5FPSA

Structure of hepatitis c virus (hcv) full-length ns3 complex with small-molecule ligand 3-aminobenzene-1,2-dicarboxylic acid (at1246) in an alternate binding site.
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
642
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords HEPATITIS C VIRUS FULL-LENGTH NS3 COMPLEX
total genus 202
structure length 642
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5fpsA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fpsA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5fpsA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpsA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpsA03
3GYMA 3HPQA 1HBTH 1EJMA 2WPDA 3T1QA 4ASUD 4DDTA 1GZSA 5CYPA 4JJZA 2WJJA 4HZUA 1L4UA 1Z07A 4QNMA 3P26A 2PMKA 1B5GH 5L3RA 3HKIB 3MH7A 1ZPCA 4D0NA 1LVGA 2VP4A 2ZRAA 1Y3AA 1ZTKA 1RD3B 3KL6A 1LPGB 1KI8A 1J8YF 4Q19A 2ZIQH 1AE8H 3VR2A 2RHDA 4W5JA 1E96A 1U9IA 1C5VA 3ADDA 2GVDC 2BLOA 4Q1BA 2QMOA 5KTYA 5CHAC 3TMKA 1OOKB 1YU9A 3MNSA 1VJAU 4Y8XA 3ZVFA 1TUEA 1SXJD 1JIMA 4ZUHA 2WUBA 2VVVA 2ZGBH 2XXAB 3RC5A 4IDPA 2HV8A 4W9MC 1SOZA 4FWTA 4YMUA 4UXIA 5KU1A 2A2XH 5JBCS 1TBQH 2ZRLA 1Q44A 1Z2AA 1YHNA 4X1PU 3SS8A 1GUAA 1VPLA 3AF3A 1G7TA 1X6VA 4F4JA 1BIFA 1JI0A 3TH3H 3W8NA 1BRAA 1QBNA 2ZKSA 3F6UH 2R6DA 3TSZA 2IEYA 3ASZA 1E69A 2Z5FA 2AGGX 1FY1A 4GZMA 1XXHA 1O2GH 2OILA 1AM4D 2QXGA 4NZLA 3URDA 1Q57A 1TPOA 5C18A 2HF8A 2HF9A 3A1SA 5F8XA 5C1YA 4OQNA 3B1YA 4HAXA 3IEUA 3QXXA 4QL3A 4DT1A 1FIWA 4DW2U 4CEJA 2A5IA 2P6RA 2QF3A 2GP9B 3R3GB 4JS0A 4ISIH 1VCPA 1AMHA 3SNHA 1ZMXA 3LD9A 4BAHB 3OESA 3NPSA 5HE8A 3BTEE 2OESA 4MNYA 2BXUH 1U8YA 2A5FA 3U8OH 5E0GA 3SQWA 1YCPH 4TL6A 4GOXA 3LW8A 4DUGD 1C5YB 2IYSA 5JSZB 3P17H 3ZVEA 3DFJA 3AW0A 3QUSA 1KAGA 2Z4SA 3TH5A 1QZXA 1DY9A 1EAXA 1TUIA 1AVXA 2FEOA 1GTVA 2O8EA 2WWWA 4JLDA 4XSHA 4LX0A 3UIRA 3RXJA 1PQ5A 4BE7B 1ONBA 3CB4A 2EWWA 1HAIH 2GCTC 2OBQA 1W7XH 5GIBA 2ZQ5A 1US8A 1CJUC 4CHAC 2OCVB 2IUUA 2VH0A 2HNTE 5HM2A 1G6OA 2W3IA 1EPTA 1HQYE 4M1MA 2GJ8A 4TPIZ 1HUTH 1LHGH 1O5AB 2OTVA 2MSCB 3S9BA 1GVNB 4OQFA 1S82A 1E0JA 2KI5A 1RJ9A 1F2SE 5GWZA 4Q9LA 4D76A 4F4OC 3LGYA 4AYWA 1Z0AA 4LC0A 5JYIA 5DYGA 3GFPA 4ZKSU 3BV9B 1QB9A 4AORA 3PUYA 2ZQ2A 1P57B 3DOEA 3B9FH 1X7AC 3HU3A 3LW7A 1ZM2A 2G88A 3CZPA 2FYQA 5FBRB 2H92A 4DDVA 2FOHA 1P2SA 4DWJA 5FUYA 1UHBB 4AFQA 1SVOA 5CYOA 1MKXH 5H1YA 4AX9H 4GHQA 1NN1A 2C8WB 2QUZA 3V4FA 2Z6BD 2JLYA 4LHVA 3AVYA 4H1UA 4TYPA 4AYTA 3IG6B 3EA7A 1ZMNA 2LNCA 4HZHA 4Y7BA 3GLIE 1F92A 1NKSA 3QPUA 5E8EH 1Y5AT 1VCQA 2IL1A 1CTQA 3BH7A 3AVXA 1W1WA 1G9XA 4YDSA 2QC2A 2GMTB 2XC4A 1K1LA 1ZR0A 2Q6GA 5F03A 1WOFA 2WOJA 2TMKA 6ESTA 5FCRA 3CRVA 4A0HA 1W11U 3BERA 3FMOB 4IMQA 2J0SA 2H5DA 4HB2A 1E9AA 3UIEA 1Z8FA 3RS4A 1C5LH 1V3XA 4IGDA 1C1WH 4HTCH 4BNRA 1MT0A 1OYQA 2CMYA 2RB4A 2UWOA 4RD3A 5DP7A 2NMVA 2Z0MA 4A0FA 1KZ7B 5JMTA 3EX7C 3W34A 4RI0A 1R0XA 5AHGH 2ZFTA 2YYZA 3C16C 1V2VT 4WY3A 3M37A 4EFMA 1G3DA 1KOFA 1XVMA 3QKSA 3ZZ9A 1PLKA 2B7DH 4JCNA 2BY9X 1T8UA 1MTVA 2Y7ZA 2D7CA 5FUWA 3UK6A 3RS2A 4U30A 4PC3A 3GJ6A 1I4TD 4LJ4A 9LPRA 3A7XA 2TGDA 4Q66C 5GNDA 2D2DA 1WAYB 1A46H 1GG2A 4I7YH 2PLFA 1WXQA 3RXSA 1O2VA 4D7FA 4AD8A 2PFEA 2ZWLH 4ZKEA 4NIVA 3UNRA 3RP2A 1Q22A 2J9NA 1ZMLA 2PGQB 1HEIA 4O97A 3OSYA 3EXAA 1Y5UT 2WKPA 3AP2A 1KYIA 1LPZB 2F43B 3E0PB 2GXQA 4D82A 1E2KA 2FTMA 2OXSA 2FSHA 1CHOG 3UWOA 2VNTA 3HYRA 3WHLA 3NDBB 3AKYA 1A0LA 2WWIA 3VGCB 4OS1A 2Z6VA 4TWZA 3AP1A 2JH6D 1A2BA 2CNWA 5CDFA 2GCTB 2W6JA 4B2LA 1G37A 4UNQA 2Q6FA 4X1RU 1TPPA 221PA 4JJKA 3DFLA 1U90A 1C2DA 1HRTH 1MTSA 2PZFA 4JYBA 4OM9A 2ZE5A 1VR1H 2F1HA 3MWJA 4AKEA 3A82A 1QF9A 4J2YB 4NFEA 1ZZZA 5EJEA 4JLNA 3MMGA 2QQ0A 4DLUA 4CRDA 3IKJA 1YVDA 1T8LA 1PLLA 1DICA 3H86A 4E07A 4PC6A 3K0CC 4B3DA 2ZGCA 5KNDA 4NG9H 1O3FA 2EA3A 4IOKA 1WQSA 1SQ5A 1F2TB 4ASHA 1DM4B 1THSH 1HJ9A 4HFPB 5JI2E 2YNAA 4PPFA 5L8VA 4IVPA 3D65E 2ZE7A 1QBOA 1O2ZA 2NU2E 2IXFA 2IHYA 3AGPA 1TMTH 2PEYA 1C5MD 4G5SA 3L0SA 4JZKA 2BDAA 5GJCA 3BEUA 2H1UA 4P4TA 3AF2A 2C90B 1SC8U 4JBWA 2PSYA 1GIAA 1W36D 1RZ3A 3T5DA 1T8MA 1UTOA 1TQ4A 1E3MA 2NO6A 2OCBA 4B3XA 4RZ3A 4M9XA 1GI0A 3ATKA 1SHYA 1TX6A 1V2TT 4Q4JB 1KTTB 1K2I1 4IDNA 2B0FA 3KN2A 1P06A 3EA9A 2VP2A 3QKUA 4WMDA 5C1XA 2D2FA 2ZPRA 3UTUH 4OJKA 1F7ZA 4TTRA 2FTLE 3QDZB 1D5CA 4QT8C 5J4QA 5FPSA 3MU5A 2FE4A 1F5RA 3BTDE 3NXSA 3AB3A 2WSSA 4O3UA 4DG4A 1XTIA 2AXPA 1D6JA 1T8TA 1BUIA 1GMCF 5GJWC 1SLXB 2HXYA 4TLDA 3T2NA 5DK1A 1BKDR 3ITIA 5CIQA 1OX1A 1VCWA 5DP6A 2A5JA 4JLVA 1U99A 3SNDA 1P9SA 2OEPA 2MSEB 1W5TA 1VHLA 1NF3A 2BD9A 1INCA 2QT0A 1LNZA 2ZU0C 2K1QA 1Y63A 3H1TA 3VFDA 1XUKA 2O8UA 1GHAG 4BZQA 2ERYA 2ODQA 1BITA 1P2OA 4DOQA 3MCAA 3A8CA 1E1RD 1EKBB 4TQUS 3OX7U 3VGCC 2HYIC 1E4YA 3U6KA 1A1RA 1TNKA 4EAQA 3PTBA 1TPAE 3ADCA 3K9LA 2BOVA 5EE5B 2EI8A 1ZGIA 1NBME 1WUNH 1GJAB 2OC1A 3SDZA 2KE5A 4L8GA 2FX4A 1YRAA 2QN5T 4GAWA 3QK1A 3QNUA 2GVZC 3MHWU 2ZS8A 3TSOA 4LHWA 2W58A 3GLIB 1OWJA 1ZSLA 4B43A 5IYTA 1LHCH 3CWZA 4RKOB 1Z47A 2I6SA 1OFUX 4TMWA 2EQBA 4FUJA 1UDXA 4Q7YA 3EC1A 1MRSA 3EA0A 4UONA 2Z9KA 4N0DA 4JZFH 4QNRA 2SGEE 3K0AA 5FUVA 4GFDA 2UZ3A 3F3YA 3QKRA 2UVQA 4PXAA 2QI9C 2RGNA 1E2NA 