1Y3UA

Trypsin inhibitor complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin, cationic
publication title Structural and Thermodynamic Characterisation of Protein-Inhibitor-Complexes of Thrombin and Trypsin Inhibitors
rcsb
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y3uA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y3uA02
2BOHB 5EU8A 2Y81A 1V2PT 3SU2A 1C5XB 3O8DA 1JOUB 2OC7A 2XNIA 3EGKH 3T28A 1TA2A 1SQOA 3U8RH 2PV9B 1SGFG 3SOSA 1J15A 1TPAE 2LNCA 4A92A 2ANWA 1OWEA 4GSOA 1YPHE 1ZSJA 2SGAA 3GY8A 2BX4A 2GT7A 5A0AE 2RDLA 1TE0A 1ZPCA 1N8OC 2PFEA 5LGOA 3TPIZ 1HRTH 3BN9A 1C1WH 3BG4B 4DJZB 3P95A 3UR9A 1YCPK 1FY4A 1O37A 1IQEA 1C2FA 1FONA 2SGPE 3F1SB 3SJKA 2ZP0H 1RTKA 1P57B 1KSNA 2OTVA 1HNEE 2FTMA 4K5ZA 1MUEB 2EI6A 1HYLA 4D76A 2FOCA 4D7FA 1AZZA 4SGAE 4ABBA 3OYPA 1BHXB 4UD9H 5DJ7A 7ESTE 5FX5A 4A1TA 1YGCH 1QGFA 1Y5UT 1GI9B 4KTSA 3RDZA 3ESTA 2VVUA 3MU1A 1HPGA 2ZFTA 2BB4A 1E37B 1P2QA 4YM9A 1G36A 1F0UA 1XKBC 4Y0ZE 1NO9H 2FXRA 2IJOB 1V2MT 2Y80A 2BDGA 3SHCH 2UUJB 2R0LA 4B71A 1VGCB 5FXLA 4AGJA 2AMDA 1BJUA 1LHCH 2A2QH 2JETB 2A32A 2FLBH 4OS6A 4FUIA 2GCHF 4Y8XA 2VIWA 4OS2A 1UK4A 3MTYA 2O8UA 2A4OA 3A82A 1V2RT 1OP0A 1ZJDA 1F2SE 4KP0A 1FLEE 3QK1A 4UDWH 1J9CH 2BOKA 3DFJA 3TJUA 2BD5A 5GPIB 1C1NA 1YPKH 3PLBA 4Y6DA 1VR1H 1Y5AT 2FODA 4AORA 4NFFA 3URDA 2XC0A 1F0TA 1TQ0B 4K8YA 3K65B 4IMZA 1ELVA 2H1UA 2ZGXH 2YNAA 3M36A 2R0KA 1UK3A 1UVUH 2XBXA 1BJVA 1V2NT 1MU6B 3T62A 4MTBA 1PQ7A 4Y7BA 2Z94A 1EAXA 1EOLA 3A7VA 1SSXA 2ZGHA 3PM3A 3U98H 3HGPA 3MU4A 1SLWB 1DOJA 1H4WA 1UVOA 3BV9B 5F6MA 2ZNKH 1G2LA 3LH1A 2A5AA 3VXFH 2GMTC 1K1LA 1LMWB 4O3UA 1LDTT 1FV9A 2ZDAH 1BMNH 4X1RU 2TRMA 1IAUA 4IN2A 2Y5FA 1UTOA 3LDXH 4Y0YE 1EX3A 1ELAA 1SGDE 1K21H 1B5GH 1GBCA 3QDZB 1SGQE 3RMNH 5I46H 1K2I1 4BAHB 8GCHG 1QHRB 9ESTA 4TY6A 5EW1H 1DSTA 1OWJA 3ELAH 1JXPA 4OS1A 1C5RA 1P2IA 1DITH 1BTZA 4SGBE 1VITG 5E2PA 5AVDA 2ZCKP 4DVAU 3GY3A 1AB9C 3AVZA 1EJAA 3AAUA 4DW2U 3A80A 3M7TA 4WWYA 2YOLA 3OY5U 2C8XB 3ZYDA 1V2OT 1PJPA 3GDSA 2ZHFH 9LPRA 2D8WA 3RXOA 1UTPA 4FUCA 4GAWA 4E06H 3UNQA 4NA8A 3UQOA 1TYNA 2FTLE 1C5UA 1L1JA 1NFUA 1GMCF 2C93B 1FMGA 2ZFSA 1HAXB 3T27A 3LKWA 3FZZA 1CA0C 5IDKA 4NG9H 2XBYA 2G4TA 5HM2A 4CR9A 1SGIB 2VNTA 2AIPA 3ATKA 4ISHH 2JKHA 2FZZA 2Y5GA 4ZXYH 1AVGH 1AVWA 3ZVGA 5DP3A 5F8XA 1C5LH 5JPMH 3BTQE 1TOCB 3SI3H 1S0QA 4BXWA 1KYNA 2OC0A 1FN6A 1E38B 4MPVA 1RGQA 4WMEA 2VWNA 5FPTA 2G5NA 2XCNA 1TGBA 1WOFA 1EKBB 2OC1A 3LH3A 4B2CA 1CHOF 2A7CA 2EC9H 1JRTA 4TWYA 4FU9A 2AMQA 1X7AC 4DOQA 2XC5A 5C1XA 4BXSA 1QJ1B 4I7YH 3ZZAA 1O3DA 1AB9B 2Q6DA 1O2XA 1QL9A 1CT0E 2CF8H 3GISB 2C4FH 2VINA 3ZVAA 1ZPBA 1P09A 3ZZ4A 4RSPA 5GXPA 4ABIA 3SJOA 4A6LA 1D6RA 2VIDA 3ZZ5A 2OBOA 1VCPA 3RXCA 4KKDA 1HAZB 4B75A 5T6DA 1NRQH 4YT7H 1HAPH 5L2YH 1UVSH 1V3XA 3PO1B 4NIYA 3SUEA 1GGDC 1CA0B 1C9PA 5FCKA 1JIRA 3A7ZA 2FM2A 2GTBA 3QZQA 1G3BA 1H9LB 3C27B 4K60A 4X1NU 3VXEH 4CRAA 2BD8A 1NT1A 1L4DA 4YESB 4CHAC 1GBDA 3SUDA 1GDUA 1GHZA 4UE7H 2ULLA 4ZUHA 3VB3A 3SORA 2FLRH 2HNTF 1YYY1 5F03A 1DX5M 4AB8A 1EP5A 4O97A 2XBVA 2NU3E 5ABWA 1SC8U 1WV7H 1FZZA 2ZHDA 3M3VA 2FS9A 2ASUB 2XWAA 4GCHG 1T32A 2ZU2A 4DT7B 4MPXA 3MH6A 3KQCA 5JBCS 1GI6A 1OP8A 3GYLB 2VGCC 3TH2H 5HYOA 1BRBE 2Z9GA 4QT8C 4AG2A 4WY3A 1AD8H 3KIDU 3UREA 2ZG0H 1OOKB 1H8IH 5C2ZA 2UUKB 3MU5A 2QXGA 2EI8A 2HPQH 4HFPB 2FOMB 1O3PB 3E0PB 1KXCA 1C2KA 3KQEA 2A0QB 8KME2 3UPEA 1GDNA 1TRNA 3VFEA 4AX9H 3QX5H 1B0EA 4B2AA 1F92A 1GGDB 2G00A 4FUBA 4TPYA 2ZHWH 3LIWA 1Z71A 2VH6A 4ISIH 4AYYB 4TPIZ 1P2JA 1C2GA 4LZ4B 2OXSA 1ELTA 4DY7B 2AMPA 1TOMH 2YNBA 3GCOA 3ATWA 5T6GA 4BTUB 4CHAB 2OD3B 1LHDH 1Y3VA 1C4V2 1ELDE 1BQYA 4JK6A 1GBHA 3UR6A 1GJ6A 3U8TH 1S83A 4BOHA 2XYAA 3QGNB 1O36A 3RXKA 1QL8A 5DKMA 1FY5A 3EA7A 1LQDB 2QF3A 3EQ0H 1O2QA 2FOAA 2WPMS 3PMHB 3ENSB 4X6MA 1C5MD 4DURA 1GJ5H 2PKSC 3MO3A 2QAAA 3ZZ7A 2PUXB 3T26A 5L2ZH 5GWZA 3LGIA 2W3KA 2B7DH 4JZIA 1FQ3A 1N6YA 3KHVA 4MQAA 2VGCB 4OGXA 1KDQA 1GBBA 1K28D 2GZ9A 3WY8A 2VVVA 3GDVA 4ISNA 4X8SH 1BA8B 1C5PA 1QY6A 3PMAB 2PTCE 2GZ8A 3ZZDA 1P3CA 1S85A 1FN8A 6GCHF 1C2HA 1WYKA 4YLUA 3F6UH 3RU4D 2BQ7B 2ZEBA 1IQNA 4WF8A 4MNVA 2G55A 1NROH 4DIIH 1WTGH 1GL0E 1PPCE 1W3CA 2Z3EA 1OX1A 1RFNA 3BF6H 1BRCE 3SUFA 3RC4A 5K0HA 1LO6A 1ID5H 3HGNA 2BMGB 1QJ6B 1TMUH 4XBDA 1SQTA 1C5NH 1K1NA 1TMBH 2P93A 1C2DA 1O2JA 1A0LA 2V3OH 3RXHA 4FUEA 1TABE 4O03A 5EQRA 1L1NA 1C1TA 1MTSA 3SJ8A 2BYAX 1O2MA 5CHAC 8GCHF 1V2TT 4MNYA 3ZVEA 1DANH 2F91A 1G9IE 2DE9A 4FVBA 3MH4A 1PQ8A 2V3HH 5EXLA 1VITF 3KGPA 2ILNA 1FNIA 1THSH 3RXDA 3SNEA 4U30A 5BRRE 3HATH 3RXAA 1YPGH 4YZUA 4ZKNU 1BTHH 1MU8B 3A8AA 1TBZH 2OLGA 1AE5A 1G3DA 5DP6A 3STIA 2G52A 5JBBS 1GJCB 5DGJA 1SLVB 2Y7ZA 1ORFA 4ABFA 2Z9JA 4B1TA 1UVPA 3QTOH 3E1XB 3TU7H 2ALVA 4AG1A 5A8ZA 1GI5A 1INCA 1ZYOA 2GZ7A 1HAVB 1QQUA 2AGGX 1UTJA 2WPLS 2QXIA 1BRAA 4KTUA 4GLYA 3UTUH 3ZZ6A 4ZH8A 2WPJS 1RTFB 1MTVA 5C67A 2BDAA 2BDYA 2THFB 4NZQA 1E0FD 2I6SA 3LU9B 1THRH 3SU3A 1GPZA 3RXJA 1O35A 1TX6A 1VCWA 1A1RA 3A81A 3OX7U 1MD8A 2P94A 5E8EH 4TYDA 1D9IA 1SGRE 1P11E 1OWDA 1WSSH 1TAWA 3LONA 1L4ZA 1S82A 2BY7X 4K1EA 1DY8A 4NIXA 3QWCH 2IN2A 1FY1A 2O8WA 2Z9KA 5LPFA 