1Y3UA

Trypsin inhibitor complex
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin, cationic
publication title Structural and Thermodynamic Characterisation of Protein-Inhibitor-Complexes of Thrombin and Trypsin Inhibitors
rcsb
molecule tags Hydrolase
total genus 50
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2004-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y3uA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1y3uA02
5EOKA 2QYIA 4Z0KA 1FIZA 1GDUA 4WMEA 3ZV8A 1O3OA 5J4SA 1C2DA 3RXRA 1BMMH 1C4U2 2D2DA 5CHAC 5HXFA 3FZZA 2ZPQA 1EPTB 1A5IA 2BD5A 3M35A 5ABWA 1QBVH 4HTCH 1EAWA 5DP9A 2Y81A 3E91A 4I8LA 2G5NA 1PQ7A 1FN8A 4BAQB 1N6YA 3A7TA 1YP9A 1UK3A 4XE4A 1K28D 1BHXF 3MNXA 1EZSC 3T25A 1EP6A 1TQ0B 3F9HA 4JZDH 5GJ4B 1LHGH 1TX7A 2IPHA 2J4IA 1K9OE 1UK4A 1L4ZA 5TCAA 2FI5E 3UY9A 3PM3A 4DGJA 1SMFE 3PV4A 2C3SA 1EX3A 6LPRA 2ULLA 3SU2A 3T29A 4ZKOU 3F1SB 2P95A 3QZRA 2ZI2H 4NSYA 1D3QB 1DPOA 1MD7A 1ORFA 2F3CE 5DG6A 1QIXB 3BIUH 3MNSA 1MD8A 5IYTA 4RSPA 2GCHF 2XCNA 1GJCB 4J1YA 2ZU2A 5E8EH 1ZSJA 1GBCA 4X6NA 1GI0A 1P01A 3FAOA 5CE1A 1PQ8A 3ZZ9A 3I77A 3SJKA 1SSXA 1YPHE 1KDQA 3A8CA 2OLGA 5DJ7A 1P3EA 1H1BA 5ESTE 1EASA 3D62A 1QFKH 1QRXA 3UOPA 1SGNE 1NROH 1IQJA 4NWLA 5E2PA 3RXHA 3LC3A 3NXPA 4KTUA 3E6PH 2Y5HA 1GCTC 4CR9A 1LVBA 4MPWA 3F6UH 2XRCA 5LPEA 3DFJA 4ZROA 2HOBA 1T4VH 1BBRH 3M5OA 1GDNA 2GV6A 2Z6BD 3HGPA 3RP2A 2BVSH 3HGNA 4NA7A 4AB9A 2HRVA 1O3HA 2OBQA 5F6MA 1EAIA 4JYTA 1G2LA 1BJVA 9ESTA 1Q3XA 4HGCA 3RC4A 1P10A 1QA7A 1KXCA 4AB8A 2A2XH 4ZKNU 3A8DA 3IITA 1AIXH 2O9QA 1S82A 2G5VA 1HIAA 1QGFA 1BTYA 4A1TA 4A92A 1GI8B 3GY6A 8GCHF 3PWBA 1O3IA 4ZAEA 1G3BA 1RS0A 3SNDA 1GBJA 2CMYA 2O8WA 5HYOA 1GG6B 4I32A 1LQDB 5TCCA 1W12U 5GDSH 2CN0H 4K60A 1UTPA 1TBRH 4BXWA 3MO3A 3QTVH 3NWUA 3SV7A 1RTFB 2D8WA 3GY4A 4CH2B 4D9RA 5JYIA 5AFZH 1SHYA 1HFDA 1Y3UA 3BV9B 2CF9H 4D8NA 3W95A 1HXFH 2JETB 3RXCA 1HB0B 3DT0H 2C4FH 4INLA 3M37A 1BUIA 1GJAB 4X2VA 1W7GH 1Y3VA 1SOZA 5J4QA 4JZIA 3RXBA 3L3TA 1RRKA 1B7XB 4K69A 3S7KB 1GJ8B 5FPYA 4CRGA 1HAVB 5FCKA 1TBZH 3RC6A 3A7YA 1UK2A 3ITIA 1K1NA 3SU3A 1NC6A 1ESAA 1THPB 2CGAA 4NFEA 4XFQA 1NFYA 1SVPA 1QA0A 6GCHF 4BAMB 2BXTH 3RXKA 1UVTH 1P05A 4R8TB 2OC7A 5A0BA 1QR3E 1OWKA 4CRBA 5LPFA 4ABFA 1GBEA 3SUDA 3TK5A 1UJ1A 1WSSH 3A7VA 3T27A 4AG1A 1P2IA 3O8RA 1V2LT 3MH4A 1GVZA 5FPSA 1SGFG 2ALVA 1SQTA 1BT7A 2OC1A 1LTOA 2ZF0H 2ZQ2A 4DIIH 2ZC9H 5L2YH 1HAXB 5DP6A 2AH4X 3BTGE 2ZHQH 1S6FA 2B0FA 2HLCA 1D4PB 1D6RA 2CV3A 4AORA 3T5FH 3Q77A 2FOFA 2PTNA 4FUJA 1GI4A 1AWFH 2V3OH 1CGHA 2Z94A 1MMJN 3TGJE 1O30A 3RXSA 3MU0A 2BXUH 1RD3B 2TGTA 1JIMA 4Y7AA 2GV7A 2BZAA 4MNVA 4KKDA 2QY0B 4YZUA 3V12A 1Z71A 3LC5A 1W7XH 1O5EH 1TX6A 5EPNA 4X8TH 4Z6AH 3Q3KA 3GCNA 1JMOH 1O2RA 2PKAA 4JZFH 1Z1JA 1W3CA 3SU1A 4LXBH 3UQVA 2V6NA 4AGKA 2VH6A 2BDCA 4NIYA 1O3LA 2P59A 4X1SU 5FCRA 3R3GB 1ARCA 2BDIA 4HFPB 1SQAA 5EGMA 1LVYA 1NPMA 1Y5UT 1O2PA 1C1VH 2C8ZB 1C5TA 3A84A 3M7QA 3ZZ8A 3MU1A 5L6NH 4NCYA 2P93A 1JOUB 1TA6A 2B7DH 4FXGH 4I8GA 1IQIA 2OBOA 2HNTF 2H5CA 1MTSA 3MI4A 1C1NA 2J94A 3VGCC 1AQ7A 1L0ZA 2AGEX 1TNHA 1P2OA 1WU1A 2H9HA 1EZXC 1TGCA 1S6HA 2XXLA 2NWNA 1ARBA 2ZGJA 4U32A 1GBMA 1OOKB 5DP7A 2CF8H 3HKJB 1WQVH 1LO6A 3ATMA 3GDVA 3ZZAA 2A2QH 4MPVA 2Q6GA 1ELCA 3TH4H 3QGNB 3C27B 1CGIE 2Z7FE 3A88A 4IN1A 5E2OA 3NKKA 1GHBF 1ZHRA 2BLVA 1Z1IA 2BQWB 3TNSA 2F9UA 3TK9A 1CHOF 1GBFA 4FUFA 4ABGA 1DM4B 1EATA 1E38B 1TRNA 4UFFH 1QJ7B 3MTYA 1SGEE 3M7TA 1TNGA 1C5ZB 2ZTYA 1AFQB 4OS6A 4WXIA 3U1JB 1N1LA 2GTBA 1MU8B 1BTPA 1DITH 4AN7A 1HGTH 1HAIH 1GJBB 1K1JA 2GT7A 1T31A 1V2ST 2CHAC 1VJ9U 1S84A 2A5KA 4Y0YE 1C1PA 1O3DA 1XXDA 1PJPA 1W0ZU 1CA0C 1FY8E 1BBRE 1NTPA 5FHTA 5EQRA 2W7SA 2GT8A 1IQKA 1KXBA 3LJJA 3LJOA 2FDAA 4RKJB 1GBDA 1N6XA 3F9FA 1OWIA 1SGTA 4SGAE 1KIGH 2EC9H 2PGBB 2F9BH 3PWCA 4YLQH 2A7JA 4HZHA 2KAIB 5JBTA 1ZRBA 2OTVA 4U30A 2C93B 1TIOA 1C5UA 3LPRA 1O2LA 1YCPH 1GGDB 2VB0A 2Y7XA 3GISB 4XSKU 2R9PA 2H6MA 4ABJA 2FPZA 3BG4B 1DS2E 2BLWA 1XKAC 1DFPA 8ESTE 1C2FA 5DO4H 1TNKA 1ZYOA 2TIOA 2UWPA 4ZHLU 3HK3B 1LPGB 1K1OA 2VGCC 3TVJB 2AMPA 5IDKA 3M61U 1WQSA 3D49H 1ACBE 2G81E 4WMDA 2ZEBA 1AHTH 1KTTB 3SNBA 3KGPA 2GDEH 1SHHB 1J15A 1C1TA 1XUJA 1LHEH 1O2KA 2FO9A 2Q6DA 1A0HB 4INHA 1A5HA 1TMUH 1WTGH 4E06H 3LKWA 4UFEH 4ABIA 1ZGVA 1D3DB 3M7UA 1Z6JH 2F9PA 4FUIA 1UCYE 2QV1A 1T4UH 2BDBA 2ZO3H 1GHYH 2HNTE 1AY6H 3P8NA 3K6YA 3RDZA 2OC8A 1Z8GA 2SGFE 2Y7ZA 1ELEE 1GL1A 4RN6A 1DWBH 2I6SA 4ZXXH 4ZMAH 4J2YB 4JYVH 1OS8A 1CBWB 1MKXH 3SNCA 2CJIA 1GJ5H 3U98H 3GCOA 2J9NA 4U2WA 5C2ZA 1UTNA 1ZTJA 2Y80A 3D23A 1C2LA 3LIWA 5CHAB 3RXFA 2JKHA 1BDAA 1SFIA 3LGVA 1A3EH 1LKAA 3EA8A 4MG3A 2QXGA 5DP4A 1LDTT 2FTLE 5DPAA 4BTTB 4I8KA 4X6PA 2VIWA 1V2TT 1XKBC 1BRAA 1QBNA 3TK6A 5JPMH 1SOTA 1SLXB 2V0BA 3B8JA 1O5AB 2AMDA 1G3CA 2G4TA 3T28A 1C5XB 1DUEA 3MH5A 4D7FA 3Q00A 3ZVDA 2BZ6H 3K9XB 1CVWH 1ZTKA 2Q1JA 2ZU3A 5C1UA 2Z3DA 1WTHD 1SGRE 1GBLA 5GCHF 3ESTA 1W8BH 1O36A 2A31A 1FDPA 2AIPA 4Y0ZE 3UWJH 1MTNC 4WH6A 2BQ6B 4FUEA 4A7IB 1VITH 2BY8X 1GHWH 1OSSA 3SO3A 2PTCE 4YT7H 2G8TA 4JYUH 3A8BA 1TA2A 1NESE 1F0UA 2LPRA 3T2NA 2VVUA 2B5TB 3KQCA 2BM2A 4KTCA 3BTTE 1MCTA 3KQBA 2ZU4A 2OCVB 