2OCAA 1F3OA 4ESTE 2FFHA 5C5OA 2AWNA 5FTJA 2SGFE 5L3SA 4MTBA 4YMWA 5DKMA 3K53A 3QSYA 2J46A 4JVSB 2OINA 2JIZA 1Y3VA 3TUJC 1XMIA 3EA5A 4NE2A 4HDQB 1E9RA 2QF0A 2VIDA 3GEIA 1XCPA 4OGXA 2QTHA 1GDUA 1JECA 4HATA 4A82A 1P2IA 1NNEA 1FONA 4BAKB 1D9ZA 2VA8A 1O2JA 3PG5A 4CZ2A 3GEEA 5T6GA 4IOJA 2GKVE 3UUZA 3D8BA 3NCLA 4CRBA 3TJZA 3ZVLA 3BEIB 2QM8A 1FXYA 2HNTF 1GBKA 4DLWA 4HLUA 3ATIA 2AD1A 3QLPH 5DIFA 3KKOA 1G8PA 1P2VA 1DG3A 1NRNH 5TARA 4CRCA 1DLEA 4TZ0A 1A2CH 1MO5A 4Q7XA 4RD0A 1ZTLA 1ELFA 8GCHG 1A5HA 3SI4H 4AKIA 3P8GA 2R0KA 2QM7A 4U7DA 4Z1MD 4FI3C 1SXJA 1E9DA 3X1DA 1UBCA 2JLVA 3QXHA 2DB3A 5DLQC 2TGTA 4UNPA 3GISB 2HPQH 1L1JA 2HNTC 2V54A 4GP7A 5TY0A 2NPFA 4POAA 1ABIH 1S3SA 3MO9A 2C04A 1E2IA 2D8WA 1E2PA 1G8HA 4WH6A 1IY2A 1TRYA 4OQXA 1CT2E 3HPRA 2BDBA 2C96A 4FCTA 5EUMA 2A4RA 3DDCA 1W4RA 1RRGA 2IW3A 3BFVA 3S69A 1GI8B 1ZM4A 2A4GA 1EFRD 4DCSA 1C1TA 2L0XA 1Z8RA 1OP8A 1R5BA 1V2JT 1GRNA 4D9QA 4FU9A 3SNEA 1NFYA 4R7ZA 3RMOH 5JJIA 1LB1B 3A58B 1EQ9A 2G5NA 2ZSAA 3KUDA 3G01A 5BW8A 5T6FA 2HJVA 5C4MA 1YKTA 3CP7A 1O3AA 4DGJA 3RXGA 4CIDA 3B13B 4EQ6B 2ZE6A 2OFOA 1E6CA 2D74A 2OM2A 1PQ8A 4FMCB 5EOKA 3BS4A 1TQDA 1Q1EA 1O2SA 2OC7A 1XM1A 2ZRHA 2D62A 1F0RA 1N6LA 4X1QU 2W0SA 3MH4A 5ESBA 1I4LD 2YWFA 1C1QA 5JBBS 1KMHB 4OHZA 3I8XA 2ODYB 4OK3A 1S0RA 2RMKA 2GZHA 2CXXA 4YDHB 2A78A 1MD8A 2VHTA 4GPTA 2F9NA 2IXEA 2F83A 4OI2A 3TKLA 2O8FA 2GWHA 3MU8A 3RMLH 1HY3A 1S5SA 2W3KA 4TMTA 5DP9A 4QBHA 5A0BA 4I1VA 5EE3A 1F5NA 2QSYA 5FBQB 2IYXA 4M1KA 3AF1A 2GJSA 1J15A 3THYA 1DG1G 2O9QA 1IQJA 4BFTA 3QKTA 3QF7A 2Z9JA 3SU1A 621PA 2J7KA 3RS7A 3MMPA 1TONA 5E7IA 4MPUA 4FMDB 4HYYA 4NA9H 2XOKD 3NG1A 2YNBA 3ZZAA 1ABJH 4ZCLA 2OAP1 2GX4A 1XTJA 1O2UA 2PWXA 3ICQB 4Y10E 4M1WA 2FI5E 4GCHF 3AGQA 3I77A 5HE9A 3MGCA 1AGJA 2GZ7A 1XJCA 2Z9LA 1TABE 2ECKA 3BIVH 2F7SA 3GEHA 3LA6A 4KYIB 1GHZA 3RXVA 3ZVGA 3RWMB 2ZVPX 2NIPA 3SZRA 5K8TA 3ZVDA 1K1NA 2SGDE 3OAAA 1AVWA 3SYNA 2VHQA 2OFWA 4QKQA 4DVAU 3RHFA 4A2WA 3SJAA 1AZ8A 3SBEA 1HAOH 1G41A 3VB4A 1DANH 1SVIA 3ATWA 4EPYA 3MUFA 1K1JA 3QEJA 5FL7D 1FP6A 1N0WA 1XXHE 3K65B 2O52A 2HUPA 1NTPA 3QX5H 1FP7A 4IN2A 3ZZ7A 3ATLA 3ZQJA 5UKDA 2QPOA 1KXEA 3PWCA 1QIXB 3NVAA 4Q01A 2Z9GA 4KXFB 4OHXA 1SFQB 4E7RG 2IUTA 2O8EB 2H2ZA 4F4CA 4DLXA 2BC9A 3OE7A 4HZIA 3M5LA 1I2DA 5LPEA 2Q9BA 1EB1H 3TR5A 3M7TA 1E35B 4OHYA 2JDID 1F6BA 1OWKA 2JIZD 1XNJA 1AZTA 4DCDA 3DOFA 3IPYA 1QGFA 4JT2A 3SU2A 2Y7XA 4WF8A 1XMJA 1AGPA 3DA9B 3WYFA 1Z1JA 1GBIA 5JDUB 4R9UC 2ZCLP 1XXFA 2ZAMA 1W44A 5F9HA 1AIXH 1S84A 1P7CA 4LGMA 1DFPA 1UBEA 4XBCA 1GHBF 1F48A 1YR9A 1GRRA 1GI2A 1SVSA 2ZUDA 1DS2E 4LXBH 2WYJA 2XBYA 2ZHQH 4EPRA 4AFUA 1PJRA 2JCSA 4QBGB 1GBCA 4K1TA 1G7CA 4NA8A 4GCHG 1HCGA 3WMEA 4YOGA 4OHVA 2BY8X 121PA 5DO4H 1H9HE 1DARA 1N8OB 4GDFA 2F3RA 3DO6A 3U3JA 4WZBE 2BM2A 2VIOA 2QCYA 4JLAA 4AB9A 1C5NH 5FPHA 3LBIA 5L6NH 4B2IA 3D7MA 2PH1A 3EIQA 3UNQA 3L0IB 2BYAX 3RLFA 1PPCE 1MO4A 5B6OA 2Q9CA 3AP3A 3PV2A 4QM7A 1KSJA 1YZQA 3RXTA 1MV5A 4X8TH 1PUIA 1TQ7B 2IWRA 3FWYA 1TRMA 4DB4A 1IQNA 1EZUC 3W6OA 2WKRA 4P32A 2HLCA 4UD9H 4RFVA 3SI3H 2CHVA 3P4XA 1VMAA 821PA 1EOJA 2R3UA 1F2UB 1JIRA 1WSSH 3EIHA 2B7BA 3A6PC 3DUXH 3BG8A 2FI3E 4HAVA 5G41A 2DUCA 3NC0C 1O5CB 2JA1A 4V02A 4EIWA 1N2CE 2JJ8A 1CR4A 2FSIA 2ZI2H 4DDWA 4R2IA 3V00A 5HR5A 1FZQA 4B76A 3A7TA 3U98H 2Q21A 3VKWA 2P95A 1ZP6A 4D25A 3KKMA 1P9NA 1TGSZ 3JZ1B 3K70C 1QDEA 1HE1C 1HAVA 3F1SB 3CWQA 3D49H 1XXDA 2F91A 1XJ0A 2QMHA 4PAQA 1EZXC 2OK5A 1YPJH 1PPGE 3RXMA 2RGXA 5T3HA 1P2JA 3WP1B 4MH0R 2FU5C 2WOOA 4CGZA 3HK6B 2D4HA 4VGCB 4CT5A 4HUTA 1MCVA 6CHAC 1O3IA 4FW9A 1GVKB 1KTVA 3D62A 2ZYTX 4Q02A 1GJ5H 5JECA 3LGWA 4ABJA 1TADA 4UEHH 2GCOA 1P9RA 1UCYK 2V0BA 4LOYH 2GCNA 2MSDB 1HXFH 2G0TA 1E9FA 4INKA 3SZEA 4KAXA 2A5AA 5DI9A 4QBIA 3P27A 1PPHE 3BFXA 1EWQA 1FUKA 3SJOA 5EQRA 3K0FA 2P5SA 2QP3A 3ZLJA 4DCUA 3SQEE 1C9TA 4LYFA 4U00A 1NY22 1Q3HA 1Z6XA 1ZTJA 4LBVA 4JBXA 4MA4A 2ZSEA 4YZUA 3DD2H 2VEDA 1RJXB 1BCUH 2ZJZA 4BQSA 2XBWA 4W5WA 1LF5A 2GZDA 1X3SA 1PPEE 1Z0KA 2F55A 4A8JC 1T5LA 1Z6AA 3K0FB 2ZRCA 1PVOA 1J16A 5M04A 1WB9A 1A0JA 8OHMA 4L9WA 1KXFA 1OKXA 3LRPA 5EZ5A 1ZRHA 3OY6U 1N6IA 2F1RA 3KQBA 4HB0A 3SUGA 1MZAA 4F92B 3GJ3A 721PA 3T5FH 2FZLA 3TJUA 4Q1AA 4QGGA 2BB4A 2JEOA 1LV7A 1NMYA 3NEJA 4Q7MB 1VZQH 1Z2CA 1D3DB 4D4LA 3LOXA 1Q1ZA 1W0JA 4G01B 5EUQB 2WKQA 3T1OA 2GKSA 5HPYB 1C1RA 4TTPA 1OH8A 1C2HA 4KV9A 4KYUA 2HEIA 4A5TS 1CGIE 5FOUA 7GCHG 2P8OB 4B47A 3ZVNA 1DPFA 4QOSA 2UUJB 3NC1C 3CX8A 1TEXA 1GI6A 5JB9S 3REFA 2P0EA 3P8OA 4YC7A 2QA9E 1IAUA 5GCHG 4QHYA 3Q77A 1CGJE 4FWIB 1FY4A 5E3HA 2XAUA 5EXLA 2A5DA 1S4QA 2HYDA 1VYUA 4AIIA 1EP6A 2CLDX 3SI7A 1LDTT 1MOZA 1EB2A 2KBEA 1Z6EA 3WMFA 3B2EA 1AE5A 4TMXA 4E22A 2PLRA 3BTHE 4AG5A 1DO0A 1YJ5A 4NKRA 2QAJA 3HGPA 5HKKA 4WVFA 3LWNA 2RGBA 2HPPH 2D06A 2B9LA 4C30A 4OS7A 4LHYA 3A4NA 1II8B 4AWXA 4UNNA 2Y6TA 4XTCS 4CRAA 4XTRA 3GY3A 1WF3A 4X2VA 3IUYA 4EJSA 1JQJC 5FXLA 1XUHA 1P61B 4A6XA 4QJ4A 1OWHA 3ZYDA 2FI4E 3WNDA 2KBFA 2OT3B 2YV5A 3T28A 1KLJH 5H4IB 1GI4A 1EAWA 1UKZA 2VSXA 1KIMA 5DJ7A 4PHGA 3I92A 5EW2H 1ANCA 3R7WB 4C0QC 1ZJDA 2GCPA 5FH9A 1VYVA 3K0EA 1YKSA 5LPNA 4Q80A 3CW2A 3M5NA 1RRFA 4Z51A 5C4GB 2FGJA 2JH0D 3T35A 