8E 3PROA 4FVBA 3MNBA 4DT7B 2W6JD 1PPGE 2FO9A 5FPYA 4Z1MD 3RLWH 2BD9A 1S5SA 1HIAB 1HLTH 2VJ1A 3LDXH 1HAOH 5I25A 1MKWH 1NFWA 1J8AA 1WQSA 5DO4H 1C2JA 3BEIB 4Y71A 5LGOA 1GBFA 2BD5A 2HNTC 8GCHG 1V2UT 2ZHWH 2WYGA 2F9PA 3PMAB 4H42U 1O30A 1MCVA 4ZHMU 1BHXB 2FTMA 2YOLA 3GCTF 5EIYA 4Q7ZA 4SGBE 1O2UA 1YCPK 1ELVA 2BY5X 3BTTE 2OTVA 3K65B 3MOCA 2OQ5A 3URDA 3AAVA 4XOJA 7ESTE 1C2IA 3UQVA 4BXWA 4LZ4B 4JCNA 2G5VA 3T29A 3TJNA 3SV7A 2Z3EA 3T25A 1V2LT 2ANMH 1C1SA 3UUZA 1B0EA 1G3DA 1TGBA 2EQNA 4AOQA 2A0QB 3SJ8A 3A7TA 2TGPZ 2XXLA 4ABFA 4A1XA 2A2QH 7GCHF 3PTNA 4ABEA 2ZGJA 1KXFA 4ISNA 2VH0A 1XXDA 4KELA 4NCYA 3RXSA 1HAIH 2TPIZ 3B9FH 3FKSD 1A3EH 1HCGA 1K1NA 2VVVA 2C8ZB 1KY9A 2FOFA 4JK6A 3SU1A 4ZHLU 3E16B 1FI8A 1GBBA 3Q00A 1QBNA 1XVMA 1GI3A 3A8AA 4BTTB 5LPFA 2BDAA 4KP0A 1EZQA 1WXRA 1P12E 1RRKA 1GI2A 5KGOA 2JJ2D 1YY3A 3ZVEA 1QZ8A 4OM9A 3VXFH 1DWDH 3PWBA 2WUBA 1AI8H 1X7AC 3F0OA 2A5IA 2BD8A 3SUDA 1W2KH 4O03A 4CRDA 4X2VA 4K1SA 1SQTA 4FU9A 5A0CA 3M61U 4I86A 1E37B 3LU9B 1T7CA 1Y5BT 1YP9A 4R8TB 4I33A 4Q63A 3TH3H 1C5VA 1FN6A 2D1JA 1GI1A 1K1LA 4YOIA 4BAQB 3M3SA 5I46H 2F9BH 3RP2A 1G2MA 3EAJA 3M5MA 3RXPA 1NPMA 3P8FA 2HLCA 2ZFRH 1GG6C 1FY5A 2OLGA 4FUIA 2Y5HA 2V0BA 4NFFA 1K1PA 1C5SA 4ZKSU 1W11U 3MFJA 1KXBA 3VGCB 2F91A 3GDSA 1Z7KA 2BX3A 1NESE 2ZNKH 3VEQB 1VITF 1DICA 4BAMB 4RT0A 4GHTA 2PHBA 2CJIA 3BTDE 5EJ1A 2WINI 1XUKA 3GY2A 3U1IB 1SGFG 3MNCA 1LPGB 1CBWB 1CGJE 1LHGH 1QJ7B 2G4TA 2Y7ZA 1BRCE 2P8OC 1DUEA 1O5GH 1P2IA 1O2GH 1IQGA 4NA7A 4ZAEA 3ATKA 5CHAC 1K9OE 1GJ4H 1AWFH 2FXRA 5C94A 4CRCA 1FN8A 1HIAA 2BOKA 3T27A 1OP8A 2ZDAH 4ZKRU 1C5PA 3MI4A 3GY7A 1O3PB 2VIDA 1ZGIA 2Z9KA 1B5GH 3BTME 1OSSA 1LMWB 2BXUH 3TJUA 1MAXA 3CP7A 1FJSA 3RU4D 2KX4A 4XBBA 2M5TA 3LJOA 3PV2A 4I8KA 3SV8A 1G3BA 3P8NA 4ZH8A 3M37A 2OQUA 2PGQB 5EXMA 4ESTE 1NBME 2ANKH 1TWXB 5B6OA 1QIXB 1O31A 5CE1A 1BUIA 3GCNA 2YMSD 1QRZA 1K0HA 1TOMH 3M36A 2O8TA 3ZVGA 1DANH 2C8XB 1YBWA 1RTKA 4FUHA 4MNXA 1LDTT 4K5ZA 3RLYH 3F6UH 4AFQA 3AW0A 1NFXA 3I29A 2AIQA 3FVFB 4YLQH 2P93A 4K3JA 5GPIB 1UK2A 1NBMD 1S82A 3ZZ3A 4WMDA 3GCOA 3SGAE 2GGVB 2VWMA 1PFXC 2EI7A 2ZHEH 3MO3A 5PTPA 3FZDA 1W0KD 1H1BA 4Q7YA 5LPRA 5AFYH 1JXPA 3SZNA 3A88A 3EA9A 3ZZ8A 1KIGH 3RXRA 1DWEH 1QL7A 3PLKA 2ASUB 1D3QB 4X8UH 3RXUA 4RKOB 4U01A 2BYAX 1BDAA 1D6WA 1UTNA 3KCGH 1D9IA 1EPTA 5EQRA 3SNEA 2CV3A 2CK3D 1FIWA 3S9CA 3KF2A 3FANA 5GDSH 1O3JA 4I31A 5FPSA 2VB0A 2DE8A 4YXWD 1FAXA 3QN7A 4B1TA 4O9VA 2J98B 1P06A 2K8IA 5DPAA 2J38A 3E8LA 1C1NA 2HNTE 2D2DA 1GHXH 2PP6A 3A7YA 3LC3A 3P17H 3MHWU 1SBWA 1SGYE 1A2CH 2Y81A 3S9BA 3IG6B 2UWPA 4IN1A 