5EXMA 5A09A 1CT2E 4Y8XA 3UNSA 1B0FA 3LGTA 3PMBB 3SN8A 5C67A 2VVVA 1TLDA 2A1DB 1O38A 4WWYA 1UHBB 1N8OC 2FESH 1RIWC 3SHCH 1GJ6A 1IAUA 1KXFA 2ILNA 3MHWU 4E7NA 2GP9B 1BBRK 2B9LA 1H8DH 1GI1A 3RXEA 1CGJE 1CT0E 1AD8H 1VGCC 4H42U 1OP0A 4AYVB 1NFXA 2F9NA 2WPIS 3SV2H 2ZHFH 1AKSB 4UONA 2BLQA 3FVFB 3IWMA 1V2NT 4O03A 1GBBA 4ISIH 3URCA 4RKOB 1C1UH 1EAUA 3MYWA 4CRFA 1BMAA 1CU1A 5FX6A 2FI3E 3E3TA 4SGBE 3CENA 1NY22 3RC5A 3E0PB 3ZVAA 1EZUC 1Y5BT 1NRQH 4DJZB 3H7TA 2ZGHA 1O5GH 3RLYH 4B73A 3SUFA 1AFEH 3O8DA 1QL7A 1VCQA 1Y5AT 4K8YA 2P3FH 2RA0A 1GMCF 1DDJA 1FUJA 3BTWE 4QT8C 1P06A 3M36A 2ZCLP 4Y7BA 1GI9B 4WH8A 3A89A 1O2IA 4F4OC 3UR6A 5F8ZA 1D6WA 3RXIA 1ZPBA 2G51A 1O2HA 5E0JA 4CHAC 1O32A 1Y3WA 4VGCC 1O3FA 4DURA 3P92A 4ABHA 1ABJH 4GLYA 1HPGA 2ZFTA 2OC0A 2VWMA 1AE8H 1UCYK 1HAYB 2FOMB 1P12E 1PYTD 1MTUA 1AVWA 3QZQA 5FPTA 2XTTB 4ISNA 1C5YB 1Z7KA 1SLVB 3M3TA 4WJG2 1ID5H 1O35A 1BCUH 1P2NA 2HGTH 1F0SA 1FPHH 2BD9A 1WBGB 2R0LA 4ZHAA 4B74A 5K7RA 1DY8A 4I7YH 4JMYA 3NUMA 5GXPA 1YGCH 1PFXC 1V2PT 1F5LA 1TOMH 3VB3A 1A46H 5GPIB 2FS9A 4LK4A 3SUEA 1IQNA 1C9PA 1RGQA 1P57B 2STAE 4B2AA 2H1UA 1PPFE 1J14A 2JH6D 1VITF 1NZQH 4X1NU 3UTUH 1VR1H 1K1IA 1CSOE 2AGIX 1P09A 1T32A 4IGDA 3QTOH 1BITA 2GCHG 3MWIU 1H9HE 4NA9H 4O97A 3ELAH 1HLTH 1C1SA 1Q31A 1ZLRA 2PSXA 2SGPE 2WV5A 5TJXA 1QB6A 1J9CH 4TYDA 4E05H 2HALA 1SGDE 1FY4A 3QUMP 3RXGA 1NRSH 1YBWA 2QGRA 3RLWH 5EW2H 2WYJA 1TAWA 2FLRH 5LH8A 1NRNH 4Q80A 1AGJA 1GJ9B 1O3MA 2XC5A 3FP7E 1PPGE 2VVCA 1BMLA 3A7XA 3NK8A 5A8YA 3ODFA 1TB6H 2OXSA 1C5MD 3SZNA 3E16B 4BTUB 1S83A 1DICA 1MQ6A 1P03A 1W14U 2W7UA 4FUGA 4WY3A 2A5IA 1RTKA 5I25A 4X2WA 1F2SE 2D26C 1LHDH 2ZHDA 2C8YB 3SQHE 4Q2KA 3SJ8A 5H4IB 1EXFA 2ZTXA 3R0FA 1BTUA 1QL8A 3P70B 3M3VA 4IN2A 2P8OC 2Y5GA 1GVKB 1HYLA 3AW1A 4YESB 4UFDH 2BX3A 3U8OH 1UTLM 1VZQH 3GY2A 4GVUA 7ESTE 2Z3CA 2A4QA 1P8VC 1O5BB 1QB9A 1YPMH 1XUHA 1IQEA 2XW9A 3AVZA 1O2SA 3GDSA 8GCHG 3F68H 3V7TA 2D1JA 4TY6A 3LH1A 1SGYE 1O3KA 1IHTH 2ZDAH 5A0CA 4Y8ZA 1QHRB 4MDSA 1CHGA 1W2KH 5DK1A 2YNBA 1C2MA 1DLKB 1ZMJA 2ODYB 3ENSB 2VWNA 1S0RA 2YOLA 1JXPA 1FZZA 1K1PA 3SUGA 4FVDA 5CMXH 3F9EA 3HATH 2YNAA 4KTSA 3SJIA 1FAKH 1PPEE 1ZHMA 1PPBH 2HVXA 1TBQH 3P95A 5EW1H 2BOHB 4Y76A 1XXFA 1A0LA 1W10U 1TABE 2XC0A 1DVAH 5DP5A 3TH3H 1EPTC 4KELA 2J95A 3GCHB 2Z9LA 2PFEA 4YM9A 3RXUA 1QJ1B 1MBMA 4YOGA 2LNCA 4AGJA 4MNYA 3V13A 1GI2A 3M5NA 4UEHH 2PSYA 1NRRH 1MTWA 1Z8RA 1V2WT 4B1TA 4OGYA 3EDXB 6GCHG 3UNQA 1F5KU 3VFEA 3S9AA 1L1GA 1SLWB 1AZZA 2M5TA 2O8LA 1YM0A 2ZU5A 3O8CA 1ZMLA 3SQEE 3ZZ6A 3MU8A 1UTMA 2JH0D 4FUHA 4X0WU 3MO6A 1G2MA 1O2XA 1V2UT 1DE7H 1A61H 1W11U 3EGKH 2VINA 5GIBA 3BEUA 1FLEE 1TMTH 4MNWA 3UIRA 1EB2A 2PLXA 4GSOA 5ESBA 2ANWA 7KMEH 2A7CA 4X1PU 4TY7A 3SNAA 1PQ5A 1RJXB 3DA9B 2RG3A 4JK5A 1CA8B 3WY8A 4Y11E 1OX1A 1FY1A 2AMQA 5DP8A 2ZHEH 3DHKH 2QXHA 1GWAA 3UFAA 4AYYB 1C2IA 1TPOA 1P9SA 2HNTC 1V2RT 1KDQB 4X8UH 2FYQA 2QAAA 4YOIA 1ELGA 1YKTA 3UOUA 1ZJKA 3GDUA 4FU7A 2DE8A 4FVBA 1O33A 1O2VA 2BMGB 2P3TB 1DSTA 3BTME 1HAPH 2VGCB 1ZGIA 6CHAC 1ZTLA 4NZLA 1QQ4A 1ETRH 5A8XA 4ZXYH 4K1EA 2AEIH 1G36A 1TPPA 1YPGH 3E8LA 1MZAA 2J38A 2OUAA 1O39A 3CS0A 1WUNH 3MOCA 1BRBE 2FM2A 1ZPZA 1M9UA 1HCGA 1K21H 1O2MA 2PKSC 3BG8A 3LDXH 2A4GA 3AASA 1MKXK 2VU8E 3E1XB 3GYMA 3D65E 3ZVCA 2ZDNA 4BNRA 1AB9C 1O2UA 1O37A 4NG9H 1AVXA 1HIAB 1GG6C 2QIQA 3TJNA 4K1SA 1ELTA 1QJ6B 1AE5A 2OP9A 1ZPCA 2XWAA 2A4RA 1E36B 2Z9JA 3ZZ5A 1GPZA 2BD2A 1X7AC 2F9OA 4OS1A 3SI3H 3EAJA 2WUBA 1BTZA 4IS5A 4CH8B 4UD9H 2UWLA 1JWTA 2IN2A 3MU5A 4H4FA 3MMGA 2VH0A 1SPJA 3FP6E 5BPEA 2QA9E 3TJOA 4Y6DA 1W13U 1GHBG 2HPPH 3PLBA 4ZUHA 1OWJA 3TGIE 4K2YA 1CHOG 1S85A 4ZKSU 3TJVA 5T6DA 2GKVE 1NFUA 3SNEA 2ZTZA 4I33A 1DY9A 3AAVA 1JRSA 1C5RA 1F0RA 4ABDA 3A7WA 1NS3A 2PHBA 1G3DA 2ASUB 4BOHA 1FQ3A 1PPCE 4MVNA 3OY5U 4DVAU 3M5LA 3SI4H 1C1WH 1C5VA 2GZ9A 3KN2A 3HK6B 3SJ9A 3RXQA 1DWCH 1YCPM 2GVFA 3NPSA 1O3CA 4E7RG 1Y8TA 1MAXA 2PR3A 4Y79A 5EQSA 2XWBI 3GY7A 1OKXA 2ODQA 1BA8B 4LZ1H 2BYAX 3BTHE 1L4DA 1OWDA 2VWOA 2ANYA 2UUYA 2VJ1A 3S9CA 1C5QA 5DKMA 1INCA 3V3MA 2GZ7A 2BD4A 1O2NA 1JRTA 5DGJA 1XMNB 3SV8A 1GBAA 4MNXA 2H9EH 1T8NA 2R3YA 1GI5A 2EI6A 2OQUA 3LGUA 5C5NA 2SGQE 3T62A 4DW2U 1XUIA 2AERH 2QC2A 2J2UA 2WPMS 2ZDKA 1AI8H 1OP2A 2FOEA 1AUTC 3PYHA 3LGYA 1OYTH 3SU5A 1BTWA 2RA3A 5JB9S 1ELVA 3TJUA 1E0FD 2ZPSA 1UVUH 3MH6A 3MH7A 1N8OB 3PO1C 2A4OA 4D76A 4ESTE 2ODPA 3EYDA 2ESTE 2UUFB 4NGAH 1PPHE 1LHCH 3O8BA 1DXPA 1XUKA 4UE7H 1KTSB 3MU4A 1XX9A 2Q6FA 3E90B 3MO9A 3NCLA 3RU4D 3ZZ3A 1ELDE 3P17H 5EU8A 2C8XB 2F83A 5E0GA 2BHGA 2Z9KA 2ZDLA 1TGNA 3TGKE 2J92A 3ATKA 5G4BA 2W26A 2WPKS 5PTPA 1HJAB 4X2YA 3ZV9A 2PKAB 1S81A 2Y6TA 1EPTA 2K1QA 2F91A 3UREA 1V2OT 1WYKA 2NU1E 1MKWH 2FX4A 1SGFA 5JBCS 2W3IA 3A8AA 2Y5FA 1FI8A 1V6DA 4VGCB 2VIOA 4MPXA 4D7GA 3JZ2B 1DLEA 2V35A 1FNIA 4WXVA 5K0HA 2WPLS 2O8TA 3OSYA 5AHGH 5AF9H 1C2EA 1GHZA 1ABIH 1TPSA 2CXVA 1OXGA 5EXLA 1IQMA 2ZFSA 1K1MA 4H6SB 1G30B 1QURH 1TE0A 3EQ0H 1V2KT 1LHFH 3SU0A 1BTXA 3VPKA 1TNJA 1BJUA 3VXFH 4Y8YA 1LPKB 1YC0A 3GCTF 3RUOA 3SW2B 2ZA5A 1YPEH 2XBYA 1PPZA 1O3EA 1W0YH 5GCHG 2FOHA 1OYQA 4WMFA 2Z3EA 3BEIB 3ATWA 3I29A 5C5OA 2EEKA 1FXYA 2PUXB 4IC6A 