1EJAA 4G5GA 2YWGA 3SHFA 3LGTA 1FY8E 1NFWA 3BWDD 1HDTH 1GBEA 3X2SA 1TPZA 4BXSA 5K7RA 2GF0A 4E5UA 1XEWY 3GY5A 4PSVA 2PT7A 4TSFA 5JEDA 4CEHB 1R5NA 5TV2A 1MABA 5DN6D 3D23A 5DSZA 4EJSB 1NP6A 2FZZA 2H6MA 2GXSA 5ELXA 3V3MA 2BBOA 5C46F 1HQCA 1DT2A 3CONA 3I29A 4U2WA 5E95A 2CCGA 1AS3A 5L3VA 1GJ6A 3IIKA 2VINA 4M8NE 1QJ7B 2HLDA 3ATMA 4UXJA 1ELGA 1NESE 2XNDA 3TGKE 3PR1A 2ZPTX 1IQFA 4K81B 2ZA5A 5BRRE 2O0KA 2QBYB 3SHCH 3FP8E 2XEXA 3GDSA 4DB2A 2VIWA 4DUGA 4BRUA 3RS5A 1HJAC 1QHIA 2FO9A 1NIJA 3TBKA 4I1SA 1CA0B 4ZCMA 1T8NA 1QL8A 5EQQA 1KI3A 5JWOA 4BAQB 1WP9A 3Q8XB 1P05A 5JBAS 1ZC4A 1WTHD 1A61H 1XD9A 1O33A 2RA0A 2ZU2A 3S9AA 4GZLA 1E1QA 5FR2A 1YBWA 1Y5BT 2QPAA 4IHQA 2XYAA 4ZAEA 1UBGA 1ZLRA 3EDXB 1QJ6B 4PHFA 1AJEA 1CHOF 1SHHB 2Q3MA 2GCOB 4E06H 3NKVA 3A8AA 2CDNA 3P70B 3T29A 1HURA 5PTPA 4TLAA 4CVNA 3SJ8A 3R9WA 2W7SA 4B3BA 1HE8B 2GCHF 4IXNA 2V6JA 4ZHAA 8LPRA 1ZC3A 1RIWB 2BX4A 3PV5A 1GILA 2ZRBA 1U2RA 4WH8A 5FCKA 5BQ5A 1BRCE 4Y8YA 4DHEA 2ZIAA 1YPHC 1G3IA 3A7WA 3ZGXA 2XNDD 4JZDH 4K1EA 1C9KA 2WVJA 4C0KA 5AJXA 3B5JA 2ZJYA 2GJKA 2GXAA 1IONA 1S83A 1R10A 3FMFA 2XB4A 1NY5A 2CLCX 3B60A 4ZH8A 3WYAA 4NIXA 1FUJA 5E4FA 2RDLA 1Q20A 1SLWB 3I3SR 1XXHB 3IEVA 1T4VH 1YF4A 1N3BA 2H18A 4CW7A 4BLPA 5EP4A 1W0KA 1NI3A 1TA2A 3AVZA 2GK6A 3AEZA 2R6GA 3UY9A 2G9NA 3U7GA 3C27B 2ZE8A 1O0DH 3DEFA 2OCPA 3D6TB 2P16A 1G32B 4JL8A 5J47A 2NZ8A 1QG4A 2ODWA 1CIPA 2J9RA 1IJFA 1YZKA 4F7WA 2VJ1A 3C1KA 2HGTH 4PC1A 3W3AA 1Y3YA 4HI3A 2V55B 1G5PA 1XPOA 2B21A 3MU4A 1VCIA 3RXPA 2HXSA 3LJOA 1DWEH 5J4LA 4Q4LA 2ZR9A 4RY2A 3R0FA 5BPEA 4ZIRA 2WICA 4A4DA 1KI9A 5JRZA 3PIRA 1O2OA 3QE0A 2JJ2D 1OP0A 2B8WA 1SVLA 1U98A 4X2YA 3V9PA 1Q1QA 5B30A 3IHLA 1P2UA 4LDJA 1ZHPA 4Q4AB 1RTLA 4QJ3A 1AQ7A 3PUXA 4LJ7A 4I8LA 1HFDA 4HLDA 2C99A 1GG6C 5IK2D 1YPLH 1Z0JA 1IBRA 1P73A 2GZ8A 1OE0A 1NJFA 2Z94A 2ZQ1A 4TY6A 1TU3A 3FDIA 1N6YA 4JMPA 4IC5A 1IN8A 4M2LA 4EFLA 4XBDA 1TOCB 4HAZA 4AI6A 3OIVA 2CCJA 1QRZA 2WIAA 3GYLB 3SE0A 2VL7A 1RIWC 5LB4A 2SNWA 1PYTD 1HAGE 1M7GA 3BXZA 3GFTA 4B33A 1KK1A 5KSOA 4KTUA 3H7OA 1IQLA 3KF2A 1TBRH 3HR8A 1LFDB 5KPJA 1HJ8A 1KSGA 3KFXA 4X8UH 2BDHA 3EE0B 1N5KA 1OF1A 1JBKA 1P60A 4TMKA 3WNBA 4JVLA 4MPXA 1NMXA 4Y0AA 4M1SA 3FB4A 1HAVB 1KO4A 5FPTA 1ETTH 3B8HA 1M1YE 2H1LA 4Q9IA 1O3LA 1OV4A 3GCOA 3ZIAD 3ZZ0A 1IQHA 2VYFA 2PX3A 2EFDB 4I4LA 1GI7B 4DDUA 4WXRA 4ESVA 1ZJ6A 4SGBE 4MDFA 1DXPA 2F1JA 3GJ0A 1BO6A 1DX5M 4OS6A 1ZHRA 4KODA 1GL1A 4OI0A 3O8RA 4HSEA 1T3LA 3ONWA 3EAJA 4MYUA 4OHWA 4X1NU 1IN5A 4ZPXA 4KO8A 2ZU1A 4LUCA 4PC7A 2RKOA 3U9AH 2X2EA 1DE0A 1C5QA 1ZNZA 4P31A 4KLZA 3CS0A 3TU7H 3VR3A 1DOAA 1TNDA 2FFBA 5A8ZA 1VITH 5JBQA 3KJHA 1PLJA 1VITG 2VWNA 5H8WA 1P02A 1Q31A 3BSQA 2N42A 1GVLA 3ESTA 3SZNA 2QE7A 1E0FD 4FUBA 1SGFG 4EDHA 3URCA 4Y76A 1HIAA 3SOPA 4MITA 4ABDA 3GCNA 1FQ3A 4MRSA 2H9TH 2BZAA 3RXQA 4PPQA 2ZDAH 1SHZA 4Q4JA 3VR6A 1JEEA 4CREA 2J7PD 3C14C 3S1AB 3QENA 2BMGB 1BMNH 3AV0B 1HAPH 5JZVA 1W8BH 5FI1B 5D3MB 5AJZA 2AFIE 3UR9A 1FOEB 3OTJE 3W6PA 3SQXA 2YC4C 3SHWA 2XRCA 2ZI9A 5EE1A 3MOCA 2VVCA 3KTAA 3GY8A 1XMSA 4KELA 2PX0A 4TYWA 2J5XA 1XUJA 2FOMB 1XVOA 5HXFA 4CR5A 4PPGA 3F9HA 5B2ZA 3TNSA 2ILNA 1RKBA 1IHSH 2RGEA 2ORWA 1MBQA 2QENA 2RH5A 1C4V2 1O30A 2CMKA 2RGGA 2JLWA 3AKEA 4NCNA 1KDRA 1G3QA 1WE2A 5CIWA 1FZZA 1BZXE 3SUFA 3JZAA 1ZCBA 1AO5A 3N7OA 3NIBA 1ODFA 2XGJA 1T3SA 3F0TA 4LZ4B 2NO7A 1IHTH 1Z63A 1TNJA 4ESHA 2J94A 3STJA 3CPEA 3NBYC 3RM0H 1MTNB 2V6NA 1PV4A 4YONB 2F4LA 2QL6A 2DFLA 1OWIA 1HTWA 4URWR 2BWJA 1RRKA 3JZMA 1W48A 2AWOA 3OYPA 3Q72A 3L3TA 3NK8A 1U94A 1GG6B 3LVRE 3SU0A 4JYVH 2BY5X 2ZFFH 1QA0A 4PO8A 1XD8A 2PLXA 1XPRA 4O3MA 3P32A 5GVRA 4A2QA 2AIPA 1EPTC 4M21A 4UKDA 4NH0A 4XFQA 2CCKA 2GRJA 3TK5A 3PUWA 3FHTA 1OKKA 1Z06A 1BYIA 2THFB 3MNBA 2BMEA 2HVXA 2ZRJA 1EFTA 4X6NA 1L2TA 2AGEX 3GJ4A 4LV8B 1MAXA 3RWOA 2BEKA 3GPLA 3ZS9A 1KSNA 4RVCA 4OI1A 3U44B 3BIFA 1BOQA 1ZHMA 1U8AA 5GDSH 1AKYA 2Z3CA 3BB1A 4TMZA 4ZDKA 2AERH 1P03A 1CE5A 1HYQA 1G4AE 3I1FA 3RXCA 3A1TA 1ZD1A 2IS6A 3MTYA 3BGWA 4BLSA 1HYLA 5FTKA 1GJBB 2AD5A 1QQUA 2BDTA 3Q3KA 2C8XB 2CHQA 3A83A 4YLGA 2J1LA 3A89A 1MD7A 4J1YA 1DSTA 2G6BA 3TPIZ 4FMDF 5H70A 2BM1A 3LX5A 2ZRKA 1NLYA 2ONKA 4NU0A 2R65A 5CE1A 2R3YA 1IQIA 1W36C 1L4DA 1AKSB 2QY0B 2J7PA 3PYHA 3OE7D 1HLTH 4FINA 4MRPA 3LO5A 2O8DB 3FKSA 3MLEA 1LKBA 5GVSA 1FIZA 1KI4A 2F9UA 4ZXYH 3L0PA 3U6BA 2TIOA 1FTSA 2TGPZ 1M6NA 3QEOA 4IDQA 1XB2A 3RNLA 4JZIA 3I72A 3OHMA 1XUIA 2VRWA 3KJGA 2BD7A 4Q4AA 1NBMD 2GT7A 4AKGA 3KXLA 3EASA 2BDCA 1YE8A 3QY0A 4PQYA 2YOGA 4RSGA 3TRFA 1P09A 4ABIA 3KFVA 2R8RA 1XZQA 3NKKA 2BKUA 2ZSFA 1BRUP 3RS0A 3OF5A 2ZTSA 2OLKA 3SJIA 2ONJA 1JAHA 4EPTA 1KO5A 3E3TA 2G81E 3WBKA 3LH3A 3U7FB 1ETSH 5IT5A 1XKBC 3SORA 5TXGA 4MGYR 3CF0A 2STAE 2V8OA 4TL8A 2XW9A 3PLPA 2XZLA 4H1VA 3BD9A 1SR5C 3SJCA 2BDGA 5CK5A 3KKNA 3MJHA 2HCBA 2ZJ2A 3LLMA 1GCTC 3WNCA 2WPMS 3TH2H 4C0SA 4FMBB 1GBAA 4AOQA 2OFXA 1B23P 5J4KA 3C4JA 4B3CA 1II9A 3P6ZB 2OXRA 2GILA 3LQRA 4P4UA 1R0WA 2A4OA 3QUMP 3TLOA 2UZIR 4ZDJA 2F1IA 1MTNC 3ICEA 3SQHE 1DADA 1IQPA 3RC3A 3PTNA 4TYNA 4WXPA 5I25A 2BY7X 2QPTA 1SFIA 2C8ZB 5IF9A 4ZHMU 5CM9C 2Y80A 2PUXB 1HH4A 1D3QB 5TCAA 2Q6TA 4ARZB 1YRBA 1N8OC 2FV8A 