2HOBA 3M5OA 2ZECA 4UONA 3BG4C 1KXEA 1NRNH 1ZTJA 3MH7A 4BAKB 1P9SA 1HJAC 1UCYK 1LVMA 2BZ6H 1KLJH 2FI3E 4AN7A 3B9FH 1SB1H 5DO4H 1OS8A 1E36B 5A8YA 4Q7XA 3Q00A 1BT7A 2OQ5A 1DE7H 1Y3UA 5AFYH 3MO6A 4DIHH 3SU5A 4BTTB 1G32B 1CGHA 1MQ6A 1O31A 1SOTA 1K1OA 2STBE 3CS7A 3RMOH 5DP5A 1QQ4A 3GDUA 1HIAA 4YT6H 2F9NA 2AYWA 4OGYA 4OS4A 1XUIA 1DWBH 1NS3A 1QIXB 1TPPA 2BLOA 1D3TB 1AWHB 5PTPA 1VGCC 1W7GH 3BTKE 4JZDH 1K22H 2JETC 3ZVBA 2TPIZ 1GBFA 1DVAH 4GPGA 3L3TA 1PPGE 4H6SB 1H9HE 2B5TB 4RKOB 1K1IA 1MKXK 3LT3A 4NZLA 1O3GA 1JBUH 3EAJA 4GCHF 1BBRK 4JCNA 1BTUA 1SLUB 1W2KH 3BTTE 4CH8B 2ZFFH 1TNIA 8LPRA 3SNDA 1SFIA 1Y3XA 1UTQA 1A46H 3SW2B 1GI0A 5F8TA 3TK9A 1QB9A 2UWPA 5I25A 4YO9A 3PROA 2BLVA 2I6QA 1SGPE 3A89A 1ZJKA 1P03A 3UWIA 5A0CA 4UEHH 1ELFA 1XXFA 1HJAB 3A8DA 5DP4A 3W95A 2NU0E 1O5DH 1YPLH 1GWAA 1B7XB 1Y3YA 5A8XA 2XBWA 1Y8TA 1A7SA 2LPRA 1LHFH 1V2UT 3TGKE 4ABGA 2FYQA 3ZVFA 2FP7B 1SL3A 1FXYA 1TB6H 3ZV9A 3FP8E 4H4FA 5A2MH 1OKXA 3O8BA 2FOFA 3DUXH 2AGIX 1TIOA 1W8BH 2BDHA 1TONA 1CT4E 3FANA 1AQ7A 1S0RA 3T5FH 3FVFB 2QXHA 1U6QA 1A5GH 4I33A 1EZUC 1DUAA 4X1SU 1QB1A 4CRGA 1GBAA 2PTNA 1O2ZA 1O5EH 5BPEA 4K8BA 2CF9H 1C1UH 4LK4A 3TK5A 3ODFA 1C2EA 1V2LT 3FZDA 3I77A 1EQ9A 3MFJA 1Z8RA 2Y7XA 1HIAB 4Y10E 3ZYEA 1FIZA 3SV2H 1GHBG 1QBOA 1TGTA 2O8TA 4BAOB 1AGJA 3BSQA 1NRPH 1MQ5A 3ATMA 3SUGA 1NESE 3SGQE 1GHAF 1NFWA 4H42U 4E7NA 2ZTZA 4INHA 3DD2H 3PWBA 1KXDA 2FX6A 6GCHG 1FDPA 3DT0H 1BCUH 1BIOA 1TPOA 4INLA 4U2WA 5E0GA 2AS9A 3RP2A 1ZMLA 1IQMA 1ZSKA 1W7XH 1NU9A 1W11U 3FFGA 1HJ8A 3QGJA 1GHXH 1JMOH 1GBEA 4DCDA 2FI5E 4KELA 3A85A 2ZWLH 3EA9A 2FOBA 3RU4E 2GV7A 1TBQH 4I31A 3A86A 4KTCA 2O8MA 2VWMA 3A7WA 1MAXA 1V2KT 1GCDA 2VVCA 1LCYA 2CN0H 4D7GA 1Q2WA 3RXBA 1V2WT 2ZA5A 1WQSA 2GP9B 3MH5A 1FIWA 1UCYE 1YKTA 4Q7ZA 4NSVA 3MWIU 2O9QA 2Z3CA 3SV9A 1ETSH 1LVYA 3F68H 4XSKU 1FJSA 2FX4A 1O34A 1QRXA 3ZZ3A 5J4QA 3K6YA 3OU0A 2SNVA 3CP7A 1LVOA 1PFXC 1T4UH 2J38A 3BEUA 1HAIH 1GHVH 1XM1A 1J8AA 3E6PH 3SNAA 2H5CA 5AHGH 4I8HA 1O30A 2RG3A 3A88A 2EEKA 3BTDE 2ZDMA 1O32A 1VITH 1O38A 1P02A 3PO1C 2GGVB 2BY9X 4MPUA 3PWCA 2GD4B 1SFQB 2ZGCA 4IW4E 3D23A 1MKWH 1MZAA 1ZRBA 4FUHA 2NU4E 1HAGE 2OP9A 1GJAB 2KAIA 2QF0A 3BTFE 3SZNA 4X6OA 1O2HA 4Y71A 3SGBE 5EW2H 1ANDA 1BTPA 3QZRA 1BBRE 1JRSA 1A0HB 4DG4A 4HTCH 4I32A 2PSXA 3LC5A 3IWMA 2SGDE 3RXIA 3SBKA 1YPJH 3SJIA 1GVKB 4X2WA 1TGSZ 3P17H 3G01A 2BDCA 2GVFA 1TRMA 1AHTH 4Y11E 2UUFB 1DXWA 3TNTA 1MD7A 2F9PA 5EODA 3RMLH 3RXGA 5FX6A 1BUIA 1O2OA 1RS0A 1ZOMA 2O8LA 1MBMA 1GI2A 4Q80A 4LZ1H 1TX8A 1AZ8A 4FUGA 2SGFE 1LHEH 5FPYA 1DLEA 4ASHA 2H5DA 1ZHPA 3NXPA 2ANKH 3S9CA 1O3EA 3ZVCA 6LPRA 2BXTH 3GY5A 2PSYA 4Y79A 1KY9A 2Z9LA 1TA6A 2H9HA 3M7QA 3DHKH 5T6FA 1KTSB 1XUKA 2P3TB 4FUFA 1C1MA 1MTUA 4ZXXH 3E91A 3TK6A 1HV7A 1D3PB 5ESBA 2G51A 7KMEH 5ETXA 2TIOA 1MMJN 4FVDA 2ZPSA 3BTWE 1GI1A 1C4Y2 3P6ZB 1RIWB 4O3TA 1J14A 1C2IA 4MLFB 4Z6AH 3SQEE 3SU1A 2PW8H 5JB9S 1BB0B 3FP6E 1W13U 2ZFQH 3PMJA 1L0ZA 1DY9A 3EA8A 5DP7A 5EPYA 3F9HA 1ELGA 1AY6H 1DM4B 3BTEE 1DS2E 1ELBA 4Y76A 4AGKA 1EASA 3BIVH 3HPTB 4F49A 2Z7FE 1DFPA 2ZU5A 2TGAA 1P10A 1SQAA 2A5IA 3NWUA 2WUCA 4YLQH 1C1QA 1ANBA 2W7UA 4DGJA 1MKWK 5B6OA 2BZAA 1OSSA 3VB4A 2JH6D 2D1JA 3PLKA 1C1RA 2KAIB 2ZDNA 1Z8IB 2XRCA 3SI4H 1TPSA 2H9TH 2VIVA 2AFQB 1RD3B 1GBTA 2TGTA 1T8LA 4ZROA 1TFXA 3A7XA 1DT2A 4X2VA 2ZPQA 1O5AB 1ZHRA 1W10U 1KXFA 4CRBA 4A5TS 1UTLM 2F9VA 3UNSA 1O3AA 5E0HA 3CENA 1WBGB 3NKKA 3AAVA 1GHWH 1FAKH 1CU1A 1H9IE 1ZTKA 7GCHG 3PLPA 1OWHA 1SOZA 1F7ZA 3LJJA 3TJVA 1ZGIA 2F3CE 1GHYH 1YC0A 3RMMH 3EYDA 3U8OH 4ABHA 2SNWA 4CREA 2FS8A 1OYQA 4Y7AA 2F9BH 3TH4H 1IHTH 1C5TA 2QY0B 1BTYA 1O2GH 3GCNA 1O2NA 1TX7A 3OTJE 3OY6U 3I78A 2ZHQH 3Q3XA 1AN1E 4Z0KA 1QFKH 3NK8A 2A4GA 4GHQA 1P3EA 1O3FA 1K1PA 1SPJA 2JH5D 1CT2E 3H5CB 5LPRA 1C1SA 1SGCA 4BNRA 1NRRH 1GMDG 7LPRA 4NIVA 4R0IA 3S9AA 1EXFA 4WVPE 1EAIA 4NIWA 4Q7YA 1GHBF 1FPCH 4LOYH 1H8DH 3PV4A 8ESTE 1W0ZU 1ZPZA 3LOXA 5EXNA 5IYTA 1HB0B 2BD9A 1GHAG 4MG3A 3S0NA 1NFYA 2B0FA 2A4RA 3MMGA 1MTNC 1DICA 4F4OC 4THNH 1VCQA 4JZEH 2ZTXA 3SNCA 1SMFE 3V3MA 1A4WH 2OINA 2FI4E 2QA9E 1UTMA 1C5QA 3ZZ9A 3UNRA 5GJ4B 1G3CA 4I8KA 1EAUA 4IMQA 4K2YA 2G8TA 3MNSA 1QA0A 1KXAA 1GBIA 2C3SA 2CHAC 3D65E 3RXRA 3TITA 1J17T 2ODPA 1TLDA 5HMAA 1UJ1A 3Q77A 2H6MA 1O39A 3UY9A 2FDAA 2WUBA 5T3HA 3FAOA 1P05A 1O2RA 4ZKOU 2Q1JA 4NA7A 1S84A 3MYWA 1F5RA 2HGTH 3U1JB 3K2UA 1LPGB 1Y59T 3HK3B 3TNSA 2P16A 4AYVB 2FYRA 4E05H 2SFAA 1Y3WA 4NA9H 1P06A 1C5SA 2C8ZB 2J34A 1Z8GA 4NSYA 4XBCA 2GDDA 3E90B 1RJXB 3OSYA 4I8JA 1O2YA 2OUAA 4AOQA 1O2LA 3VGCC 1C2LA 1QBNA 1S6HA 2ANMH 3V12A 4NWLA 1GVZA 1QNJA 1YCPM 2NU1E 1QJ7B 5HM9A 1DUEA 1GJ8B 1YBWA 1DWCH 1MTNB 2VU8E 4ZMAH 2BLWA 1CHGA 3M3TA 2GDEH 1EUFA 3E3TA 1ELCA 3VB7A 4PROA 2ZIQH 1GVLA 2VH0A 2PWXA 1WQVH 2WINI 1ZLRA 4U32A 5TCAA 2BM2A 4K1TA 1ESTA 1QL7A 1Y5BT 2R2WU 1AFQC 1GBMA 2BDIA 5C1UA 4IGDA 2BLQA 1LKBA 2EA3A 3GCTG 5GDSH 1KDQB 2CHAB 2GV6A 3P8GA 4AB9A 3A8CA 2HRVA 1BRUP 3PMBB 1S81A 1FUJA 1V2QT 3V13A 3ZV8A 5EGMA 1DPOA 1TNGA 3D49H 5C1YA 2TGDA 2QCYA 3T25A 3U1IB 2FWWA 1IOEA 1DLKB 1C5VA 1NZQH 2GT8A 4BAMB 2ANYA 2NWNA 3BTHE 2CJIA 1PPBH 5JBTA 4ZKRU 1VZQH 3GCHC 