1CSOE 2BDIA 8LPRA 2A4RA 3OEHD 1JOUB 2BDYA 3KYGA 4RN6A 4GCHF 1AFQC 4I8GA 4MG3A 2JKHA 1AN1E 1Z6EA 5T3HA 1L4ZA 2ODYB 3TGJE 4DVAU 3STJA 1F0UA 1ZSJA 2PSXA 5ABWA 1ETRH 1O3IA 2QF5A 4FU7A 2HPPH 5E2PA 1O2NA 1GJ8B 2H5CA 3SJOA 1UTLM 4ACAA 2WPDD 2WPHS 1FPHH 2ZCLP 1XMNB 2ZU5A 1PQ5A 5J4SA 1Y3YA 3HGPA 5JB8S 3S69A 3M35A 3LONA 4ASHA 2GMTC 1S0RA 1KSNA 1KXDA 2P94A 4B76A 2A4QA 1RJXB 1MKXH 2XRCA 1P2JA 4KTUA 1EAIA 2G4UA 3NPSA 5T6DA 3ITIA 2O8WA 1S6FA 4OGYA 3O8RA 1QURH 2ZGCA 1P2OA 3RM0H 4A6LA 1G3CA 7KMEH 4A5TS 1BBRK 1BITA 3BTHE 3EGKH 2V6NA 3MH5A 1Z1IA 4INLA 2BD3A 2XC5A 4UFFH 2GT7A 1O34A 2HRVA 4YT7H 2A31A 4B2BA 2GDEH 3MH4A 3ATWA 1F5LA 2BY8X 4HZHA 3SZEA 1GJAB 2TIOA 1F5KU 3FP6E 3M7UA 4FUEA 3SUEA 3TH4H 4YLUA 4OS6A 4KTCA 1MTNB 3P92A 1RTFB 2BLVA 1EPTC 2WV9A 1TA6A 2ZQ2A 3F9GA 4ABHA 2ZQ1A 5EJZA 2ZA5A 1LKAA 2BVSH 3T5FH 5JDUB 1EASA 4F49A 1QJ1B 3KNXA 1HPGA 1ABJH 1GMHF 2PR3A 6ESTA 1QB1A 2O8MA 4X6PA 5DP4A 4OS7A 2LELA 2O8LA 2TGDA 1EB1H 5E8EH 1OPHB 2BY7X 2CF9H 5BPEA 1TRMA 5T6FA 3LKWA 1NRNH 3RMOH 4JYUH 5HIZA 2HGTH 4B2CA 2GT8A 3F9FA 1O3MA 1O5DH 4K8BA 1HAGE 1V2JT 1WTGH 4RT1A 1FY1A 1OWKA 2ZEBA 1AB9B 1EKBB 2C3SA 4FETA 1IQMA 2F9NA 2H6MA 1KDQA 2R2WU 1SLVB 2BVRH 1UTQA 3BIUH 4AFSA 4AN7A 4OS1A 3A7WA 2PFEA 1GHWH 3VB3A 1O3KA 4CBNA 1A46H 3LGUA 2A4OA 4CR9A 2A2XH 2H2ZA 1MD8A 1WQVH 4MNVA 1E34B 3TH2H 1SR5C 1W7GH 1KDQB 3SU6A 3V12A 4Y6DA 1T4UH 1TBZH 1HFDA 4JMYA 3KEEA 2ZWLH 2CHAB 2AIPA 2R2MB 2ANWA 2HPQH 2ZDVH 2ZZUH 3A7VA 5EXLA 3KQDA 1MMJN 1FY3A 3P8OA 2OC0A 1FLEE 1J14A 5EQQA 6GCHF 1BMAA 1SKYE 3AASA 4MPUA 3SNDA 3ATLA 1YPMH 4X6MA 1ELDE 1GBTA 1GL1A 1DWCH 1RFNA 1V6DA 3PWCA 1UVUH 2GMTB 1TGNA 1E36B 3PYHA 2AGIX 1P10A 1PPEE 2CF8H 3MU8A 4NWKA 5F8XA 4AX9H 2ZTYA 4Q2KA 3RC5A 3RXCA 3OX7U 3FP8E 1QA7A 3O8CA 3ZZAA 3ZZ9A 3LPRA 2R0LA 1ELAA 2FLBH 3MH6A 1NM6A 4KGAA 3KQCA 1A5IA 1SHYA 1UTOA 4NA8A 5EODA 4CRAA 1E38B 1MQ6A 1GBIA 5K7RA 2VBCA 1EP6A 1NRQH 1SGDE 1FONA 3K6YA 1ANCA 2BZ6H 5TCAA 1TFXA 3ZZ4A 3VB6A 4HI3A 4ISLA 3F1SB 1W3CA 1IHTH 2WV5A 3UWJH 2W7UA 3S7KB 4A1VA 1QL8A 1MU6B 1C1TA 1TX7A 4TYDA 1PYTD 3LC5A 1TGCA 2IJOB 5JBAS 1FQ3A 2AS9A 1ZPBA 3SU5A 4ASUD 2OC7A 4OS4A 4Y7AA 3H5CB 3UY9A 2OC8A 2FOCA 4ZCNA 1Q2WA 2A45B 2BLOA 1QRXA 1AFEH 2XCNA 4Y8XA 2P95A 1QB9A 2QF0A 5JBTA 2JH6D 2VGCC 3ZVAA 4X8SH 4I8JA 1EJMA 1YPKH 1O3DA 5FX6A 7GCHG 3SGBE 2IN2A 4B73A 1DS2E 1P09A 1VR1H 3QGNB 2VIQA 2F43B 4MDSA 1GCDA 2QXIA 1S6HA 1O2RA 2OCVB 3T26A 3RMMH 3D49H 2WV4A 3H7TA 2FP7B 1CT0E 3BV9B 3ZZ6A 1CBWC 2HWLB 8KME2 4MVNA 1FPCH 4UFDH 1HRTH 3N7EA 1LCYA 4DY7B 1L1JA 2ZPRA 4AB9A 4LZ1H 1EX3A 2Y5GA 4RI0A 5T6GA 