5FPSA

Structure of hepatitis c virus (hcv) full-length ns3 complex with small-molecule ligand 3-aminobenzene-1,2-dicarboxylic acid (at1246) in an alternate binding site.
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
642
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords HEPATITIS C VIRUS FULL-LENGTH NS3 COMPLEX
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
total genus 202
structure length 642
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5fpsA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fpsA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5fpsA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpsA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpsA03
1XKAC 3MAAC 2YWEA 4EUNA 2BJWA 2BDTA 1ORFA 3GDSA 2FE4A 3OEHD 2JETB 2GHIA 4DGJA 3CO5A 2XJ9A 3PWCA 1V2NT 1FMLA 2CVHA 3H09A 2ZI2H 3Q3YA 3TK5A 3D3QA 3N5CA 3RLYH 4GUXA 3AKYA 3CR8A 3QXHA 4P4UA 3ELAH 1AQUA 1P60A 1OP0A 3H2YA 4IW3B 4M1KA 4Z8YA 1EAXA 1KO1A 4DT1A 5DK1A 2OXSA 1G291 4Z51A 2XEXA 3FMPB 4I1VA 1D6WA 4OQXA 3TQFA 1KI1A 4I32A 4Y7AA 2F1HA 2CCGA 1TNJA 1Z0AA 1SQOA 9ESTA 4C3ZA 4URXR 1TL7C 3PEUA 2BD8A 1XVMA 5GJBA 4ZI2A 2B8OH 5LPNA 3M6AA 3EIHA 4JL8A 1GTVA 3VXEH 1OXSC 1V5WA 1CP2A 4B47A 1XX9A 1GBTA 2O8FB 3L0PA 2WKQA 1CR0A 4O9VA 4JYCA 1XU4A 1ZTJA 1ZIOA 3F9GA 1EWRA 4ISIH 5DG6A 4B2LA 4G0NA 4LHZA 2QE7A 2RGXA 1DUAA 4Y0ZE 4BLQA 1QY6A 3SHCH 3RM2H 2JLYA 3U7FB 3GLGE 3M5MA 1C1UH 3FMIA 1AM4D 2BKUA 2VVCA 1O3HA 5FBWB 2R9VA 3HWSA 1F60A 3MJRA 4CEIA 1MAYA 3ASZA 3JZMA 2IYQA 1U9IA 1GG6C 2BVRH 1EX7A 2IBMA 3FKSA 2J9RA 1MT0A 2AL7A 4MRRA 2XNDD 1E96A 2YOFA 1H4WA 2QXJA 2O8MA 3FDIA 1OB2A 4WOPA 4MKHA 3U3RA 1SLXB 4XIGS 3AKCA 4KFTA 2QXHA 3B2EA 2E87A 3WMFA 4ESVA 3AF3A 4FMCF 1IXRC 2WWXA 1ZJ6A 2TIOA 3VR3A 1O3YA 1GM5A 1HPGA 2FOMB 1KAOA 3PO1B 1AB9C 1RIWC 1WCV1 3CR7A 3LC3A 4M9XA 4WH6A 2GDDA 4JYUH 2B9LA 1HFDA 4PO9A 1ZLRA 4TQUS 4YDHB 1DEKA 5BXQC 4Q4JA 3A4NA 4R71A 1YPGH 1GKYA 2BIFA 3SFZA 1E1QD 4D7FA 1JAIA 2FNAA 1J7KA 1VCMA 1AZZA 3NBYC 1E79A 4M1YA 4MRVA 4FCVA 2JJ8A 3TLXA 4TPYA 2ZDAH 4CT4B 4TY7A 1XPUA 1QB1A 5KYKA 1P5ZB 1OP2A 1EFRA 1RTLA 1G5RA 2Q3FA 3BK7A 3UFAA 3MI4A 1BBRE 4X8SH 1TUEA 4NSVA 1BIFA 5JBAS 3TK1A 4KO8A 2IPHA 1LW7A 3AKDA 3UPUA 1C5QA 4M21A 1W4CA 4QRHA 3STJA 2BB4A 2R44A 1YPHC 2WINI 5CMXH 4HSEA 1NFWA 1QDEA 3SQWA 1DO0A 3SGAE 5B64A 1K1IA 5EU8A 1W48A 2ZSBA 2A31A 3WYGA 5FCRA 4CHAC 5ETXA 1A3BH 3GY2A 1SGPE 3SU8A 1QBNA 2F9UA 1PFXC 4QGFA 2KE5A 4K8YA 1N6OA 4HZUA 3X2SA 3GCTG 3ZYDA 4DCDA 4IN2A 1F3OA 1W46A 3VR1A 2H17A 3GJ5A 2O8DA 1KI4A 2VIWA 1W2HA 1NG1A 1Z71A 2QP9X 4P4TA 4QJ3A 3DKPA 1HE8B 4FN5A 4PZYA 1CSOE 4VGCC 3EG5A 1S84A 5IT5A 4MRNA 1ANDA 2OC1A 3LGYA 1IQNA 4DLZA 1A2CH 4NPHA 1VKJA 2XWBI 4NHOA 3ZDQA 5LPFA 1OFTA 1W14U 4MKGA 1N6XA 3MLEA 2ZGBH 2C78A 2BDCA 1E1RD 3ZQJA 4FW9A 1D2NA 2NMVA 4A36A 4A9AA 1QG2A 1ELAA 3HGNA 2C5LA 4E5UA 1SXJE 1WBBA 1IHUA 3U5ZB 1CTQA 3PITA 1OFUX 4DURA 3ZZ0A 2HNTF 1U98A 3BTTE 1HJAC 1A1RA 4EPXA 2P94A 2J0UB 3KHVA 1N0VC 5CLQA 3KNXA 4DJTA 2JGNA 5H70A 1ZOMA 4KITB 2AGGX 1GI9B 3NDBB 2XBVA 4FUHA 2DWPA 2WWHA 1LQDB 3V0XA 5ABWA 1QRAA 2XXAA 4G01B 4C2UA 4M1WA 3BTHE 3UNSA 4DHEA 3H0KA 2ZYWX 2VIQA 4HUTA 2VSOA 1ZRBA 2XTNA 3WNBA 2FDCA 1YZUA 4ASUA 1YRBA 4NCYA 3X1YA 4ISOA 4CT5A 1KXAA 3P17H 3WP1B 5CITA 4HZIA 3KQEA 2GXSA 3MWYW 4ABYA 3EPKA 1MKXK 4UNPA 3SOSA 4M53A 3NH6A 3H4MA 2RGNC 4G5RA 1NMZA 5EQTA 2IT1A 2GZ8A 2V3CC 1UPTA 3LH5A 4IBLH 4Q7XA 3TUJC 4UJ3A 1XUFA 1UTOA 1FAXA 2ZHEH 4YLGA 1AKSA 1MTNC 4X1PU 3CPJB 2ZDVH 1J14A 1R5NA 4E22A 3UKDA 3ZV9A 2P59A 1ZNZA 3LGVA 1LB1B 4PSVA 5FL7A 4MDEA 1HYQA 2Z3CA 5JB9S 5FBRB 2O8EA 4ACBA 5CYPA 4PSAA 1Z8JB 3SV9A 4FMBB 2A4RA 2R6AA 1GBFA 1E9DA 2GCHF 3UG7A 1LMWB 4Z8XA 1DAEA 