1FPHH 1MBQA 2J94A 1C9TA 1IQIA 1JWTA 5EPNA 1PQ5A 3VGCB 3SQHE 2R3UA 2PHBA 3DA9B 4FXGH 1Q31A 4J1YA 2BVXH 3VEQB 1XUGA 3BEIB 3U9AH 2HNTC 3S69A 4CH2B 1UHBA 1ETRH 1O3NA 1P04A 1SGYE 3RLYH 1Z8JB 4D8NA 3KN2A 5EQSA 1UO6A 5ESTE 1O3KA 4XOJA 4WH8A 3SV6A 1L1GA 1O5FH 1TNLA 4WJG2 1K9OE 1MH0A 2CGAA 1AMHA 3QTVH 3KL6A 1EZQA 1AFQB 1T31A 2C8WB 2ZGBH 5J4SA 5LH8A 1P12E 2FPZA 1BMAA 4ISLA 1AFEH 1GCTB 1UTKA 2BY8X 1DWDH 2P8OB 3I29A 3SNBA 2Y82A 4VGCB 1S5SA 1RRKA 3ZVDA 1SR5C 1BTXA 5GCHG 5C5NA 1O3IA 4X8VH 1P2OA 2W5EA 3UOPA 3P8FA 2WPKS 1UTNA 3W94A 1GJ7B 2DUCA 2XXLA 3MO9A 3NCLA 1W12U 1NPMA 2ZCLP 3E8LA 6CHAC 1V2ST 2VIOA 1EAWA 1AU8A 1H1BA 1NM6A 2A4QA 3GICB 2C8YB 3PB1E 1HDTH 1P2KA 1ZTLA 4Y8ZA 3GCHB 3GOVB 1AO5A 1C2MA 3Q3YA 3TIUA 3GY6A 3KEEA 1E35B 4OS5A 5G4BA 1XKAC 1GMHG 1CBWB 2VJ1A 1XVOA 1C4U2 1THPB 2J9NA 4X1PU 1C2JA 1N6XA 2RCEA 1FI8A 2OCVB 1CE5A 4ZAEA 4IS5A 3LGTA 3SJ9A 1V2VT 4K69A 3JZ2B 2FOEA 3SU6A 7GCHF 1CO7E 1SVPA 1OYTH 2IOTA 4WH6A 2W3IA 1YF4A 1KTTB 3KF2A 6ESTA 3BTME 1C5WB 2QYIA 3VPKA 3R0FA 4RKJB 2ZQ2A 1LPKB 2PR3A 1EB1H 4AFZA 4X8UH 4YOGA 1IQLA 2AEIH 2XTTB 1EJNA 3DFLA 1BZXE 5DG6A 1QA7A 4MNXA 3F9FA 1UHBB 1FAXA 3TJOA 1SG8B 5DP8A 1Z1IA 1GL1A 2ZGJA 3MNBA 3P92A 1T7CA 1F0RA 2J95A 1NC6A 1IQGA 1OXGA 2G81E 3GYMA 4XFQA 1GMDF 3LC3A 3T2NA 4MNWA 1ZR0A 1ZMNA 4RN6A 2B8OH 3F9EA 1K1JA 4JK5A 1N1LA 2DE8A 4INKA 6CHAB 1IQFA 1DDJA 3TVJB 4E7RG 2XW9A 2BX3A 2ZPRA 3A87A 1J16A 3CS0A 1EB2A 3MOCA 1F0SA 1GBJA 1SLXB 2WV5A 1O5CB 1ELEE 1HUTH 1YLDA 2J4IA 3S7KB 3TJNA 1HAOH 5F8ZA 1Z7KA 1SHHB 4ZHLU 5H4IB 1O2VA 1UVTH 1N8OB 1TNHA 2Z9IA 3MNXA 1ACBE 2BQ6B 3TH3H 4Q2KA 3D62A 5EXMA 3F9GA 1HAYB 5JDUB 3SHAH 2XCFA 4D9QA 5DPAA 2ALPA 1BITA 1XUJA 3BTGE 5C5OA 1HLTH 2BD3A 3RXLA 1O2KA 1ZMJA 2GX4A 4JZFH 1D4PB 3IG6B 1BDAA 4U01A 5FAHA 1D6WA 3SV8A 3M5LA 2FOHA 1EJMA 1JIMA 3B8JA 4B74A 2TBSA 4JMYA 3ATIA 1OWKA 3VB6A 1O3LA 1T8MA 1MTWA 1LVBA 1YPEH 3E16B 1GBKA 1YLCA 3RUOA 2W7SA 2STAE 1CA8B 3GY4A 1HBTH 1PPEE 4HI3A 1CGJE 4ABJA 2J92A 3IITA 1S6FA 1QBVH 3LGVA 1O3JA 1LPZB 5A0BA 1EPTA 4AFSA 1KLIH 4OS7A 1WAYB 1WUNH 1O5GH 4X2XA 1A61H 1GJ4H 1QTFA 1TQ7B 2TGPZ 1PQAA 1KLTA 3U69H 1UMAH 4IN1A 4M7GA 1MCVA 4B2BA 3QUMP 4GHTA 1RIWC 2RA0A 4CRCA 1M9UA 1TBRH 3KQDA 1CVWH 4MPWA 1O2TA 2PGQB 1F5LA 4JYVH 3GCTF 1LHGH 1AI8H 1EPTC 3K9XB 1A3BH 3N7OA 1OPHB 1AVXA 2P59A 3R3GB 1HGTH 5EQQA 3M3SA 2BVSH 1BOQA 3RXFA 1GI4A 2C90B 1ZHMA 5FBIA 4X0WU 1A0JA 2Q6GA 3MNCA 1CGIE 4ISOA 4UFFH 4MDSA 3M61U 3BEFB 2ZU3A 2GKVE 1GJBB 2ZCHP 2H9EH 2GMTB 4FU8A 1HXFH 4ZHAA 1P01A 5E0JA 1Z6JH 2BHGA 2QC2A 5C20A 3RM2H 2V6NA 3TGJE 2BVRH 1SGNE 4IC6A 4ABAA 3UUZA 1C5OH 1YM0A 1NN6A 3RXVA 1LTOA 2EI7A 3HKJB 1EOJA 1BMMH 1YPHC 2R9PA 1O3BA 5C3NA 2XC4A 1VJ9U 2Y6TA 1ARBA 1ARCA 1D3QB 4AFQA 1WTHD 4GVUA 3RXEA 3ITIA 2OC8A 3MI4A 2Z3DA 2QN5T 1AWFH 3K6ZA 3P8OA 4X6NA 2JH0D 2FMJA 4UFDH 1NFXA 1BMLA 2R2MB 2Z6BD 3UFAA 1EP6A 2D26C 4I8LA 1Z1JA 2ZFRH 2BY5X 2Q6FA 4UFEH 3V0XA 1V6DA 1O5BB 1AKSA 4BANB 3HKIB 1A2CH 4YTAA 1EPTB 1VJAU 3MHWU 1A3EH 1ETTH 2ZDVH 3STJA 2BXUH 3B23B 2A2XH 1EZSC 5TJXA 4X8TH 2ODQA 1MZDA 1ANEA 3MU8A 5GCHF 3ZZCA 3AW0A 1T4VH 3ZZBA 4NFEA 2WV4A 2QV1A 3LGUA 4KGAA 3M35A 4H6TA 4AFUA 4CBOA 5HGGA 4FU7A 1IQJA 4ZHMU 3QO6A 2VWOA 2FESH 3SN8A 3LPRA 3A84A 5GIBA 2FEQH 2BD4A 4XDEA 1BHXF 3NUMA 1O33A 4WMFA 4R8TB 1G30B 3A7TA 3SV7A 2W26A 5TCCA 3LGYA 4JYTA 5E2OA 2BY6X 4AZ2B 2HLCA 1EATA 2FO9A 2UWLA 1XUFA 3FP7E 5FCRA 1GMHF 1FY3A 1ABJH 5JB8S 3RLWH 5AF9H 2NU2E 1PYTC 3NZIA 4IBLH 5JBAS 2HNTE 4ABDA 4LXBH 2RA3A 1O3CA 1TNKA 2BTCE 3TLOA 2AH4X 1RTLA 1P0SH 2BDBA 2PKAA 2HALA 2XWBI 3RU4T 3S9BA 2ODYB 2VB0A 3RXTA 1QRWA 3A8BA 2P3FH 2ZU1A 1G3EA 4FUJA 3E0NB 1TNJA 5FPSA 1O0DH 3L6PA 2V0BA 3KCGH 2QIQA 1P8VC 2WYGA 4JYUH 3SO3A 1GDQA 1GJDB 4GUXA 1C5ZB 4D9RA 3UOUA 2F9UA 5CE1A 3H7OA 3L33A 1TGCA 2CXVA 2QGRA 3M5NA 1GJ9B 1ZRKA 3M37A 1O2PA 1Q3XA 1KXBA 1A5IA 1O3HA 2P95A 5L30H 4NWKA 1XXDA 2F9OA 4XE4A 2A45B 1HXEH 1FY8E 1AE8H 3VB5A 1HFDA 3AW1A 3M7UA 1AKSB 1PYTD 1XMNB 4Y8YA 1B0FA 4YOJA 1O3OA 1O2IA 2P3UB 1NU7B 3SGAE 1T8OA 2GCHG 4X2YA 1D3DB 3PYHA 1GI3A 4HZHA 1ABIH 4J2YB 1PPZA 2ESTE 1IQHA 3GY2A 2R3YA 1SGEE 1HAVA 1T8NA 3SU0A 1SGTA 1G2MA 2ZZUH 1QR3E 1AUTC 4K3JA 1WCZA 2A7HA 3M5MA 1A5HA 3BG8A 3ODDA 5FBEA 3P8NA 5K7RA 1C1VH 2A7JA 1G37A 3EE0B 1GBLA 1W0YH 4WXIA 1O3MA 5AFZH 2ZHEH 5L6NH 2FOGA 3UQVA 1F5KU 4BTIB 3RXMA 1W14U 2OQUA 3RXPA 4CBNA 1YP9A 3P70B 4CR5A 2CV3A 1XX9A 3KNXA 3GY7A 1EZXC 3QN7A 2ZU4A 1BTWA 1XVMA 2CMYA 2PKAB 5EG4A 2H2ZA 1MAYA 4ESTE 3QLPH 2IPHA 4WXVA 2AGEX 4A1VA 1UCYH 2SGEE 2D2DA 1QB6A 1HAHH 2GCTC 3O8RA 4B76A 4X1QU 1PPFE 3EDXB 1GG6C 2UUYA 5DP9A 1ANCA 2VWLA 2VIQA 1ESBA 4CRFA 2B9LA 1P2MA 3RM0H 1HJ9A 1XUHA 3RXSA 2PKSB 4NCYA 4O9VA 3V7TA 2OBQA 3LGWA 3RXQA 1TWXB 4CRDA 1KIGH 1GI7B 3AASA 1QRZA 1E34B 1C1OA 2PGBB 2HWLB 4UFGH 3RXUA 3HK6B 1GMCG 3ATLA 2HVXA 1ZGVA 4ZKSU 1WU1A 1V2JT 2QXJA 1GCTC 2P8OC 5A09A 3KQBA 1P9UA 1DWEH 2PUQH 4VGCC 3RC6A 2K1QA 4K1SA 4XBBA 2UWOA 1MKXH 1IHSH 3T29A 2WYJA 1AUJA 4TWWA 2ZFPH 3TGIE 1BBRH 5DK1A 1TALA 2ZC9H 2ZDKA 4A1XA 1TRYA 1HCGA 1GI8B 1LKAA 1RXPA 3S7HB 2PLXA 2M5TA 2F83A 1AIXH 1QURH 1Z6EA 2AERH 4TY7A 1YCPH 1MCTA 2ZKSA 3A83A 1O2UA 4WMDA 2VIPA 1CSOE 2WPHS 4FUDA 3SU4A 3PTBA 1PPHE 5CHAB 2GCTB 1O2SA 1CQQA 2AIQA 3O8CA 1CHOG 1GG6B 3ZZ8A 4IC5A 2ZTYA 1CBWC 1SGFA 3PTNA 2BQWB 1NTPA 1C5YB 1OP2A 5EOKA 1OWIA 5CMXH 2BD2A 1NY22 2SGQE 1ESAA 2ZI2H 4A7IB 1SI5H 3NPSA 2G4UA 1SHYA 3URCA 2A31A 1DSUA 3BIUH 1K1MA 1NRSH 1L2EA 1TGNA 1SBWA 5SGAE 2J2UA 1DXPA 3LJOA 4YOIA 2ZQ1A 4BAQB 1P2NA 4MVNA 3MU0A 2ZF0H 2ZDLA 2A5KA 3UIRA 1QCPA 4NGAH 4I8GA 5LPEA 4B73A 1O2WA 4HGCA 1TMTH 4X6PA 4JZ1A 3Q76A 2Y5HA 3UWJH 4ABEA 1IQKA 3H7TA 5FHTA 1ZSLA 1YPMH 2BD7A 5JYIA 2G5VA 1LQEA 2FIRH 1C1PA 1ZZZA 3Q3KA 5HXFA 3JZ1B 1UK2A 3RC5A 2ZO3H 2A1DB 3C1KA 3A7YA 2V35A 2HPPH 2WPIS