4O3UA 2FZZA 1ANBA 2VIDA 4CRCA 1ESTA 1SQOA 3U8RH 3P6ZB 4NA8A 2FODA 3PROA 1AFQC 4DIHH 1MUEB 4DOQA 1O3BA 1BOQA 3EE0B 3FANA 4GPGA 2AIQA 2FWWA 1TPAE 1G32B 1KXEA 1ZSKA 1VCWA 4ABEA 3RXJA 2A5AA 1ETSH 2WPHS 4CBNA 2H9TH 1LVOA 4X1RU 1EB1H 2BTCE 2JH5D 4K3JA 2RDLA 4YLUA 9LPRA 2PV9B 2Z9IA 3G01A 3QN7A 1HUTH 1ANEA 1BMNH 2WUCA 4K8BA 1V3XA 3KIDU 1EKBB 4B75A 1GCTB 1LCYA 2ZGCA 4INKA 4TWWA 1HAHH 8LPRA 2ZQ1A 1GGDC 1AMHA 2AFQB 1GJ4H 4CRAA 3QWCH 2W5EA 2ZU1A 1OWEA 3TLOA 3VB4A 1IQGA 4B71A 1D3PB 2ZNKH 1WV7H 3A83A 5A2MH 2BDHA 2P8OB 2HPQH 1ELFA 1ANCA 1GI3A 1CQQA 1GHAF 4K5ZA 3UWIA 2GCTC 1RXPA 5C1YA 1C4V2 3Q76A 1O5FH 3PMAB 2BDGA 3RXPA 3LT3A 1CE5A 1V2JT 1HAOH 5L2ZH 4GCHG 3A7ZA 1GMCG 4GCHF 2BD7A 1A4WH 1LPZB 3ATLA 5DP3A 4AX9H 1S5SA 1BRUP 3QO6A 5GWZA 3GOVB 3SGQE 1HXEH 1GMDF 1EP5A 1O2OA 2FX6A 1DOJA 4OS5A 1A0JA 1F7ZA 2OD3B 3K2UA 2GGVB 1C5NH 1HRTH 1FIWA 2B8OH 5EXNA 1KYNA 2GMTC 2G4UA 1FAXA 3ZYEA 1CBWC 3PMHB 2H2ZA 3UR9A 2XNIA 2FOBA 2G52A 3SV9A 1ZMNA 1HNEE 1GBKA 1HAVA 3RXOA 2AYWA 4XDEA 1D3TB 1T8LA 2ZFPH 1TX8A 1GJDB 3STJA 3ZVFA 4CREA 3DFLA 3MNCA 2ZHWH 4O3TA 4JZ1A 1EJNA 3ZYDA 1TGSZ 1VITG 2UUKB 4DCDA 4NWKA 3TPIZ 1MU6B 2C90B 3KQDA 2RCEA 1SGPE 1HAGE 1DWEH 1YLCA 2ZWLH 1GBTA 2IJOB 3K65B 1ZOMA 1A1RA 1CO7E 2HWLB 5JBBS 2PUQH 1EOJA 4OS7A 4ZH8A 5C1XA 3PB1E 1K22H 1SFQB 2FIRH 2GX4A 1XVOA 2ZPRA 4K1TA 1BQYA 1O2QA 3SBKA 1ZSLA 1UTQA 3PLPA 1F5RA 3C1KA 3QLPH 1C2HA 2P3UB 3CS7A 3DUXH 1C1OA 3RXVA 2A45B 1J17T 3LH3A 4BANB 1O5CB 2UUJB 5FXLA 2F9VA 4B76A 1IOEA 1CT4E 1O0DH 1ZJDA 5JDUB 2FEQH 3RMNH 1WAYB 2BY5X 4JZEH 1KXDA 1T7CA 3L6PA 4CBOA 3SORA 1E35B 2VIPA 1SB1H 1UVOA 1P2JA 1TYNA 1L2EA 3STIA 3VB7A 4KP0A 3U69H 1QRZA 3SU4A 3VB5A 1DANH 2XYAA 3RM2H 2WV4A 3S69A 2BD3A 4AFQA 4WVPE 5LPRA 1MH0A 4AOQA 2NU2E 1KSNA 5BRRE 1ZHPA 4I8JA 1GDQA 2QXIA 8KME2 3U8TH 4A6LA 2NU4E 3SOSA 3BEFB 6CHAB 3TIUA 1UO6A 2FOGA 1TOCB 2BD8A 4AFSA 1O2TA 1HAZB 5EQQA 3V0XA 4DY7B 2GD4B 1ELBA 4Q7YA 4AFZA 3FZDA 5SGAE 1YYY1 1AU8A 5C3NA 1YF4A 5AFYH 1C2GA 2ZDVH 4BAKB 2R2MB 3GICB 2PKSB 1YLDA 3ZZBA 4Y71A 4IW4E 3U9AH 2O8UA 1K2I1 3ZZ4A 2TGDA 1E34B 3VGCB 1AB9B 3ZVBA 1P2QA 3PTNA 1MTVA 1C5LH 1TMBH 5EG4A 3AAUA 1C1RA 3GY3A 2BY7X 3RMMH 4IBLH 1UVPA 1BTHH 1UTKA 3F9GA 1YPLH 5A8ZA 2XCFA 2WYGA 2GDDA 1XM1A 4YO9A 4BTIB 4WF8A 1DSUA 4Q7ZA 5EODA 5A0AE 1UCYH 2BDYA 3FP8E 4XOJA 2DUCA 1GI7B 3S0NA 1BB0B 3JZ1B 1ZR0A 5EPYA 4MPUA 2J34A 4FUCA 3H5CB 1P02A 4FU9A 5E0HA 5F03A 3S7HB 1DUAA 1O2JA 2DE9A 3KL6A 2QF3A 4NSVA 7LPRA 1FN6A 1QCPA 3RXDA 2P16A 2FS8A 1O34A 4MQAA 2PGQB 1H8IH 5HMAA 2TPIZ 1HJ8A 3KEEA 1D9IA 1O2GH 2H5DA 1KLIH 4A1VA 3TH2H 3VEQB 1MAYA 3LGIA 1EJAA 2CHAB 1C5SA 4BAOB 5T3HA 3MFJA 1GMHG 2ZGBH 1GMHF 2I6QA 7GCHG 7GCHF 1CA0B 4FUBA 2KAIA 4AG2A 1Y3YA 1YCPK 1MCVA 1P9UA 2FXRA 1O31A 1QTFA 2QXJA 1TRMA 3RXAA 1XVMA 4M7GA 3BIVH 3OU0A 1G3EA 1LMWB 2QF0A 3KHVA 3ZZCA 1T8OA 1GCDA 2GZ8A 1NO9H 1IQHA 2FOAA 3RMOH 2TBSA 1EOLA 2V3HH 1BRCE 1FONA 1LKBA 4MLFB 2ZCHP 4CRDA 3UQOA 1ZRKA 3PLKA 3T26A 3PO1B 1GI6A 1VJAU 1Z8IB 3BTFE 4I8HA 1G37A 1HJ9A 1EAXA 2BB4A 4ZKRU 1KXAA 1EZQA 1LQEA 1SL3A 4X6MA 2SFAA 4YOJA 1P04A 3Q3XA 4CR5A 1AUJA 3LGWA 1O2ZA 2XC4A 5L30H 4HI3A 1AZ8A 2ZECA 1O2YA 1Y3XA 4TPIZ 2PW8H 2AGGX 3KF2A 3SJOA 1TONA 4DG4A 3E0NB 1TNLA 4ISOA 1NT1A 1AVGH 3OY6U 2FI4E 3SGAE 1FY3A 1Z6EA 4GAWA 3UPEA 1MKWK 3PTBA 4I31A 3GY8A 3CP7A 1O2WA 1WOFA 5C20A 1SGCA 4H6TA 1P0SH 1TALA 2BVXH 3BTEE 2R0KA 3QK1A 1FPCH 1IQFA 1QBOA 1P3CA 1SI5H 1DXWA 5F8XA 3GYLB 2P94A 2A32A 2JETC 4BAHB 1C5OH 1ZZZA 4PROA 3W94A 1IHSH 2QN5T 3GCHC 3KNXA 3RXTA 5LGOA 4THNH 1KY9A 2BX4A 1MQ5A 2Z9GA 1WCZA 1L1NA 2C8WB 3RXLA 4FU8A 4YT6H 2XBVA 2SGEE 3L33A 1NU7B 3I78A 4O9VA 1RTLA 1SC8U 5FAHA 4FUDA 4UDWH 3SU6A 1J16A 4GHTA 5F8TA 3BSQA 1SBWA 3B23B 5JB8S 1ETTH 1SGQE 4IMQA 1KLJH 1SG8B 1ANDA 1XUFA 3BTKE 1C2KA 2TGPZ 2WINI 4F49A 2AS9A 4D9QA 1MTNB 1H9LB 2OQ5A 1NRPH 3LONA 1MBQA 2NU0E 1H9IE 2SGDE 3ATIA 2ZDMA 3EA9A 2ZKSA 1O3NA 2BY6X 1JIRA 3HPTB 1UMAH 3A80A 1YPKH 2XBXA 3FFGA 3P8GA 1QQUA 1H4WA 4X2XA 1F92A 1UHBA 4LOYH 3N7OA 1A7SA 3RU4E 1Z8JB 1NU9A 1PYTC 4ASHA 2ZCKP 1SLUB 5HGGA 3A82A 3BN9A 4JCNA 4NIWA 3SV6A 1OWHA 3RMLH 1QRWA 2R3UA 1P2MA 1RIWB 2WPJS 1AO5A 1S0QA 1AKSA 1DX5M 2ZG0H 6ESTA 3A86A 1GBIA 2ANKH 1FV9A 1DT2A 1OP8A 1VGCB 1NFWA 4JK6A 3LU9B 2THFB 2BOKA 3URDA 3OTJE 1HV7A 4NFFA 4IMZA 1MZDA 4IC5A 4OS4A 2ALPA 4UFGH 2XBWA 3A81A 1AWHB 4MTBA 4ABBA 1UVSH 1Y59T 4A1XA 4AZ2B 2EI8A 4ISHH 1KLTA 4GHQA 1NN6A 1BHXB 2GCTB 2A0QB 1THRH 4ABAA 1O3JA 1P2KA 1A2CH 3P8FA 3OX7U 1PQAA 3M5MA 1A3BH 3OYPA 1C1MA 1O3GA 1V2MT 1HDTH 3A85A 2ZFFH 1TWXB 1GHVH 1TGBA 2ZP0H 2VWLA 4X8SH 1A5GH 1LVMA 4CHAB 1QB1A 3NZIA 3BF6H 2FTMA 1GL0E 3LOXA 1O3AA 2GMTB 2W3KA 2FYRA 1C5WB 2G00A 5AVDA 2O8MA 5FX5A 3DD2H 2VNTA 3ZZ7A 2ZFRH 1TGTA 4TWYA 1P11E 3GY5A 1GBHA 3RM0H 4X6OA 2FMJA 1TFXA 4OGXA 3SHAH 1THSH 5I46H 3TNTA 1L1JA 1EJMA 2ZZUH 3B9FH 3GCTG 4KGAA 4XBCA 1J8AA 5ETXA 2BVRH 1F0TA 3UNRA 3K6ZA 4DT7B 5T6FA 4OS2A 1C2JA 1TRYA 2EI7A 1QY6A 4Q7XA 3ZVGA 4B2CA 1IQLA 2EA3A 2PWXA 4XBDA 3ZVEA 2TRMA 1OPHB 2STBE 1YPHC 2FLBH 3IG6B 1UTOA 4AFUA 5B6OA 1C1QA 1V2QT 3KCGH 3RXMA 5JBAS 1E37B 4A5TS 1FMGA 1O3PB 1NM6A 2ZGXH 3BTQE 4B2BA 1EQ9A 5HM2A 3ZZDA 1QNJA 4ISLA 3S9BA 2Y82A 3A87A 2QCYA 3PMJA 2ZIQH 3QGJA 5HM9A 1O5DH 4U01A 3RU4T 2VIQA 2SGAA 1C5PA 2TGAA 4YTAA 2R2WU 3VXEH 3ODDA 1U6QA 1SGIB 2OINA 4NIXA 1G9IE 3VB6A 2UWOA 5FBIA 3MNBA 1BIOA 1TNIA 4X8VH 3UUZA 1FJSA 1YPJH 1VCPA 3QX5H 1K1LA 2ZFQH 3BG4C 1GJ7B 1BZXE 3TITA 1ELAA 2BQ7B 4GUXA 1B0EA 1FY5A 1GVLA 3AW0A 4LZ4B 3SGBE 4NZQA 2BDAA 1V2VT 1AN1E 1JBUH 4TPYA 1GHAG 3Q3YA 3HKIB 1C9TA 1TQ7B 3BTDE 3H7OA 3TU7H 5FBEA 3M3SA 4X1QU 1DWDH 4NIVA 4ZHMU 3U1IB 2VIVA 2ANMH 1SR5C 2FP7B 1T8MA 1EUFA 2BLOA 3KQEA 1B5GH 1XUGA 2FOCA 3QDZB 1GHXH 1GMDG 1Q2WA 2G55A 2BY9X 2IOTA 2A7HA 5T6GA 1C4Y2 2NU3E 4Y10E 1RFNA 4BXSA 1QL9A 3P8OA 1ESBA 1HBTH 2SNWA 3EA7A 1HJAC 4R0IA 4XBBA 2SNVA 1UTJA