3ZVDA 3MWIU 3QO6A 1Z1JA 3QTVH 4B74A 2SGDE 1UCYE 1OYQA 1AIXH 1C5QA 4DGJA 3F9HA 1QB6A 1GJCB 2PSYA 1MD7A 1FX0B 2BD2A 4O3TA 1S85A 1YYY1 2IPHA 1E35B 4X1NU 1G36A 2VIWA 1TAWA 1IQHA 4XBDA 2R3YA 1LO6A 1W0JD 1H4WA 5DP8A 6LPRA 2ANYA 4AG1A 2P3FH 4TY6A 2QXJA 5FAHA 2BM2A 2Z6BD 1DXWA 3R3GB 3S7HB 2BOHB 1SMFE 1SLXB 4ABGA 1S83A 2PKAB 1P02A 1NRPH 2AH4X 1W13U 5FBIA 5EW2H 1O2HA 4DIHH 3RXMA 1K21H 2NU4E 4X8TH 2SGFE 1IAUA 1PPZA 2AFQB 1NROH 2PKAA 4IS5A 3B23B 2GDDA 2KAIB 1EAUA 2P59A 1GCTC 2D26C 4AZ2B 1F0SA 3RXFA 1OYTH 2OP9A 4YT6H 1Q3XA 1CA8B 2ZDLA 5DG6A 3BTEE 1K1JA 1O38A 4GPGA 1XKAC 3QGJA 3VFEA 5C1UA 1BTWA 1QRWA 1VCWA 1ZJKA 5FPTA 5H4IB 3QZRA 2V35A 1C5MD 4KTSA 1YLCA 1WSSH 3A8DA 2AHME 3HKIB 3DSPA 3ZZDA 2FX4A 3BEUA 5C0UA 1AE5A 5F8ZA 1SGQE 4Y7BA 3VGCC 1Y5UT 1TIOA 4X1RU 1YPHE 4LXBH 3RXBA 1HDTH 1VJAU 1O3AA 3SNBA 1GDNA 3F9EA 2BLWA 2AMPA 2OBQA 1K1IA 2WPIS 4CRGA 5HM2A 3IWMA 3RXTA 2F9OA 3DFJA 3SJIA 4E7RG 4B6FA 1INCA 4ZHAA 1KXCA 4XDEA 4DURA 1UK4A 3SV6A 1PPHE 2ZFFH 1SGRE 4ZXYH 3TGKE 1ZHPA 3RC4A 3OY6U 1JBUH 3RU4E 1GHZA 3A8CA 1WTHD 5JBCS 1ESBA 1O32A 4P00A 1BJUA 2F3CE 4JZIA 2FI4E 1C1MA 4I8HA 5LPEA 1DLKB 1GWAA 1SGEE 3EYDA 4NG9H 4YO9A 4J2YB 3ATIA 2FX6A 3UTUH 4DW2U 2QN5T 2UUJB 1V2NT 2CMYA 3EA7A 4DG4A 2PV9B 1EZXC 1C1QA 4DJZB 2Y7XA 5A0BA 2XBXA 4Q80A 4WWYA 5A0AE 1AKSA 1IQJA 1ELCA 3BN9A 1QR3E 1OHHD 1V2RT 2FODA 5HXFA 2VIOA 4GSOA 4ISIH 3VB5A 4F4OC 3NK8A 2FM2A 4NIWA 3UFAA 3LIWA 3A84A 5EU8A 4TY7A 3ZZBA 3B8JA 1AB9C 1BIOA 2QF3A 1THRH 1TNLA 1VGCC 3ODFA 3SQHE 3A81A 4X1PU 3E90B 5F53A 3GY6A 1O36A 3F2FA 3OEED 2V7QD 2ZGHA 4K8YA 2Z9IA 2QA9E 1TE0A 1LVBA 2A7CA 4AGJA 3ZZ7A 2ZCHP 1BMFD 4GLYA 1ID5H 2JETB 1QTFA 1V2KT 4I32A 4AFZA 1IQEA 1NY22 1SFIA 1DSTA 2XBYA 2ULLA 2ZU1A 1L2EA 3BTGE 1O2ZA 3FZZA 1DY9A 3EA8A 3SNAA 1TBRH 2RCEA 2TBSA 4O3UA 4GUXA 1V2OT 2R9PA 1C1OA 1S84A 3QDZB 1SSXA 1MU8B 3Q3XA 1BTUA 3UNRA 3KGPA 1TGTA 4X1SU 2F83A 1O2YA 1CU1A 4WMEA 4FOUC 3TK9A 2ODPA 3FP7E 5BRRE 1XXFA 4MPWA 1L0ZA 2RFKC 3MU5A 1ZPCA 4YOJA 1HGTH 1GI9B 4TPYA 4ZXXH 1OS8A 1O2OA 3M3VA 4BTUB 1VGCB 2A7HA 1EZSC 1DOJA 3UR9A 1YLDA 1ESAA 2UWLA 2ZGBH 2H9HA 1O5BB 1TMUH 2EA3A 2G8TA 4WMFA 1NZQH 1EP5A 1SGCA 1WBGB 1IQNA 3AAUA 4FUDA 6CHAC 2Z9JA 3V7TA 3A89A 1WOFA 3KQ5A 2Q1JA 2BZAA 1BZXE 2EI8A 2XTTB 2IJD1 4Y11E 1WU1A 1XVOA 1GBCA 2F9VA 3PV4A 4WH8A 2K1QA 4IC6A 2CHAC 2LNCA 4XFQA 5AF9H 4BNRA 1O37A 4IW4E 4ABJA 4Y76A 3E3TA 3D23A 1P01A 1ELFA 2FIRH 1P2NA 3P95A 2BY9X 1IQIA 3ZVFA 4ABIA 4H6SB 1QQUA 2ZU2A 4MNWA 2FESH 1O35A 3SV2H 2FPZA 1C1PA 3GY3A 5DP6A 5A2MH 5B6LA 3F68H 2NU0E 3RDZA 1L1NA 5JBBS 5DK1A 3GDUA 