1OT3A 2BBSA 1MKXK 2EYQA 4CRGA 1O3DA 1GBFA 3ZVAA 5JLJA 1ZU5A 4DC9A 4NMMA 1DAEA 3UKDA 2NTYC 2R2MB 2Q0HA 5IRCD 1BMFA 3P1JA 1H8EA 1FNNA 1UCYH 4YXWD 2J38A 2TBSA 4K2YA 3OY5U 2ZDLA 1DOJA 4NA7A 2SGQE 1XTSA 3TITA 3A4LA 4HUQA 4E05H 5K8UA 3A37A 2JLZA 2P93A 3BC1A 4BFXA 2P3SA 1T5IA 1JR6A 1Z1IA 2AH4X 2YZ2A 1VDZA 2WWXA 1ZOMA 4NZYA 3QXCA 4XWAA 3W5JA 3CPHA 4MYCA 4RZXA 3FGNA 5DI3B 4CDGA 3FZDA 1Y3UA 4I8JA 1LPKB 1X8JA 2ANKH 1IQKA 3WBJA 4Q00A 4CR9A 4ZKNU 3KKQA 2FOFA 3AF4A 2VSOA 1H4WA 7GCHF 3VB7A 2XZPA 1HT1E 1UTPA 3MWYW 2ZREA 1UVTH 1SVKA 3M5MA 3SN8A 1ELOA 2W6ID 2A2ZA 4V0MA 3IILA 3KEEA 1HAXB 1ZRBA 4HLUC 2QSZA 1X1RA 2ZS9A 4R0IA 1SULA 2EFHB 1LTOA 1NN0A 1XFAA 1TWXB 4YMVA 3RXIA 3LKWA 1GL7A 1THPB 1TTTA 4ZDWA 3TUIC 1AZZA 1H8DH 5C2JB 3GLFE 1GMHG 4NBSA 2OBLA 2SGPE 4ISOA 1JB1A 1XEFA 1UHBA 3BG4B 1Z6JH 4H4FA 3PMBB 3F9FA 1GCDA 4Z1MA 3RYTC 3TJNA 4TL7A 4MG3A 1N6HA 3OEHA 1O3PB 1E9EA 1GNPA 1U8ZA 1DELA 2N46A 2W26A 2B5TB 3Q7QA 2ODBA 2J3EA 4BFSA 1Q3XA 3SHAH 1O3NA 1AQUA 2ZCKP 4PHHA 1MMJN 1TGBA 1C5XB 1KK2A 3HGNA 1NN5A 3H4MA 3RMNH 4JLBA 4DLSA 4YT6H 4M4SA 4FUDA 1S1MA 1GDQA 3PV4A 4NPHA 3SGQE 2FOAA 1NU7B 4KJZA 3SBKA 3U3RA 2GESA 1RRPA 1ESMA 2ZHWH 4Q7KA 4I1OA 2ZEBA 4FMCF 4Z54A 2PEZA 4TQ9A 3ENSB 2XTZA 3Q85A 3AQ4A 2P3FH 2H57A 3FAOA 2FDCA 2CXVA 2GK7A 2IYLD 2REOA 1WA5A 1KY2A 1W2GA 5HCIA 1IQMA 1XKAC 1GJ8B 1P8VC 5LPRA 4WIAA 3PMAB 2PKSB 1LCYA 2B92A 4D2IA 4NDZA 3GJXC 4B3FX 3THXB 3LBHA 3A80A 4XH9B 1KY3A 1GGDB 5EXMA 1RE0A 2VIQA 3TVJB 2NU4E 1ESAA 4IN1A 5DISB 1Z6YA 4S2EA 1HAHH 1E98A 1GBBA 1W14U 3KDSE 2PZEA 4NYJR 1GMDF 1ZINA 3B82A 1C2IA 4DT7B 4MPWA 2VSFA 3A87A 3D31A 4XIGS 5FAHA 3BK7A 2ZCHP 1D8TA 4PSKA 4K1SA 1D6RA 2OV2A 2GMTC 3DZDA 5FOVA 3AVVA 1YQTA 2QAAA 2C77A 3GLHE 2QGRA 4BPBA 2C9CA 4GNKA 4I8GA 1NSTA 2FDAA 3Q3YA 5E2PA 1G7RA 1OFTA 3GOVB 1X8KA 1PQAA 1TEVA 4D6PA 2GGVB 1D3PB 1PYTC 5F98A 1IN6A 3TGPA 1KI1A 3RXUA 1IY0A 3OEED 5A8YA 4A7IB 3SGAE 5CM8B 4G5QA 4LJYA 3G0HA 1L4YA 3CRMA 2DHRA 1QHGA 4C9BA 4RSPA 1Z83A 2WWYA 2ZRMA 2DE9A 4XWKA 2FESH 2GZAA 2IPHA 1SZPA 3QZRA 1FMJA 2VP6A 2P6NA 4H9GA 3CNOA 1Z0IA 1NN3A 3U8RH 3SW2B 2E9SA 4WZAE 3ND8A 5B64A 2KAIA 4BFVA 3B1XA 1S2MA 4BEJA 4AG1A 5EPYA 2NGRA 5FBVB 1ACBE 3P4YA 1OPXA 1E36B 1W13U 2IYVA 3WYGA 3TW4A 2Z83A 3P92A 2H17A 1J99A 2CEAA 2CL0X 4B2AA 3VQTA 5T6DA 4LC1A 2QXIA 1RFNA 1OFIA 2IEZA 2ZRFA 2ZTZA 2HT6A 3UG7A 1YZTA 4LCBA 5JFGA 1QA7A 3GLFA 3PEYA 1ZNWA 2OZEA 4UQOA 4NL4H 1BTHH 3C15C 3SJBA 3X1XA 4A1VA 3AAVA 1UTKA 4NYJQ 1Z0FA 2HDNB 3X1YA 1FMLA 2WUCA 4QJ5A 3GICB 4D80A 2BIFA 1K21H 4D7GA 1OIVA 4X8SH 1CJMA 4MLFB 4PSAA 3IHWA 2DBYA 4AURA 1Z6GA 5F2EA 2F9MA 2BVXH 3SV7A 3CH5A 2XNIA 3U61B 5JS8A 1Z5ZA 2BQWB 3SYKA 1G2LA 2DWOA 2O8TA 3E8LA 2QN6A 4B2BA 1AIPA 3K09C 3G5UA 1W7AA 2ZGJA 3F8TA 2FX3A 2CVFA 1HIAB 1FJSA 1Z8GA 3H5CB 2WHXA 4YMSA 2QXHA 4BRWA 2XNSA 3BTGE 4IC6A 4Q1EA 1UTJA 2ZDVH 2IT1A 2BXTH 1CP2A 2BV3A 5I46H 4TY7A 4OBEA 4GHTA 1KI2A 4G1UC 2PKAB 3PMHB 3Q3XA 5JHHB 2VH6A 4XVRA 2BCGY 4IDHA 1FQKA 4P3YA 2H5EA 3OU0A 1E94E 3RXLA 5LBIA 1XU4A 4OJQA 2TPIZ 3CF2A 4U5XA 5SZJA 4PAMA 3B1VA 4NONA 1VJ9U 1U0JA 4B2CA 1QL9A 1F0SA 1E2MA 1TGTA 2XSZA 3M4YA 4ILEA 8ESTE 1T91A 1X86B 4RZ2A 2YJTD 3SGBE 3QI2A 1AFQC 2XTNA 1SQTA 3RU4D 1SGDE 3KX2A 5EE0A 3R9XA 1O3MA 4AY2A 4B35A 5P21A 5AUOB 2CVHA 4AN7A 3W9YA 5KPDA 3F9EA 1JWTA 1EX7A 3R7WA 2A1DB 3ZH9B 1Y3WA 3EW9A 2BEJA 1F5KU 3W90A 1TE0A 4OK5A 2DFKB 2ZITA 4MGZR 3W5IA 2BQ6B 1EX3A 2GXUA 1E2JA 1G8FA 3U4QB 3UMFA 4LZZA 1NRPH 2O8CB 5AUPB 1PUJA 2BVSH 3NHBA 1GMDG 4QHSA 4CEJB 2ZPSA 4Q21A 4US1R 3L43A 1LVMA 4F91B 1TBZH 5EZ6B 3SU8A 2GA8A 5CB8A 2FS8A 1QHXA 4OQMA 3ZVRA 1OS8A 1VG1A 3VKHA 1KO8A 1SVMA 1ZBDA 4GMXA 4HZUB 2GTBA 4D4KA 1WV7H 3I78A 4YESB 5E7JA 4XDEA 4PFSA 3ZZ5A 1W4BA 2BTCE 1CF4A 3LAWA 2QAGB 5EQSA 1KDQB 4TWWA 4MRNA 3CNNA 3IO5A 1OH7A 1N6NA 2ZRIA 7ESTE 1AS2A 3WHKA 2FLBH 3LGIA 4GLYA 3PENA 2RA3A 1FI8A 3P95A 3T1TA 1S96A 1J14A 2ZDMA 5DH9A 1O3EA 1NU9A 3LXRA 2BD8A 4A9AA 3SU6A 2FYRA 3ZZBA 3BF6H 3LIWA 3QF4A 3TLXA 1CQQA 4A0GA 3IO3A 2F9PA 1J2JA 4DJTA 2G51A 2FM2A 2QV1A 2QXJA 4WWYA 3UOUA 3IBYA 3PCRB 1IQGA 5C2ZA 1HT2E 5KDDA 2FS9A 3GJ7A 1GI1A 5AR1A 3V4RA 1E2HA 1KJWA 4I81A 2JATA 4JLMA 4KFUA 2RGAA 1XD2B 3NEYA 1XCMA 1II8A 5AWFC 1M7HA 1C1SA 1KXCA 1JR3A 1WBDA 1HV8A 5E0JA 2V3OH 1GWNA 1GI3A 5TVKA 3GLFB 2LPRA 1JRSA 3FMIA 2HLDD 2ZDNA 3QGNB 3K9GA 3HWSA 1DAIA 3OTPA 1RYHA 2GDDA 2I1VB 2A32A 3KHVA 4XVQA 1XTKA 3OEHD 1C1PA 5FUXA 1S9DA 1LHFH 1Z71A 1S3GA 1UBFA 1B0EA 1JBUH 3L82B 1SGFA 2P65A 1EZQA 2Y5FA 1O36A 2PHBA 4LWZA 3AVPA 1ELDE 3QWCH 3PXGA 3SUEA 1LVBA 4IMZA 2ZRDA 3VB5A 1EG7A 4TSFD 3K9HA 4XE4A 4ZKOU 2CK3A 5E2OA 4K8OA 1MO6A 4LJ6A 3VKGA 4M22A 4GOKA 1BA8B 2VLIA 1EGAA 2NO1A 5G53C 4H42U 2W2TA 4F93B 1QJ1B 3G82C 1Z8IB 2BLVA 1UEIA 5AK0A 4JLPA 2FXRA 4BAMB 1GAJA 2DFNA 1ELEE 2X8AA 4M1OA 1SGCA 3UQOA 1SSXA 3L33A 4X6PA 1N5LA 3VFEA 3QXJA 1DUEA 3RXRA 4LY6A 2WYGA 2ZU5A 1GL6A 3E16B 3CNLA 3VHLB 1IXSB 4YM9A 4FN5A 3B9PA 1ANKA 3AUYA 5JBTA 1XBTA 4EPVA 4RD4A 4MKGA 1G9IE 3RXDA 5FL7A 3ZZCA 1JPNA 2RHMA 3E2IA 2ZFSA 4H6TA 2W00A 3EWAA 2A3RA 1H8ED 1Z8JB 1C1OA 1DE7H 2H5CA 3M1IA 2ZI6A 1VCMA 2QBYA 1T9HA 6CHAB 1N5JA 5AF9H 2YOFA 4IXMA 1KTSB 2IHBA 4V0NA 