chains in the Genus database with same CATH superfamily
5EOKA 2QYIA 4Z0KA 4FETA 1FIZA 1GDUA 4WMEA 3ZV8A 1O3OA 5J4SA 1C2DA 3RXRA 1BMMH 1C4U2 2D2DA 2LELA 5CHAC 3FZZA 5HXFA 2ZPQA 1EPTB 1A5IA 2BD5A 3M35A 5ABWA 1QBVH 4HTCH 1EAWA 5DP9A 2Y81A 3E91A 4I8LA 2G5NA 1PQ7A 1FN8A 4BAQB 1N6YA 3A7TA 1YP9A 3CNRA 1UK3A 4XE4A 1K28D 1BHXF 3MNXA 1EZSC 3T25A 1EP6A 1TQ0B 3F9HA 4JZDH 5GJ4B 2M2AA 1LHGH 1TX7A 2IPHA 2J4IA 4ZCNA 1K9OE 1UK4A 1L4ZA 5TCAA 2FI5E 3UY9A 3PM3A 4DGJA 1SMFE 3PV4A 2C3SA 1EX3A 6LPRA 2ULLA 3SU2A 3T29A 4ZKOU 3F1SB 2P95A 3QZRA 2ZI2H 4NSYA 1D3QB 1DPOA 1MD7A 1ORFA 2F3CE 5DG6A 1QIXB 3BIUH 3MNSA 1MD8A 5IYTA 4RSPA 2GCHF 2XCNA 1GJCB 4J1YA 2ZU2A 5E8EH 1ZSJA 1GBCA 4X6NA 1GI0A 1P01A 3FAOA 5CE1A 1PQ8A 3ZZ9A 3I77A 4P02A 3SJKA 1SSXA 1YPHE 1KDQA 3A8CA 2OLGA 5DJ7A 1P3EA 1H1BA 5ESTE 1EASA 3D62A 1QFKH 1QRXA 3UOPA 1SGNE 1NROH 1IQJA 4NWLA 5E2PA 3RXHA 3LC3A 3NXPA 4KTUA 3E6PH 2Y5HA 1GCTC 4CR9A 3OAAD 1LVBA 4MPWA 3F6UH 2XRCA 5LPEA 3DFJA 4ZROA 2HOBA 1T4VH 1BBRH 3M5OA 1GDNA 2GV6A 2Z6BD 3HGPA 3RP2A 2QF5A 2BVSH 3HGNA 4NA7A 4AB9A 2HRVA 1O3HA 2OBQA 5F6MA 1EAIA 4JYTA 1G2LA 1BJVA 9ESTA 1Q3XA 4HGCA 3RC4A 1P10A 1QA7A 1KXCA 4AB8A 2A2XH 4ZKNU 3A8DA 3UB0A 3IITA 1AIXH 2O9QA 1S82A 2G5VA 1HIAA 1QGFA 1BTYA 4A1TA 4A92A 1GI8B 3GY6A 8GCHF 3PWBA 3AK5A 1O3IA 4ZAEA 1G3BA 1RS0A 3SNDA 1GBJA 2CMYA 2O8WA 5HYOA 1GG6B 4I32A 1LQDB 5TCCA 1W12U 5GDSH 2CN0H 4K60A 1UTPA 1TBRH 4BXWA 3MO3A 3PV5A 3QTVH 3NWUA 3SV7A 1RTFB 2D8WA 3GY4A 4CH2B 4D9RA 5JYIA 5AFZH 1SHYA 1HFDA 1Y3UA 3BV9B 4B6EA 2CF9H 4D8NA 3W95A 1HXFH 2JETB 3RXCA 1HB0B 3DT0H 2C4FH 4INLA 3M37A 1BUIA 1GJAB 4X2VA 1W7GH 1Y3VA 3MQKC 1SOZA 5J4QA 4JZIA 3RXBA 3L3TA 1RRKA 2J97A 1B7XB 4K69A 3S7KB 1GJ8B 5FPYA 4CRGA 1HAVB 5FCKA 1TBZH 3RC6A 1H8HD 3A7YA 1UK2A 3ITIA 1K1NA 3SU3A 1NC6A 1ESAA 1THPB 2CGAA 2IJD1 4NFEA 4XFQA 1NFYA 1MABB 1SVPA 1QA0A 6GCHF 4BAMB 2BXTH 3N7EA 3RXKA 2J5UA 1UVTH 1P05A 4R8TB 2OC7A 5A0BA 1QR3E 2XOKD 1OWKA 4CRBA 5LPFA 4XD7D 4ABFA 1GBEA 3SUDA 3TK5A 1UJ1A 1WSSH 3A7VA 3FN8A 3T27A 4AG1A 1P2IA 3O8RA 1FX0B 1V2LT 3MH4A 1GVZA 5FPSA 1SGFG 2ALVA 1SQTA 1QZ8A 1BT7A 2OC1A 1LTOA 2ZF0H 2ZQ2A 4DIIH 2ZC9H 5L2YH 1HAXB 5DP6A 2AH4X 3BTGE 2ZHQH 1S6FA 2B0FA 2HLCA 1D4PB 1D6RA 2CV3A 4AORA 3T5FH 3Q77A 2FOFA 2PTNA 2W6JD 4FUJA 1EFRD 1GI4A 1AWFH 2V3OH 1CGHA 2Z94A 3F0PA 1MMJN 3TGJE 1O30A 3RXSA 3MU0A 2BXUH 1RD3B 2TGTA 1JIMA 4Y7AA 2GV7A 2BZAA 4MNVA 4KKDA 2QY0B 4YZUA 3V12A 1Z71A 3LC5A 1W7XH 1O5EH 1TX6A 5EPNA 5EIYA 5EJLA 1E1RD 4X8TH 4Z6AH 3Q3KA 3GCNA 1JMOH 1O2RA 2PKAA 4JZFH 1Z1JA 1W3CA 3SU1A 4LXBH 3UQVA 2V6NA 4AGKA 2VH6A 2BDCA 4NIYA 1O3LA 2P59A 4X1SU 3N99A 5FCRA 3R3GB 1ARCA 2BDIA 4HFPB 1SQAA 5EGMA 1LVYA 1NPMA 2HLDD 1Y5UT 1O2PA 1C1VH 2C8ZB 1C5TA 3A84A 3M7QA 3ZZ8A 3MU1A 5L6NH 4NCYA 2P93A 1JOUB 1TA6A 2B7DH 4FXGH 4I8GA 1IQIA 2OBOA 2HNTF 5DN6D 2H5CA 1MTSA 3MI4A 1C1NA 2J94A 3VGCC 1AQ7A 1L0ZA 2AGEX 1TNHA 1P2OA 1WU1A 2H9HA 1EZXC 1TGCA 1S6HA 2XXLA 4AC9A 2NWNA 1ARBA 2ZGJA 4U32A 1GBMA 1OOKB 5DP7A 2CF8H 3HKJB 1WQVH 2YMSC 1LO6A 3ATMA 3GDVA 4RT1A 3ZZAA 2A2QH 4MPVA 2Q6GA 1ELCA 3TH4H 3QGNB 3C27B 1CGIE 2Z7FE 3A88A 4IN1A 5E2OA 3NKKA 1GHBF 1ZHRA 2BLVA 1Z1IA 2BQWB 3TNSA 2F9UA 3TK9A 1CHOF 1GBFA 4FUFA 4ABGA 1DM4B 1EATA 5HIYA 1E38B 1TRNA 4UFFH 1QJ7B 1W0KD 3MTYA 1SGEE 3M7TA 1TNGA 1C5ZB 2ZTYA 1AFQB 4OS6A 4WXIA 3U1JB 1N1LA 2GTBA 1MU8B 1BTPA 1DITH 4AN7A 1HGTH 1HAIH 1GJBB 1K1JA 2GT7A 1T31A 1V2ST 2CHAC 1VJ9U 5KGOA 1S84A 2A5KA 4Y0YE 5T1VA 1C1PA 1O3DA 1XXDA 1PJPA 1W0ZU 1CA0C 1FY8E 1BBRE 1NTPA 5FHTA 5EQRA 2W7SA 2GT8A 1IQKA 1KXBA 3LJJA 2WPDD 3LJOA 2FDAA 4RKJB 1GBDA 1N6XA 3F9FA 1OWIA 1SGTA 4SGAE 1KIGH 2EC9H 2PGBB 2F9BH 3PWCA 4YLQH 2A7JA 4HZHA 2KAIB 5JBTA 1ZRBA 2OTVA 4U30A 2C93B 1TIOA 1C5UA 3LPRA 1O2LA 1YCPH 1GGDB 2VB0A 2Y7XA 3GISB 4XSKU 2R9PA 2H6MA 4ABJA 2FPZA 3BG4B 1DS2E 2BLWA 1XKAC 1DFPA 8ESTE 1C2FA 5DO4H 1TNKA 1ZYOA 2TIOA 2UWPA 4ZHLU 3HK3B 1LPGB 1K1OA 2VGCC 3TVJB 2AMPA 5IDKA 3M61U 1WQSA 3D49H 1ACBE 2G81E 4WMDA 2ZEBA 1AHTH 1KTTB 3SNBA 3KGPA 1H8ED 2GDEH 1SHHB 1J15A 1C1TA 1XUJA 1LHEH 1O2KA 2FO9A 2Q6DA 1A0HB 4INHA 1A5HA 1TMUH 1WTGH 4E06H 3LKWA 4UFEH 4ABIA 1ZGVA 1D3DB 3M7UA 1Z6JH 2F9PA 2WSSD 4FUIA 1UCYE 2QV1A 1T4UH 4F48B 2BDBA 2ZO3H 1GHYH 2HNTE 1AY6H 3P8NA 3K6YA 3RDZA 2OC8A 1Z8GA 2SGFE 2Y7ZA 1ELEE 1GL1A 4RN6A 1DWBH 2I6SA 5F53A 4ZXXH 4ZMAH 4J2YB 4JYVH 1OS8A 1CBWB 1MKXH 3SNCA 2CJIA 1GJ5H 3FO8D 3U98H 4DT4A 3GCOA 2J9NA 4U2WA 5C2ZA 1UTNA 1ZTJA 2Y80A 