3MO9A 4U32A 5FBEA 1SGIB 3CS0A 2JH0D 1JIRA 1HJ9A 1K22H 1V2PT 3KL6A 3A87A 4MLFB 1O5CB 4WXVA 5C2ZA 1OOKB 2Q6DA 2JH5D 1E0FD 1UVPA 5GCHG 5T1VA 1Z8RA 3MNSA 1O2PA 2KFWA 1AHTH 2QGRA 3BTQE 1TX8A 2FZZA 3ATMA 5EW1H 3MU1A 3BEFB 1TALA 3ENSB 2AGGX 1MTNC 4Y0YE 2XW9A 1MQ5A 1O2MA 2BDGA 3RXQA 1T8OA 1EJNA 1NRRH 3MH7A 3GICB 2P3UB 3A7XA 4LK4A 3SU2A 5F6MA 4JYTA 2VNTA 3N7DA 2EC9H 1GHAF 1WYKA 2Z7FE 2NU1E 1AU8A 3E91A 2ZTXA 1DXPA 1WDIA 4NZQA 4UDWH 2AEIH 4SGAE 2Q6FA 1A4WH 1SOZA 2BVXH 4GHQA 3TJOA 1C5LH 3DCLA 1SLWB 1GMDF 3DUXH 2FLRH 1FUJA 2C8YB 2ZC9H 1C5NH 2GZ9A 1GJDB 1C2MA 4Q4LA 1M9UA 3H7OA 3RXLA 4K1TA 4K60A 3RXEA 1XM1A 2TRMA 4B2AA 1YC0A 1ZMJA 1O3FA 3HPTB 4J1YA 4WXIA 2RA3A 1C2EA 2ALPA 4IBLH 1OKXA 1GMCF 1V2ST 3AVZA 4D7FA 1ETTH 3HK6B 4YTAA 3UNQA 3NWUA 3PMJA 1EPTB 2JJ1D 4YZUA 1TPOA 2ALVA 2QCYA 2GZ8A 1N8OB 3GCHB 4I8LA 5EJLA 1HJAB 2KCYA 2ZO3H 1NTPA 2VIPA 4WJG2 2SGPE 2YMSB 3QTOH 1XUIA 1EQ9A 1BOQA 1D3DB 3RXVA 3K6ZA 2KCOA 1QJ6B 1UW7A 1FXYA 1YWUA 4IMZA 4ZKOU 1MTUA 3CENA 3MU4A 2ZGXH 3ELAH 2B0FA 1XUHA 1ARCA 1O2WA 1YCPM 1J15A 1W8BH 3A7ZA 2FI3E 2YNAA 2J98A 1VJ9U 1DUAA 8ESTE 3TGIE 3F2GA 1LQEA 4Y79A 3SU4A 1PPBH 1LHFH 1T8NA 5AHGH 1MTSA 3N99A 4UD9H 2YMSC 3EE7A 2C93B 3TU7H 3QK1A 2D8WA 2SGQE 4E06H 2OBOA 1SQOA 4F55A 1O2IA 4GCHG 1CA0B 3SI4H 1RXPA 1O3LA 2GV7A 2Z94A 1AVXA 1QHRB 1UMAH 1YGCH 1O5FH 1MAYA 1W12U 1AMHA 3GY4A 4BTIB 2THFB 1BRAA 2R3UA 4CR5A 5C1XA 3LOXA 3KYFA 1CE5A 1P3EA 3TLOA 2H5DA 3D62A 5SGAE 3LGYA 2W7SA 1HYLA 1UCYK 2H9TH 2WHXA 1GHAG 1EJAA 4BANB 2A4GA 1P0SH 1PQAA 1O3HA 1KTTB 1HXEH 1J16A 2GCHF 3GYLB 4VGCC 1C5OH 1K2I1 3MNXA 2OD3B 2ZIQH 2BD7A 4NIXA 1A61H 2FWWA 4ZMAH 1TMTH 1ZYOA 3TJVA 1ZLRA 4ABAA 1W10U 1FY8E 3VG8A 5GWZA 3GY8A 1SQRA 1GHVH 2BDHA 1O2TA 4A1TA 2RDEA 1G32B 2BQ6B 3SQEE 4P02A 1FMGA 1O33A 3I77A 4BOHA 2YNBA 1T8MA 5DP9A 3KHVA 2JIZD 3OAAD 1LVMA 1HAYB 1TPPA 3A83A 3TPIZ 1PQ7A 2GV6A 1C5ZB 2WPLS 4BAKB 3SHCH 4CREA 1GMCG 1HB0B 1O3EA 1SG8B 3BF6H 2Z3CA 1GJ9B 5FCRA 3OTPA 3RXOA 2QAAA 5J4QA 1H8ED 3FAOA 1FNIA 1U6QA 1PPCE 1HXFH 3P70B 4MPVA 1CA0C 4INKA 4AB8A 4D9RA 3MO6A 1H9LB 1ARBA 2P16A 1GHBF 3KIDU 1C2HA 2IPQX 3M5OA 1WCZA 3FOAA 1HNEE 3EDXB 6CHAB 1MBQA 4JK5A 3OYPA 3L6PA 4GAWA 2NU2E 1Z8IB 3T28A 3TNSA 4F48B 5EG4A 1HV7A 1ZHMA 5E0HA 5FL7D 1SQAA 1THPB 4KKDA 1C5WB 5FX5A 3GS9A 1A7SA 1EFRD 2SGEE 1O39A 3LGIA 2NWNA 3BG4B 3PLBA 3TITA 1TX6A 2QXHA 2BB4A 5HGGA 3SNCA 4E7NA 2OK5A 2GVFA 1P11E 2VINA 3U69H 1ELBA 3ZIAD 1C5UA 1P2QA 5KECA 4XRNA 2Y5FA 4CH8B 3BTKE 4INHA 3DSGA 1N6YA 1DFPA 1IOEA 1LVOA 3TIUA 3L33A 2OINA 4NFEA 3NUMA 1AQ7A 1GHYH 1P9SA 3U1JB 2A7JA 3VXEH 