3TAUA 1O3KA 1ZPBA 2JLRA 4IFBA 5HKKD 1ZJKA 2V9PA 1U0HC 2VWOA 1E79A 1YGCH 4A15A 4QM6A 3W95A 1DVRA 3CR7A 1C5WB 1VIYA 5FHTA 2QP4A 5FPYA 4JLOA 4A1XA 1P04A 1UJ2A 5KNBA 2EFGA 3ZVCA 2AN9A 3W6NA 3C8UA 1Z22A 3EPHA 1ORFA 2EWVA 4X1SU 4WOPA 4O3TA 3A88A 4K69A 1BMAA 2WV4A 4KKDA 2ZF0H 1FQJA 1E2DA 1KKLA 3PLKA 2ZECA 4QC2A 2RCEA 3PV0A 1KO1A 3SN6A 1A5GH 2PSXA 1CRQA 2IBMA 1BTPA 2J0UB 3KQLA 4I99A 1SVWA 4BFUA 2OSBA 1DWBH 4I1UA 2IS2A 4NFFA 6LPRA 4JKYA 4V0LA 3SBDA 2W2XA 1SXJB 1ZUHA 2ZHFH 3C41J 3PFIA 4FUHA 2XC0A 1TA6A 3D3QA 4AK9A 2HOBA 2VGCC 4LYHA 5JI3E 1OB5A 1XTRA 2AMQA 5F6MA 4RFSA 4EUNA 4DCVA 2WPHS 4B32A 4KTSA 1FUUA 4TTQA 2DYKA 2G3YA 1A7SA 2DE8A 3GP8A 3A7YA 1RJ9B 3MWLA 1KDTA 1YR7A 3Q3JB 1CGHA 4C2TA 1D2NA 2EFEB 4X2WA 3FANA 2PT5A 2YVUA 3TR0A 4LJ9A 4ZXXH 3SV6A 3S1AA 4Y0VA 1AD8H 4BTTB 4M9QA 2B8TA 2BBWA 3NH6A 3ZS8A 4NIWA 1G3CA 2WSMA 1QFKH 3ZZ4A 3KKPA 1TF5A 1AB9C 5KSZA 2CGAA 4AFZA 2J2UA 1BT7A 1P9UA 4GP6A 2WPJS 3MSXA 2HJGA 2O8DA 4Q18A 1NG9A 4QBFA 2LWIA 4M7GA 1P5ZB 4ACAA 1N25A 1NIPA 1WMSA 2CK3D 1P12E 1NRQH 1G3BA 5G3ZA 3I61A 2P94A 5HGGA 3QBTA 3BTQE 3LGVA 5EW1H 2GD4B 4O2LA 2XBVA 3BG4C 4IRUB 3UFAA 4ZDIA 1UK3A 8GCHF 3PM3A 4OS2A 4A6PA 5FOTA 2ZFRH 3KCGH 5L30H 5HZKA 1IM2A 1O5FH 4LK2A 2KJQA 2O0HA 3TW8B 4KP0A 2BKEA 2ZJ8A 5GJ4B 1S0QA 3SOSA 2ATXA 2PL3A 1DAFA 1Q3TA 4LV6A 1VG0B 5EP3A 1OIXA 3KTAB 1R8QA 5J4YA 1FY5A 1FV9A 5CHAB 3T61A 3MAAC 1JR3D 4BECA 3K6YA 3B1ZA 4DT1B 3QO6A 1QBVH 3WY8A 1JEDA 1C1UH 1DWDH 4HDCA 3K2UA 4B6EA 3M3TA 4MVNA 1JXOA 3FPAA 4BAOB 5KDLA 3VR1A 1DLKB 5LDDC 5L3QA 2REBA 1WQ1R 1V2ST 1NVWQ 1GVZA 2X1VA 4NSYA 4F38A 2FWRA 4N1AA 4DLYA 1B0UA 2G77B 3BJIC 2NOAA 1RIFA 5TCCA 3GLGE 4AYYB 2QEQA 1GBHA 3OIUA 3IIMA 3VB3A 1P4SA 2P59A 2Z4RA 1G19A 1A3BH 3P8FA 3VX3A 3FYHA 3EZ9A 4QHTA 1PJPA 2W5EA 4C3ZA 1YPMH 3STIA 1W10U 3MWIU 1KGDA 2GBLC 1NY6A 5G4BA 4KBFA 1SB1H 2G1KA 4P4SA 1AKSA 1JOUB 5KHOC 4GI7A 1P10A 3FE2A 1W46A 1K22H 4X6MA 2OXCA 1OH5A 1QG2A 3QXSA 1KK3A 1HA3A 2FOBA 3EPKA 3CF6R 4HUQB 1C4U2 3NWUA 1ZNXA 5EP1A 4P0TA 2WINI 1H9IE 1YCPM 2ZRPA 5BYJA 2EC9H 1P01A 1TPSA 1G21E 1K5GA 2C03A 1VIAA 2CJWA 2IX3A 5EU8A 3THWB 1KSFX 1BHXF 2ANMH 4OYHA 1PZNA 1FAXA 4JMYA 5EP2A 4RCYA 3A4MA 2FFAA 2YKGA 1SGWA 3ZZ6A 5CJPA 4QRHA 4QGHA 3DMNA 2AXNA 4US2R 1OPHB 4JZEH 1OSSA 1MRNA 3AVTA 4E03A 3MU0A 2VP5A 3CH4B 3R9IA 3CLVA 3THXA 5JJLA 2GNOA 3PO1C 2VHUA 4URVR 4BZPA 1VGCC 4V0ME 2ZU4A 3BE4A 1SQOA 1JQLB 5SZHB 1G64A 3A81A 1OXGA 3F9GA 3TGJE 1TX7A 3EPLA 1DPOA 1N6PA 4OL0A 2HT1A 2UWPA 5K8IA 3BH0A 2O0JA 1THRH 4DLTA 4MQAA 1T8OA 2PKAA 3CUEF 2ZUCA 3LC3A 4LHXA 2WSSD 1XMNB 1W12U 3FTQA 2QU8A 4KHZA 4ABAA 2I3BA 4JSTA 4KLNA 4Q47A 1GHWH 1OYTH 4PO9A 1R2QA 1V6DA 4RZUA 3IIJA 4XD7D 5EODA 1I2MA 4TYDA 1G8GA 1EESA 5FX5A 2YHSA 3RANA 2FX6A 2YWHA 2A4QA 5B58C 3THYB 1D2MA 3OAAD 4B6FA 4URYR 1NVVQ 4KCGA 1C2LA 4TLBA 3LT3A 1HB0B 4LBZA 3Q00A 4OK6A 2BOKA 4GSOA 3QKSB 1G3RA 2ZI3A 1EFUA 4EKDA 1KLIH 2D2EA 1L1GA 4Z6AH 1V2PT 1J90A 3R20A 2VTKA 1PFXC 1T4UH 1HXEH 3LDXH 2BMDA 3ZIAA 2FIRH 1XCGB 3LQQA 3WRYC 4DRZA 2ULLA 1EXFA 5FBEA 3QKRB 2WPLS 1UADA 3L0OA 2OAQ1 5JB8S 4A0RA 4GRAA 2C9OA 4MDEA 1ANDA 5IDKA 1UTMA 2WJGA 3GLGB 2ZAOA 1D9IA 3PEUA 4PAOA 1XX6A 1E79D 5AUNB 2C9YA 1SG8B 4LJAA 3LH1A 3AAUA 4TL9A 1UKYA 2PCJA 1AKEA 3KQUA 3BOSA 1R0ZA 5B57C 1KNQA 1QRAA 1G6HA 2Y5HA 3CRW1 5DE3A 1GGDC 4PPNA 1TGCA 3BTWE 1Z08A 3LFUA 3TNTA 4LK4A 4E7NA 2A5YB 3VR5A 4JL6A 5DPAA 1HPGA 1P9WA 2W7UA 1LO6A 1S81A 2STBE 4IS5A 5EXSA 3GCHC 2B7CA 1AN1E 3E0NB 5GADl 2H7VA 1C5SA 4URXR 2GDEH 3LDAA 5CK4A 4KI0A 3U7EB 1RGQA 2PKSC 1JALA 4RD6A 1UMAH 3UQVA 4KTCA 4NWLA 2JLXA 1LQDB 3B85A 5C3NA 3U3MA 1H8IH 1K8RA 1O5BB 3RAPR 2FJUA 1CBWB 2PTCE 1QVRA 1QB6A 2IC5A 2NU3E 1NRSH 2QTFA 1F60A 4MGKR 3L2OB 5ANRB 4AFSA 4QFMA 5LB2A 3GCTF 5DHFA 1QRXA 2OHFA 1FL9A 1DWCH 1GJ7B 4AB8A 1BBRH 3B78A 1NRJB 4LPSA 2BVNA 5FBIA 5HM9A 2FSFA 2WV9A 1BBRK 3SYLA 4DIEA 1OXXK 2QORA 3ZDQA 2BQ7B 1DXWA 4ZMAH 2SFAA 1TMUH 2P5TB 1M9UA 1MBMA 1CHGA 2P2LA 3N70A 5KDOA 3QGJA 3GLHA 4XOJA 1C5RA 2UUFB 1GJ9B 4FUGA 3O47A 4KBGA 4Y79A 3U1JB 2Z9IA 3ZYCA 2AS9A 4DEYA 4BLOA 5CB6A 1W0KD 4N0EA 1RTFB 1LS6A 3MJRA 3T27A 5EG4A 1JPJA 2VB0A 2G1JA 1E9SA 3QJYA 2BBTA 5C5NA 3MH6A 521PA 1G5RA 3ODFA 5AFZH 2AK2A 3FKQA 3SNBA 3KUCA 4LSGA 5KO2A 4NZQA 3U44A 3Q5EA 1TX8A 1AWFH 2ZTXA 5A0FA 3MH5A 4EFNA 1A3EH 5FOXA 3QBVA 2QQEA 4A1TA 4K60A 5BN5A 3RXKA 4MNWA 1SGQE 4AG6A 4V0KA 4JYCA 4US0R 1N6XA 1O37A 1FDPA 3GY6A 4ON9A 4D8NA 1GWAA 4NYIR 4YO9A 3CR8A 3ZYEA 3EZ6A 4GSYA 1JXPA 2XXLA 2A7JA 2XWAA 4MNVA 5CLLA 5LH8A 1DAMA 2VIIA 1MZDA 1NO9H 3RXOA 1K1OA 1O31A 1ARBA 3KQKA 1CBUA 3QN7A 3BEFB 1T7CA 3DL0A 1SGIB 3UWKA 3QPVA 3UATA 3LV8A 4Q9HA 1XRJA 3RLYH 5ETXA 2FGKA 2ZU6A 2OBOA 5ESTE 3CRQA 1GHXH 1UPTA 2HCJB 1Z3IX 1IY1A 3PB1E 1G3EA 1HNEE 1O2HA 2A7QA 3GLIA 2VIVA 1ESTA 3CRRA 1BOFA 4DLZA 4EPWA 1GL9B 1KMHA 4I8KA 3Q9LA 5IHPA 2F9BH 2J45A 4X8VH 4KSBA 4FCVA 4WW0A 1XX9A 5KNCA 2RGCA 3ZVBA 2GT8A 1CSOE 4G5OA 4WMEA 3RU4T 1N1LA 3DZ8A 1UKVY 1TB6H 1SGRE 2W2VA 4YMTA 1GOTA 1G16A 3VNVA 3SR0A 4TMVA 2WMOB 3VU9B 1UK2A 5DN6A 3PEWA 3IITA 2FNAA 3MG9A 4WXVA 2ZHDA 1M34E 3CO5A 3NXPA 4Y0YE 5AVDA 2FEQH 3ZZUA 3KB1A 4C0JA 2VO1A 3V12A 1UJ1A 1BIOA 5AFYH 