3D23A 1C2LA 3LIWA 4RT0A 5CHAB 3RXFA 2JKHA 1BDAA 1SFIA 3LGVA 3ZIAD 1A3EH 1LKAA 5C0UA 3EA8A 4MG3A 2QXGA 5DP4A 1LDTT 2FTLE 5DPAA 4BTTB 4I8KA 4X6PA 2VIWA 1V2TT 1XKBC 1BRAA 1QBNA 3TK6A 5JPMH 1SOTA 1SLXB 2V0BA 3B8JA 1O5AB 2AMDA 1G3CA 2K8IA 2G4TA 3T28A 2EY4C 1C5XB 1DUEA 3MH5A 4D7FA 3Q00A 3ZVDA 2BZ6H 3K9XB 1CVWH 1ZTKA 2Q1JA 2ZU3A 5C1UA 2Z3DA 1WTHD 1SGRE 1GBLA 5GCHF 2AHME 3ESTA 1W8BH 1O36A 2A31A 1FDPA 2AIPA 4Y0ZE 3UWJH 1MTNC 4WH6A 2BQ6B 4FUEA 4A7IB 3VG8A 1VITH 2BY8X 1GHWH 1OSSA 3SO3A 2PTCE 4YT7H 2G8TA 4JYUH 3A8BA 1TA2A 1NESE 1F0UA 2LPRA 3T2NA 2VVUA 2B5TB 3KQCA 2BM2A 4KTCA 3BTTE 1MCTA 3KQBA 2ZU4A 2OCVB 5EXMA 5A09A 1CT2E 4Y8XA 3UNSA 1B0FA 3LGTA 3PMBB 3SN8A 5C67A 2VVVA 1TLDA 2A1DB 1O38A 4WWYA 1UHBB 1N8OC 2FESH 1RIWC 3SHCH 1GJ6A 1IAUA 1KXFA 2ILNA 3MHWU 4E7NA 2GP9B 1BBRK 3KYGA 2B9LA 1H8DH 2W6ID 3H09A 1GI1A 3RXEA 1CGJE 1CT0E 1AD8H 1VGCC 4H42U 1OP0A 4AYVB 1NFXA 2F9NA 2WPIS 3SV2H 2ZHFH 1AKSB 4UONA 2BLQA 3FVFB 3IWMA 1V2NT 4O03A 1GBBA 4ISIH 3URCA 4RKOB 1C1UH 2QF4A 1EAUA 3MYWA 4CRFA 1BMAA 1CU1A 5FX6A 2FI3E 3E3TA 4SGBE 3CENA 1NY22 3RC5A 3E0PB 3ZVAA 1EZUC 1Y5BT 1NRQH 4DJZB 3H7TA 2ZGHA 1O5GH 3RLYH 3PV2A 4B73A 3SUFA 1AFEH 2JJ2D 3O8DA 1QL7A 1VCQA 1Y5AT 4K8YA 2P3FH 2RA0A 1GMCF 4OM9A 1DDJA 1FUJA 3BTWE 4QT8C 1P06A 3M36A 2ZCLP 4Y7BA 1GI9B 4WH8A 3A89A 1O2IA 5DSFA 4F4OC 3UR6A 5F8ZA 1D6WA 3RXIA 1ZPBA 2G51A 1O2HA 5E0JA 4CHAC 1O32A 1Y3WA 4VGCC 1O3FA 4DURA 3P92A 4ABHA 1ABJH 4GLYA 1HPGA 2ZFTA 2OC0A 2VWMA 1AE8H 1UCYK 1HAYB 2FOMB 1P12E 1PYTD 1MTUA 1AVWA 3QZQA 5FPTA 2XTTB 4ISNA 1C5YB 1Z7KA 1SLVB 3M3TA 4WJG2 1ID5H 1O35A 1BCUH 1P2NA 2HGTH 4HG6A 1F0SA 1FPHH 2BD9A 1WBGB 2R0LA 3GS9A 4ZHAA 4B74A 5K7RA 1DY8A 4I7YH 4F55A 4JMYA 3NUMA 1VKYA 5GXPA 1YGCH 1PFXC 1V2PT 1F5LA 1TOMH 3VB3A 1A46H 5GPIB 2FS9A 4LK4A 3SUEA 1IQNA 1C9PA 1RGQA 1P57B 2STAE 4B2AA 2H1UA 1PPFE 1J14A 2JH6D 1VITF 5KEDA 1NZQH 4X1NU 3UTUH 1VR1H 1K1IA 1CSOE 2L6OA 2V7QD 2AGIX 1P09A 1T32A 4IGDA 3QTOH 1BITA 2GCHG 3F3BA 3MWIU 1H9HE 4NA9H 4O97A 1S6LA 3ELAH 1HLTH 1C1SA 1Q31A 1ZLRA 2PSXA 2SGPE 2WV5A 1NBME 5TJXA 1QB6A 1J9CH 4TYDA 4E05H 2HALA 1SGDE 1FY4A 3QUMP 3RXGA 1NRSH 1YBWA 2QGRA 3RLWH 5EW2H 2WYJA 1TAWA 2FLRH 5LH8A 1NRNH 4Q80A 1AGJA 1GJ9B 1O3MA 2XC5A 3FP7E 3F2HA 1PPGE 2VVCA 1BMLA 3A7XA 3NK8A 5A8YA 3ODFA 1TB6H 2OXSA 1C5MD 3SZNA 3E16B 4BTUB 1S83A 1DICA 1MQ6A 1P03A 1W14U 2W7UA 4FUGA 4WY3A 2A5IA 1RTKA 5I25A 4X2WA 1F2SE 2D26C 4TT3D 1LHDH 2ZHDA 2C8YB 3SQHE 4Q2KA 3SJ8A 5H4IB 1EXFA 2ZTXA 3R0FA 1BTUA 1QL8A 3P70B 3M3VA 4IN2A 2P8OC 2Y5GA 3WW7A 1GVKB 1HYLA 1E1QD 3AW1A 4YESB 4UFDH 2BX3A 3U8OH 1UTLM 1VZQH 3GY2A 4GVUA 7ESTE 2Z3CA 2A4QA 1P8VC 1O5BB 1QB9A 1YPMH 1XUHA 5CDFE 1IQEA 2IPQX 2XW9A 3AVZA 1O2SA 3GDSA 8GCHG 3F68H 3V7TA 2D1JA 4TY6A 3LH1A 1SGYE 1O3KA 3OEED 1IHTH 2ZDAH 5A0CA 4Y8ZA 1QHRB 4MDSA 1CHGA 1W2KH 5DK1A 2YNBA 1C2MA 1DLKB 1ZMJA 2ODYB 3ENSB 2VWNA 1S0RA 2YOLA 3N7DA 1JXPA 1FZZA 1K1PA 3SUGA 4FVDA 5CMXH 3F9EA 3HATH 2YNAA 4KTSA 3SJIA 1FAKH 1PPEE 1ZHMA 1PPBH 2KX4A 2L74A 2HVXA 3SYJA 1TBQH 3P95A 5EW1H 2BOHB 4Y76A 1XXFA 1A0LA 1W10U 1TABE 2XC0A 1DVAH 5DP5A 3TH3H 1EPTC 4KELA 2J95A 3GCHB 2Z9LA 2PFEA 4YM9A 3RXUA 1QJ1B 5C17A 1MBMA 4YOGA 2LNCA 4AGJA 4MNYA 3V13A 1GI2A 3M5NA 4UEHH 2PSYA 1NRRH 1MTWA 1Z8RA 1V2WT 4B1TA 4OGYA 3EDXB 6GCHG 3UNQA 1F5KU 3VFEA 2VBCA 3S9AA 2JJ1D 1L1GA 1SLWB 1AZZA 2M5TA 2O8LA 1YM0A 2ZU5A 3O8CA 1ZMLA 3SQEE 3ZZ6A 3MU8A 1UTMA 2JH0D 4FUHA 4X0WU 3MO6A 1G2MA 1O2XA 1V2UT 1DE7H 1A61H 1W11U 3EGKH 2VINA 5GIBA 3BEUA 1FLEE 1TMTH 2GJGA 4MNWA 3UIRA 2KCYA 1EB2A 2PLXA 4GSOA 5ESBA 2ANWA 7KMEH 2A7CA 4X1PU 4TY7A 3SNAA 1PQ5A 1RJXB 3DA9B 2RG3A 4JK5A 1CA8B 3WY8A 4Y11E 1OX1A 1FY1A 2AMQA 5DP8A 2ZHEH 3DHKH 2QXHA 1GWAA 3UFAA 4AYYB 1C2IA 1TPOA 1P9SA 2HNTC 1V2RT 1KDQB 4X8UH 2FYQA 2QAAA 4YOIA 1ELGA 1YKTA 3UOUA 1ZJKA 3GDUA 4FU7A 2DE8A 4FVBA 1O33A 1O2VA 2BMGB 2P3TB 1DSTA 3BTME 1HAPH 2VGCB 1ZGIA 6CHAC 1ZTLA 4NZLA 1QQ4A 1ETRH 5A8XA 4ZXYH 4K1EA 2AEIH 1G36A 2J98A 1TPPA 1YPGH 3E8LA 1MZAA 2J38A 2OUAA 1O39A 3CS0A 4ACBA 1WUNH 3MOCA 1BRBE 2FM2A 1ZPZA 4Z1MD 1M9UA 1HCGA 1K21H 1O2MA 2PKSC 3BG8A 3LDXH 5C0TA 2A4GA 3AASA 1MKXK 2VU8E 3E1XB 3GYMA 3D65E 3ZVCA 2ZDNA 4TSFD 4BNRA 1AB9C 1O2UA 1O37A 4NG9H 1AVXA 1HIAB 1GG6C 2QIQA 3TJNA 4K1SA 1ELTA 1QJ6B 1AE5A 3WWBA 2OP9A 1ZPCA 2XWAA 2A4RA 1E36B 2Z9JA 3ZZ5A 1GPZA 2BD2A 1X7AC 2F9OA 4OS1A 3SI3H 3EAJA 2WUBA 1BTZA 4IS5A 4CH8B 4UD9H 2UWLA 1JWTA 2IN2A 3MU5A 4H4FA 3MMGA 3F2FA 2VH0A 3PRDA 1SPJA 3FP6E 5BPEA 2QA9E 3TJOA 4Y6DA 2XNDD 1W13U 1GHBG 2HPPH 3PLBA 4ZUHA 1OWJA 3TGIE 4K2YA 1CHOG 1S85A 4ZKSU 3TJVA 5T6DA 2GKVE 1NFUA 3SNEA 2ZTZA 3OTPA 4I33A 1DY9A 3AAVA 1JRSA 1C5RA 1F0RA 4ABDA 3A7WA 1NS3A 2PHBA 1G3DA 2ASUB 4BOHA 3UAIC 1FQ3A 1PPCE 4MVNA 3OY5U 4DVAU 3M5LA 3SI4H 1C1WH 1C5VA 2GZ9A 3KN2A 3HK6B 2WZQA 3SJ9A 1YWUA 3RXQA 1DWCH 1YCPM 2GVFA 3NPSA 1O3CA 4E7RG 1Y8TA 1MAXA 2PR3A 2KCOA 4Y79A 5EQSA 2XWBI 3GY7A 1OKXA 2ODQA 1BA8B 1OHHD 4LZ1H 4P00A 2BYAX 3BTHE 1L4DA 1OWDA 2VWOA 2ANYA 2UUYA 2VJ1A 3S9CA 1C5QA 5DKMA 1INCA 3V3MA 2GZ7A 2BD4A 1O2NA 1JRTA 5DGJA 1XMNB 3SV8A 1GBAA 4MNXA 2H9EH 1T8NA 2R3YA 1GI5A 2EI6A 2OQUA 3LGUA 5C5NA 2SGQE 3T62A 4DW2U 1XUIA 2AERH 