chains in the Genus database with same CATH superfamily
2BOHB 5EU8A 2Y81A 1V2PT 3SU2A 1C5XB 3O8DA 1JOUB 2OC7A 2XNIA 3EGKH 3T28A 1TA2A 1SQOA 3U8RH 2PV9B 1SGFG 3SOSA 1J15A 1TPAE 2LNCA 4A92A 2ANWA 1OWEA 4GSOA 1YPHE 1ZSJA 2SGAA 3GY8A 2BX4A 2GT7A 5A0AE 2RDLA 1TE0A 1ZPCA 1N8OC 2PFEA 5LGOA 3TPIZ 1HRTH 3BN9A 3ZIAD 1C1WH 3BG4B 4DJZB 3P95A 3UR9A 1YCPK 1FY4A 1O37A 1NBMD 1IQEA 1C2FA 1FONA 4OM9A 2SGPE 3F1SB 3SJKA 2ZP0H 1RTKA 1P57B 1KSNA 2FTMA 1HNEE 2OTVA 4K5ZA 1MUEB 2EI6A 1HYLA 4D76A 2FOCA 4D7FA 1AZZA 4SGAE 4ABBA 3OYPA 1BHXB 4UD9H 5DJ7A 7ESTE 5FX5A 4A1TA 1YGCH 1QGFA 1Y5UT 1GI9B 4KTSA 3RDZA 3ESTA 2VVUA 3MU1A 1HPGA 2ZFTA 2BB4A 1E37B 1P2QA 4YM9A 5EJZA 1G36A 1F0UA 1XKBC 4Y0ZE 1NO9H 2FXRA 2IJOB 1V2MT 2Y80A 2BDGA 3SHCH 2UUJB 2R0LA 4B71A 1VGCB 5FXLA 4AGJA 2AMDA 1BJUA 1LHCH 2A2QH 2JETB 2A32A 2FLBH 4OS6A 4FUIA 2GCHF 4Y8XA 2VIWA 4OS2A 1UK4A 3MTYA 5F53A 2O8UA 2A4OA 3A82A 1V2RT 1OP0A 1ZJDA 1F2SE 4KP0A 1FLEE 3KYFA 3QK1A 4UDWH 1J9CH 2BOKA 3DFJA 3TJUA 2BD5A 5GPIB 1C1NA 1YPKH 3PLBA 4Y6DA 1VR1H 1Y5AT 2QF4A 2FODA 3AK5A 4AORA 4NFFA 3URDA 2XC0A 1F0TA 1TQ0B 4K8YA 3K65B 4IMZA 1ELVA 2H1UA 2ZGXH 2YNAA 3M36A 2R0KA 1UK3A 1UVUH 2XBXA 1BJVA 1V2NT 1MU6B 3T62A 4MTBA 1PQ7A 4Y7BA 4TSFD 2Z94A 1EAXA 1EOLA 3A7VA 1SSXA 2ZGHA 3PM3A 3U98H 3HGPA 3MU4A 1SLWB 1DOJA 1H4WA 1UVOA 3BV9B 5F6MA 2ZNKH 1G2LA 3LH1A 2A5AA 3VXFH 2GMTC 1K1LA 2JJ2D 1LMWB 4O3UA 1LDTT 1FV9A 2ZDAH 1BMNH 4X1RU 2TRMA 1IAUA 4IN2A 2Y5FA 1UTOA 3LDXH 4Y0YE 1EX3A 1ELAA 1SGDE 1K21H 1B5GH 1GBCA 3QDZB 1SGQE 3RMNH 5I46H 1K2I1 4BAHB 8GCHG 1QHRB 9ESTA 4TY6A 4Q4LA 5EW1H 1DSTA 1OWJA 3ELAH 1JXPA 4OS1A 1C5RA 1P2IA 1DITH 1BTZA 4SGBE 1VITG 5E2PA 5AVDA 2ZCKP 4DVAU 3GY3A 1AB9C 3AVZA 1EJAA 3AAUA 4DW2U 3A80A 3M7TA 4WWYA 2YOLA 3OY5U 2C8XB 3ZYDA 1V2OT 1PJPA 3GDSA 2ZHFH 9LPRA 2D8WA 3RXOA 5EIYA 1UTPA 4FUCA 4GAWA 4E06H 3UNQA 4NA8A 3UQOA 1TYNA 2FTLE 1C5UA 1L1JA 1NFUA 1GMCF 2C93B 1FMGA 2ZFSA 2V3MA 1HAXB 3T27A 3LKWA 3FZZA 1CA0C 3OTPA 5IDKA 4NG9H 2XBYA 2G4TA 5HM2A 4CR9A 1SGIB 2VNTA 2AIPA 3ATKA 4ISHH 2JKHA 2FZZA 2Y5GA 5CDFE 4ZXYH 1AVGH 1AVWA 3ZVGA 5DP3A 5F8XA 1C5LH 5JPMH 3BTQE 1TOCB 3SI3H 1S0QA 4BXWA 1KYNA 2OC0A 1FN6A 1E38B 4MPVA 1RGQA 4WMEA 2VWNA 5FPTA 2G5NA 2WV9A 1TGBA 1WOFA 2XCNA 1EKBB 2OC1A 3LH3A 2JJ1D 5EJLA 4B2CA 1CHOF 2A7CA 2EC9H 1JRTA 4TWYA 2RFKC 4FU9A 2AMQA 1X7AC 4DOQA 2XC5A 5C1XA 4BXSA 1QJ1B 4I7YH 3ZZAA 1O3DA 1AB9B 2Q6DA 1O2XA 1QL9A 1CT0E 2CF8H 3GISB 2C4FH 2VINA 3ZVAA 3OE7D 1ZPBA 1P09A 5FL7D 3ZZ4A 4RSPA 5GXPA 4ABIA 1SQRA 3SJOA 4A6LA 1D6RA 2VIDA 3ZZ5A 2OBOA 1VCPA 3RXCA 4KKDA 1HAZB 4B75A 5T6DA 3U28C 1NRQH 4YT7H 1HAPH 5L2YH 1UVSH 1V3XA 3PO1B 2QE7D 4NIYA 3SUEA 1MABB 1GGDC 2KFWA 5KECA 2L74A 1CA0B 1C9PA 5FCKA 1JIRA 3A7ZA 2FM2A 2GTBA 3CNRA 3QZQA 1G3BA 5C0UA 1H9LB 3C27B 4K60A 4X1NU 3VXEH 4CRAA 2BD8A 1NT1A 1L4DA 4YESB 4CHAC 1GBDA 3SUDA 1GDUA 1GHZA 4UE7H 2ULLA 2LELA 4ZUHA 3SORA 3VB3A 2FLRH 2HNTF 1YYY1 5F03A 2YMSC 1DX5M 4AB8A 1EP5A 4O97A 2XBVA 2NU3E 5ABWA 1SC8U 1WV7H 1FZZA 2ZHDA 3M3VA 2FS9A 2ASUB 2XWAA 4GCHG 1T32A 2ZU2A 4DT7B 4MPXA 3MH6A 3KQCA 5JBCS 5EJ1A 1GI6A 1OP8A 3GYLB 2VGCC 3TH2H 5HYOA 1BRBE 2Z9GA 4QT8C 4AG2A 4WY3A 1AD8H 3KIDU 3UREA 2ZG0H 1OOKB 1H8IH 5C2ZA 2UUKB 3MU5A 2QXGA 2WPDD 2EI8A 2KM0A 2HPQH 4HFPB 2FOMB 1O3PB 3E0PB 1KXCA 1C2KA 3KQEA 2A0QB 8KME2 3UPEA 1GDNA 1TRNA 1NBME 3VFEA 4AX9H 3QX5H 1B0EA 4B2AA 1F92A 4XD7D 1GGDB 2G00A 4FUBA 4TPYA 2ZHWH 3LIWA 1Z71A 2VH6A 4ISIH 4AYYB 4TPIZ 1P2JA 1C2GA 4LZ4B 2OXSA 1ELTA 4DY7B 2AMPA 1TOMH 4P00A 2YNBA 2L6OA 3GCOA 3ATWA 5T6GA 4BTUB 4CHAB 2OD3B 1LHDH 1Y3VA 1C4V2 1ELDE 1BQYA 4JK6A 1GBHA 3UR6A 1GJ6A 4FOUC 3U8TH 1S83A 4BOHA 2XYAA 3QGNB 3NRLA 2YMSB 1O36A 3RXKA 1QL8A 5DKMA 1FY5A 3EA7A 1LQDB 2QF3A 3EQ0H 1O2QA 2FOAA 2WPMS 3PMHB 2GJGA 3ENSB 4X6MA 1C5MD 4DURA 1GJ5H 2PKSC 3MO3A 2QAAA 3ZZ7A 2PUXB 3T26A 5L2ZH 5GWZA 3LGIA 2W3KA 2B7DH 4JZIA 1FQ3A 3N99A 1N6YA 3KHVA 4MQAA 2VGCB 4OGXA 1KDQA 1GBBA 1K28D 2GZ9A 3WY8A 2VVVA 3GDVA 4ISNA 4X8SH 1BA8B 1C5PA 1QY6A 3PMAB 2PTCE 2GZ8A 3ZZDA 1P3CA 3F3BA 1S85A 1FN8A 6GCHF 1C2HA 1WYKA 4YLUA 3F6UH 3RU4D 2BQ7B 2ZEBA 1IQNA 4WF8A 1S6LA 4MNVA 2G55A 1NROH 3SZEA 1WTGH 4DIIH 1GL0E 1PPCE 1W3CA 2Z3EA 1OX1A 1RFNA 3BF6H 1BRCE 3SUFA 3RC4A 5K0HA 1LO6A 1ID5H 3HGNA 2BMGB 1BMFD 1QJ6B 3OEHD 1TMUH 4XBDA 1SQTA 1C5NH 1K1NA 1TMBH 2P93A 1C2DA 1O2JA 1A0LA 2V3OH 3RXHA 4FUEA 1TABE 3FN8A 4O03A 5EQRA 1L1NA 1C1TA 1MTSA 4HG6A 3SJ8A 2BYAX 1O2MA 5CHAC 8GCHF 1V2TT 4MNYA 3ZVEA 1DANH 2F91A 1G9IE 2DE9A 4FVBA 3MH4A 1PQ8A 