4G0NA 3HDTA 4FU8A 3ZVMA 2W6IA 1C4Y2 1QHSA 4DZZA 2R2WU 4IVRA 3T25A 1RVDA 2G52A 1GMCG 4AGJA 4S35A 1ZM9A 5GJBA 1G4UR 1J17T 5B6LA 1DEKA 1Y3XA 2C93B 2O8CA 4Q2KA 4HLCA 3LXXA 1E2QA 2XTMA 2PZGA 1J8MF 2XSZD 3TVDA 1DVAH 5E0HA 4PR0A 2D7DA 4JLKA 4DKXA 5J4SA 4Q4HB 3E91A 3MFJA 4XJXA 4Q5IA 4DJZB 4UXHA 4BLQA 5L2ZH 1OWEA 4AYXA 1RXPA 1O2MA 2ZSDA 3QZQA 4YQFA 3X1ZA 4DIIH 4BEBA 1M74A 2CHAC 2A2QH 3VB6A 2ZSBA 4FCWA 1B7XB 3QG5A 5JWHA 2CL6X 4Y71A 1TNLA 2JETB 5HMAA 1KXAA 3O8CA 1TAWA 5T1VA 1GFIA 2F9LA 3CBQA 4F4IA 1KZGB 3GJ5A 4UJ3A 2IYWA 3FHCB 2UKDA 2CHAB 1V2QT 3KNXA 2RG3A 1KDPA 4QG7A 1JR3E 2BD3A 3RXEA 2IJOB 1S6FA 3GY2A 4YXWA 1R7RA 3T34A 2XXAA 1GSIA 1E37B 1FPHH 1J7KA 5SZKB 4YT7H 3OZXA 1GRQA 3A7ZA 3FMPB 1EWRA 2RGDA 3A84A 3S7KB 4IJMA 2A7HA 3A1VA 3THOA 5EXNA 1DY8A 1V2UT 3M3SA 4LZ1H 1II0A 6GCHF 1C2EA 1IAQA 5DHAA 5L2YH 1JJVA 2QA5A 3HU1A 2I6QA 1YPHE 1G5TA 1O3JA 5DG6A 2VH5R 4LRWA 1GJDB 3K9NA 2Q9AA 1CR0A 4KU4A 3A86A 3EAQA 3B6EA 4OQLA 5AJVB 1NS3A 4DSOA 2C78A 2J0VA 1ZSJA 1IN4A 3MO6A 1NZQH 2JETC 3ELAH 3A36A 2J0QA 4KITB 2PCLA 2DWQA 2AEIH 1JRTA 1E9CA 4URUR 1NFUA 4Q9KA 1LKAA 1SPJA 1T31A 1CLUA 1AWHB 4ZO4A 2CNWD 1BJUA 3N2IA 1VCNA 4ASUA 2WPDD 1VECA 3I73A 2ORVA 2J0UA 2B6HA 1EAUA 2CF9H 1LQEA 3QTVH 1KKMA 4L5BA 4HB4A 3K0CA 3LBNA 4XD7A 1G18A 4D9RA 4MYHA 3GLHB 1UF9A 2BLQA 3KQHA 2ZHEH 1GDDA 4PQRA 3RC6A 1MTUA 4II7A 1YPGH 3RRMA 1ZYUA 1E99A 1CKEA 4NCKA 1NBMA 5DP5A 1ZM7A 2ANCA 5A09A 4JK5A 4WJG2 1WBBA 1FPMA 2ZU3A 2ZVQX 3EC2A 1L0ZA 3RABA 1AFEH 1FFHA 3VU9A 3FFGA 4M1YA 3BB3A 2FFQA 2AHOA 1XUFA 2IYTA 4AGKA 3NDPA 4OGYA 1A7JA 4GOJA 3U3KA 1HUQA 4DSNA 1CBWC 2QMUA 3RRZA 4GL2A 3U7HB 1COWA 1L8QA 2LKDA 1ZUNB 2ODNA 4TQAA 2JAQA 1UTLM 3E1XB 2RAPA 1C1MA 3CKLA 2FMXA 1YC0A 1ZMJA 4HB3A 1P75A 1EX6A 5DP3A 3REGA 1P3CA 1N5IA 3A85A 3I32A 3SV2H 4ZKDA 3RU4E 2OUKA 1GKYA 3M0EA 5K8LA 3TSWA 4R2HA 6Q21A 4GVUA 1MQ6A 1ZYOA 3ADKA 2QNRA 3UMSA 1IQEA 2PGBB 3H84A 3K6ZA 4PHTA 5DI3A 3NZIA 3W94A 3RC8A 3MU1A 4FVBA 5GXPA 3BRWD 2ZNKH 2IYRA 4JYTA 1P0SH 4LI0A 5F8ZA 2ZR7A 3UREA 1SKQA 1YR6A 3HPTB 1B0FA 1W7GH 1C5PA 1CU1A 2NWNA 2REXB 4WMFA 1ZCAA 4DCTA 4C0AC 1OXVA 1QVAA 5FBLB 1BYUA 2A5GA 3W8RA 2IYUA 4B74A 5G40A 3VNUA 2ZI5A 2FH5B 3AVOA 2ZPQA 1FLEE 2VP9A 4N3NA 2PJZA 5E7MA 4DXAA 2ZJ5A 5KYKA 1GCTB 2V1UA 1NM6A 3SV9A 1L2EA 3WMGA 4RKFA 1FTNA 2GVFA 5CLQA 2Y8EA 1CXZA 3RSLA 1CA8B 3TIFA 2BMFA 1AFQB 5FI0B 1MAYA 1Z6TA 4OS4A 5JHGB 1N0VC 1XF9A 1O2XA 2DY1A 4B2PA 2OP9A 1P11E 3B1WA 1X8LA 2ZYUX 3M7QA 3P8NA 3SO3A 3E1SA 3CPJB 3E5HA 1I4DD 1FAKH 4PO1A 2PV9B 1E2GA 3FZZA 5J5CA 2AMDA 2AYWA 2GTPA 1YR8A 2BLWA 3J81k 2F9OA 1O2KA 5HYOA 1SXJC 2FLRH 2PR3A 3DVLA 3RC4A 3Q7PA 3OIWA 3UWJH 3TQFA 1E38B 1XZPA 4NIYA 1TOMH 1W5SA 4H6SB 3Q5DA 1GHYH 1G3UA 1SVPA 2R6CA 2UUYA 2V7QD 4IVQA 3NUMA 1MO3A 2VU8E 1O5DH 3ZQ6A 1JNYA 2X2FA 1GBDA 2GEVA 3T06B 4DEXA 3K09A 2Q6DA 1P62B 4M1TA 3O8BA 2QRZA 1AQYA 2QY9A 1W4AA 2O5VA 3T1VA 5FTMA 1M7BA 4FUFA 3PMJA 2JJ1D 4FUEA 2Z7FE 2FPKA 2JDIA 3TUZC 3RM2H 5ABWA 1LVOA 4Q7JB 2WWGA 3PQCA 2ZP0H 1W47A 4U02A 4Y0ZE 1ZSKA 2YNMA 2W0MA 3QPWA 1CR1A 4TLEA 2G0NA 1P2KA 5D3MA 1G1MA 1K5DA 3DPUA 2FMJA 1O2IA 1WYKA 4INLA 1DUAA 4OI4A 2G5VA 4QGFA 1MR3F 4KVAA 1O5EH 4Y11E 2FN4A 2R0LA 4WXIA 1G291 3JVVA 1MQ5A 1C5ZB 1J9CH 2QZ4A 2V1XA 1KXDA 4LYJA 1XEWX 2P67A 1VCOA 4X2XA 1P2QA 1E2LA 5EGMA 5GJVC 1E0AA 1S9HA 5K0HA 1H9LB 1W4CA 4C0BA 5GPIB 1A4WH 3LU9B 5CDFE 3EA8A 3SFVA 1RYFA 2FPZA 2PUQH 1BMFD 1DSUA 2XC5A 4C0HA 1UCYE 1LY1A 1G20E 3K9XB 4ZKRU 2IYQA 4CHAB 3U60B 3BN9A 2M5TA 4MUAA 3I5XA 3BTKE 2EI7A 3TIUA 1GDNA 3PVSA 4IW3B 4PX9A 3TJVA 2BJVA 1CVWH 4KGAA 1R8SA 3LH5A 3U8TH 2WJHA 1A4RA 1D3TB 3L8YA 3LY5A 1BB0B 3AASA 3K70B 1TMBH 1KDQA 5BN4A 5AJYA 4BZXA 3SNAA 1O2QA 4O9VA 1ID5H 2PTNA 1GITA 2I4IA 1NVUQ 3DT0H 1CS4C 4DLRA 1TX4B 1W36B 2ORIA 3T5GA 1PPBH 3DKPA 1A1VA 5BN3A 2ALPA 4UFDH 2IUSA 1DO2A 4MQBA 2BVRH 1FPCH 4TLCA 3MI4A 4CH8B 2QGNA 1QB1A 1P2TA 2QT1A 2R9VA 2P3TB 4QXAA 3H09A 2XCFA 2R6FA 2VP0A 1D2EA 3KGPA 1UKEA 3UANA 5BWMA 1NKTA 1T0HB 1C5UA 1OW3B 1ELCA 2NZJA 2ZM5A 5G3YA 2EVWX 4KFTA 4MKHA 1WRBA 3NBZC 5DGXA 4UDWH 2OC8A 1OXUA 1CJKC 3SC3A 4HAYA 2AX4A 5IK2A 3L8ZA 4ISHH 1TQ0B 3TQCA 5FOWA 3FVQA 2O8MA 4PROA 2SHKA 4DCNA 1GBMA 1XPUA 3PUZA 3I8SA 1GP2A 2WMNB 4U01A 2AKAB 2AMPA 4X8OA 1RC8A 1O3HA 1IN7A 3IQXA 4CEIA 1CULC 2WM9B 1G3MA 3HP1A 4NYIQ 1XEXB 1C9PA 1S6HA 5DYIA 2XJ9A 3EIEA 1JMOH 1TMKA 3U3OA 3QG1A 3NH9A 1NROH 4KFRA 4XSGA 1YLCA 2ZTYA 3PUVA 3SUDA 4LV5B 3VXFH 2ZETA 2OUAA 1OSNA 4IFEA 2VPPA 1TGNA 3CZQA 5LPFA 3DHKH 2WAXA 1MH0A 4MKIA 3M7UA 5F8TA 4LPKA 3QQ5A 4BTUB 6GCHG 2XZOA 3K0AB 1SHKA 4B73A 2X77A 3N2EA 2GZ9A 1BBRE 1DAHA 3RS3A 1YLDA 1IXZA 2AFHE 1OJLA 2FOLA 1EZSC 2QRNA 2ZJAA 5F3WB 1GKIA 1A0HB 3SV8A 2YC2C 4IOMA 2QROA 4AG2A 1WBGB 4IDOA 4D4JA 1E2EA 4UFEH 1G7SA 1EOLA 1FNIA 2VIPA 2ZRGA 4IKEA 4WA7A 1QRWA 5FOSA 1ZD8A 4HGCA 1AVGH 3LNCA 2BZ6H 2O8LA 1SKYE 2ZJOA 3LC5A 1DTSA 3TK6A 3VX4A 2IYZA 2JLSA 2AKYA 2QIQA 1OXSC 5TB5A 1N0UA 3GD7A 1RTKA 4NCHA 3SJ9A 4PTLA 4B75A 2JGNA 2NO9A 3BAFA 1R6BX 4IEEA 1OKKD 1UO6A 2ZG0H 3GQBA 1YCPK 2AFQB 2YINC 1EP5A 4X8LA 2GEUA 1Z0DA 2FODA 2WTUA 1CT0E 1QHNA 3A8DA 1ZM3A 1A82A 2NQ2C 2GETA 1MCTA 4MPVA 3B9QA 3BBPA 1LMWB 