2QC2A 2J2UA 2KFWA 2WPMS 2ZDKA 1AI8H 1OP2A 2FOEA 1AUTC 3PYHA 3LGYA 1OYTH 3SU5A 1BTWA 2RA3A 5JB9S 1ELVA 3TJUA 1E0FD 2ZPSA 1UVUH 3MH6A 3MH7A 1W0JD 1N8OB 3PO1C 2A4OA 4D76A 4ESTE 2ODPA 3EYDA 2QE7D 2ESTE 2UUFB 4NGAH 1PPHE 1LHCH 3O8BA 1DXPA 1XUKA 4UE7H 1KTSB 3MU4A 1XX9A 2Q6FA 3E90B 3MO9A 3NCLA 3RU4D 3ZZ3A 1ELDE 3P17H 5EU8A 2C8XB 2F83A 5E0GA 2BHGA 2Z9KA 5GNDA 2ZDLA 1TGNA 3TGKE 2J92A 3ATKA 5G4BA 2W26A 2WPKS 5PTPA 1HJAB 4X2YA 3ZV9A 2PKAB 1S81A 2Y6TA 1EPTA 2K1QA 2F91A 2KZ4A 3UREA 1V2OT 1WYKA 2NU1E 1MKWH 2FX4A 1SGFA 5JBCS 2W3IA 3A8AA 2Y5FA 1FI8A 1V6DA 4VGCB 2F43B 2VIOA 4MPXA 4D7GA 4I86A 3JZ2B 1DLEA 2V35A 1FNIA 4WXVA 5K0HA 2WPLS 2O8TA 1YY3A 3OSYA 5AHGH 5AF9H 1C2EA 1GHZA 1ABIH 1TPSA 2CXVA 1OXGA 5EXLA 1IQMA 2ZFSA 1K1MA 4H6SB 1G30B 1QURH 1TE0A 3EQ0H 1V2KT 1LHFH 3SU0A 1BTXA 3VPKA 1TNJA 1BJUA 3VXFH 4Y8YA 1LPKB 1YC0A 3GCTF 3RUOA 3SW2B 2ZA5A 1YPEH 2XBYA 1PPZA 1SQRA 1O3EA 4ACAA 1W0YH 5GCHG 2FOHA 1OYQA 4WMFA 2Z3EA 3BEIB 3ATWA 3I29A 5C5OA 2EEKA 1FXYA 2PUXB 5HKKD 4IC6A 4O3UA 2FZZA 1ANBA 2VIDA 4CRCA 1ESTA 1SQOA 3U8RH 3P6ZB 3OE7D 4NA8A 2FODA 3PROA 1AFQC 4DIHH 2KCAA 2HVYB 1MUEB 4DOQA 1O3BA 1BOQA 3EE0B 3FANA 4GPGA 2AIQA 2FWWA 1TPAE 1G32B 1KXEA 1ZSKA 1VCWA 4ABEA 4B6FA 3RXJA 2A5AA 1ETSH 2WPHS 4CBNA 4FOUC 2H9TH 1LVOA 4X1RU 1EB1H 2BTCE 2JH5D 4K3JA 2RDLA 4YLUA 9LPRA 2PV9B 2Z9IA 3G01A 3QN7A 1HUTH 3OEHD 1ANEA 1BMNH 2WUCA 4K8BA 1V3XA 3KIDU 1EKBB 4B75A 1GCTB 1LCYA 2ZGCA 4INKA 2WHXA 1HAHH 4TWWA 8LPRA 2ZQ1A 1GGDC 1AMHA 2AFQB 2YMSD 1GJ4H 4CRAA 3QWCH 2W5EA 2ZU1A 1OWEA 3TLOA 3VB4A 1IQGA 4B71A 1D3PB 2ZNKH 1WV7H 3A83A 5A2MH 2JIZD 2BDHA 2P8OB 2HPQH 1ELFA 2RFKC 1ANCA 1GI3A 1CQQA 1GHAF 4K5ZA 3UWIA 2GCTC 1RXPA 5C1YA 1C4V2 3Q76A 1O5FH 3PMAB 2BDGA 3RXPA 3LT3A 1CE5A 1V2JT 1HAOH 5L2ZH 4GCHG 3A7ZA 1GMCG 4GCHF 2BD7A 1A4WH 1LPZB 3ATLA 5DP3A 4AX9H 1S5SA 1BRUP 3QO6A 5GWZA 3GOVB 3SGQE 1HXEH 3W1EA 1GMDF 1EP5A 1O2OA 2FX6A 1DOJA 4OS5A 1A0JA 1F7ZA 2OD3B 3K2UA 2GGVB 1C5NH 1HRTH 1FIWA 2B8OH 5EXNA 1KYNA 2GMTC 2G4UA 1FAXA 3ZYEA 1CBWC 3PMHB 2H2ZA 3UR9A 2XNIA 2FOBA 2G52A 3SV9A 1ZMNA 1HNEE 1GBKA 1HAVA 3RXOA 2AYWA 4XDEA 1D3TB 1T8LA 2ZFPH 1TX8A 1GJDB 3STJA 3ZVFA 4CREA 3DFLA 3MNCA 2ZHWH 4O3TA 3DSOA 4JZ1A 1EJNA 3ZYDA 1TGSZ 1VITG 2UUKB 4DCDA 4NWKA 3TPIZ 1MU6B 2C90B 3KQDA 2RCEA 1SGPE 1HAGE 1DWEH 1YLCA 2ZWLH 3FOAA 1GBTA 2IJOB 3K65B 1ZOMA 1A1RA 1CO7E 2HWLB 5JBBS 2PUQH 1EOJA 4OS7A 4ZH8A 5C1XA 3PB1E 1K22H 1SFQB 2FIRH 2GX4A 1XVOA 2ZPRA 4K1TA 1BQYA 1O2QA 3SBKA 1ZSLA 1UTQA 3PLPA 1F5RA 3C1KA 3QLPH 1C2HA 5B6LA 2P3UB 3CS7A 3DUXH 1C1OA 3RXVA 2A45B 1J17T 3LH3A 4BANB 1O5CB 2UUJB 5FXLA 2F9VA 4B76A 1IOEA 1CT4E 1O0DH 1ZJDA 5JDUB 2FEQH 3RMNH 1WAYB 2BY5X 4JZEH 1KXDA 1T7CA 3L6PA 4CBOA 3SORA 1E35B 2VIPA 1SB1H 1UVOA 1P2JA 2WV9A 1TYNA 1L2EA 3STIA 3VB7A 4KP0A 3U69H 1QRZA 3SU4A 2CK3D 3VB5A 1DANH 2XYAA 3RM2H 2WV4A 3S69A 2BD3A 4AFQA 4WVPE 5LPRA 1MH0A 2LP6A 4AOQA 2NU2E 1KSNA 1NBMD 5BRRE 1ZHPA 4I8JA 5EJZA 1GDQA 1YLNA 2QXIA 8KME2 3U8TH 4A6LA 2NU4E 3SOSA 3BEFB 6CHAB 3TIUA 1UO6A 2FOGA 1TOCB 2BD8A 4AFSA 1O2TA 1HAZB 5EQQA 3V0XA 4DY7B 2GD4B 1ELBA 4Q7YA 4AFZA 3FZDA 5SGAE 1YYY1 1AU8A 4Q63A 5C3NA 1YF4A 5AFYH 1C2GA 2ZDVH 4BAKB 3DCLA 2R2MB 1BMFD 3GICB 2PKSB 1YLDA 3ZZBA 4Y71A 4IW4E 3U9AH 2O8UA 1K2I1 3ZZ4A 2TGDA 1E34B 3VGCB 1AB9B 3ZVBA 1P2QA 3PTNA 1MTVA 1C5LH 4RI0A 1TMBH 5EG4A 3AAUA 1C1RA 3GY3A 2BY7X 3RMMH 4IBLH 1UVPA 1BTHH 1UTKA 3F9GA 1YPLH 5A8ZA 2YMSB 2XCFA 2WYGA 2GDDA 1XM1A 4YO9A 4BTIB 4WF8A 1DSUA 4Q7ZA 3OFND 5EODA 5A0AE 1UCYH 2BDYA 3FP8E 4XOJA 2DUCA 1GI7B 3S0NA 1BB0B 3JZ1B 1ZR0A 5EPYA 4MPUA 2J34A 4FUCA 3H5CB 1P02A 4FU9A 5E0HA 5F03A 3S7HB 1DUAA 1O2JA 2DE9A 3KL6A 2QF3A 4NSVA 7LPRA 1FN6A 1QCPA 3RXDA 1SKYE 3F2GA 2P16A 2FS8A 1O34A 4MQAA 2PGQB 1H8IH 5HMAA 2TPIZ 1HJ8A 3KEEA 1D9IA 1O2GH 2H5DA 1KLIH 4A1VA 3F0OA 3TH2H 3VEQB 1MAYA 3LGIA 1EJAA 2CHAB 1C5SA 5CHBA 4BAOB 5T3HA 3MFJA 1GMHG 2ZGBH 1GMHF 2I6QA 7GCHG 7GCHF 1CA0B 4FUBA 2KAIA 4AG2A 1Y3YA 1YCPK 1MCVA 1P9UA 2FXRA 1O31A 1QTFA 2QXJA 1TRMA 3RXAA 1XVMA 1COWD 4M7GA 3BIVH 3OU0A 1G3EA 1LMWB 2F4LA 2QF0A 3KHVA 3ZZCA 1T8OA 1GCDA 2GZ8A 1NO9H 1IQHA 2FOAA 3RMOH 2TBSA 1EOLA 2V3HH 1BRCE 1FONA 1LKBA 4MLFB 2ZCHP 3DSPA 4CRDA 3UQOA 1ZRKA 3PLKA 3T26A 5KECA 3PO1B 1GI6A 1VJAU 1Z8IB 3BTFE 4I8HA 1G37A 1HJ9A 1EAXA 2BB4A 4ZKRU 4ASUD 1KXAA 1EZQA 1LQEA 1SL3A 4X6MA 2SFAA 4YOJA 1P04A 3Q3XA 4CR5A 1AUJA 3LGWA 1O2ZA 2XC4A 5L30H 4HI3A 1AZ8A 2ZECA 1O2YA 1Y3XA 4TPIZ 2PW8H 3PRBA 2AGGX 3KF2A 3SJOA 1TONA 4DG4A 3E0NB 1TNLA 4ISOA 1NT1A 1AVGH 3OY6U 2FI4E 3SGAE 1FY3A 1Z6EA 3KQ5A 4GAWA 3UPEA 1MKWK 3PTBA 4I31A 3GY8A 3CP7A 1O2WA 3DSGA 3NRLA 1WOFA 5C20A 1SGCA 4H6TA 1P0SH 1TALA 2BVXH 3BTEE 2R0KA 3QK1A 1FPCH 1IQFA 1QBOA 1P3CA 1SI5H 1DXWA 5F8XA 3GYLB 2P94A 2A32A 2EQNA 2JETC 4BAHB 1C5OH 1ZZZA 4PROA 3W94A 1IHSH 2QN5T 3GCHC 3KNXA 3RXTA 5LGOA 4THNH 1KY9A 2BX4A 1MQ5A 2Z9GA 1WCZA 1L1NA 2C8WB 3RXLA 4FU8A 4YT6H 2XBVA 4M9FA 2SGEE 3L33A 1NU7B 3I78A 4O9VA 3EE7A 1RTLA 1SC8U 5FAHA 4FUDA 4UDWH 3SU6A 1J16A 4GHTA 5F8TA 3BSQA 1SBWA 3B23B 5JB8S 1ETTH 1SGQE 4IMQA 1KLJH 1SG8B 1ANDA 1XUFA 3BTKE 1C2KA 2TGPZ 2WINI 4F49A 2AS9A 4D9QA 1MTNB 4XRNA 1H9LB 2OQ5A 1NRPH 