3BH0A 5JYIA 4I8KA 1QRXA 2HLDD 2TGDA 4E07A 1E2JA 4Y8YA 1GHBG 4G5GA 4B6FA 2QCYA 4QL3A 2ASEA 1JEEA 4P33A 2YJTD 1O2HA 2Z3DA 4GCHF 3TU7H 8OHMA 3NK8A 1XMSA 4E05H 1WQSA 4C0QC 4KSCA 2Z94A 2R3UA 1UVPA 2QENA 5TMPA 4S35A 1YE8A 1JR3D 4Q9LA 1H8EA 2QT1A 4LGMA 1BUIA 5FBVB 3K9NA 3GCOA 2F9OA 1QGFA 1Z1JA 5JSZA 3AK5A 1CHGA 1TTTA 1GL6A 1E38B 1E9SA 1O2UA 3AVTA 2ZU0C 1QG4A 3EPJA 1Z0JA 2AH4X 1EPTC 3V12A 1FW6A 1G3QA 5KTYA 1QBKC 2VHTA 2P5SA 4CBOA 2SNWA 3EX7C 2PKAB 2C8VA 3Q5EA 3SOPA 2EQBA 3DFLA 521PA 1IXZA 2IJD1 4LBVA 1N6LA 1SMFE 2QTVB 4M9ZA 1S81A 3MYWA 2BX4A 3B82A 2ZANA 4NA8A 2ESTE 4LYAA 1ZM3A 4A0RA 2NU4E 3SJAA 1JB1A 2W6JA 2HPQH 5KU1A 1BCUH 1V43A 1P3JA 1TX7A 2J2UA 1IY0A 1CGJE 4D4KA 2ZITA 4XBDA 2ZU4A 1UTNA 4ZDIA 4QM7A 2R6CA 1O5GH 2ORWA 3HGPA 1ZNXA 1Z2CA 3NKKA 1GL0E 4PPQA 8GCHG 3AF0A 4YOIA 3U3OA 1Q3TA 3RC8A 3K70B 1KI3A 4MTBA 1P9NA 1G8YA 2RDLA 1T6NA 1RW4A 4W9MC 5GJWC 3T61A 4JZKA 1C5YB 4AYWA 4K60A 1E2MA 1KXCA 1E36B 4JZ1A 1Z29A 4DCVA 4L9SA 3DMNA 3QEOA 2A5AA 3R9XA 3A84A 4DSNA 3I62A 2VP2A 3PWBA 1O3DA 1CULC 1GVLA 2A5JA 4LJ6A 3SJZA 1C5TA 1DWCH 4JLKA 1WP9A 1NPMA 2VO1A 3Q3JB 4JVLA 3Q72A 3QEJA 2QN6A 2XSZA 1P05A 4LOAA 1GBEA 5JJKA 5HR5A 1G16A 1P2OA 2D4HA 1Q20A 2VH6A 3DM5A 3Q5DA 4ASHA 1IHSH 1HAOH 1T91A 2VF8A 1NBME 2FSGA 1XPOA 1G7SA 2ZP0H 1OWDA 3QK1A 3TBKA 5L3QB 5B6OA 3FAOA 1GBKA 4P31A 4Q4HB 5TXGA 1ETUA 4JSYA 1Q0UA 2QA5A 1WXRA 3VB3A 1XWIA 2ZPSA 1HH4A 1FONA 1MD7A 2ZJOA 2SGDE 3SS8A 2DYKA 3VB6A 3LBNA 1EZXC 1KIMA 3DL0A 3KTAA 4YMSA 4A1XA 2ZQ1A 1OE0A 1GZSA 4M0LA 1C2LA 1TGBA 2WOJA 3RXRA 1QL8A 4GBMA 3S1AA 2AXNA 4JMYA 4YO9A 3EA9A 2Q6FA 3LRPA 1GBCA 3BFXA 3VAAA 1BRCE 2W58A 3U9AH 5HTKA 4R8TB 1P02A 2D2DA 4HFPB 4LPKA 3VX3A 4LZ4B 5JEDA 1GJ9B 3SO3A 4B74A 1J17T 2CN0H 3E1XB 1O3BA 1ETRH 2QE7D 4FUCA 5HCIA 4QGHA 3THOA 3S7HB 3GLHE 1C1VH 3OESA 1GBMA 1K22H 2JLUA 5HM2A 1DAHA 1XZPA 5EP2A 3TGPA 2Y5HA 4B3XA 4DLSA 3KXKA 3QUSA 2ZTYA 2AMDA 2C90B 1ZC4A 2TGAA 4PAMA 4O25A 2A7QA 3DPUA 4E7NA 1U6QA 1KK3A 3FKSD 2OK5A 2FOCA 1YCPH 4RFSB 4THNH 1CT0E 4YXWD 4A8JB 1HYLA 2Y6TA 1X1SA 2BYAX 1NBMA 2G8TA 4X0WU 1HQYE 1TQ4A 2CGAA 4JCNA 3AEZA 4ZH8A 1E37B 2DR3A 1NF3A 4ZXYH 4MLFB 5DP5A 5DI3B 3N2EA 2VHQA 1PPGE 5J4HA 5GXPA 1A0LA 1WYKA 2JDIA 1ABJH 1BDAA 4HAWA 5CK4A 2REBA 4GMDA 3AP1A 2ZU6A 4TYQA 1SVKA 1QRWA 5A0AE 4DBLC 2GCTB 3MU1A 1E0JA 3P1JA 1T4UH 1E6CA 1SB1H 2O52A 2GJ8A 1E79D 2ZFTA 5M04A 3SNBA 4BASA 5HCNA 3HU1A 3VEQB 2UWLA 4IDQA 5EE9A 5T3HA 1XMNB 2W5EA 1KJWA 3S9AA 5CB8A 2ZRBA 1EFRD 1T32A 1GKIA 3Q3XA 3HKJB 1OJLA 1Z6GA 2C8XB 2RA3A 1RRCA 1LPZB 2B92A 3QKSA 1J15A 1VCIA 3GLIE 2QM7A 3STIA 3RAPR 4JZFH 3CX8A 1U90A 3CRVA 4JLOA 2WPDA 2VU8E 5GCHF 5A8ZA 2QG6A 3GLHA 1ZM2A 3SR0A 2XZOA 2ZJZA 1O2ZA 3CX6A 1MKYA 1YC0A 4EPTA 3I29A 1N1LA 1U9IC 4I1UA 2VH5R 2QTFA 2BD2A 1QB9A 1O30A 2CXVA 3PLKA 3N2IA 4PPFA 2R6FA 1G9IE 1N3BA 1UHBB 1O2QA 5F8TA 1DAGA 3AM1A 1DAIA 3LQQA 2WJVA 1DVAH 1Y59T 2XW9A 2PCJA 1BA8B 1HT1E 1SHYA 1KSJA 1V2LT 1OP8A 1S3GA 1I2DA 2FGKA 4CRAA 3F5FA 3GLFA 1LQEA 2QPOA 2PTCE 3TH2H 1W4BA 1C5ZB 1CA0C 2G9NA 3Q7PA 4PO1A 2BOHB 3PUVA 1AKYA 3EARA 1SGQE 4QHSA 2FP7B 4FVBA 1OF1A 1AFQC 4TT3A 4XTCS 1PUJA 2BMFA 1F48A 5EODA 4LBWA 4WH8A 1N6KA 2A5GA 1UF9A 4DW2U 4GAWA 3AVYA 1LTQA 2VWMA 1GJ4H 4TWZA 2GJAA 5HPYB 3P8OA 1GMCF 1T7CA 3LIWA 1VIAA 3TVTA 1DFPA 5KNDA 1KDPA 1Z08A 3GLIA 5EGMA 5K8LA 2ZCHP 2LWIA 5DNYB 1GG6B 1C5UA 1S2MA 1IN7A 2AN9A 1GOTA 4CR5A 3V9PA 1Y3XA 4XE4A 4FCTA 4D7GA 3E16B 3RRMA 1TRNA 1TU4A 5EP1A 1W0YH 2RGEA 1RZ3A 4Q03A 2G77B 4Y10E 4XBCA 1IM2A 1V2MT 1ZIPA 1JIRA 1CJMA 2FOGA 1NRQH 2W2XA 4ZAEA 4ASUD 4MQAA 3U4QA 5CK5A 5F8ZA 1D9ZA 4UEHH 5C5OA 1AB9B 1T5IA 2P67A 3Q85A 2W83A 3VGCC 2N42A 2ODEA 1FZQA 2IYYA 4NA7A 1A61H 4BFZA 2GZ9A 5F9FA 2R2WU 3H84A 3U69H 3SI4H 3IHWA 