2V3HH 5EXLA 1VITF 2WHXA 3KGPA 2ILNA 1FNIA 1THSH 3RXDA 3SNEA 4U30A 5BRRE 3HATH 3RXAA 5T1VA 1YPGH 4YZUA 4ZKNU 1BTHH 1MU8B 3A8AA 1TBZH 2OLGA 1AE5A 1G3DA 5DP6A 5C17A 3STIA 2G52A 1OHHD 5JBBS 1GJCB 5DGJA 1SLVB 2Y7ZA 1ORFA 4ABFA 2Z9JA 4B1TA 2EQNA 1UVPA 4ACAA 2PP6A 3QTOH 4RT0A 3E1XB 3TU7H 2ALVA 4AG1A 5A8ZA 1GI5A 1INCA 1ZYOA 2GZ7A 1HAVB 1QQUA 2AGGX 1UTJA 2WPLS 2QXIA 1BRAA 4KTUA 4GLYA 3UTUH 3ZZ6A 4ZH8A 2WPJS 1RTFB 1MTVA 5C67A 2BDAA 2BDYA 2THFB 4NZQA 1E0FD 2I6SA 4M9FA 3LU9B 1THRH 3SU3A 1GPZA 3RXJA 1O35A 1TX6A 1VCWA 1A1RA 3A81A 3OX7U 2KX4A 1MD8A 2P94A 5E8EH 4TYDA 1D9IA 1SGRE 1P11E 1OWDA 1WSSH 1TAWA 3LONA 1L4ZA 1S82A 2BY7X 4K1EA 1DY8A 4NIXA 3QWCH 2IN2A 1FY1A 2O8WA 2Z9KA 5LPFA 2HOBA 3M5OA 2ZECA 4UONA 3BG4C 1KXEA 1NRNH 1ZTJA 3MH7A 4BAKB 1P9SA 1HJAC 1UCYK 1LVMA 2BZ6H 1KLJH 2FI3E 4AN7A 3B9FH 1SB1H 3F2FA 5DO4H 1OS8A 1E36B 5A8YA 4Q7XA 3Q00A 1BT7A 2OQ5A 1DE7H 1Y3UA 5AFYH 3MO6A 4DIHH 3SU5A 5C94A 4BTTB 1G32B 1CGHA 1MQ6A 1O31A 1SOTA 1K1OA 2STBE 3CS7A 3RMOH 5DP5A 5C0TA 1QQ4A 3GDUA 1HIAA 4YT6H 2F9NA 2AYWA 4OGYA 2XOKD 4OS4A 4Z1MD 1XUIA 1DWBH 1NS3A 1QIXB 1TPPA 2BLOA 1D3TB 1AWHB 5PTPA 1VGCC 1W7GH 3BTKE 4JZDH 1K22H 2JETC 3ZVBA 2TPIZ 1GBFA 1DVAH 3H09A 4GPGA 3L3TA 1PPGE 4H6SB 1H9HE 2B5TB 4RKOB 1K1IA 1MKXK 3LT3A 4NZLA 1O3GA 1JBUH 3EAJA 4GCHF 1BBRK 4JCNA 1BTUA 1SLUB 1W2KH 3BTTE 4CH8B 2ZFFH 1TNIA 8LPRA 3SNDA 1SFIA 1Y3XA 1UTQA 3PV2A 1A46H 3SW2B 1GI0A 5F8TA 3TK9A 1QB9A 2UWPA 5I25A 4YO9A 3PROA 2BLVA 2I6QA 1SGPE 3A89A 1ZJKA 1P03A 3UWIA 5A0CA 4UEHH 2EY4C 1ELFA 1XXFA 1HJAB 3A8DA 5DP4A 3W95A 2NU0E 1O5DH 1YPLH 1GWAA 3N7DA 1B7XB 1Y3YA 5A8XA 2XBWA 1Y8TA 1A7SA 1E1RD 2LPRA 1LHFH 1V2UT 3TGKE 2KCAA 2RDEA 4ABGA 2FYQA 3ZVFA 2FP7B 1SL3A 1FXYA 1TB6H 3ZV9A 3FP8E 4H4FA 4XRNA 5A2MH 1OKXA 3O8BA 2FOFA 3VG8A 3DUXH 2AGIX 1TIOA 1W8BH 2BDHA 1TONA 1CT4E 3FANA 1AQ7A 1EFRD 1S0RA 3T5FH 3FVFB 2QXHA 1U6QA 1A5GH 4I33A 1EZUC 1DUAA 4X1SU 1QB1A 4CRGA 1GBAA 2PTNA 1O2ZA 1O5EH 5BPEA 4K8BA 2CF9H 1C1UH 4LK4A 3TK5A 3ODFA 1C2EA 1V2LT 3FZDA 3I77A 1EQ9A 3MFJA 1Z8RA 2Y7XA 1HIAB 4Y10E 3ZYEA 3PRBA 1FIZA 3SV2H 1GHBG 1QBOA 1TGTA 2O8TA 4BAOB 1AGJA 3BSQA 1NRPH 1MQ5A 3ATMA 3SUGA 1NESE 3SGQE 2KCOA 1GHAF 1NFWA 4H42U 4E7NA 2K0QA 1SKYE 2ZTZA 4INHA 3SYJA 3DD2H 3PWBA 1KXDA 2FX6A 6GCHG 1FDPA 3DT0H 1BCUH 1BIOA 1TPOA 4INLA 4U2WA 5E0GA 2AS9A 3RP2A 1ZMLA 1IQMA 1ZSKA 1W7XH 1NU9A 1W11U 3FFGA 1HJ8A 3QGJA 1GHXH 1JMOH 1GBEA 4DCDA 2FI5E 5DN6D 4KELA 3A85A 2ZWLH 3EA9A 2FOBA 5GNDA 3RU4E 2GV7A 1TBQH 4I31A 3A86A 4KTCA 2O8MA 2VWMA 3A7WA 1MAXA 1V2KT 1GCDA 2VVCA 1LCYA 2CN0H 4D7GA 1Q2WA 3RXBA 1V2WT 1VKYA 2ZA5A 1WQSA 2GP9B 3MH5A 2LP6A 1FIWA 1UCYE 1YKTA 4Q7ZA 4NSVA 3MWIU 2O9QA 1H8ED 2Z3CA 3SV9A 1ETSH 1LVYA 3F68H 4XSKU 1FJSA 2FX4A 1O34A 1QRXA 3ZZ3A 5J4QA 3K6YA 3OU0A 2SNVA 3CP7A 1LVOA 1PFXC 3DCLA 1T4UH 4B6FA 2J38A 3UB0A 3BEUA 1HAIH 1GHVH 4YXWD 1XM1A 1J8AA 3E6PH 3SNAA 4F48B 2H5CA 5AHGH 4I8HA 1O30A 2RG3A 3A88A 2EEKA 3BTDE 2ZDMA 1O32A 1VITH 1O38A 1P02A 3PO1C 2GGVB 2BY9X 4MPUA 3PWCA 2GD4B 1SFQB 2ZGCA 4IW4E 3D23A 1MKWH 1MZAA 1ZRBA 4FUHA 2NU4E 1HAGE 2OP9A 2JIZD 1GJAB 2KAIA 2QF0A 2J5UA 3BTFE 3SZNA 4X6OA 1O2HA 4Y71A 3SGBE 5EW2H 1ANDA 1BTPA 3QZRA 1BBRE 1JRSA 1A0HB 4DG4A 4HTCH 4I32A 2PSXA 3LC5A 3IWMA 2SGDE 3RXIA 3SBKA 1YPJH 3SJIA 1GVKB 4X2WA 1TGSZ 3P17H 3G01A 2BDCA 2GVFA 1TRMA 1AHTH 4Y11E 2UUFB 1DXWA 2W6ID 3TNTA 1MD7A 2F9PA 5EODA 3RMLH 3RXGA 5FX6A 1BUIA 1O2OA 1RS0A 1ZOMA 2O8LA 1MBMA 1GI2A 4Q80A 3EE7A 4LZ1H 1TX8A 1AZ8A 4FUGA 2SGFE 1LHEH 5FPYA 1DLEA 4ASHA 2H5DA 1ZHPA 3NXPA 2ANKH 3S9CA 1O3EA 4F55A 3ZVCA 6LPRA 2BXTH 3GY5A 2PSYA 5HKKD 4Y79A 1UW7A 1KY9A 2Z9LA 1TA6A 2H9HA 3M7QA 3DHKH 5T6FA 1KTSB 1XUKA 2P3TB 2CK3D 4FUFA 1C1MA 1MTUA 4ZXXH 3E91A 3TK6A 1HV7A 1D3PB 5ESBA 2G51A 7KMEH 5ETXA 2TIOA 1MMJN 4FVDA 2ZPSA 3BTWE 1GI1A 1C4Y2 3P6ZB 1RIWB 4O3TA 1J14A 1C2IA 4MLFB 4Z6AH 3SQEE 3SU1A 2PW8H 5JB9S 1BB0B 3FP6E 1W13U 2ZFQH 3PMJA 1L0ZA 1DY9A 3EA8A 5DP7A 5EPYA 3F9HA 1ELGA 1AY6H 1DM4B 3BTEE 1DS2E 1ELBA 4Y76A 4AGKA 1EASA 3BIVH 3HPTB 4F49A 2Z7FE 1DFPA 2ZU5A 2TGAA 1P10A 1SQAA 2A5IA 3NWUA 2WUCA 4YLQH 1C1QA 1ANBA 2W7UA 4DGJA 1MKWK 5B6OA 2BZAA 1OSSA 3VB4A 2JH6D 2D1JA 3PLKA 1C1RA 2KAIB 1W0KD 2ZDNA 1Z8IB 2XRCA 3FOAA 3SI4H 1TPSA 2H9TH 2VIVA 2AFQB 1RD3B 1GBTA 2TGTA 1T8LA 4ZROA 1TFXA 3A7XA 2KCPA 1DT2A 4X2VA 2ZPQA 1O5AB 1ZHRA 1W10U 1KXFA 4CRBA 2V7QD 4A5TS 1UTLM 2F9VA 3UNSA 1O3AA 5E0HA 3CENA 1WBGB 3NKKA 3AAVA 1GHWH 1FAKH 1CU1A 1H9IE 1ZTKA 7GCHG 3PLPA 1OWHA 1SOZA 2YMSD 1F7ZA 3LJJA 3TJVA 1ZGIA 2F3CE 1GHYH 1YC0A 3RMMH 3EYDA 3U8OH 4ABHA 2SNWA 4CREA 2FS8A 1OYQA 4Y7AA 2F9BH 3TH4H 1IHTH 1C5TA 2QY0B 1BTYA 1O2GH 3GCNA 1O2NA 1TX7A 3OTJE 3OY6U 3I78A 2ZHQH 3Q3XA 1AN1E 4Z0KA 1QFKH 1KMHB 2A4GA 3NK8A 4GHQA 1P3EA 1O3FA 1K1PA 1SPJA 2JH5D 1CT2E 3H5CB 5LPRA 1C1SA 1SGCA 4BNRA 1NRRH 1GMDG 7LPRA 4NIVA 4R0IA 3S9AA 1EXFA 4WVPE 1EAIA 4NIWA 4Q7YA 1GHBF 1FPCH 4LOYH 1H8DH 3PV4A 8ESTE 1W0ZU 1ZPZA 3LOXA 5EXNA 5IYTA 1HB0B 2BD9A 1GHAG 4MG3A 3S0NA 1NFYA 2B0FA 2A4RA 3MMGA 1MTNC 1DICA 4F4OC 4THNH 1VCQA 4JZEH 2ZTXA 3SNCA 1SMFE 3V3MA 3F0OA 1A4WH 2OINA 2FI4E 2QA9E 1UTMA 3OAAD 1C5QA 3ZZ9A 3UNRA 5GJ4B 1G3CA 