2BDBA 1UTMA 2GCHG 1C1VH 3E6PH 1DE7H 2BHGA 1H8IH 5K0HA 1ABIH 1CT2E 1SGFA 1GL0E 1O3BA 3MTYA 1GCTB 3NZIA 1C9PA 1EAXA 2CGAA 1FIZA 1ANEA 1C4Y2 1NT1A 3UWIA 2F9UA 2PUXB 1H9HE 2V3HH 2BY6X 4X1QU 1EOJA 4Y8ZA 1BTYA 2PGBB 4X6NA 2FOMB 3UAIC 4ACBA 3M5NA 1UVOA 1IQFA 2LP6A 1QA0A 3PMBB 1SHHB 4D7GA 5FHTA 2K0QA 3PLPA 2J2UA 1BMMH 1UHBB 1GGDB 4NSVA 4XBCA 5A09A 4QT8C 5L30H 2GZ7A 2LPRA 1GJ7B 2B9LA 2Y80A 4YOGA 3T62A 1V2TT 1C2FA 5C5OA 1AUTC 2FOBA 2B8OH 2VWOA 2SNVA 2Y82A 1UHBA 1ZRBA 2ZDMA 4X2YA 1PPFE 3RXGA 4NGAH 2ZECA 3RU4T 4ABDA 5HM9A 1CHOG 5TJXA 2FI5E 3ZVCA 4NSYA 1F2SE 1KTSB 3BG8A 2XNIA 1ANDA 1C1RA 2A5KA 4HG6A 4K69A 1RGQA 3UQOA 2ESTE 2P3TB 1TLDA 2GKVE 1VCPA 3A80A 4CRFA 1MBMA 2KM0A 2AERH 2FTLE 4NIYA 3TVJB 3ZVBA 1LPKB 4NZLA 3RXDA 1EATA 4THNH 1ESTA 1BTPA 1KYNA 1ANBA 2SFAA 2G55A 2G5NA 3PM3A 1GVKB 1BT7A 2BD4A 2V3OH 5CHBA 1KXEA 3KQEA 3R0FA 3UB0A 1GBLA 1A1RA 1IQKA 1JRSA 4IMQA 1C2KA 3O8BA 1THSH 2GP9B 1ZGVA 5HMAA 5GIBA 2ZG0H 1KLJH 3F2HA 1BBRH 3RXJA 4AYVB 2HVYB 2VGCB 2PKSB 1ORFA 3W1EA 5L2ZH 4A7IB 2QY0B 1ZTKA 3U9AH 3PB1E 2ZF0H 3CNRA 1YF4A 4IN2A 3LGVA 1NU7B 1A0LA 1MKXK 5CMXH 1O2VA 1JMOH 2A1DB 2UUKB 2W6ID 1N6XA 3UR6A 2ODQA 5F8TA 1QNJA 3VB7A 5DN6D 4H4FA 5C67A 4NA9H 2HLDD 4TT3D 3K9XB 5E0JA 4NIVA 3DFLA 1ZHRA 1GBJA 4U30A 1YPHC 2J95A 5KEDA 5CHAB 1RS0A 3SORA 1IHSH 1SVPA 2A5AA 4D8NA 1ZR0A 1PYTC 2J92A 2M2AA 1V2WT 4B6EA 3DHKH 1GJ5H 1L1GA 2XC0A 1W7XH 1Y5AT 3M5LA 4UFEH 3KN2A 2WPKS 1QBVH 4WH6A 4VGCB 1ZMNA 1CVWH 3ZZCA 3GY5A 5ESBA 1YPEH 4GVUA 4AFUA 2ZDKA 2TGAA 2GCTC 2BQWB 1MTWA 1ZTLA 1XUFA 2FEQH 3S9AA 3T2NA 1CHOF 1O2XA 1YPLH 2J4IA 2RDLA 5L2YH 2PUQH 1E79D 3M7TA 4AGKA 4K1EA 3FFGA 2PW8H 3LH3A 2VVCA 3SW2B 2KAIA 1TABE 1DVAH 5ESTE 4OGXA 3NCLA 1Y3WA 2A32A 5LH8A 2ZI2H 4UFGH 1MZDA 1DLEA 1F0TA 3TK5A 1C5RA 3URCA 2RA0A 3PRBA 4MNYA 1SFQB 5HKKD 1MH0A 4BAHB 1PJPA 2XNDD 4BAOB 3Q3KA 1BMNH 3QLPH 3LGTA 4DOQA 1TQ7B 1O3GA 1Y8TA 1AZ8A 2STBE 2AMQA 1BRBE 2Q6GA 1BTHH 2BX4A 3BTFE 3UOUA 3RUOA 1NU9A 2PLXA 1BMLA 1FY4A 2C4FH 4X8VH 1ZOMA 3RXKA 1B0FA 3DT0H 3QWCH 1T31A 1ZSKA 1MABB 1RIWB 4K2YA 1D3PB 1C4V2 2ZCKP 1DT2A 2Y6TA 1P03A 1GI5A 1P05A 3DSOA 4I7YH 1Z6JH 2VH6A 4OS2A 3VB4A 1Z8JB 1GBDA 1LHEH 4Z0KA 5HYOA 1ETSH 4M7GA 5DKMA 2L74A 1WV7H 2UUFB 3NKKA 3JZ1B 3DD2H 1AVWA 1TYNA 3OY5U 5A8ZA
chains in the Genus database with same CATH topology