1KAOA 4A6LA 1LTQA 1ZAKA 3AK5A 1BTUA 2G4UA 3B8JA 1AUTC 1QQ4A 1NJGA 4DVGA 1F0UA 4K3JA 5AJWA 2ZGHA 1IOEA 2PMDA 1H8HD 1UVUH 3KXIA 3UMRA 1C2GA 2J41A 1TALA 2J92A 3IWMA 4A36A 4D26A 3A1WA 2KWIA 2CBZA 3GY4A 4DIDA 2A30A 4FU7A 4THNH 4CRWB 1BDAA 4GUXA 1DAGA 1GBTA 1FX0A 3ZZ8A 2TGAA 4U32A 2H16A 4BWYA 1H1BA 1W2HA 3BTFE 2F3CE 1HAZB 1NFXA 2A5KA 3TE6A 4DY7B 4IBLH 1M2OB 2BHRA 3FFBA 5BXQC 2D3WA 2JJ1A 2BMJA 4PC2A 1WQVH 1V2RT 1O2TA 1BS1A 1KDOA 3RXFA 4C2UA 1Q1BA 2B8OH 1EJNA 3I5YA 4Q4HA 1MUEB 4O03A 1O2YA 1C5OH 4NTZA 2V35A 3PO1B 4D81A 2WPIS 2ZXUA 1DBSA 1V5WA 2V7QA 2H8KA 4RJLA 3OIYA 1QNJA 4NYMR 4BFWA 4M9ZA 2XB2A 4R8TB 4MYTA 2IK8A 4PZZA 3P20A 1NL3A 1SLVB 4K46A 4D0GA 4JL5A 2BHGA 2GJ9A 1KK0A 3MFYA 5TJXA 4ABBA 3U5ZB 4AZ2B 4INHA 5BYKA 1K1PA 1CRPA 1KO7A 4M9FA 2FPMA 3SJZA 2YOHA 4F49A 2Y5GA 5JJKA 2WV5A 2FOEA 2XJ4A 2IF2A 3K1JA 1MKWH 3FP6E 2OD3B 3KZ1E 1L7VC 4L9SA 2CL7X 2BD2A 5F9FA 2CJWB 3TJOA 2E1RA 4JYUH 3KQEA 5FTLA 1GHAF 1UTQA 1QHRB 4MUBA 2IN2A 2DR3A 2GAOA 4YLQH 2H9EH 1YYY1 2QE7D 1T32A 2ANWA 1BHXB 3W3ZB 1IJEA 1UTNA 3RVBA 1NRRH 4O25A 4P33A 4I33A 1GPZA 1KJZA 1OHHA 2A45B 2GDJA 2R2AA 2JASA 3DM9B 4B3GA 3SNCA 3RDZA 3HYTA 5CMXH 1V2KT 5A2MH 1ZRKA 2IXGA 5DGJA 3A8TA 1OP2A 5A8XA 1ELVA 5C67A 1BJVA 2VWMA 3AM1A 1GI5A 4GT1A 1TL7C 3MD0A 4TWYA 1XUGA 5JS7A 2BOHB 1LHDH 4CH2B 2E87A 2ZEJA 3ADBA 1R4AA 3H7TA 3HJNA 1PPFE 4FXPA 4TT3A 2TRMA 1G2MA 1WU1A 2ERXA 2GJAA 2ZROA 3RXHA 3RRYA 1MU8B 1NT1A 3I62A 2C3SA 4BLTA 2GV7A 4AC9A 3FOZA 4A1FA 2QG6A 4B44A 3RXBA 4FXGH 2CE7A 2VF8A 3OFND 4JSYA 4NCJA 4EQ6A 5TMPA 1ZUIA 4V0OA 2R9PA 5L3QB 2QP9X 1W49A 3M35A 1FNMA 2IWHA 4MKFA 4WBSA 3AVWA 1QBKC 3AW1A 4PANA 2I1QA 1NMZA 3AVQA 4W5HA 2O8BA 4C4PA 1T3HA 2QYIA 3BIUH 1FMGA 1GNRA 3S7HB 1OFHA 4ZIRB 2Y82A 4CBNA 3EZ7A 5J40A 3EGKH 2Z43A 1AUJA 1NSFA 2ZFPH 2DFTA 2A7CA 3FVFB 4BOHA 4MGIR 2NG1A 3UWIA 1ZGVA 2C2HA 4NWKA 4EPXA 3H2YA 4G3XA 2ZZUH 1SGPE 4Q1DA 4J0QA 3B23B 3ZD7A 4URZR 4BFZA 4HLQB 3GDUA 4CEHA 1E0KA 2RGNC 2ZS7A 4X0WU 2XTTB 4TPYA 4O2RA 4TYQA 2O8FB 1C2MA 2R44A 5EXPA 5FTNA 1U9IC 3N5CA 2IS4A 2RCNA 3BB4A 5JSZA 1TU4A 3ZV8A 3UXMA 1GL0E 1JXMA 4A92A 1LW7A 1M8PA 1ELBA 2OLGA 3NBXX 3KB2A 4BUJA 3RLWH 1P2MA 5JEEA 1UM8A 3GFOA 5DP4A 2SNVA 4Q48A 1ELTA 3TNFA 4HAUA 4L15A 2BD4A 1F0TA 4D4MA 4C7OB 4CYMA 4ZV4A 2WJVA 1E34B 3A1UA 4ZI3A 2VF7A 2EI6A 2BCJQ 4MDSA 3GMTA 1GJ4H 3CX6A 1WCZA 1TNGA 1KI6A 4Y6DA 2JLUA 1EPTB 1HJAB 2QAGA 3IDQA 3F68H 5C20A 1RRCA 3UPEA 2N1BA 1U81A 2LCFA 2ZFQH 2ATVA 3Q76A 1N6RA 3B7GA 1ZIPA 2G8TA 3OEEA 4Q7LA 5KSYA 4PQFA 1KJYA 1QHHB 1YZNA 1LS1A 1KLTA 2BY6X 4YTAA 1XTQA 3AKDA 1EAIA 1BQYA 3MO3A 4CT4B 3LONA 1TQ6A 2VHCA 1CJTC 1YPEH 1K1MA 1S0UA 2W83A 1GNQA 3TVTA 2FZ4A 2JLQA 1HGTH 1OH6A 1XEXA 3ZD6A 1U0LA 1SQAA 3OFNA 1QTFA 4BANB 1QHHA 3IPXA 3PITA 1GJCB 3S9CA 3QTOH 1HV7A 4BTIB 4AKHA 3U1IB 3HATH 4CBOA 2Y81A 3A7VA 4JBYA 4TT3D 5HZHA 2ZC9H 5C1UA 2OE2A 4UJ5A 4RKEA 2QAGC 3F5FA 3SYJA 4ZHLU 2R62A 3GCHB 2ZR0A 1GKUB 4GMDA 4IW4E 1KSHA 3ETLA 4L16A 3V7TA 2OCYC 1C5TA 4MNXA 3THWA 4ABYA 2WAYA 3V0XA 2ANYA 2V4ZA 3NBFA 2D1JA 1ANEA 3KJIA 4BXWA 2J87A 1MKWK 2NU0E 4ERNA 2WZQA 1IHUA 1NC6A 1LVYA 1E1QD 1MABB 3VMFA 1V2LT 1KHTA 2ASEA 5EQTA 1RPZA 5SZIA 1AGRA 1OHHD 3FP7E 3CS7A 2EYUA 1C2KA 1O3BA 1P6XA 2UWLA 3T26A 1Q0UA 4XBBA 1WXRA 3WY9A 4ACBA 3EQ0H 3EG5A 3DHWC 1ZD9A 4ISNA 3O8DA 1AB9B 2VQSA 2FSGA 4BLRA 2JKHA 1OYWA 4HI0E 3UR6A 3CX7A 4JVNA 4LOAA 1E32A 4JT4A 2P3UB 2ASUB 1C2JA 2WJYA 3M5OA 2J4IA 4NP6A 2ZJBA 5A0AE 2FG5A 1ZW6A 1W0YH 2G83A 5H68A 2J34A 1TQ2A 1C2FA 5A4JA 1P3EA 3M36A 3TGIE 3NWJA 1PPZA 1US8B 2ZO3H 3GCGA 4Q1FA 2KAIB 1W3CA 1Q21A 5EXTA 1R0YA 5J4VA 2C8VA 1XJQA 1QY6A 4JK6A 3V13A 5GCHF 4NHOA 3HKJB 1KXBA 3LPRA 5FFMA 2GAAA 1Q2WA 5D3QA 1ELAA 2OC0A 3IBGA 4FD2A 1N6KA 2WPKS 1RFLA 4BFYA 1NLFA 4JZ1A 1CO7E 2H9HA 1BH2A 1MU6B 1VITF 3RMMH 3QF4B 4Y8ZA 4Z8YA 4JIMA 2F3TA 1GI9B 5A5GA 3L6PA 2V3CC 4I31A 4JVMA 2BD5A 2PW8H 1VTKA 2GF9A 1K9OE 2HALA 3ECCA 1OB2A 1EASA 1L4ZA 1U6QA 4VGCC 3K70D 3T62A 2OQ5A 2FOCA 1EXMA 1AI8H 3QVUA 4C7OA 4XWOA 3E70C 4RCZA 1HAYB 1E9BA 2FOGA 1DDJA 3CIOA 1PQ7A 7KMEH 3WXMA 4GBMA 2PBRA 5JRJA 3SU3A 2ESTE 2GEDA 3ZZ3A 1BTZA 1C1VH 1BMMH 3ODDA 1IOZA 2ZI4A 3IGFA 1CEEA 1O2RA 2CE2X 1S85A 3CENA 3C5HA 4ITRC 5L3SB 8KME2 1BTWA 1Z7KA 4SGAE 4DSUA 1E4VA 5JCPA 3VAAA 3KQCA 4WAUA 4NCYA 1AA9A 3ZJYA 4B1TA 3EARA 1TLDA 4YOIA 2ZI7A 1DAKA 3AUXA 1O3YA 3M61U 2P8OC 4KVGA 3KQDA 1TNHA 2ALVA 4HDOB 3TAHA 2DCUA 5JCZA 2G55A 1LHEH 1NPMA 1VKJA 4YLUA 1L1NA 2C95A 4DSTA 1J70A 1YM0A 1QL7A 1V2WT 3KIDU 4TN1A 3PJRA 5TDHA 1EK0A 2F43A 1QURH 4NGAH 4W7SA 3PROA 4UE7H 4A8JA 3ND9A 4LYAA 3U2QA 4ZROA 5FBWB 1AN0A 3R8FA 2Q3HA 1KYNA 1WCV1 2XOKA 1FN8A 5DNYB 1K1IA 1OYYA 1MTWA 1TF7A 4B34A 1TIOA 3MNXA 4OKSA 4Q1CA 4DBLC 2OO7A 4PZYA 1G30B 3BTTE 3GCTG 4BGDA 5EE9A 1N6OA 2WWFA 4FUCA 1O5GH 1YZGA 1SOTA 1W0JD 2EU8A 1O3GA 5KSPA 2WBLC 3DMDA 4K5ZA 3QOFA 4TZ6A 1GMHF 5JWRA 2O8WA 4DURA 3DKVA 2QMEA 3BORA 3JZ2B 4K8BA 1C1NA 2XITA 1NVVR 1H65A 2XBXA 4FVDA 5JPMH 4Q03A 1O2PA 3IQWA 2ODEA 3SU5A 1FW6A 1J8AA 5HTKA 3PWBA 5KOYA 1UVSH 2CN0H 2NU1E 1O2NA 1SI5H 1GHBG 3TK9A 2D26C 4Z8XA 2IF0A 4I32A 1CA0C 2WIBA 2AR7A 1O32A 1UVPA 2OQUA 2NPIA 1BMLA 2UUKB 1ETUA 3UG6A 4ZCIA 