3Q9LA 4HB3A 2A5YB 1R6BX 1GI7B 2Y5GA 3BERA 2D74A 1P2VA 1PUIA 1C1RA 2OILA 3CS0A 1AFEH 4WMDA 1UDXA 3F9EA 4B6EA 5KNBA 1KSHA 2FOFA 4IOMA 3S7KB 2NZJA 4FWIB 5GJCA 1P6XA 1XUGA 5T1VA 3GCNA 2ZAMA 2GEUA 4AKIA 1XD2B 2ALVA 1WTGH 3VQTA 4JSTA 3LJOA 3P4XA 2H1LA 2IEYA 1VECA 1YCPM 1ESMA 3P8NA 4OS7A 4BFXA 5HZKA 3TSZA 3BIUH 1W49A 2BOKA 1W0JA 4MGKR 1C2EA 4WJG2 4G5QA 3L8YA 2G5NA 1P9UA 5FL7D 4IC5A 1AMHA 1NRSH 1GDDA 3GJ4A 5FTLA 2PMKA 3I72A 3NBXX 2H92A 2GXAA 3GQBA 1VITF 2DCUA 2X8AA 4JVMA 2R0KA 2JJ2A 4PC7A 3RLWH 5DKMA 1GITA 3C41J 5UKDA 4HAVA 1EFTA 2A45B 4OI0A 4CHAB 4A1TA 4LJ7A 1JJVA 1HDTH 3I8SA 2B5TB 3LH3A 3AW1A 1SGYE 2CL7X 3RXTA 4PZLA 3QX5H 4US1R 1IHTH 2FI5E 2RKOA 1BMNH 1FN6A 1AN0A 1OWIA 1R0XA 1R0YA 1F0SA 3EC1A 2ZJAA 3RXOA 2CHQA 3H7OA 2WMOB 2WYJA 4GHTA 1TNIA 1YPMH 3ODFA 2ZR0A 1SFQB 1VYUA 1WBGB 1VG9B 4VGCB 3AW0A 1H8ED 2GT8A 1AS3A 2NTYC 1DS2E 2OC7A 1O5CB 4IVQA 3FANA 1LKAA 1GBAA 3QGNB 5F2EA 4WF8A 1OWEA 1C1YA 1F6BA 3UMFA 4I7YH 3QWCH 1EQ9A 3VB5A 1TEXA 2QIQA 4O3TA 2NZ8A 2WWFA 4RD3A 2X77A 4AB9A 1W11U 5EZ5A 3W3AA 1LS6A 1GRQA 1L2EA 3U7GA 1ANEA 4K46A 4AFZA 3MRSA 3W5IA 3DFJA 1XVOA 3QXXA 3T1OA 1W5TA 1HJ8A 1PPEE 3DA9B 1EJNA 1NT1A 2LKCA 1RKBA 1FQKA 2PMDA 4AOQA 1G7CA 2BY6X 4X2WA 2CCKA 4LK2A 4TLEA 1RIFA 1T8OA 2ZPQA 1P11E 4MPVA 1HJAB 1WSSH 4NYJR 1S4QA 1SXJC 3P4YA 1GNPA 2IXEA 1KXDA 1GHAG 1IN6A 2FYRA 1TPZA 2W6JD 2ZO3H 2GRJA 1ZMLA 2ZG0H 3BTME 4BUJA 2HRVA 4B73A 3WMGA 4Q1FA 3VR4A 5LPEA 1Z83A 5FPKA 1NC6A 2FH5B 3TK9A 2GVZC 1HY3A 5FL3A 1EESA 4HUQA 1FX0B 3T28A 4D0NA 3T5FH 3GCHC 2CLSA 1GJ5H 1HUQA 3NKVA 4IXNA 1C1NA 1KO7A 1OIXA 1HB0B 4OL0A 2CLDX 1U0LA 4LJAA 2ZU5A 4W5HA 5CM9C 2BHRA 4A15A 1A3EH 5FUWA 4GDFA 1V2WT 4JIMA 1P9SA 2DB3A 3FFGA 2EWVA 4XVRA 1LO6A 4JZEH 4INKA 1XTJA 4IXMA 3K0CA 3THWA 1GIAA 1QRZA 1VYVA 1RTKA 4CRBA 8KME2 4ZV4A 3QE0A 4HDCA 3CW2A 1N6NA 1R5BA 4AKGA 2JKHA 2GDEH 2DFKB 3MUFA 3QG1A 1JRSA 1TQ6A 1NY5A 2PX0A 2FA9A 3IIMA 3SV8A 3CB4A 2EWWA 2XSZD 3R8FA 3RS3A 5CJ2A 2A30A 3UPEA 2CV3A 3B8JA 1G7TA 1KMHA 1PQAA 2FDAA 4GPTA 1ZJKA 3QY0A 1DVRA 2A5IA 4MNVA 4HAZA 2BD5A 3BE4A 2D8WA 4GOJA 2FLBH 3DO6A 4X8OA 3TVJB 4MYHA 2NQ2C 2ZI5A 4BLTA 4W5WA 4A6PA 2EI8A 2PLRA 2GJSA 3ADBA 3URCA 1UJ2A 3RXBA 1KMQA 1W0ZU 5L3RA 2EI6A 2WJYA 5H8WA 5DIFA 4YMWA 2P65A 5A0BA 1OXVA 3C15C 3KFVA 1K9OE 4DIHH 1IQHA 4M7GA 1T3HA 4C0SA 3PMHB 4NFEA 3GJ7A 3WYAA 3PYHA 3SU3A 1XDBA 4TMTA 3L0IB 2AS9A 4K69A 1MMJN 2F43A 1SLUB 2G51A 1I2MA 3RUOA 2ZJ8A 2IYTA 1J16A 1H8HA 1P3EA 1UTPA 4WZBE 4H1VA 4MKIA 1N6RA 2J92A 1O87A 3Q77A 2DFNA 2EFCB 3I4LA 1P8VC 2O5VA 1Z6AA 4ZHAA 3C4JA 2VIPA 3KF2A 2A7CA 3LT3A 3BH6A 4ZIRA 2XX3A 2PT5A 1EPTB 4OHXA 2O8UA 3W9YA 2XC5A 4DSTA 4F4OC 2J4IA 3HJNA 3BEUA 2RG3A 1MTUA 1GMDF 3REFA 3W5JA 3BJIC 2DE9A 3ATLA 3LO5A 1O3FA 1D6JA 5GVSA 3WHKA 4FVDA 5HXFA 4INHA 4KFUA 4KLZA 2BBTA 3RXFA 2G6BA 3VB7A 2OUAA 2ONKA 1SOZA 3HK3B 1QHXA 4IHQA 4LDJA 2VEDA 1XPRA 5T6GA 1W47A 3IILA 2ZXUA 1NBMD 3QKTA 3JZ1B 5HZHA 2V1XA 2G0NA 1G8FA 2C8ZB 4DXAA 1LV7A 3RXAA 2AIQA 2JATA 1CR4A 1VG8A 2PW8H 2F55A 2JDID 3MWLA 3CH4B 1VITH 1FPCH 1ELFA 4UKDA 2ATVA 1P57B 1OWHA 3NH9A 3KQCA 421PA 2ZS9A 1TB6H 4JYTA 1GAJA 4Q7MB 1O5AB 4ABBA 4LJ4A 4CEJA 2A9KA 3E0PB 1P2NA 2CE7A 2PLXA 3K9LA 2BD3A 4MDSA 2J41A 3RXQA 1KDRA 3B8HA 2OZEA 3SFVA 1E98A 1XTIA 5EXTA 1TONA 1E9RA 4V0OA 2YOLA 1AN1E 2QY0B 1W7GH 5EP3A 4UDWH 3MU8A 4OHZA 2IS4A 4MYTA 3A7ZA 4DDVA 3BGWA 3KJIA 2WPDD 3K1JA 5L2YH 4KJZA 5EPNA 5IF9A 1SGDE 2QAGA 1HAZB 3CNNA 1Z6TA 3BH7A 5J47A 3SJKA 1YLCA 4KELA 1BYIA 2WKRA 1YZQA 5HM9A 3M5NA 3I8XA 2QRNA 3A89A 1PJPA 3FWYA 2J0SA 1DSUA 3IO5A 3ICQB 4R2HA 2AKAB 1EZUC 1E2IA 4DOQA 2B7DH 4FINA 3FVFB 1BTUA 1NRNH 5TY0A 2IS1A 1F5NA 3MMGA 2ZSDA 1LVMA 2OLGA 1C2FA 2ZRNA 3RRYA 2ZI9A 1ZINA 4B2BA 4KVAA 3OIWA 1OXTA 