1QQ4A 2GX4A 4FUFA 2WPMS 4Y10E 1AFQB 1G3EA 2GD4B 3W95A 1N8OC 3GCHC 3N7OA 3QZQA 2HOBA 1QFKH 1V2VT 1AKSB 1MCTA 3Q3YA 3Q76A 1HJ8A 1BQYA 2AMDA 1EOLA 1TNGA 1GVLA 3O8DA 1DY8A 2XCFA 3PMHB 2FS9A 2VWLA 1V3XA 2XBVA 1O2JA 2OC1A 3PTBA 3EQ0H 3GYMA 2ZDNA 1L4DA 1RIWC 3U8OH 4ISHH 3HK3B 5L6NH 1S0QA 7LPRA 3TK6A 3SV9A 1C4U2 4Z6AH 1NO9H 1JWTA 1P8VC 3OTJE 3STIA 1SPJA 1RD3B 2ZPQA 1SGNE 1YM0A 2STAE 3D65E 1C1WH 1GI6A 3GOVB 5DJ7A 3U8RH 4CHAC 8GCHF 2QIQA 2VVUA 3SU3A 1BHXF 4IGDA 3MMGA 1OP0A 1O3CA 1C5TA 3RM2H 4TWWA 1O3OA 1TQ0B 4BXSA 2FS8A 2QXGA 4R0IA 1UTPA 1VITH 2XBWA 2B7DH 2UWOA 4JZDH 3L3TA 1CO7E 2CN0H 3NXPA 2DE9A 1ELGA 1Y3XA 2C90B 3LT3A 1OX1A 2ZFPH 3SN8A 3SHAH 3U98H 2AGEX 2BXTH 2J9NA 3IITA 5JPMH 1TPAE 1DPOA 2FYRA 3S0NA 2FOGA 3SBKA 1GDUA 2J94A 1YPGH 1AZZA 2Z9LA 1GJ6A 3GISB 1CT4E 1HAVB 2PTNA 3BIVH 1SLUB 5ETXA 1GBEA 1NRSH 1XKBC 1UO6A 5C1YA 1O2LA 1H9IE 1P2MA 1GDQA 3A86A 4WVPE 5AVDA 5C20A 1F7ZA 2DUCA 3UOPA 1ZZZA 3UPEA 4YESB 4AORA 3E1XB 3ESTA 4B71A 2FYQA 1Y3UA 3RMLH 1GI8B 1TNHA 4FUJA 2WPJS 1D3TB 4A92A 3E0NB 1SOTA 4TPIZ 3SO3A 1DITH 1NS3A 3MYWA 4CBOA 1Z8GA 3BTWE 1FV9A 3A8BA 4PROA 1LVYA 2WUCA 1W14U 4UEHH 1LQDB 3DA9B 5AFZH 2XWAA 1GMDG 1TMBH 4U2WA 5IYTA 1Z71A 2H1UA 1VZQH 1TBQH 4ABBA 1FAKH 4DCDA 2GTBA 2ZFTA 5DP3A 3ZYEA 1V2QT 1OWDA 5GCHF 1OP2A 3SUGA 1C1UH 1P2KA 1UVSH 5EOKA 2XWBI 9LPRA 2HALA 1BJVA 3UIRA 2ZU4A 1VITG 1P04A 1QL9A 1ELEE 2Z9GA 2I6SA 3RMNH 4Y8YA 1V2MT 2QC2A 1A3BH 3LJJA 4ZROA 1G2LA 1TPSA 2SNWA 1GPZA 1TONA 2WYJA 2BDCA 1QY6A 2W3KA 1O5AB 1P57B 2HVXA 1YCPH 1K1MA 1LPZB 1GBHA 4WY3A 1CHGA 2EEKA 1GMHG 1F0RA 1TB6H 2W5EA 3E0PB 1LKBA 1PQ8A 1QGFA 1WUNH 3I78A 1HBTH 1MTVA 5FXLA 1MKWK 1VCQA 1OWEA 1SB1H 3M3TA 1NFYA 2FMJA 1TOCB 1O5EH 1TRNA 1YPJH 1TGSZ 4MTBA 2TGTA 2ZKSA 1A0HB 1F92A 4IC5A 1SGPE 1UJ1A 3P6ZB 1FDPA 4AG2A 4X2XA 1HUTH 2NU3E 1MZAA 1OXGA 4D76A 5JYIA 3C27B 2BQ7B 5C5NA 3P8GA 5F03A 3SU0A 1AO5A 4YM9A 1C9TA 4UE7H 1K28D 1DWBH 1CQQA 1FZZA 5EXNA 1WAYB 1HAVA 2FOEA 1DM4B 2OXSA 1SI5H 5EPYA 1ACBE 1UCYH 1GI4A 1JIMA 2FOAA 1EUFA 4CH2B 3SJKA 2O8UA 4JZEH 1ZJDA 1HAPH 3HGNA 4LOYH 3OSYA 2B5TB 1EB2A 4ZUHA 2C8WB 1N1LA 1HAXB 1DSUA 3PO1B 1GG6B 1UVTH 2Z3DA 2QYIA 3KQBA 1XUGA 2RG3A 4X0WU 5C3NA 1GGDC 2AYWA 1DX5M 2SGAA 1HAZB 2VIVA 1NN6A 1OWJA 1RTLA 1D6RA 4Q7XA 4WF8A 1GHBG 2UUYA 1G30B 1S81A 1B7XB 4OS5A 1P3CA 1BCUH 1QCPA 1TRYA 1BB0B 1BTZA 2ZPSA 1A5GH 3EE0B 5A8XA 1AWHB 2I6QA 2P8OB 2W26A 3SJ9A 1GBMA 1O2QA 5JB9S 2QV1A 1G9IE 4FUBA 4RKJB 5DGJA 1EAWA 2G51A 2EI6A 1ZPZA 3SGQE 5EGMA 2BTCE 3JZ2B 1T32A 5GXPA 4MPXA 1BTXA 2ZHQH 5IDKA 4XSKU 1AY6H 1AUJA 3HKJB 6GCHG 1H8DH 3ZYDA 2ZFSA 1K1OA 3A85A 1G37A 1TNIA 1C2DA 5G4BA 1UK3A 1C2GA 3HATH 4RSPA 2ILNA 2GCTB 3LH1A 1OWHA 1SGTA 2JETC 3TNTA 5FCKA 1DDJA 4Y0ZE 1LTOA 1Y3VA 1O2SA 4FU8A 5E2OA 1UTKA 1ELTA 2ZP0H 2HNTF 3BG4C 1BA8B 4NWLA 1O3NA 2VWNA 3MU0A 1LHCH 1CGHA 1GI0A 