3WWFA 4I8KA 1EAUA 3GS9A 4IMQA 4K2YA 2G8TA 3MNSA 4RT1A 1QA0A 1KXAA 1GBIA 2C3SA 2CHAC 3D65E 3RXRA 3TITA 1J17T 2ODPA 1TLDA 5HMAA 1UJ1A 3Q77A 2H6MA 1O39A 3UY9A 2FDAA 2WUBA 5T3HA 3FAOA 1P05A 1O2RA 4ZKOU 2Q1JA 4NA7A 1S84A 3MYWA 1F5RA 1W0JD 2HGTH 3U1JB 3K2UA 2KZ4A 1LPGB 1Y59T 3HK3B 3TNSA 2P16A 4AYVB 2FYRA 4E05H 2SFAA 1Y3WA 4NA9H 1P06A 1C5SA 2C8ZB 2J34A 1Z8GA 4NSYA 4XBCA 2GDDA 3E90B 1RJXB 3OSYA 4I8JA 1O2YA 2OUAA 4AOQA 1O2LA 3VGCC 1C2LA 1QBNA 1S6HA 2ANMH 3V12A 4NWLA 1GVZA 1QNJA 1YCPM 2NU1E 1QJ7B 5HM9A 1DUEA 3N7EA 1GJ8B 1YBWA 1DWCH 1MTNB 2VU8E 4ZMAH 2BLWA 1CHGA 3M3TA 2GDEH 1EUFA 4B6EA 3E3TA 1ELCA 3VB7A 4PROA 2ZIQH 1GVLA 2VH0A 2PWXA 1WQVH 2WINI 1ZLRA 4U32A 5TCAA 2BM2A 4K1TA 1ESTA 1QL7A 1Y5BT 2R2WU 1AFQC 1GBMA 2BDIA 5C1UA 4IGDA 2BLQA 1LKBA 2EA3A 3GCTG 5GDSH 1KDQB 2CHAB 2GV6A 3P8GA 4AB9A 3A8CA 4P02A 2J98A 2HRVA 1BRUP 3PMBB 1S81A 1FUJA 3F2HA 1V2QT 3V13A 5DSFA 3ZV8A 4AC9A 5EGMA 1DPOA 1TNGA 3D49H 5C1YA 2TGDA 2QCYA 3T25A 3U1IB 2FWWA 1IOEA 1DLKB 1C5VA 1NZQH 2GT8A 4BAMB 2ANYA 2NWNA 3BTHE 2CJIA 1PPBH 5JBTA 4I86A 4ZKRU 1VZQH 3GCHC 1FPHH 1MBQA 2J94A 1C9TA 2KCYA 1IQIA 1JWTA 5EPNA 1PQ5A 3VGCB 3SQHE 2R3UA 2PHBA 3DA9B 4FXGH 1Q31A 4J1YA 2BVXH 3VEQB 1XUGA 3BEIB 3U9AH 2HNTC 3S69A 4CH2B 1UHBA 1ETRH 1O3NA 1P04A 1SGYE 3RLYH 1Z8JB 4D8NA 3KN2A 5EQSA 1UO6A 5ESTE 1O3KA 4XOJA 2F4LA 4WH8A 3SV6A 1L1GA 1O5FH 1TNLA 4WJG2 4ACBA 1K9OE 1MH0A 2CGAA 1AMHA 3QTVH 3KL6A 1EZQA 1AFQB 1T31A 3W1EA 2C8WB 2ZGBH 5J4SA 5LH8A 1P12E 2FPZA 1BMAA 4ISLA 1AFEH 1GCTB 1UTKA 2BY8X 1DWDH 2P8OB 3I29A 3SNBA 2Y82A 4VGCB 1S5SA 1RRKA 3ZVDA 1SR5C 1BTXA 5KEDA 5GCHG 5C5NA 1O3IA 4X8VH 1P2OA 2W5EA 3UOPA 3P8FA 2WPKS 1UTNA 3W94A 1GJ7B 2DUCA 2XXLA 3MO9A 3NCLA 1W12U 1NPMA 2ZCLP 1WXRA 3E8LA 6CHAC 1V2ST 2VIOA 1EAWA 1AU8A 1H1BA 1NM6A 2A4QA 3GICB 2C8YB 3PB1E 4ZCNA 1HDTH 1P2KA 1ZTLA 4Y8ZA 3MQKC 3GCHB 3GOVB 1AO5A 5KGOA 1C2MA 2J98B 3Q3YA 3TIUA 3GY6A 3KEEA 1E35B 3WWBA 4OS5A 5G4BA 1XKAC 1GMHG 1CBWB 2VJ1A 1XVOA 5HIZA 1C4U2 1THPB 2J9NA 2M2AA 4X1PU 1C2JA 1N6XA 2RCEA 1FI8A 2OCVB 1CE5A 4ZAEA 4IS5A 3LGTA 3SJ9A 1V2VT 4K69A 3JZ2B 2FOEA 3SU6A 7GCHF 1CO7E 1SVPA 1OYTH 2IOTA 4WH6A 2W3IA 1YF4A 1KTTB 3KF2A 6ESTA 3BTME 1C5WB 2QYIA 4RI0A 3VPKA 3R0FA 4RKJB 2ZQ2A 1LPKB 2PR3A 1EB1H 3FKSD 4AFZA 4X8UH 4YOGA 1IQLA 2AEIH 2XTTB 1EJNA 2QF5A 3DFLA 1BZXE 5DG6A 1QA7A 4MNXA 3F9FA 1UHBB 1FAXA 3TJOA 1SG8B 5DP8A 3F0PA 1Z1IA 1GL1A 2ZGJA 2JDID 3MNBA 3P92A 1T7CA 1F0RA 2J95A 1NC6A 1IQGA 1OXGA 2G81E 3GYMA 4XFQA 1GMDF 3LC3A 3T2NA 4MNWA 1ZR0A 1ZMNA 4RN6A 2B8OH 3F9EA 4DT4A 1K1JA 4JK5A 1N1LA 2DE8A 4INKA 6CHAB 1IQFA 1DDJA 3TVJB 4E7RG 2XW9A 2BX3A 2ZPRA 3A87A 1J16A 3CS0A 1EB2A 3MOCA 1F0SA 3WW7A 1GBJA 1SLXB 2WV5A 1O5CB 1ELEE 1HUTH 1YLDA 2J4IA 3S7KB 3TJNA 1HAOH 5F8ZA 1Z7KA 1SHHB 4ZHLU 5H4IB 1O2VA 1UVTH 1N8OB 1TNHA 2Z9IA 3MNXA 1ACBE 2BQ6B 3TH3H 4Q2KA 3D62A 5EXMA 3F9GA 1HAYB 5JDUB 3SHAH 2K8IA 2XCFA 4D9QA 2HLDD 5DPAA 2ALPA 1BITA 1XUJA 3BTGE 5C5OA 1HLTH 2BD3A 3RXLA 3KQ5A 1O2KA 1ZMJA 2GX4A 4JZFH 1D4PB 3IG6B 1BDAA 4U01A 4FETA 1D6WA 5FAHA 3SV8A 3M5LA 2FOHA 1EJMA 1JIMA 3B8JA 4B74A 2TBSA 4JMYA 3ATIA 1OWKA 3VB6A 1O3LA 1T8MA 1MTWA 1LVBA 1YPEH 3E16B 1GBKA 1YLCA 3RUOA 2W7SA 2STAE 2XNDD 1CA8B 3GY4A 1HBTH 1YLNA 1PPEE 4HI3A 1CGJE 4ABJA 2J92A 3IITA 1S6FA 1QBVH 3LGVA 1O3JA 1LPZB 5A0BA 1EPTA 4AFSA 1KLIH 4OS7A 1WAYB 1WUNH 1O5GH 4X2XA 1A61H 1GJ4H 1QTFA 1TQ7B 2TGPZ 1PQAA 1KLTA 3U69H 1UMAH 4IN1A 4M7GA 1MCVA 4B2BA 3QUMP 4GHTA 1RIWC 2RA0A 4CRCA 1M9UA 1TBRH 3KQDA 1CVWH 4MPWA 1O2TA 2PGQB 1F5LA 4JYVH 3GCTF 1LHGH 3OFND 1AI8H 1EPTC 3K9XB 1A3BH 3N7OA 1OPHB 1AVXA 2P59A 3R3GB 1HGTH 5EQQA 3M3SA 2BVSH 1BOQA 3RXFA 1GI4A 2C90B 1ZHMA 5FBIA 4X0WU 1A0JA 2Q6GA 3MNCA 1CGIE 2IPQX 4ISOA 4UFFH 4MDSA 1E1QD 3M61U 3BEFB 2ZU3A 2GKVE 1GJBB 2ZCHP 2H9EH 2GMTB 4FU8A 1HXFH 4ZHAA 1P01A 5E0JA 1Z6JH 2BHGA 2WZQA 2QC2A 5C20A 3RM2H 2V6NA 3TGJE 2BVRH 1SGNE 4IC6A 4ABAA 3UUZA 1C5OH 1QZ8A 1YM0A 1NN6A 3RXVA 1LTOA 2EI7A 3HKJB 1EOJA 1BMMH 1YPHC 2R9PA 1O3BA 5C3NA 2XC4A 1VJ9U 2Y6TA 1ARBA 1ARCA 1D3QB 4AFQA 1WTHD 4GVUA 3RXEA 3UAIC 3ITIA 2OC8A 3MI4A 2Z3DA 2QN5T 1AWFH 3K6ZA 3P8OA 4X6NA 2JH0D 2FMJA 4UFDH 1NFXA 3PRDA 1BMLA 2R2MB 2Z6BD 3UFAA 3FO8D 1EP6A 2D26C 4I8LA 1Z1JA 2ZFRH 2BY5X 2Q6FA 4UFEH 3V0XA 1V6DA 1O5BB 1AKSA 4BANB 3HKIB 1A2CH 1COWD 4YTAA 1EPTB 1VJAU 3MHWU 1A3EH 1ETTH 2ZDVH 3STJA 2BXUH 3B23B 2A2XH 1EZSC 3PV5A 5TJXA 4X8TH 2ODQA 1MZDA 1ANEA 3MU8A 5GCHF 3ZZCA 3AW0A 1T4VH 3ZZBA 4NFEA 2WV4A 2QV1A 3DSOA 3LGUA 4KGAA 3M35A 4H6TA 4AFUA 2KR7A 3DSGA 4CBOA 5HGGA 4FU7A 1IQJA 4ZHMU 3QO6A 1K0HA 2VWOA 2FESH 3SN8A 3LPRA 3A84A 5GIBA 2FEQH 2BD4A 4XDEA 1BHXF 3NUMA 1O33A 4WMFA 4R8TB 1G30B 3A7TA 3SV7A 2W26A 5TCCA 3LGYA 4JYTA 5E2OA 2BY6X 4AZ2B 2HLCA 1EATA 2FO9A 2UWLA 1XUFA 3FP7E 2W6JD 5FCRA 1GMHF 1FY3A 1ABJH 5JB8S 1WDIA 3RLWH 5AF9H 2NU2E 1PYTC 3NZIA 3KYGA 4IBLH 5JBAS 2HNTE 4ABDA 4LXBH 2RA3A 1O3CA 1TNKA 2BTCE 3TLOA 2AH4X 1RTLA 1P0SH 2BDBA 2PKAA 2HALA 2XWBI 3F2GA 4TT3D 3RU4T 2ODYB 2VB0A 3S9BA 2VBCA 3RXTA 1QRWA 3A8BA 2P3FH 2ZU1A 1G3EA 4FUJA 3E0NB 1TNJA 5FPSA 1O0DH 5IK2D 3L6PA 2V0BA 3KCGH 3DSPA 2QIQA 1P8VC 2WYGA 4JYUH 3SO3A 1GDQA 1GJDB 