3LONA 1MBQA 2NU0E 1H9IE 2SGDE 3ATIA 2ZDMA 3EA9A 2ZKSA 1O3NA 2BY6X 2V3MA 1JIRA 3HPTB 1UMAH 3A80A 1YPKH 2XBXA 3FFGA 3P8GA 1QQUA 1H4WA 4X2XA 1F92A 1UHBA 4LOYH 3N7OA 1A7SA 3FKSD 3RU4E 1Z8JB 1NU9A 1PYTC 4ASHA 2ZCKP 1SLUB 5HGGA 3A82A 3BN9A 4JCNA 4NIWA 3SV6A 1OWHA 3RMLH 1QRWA 2R3UA 1P2MA 1RIWB 2WPJS 1AO5A 1S0QA 4YXWD 1AKSA 1DX5M 2ZG0H 6ESTA 3A86A 1GBIA 2ANKH 1FV9A 1DT2A 1OP8A 1VGCB 1NFWA 4JK6A 3LU9B 2THFB 2BOKA 3URDA 3OTJE 1HV7A 4NFFA 4IMZA 1MZDA 4IC5A 4OS4A 2ALPA 4UFGH 2XBWA 3A81A 1AWHB 4MTBA 4ABBA 1UVSH 1Y59T 4A1XA 4AZ2B 1WDIA 2EI8A 4ISHH 1KLTA 4GHQA 1NN6A 1BHXB 2GCTB 2A0QB 2JDID 1THRH 4ABAA 1O3JA 1P2KA 1A2CH 3P8FA 3OX7U 5C94A 1PQAA 3M5MA 1A3BH 3OYPA 1C1MA 1O3GA 1V2MT 2J98B 1HDTH 3A85A 2ZFFH 1TWXB 1GHVH 1TGBA 2ZP0H 2VWLA 2RDEA 1A5GH 4X8SH 1LVMA 4CHAB 1QB1A 3NZIA 3SZEA 3BF6H 2FTMA 1GL0E 3LOXA 1O3AA 4Q4LA 2GMTB 2W3KA 2FYRA 2K0QA 1C5WB 1WXRA 2G00A 5AVDA 2O8MA 5FX5A 3DD2H 2PP6A 2VNTA 3ZZ7A 2ZFRH 1TGTA 5FL7D 4TWYA 1P11E 3GY5A 1GBHA 3RM0H 4X6OA 1KMHB 2FMJA 1TFXA 4OGXA 3SHAH 1THSH 5I46H 3TNTA 1L1JA 1EJMA 2ZZUH 3B9FH 3GCTG 4KGAA 4XBCA 1J8AA 5ETXA 2BVRH 1F0TA 3UNRA 3K6ZA 4DT7B 5T6FA 4OS2A 1C2JA 1TRYA 2EI7A 1QY6A 4Q7XA 3ZVGA 4B2CA 1IQLA 2EA3A 2PWXA 4XBDA 3ZVEA 2TRMA 1OPHB 2STBE 1YPHC 1K0HA 2FLBH 3IG6B 1UTOA 4AFUA 5HIZA 5B6OA 1C1QA 1V2QT 3KCGH 3RXMA 5JBAS 1E37B 3WWFA 4A5TS 1FMGA 1O3PB 1NM6A 2ZGXH 5EJ1A 3BTQE 4B2BA 1EQ9A 5HM2A 3ZZDA 1QNJA 4ISLA 3S9BA 2Y82A 3A87A 2QCYA 3PMJA 2KCPA 2ZIQH 3QGJA 5HM9A 1O5DH 4U01A 3RU4T 2VIQA 2SGAA 2KM0A 1C5PA 2TGAA 4YTAA 2R2WU 1UW7A 3VXEH 3ODDA 1U6QA 1SGIB 2OINA 4NIXA 1G9IE 3VB6A 2UWOA 5FBIA 3MNBA 1BIOA 1TNIA 4X8VH 3UUZA 1FJSA 5IK2D 1YPJH 1VCPA 3QX5H 2OK5A 1K1LA 2ZFQH 3BG4C 1GJ7B 1BZXE 3TITA 1ELAA 2BQ7B 4GUXA 1B0EA 1FY5A 1GVLA 3AW0A 4LZ4B 3SGBE 4NZQA 2BDAA 1V2VT 1AN1E 1JBUH 4TPYA 1E79D 1GHAG 3Q3YA 3HKIB 1C9TA 1TQ7B 3BTDE 3H7OA 3TU7H 5FBEA 3M3SA 4X1QU 1DWDH 4NIVA 4ZHMU 3U1IB 2VIVA 2ANMH 1SR5C 2FP7B 1T8MA 1EUFA 2BLOA 3KQEA 1B5GH 1XUGA 2FOCA 3QDZB 3U28C 1GHXH 1GMDG 2KR7A 1Q2WA 2G55A 2BY9X 2IOTA 2A7HA 5T6GA 3KYFA 1C4Y2 2NU3E 4Y10E 1RFNA 4BXSA 1QL9A 3P8OA 1ESBA 1HBTH 2SNWA 3EA7A 1HJAC 4R0IA 4XBBA 2SNVA 1UTJA
chains in the Genus database with same CATH topology
5EOKA 2QYIA 4Z0KA 1FIZA 1GDUA 4WMEA 3ZV8A 1O3OA 5J4SA 1C2DA 3RXRA 1BMMH 1C4U2 2D2DA 5CHAC 5HXFA 3FZZA 2ZPQA 1EPTB 1A5IA 2BD5A 3M35A 5ABWA 1QBVH 4HTCH 1EAWA 5DP9A 2Y81A 3E91A 4I8LA 2G5NA 1PQ7A 1FN8A 4BAQB 1N6YA 3A7TA 1YP9A 1UK3A 4XE4A 1K28D 1BHXF 3MNXA 1EZSC 3T25A 1EP6A 1TQ0B 3F9HA 4JZDH 5GJ4B 1LHGH 1TX7A 2IPHA 2J4IA 1K9OE 1UK4A 1L4ZA 5TCAA 2FI5E 3UY9A 3PM3A 4DGJA 1SMFE 3PV4A 2C3SA 1EX3A 6LPRA 2ULLA 3SU2A 3T29A 4ZKOU 3F1SB 2P95A 3QZRA 2ZI2H 4NSYA 1D3QB 1DPOA 1MD7A 1ORFA 2F3CE 5DG6A 1QIXB 3BIUH 3MNSA 1MD8A 5IYTA 4RSPA 2GCHF 2XCNA 1GJCB 4J1YA 2ZU2A 5E8EH 1ZSJA 1GBCA 4X6NA 1GI0A 1P01A 3FAOA 5CE1A 1PQ8A 3ZZ9A 3I77A 3SJKA 1SSXA 1YPHE 1KDQA 3A8CA 2OLGA 5DJ7A 1P3EA 1H1BA 5ESTE 1EASA 3D62A 1QFKH 1QRXA 3UOPA 1SGNE 1NROH 1IQJA 4NWLA 5E2PA 3RXHA 3LC3A 3NXPA 4KTUA 3E6PH 2Y5HA 1GCTC 4CR9A 1LVBA 4MPWA 3F6UH 2XRCA 5LPEA 3DFJA 4ZROA 2HOBA 1T4VH 1BBRH 3M5OA 1GDNA 2GV6A 2Z6BD 3HGPA 3RP2A 2BVSH 3HGNA 4NA7A 4AB9A 2HRVA 1O3HA 2OBQA 5F6MA 1EAIA 4JYTA 1G2LA 1BJVA 9ESTA 1Q3XA 4HGCA 3RC4A 1P10A 1QA7A 1KXCA 4AB8A 2A2XH 4ZKNU 3A8DA 3IITA 1AIXH 2O9QA 1S82A 2G5VA 1HIAA 1QGFA 1BTYA 4A1TA 4A92A 1GI8B 3GY6A 8GCHF 3PWBA 1O3IA 4ZAEA 1G3BA 1RS0A 3SNDA 1GBJA 2CMYA 2O8WA 5HYOA 1GG6B 4I32A 1LQDB 5TCCA 1W12U 5GDSH 2CN0H 4K60A 1UTPA 1TBRH 4BXWA 3MO3A 3QTVH 3NWUA 3SV7A 1RTFB 2D8WA 3GY4A 4CH2B 4D9RA 5JYIA 5AFZH 1SHYA 1HFDA 1Y3UA 3BV9B 2CF9H 4D8NA 3W95A 1HXFH 2JETB 3RXCA 1HB0B 3DT0H 2C4FH 4INLA 3M37A 1BUIA 1GJAB 4X2VA 1W7GH 1Y3VA 1SOZA 5J4QA 4JZIA 3RXBA 3L3TA 1RRKA 1B7XB 4K69A 3S7KB 1GJ8B 5FPYA 4CRGA 1HAVB 5FCKA 1TBZH 3RC6A 3A7YA 1UK2A 3ITIA 1K1NA 3SU3A 1NC6A 1ESAA 1THPB 2CGAA 4NFEA 4XFQA 1NFYA 1SVPA 1QA0A 6GCHF 4BAMB 2BXTH 3RXKA 1UVTH 1P05A 4R8TB 2OC7A 5A0BA 1QR3E 1OWKA 4CRBA 5LPFA 4ABFA 1GBEA 3SUDA 3TK5A 1UJ1A 1WSSH 3A7VA 3T27A 4AG1A 1P2IA 3O8RA 1V2LT 3MH4A 1GVZA 5FPSA 1SGFG 2ALVA 1SQTA 1BT7A 2OC1A 1LTOA 2ZF0H 2ZQ2A 4DIIH 2ZC9H 5L2YH 1HAXB 5DP6A 2AH4X 3BTGE 2ZHQH 1S6FA 2B0FA 2HLCA 1D4PB 1D6RA 2CV3A 4AORA 3T5FH 3Q77A 2FOFA 2PTNA 4FUJA 1GI4A 1AWFH 2V3OH 1CGHA 2Z94A 1MMJN 3TGJE 1O30A 3RXSA 3MU0A 2BXUH 1RD3B 2TGTA 1JIMA 4Y7AA 2GV7A 2BZAA 4MNVA 4KKDA 2QY0B 4YZUA 3V12A 1Z71A 3LC5A 1W7XH 1O5EH 1TX6A 5EPNA 4X8TH 4Z6AH 3Q3KA 3GCNA 1JMOH 1O2RA 2PKAA 4JZFH 1Z1JA 1W3CA 3SU1A 4LXBH 3UQVA 2V6NA 4AGKA 2VH6A 2BDCA 4NIYA 1O3LA 2P59A 4X1SU 5FCRA 3R3GB 1ARCA 2BDIA 4HFPB 1SQAA 5EGMA 1LVYA 1NPMA 1Y5UT 1O2PA 1C1VH 2C8ZB 1C5TA 3A84A 3M7QA 3ZZ8A 3MU1A 5L6NH 4NCYA 2P93A 1JOUB 1TA6A 2B7DH 4FXGH 4I8GA 1IQIA 2OBOA 2HNTF 2H5CA 1MTSA 3MI4A 1C1NA 2J94A 3VGCC 1AQ7A 1L0ZA 2AGEX 1TNHA 1P2OA 1WU1A 2H9HA 1EZXC 1TGCA 1S6HA 2XXLA 2NWNA 1ARBA 2ZGJA 4U32A 1GBMA 1OOKB 5DP7A 2CF8H 3HKJB 1WQVH 1LO6A 3ATMA 3GDVA 3ZZAA 2A2QH 4MPVA 2Q6GA 1ELCA 3TH4H 3QGNB 3C27B 1CGIE 2Z7FE 3A88A 4IN1A 5E2OA 3NKKA 1GHBF 1ZHRA 2BLVA 1Z1IA 2BQWB 3TNSA 2F9UA 3TK9A 