1Y59T 3A82A 4AYYB 2FOHA 2XYAA 2ZHFH 3BSQA 3M7QA 4JYVH 1T4VH 3ZZ5A 4MQAA 1UTJA 4ZKNU 1P9UA 2PTCE 2J34A 5DP5A 2ZHDA 1ZMLA 1CGIE 3UREA 4X2WA 3WY8A 1GBKA 1GBAA 1XX9A 1LHDH 4B75A 3OU0A 3RXIA 2G00A 1T8LA 1NFUA 3C1KA 1BBRE 5EPNA 4UONA 3ODDA 4XE4A 5GJ4B 1C5XB 3V0XA 1MUEB 1NC6A 2W3IA 1GVZA 4FUCA 9ESTA 3GCTG 1SL3A 1F5RA 1GJBB 2OUAA 2ZFQH 4FVDA 5DP7A 4FXGH 3QUMP 1QBOA 2G52A 2BLQA 3K2UA 2IOTA 4DIIH 3RXHA 2R0KA 2BMGB 1JRTA 3SI3H 3QX5H 3RC6A 1KXAA 1HJAC 3PO1C 1W0YH 1J9CH 2PWXA 4JZFH 1YKTA 1EXFA 1IQLA 3AW1A 3CS7A 4HFPB 1A5HA 1XUJA 4E05H 1AD8H 1TNKA 1AVGH 1Q31A 2PKSC 4O97A 4CRBA 1ZTJA 1KLTA 3ZV8A 2ZU3A 3ZV9A 4X6OA 1AGJA 2O9QA 1GI7B 1OWIA 1AE8H 3RXAA 3U8TH 4HTCH 1ZRKA 1J17T 3LGWA 3SUFA 5TCCA 4HGCA 4H6TA 4JZ1A 1O2KA 3V13A 5E0GA 1A0JA 1TNJA 3G01A 2H9EH 4TWYA 1SC8U 1KLIH 3SOSA 1W0ZU 4FUGA 4D9QA 1HAHH 3UNSA 1BRUP 2G81E 4ISOA 3Q77A 1O0DH 5EQSA 3W94A 2CXVA 3V3MA 1ZSLA 3GDVA 2ZTZA 1D4PB 5A8YA 1EZUC 2XC4A 1C2LA 3VPKA 4CHAB 2FDAA 1C5YB 1TA2A 2VU8E 3PROA 4FVBA 3MNBA 4DT7B 1PPGE 2FO9A 5FPYA 3RLWH 2BD9A 1S5SA 1HIAB 1HLTH 2VJ1A 3LDXH 1HAOH 5I25A 1MKWH 1NFWA 1J8AA 1WQSA 5DO4H 1C2JA 3BEIB 4Y71A 5LGOA 1GBFA 2BD5A 2HNTC 8GCHG 1V2UT 2ZHWH 2WYGA 2F9PA 3PMAB 4H42U 1O30A 1MCVA 4ZHMU 1BHXB 2FTMA 2YOLA 3GCTF 4Q7ZA 4SGBE 1O2UA 1YCPK 1ELVA 2BY5X 3BTTE 2OTVA 3K65B 3MOCA 2OQ5A 3URDA 3AAVA 4XOJA 7ESTE 1C2IA 3UQVA 4BXWA 4LZ4B 4JCNA 2G5VA 3T29A 3TJNA 3SV7A 2Z3EA 3T25A 1V2LT 2ANMH 1C1SA 3UUZA 1B0EA 1G3DA 1TGBA 4AOQA 2A0QB 3SJ8A 3A7TA 2TGPZ 2XXLA 4ABFA 4A1XA 2A2QH 7GCHF 3PTNA 4ABEA 2ZGJA 1KXFA 4ISNA 2VH0A 1XXDA 4KELA 4NCYA 3RXSA 1HAIH 2TPIZ 3B9FH 1A3EH 1HCGA 1K1NA 2VVVA 2C8ZB 1KY9A 2FOFA 4JK6A 3SU1A 4ZHLU 3E16B 1FI8A 1GBBA 3Q00A 1QBNA 1XVMA 1GI3A 3A8AA 4BTTB 5LPFA 2BDAA 4KP0A 1EZQA 1P12E 1RRKA 1GI2A 3ZVEA 3VXFH 1DWDH 3PWBA 2WUBA 1AI8H 1X7AC 2A5IA 2BD8A 3SUDA 1W2KH 4O03A 4CRDA 4X2VA 4K1SA 1SQTA 4FU9A 5A0CA 3M61U 1E37B 3LU9B 1T7CA 1Y5BT 1YP9A 4R8TB 4I33A 3TH3H 1C5VA 1FN6A 2D1JA 1GI1A 1K1LA 4YOIA 4BAQB 3M3SA 5I46H 2F9BH 3RP2A 1G2MA 3EAJA 3M5MA 3RXPA 1NPMA 3P8FA 2HLCA 2ZFRH 1GG6C 1FY5A 2OLGA 4FUIA 2Y5HA 2V0BA 4NFFA 1K1PA 1C5SA 4ZKSU 1W11U 3MFJA 1KXBA 3VGCB 2F91A 3GDSA 1Z7KA 2BX3A 1NESE 2ZNKH 3VEQB 1VITF 1DICA 4BAMB 4GHTA 2PHBA 2CJIA 3BTDE 2WINI 1XUKA 3GY2A 3U1IB 1SGFG 3MNCA 1LPGB 1CBWB 1CGJE 1LHGH 1QJ7B 2G4TA 2Y7ZA 1BRCE 2P8OC 1DUEA 1O5GH 1P2IA 1O2GH 1IQGA 4NA7A 4ZAEA 3ATKA 5CHAC 1K9OE 1GJ4H 1AWFH 2FXRA 4CRCA 1FN8A 1HIAA 2BOKA 3T27A 1OP8A 2ZDAH 4ZKRU 1C5PA 3MI4A 3GY7A 1O3PB 2VIDA 1ZGIA 2Z9KA 1B5GH 3BTME 1OSSA 1LMWB 2BXUH 3TJUA 1MAXA 