1QZXA 4BLSA 2VNTA 1CBUA 5DYIA 2NU2E 1IAQA 2XZLA 3QVVA 1O3IA 4ZKNU 5CYOA 3W34A 4C0AC 1FY4A 3A8BA 1LHDH 4TT3D 2Z3EA 4A6XA 2WSMA 4F92B 1CR2A 4UNRA 3MTYA 2QPTA 2VYFA 1AGJA 3S9CA 1V2RT 3UY9A 3RDZA 4H1UA 5LBIA 4DCSA 4UNNA 1VG1A 1PPBH 4YESB 2IEZA 1CLUA 1BKDR 4G5SA 1TGCA 5C67A 1GHVH 3ASYA 1V2VT 1F5KU 4KODA 4ABJA 1MU6B 3MH7A 3OTJE 3TVDA 4NFFA 2ZFPH 4WIAA 1S82A 2EYQA 3JVUA 5C5NA 4JJZA 2ONJA 3B60A 1A4RA 1CQQA 2THFB 4X6OA 3R8CA 1O39A 4GOXA 3O8RA 2A2ZA 1ZRHA 4Q18A 4ABAA 4NSYA 3VKWA 1MOZA 3I5YA 2ZHFH 4NH0A 4SGAE 3B9PA 2UUJB 4DIIH 1T8UA 3RU4E 2YKGA 4IEIA 1GJ7B 4H9GA 3EQ0H 4NGAH 2J3EA 1XP8A 2OUKA 4L15A 1E35B 3HATH 4AFSA 1DBSA 1O32A 3BTGE 3PV5A 4X2VA 2BLWA 1W8BH 1QHRB 2W0MA 1GCDA 1OWJA 3T1QA 4CRCA 3ITIA 3ZZAA 1PLJA 2IA5A 1QNJA 2JJ1A 3FHOA 2ODWA 2BQ6B 1XNJA 1O5EH 3IBGA 1O3MA 1YR6A 2RGDA 4A2QA 1KK2A 5C18A 5DP9A 1S6FA 1IQKA 3BTWE 4AFUA 1W0JD 3K9GA 8LPRA 1IXSB 4FXPA 1W2KH 4WXIA 1WTHD 2RB4A 4MG3A 1UTQA 1DY8A 4FUGA 2A1DB 2JJ2D 1PPFE 5JI3E 1GHXH 4KFRA 3AP2A 2QQEA 2ILNA 3SI3H 4RD0A 3PLBA 4ISLA 3LBIA 3THYB 4JBYA 1EASA 1IOEA 1KI6A 1WE2A 4Q7LA 1GBLA 2FEMA 1C1MA 4QJ4A 1ELVA 4P4SA 3DEFA 2KB0A 2HPPH 1O3JA 2OXRA 2OAQ1 4F4JA 5DH9A 1FY1A 3Q3KA 3RM0H 2X2EA 4CDGA 2HUPA 4LYFA 4XWAA 4BLRA 2JLVA 3W94A 3IITA 4PPGA 1MKWH 3SYNA 1RD3B 3EW9A 2VHCA 3TSWA 3A37A 8ESTE 3SZNA 4J1YA 1F0RA 1AU8A 2QAAA 2BY9X 2V7QA 4Q1BA 3GJ3A 1CA0B 1VR1H 3KB1A 4Q4JB 3Q7QA 4X6MA 2ZHDA 4NCJA 2HYDA 3GY4A 1GWNA 4PTLA 3IPYA 2TPIZ 2DWQA 1T5LA 1AFQB 4TWYA 3TUIC 2ZE5A 2FPLA 1O2GH 1NIJA 1U94A 1A5HA 3LA6A 3SBKA 2X19A 2IYSA 2NO9A 1TLDA 7GCHF 5AHGH 1MABB 5L6NH 1E9EA 1GRRA 1S0RA 2ZR7A 1V2PT 3QPUA 1TNGA 5EOKA 1IJFA 1GBBA 1FOEB 2GTPA 4QGAA 1J99A 3S9BA 1T8LA 2ANYA 3NUMA 3ZVGA 1VCNA 3IIJA 2GV7A 3CUEF 1UEJA 2JH5D 4XWOA 3ZZ5A 1QHGA 2EVWX 4ACAA 2FGJA 5FX6A 1Y3YA 3GLGB 1UO6A 2NIPA 4U01A 4R2IA 3LH1A 4RN6A 1CKEA 1A7JA 1ANBA 1O35A 4B3FX 5GWZA 3PTBA 1MV5A 4B32A 2KBFA 4HZUB 2ZIAA 4TMWA 1FQ3A 1OH8A 3SHAH 2N1BA 1C9TA 2JH6D 1L0ZA 2CL0X 1QBOA 3VGCB 4TYNA 2AFIE 3SV7A 2HT6A 4AZ2B 4Y0AA 4ZPXA 1C5PA 2CDNA 4Z1MA 1FXYA 1HXFH 2HEIA 2DHRA 3EC2A 2R6DA 1O2PA 2AERH 3SV6A 1EZQA 1IQJA 3K0SA 1DE0A 3R9WA 1SULA 4EJSA 4Y7BA 3SBEA 3D23A 2QROA 2FSHA 1EX3A 1COWA 1TIOA 1P04A 4ABFA 3DHWC 1G5TA 3MNBA 3AB3A 5A5GA 1P62B 3GY7A 3P95A 3MSXA 4PHTA 5G4BA 1G8GA 1DT2A 1KJYA 4I8HA 2NWNA 2VBCA 1SPJA 4K2YA 5HE9A 4PC1A 1KJZA 2M5TA 2FM2A 3THXA 2ATXA 3RP2A 2PZEA 2Q1JA 3RXPA 1PV4A 2GCOA 3T27A 3VNVA 3FP7E 4I8LA 1NMYA 1T31A 3MWKA 1RS0A 1TX8A 3TE6A 4TMKA 5PTPA 3BF6H 3RVBA 1HTWA 1R8QA 4V0LA 1HEIA 4JYVH 4C7OA 2G52A 3ZVFA 3ZZ7A 1GDQA 2IYUA 2XXAB 1V2QT 4B1TA 3L2OB 4Y76A 4BOHA 1TF5A 2O8LA 3SI7A 3PTNA 2JLQA 4A7IB 4RSGA 2FOBA 5J4SA 2FIRH 4C0LA 3QBVA 4BECA 3FZZA 5FR2A 1E3MA 4OM9A 3ATIA 4BE7B 1AUTC 1JXOA 1DXPA 2ZSAA 3AVWA 4LPSA 3FFAA 4JKYA 5C2JB 1AZ8A 1IOZA 1V2UT 4IDNA 4ZCIA 2UWPA 3IQWA 1H8HD 3PUYA 3K0CC 5L3SB 1O2YA 4UXIA 3PV4A 2R2AA 2V55B 2GBLC 5EXSA 4MDFA 1BZXE 1XUIA 3CH5A 4OQLA 1Z0KA 4TZ0A 3SDZA 2PWXA 1NNEA 3TR0A 3CLVA 1OYYA 1AKSB 2OXCA 1C5OH 2MSDB 5E8EH 5SZJA 1NLYA 1N0UA 3WXMA 1KO5A 1XMIA 1NFYA 1UCYH 1ELDE 3MWIU 2O8EB 1OS8A 4BWYA 5G53C 4TMVA 3O8DA 3TNSA 1SHZA 5CDFE 1TWXB 4UNSA 4GRAA 1RVDA 4NDZA 4XVQA 1N2CE 2GCHG 2IX3A 1P0SH 2C99A 4OK3A 1G41A 1HAVA 2QN5T 3QPWA 2ZRDA 1Q21A 3UANA 3EXAA 2ZREA 4RI0A 3RS2A 2QMUA 3RS4A 1P2SA 2ZPTX 2OBLA 5CE1A 3GCHB 1UKZA 1NVXQ 2F4LA 3KGPA 4GCHG 3D6TB 3U98H 4BPBA 3AQ4A 1GCTC 3U2QA 3FP6E 2CF8H 2H9TH 1JR3E 1GVKB 4HB0A 1E2FA 1INCA 4K8OA 1O5FH 3RXUA 1ZYUA 2ZYTX 3MU4A 1QURH 2MSEB 3URDA 3OHMA 5JSZB 4J2YB 1QR3E 3B1WA 1IJEA 1NN3A 4B33A 4X8TH 3C8UA 2OBOA 1T0JB 4H6SB 4A1FA 2AWNA 1JOUB 5DP4A 2VSFA 1H8DH 2Z6BD 1AZTA 4BFTA 1VCOA 1DPFA 1XEWX 4N0EA 5DP7A 2XTMA 3SU6A 3SUFA 