5FL3A 4UFFH 3GLGA 4QGAA 4JLJA 3UOPA 1T0JB 2Z3EA 3TK1A 5LD2C 3VR4A 3HU2A 2J59A 2A9KA 1IXRC 3M6AA 2C98A 1EFRA 2OLJA 3FKSD 3EWSA 1YZLA 2ZRNA 1TYNA 2Q1JA 2G4TA 1F2UA 5C1BA 3KXKA 1G36A 1XD2A 4EJSC 2Q3FA 1JAIA 5AUQA 1O39A 3NTUA 4X8MA 1Y8TA 2R6AA 2OBMA 1SGYE 3KJEA 4NYMQ 2K5UA 4ABEA 3H0KA 4ABGA 2VGCB 3I4LA 5DO9A 2IYYA 3ZZDA 2FF7A 1SBWA 1CJVC 2ZUBA 5LGOA 4O0MA 2VHJA 1SL3A 4KFSA 1TF2A 4IOLA 4Q9JA 1A5TA 1UFQA 3WP0A 1GHVH 2WWHA 1YP9A 2DPXA 3MNCA 2A31A 3AKCA 1SMFE 2QGZA 2DWPA 4Z0KA 1EATA 1WTGH 4DIHH 1VG9B 2FEMA 1O3CA 3SFZA 3GJ8A 2GBLA 2C4FH 4ISLA 2OBNA 2FPLA 4RN6A 3TH4H 2CHGA 5J4HA 2YOLA 1DITH 2FWWA 3LJJA 4V03A 2A0QB 2NO0A 1UAAA 1P2NA 3FHOA 4ABFA 1A2KC 1OIWA 3KL4A 1AK2A 3VTKA 2EEKA 1GM5A 1JJ7A 4HAWA 2G00A 3QVVA 1QR3E 1XMVA 1ZNYA 3NHAA 2BDYA 4NCIA 4X6OA 4PZLA 3VPKA 1S1CA 2WJIA 2XWBI 2C8YB 4D0LB 2VVUA 1O34A 3LGUA 1DS6A 1EUFA 1O87A 4RD2A 1YZUA 5SGAE 4RD1A 1NG1A 1TRNA 2ZGXH 3ZV9A 2Z3DA 2AK3A 1AU8A 3C5CA 1XDBA 2GV6A 3BH6A 4UFGH 3K0SA 3GDVA 4ZI2A 4BASA 5LD2B 5EXXA 3RUOA 5IDVA 1AS0A 3WRXC 2AIQA 3M3VA 1UEJA 1O38A 4M9SA 3U69H 3EZ2A 4LBWA 2FP7B 3S0NA 1XP8A 4LJ5A 2X19A 1W0ZU 1LF0A 3K8YA 3ZZTA 1TNIA 4HEJA 1AHTH 2ZDKA 2VBCA 3BTME 1ESNA 1V43A 1ZU4A 4X8HA 2ZYVX 2GHIA 4CEIB 3SEAA 3EZFA 1BRBE 1KI6B 2JH5D 4RKJB 3E90B 3ASYA 3SJKA 2MMGA 1ZIOA 2F9VA 2BM0A 3MWKA 4JKIA 2XX3A 1FX0B 1WDTA 3X1WA 1YPKH 2BDIA 1QCPA 1F2TA 2J95A 2C5LA 1GBLA 2BJWA 1E1RA 4KSCA 2IJD1 1TAGA 3RDPA 1UVOA 2SGAA 1R5OA 1EFHA 1G8YA 1C4OA 1K6MA 4ABHA 4WVPE 1KNXA 4DLVA 3GY7A 4B48A 1O2LA 5FR1A 3UPUA 4A2PA 1S8FA 3E6PH 1D6WA 4MRRA 2MMCA 2OG2A 3MRSA 3T12A 1VGCB 1NN6A 1KIGH 1H8HA 3VXEH 3BFKA 2FA9A 4RFSB 4R71A 1O35A 3AH8A 1SLUB 4WZ6A 1SGTA 2VWLA 1SKYB 2ZYWX 4L4UA 2KB0A 4C0LA 3EYDA 1NVXQ 1UK4A 1Z29A 4ARZA 4FIDA 1SGNE 2V3HH 2ANBA 4NSVA 5FX6A 1D4PB 1V2OT 2P6UA 1FY3A 2BX3A 1ZVQA 3VEQB 2PJRA 3AVUA 3T15A 3C7KA 1RS0A 5CJ2A 3AF0A 3PEVA 4I8HA 4XOIA 1VG8A 4YOJA 2V6IA 2F6RA 1G17A 2ZANA 5KUTA 4LJ8A 4A8JB 421PA 3LX8A 1V2NT 3LVQE 4MRVA 1Y59T 1OXTA 2AL7A 1SXJE 1E0SA 1MH1A 3RXAA 4B71A 1V2MT 2HRVA 1FN6A 3EPJA 1RW4A 1ETRH 4AYVB 2HWLB 1T4GA 4FUIA 1AY6H 1MKYA 1O3OA 4XSKU 1KI7A 4XVUA 1TFXA 2ODPA 1KMQA 3VHXA 1GBJA 1OWDA 4Q7ZA 4R98A 4OS5A 4IEIA 9ESTA 3UNSA 3MYWA 1CT4E 3JVUA 4Y7AA 5A0CA 2EW1A 2EFCB 1O2WA 4K8YA 2QTVB 4M0LA 1D9XA 1Z28A 1COWD 3QIAA 2O8BB 2IOTA 4LBYA 2GCHG 4TYYA 1X1SA 4G5RA 4CRFA 2LKCA 1E2FA 5EPNA 3DM5A 5HCNA 7LPRA 3R8CA 5FPKA 1ESBA 3RRNA 1XWIA 5CITA 4UNRA 3A8BA 1SGEE 3KQNA 2CV3A 3HR7A 1K28D 1T6NA 1C1YA 3CM0A 3SU4A 1P72A 2CF8H 2IS1A 1AZSC 2KSQA 2W6JD 3U4QA 1BTYA 2AGIX 3HK3B 3FFAA 1OLOA 3PLBA 1EFCA 4P4SB 1ARCA 1NLZA 2IA5A 1QHYA 4E09A 1VYTA 1A5IA 1CR2A 1VHTA 4UNSA 2CJIA 4M53A 1UDWA 4CF7A 1P3JA 2CLSA 1Q12A 1ZPZA 3RSOA 1F5LA 2JJ2A 4GPGA 1KY9A 3LLUA 4LHZA 2YWEA 1W2KH 1BTXA 5DP8A 1ANBA 2XCNA
chains in the Genus database with same CATH superfamily
3C85A 1F51E 3GYMA 3HPQA 5ESXA 1HBTH 4GKKB 5CVUA 1BCSA 3EFOA 1RJDA 4L8YA 4RETA 1FVXA 1EJMA 2HRBA 1SBCA 3MWDB 2WPDA 4Q15A 4WDRA 4ZAYA 4CM4B 3ZG6A 3T1QA 4ASUD 3O8LA 4DDTA 3HNOA 5A3RA 1GZSA 3LL7A 5CYPA 4AROA 4JJZA 2WJJA 4HZUA 1L4UA 1Z07A 4QNMA 1ISFA 1EQAA 1DRUA 3P26A 1T6XA 1D2GA 3LSYA 4BN4A 2DZDA 2PMKA 3LYLA 4R9RA 1B5GH 1NZJA 2NX2A 5CT5A 5L3RA 3OCXA 3HKIB 3MH7A 1C5KA 1ZPCA 1PQWA 2OBFA 3L46A 5IH3A 4D0NA 1AGNA 1LVGA 1EM6A 1RHJA 1ZLXA 2VP4A 4K2AA 1I7PA 4F6CA 2C3PA 2ZRAA 3BE5A 5THXA 1Y3AA 2IODA 3BWCA 3DNFA 2PUEA 1I2ZA 4UQPA 5EJFA 1ZTKA 1RD3B 1HLDA 1U7UA 1X94A 2F67A 3N8HA 4TSKA 3T3NA 2AG0A 2OXEA 3EE7A 4WBNA 2HJ9A 3KL6A 1KOJA 3HDVA 4PG8A 1LPGB 2FE1A 1KI8A 1WABA 2W6ZA 3G0BA 1J8YF 1L4HA 4Q19A 1JEYA 4R6XA 2ZIQH 1Q1AA 3QWFA 1K9SA 4JASB 4B4WA 1AE8H 3VR2A 2RHDA 3WB0A 1M8GA 1RBMA 1LPMA 1ABFA 3EVEA 4CUKA 4BQIA 1SG0A 1E96A 3QVWA 2PKQP 4W5JA 5IM4F 1X39A 5PNTA 1U9IA 1FRQA 2RHJA 4HOYA 2HTFA 1NC3A 2PAAA 3NWPA 3G9UA 1PE0A 1C5VA 1D8AA 1U3CA 3RJ5A 3ADDA 1A9SA 1D2CA 1DXHA 2BDEA 3M1AA 4LRSB 5FWXB 3CCBA 3MCVA 1TZKA 2GVDC 3L04A 3JR3A 1V3TA 2YVAA 4YPVA 2BLOA 1VM6A 3AR2A 2HA7A 2E5LB 1SWWA 2Z6AA 4Q1BA 4G9BA 2FW7A 4XQEA 5EZYB 4KQ2A 4D98A 1FLDA 2QMOA 4BNUA 5KTYA 5CHAC 2PVCA 2L69A 5AOBA 3SHTA 3TMKA 2IPXA 3KDAA 4GKBA 4PU0A 3ECAA 4X1YA 3IESA 1OOKB 1YU9A 3COVA 3K8OE 3MNSA 3VYVA 3FKJA 4CMCA 1VJAU 3P0EA 1UBUS 4Y8XA 4K3VA 4AO8A 3ZVFA 4BVBA 1TUEA 1SXJD 3QVTA 2VUTA 1JIMA 1PWEA 3PT5A 5JZOA 4ZUHA 4FFRA 1NOJA 3UOAB 1Y3BE 4O33A 2WUBA 2KW5A 1NUTA 2VVVA 2ZGBH 2AG5A 3DVQX 4KQ1A 4ZQFA 3OF3A 3CXUA 4NFHA 2GH1A 2XXAB 3RC5A 1IYZA 4IDPA 2HV8A 4ITVA 4W9MC 3G0OA 1SOZA 3O31A 3GK3A 2HNBA 1PYOA 1EUQA 2VFAA 3O9VA 4DMHA 4FWTA 4YMUA 3DD1A 2IZ5A 2OCIA 4UPVA 4UXIA 3ZXYA 4UOZA 2CXPA 3BYZA 5KU1A 3ELYA 2A2XH 1ZH6A 5JMWA 2K7FA 5JBCS 1QIDA 3ZWCA 1ONPA 5C8VA 4CETA 1ODTC 1TBQH 3UMGA 4TRRA 2ZRLA 2ZUVA 3GUUA 3VV2A 1Q44A 3JVDA 5CVTA 4MZDA 1E5QA 2LTAA 3F3SA 6YASA 3D7RA 3QQPA 1Z2AA 2OD9A 1YHNA 2Z9DA 2B37A 4X1PU 3EEBA 3F71A 1B26A 4TS4A 5CXQA 5DRYA 2QRUA 3HCOA 4M0PA 4UM8B 3SS8A 1GUAA 2H0QA 3NTXA 2IEDA 6LDHA 2BGRA 1DLIA 1B2RA 4E30A 4YCNA 3V7YA 1T1IA 3C6MA 3T54A 5EQDA 1VPLA 3HBJA 4BO3A 1NYLA 2A92A 3GFFA 2BFMA 3BKWA 3GGCA 3I2YX 5B1DA 3AF3A 2OZKA 4ZZ1A 2C2ZA 4NZOA 5H3CA