3CP7A 1FJSA 3RU4D 4XBBA 2M5TA 3LJOA 4I8KA 3SV8A 1G3BA 3P8NA 4ZH8A 3M37A 2OQUA 2PGQB 5EXMA 4ESTE 2ANKH 1TWXB 5B6OA 1QIXB 1O31A 5CE1A 1BUIA 3GCNA 1QRZA 1TOMH 3M36A 2O8TA 3ZVGA 1DANH 2C8XB 1YBWA 1RTKA 4FUHA 4MNXA 1LDTT 4K5ZA 3RLYH 3F6UH 4AFQA 3AW0A 1NFXA 3I29A 2AIQA 3FVFB 4YLQH 2P93A 4K3JA 5GPIB 1UK2A 1S82A 3ZZ3A 4WMDA 3GCOA 3SGAE 2GGVB 2VWMA 1PFXC 2EI7A 2ZHEH 3MO3A 5PTPA 3FZDA 1H1BA 4Q7YA 5LPRA 5AFYH 1JXPA 3SZNA 3A88A 3EA9A 3ZZ8A 1KIGH 3RXRA 1DWEH 1QL7A 3PLKA 2ASUB 1D3QB 4X8UH 3RXUA 4RKOB 4U01A 2BYAX 1BDAA 1D6WA 1UTNA 3KCGH 1D9IA 1EPTA 5EQRA 3SNEA 2CV3A 1FIWA 3S9CA 3KF2A 3FANA 5GDSH 1O3JA 4I31A 5FPSA 2VB0A 2DE8A 1FAXA 3QN7A 4B1TA 4O9VA 1P06A 5DPAA 2J38A 3E8LA 1C1NA 2HNTE 2D2DA 1GHXH 3A7YA 3LC3A 3P17H 3MHWU 1SBWA 1SGYE 1A2CH 2Y81A 3S9BA 3IG6B 2UWPA 4IN1A 1CSOE 2BDIA 8LPRA 2A4RA 1JOUB 2BDYA 4RN6A 4GCHF 1AFQC 4I8GA 4MG3A 2JKHA 1AN1E 1Z6EA 5T3HA 1L4ZA 2ODYB 3TGJE 4DVAU 3STJA 1F0UA 1ZSJA 2PSXA 5ABWA 1ETRH 1O3IA 4FU7A 2HPPH 5E2PA 1O2NA 1GJ8B 2H5CA 3SJOA 1UTLM 2WPHS 1FPHH 2ZCLP 1XMNB 2ZU5A 1PQ5A 5J4SA 1Y3YA 3HGPA 5JB8S 3S69A 3M35A 3LONA 4ASHA 2GMTC 1S0RA 1KSNA 1KXDA 2P94A 4B76A 2A4QA 1RJXB 1MKXH 2XRCA 1P2JA 4KTUA 1EAIA 2G4UA 3NPSA 5T6DA 3ITIA 2O8WA 1S6FA 4OGYA 3O8RA 1QURH 2ZGCA 1P2OA 3RM0H 4A6LA 1G3CA 7KMEH 4A5TS 1BBRK 1BITA 3BTHE 3EGKH 2V6NA 3MH5A 1Z1IA 4INLA 2BD3A 2XC5A 4UFFH 2GT7A 1O34A 2HRVA 4YT7H 2A31A 4B2BA 2GDEH 3MH4A 3ATWA 1F5LA 2BY8X 4HZHA 1GJAB 2TIOA 1F5KU 3FP6E 3M7UA 4FUEA 3SUEA 3TH4H 4YLUA 4OS6A 4KTCA 1MTNB 3P92A 1RTFB 2BLVA 1EPTC 1TA6A 2ZQ2A 3F9GA 4ABHA 2ZQ1A 2ZA5A 1LKAA 2BVSH 3T5FH 5JDUB 1EASA 4F49A 1QJ1B 3KNXA 1HPGA 1ABJH 1GMHF 2PR3A 6ESTA 1QB1A 2O8MA 4X6PA 5DP4A 4OS7A 2O8LA 2TGDA 1EB1H 5E8EH 1OPHB 2BY7X 2CF9H 5BPEA 1TRMA 5T6FA 3LKWA 1NRNH 3RMOH 4JYUH 2HGTH 4B2CA 2GT8A 3F9FA 1O3MA 1O5DH 4K8BA 1HAGE 1V2JT 1WTGH 1FY1A 1OWKA 2ZEBA 1AB9B 1EKBB 2C3SA 1IQMA 2F9NA 2H6MA 1KDQA 2R2WU 1SLVB 2BVRH 1UTQA 3BIUH 4AFSA 4AN7A 4OS1A 3A7WA 2PFEA 1GHWH 3VB3A 1O3KA 4CBNA 1A46H 3LGUA 2A4OA 4CR9A 2A2XH 2H2ZA 1MD8A 1WQVH 4MNVA 1E34B 3TH2H 1SR5C 1W7GH 1KDQB 3SU6A 3V12A 4Y6DA 1T4UH 1TBZH 1HFDA 4JMYA 3KEEA 2ZWLH 2CHAB 2AIPA 2R2MB 2ANWA 2HPQH 2ZDVH 2ZZUH 3A7VA 5EXLA 3KQDA 1MMJN 1FY3A 3P8OA 2OC0A 1FLEE 1J14A 5EQQA 6GCHF 1BMAA 3AASA 4MPUA 3SNDA 3ATLA 1YPMH 4X6MA 1ELDE 1GBTA 1GL1A 1DWCH 1RFNA 1V6DA 3PWCA 1UVUH 2GMTB 1TGNA 1E36B 3PYHA 2AGIX 1P10A 1PPEE 2CF8H 3MU8A 4NWKA 5F8XA 4AX9H 2ZTYA 4Q2KA 3RC5A 3RXCA 3OX7U 3FP8E 1QA7A 3O8CA 3ZZAA 3ZZ9A 3LPRA 2R0LA 1ELAA 2FLBH 3MH6A 1NM6A 4KGAA 3KQCA 1A5IA 1SHYA 1UTOA 4NA8A