1G7RA 1KI8A 4IGDA 1GJ6A 3TKLA 1DTSA 2ZTZA 4HDOB 1K1PA 4ZCLA 2IOTA 5E0JA 1SGNE 1Z28A 1NN6A 2WWWA 2FJUA 1JBUH 1RPZA 3U1JB 1AIPA 1NY22 1V2OT 2P16A 4QBIA 1Z6JH 2WICA 2FTMA 1B23P 4DIEA 4YDSA 3GY8A 1E2DA 1H9LB 1IQFA 1TPOA 2XTTB 3DMDA 4HI0E 4MPWA 1X8JA 5BYJA 1NVUQ 3K0EA 4BQSA 2WV4A 1PZNA 5JECA 1HGTH 2RA0A 2ODPA 5CDFA 1A5GH 3LVQE 4Q9HA 4LV5B 5E4FA 5TJXA 3MNCA 5FOWA 2GGVB 1C5WB 1F0UA 2HXYA 2H57A 2O0HA 3LD9A 1KLJH 3WNDA 4OYHA 2FMJA 3ZVRA 2J45A 4DDUA 5DYGA 3SN6A 4MA4A 3KJHA 4AIIA 3PMBB 1K1LA 1SGEE 4C9BA 2W0SA 1NN0A 4X2YA 1AO5A 1Z5ZA 3QJYA 5J4VA 4NBSA 4L9WA 4Q1CA 5G41A 2P5TB 2GJ9A 2QNRA 6CHAC 1YRAA 3GYMA 2PL3A 4LY6A 3H86A 2F9NA 4AGJA 4ZKDA 4Q00A 1DSTA 4UFFH 2WUBA 4C4PA 1ESBA 3FFBA 1Y8TA 4ZCMA 1XF9A 4IW4E 1P7CA 1SQ5A 1LCYA 4N1AA 2QAGC 3EZ9A 4B35A 1EFUA 2VWNA 3D31A 3F3YA 1OXUA 1VCPA 1YZKA 1ZD1A 4LJYA 2ZJ5A 3PG5A 3M3SA 4H42U 2RMKA 4YMTA 5DP6A 4MH0R 2P3UB 2BHGA 5AUNB 1OB5A 8GCHF 4OQMA 3BD9A 5JDUB 1M34E 2FO9A 2HNTE 3OSYA 2WPHS 1GGDC 1ESNA 6GCHF 2VHJA 4QFMA 1FMGA 1FV9A 2QA9E 1XEXA 4D76A 2CK3A 2FV8A 3IWMA 1MBMA 1M7GA 5AFYH 1ZP6A 2JH0D 3KTAB 4NYMQ 4JBWA 3LKWA 2VVUA 1BT7A 1ZM9A 4XOJA 3A1VA 1P2TA 1US8A 1K1OA 5G3YA 2Y82A 3GJ6A 5CJPA 3PENA 4Q7YA 4NYIR 1DANH 2JJ1D 3S1AB 2PGBB 5FUVA 2YNMA 2REXB 1ELCA 3CF6R 1TMUH 4JLPA 1SLVB 3VKGA 3PROA 1ID5H 4E06H 1QTFA 2JCSA 1TBRH 4BFYA 1XTQA 3KQUA 121PA 1NKTA 1XJQA 4RZUA 5LDDC 1SSXA 1KYIA 5LB2A 2Q9CA 1KXFA 2GD4B 2R0LA 3AUYA 3I3SR 4U02A 1P3CA 1BJVA 3LPRA 1ZD8A 3QF7A 3E5HA 1ARBA 4A5TS 4Q02A 1CT2E 2ZHWH 5CLLA 1D3DB 1WB9A 3SQEE 4GL2A 4Q4LA 2PV9B 3GJ0A 4YOGA 4K1SA 1Y3AA 1OH5A 5DJ7A 1W0KA 4DLRA 4CREA 2FI4E 1QIXB 2A78A 2FESH 1TU3A 4IOJA 1UVOA 1GVZA 3ZZ3A 5FBIA 3KQNA 4DY7B 3FB4A 3TGJE 1L4UA 3HKIB 1ETTH 4DCTA 3KXLA 2DFTA 2KBEA 1UVUH 2ZS8A 5JJLA 1D3TB 4YLQH 3UREA 4ZDJA 5FR1A 4WWYA 3NIBA 3FVQA 3D65E 3MNSA 4HLQB 2GKSA 1V2JT 3T12A 2UKDA 3RU4D 1SVIA 2YZ2A 4BZXA 2STBE 1XXHA 4TYPA 1B0EA 3DHKH 4M1TA 1C1OA 4I4LA 3V13A 3BB3A 2ZGJA 5E2PA 2V7QD 1ZNYA 4ABEA 1TA6A 3FOZA 3RXLA 1G3RA 1H9HE 1ZCAA 2UWOA 4UFDH 2BMDA 4QBHA 4Q80A 4PHFA 2XTZA 3ZZBA 3T62A 2I6QA 1WQ1R 3AF2A 3P70B 3VR2A 2VJ1A 3AUXA 3A80A 2O0JA 3MGCA 2IC5A 1ACBE 1KK0A 3VR6A 4UXHA 3ZQ6A 4IMQA 2Q21A 3RHFA 1GHWH 1MTWA 1ZC3A 1P03A 2Z7FE 5KDDA 2EW1A 1NROH 4AYYB 1FUKA 1X86B 3TJVA 2A2QH 3QKSB 3SU2A 4NIYA 4AI6A 5IDVA 2FYQA 1HT2E 3UQVA 1TPPA 2DY1A 3QXJA 4YMVA 1E2NA 1QHYA 1ZMNA 7KMEH 1GVNB 2AHOA 2CLCX 3MHWU 3WMEA 1MO5A 4BZQA 1BOQA 3GLHB 4HAYA 3GJXC 3B9FH 5FBQB 1JEDA 1G64A 1K1JA 3G0HA 1O3AA 1GL9B 1E2LA 2ZNKH 1LVOA 4Q21A 1IY1A 1C2GA 5DI3A 3DD2H 1TFXA 3RNLA 5H1YA 1C4Y2 2QPAA 4Z6AH 4LJ9A 1GDNA 1XCGB 3I61A 4NYIQ 1DELA 1XTKA 1CS4C 2CJWA 1BTPA 1J2JA 1A0JA 4DSUA 4X8UH 1TQ2A 4XDEA 2VP0A 4X1RU 1SGTA 1O2MA 1JPJA 1Q57A 2KWIA 3S69A 2ZFRH 4QGGA 1T3LA 4Z1MD 4QNRA 4DZZA 1PQ8A 5GNDA 5E7MA 4Z54A 3H1TA 2ZRFA 5A2MH 3ZVMA 1FN8A 3HR7A 4JT4A 1N5IA 1ZGVA 5EZ6B 4JL5A 1AHTH 1TAGA 4NTZA 3UNRA 3LJJA 1ANKA 4RCYA 1KGDA 4ON9A 2ZYVX 1FUUA 4KLNA 2JA1A 3A6PC 2NU0E 1ZHMA 4JLJA 1COWD 3CIOA 4JLDA 3GY3A 2IXFA 2ZTXA 5FBEA 1E2EA 1BB0B 1TA2A 1TGTA 4F38A 3ZVLA 5TV2A 4OS6A 4FCWA 1Y5AT 1II8A 3EWSA 1JR6A 3O8CA 4K3JA 3MG9A 4JLVA 1JQJC 1P61B 2H18A 4DVGA 4E03A 3Q76A 1GUAA 4I31A 3P6ZB 1P2MA 3B23B 1PVOA 1O2JA 4IRUB 4DG4A 1E94E 3GLIB 3LGIA 3CP7A 4KXFB 3EA5A 3VU9A 2PHBA 4LSGA 2FWWA 2QGNA 1WCZA 4O3MA 3A7VA 1CO7E 1DPOA 5ESTE 2GXUA 4OHWA 4OQNA 2BBOA 3CF0A 5HKKA 5K7RA 1NRRH 3QVUA 2ZM5A 4XSHA 2F9BH 3U4QB 1A2KC 3K0AA 1WU1A 2P6NA 1S8FA 4KGAA 4JLBA 3K9XB 1RE0A 4RD1A 2NPFA 3QTOH 3RC5A 4LZ1H 1LPGB 3L43A 3QXCA 3RWOA 5KSYA 2WIAA 1CIPA 4XD7A 2MMCA 4DLWA 2D3WA 2C95A 1W2GA 3GICB 1L4ZA 1IAUA 2VWLA 4EJSC 1K1MA 2J7KA 3U8OH 1IN8A 4BAQB 3U6BA 3R20A 1K2I1 3FHCB 1LVYA 4UQOA 