4GUXA 1C5ZB 1FX0B 4D9RA 3UOUA 2AHME 2F9UA 5CE1A 3H7OA 3L33A 1TGCA 2CXVA 2QGRA 3M5NA 1GJ9B 1ZRKA 3M37A 1O2PA 1Q3XA 2V35A 1KXBA 1A5IA 1O3HA 2P95A 2F43B 5L30H 4NWKA 1XXDA 2F9OA 4XE4A 2A45B 1HXEH 1FY8E 1AE8H 3VB5A 1HFDA 3AW1A 3M7UA 1AKSB 1PYTD 1XMNB 4Y8YA 1B0FA 4YOJA 1O3OA 1O2IA 2P3UB 1NU7B 3SGAE 1T8OA 2GCHG 4X2YA 1D3DB 3PYHA 1GI3A 4HZHA 1ABIH 4J2YB 1PPZA 2OK5A 2ESTE 1IQHA 3GY2A 2R3YA 1SGEE 1HAVA 1T8NA 3SU0A 1SGTA 1G2MA 2ZZUH 1QR3E 1AUTC 4K3JA 1WCZA 2A7HA 3M5MA 1A5HA 3BG8A 3ODDA 5FBEA 3P8NA 5K7RA 1C1VH 2A7JA 1G37A 3EE0B 1GBLA 1W0YH 4WXIA 1O3MA 5AFZH 2ZHEH 5L6NH 2FOGA 3UQVA 1F5KU 4BTIB 3RXMA 1W14U 2OQUA 3RXPA 4CBNA 1YP9A 3P70B 4CR5A 4Q63A 2CV3A 1XX9A 3KNXA 3GY7A 1EZXC 3QN7A 2ZU4A 1BTWA 1XVMA 2CMYA 2PKAB 5EG4A 2H2ZA 1MAYA 4ESTE 3QLPH 2IPHA 4WXVA 2AGEX 4A1VA 1UCYH 2SGEE 1H8HD 2D2DA 1QB6A 1HAHH 2GCTC 3O8RA 2J97A 4B76A 4X1QU 1PPFE 3EDXB 1GG6C 2UUYA 5DP9A 1ANCA 2VWLA 2VIQA 1ESBA 4CRFA 2B9LA 1P2MA 3RM0H 1HJ9A 2HVYB 1XUHA 3RXSA 2PKSB 4NCYA 4O9VA 3V7TA 4ASUD 2OBQA 3LGWA 3RXQA 1TWXB 4CRDA 1KIGH 1GI7B 3AASA 1QRZA 2IJD1 1E34B 1C1OA 2PGBB 2HWLB 4UFGH 3RXUA 3HK6B 1GMCG 3ATLA 2HVXA 1ZGVA 4ZKSU 1WU1A 1V2JT 2QXJA 1GCTC 2P8OC 5A09A 3KQBA 1P9UA 1DWEH 2PUQH 4VGCC 3RC6A 2K1QA 4K1SA 4XBBA 2UWOA 1MKXH 1IHSH 3T29A 2WYJA 1AUJA 4TWWA 2ZFPH 3TGIE 1BBRH 5DK1A 1TALA 2ZC9H 2ZDKA 4A1XA 1TRYA 1HCGA 1GI8B 1LKAA 1RXPA 3S7HB 2PLXA 2M5TA 2F83A 1AIXH 1QURH 1Z6EA 2AERH 4TY7A 1YCPH 1MCTA 2ZKSA 3A83A 1O2UA 4WMDA 2VIPA 1CSOE 2WPHS 4FUDA 3SU4A 3PTBA 1PPHE 5CHAB 2GCTB 1O2SA 1CQQA 2AIQA 3O8CA 1E79D 1CHOG 1GG6B 3ZZ8A 4IC5A 2ZTYA 2WSSD 1CBWC 1SGFA 3PTNA 2BQWB 1NTPA 1C5YB 1OP2A 5EOKA 1OWIA 5CMXH 2BD2A 1NY22 2SGQE 1ESAA 2ZI2H 4A7IB 1SI5H 3NPSA 2G4UA 1SHYA 3URCA 2A31A 1DSUA 3BIUH 1K1MA 1NRSH 1L2EA 5B6LA 3OEED 5HIYA 1TGNA 1SBWA 5SGAE 2J2UA 1DXPA 3LJOA 4YOIA 2ZQ1A 4BAQB 1P2NA 4MVNA 3MU0A 2ZF0H 1YWUA 2ZDLA 2A5KA 3UIRA 1QCPA 4NGAH 4I8GA 5LPEA 4B73A 1O2WA 4HGCA 1TMTH 4X6PA 4JZ1A 3Q76A 2Y5HA 3UWJH 4ABEA 1IQKA 5CHBA 3H7TA 5FHTA 1ZSLA 1YPMH 2BD7A 5JYIA 2G5VA 1LQEA 2FIRH 1C1PA 1ZZZA 3Q3KA 5HXFA 3JZ1B 1UK2A 3RC5A 2ZO3H 2A1DB 3C1KA 3A7YA 1YY3A 2HPPH 2WPIS
chains in the Genus database with same CATH topology
2BOHB 5EU8A 2Y81A 1V2PT 3SU2A 1C5XB 3O8DA 1JOUB 2OC7A 2XNIA 3EGKH 3T28A 1TA2A 1SQOA 3U8RH 2PV9B 1SGFG 3SOSA 1J15A 1TPAE 2LNCA 4A92A 2ANWA 1OWEA 4GSOA 1YPHE 1ZSJA 2SGAA 3GY8A 2BX4A 2GT7A 5A0AE 2RDLA 1TE0A 1ZPCA 1N8OC 2PFEA 5LGOA 3TPIZ 1HRTH 3BN9A 1C1WH 3BG4B 4DJZB 3P95A 3UR9A 1YCPK 1FY4A 1O37A 1IQEA 1C2FA 1FONA 2SGPE 3F1SB 3SJKA 2ZP0H 1RTKA 1P57B 1KSNA 2OTVA 1HNEE 2FTMA 4K5ZA 1MUEB 2EI6A 1HYLA 4D76A 2FOCA 4D7FA 1AZZA 4SGAE 4ABBA 3OYPA 1BHXB 4UD9H 5DJ7A 7ESTE 5FX5A 4A1TA 1YGCH 1QGFA 1Y5UT 1GI9B 4KTSA 3RDZA 3ESTA 2VVUA 3MU1A 1HPGA 2ZFTA 2BB4A 1E37B 1P2QA 4YM9A 1G36A 1F0UA 1XKBC 4Y0ZE 1NO9H 2FXRA 2IJOB 1V2MT 2Y80A 2BDGA 3SHCH 2UUJB 2R0LA 4B71A 1VGCB 5FXLA 4AGJA 2AMDA 1BJUA 1LHCH 2A2QH 2JETB 2A32A 2FLBH 4OS6A 4FUIA 2GCHF 4Y8XA 2VIWA 4OS2A 1UK4A 3MTYA 2O8UA 2A4OA 3A82A 1V2RT 1OP0A 1ZJDA 1F2SE 4KP0A 1FLEE 3QK1A 4UDWH 1J9CH 2BOKA 3DFJA 3TJUA 2BD5A 5GPIB 1C1NA 1YPKH 3PLBA 4Y6DA 1VR1H 1Y5AT 2FODA 4AORA 4NFFA 3URDA 2XC0A 1F0TA 1TQ0B 4K8YA 3K65B 4IMZA 1ELVA 2H1UA 2ZGXH 2YNAA 3M36A 2R0KA 1UK3A 1UVUH 2XBXA 1BJVA 1V2NT 1MU6B 3T62A 4MTBA 1PQ7A 4Y7BA 2Z94A 1EAXA 1EOLA 3A7VA 1SSXA 2ZGHA 3PM3A 3U98H 3HGPA 3MU4A 1SLWB 1DOJA 1H4WA 1UVOA 3BV9B 5F6MA 2ZNKH 1G2LA 3LH1A 2A5AA 3VXFH 2GMTC 1K1LA 1LMWB 4O3UA 1LDTT 1FV9A 2ZDAH 1BMNH 4X1RU 2TRMA 1IAUA 4IN2A 2Y5FA 1UTOA 3LDXH 4Y0YE 1EX3A 1ELAA 1SGDE 1K21H 1B5GH 1GBCA 3QDZB 1SGQE 3RMNH 5I46H 1K2I1 4BAHB 8GCHG 1QHRB 9ESTA 4TY6A 5EW1H 1DSTA 1OWJA 3ELAH 1JXPA 4OS1A 1C5RA 1P2IA 1DITH 1BTZA 4SGBE 1VITG 5E2PA 5AVDA 2ZCKP 4DVAU 3GY3A 1AB9C 3AVZA 1EJAA 3AAUA 4DW2U 3A80A 3M7TA 4WWYA 2YOLA 3OY5U 2C8XB 3ZYDA 1V2OT 1PJPA 3GDSA 2ZHFH 9LPRA 2D8WA 3RXOA 1UTPA 4FUCA 4GAWA 4E06H 3UNQA 4NA8A 3UQOA 1TYNA 2FTLE 1C5UA 1L1JA 1NFUA 1GMCF 2C93B 1FMGA 2ZFSA 1HAXB 3T27A 3LKWA 3FZZA 1CA0C 5IDKA 4NG9H 2XBYA 2G4TA 5HM2A 4CR9A 1SGIB 2VNTA 2AIPA 3ATKA 4ISHH 2JKHA 2FZZA 2Y5GA 4ZXYH 1AVGH 1AVWA 3ZVGA 5DP3A 5F8XA 1C5LH 5JPMH 3BTQE 1TOCB 3SI3H 1S0QA 4BXWA 1KYNA 2OC0A 1FN6A 1E38B 4MPVA 1RGQA 4WMEA 2VWNA 5FPTA 2G5NA 2XCNA 1TGBA 1WOFA 1EKBB 2OC1A 3LH3A 4B2CA 1CHOF 2A7CA 2EC9H 1JRTA 4TWYA 4FU9A 2AMQA 1X7AC 4DOQA 2XC5A 5C1XA 4BXSA 1QJ1B 4I7YH 3ZZAA 1O3DA 1AB9B 2Q6DA 1O2XA 1QL9A 1CT0E 2CF8H 3GISB 2C4FH 2VINA 3ZVAA 1ZPBA 1P09A 3ZZ4A 4RSPA 5GXPA 4ABIA 3SJOA 4A6LA 1D6RA 2VIDA 3ZZ5A 2OBOA 1VCPA 3RXCA 4KKDA 1HAZB 4B75A 5T6DA 1NRQH 4YT7H 1HAPH 5L2YH 1UVSH 1V3XA 3PO1B 4NIYA 3SUEA 1GGDC 1CA0B 1C9PA 5FCKA 1JIRA 3A7ZA 2FM2A 2GTBA 3QZQA 1G3BA 1H9LB 3C27B 4K60A 4X1NU 3VXEH 4CRAA 2BD8A 1NT1A 1L4DA 4YESB 4CHAC 1GBDA 3SUDA 1GDUA 1GHZA 4UE7H 2ULLA 4ZUHA 3VB3A 3SORA 2FLRH 2HNTF 1YYY1 5F03A 1DX5M 4AB8A 1EP5A 4O97A 2XBVA 2NU3E 5ABWA 1SC8U 1WV7H 1FZZA 2ZHDA 3M3VA 2FS9A 2ASUB 2XWAA 4GCHG 1T32A 2ZU2A 4DT7B 4MPXA 3MH6A 3KQCA 5JBCS 1GI6A 1OP8A 3GYLB 2VGCC 3TH2H 5HYOA 1BRBE 2Z9GA 4QT8C 4AG2A 4WY3A 1AD8H 3KIDU 3UREA 2ZG0H 