1CHOF 1GBFA 4FUFA 4ABGA 1DM4B 1EATA 1E38B 1TRNA 4UFFH 1QJ7B 3MTYA 1SGEE 3M7TA 1TNGA 1C5ZB 2ZTYA 1AFQB 4OS6A 4WXIA 3U1JB 1N1LA 2GTBA 1MU8B 1BTPA 1DITH 4AN7A 1HGTH 1HAIH 1GJBB 1K1JA 2GT7A 1T31A 1V2ST 2CHAC 1VJ9U 1S84A 2A5KA 4Y0YE 1C1PA 1O3DA 1XXDA 1PJPA 1W0ZU 1CA0C 1FY8E 1BBRE 1NTPA 5FHTA 5EQRA 2W7SA 2GT8A 1IQKA 1KXBA 3LJJA 3LJOA 2FDAA 4RKJB 1GBDA 1N6XA 3F9FA 1OWIA 1SGTA 4SGAE 1KIGH 2EC9H 2PGBB 2F9BH 3PWCA 4YLQH 2A7JA 4HZHA 2KAIB 5JBTA 1ZRBA 2OTVA 4U30A 2C93B 1TIOA 1C5UA 3LPRA 1O2LA 1YCPH 1GGDB 2VB0A 2Y7XA 3GISB 4XSKU 2R9PA 2H6MA 4ABJA 2FPZA 3BG4B 1DS2E 2BLWA 1XKAC 1DFPA 8ESTE 1C2FA 5DO4H 1TNKA 1ZYOA 2TIOA 2UWPA 4ZHLU 3HK3B 1LPGB 1K1OA 2VGCC 3TVJB 2AMPA 5IDKA 3M61U 1WQSA 3D49H 1ACBE 2G81E 4WMDA 2ZEBA 1AHTH 1KTTB 3SNBA 3KGPA 2GDEH 1SHHB 1J15A 1C1TA 1XUJA 1LHEH 1O2KA 2FO9A 2Q6DA 1A0HB 4INHA 1A5HA 1TMUH 1WTGH 4E06H 3LKWA 4UFEH 4ABIA 1ZGVA 1D3DB 3M7UA 1Z6JH 2F9PA 4FUIA 1UCYE 2QV1A 1T4UH 2BDBA 2ZO3H 1GHYH 2HNTE 1AY6H 3P8NA 3K6YA 3RDZA 2OC8A 1Z8GA 2SGFE 2Y7ZA 1ELEE 1GL1A 4RN6A 1DWBH 2I6SA 4ZXXH 4ZMAH 4J2YB 4JYVH 1OS8A 1CBWB 1MKXH 3SNCA 2CJIA 1GJ5H 3U98H 3GCOA 2J9NA 4U2WA 5C2ZA 1UTNA 1ZTJA 2Y80A 3D23A 1C2LA 3LIWA 5CHAB 3RXFA 2JKHA 1BDAA 1SFIA 3LGVA 1A3EH 1LKAA 3EA8A 4MG3A 2QXGA 5DP4A 1LDTT 2FTLE 5DPAA 4BTTB 4I8KA 4X6PA 2VIWA 1V2TT 1XKBC 1BRAA 1QBNA 3TK6A 5JPMH 1SOTA 1SLXB 2V0BA 3B8JA 1O5AB 2AMDA 1G3CA 2G4TA 3T28A 1C5XB 1DUEA 3MH5A 4D7FA 3Q00A 3ZVDA 2BZ6H 3K9XB 1CVWH 1ZTKA 2Q1JA 2ZU3A 5C1UA 2Z3DA 1WTHD 1SGRE 1GBLA 5GCHF 3ESTA 1W8BH 1O36A 2A31A 1FDPA 2AIPA 4Y0ZE 3UWJH 1MTNC 4WH6A 2BQ6B 4FUEA 4A7IB 1VITH 2BY8X 1GHWH 1OSSA 3SO3A 2PTCE 4YT7H 2G8TA 4JYUH 3A8BA 1TA2A 1NESE 1F0UA 2LPRA 3T2NA 2VVUA 2B5TB 3KQCA 2BM2A 4KTCA 3BTTE 1MCTA 3KQBA 2ZU4A 2OCVB 5EXMA 5A09A 1CT2E 4Y8XA 3UNSA 1B0FA 3LGTA 3PMBB 3SN8A 5C67A 2VVVA 1TLDA 2A1DB 1O38A 4WWYA 1UHBB 1N8OC 2FESH 1RIWC 3SHCH 1GJ6A 1IAUA 1KXFA 2ILNA 3MHWU 4E7NA 2GP9B 1BBRK 2B9LA 1H8DH 1GI1A 3RXEA 1CGJE 1CT0E 1AD8H 1VGCC 4H42U 1OP0A 4AYVB 1NFXA 2F9NA 2WPIS 3SV2H 2ZHFH 1AKSB 4UONA 2BLQA 3FVFB 3IWMA 1V2NT 4O03A 1GBBA 4ISIH 3URCA 4RKOB 1C1UH 1EAUA 3MYWA 4CRFA 1BMAA 1CU1A 5FX6A 2FI3E 3E3TA 4SGBE 3CENA 1NY22 3RC5A 3E0PB 3ZVAA 1EZUC 1Y5BT 1NRQH 4DJZB 3H7TA 2ZGHA 1O5GH 3RLYH 4B73A 3SUFA 1AFEH 3O8DA 1QL7A 1VCQA 1Y5AT 4K8YA 2P3FH 2RA0A 1GMCF 1DDJA 1FUJA 3BTWE 4QT8C 1P06A 3M36A 2ZCLP 4Y7BA 1GI9B 4WH8A 3A89A 1O2IA 4F4OC 3UR6A 5F8ZA 1D6WA 3RXIA 1ZPBA 2G51A 1O2HA 5E0JA 4CHAC 1O32A 1Y3WA 4VGCC 1O3FA 4DURA 3P92A 4ABHA 1ABJH 4GLYA 1HPGA 2ZFTA 2OC0A 2VWMA 1AE8H 1UCYK 1HAYB 2FOMB 1P12E 1PYTD 1MTUA 1AVWA 3QZQA 5FPTA 2XTTB 4ISNA 1C5YB 1Z7KA 1SLVB 3M3TA 4WJG2 1ID5H 1O35A 1BCUH 1P2NA 2HGTH 1F0SA 1FPHH 2BD9A 1WBGB 2R0LA 4ZHAA 4B74A 5K7RA 1DY8A 4I7YH 4JMYA 3NUMA 5GXPA 1YGCH 1PFXC 1V2PT 1F5LA 1TOMH 3VB3A 1A46H 5GPIB 2FS9A 4LK4A 3SUEA 1IQNA 1C9PA 1RGQA 1P57B 2STAE 4B2AA 2H1UA 1PPFE 1J14A 2JH6D 1VITF 1NZQH 4X1NU 3UTUH 1VR1H 1K1IA 1CSOE 2AGIX 1P09A 1T32A 4IGDA 3QTOH 1BITA 2GCHG 3MWIU 1H9HE 4NA9H 4O97A 3ELAH 1HLTH 1C1SA 1Q31A 1ZLRA 2PSXA 2SGPE 2WV5A 5TJXA 1QB6A 1J9CH 4TYDA 4E05H 2HALA 1SGDE 1FY4A 3QUMP 3RXGA 1NRSH 1YBWA 2QGRA 3RLWH 5EW2H 2WYJA 1TAWA 2FLRH 5LH8A 1NRNH 4Q80A 1AGJA 1GJ9B 1O3MA 2XC5A 3FP7E 1PPGE 2VVCA 1BMLA 3A7XA 3NK8A 5A8YA 3ODFA 1TB6H 2OXSA 1C5MD 3SZNA 3E16B 4BTUB 1S83A 1DICA 1MQ6A 1P03A 1W14U 2W7UA 4FUGA 4WY3A 2A5IA 1RTKA 5I25A 4X2WA 1F2SE 2D26C 1LHDH 2ZHDA 2C8YB 3SQHE 4Q2KA 3SJ8A 5H4IB 1EXFA 2ZTXA 3R0FA 1BTUA 1QL8A 3P70B 3M3VA 4IN2A 2P8OC 2Y5GA 1GVKB 1HYLA 3AW1A 4YESB 4UFDH 2BX3A 3U8OH 1UTLM 1VZQH 3GY2A 4GVUA 7ESTE 2Z3CA 2A4QA 1P8VC 1O5BB 1QB9A 1YPMH 1XUHA 1IQEA 2XW9A 3AVZA 1O2SA 3GDSA 8GCHG 3F68H 3V7TA 2D1JA 4TY6A 3LH1A 1SGYE 1O3KA 1IHTH 2ZDAH 5A0CA 4Y8ZA 1QHRB 4MDSA 1CHGA 1W2KH 5DK1A 2YNBA 1C2MA 1DLKB 1ZMJA 2ODYB 3ENSB 2VWNA 1S0RA 2YOLA 1JXPA 1FZZA 1K1PA 3SUGA 4FVDA 5CMXH 3F9EA 3HATH 2YNAA 4KTSA 3SJIA 1FAKH 1PPEE 1ZHMA 1PPBH 2HVXA 1TBQH 3P95A 5EW1H 2BOHB 4Y76A 1XXFA 1A0LA 1W10U 1TABE 2XC0A 1DVAH 5DP5A 3TH3H 1EPTC 4KELA 2J95A 3GCHB 2Z9LA 2PFEA 4YM9A 3RXUA 1QJ1B 1MBMA 4YOGA 2LNCA 4AGJA 4MNYA 3V13A 1GI2A 3M5NA 4UEHH 2PSYA 1NRRH 1MTWA 1Z8RA 1V2WT 4B1TA 4OGYA 3EDXB 6GCHG 3UNQA 1F5KU 3VFEA 3S9AA 1L1GA 1SLWB 1AZZA 2M5TA 2O8LA 1YM0A 2ZU5A 3O8CA 1ZMLA 3SQEE 3ZZ6A 3MU8A 1UTMA 2JH0D 4FUHA 4X0WU 3MO6A 1G2MA 1O2XA 1V2UT 1DE7H 1A61H 1W11U 3EGKH 2VINA 5GIBA 3BEUA 1FLEE 1TMTH 4MNWA 3UIRA 1EB2A 2PLXA 4GSOA 5ESBA 2ANWA 7KMEH 2A7CA 4X1PU 4TY7A 3SNAA 1PQ5A 1RJXB 3DA9B 2RG3A 4JK5A 1CA8B 3WY8A 4Y11E 1OX1A 1FY1A 2AMQA 5DP8A 2ZHEH 3DHKH 2QXHA 1GWAA 3UFAA 4AYYB 1C2IA 1TPOA 1P9SA 2HNTC 1V2RT 1KDQB 4X8UH 2FYQA 2QAAA 4YOIA 1ELGA 1YKTA 3UOUA 1ZJKA 3GDUA 4FU7A 2DE8A 4FVBA 1O33A 1O2VA 2BMGB 2P3TB 1DSTA 3BTME 1HAPH 2VGCB 1ZGIA 6CHAC 1ZTLA 4NZLA 1QQ4A 1ETRH 5A8XA 4ZXYH 4K1EA 2AEIH 1G36A 1TPPA 1YPGH 3E8LA 1MZAA 2J38A 2OUAA 1O39A 3CS0A 1WUNH 3MOCA 1BRBE 2FM2A 1ZPZA 1M9UA 1HCGA 1K21H 1O2MA 2PKSC 3BG8A 3LDXH 2A4GA 3AASA 1MKXK 2VU8E 3E1XB 3GYMA 3D65E 3ZVCA 2ZDNA 4BNRA 1AB9C 1O2UA 1O37A 4NG9H 1AVXA 1HIAB 1GG6C 2QIQA 3TJNA 4K1SA 1ELTA 1QJ6B 1AE5A 2OP9A