3TW8B 1D2EA 5AUQA 1HAYB 2GEVA 5DHAA 4OKSA 1TMKA 5DE3A 1CT4E 2WVJA 3QQ5A 2VIVA 4PFSA 4ESTE 2PUXB 2B8TA 1GNRA 1ZPZA 4XTRA 3G01A 3ZD6A 4U30A 1QF9A 2HDNB 1HURA 4BNRA 4AG1A 3SJCA 4NWLA 4F4IA 2WPJS 1O31A 4QKQA 1VITG 3M3VA 3K09A 1G2LA 3LAWA 1LVGA 3TLOA 3P8FA 4GP6A 2A7HA 2ZFFH 2ODYB 1MO6A 2RHMA 1HAXB 1OV4A 3V00A 1EK0A 5DGXA 4KBGA 1XXFA 2ZFQH 4RSPA 2Z6VA 3MFJA 3R9IA 3CWZA 4TYWA 4FMDB 1DG3A 5TARA 3U7EB 2I4IA 3EPLA 1O2OA 1N6HA 3L33A 2STAE 1YPLH 3UIEA 1DUEA 1EG7A 1EP6A 4Z0KA 1TOCB 4M2LA 2B8WA 2ZDKA 3QKUA 1N8OC 1XD2A 3M7QA 3DT0H 5IDKA 2B7CA 1Z3IX 2A5DA 2H6MA 1X3SA 1IONA 2ZE7A 5C2ZA 4BEBA 1OPXA 3IGFA 1ZCBA 4D2IA 4R9UC 4UONA 2W7SA 3GEIA 2O8WA 4M22A 1C1PA 2ANKH 1TE0A 1A7SA 4UFEH 1P2IA 4MGYR 3A4LA 1TBQH 2QU8A 1IQGA 2GDJA 4OQFA 4M9SA 3X1XA 4YQFA 1D5CA 2WWYA 2ASUB 2NG1A 3CWQA 3TGIE 4UNQA 1MKWK 3VMFA 1AQ7A 4B3DA 4TLAA 2J5XA 1G4AE 5SZIA 1C4U2 2XJ4A 3OIVA 2ZJBA 2J9NA 5E7JA 1OLOA 1KO4A 1XZQA 3NVAA 1XD9A 1QBVH 4MPXA 4ABHA 3D7MA 1ANCA 3ND8A 2GP9B 1R4AA 1W1WA 1GSIA 2P95A 1TF2A 5LPRA 1YZGA 3M61U 2ZS7A 3K8YA 5TVKA 1F2SE 4IDPA 3SGQE 3A4MA 3RSOA 4WA7A 2AR7A 2AD1A 3UATA 3D62A 2A7JA 4KTUA 1TQ7B 4DEXA 2J1LA 3QUMP 2VQSA 3U61B 2D26C 1VHTA 3EDXB 1NFXA 5K0HA 2IYLD 2GETA 4X6PA 1W36D 1FFHA 2QGZA 3KKQA 4KYUA 4RKJB 1G19A 2OO7A 3ZVBA 1BH2A 3VR5A 1XJCA 4AFQA 4AWXA 5F8XA 3AAUA 4XSKU 2CJIA 1F2UA 4BTTB 5EG4A 1NL3A 4CRGA 1KDTA 2QI9C 1OYTH 4L5BA 2H2ZA 4CVNA 3M1IA 2HJVA 2BLVA 3EGKH 2FSFA 3MJHA 4LI0A 1KSNA 3M35A 1UKVY 2OV2A 1RJ9A 4RY2A 4AC9A 2YC2C 1GHAF 4C0JA 4RD6A 4TTQA 3F6UH 2FFHA 1HUTH 3QI2A 1G3DA 2J0QA 4YM9A 1KMHB 1AIXH 4DC9A 1O33A 3BV9B 2R3YA 2HXSA 1JNYA 2OLJA 3B5JA 4D4JA 3EZ6A 1G1MA 4FU8A 3OF5A 2KSQA 4HLUA 3QKRA 2P0EA 4KKDA 2Y5FA 4BTIB 1BRBE 3TUZC 2ZUCA 3DOFA 1HAGE 4Q48A 2XWAA 2ZAOA 3LBHA 4CRWB 1MCVA 2P3SA 2HOBA 1ZD9A 4FD2A 3LWNA 1ZSKA 2H5DA 2W2TA 4MITA 4CEHA 3NWJA 3U44A 4LC1A 1TALA 1BS1A 2FX4A 2IYRA 2FPMA 1HJ9A 5LGOA 2G83A 3AVPA 2RGNA 3GEEA 1D9XA 4BFVA 4PO8A 1GCTB 4EFMA 3RABA 2ZUBA 3GPLA 2ZGHA 2F43B 3SUDA 4RFVA 3SJ9A 2J59A 2XC4A 2PJRA 1Q3XA 4RD2A 3H5CB 2BMJA 3ZH9B 1WV7H 1ARCA 2O8BB 2ZF0H 3BN9A 4QBGB 2EA3A 3PM3A 2O0KA 3ZZUA 1VJ9U 3SNAA 3FE2A 2WTUA 4FIDA 4ZIRB 2N46A 2R8RA 3AVUA 4EPWA 4O03A 2TRMA 2IYVA 2CHVA 2TGTA 3C1KA 3K0FA 1E9CA 2AD5A 2ZRCA 3GFPA 5H4IB 5SGAE 1BTYA 1TRYA 3ZS8A 1GMDG 4MKFA 2OC0A 3QF4A 1C2DA 1CU1A 2EEKA 4ARZB 1EXMA 1O2RA 4O2RA 2ZGXH 3T5GA 3RANA 3PXGA 5JMTA 3VFEA 2VVVA 1GG2A 1OX1A 1DLKB 1KTTB 5EPYA 2ZJ2A 1C5SA 1L1NA 5KSPA 3BAFA 1G37A 2Y80A 1TABE 4Q66C 1AA9A 3NHBA 1DM4B 2A5KA 4LHXA 2DPXA 3REGA 4TWWA 1FJSA 4AX9H 2QP3A 2P93A 4AKHA 4CYMA 4CEJB 2D2EA 4TLDA 3HU2A 1LPKB 2PUQH 3VB4A 3L0OA 4EPYA 3GMTA 4X2XA 5J40A 1GI8B 2K5UA 2SGPE 5GVRA 3UNQA 4L8GA 3OY6U 5CHAC 3ATMA 3CRQA 1L1JA 3ADDA 2XXLA 4V0KA 1BIOA 2ZKSA 3AVXA 6CHAB 2ZE8A 2EI7A 1L2TA 3TH5A 4IKEA 4PHGA 2JLXA 3LXXA 3PR1A 4LZZA 5DO9A 1E4VA 1Z47A 1QVAA 4AN7A 1DX5M 1ZW6A 3UWOA 2QAGB 1OSSA 1VCWA 2VLIA 1GI5A 1MH0A 3RS0A 2BDIA 1O3CA 5EE5B 4PC2A 3CNOA 4DT7B 5HGGA 1OXGA 3C27B 2DFLA 1OFIA 5FTJA 2VGCC 1GHYH 1QHHB 3WBJA 1P73A 4LX0A 1UTJA 5FI1B 1C2JA 2OM2A 4QXAA 1TF7A 1Y63A 1PLKA 1OYWA 1MRNA 5HYOA 4N3NA 1GGDB 2ZU3A 3ZZ9A 3MFYA 1YKSA 4AY2A 5LD2C 3O47A 3RLFA 1P72A 1EUFA 1Z1IA 2G00A 5F03A 2FU5C 4FUEA 2F1IA 2Z43A 2BVXH 1VGCB 4DIDA 2HNTC 1F7ZA 3GLFE 4C0HA 1XXDA 3A7TA 3C16C 4PX9A 4FXGH 3BB4A 4OGYA 2IYXA 5E2OA 1P9WA 1W12U 3GY6A 2LCFA 1E99A 1L1GA 1C1TA 2BKEA 3EA0A 5DP8A 3KFXA 1R8SA 2IJOB 3LGUA 3RS7A 4K81B 4JT2A 4Y8XA 3RMOH 4WW0A 1P9RA 1ZPCA 5F9HA 2RCEA 3RC4A 1E9FA 3A8CA 4M1MA 1NS3A 1PQ5A 2ERYA 5EJEA 1ZSLA 4Y71A 1Z7KA 1CJUC 1I4LD 4AG2A 3RXVA 1DOJA 2BOVA 1KLIH 4D26A 1XUKA 3JVVA 2VIDA 3T1TA 2WOOA 3EWAA 2GTBA 5GDSH 4PC6A 1E0KA 3R7WA 1ZNWA 5C4MA 