1OOKB 1H8IH 5C2ZA 2UUKB 3MU5A 2QXGA 2EI8A 2HPQH 4HFPB 2FOMB 1O3PB 3E0PB 1KXCA 1C2KA 3KQEA 2A0QB 8KME2 3UPEA 1GDNA 1TRNA 3VFEA 4AX9H 3QX5H 1B0EA 4B2AA 1F92A 1GGDB 2G00A 4FUBA 4TPYA 2ZHWH 3LIWA 1Z71A 2VH6A 4ISIH 4AYYB 4TPIZ 1P2JA 1C2GA 4LZ4B 2OXSA 1ELTA 4DY7B 2AMPA 1TOMH 2YNBA 3GCOA 3ATWA 5T6GA 4BTUB 4CHAB 2OD3B 1LHDH 1Y3VA 1C4V2 1ELDE 1BQYA 4JK6A 1GBHA 3UR6A 1GJ6A 3U8TH 1S83A 4BOHA 2XYAA 3QGNB 1O36A 3RXKA 1QL8A 5DKMA 1FY5A 3EA7A 1LQDB 2QF3A 3EQ0H 1O2QA 2FOAA 2WPMS 3PMHB 3ENSB 4X6MA 1C5MD 4DURA 1GJ5H 2PKSC 3MO3A 2QAAA 3ZZ7A 2PUXB 3T26A 5L2ZH 5GWZA 3LGIA 2W3KA 2B7DH 4JZIA 1FQ3A 1N6YA 3KHVA 4MQAA 2VGCB 4OGXA 1KDQA 1GBBA 1K28D 2GZ9A 3WY8A 2VVVA 3GDVA 4ISNA 4X8SH 1BA8B 1C5PA 1QY6A 3PMAB 2PTCE 2GZ8A 3ZZDA 1P3CA 1S85A 1FN8A 6GCHF 1C2HA 1WYKA 4YLUA 3F6UH 3RU4D 2BQ7B 2ZEBA 1IQNA 4WF8A 4MNVA 2G55A 1NROH 4DIIH 1WTGH 1GL0E 1PPCE 1W3CA 2Z3EA 1OX1A 1RFNA 3BF6H 1BRCE 3SUFA 3RC4A 5K0HA 1LO6A 1ID5H 3HGNA 2BMGB 1QJ6B 1TMUH 4XBDA 1SQTA 1C5NH 1K1NA 1TMBH 2P93A 1C2DA 1O2JA 1A0LA 2V3OH 3RXHA 4FUEA 1TABE 4O03A 5EQRA 1L1NA 1C1TA 1MTSA 3SJ8A 2BYAX 1O2MA 5CHAC 8GCHF 1V2TT 4MNYA 3ZVEA 1DANH 2F91A 1G9IE 2DE9A 4FVBA 3MH4A 1PQ8A 2V3HH 5EXLA 1VITF 3KGPA 2ILNA 1FNIA 1THSH 3RXDA 3SNEA 4U30A 5BRRE 3HATH 3RXAA 1YPGH 4YZUA 4ZKNU 1BTHH 1MU8B 3A8AA 1TBZH 2OLGA 1AE5A 1G3DA 5DP6A 3STIA 2G52A 5JBBS 1GJCB 5DGJA 1SLVB 2Y7ZA 1ORFA 4ABFA 2Z9JA 4B1TA 1UVPA 3QTOH 3E1XB 3TU7H 2ALVA 4AG1A 5A8ZA 1GI5A 1INCA 1ZYOA 2GZ7A 1HAVB 1QQUA 2AGGX 1UTJA 2WPLS 2QXIA 1BRAA 4KTUA 4GLYA 3UTUH 3ZZ6A 4ZH8A 2WPJS 1RTFB 1MTVA 5C67A 2BDAA 2BDYA 2THFB 4NZQA 1E0FD 2I6SA 3LU9B 1THRH 3SU3A 1GPZA 3RXJA 1O35A 1TX6A 1VCWA 1A1RA 3A81A 3OX7U 1MD8A 2P94A 5E8EH 4TYDA 1D9IA 1SGRE 1P11E 1OWDA 1WSSH 1TAWA 3LONA 1L4ZA 1S82A 2BY7X 4K1EA 1DY8A 4NIXA 3QWCH 2IN2A 1FY1A 2O8WA 2Z9KA 5LPFA 2HOBA 3M5OA 2ZECA 4UONA 3BG4C 1KXEA 1NRNH 1ZTJA 3MH7A 4BAKB 1P9SA 1HJAC 1UCYK 1LVMA 2BZ6H 1KLJH 2FI3E 4AN7A 3B9FH 1SB1H 5DO4H 1OS8A 1E36B 5A8YA 4Q7XA 3Q00A 1BT7A 2OQ5A 1DE7H 1Y3UA 5AFYH 3MO6A 4DIHH 3SU5A 4BTTB 1G32B 1CGHA 1MQ6A 1O31A 1SOTA 1K1OA 2STBE 3CS7A 3RMOH 5DP5A 1QQ4A 3GDUA 1HIAA 4YT6H 2F9NA 2AYWA 4OGYA 4OS4A 1XUIA 1DWBH 1NS3A 1QIXB 1TPPA 2BLOA 1D3TB 1AWHB 5PTPA 1VGCC 1W7GH 3BTKE 4JZDH 1K22H 2JETC 3ZVBA 2TPIZ 1GBFA 1DVAH 4GPGA 3L3TA 1PPGE 4H6SB 1H9HE 2B5TB 4RKOB 1K1IA 1MKXK 3LT3A 4NZLA 1O3GA 1JBUH 3EAJA 4GCHF 1BBRK 4JCNA 1BTUA 1SLUB 1W2KH 3BTTE 4CH8B 2ZFFH 1TNIA 8LPRA 3SNDA 1SFIA 1Y3XA 1UTQA 1A46H 3SW2B 1GI0A 5F8TA 3TK9A 1QB9A 2UWPA 5I25A 4YO9A 3PROA 2BLVA 2I6QA 1SGPE 3A89A 1ZJKA 1P03A 3UWIA 5A0CA 4UEHH 1ELFA 1XXFA 1HJAB 3A8DA 5DP4A 3W95A 2NU0E 1O5DH 1YPLH 1GWAA 1B7XB 1Y3YA 5A8XA 2XBWA 1Y8TA 1A7SA 2LPRA 1LHFH 1V2UT 3TGKE 4ABGA 2FYQA 3ZVFA 2FP7B 1SL3A 1FXYA 1TB6H 3ZV9A 3FP8E 4H4FA 5A2MH 1OKXA 3O8BA 2FOFA 3DUXH 2AGIX 1TIOA 1W8BH 2BDHA 1TONA 1CT4E 3FANA 1AQ7A 1S0RA 3T5FH 3FVFB 2QXHA 1U6QA 1A5GH 4I33A 1EZUC 1DUAA 4X1SU 1QB1A 4CRGA 1GBAA 2PTNA 1O2ZA 1O5EH 5BPEA 4K8BA 2CF9H 1C1UH 4LK4A 3TK5A 3ODFA 1C2EA 1V2LT 3FZDA 3I77A 1EQ9A 3MFJA 1Z8RA 2Y7XA 1HIAB 4Y10E 3ZYEA 1FIZA 3SV2H 1GHBG 1QBOA 1TGTA 2O8TA 4BAOB 1AGJA 3BSQA 1NRPH 1MQ5A 3ATMA 3SUGA 1NESE 3SGQE 1GHAF 1NFWA 4H42U 4E7NA 2ZTZA 4INHA 3DD2H 3PWBA 1KXDA 2FX6A 6GCHG 1FDPA 3DT0H 1BCUH 1BIOA 1TPOA 4INLA 4U2WA 5E0GA 2AS9A 3RP2A 1ZMLA 1IQMA 1ZSKA 1W7XH 1NU9A 1W11U 3FFGA 1HJ8A 3QGJA 1GHXH 1JMOH 1GBEA 4DCDA 2FI5E 4KELA 3A85A 2ZWLH 3EA9A 2FOBA 3RU4E 2GV7A 1TBQH 4I31A 3A86A 4KTCA 2O8MA 2VWMA 3A7WA 1MAXA 1V2KT 1GCDA 2VVCA 1LCYA 2CN0H 4D7GA 1Q2WA 3RXBA 1V2WT 2ZA5A 1WQSA 2GP9B 3MH5A 1FIWA 1UCYE 1YKTA 4Q7ZA 4NSVA 3MWIU 2O9QA 2Z3CA 3SV9A 1ETSH 1LVYA 3F68H 4XSKU 1FJSA 2FX4A 1O34A 1QRXA 3ZZ3A 5J4QA 3K6YA 3OU0A 2SNVA 3CP7A 1LVOA 1PFXC 1T4UH 2J38A 3BEUA 1HAIH 1GHVH 1XM1A 1J8AA 3E6PH 3SNAA 2H5CA 5AHGH 4I8HA 1O30A 2RG3A 3A88A 2EEKA 3BTDE 2ZDMA 1O32A 1VITH 1O38A 1P02A 3PO1C 2GGVB 2BY9X 4MPUA 3PWCA 2GD4B 1SFQB 2ZGCA 4IW4E 3D23A 1MKWH 1MZAA 1ZRBA 4FUHA 2NU4E 1HAGE 2OP9A 1GJAB 2KAIA 2QF0A 3BTFE 3SZNA 4X6OA 1O2HA 4Y71A 3SGBE 5EW2H 1ANDA 1BTPA 3QZRA 1BBRE 1JRSA 1A0HB 4DG4A 4HTCH 4I32A 2PSXA 3LC5A 3IWMA 2SGDE 3RXIA 3SBKA 1YPJH 3SJIA 1GVKB 4X2WA 1TGSZ 3P17H 3G01A 2BDCA 2GVFA 1TRMA 1AHTH 4Y11E 2UUFB 1DXWA 3TNTA 1MD7A 2F9PA 5EODA 3RMLH 3RXGA 5FX6A 1BUIA 1O2OA 1RS0A 1ZOMA 2O8LA 1MBMA 1GI2A 4Q80A 4LZ1H 1TX8A 1AZ8A 4FUGA 2SGFE 1LHEH 5FPYA 1DLEA 4ASHA 2H5DA 1ZHPA 3NXPA 2ANKH 3S9CA 1O3EA 3ZVCA 6LPRA 2BXTH 3GY5A 2PSYA 4Y79A 1KY9A 2Z9LA 1TA6A 2H9HA 3M7QA 3DHKH 5T6FA 1KTSB 1XUKA 2P3TB 4FUFA 1C1MA 1MTUA 4ZXXH 3E91A 3TK6A 1HV7A 1D3PB 5ESBA 2G51A 7KMEH 5ETXA 2TIOA 1MMJN 4FVDA 2ZPSA 3BTWE 1GI1A 1C4Y2 3P6ZB 1RIWB 4O3TA 1J14A 1C2IA 4MLFB 4Z6AH 3SQEE 3SU1A 2PW8H 5JB9S 1BB0B 3FP6E 1W13U 2ZFQH 3PMJA 1L0ZA 1DY9A 3EA8A 5DP7A 5EPYA 3F9HA 1ELGA 1AY6H 1DM4B 3BTEE 1DS2E 1ELBA 4Y76A 4AGKA 1EASA 3BIVH 3HPTB 4F49A 2Z7FE 1DFPA 2ZU5A 2TGAA 1P10A 1SQAA 2A5IA 3NWUA 2WUCA 4YLQH 1C1QA 1ANBA 2W7UA 4DGJA 1MKWK 5B6OA 2BZAA 1OSSA 3VB4A 2JH6D 2D1JA 3PLKA 1C1RA 2KAIB 2ZDNA 1Z8IB 2XRCA 3SI4H 1TPSA 2H9TH 2VIVA 2AFQB 1RD3B 1GBTA 2TGTA