4IJMA 2W6IA 2BBSA 4LYHA 1DE7H 1UFQA 2ZVQX 2OSBA 1C5XB 2C96A 2O8TA 7ESTE 3TPIZ 2F3TA 4GZMA 3WP0A 5KDLA 4PAQA 5AWFC 4MYCA 4URYR 2WV5A 3P27A 4HLCA 1F2TA 1LDTT 5J5CA 5HKKD 2G4TA 1LHCH 5EUMA 1BRAA 3PCRB 1JWTA 1EX6A 2TMKA 4URWR 1ELOA 1HV7A 4EFNA 3LX5A 5E7IA 2J38A 4CBNA 3ADKA 1DOAA 1NTPA 3MH4A 4ISHH 1QJ1B 4ZKSU 1FNNA 2C8WB 1O2SA 2ZSEA 4QJ5A 4XD7D 1JQLB 1T0HB 4XFQA 2P8OC 4Q01A 621PA 4Y79A 2BDHA 2F6RA 1MCTA 4NE2A 1JBKA 2BJVA 4D4MA 2V0BA 4MRPA 4TN1A 2HF8A 5EQQA 2E9SA 5GIBA 3A1SA 4OHVA 5BQ5A 5A0FA 1ZPBA 3QPVA 2YWFA 2C77A 2JLZA 4Y6DA 1HXEH 1D9IA 5IHPA 1KDQB 3PUZA 3MU0A 3LFUA 3EE0B 1YPKH 3UWJH 1H65A 2CMYA 1WF3A 4BLPA 2FFBA 1U0JA 1SGWA 3SNDA 1U2RA 2UUKB 2JLRA 1U8AA 2PX3A 1KZGB 1XTSA 3RDPA 1VMAA 5DI9A 3ZVAA 1ZYOA 1PPHE 1U0HC 2XCNA 2J7PA 1FIZA 1O2VA 2QXGA 3HR8A 3L82B 1XD8A 3SUGA 3WY8A 1GHZA 4K8BA 4II7A 2Q9BA 1UAAA 1P09A 1J8MF 2YV5A 4RZ2A 4LRWA 2RAPA 2PTNA 1KI6B 3AVQA 4FUFA 1AVGH 3ZIAA 4CRDA 2ANBA 5FHTA 4MVNA 5CIQA 3L0SA 4AYTA 1LS1A 1Q44A 4P4SB 1BHXB 1NLZA 4DB2A 2EU8A 4NP6A 4X1SU 4W7SA 3SZRA 1LF5A 2C2HA 1CHOF 1TUIA 1VYTA 3CZPA 3KL6A 3QTVH 4AKEA 1BJUA 4W5JA 1OWKA 4V02A 3TW4A 1SGCA 1XCPA 1A82A 4DLYA 5JB8S 1ZVQA 2PZFA 2XZPA 3P92A 4NMMA 2FOEA 4EKDA 2ZI6A 1U8YA 3ATKA 4GSOA 1DWEH 1O36A 5DLQC 5FPSA 1MO3A 2XITA 4Q9IA 3B1XA 3EA7A 4UJ5A 9LPRA 1GMHG 2AX4A 4AYXA 4JL6A 3W8NA 2F9MA 1S0QA 3MOCA 2E1RA 1P4SA 3NWUA 2J46A 3S0NA 3LGTA 2BQ7B 1G3IA 7GCHG 3UK6A 3THYA 1YPEH 2ANWA 4B48A 3QIAA 4Q1DA 4JYBA 2UVQA 4JLNA 3CF2A 1EAWA 1G36A 2OCYC 4DVAU 4YXWA 2V6NA 3OAAA 2Q6GA 2ZECA 1EWQA 3K09C 1F0TA 1PPZA 4BFWA 4JKIA 1HLTH 1XX6A 3BORA 1QVRA 4QT8C 1Q12A 5TCCA 3SORA 1Y3UA 5KO2A 3BEFB 3ZGXA 3CRRA 1XTRA 3UTUH 2JLWA 1E9AA 1Q1EA 5J4LA 3AVZA 2QF0A 4PR0A 2ODNA 1UTKA 4D9RA 5JRZA 4GFDA 2W3IA 2F7SA 2VTKA 4BRUA 4NONA 1O5DH 2R65A 2XNSA 2NGRA 1LF0A 4B44A 3K6ZA 2PEZA 4WY3A 4ZHMU 3SYLA 1IY2A 4EQ6B 3ZZ8A 4ZHLU 1AVWA 3ZZ6A 2SHKA 3F8TA 1HRTH 3U8TH 2P3FH 2GF9A 4AK9A 4M9QA 1AKEA 5IRCD 3TJOA 3PMJA 2K1QA 2H5CA 1EOLA 3HK6B 1XEWY 1V6DA 5FOSA 2EC9H 1MABA 5DHFA 1NVWQ 5CM8B 3AF1A 1TPAE 2A0QB 1KK1A 3U7HB 1J90A 1MAXA 4EJSB 2OE2A 3RMLH 4ESHA 2YNBA 3U3MA 1DG1G 3P8GA 4LJ5A 1EP5A 1EXFA 2IF0A 4PAOA 4ZKRU 5JPMH 1D2MA 1PPCE 2FOAA 1ZM7A 2FS8A 3RRZA 4LXBH 1S3SA 2Q3HA 4TMXA 1ELGA 5L3VA 3GLGA 4NZYA 4OJQA 4NKRA 3KXIA 1NU9A 4LV6A 1K5GA 5AR1A 5B2ZA 1GRNA 3WHLA 1FY8E 3THXB 1BITA 1XKBC 1LTOA 3ZVDA 2GCOB 1SGFG 2AMPA 1G3EA 1SFIA 1G21E 5L2ZH 3LOXA 4OS5A 3PQCA 3MWJA 1E2PA 3QG5A 4NIWA 5KHOC 4C7OB 2RCNA 4DDTA 4DUGA 4U7DA 1SKYB 4S2EA 2WPLS 2QMHA 2V35A 3NZIA 3NPSA 4BXSA 3P20A 2G55A 1H1BA 2F1JA 1OKXA 2FN4A 5D3QA 1SLWB 2PT7A 1LKBA 1UBEA 3QN7A 3ZLJA 1SVMA 4OI1A 1VIYA 3OE7A 1WAYB 3BXZA 1O38A 2GK7A 1S9HA 3VXFH 3NC1C 1N8OB 1MRSA 3ZVCA 1X7AC 1AE5A 4G3XA 2CE2X 1OOKB 4CH2B 3BSQA 3KJEA 5AJVB 4XH9B 3KQDA 4OK6A 2P3TB 5EXMA 4BFSA 2ODQA 1KLTA 4H4FA 3TITA 2Q6TA 2ZEBA 1SL3A 3OY5U 1TPSA 3BG4C 2C9OA 2HF9A 3TH3H 3HP1A 1QJ6B 1KZ7B 2CHAC 1UCYE 1FAKH 1S0UA 1BQYA 2BZAA 1C1SA 1PLLA 4IC6A 2ZQ5A 1P06A 1KKMA 4Q1EA 2ZU1A 1YJ5A 4A0GA 1G32B 4KAXA 2AEIH 4JZDH 3SHFA 2ZRKA 2RHDA 2O9QA 1XJ0A 1OKKA 4IOKA 3BTQE 3D49H 1M8PA 1A0HB 1YHNA 3NBFA 4D0GA 3VTKA 3DUXH 4HB4A 1M9UA 1CE5A 2ZYUX 1OH7A 1ZUNB 2RGBA 2MSCB 4HLUC 1BTWA 4TSFA 4N0DA 5HE8A 4JMPA 2GMTC 4HI3A 4D25A 3SEAA 1HAVB 2OP9A 5IK2A 2ZFSA 3W3ZB 4D4LA 4BXWA 2XCFA 2ZHQH 5F98A 1OXXK 1TNDA 4QHYA 3VHXA 5L3SA 1OPHB 2IUUA 2YC4C 1JALA 2AYWA 2OEPA 3AGQA 3FTQA 1AVXA 2OD3B 5FPTA 3KKMA 1O3GA 1F92A 2Q9AA 1ZSJA 1SR5C 1YKTA 3NHAA 5EXXA 1O5BB 1H9IE 2ZTSA 3EASA 1GJ8B 3RXHA 2WWIA 1LFDB 2HV8A 1OIVA 1EGAA 3RS5A 3C14C 3WYFA 2HYIC 4D6PA 1Z22A 1QHSA 2QMEA 3T26A 2KAIB 1O3PB 3GOVB 2I3BA 3W90A 4WMFA 1AD8H 1E2GA 1FMJA 2IWRA 1W7AA 2BM2A 3KUDA 2G88A 1WA5A 2IWHA 1G6HA 1SXJA 2P6RA 1RYHA 1GJAB 1N5KA 1MO4A 3C5CA 1OYQA 2FFQA 1R0WA 1RXPA 1W13U 4PROA 3N7OA 2BVSH 4WBSA 4ITRC 1M1YE 1Q1QA 1Z06A 2G3YA 5JJIA 4X8MA 1E0SA 4KBFA 3F68H 1DAKA 5C46F 3ETLA 2ZCLP 1ZBDA 2QYIA 5I46H 3AH8A 4KHZA 1TNLA 4RKEA 2Z4RA 1YPJH 3LX8A 1H8IH 1TMTH 3KQLA 1II0A 5DISB 3PVSA 1A5TA 1A5IA 5EUQB 1GWAA 5TB5A 5GJ4B 3I77A 4UE7H 1CR1A 4BAOB 4Q4AB 3VHLB 2BLQA 1Z0FA 2AMQA 2GA8A 4Q47A 3TGKE 2D62A 2XYAA 4BLOA 2HT1A 2C4FH 1W36B 4JK5A 2O8CA 4GMXA 3O8BA 3BTDE 2GXQA 1U99A 3T35A 2ZCKP 3AVVA 3WRYC 1G6OA 4Q5IA 4DLTA 2V3OH 4FMCB 2CMKA 3A88A 3V4RA 4D0LB 3SJ8A 2BXTH 1CA8B 3TK6A 1RTFB 1MUEB 4I8GA 4URZR 4IMZA 3UIRA 1C2KA 3PIRA 1M7BA 3ATWA 1MR3F 3AV0B 2WUCA 2A4GA 2OQUA 1IBRA 4FU7A 2XRCA 3RXSA 4SGBE 2Z9IA 2GEDA 4AG5A 2QBYA 4US0R 2W6ID 2ERXA 5D3MA 4PPNA 1YR7A 1QHIA 4HB2A 4BANB 3ADCA 1W10U 4YOJA 2OCPA 3M5OA 2AXPA 2NPIA 3WNCA 3RWMB 1X8LA 2A3RA 2HGTH 1KDOA 4I33A 1HAHH 1TX6A 4KU4A 3IG6B 4AORA 2WZQA 6GCHG 2HLCA 4NCNA 3SU5A 1P12E 3QENA 1XEXB 3UWIA 5BN4A 1C9PA 1NN1A 4WVPE 4AGKA 1GP2A 1BYUA 1G20E 1V2ST 2ZI3A 2H16A 3E2IA 1MH1A 1US8B 2XBXA 4CH8B 3BIFA 2BC9A 3TMKA 2W00A 1XBTA 4B3GA 3CX7A 3PB1E 2QT0A 1Z6YA 4TZ6A 1NJFA 1ESTA 2C03A 1N6YA 1KI9A 1IN5A 1YR9A 4B75A 5EQSA 1J8YF 2B0FA 3KQHA 2PKSC 1YLDA 5JWRA 1ZMXA 2QV1A 3NXSA 1UTMA 1ZTLA 1KSGA 5CHAB 4DCNA 5C1XA 1AQYA 1IN4A 1DADA 1ETSH 3M7TA 2ZI4A 4JBXA 4WAUA 2XNIA 4NCIA 1HE1C 3LNCA 3MH5A 1G3MA 4GNKA 1RRFA 1K21H 2CHGA 2WKPA 3RXDA 2C9YA 4K1TA 2XGJA 2J7PD 3T1VA 5A0CA 4TL9A 4CR9A 2ODBA 2GAOA 4NG9H 2LNCA 5C1UA 1E34B 1D3QB 2VGCB 5E0HA 4C0KA 1FI8A 1CBWC 3ZIAD 3R0FA 2ZIQH 6ESTA 4LC0A 4NU0A 3CKLA 2CL6X 1E2QA 1GFIA 2IW3A 4DLUA 2GESA 4OS2A 5FI0B 1A2BA 5LD2B 5JS7A 2VIOA 4YTAA 2OHFA 2VH0A 2BQWB 1SGFA 2W7UA 2B21A 5C4GB 4TQ9A 4DT1B 1KTSB 1XXHB 3X1WA 1SOTA 3U8RH 1AS0A 4TLBA 1II9A 2A4OA 2CEAA 4XVUA 5FXLA 1K6MA 4LHWA 1UJ1A 4A0FA 5B6LA 2SGAA 5GADl 2ZETA 2QGRA 2FEQH 3EZ2A 1ESAA 3FYHA 3QSYA 4M8NE 4QNMA 1HIAA 1SGRE 1C2MA 1ZU5A 1JI0A 5FFMA 3VX4A 2G81E 3CZQA 1Z8GA 4FUIA 3V4FA 1E0FD 4F7WA 4R0IA 3TAHA 2YYZA 4TL7A 1E9BA 2FSIA 1DY9A 2QZ4A 4OS4A 1YBWA 3TIFA 4ZXXH 4Q9JA 1FPHH 1LVBA 1Z6EA 1OHHA 1NLFA 2V1UA 1D3PB 3OAAD 4US2R 3RRNA 2YHSA 3KCGH 2R9PA 2FZ4A 3R3GB 3UG6A 3WBKA 2PSXA 5JS8A 4CEIB 3U6KA 1HA3A 3A1WA 1RFNA 2F1RA 4TLCA 1SVSA 2QC2A 4LK4A 4QHTA 3NXPA 4GZLA 1OSNA 1G3BA 2CJWB 3K9HA 3B1YA 1MTVA 3UMSA 3W6NA 1T4GA 2IF2A 5FPYA 3TQCA 4AD8A 3RXIA 2XAUA 3NCLA 5G40A 2EFHB 1HAIH 2O8FA 3K2UA 1XMVA 3IIKA 3GDUA 1EAUA 2VWOA 2X1VA 4TPIZ 1K28D 2Q6DA 3GFOA 4E7RG 1FP6A 1Z6XA 3NG1A 1NG9A 1QHNA 1XRJA 2D06A 4F93B 2P8OB 5K8IA 1QQUA 3BB1A 1PJRA 2OFOA 2BX3A 4MPUA 4PZZA 3ENSB 2BMEA 3AGPA 1YCPK 2JASA 3EA8A 4U32A 3MO9A 3T29A 3EPHA 1C1WH 1W3CA 4YMUA 4YZUA 2AFHE 2Q0HA 2ECKA 4FU9A 3QXSA 4NL4H 1II8B 4H6TA 1ZUIA 1B0UA 1I4TD 5EXLA 1BMMH 4TQAA 4XWKA 1S96A 1TADA 1P2UA 2P6UA 5F6MA 2WJHA 3ND9A 1YZTA 4JZIA 4G5OA 3SU1A 1GI4A 1EFCA 3I32A 4M1SA 5AVDA 1C5LH 2D7DA 5AJWA 4JLMA 4BFUA 3HPTB 3VU9B 2KJQA 3GY5A 1KAGA 3PV0A 1SKYE 1TGNA 1C5RA 1JECA 2XB4A 4X1NU 3GJ8A 4DUGD 2ZDMA 2WJJA 2ZI7A 3PFIA 4UD9H 2CCJA 4WZ6A 2IHYA 2Z9GA 1DAMA 4ZUHA 1AWFH 3W6OA 2SNVA 3GISB 1C5VA 1KI2A 1ELTA 2WAYA 4NWKA 3K0AB 3OE7D 3HPQA 1YVDA 4HGCA 1OIWA 1DWBH 5F3WB 3QGJA 1KO8A 2Z0MA 2DWOA 1ZTKA 1VPLA 2QORA 3RYTC 1NSFA 4POAA 4LHVA 4JK6A 1FQJA 2O8DB 3GD7A 4MNYA 2ZJYA 1FLEE 1S9DA 5DPAA 2VL7A 3EYDA 4NCKA 2VIIA 1W5SA 1UMAH 1A1VA 1N5LA 2YOHA 3LQRA 2FMXA 2IHBA 3CPHA 2ZZUH 2QXIA 2WAXA 2QSYA 2VP5A 3B6EA 5JCPA 4YLUA 1N6PA 2BDGA 1T9HA 1OKKD 3OIUA 2IXGA 3F9HA 1CF4A 3SE0A 4X1QU 3SYJA 1BBRH 1GILA 3DVLA 3TH4H 3MO3A 3F0TA 4LUCA 1KTVA 1D4PB 1G9XA 4PHHA 1GI2A 2CNWA 3TIUA 2W26A 4TSFD 1K1NA 1M2OB 2GWHA 1O3OA 3GCTF 3KN2A 2BY7X 4OBEA 1YR8A 1EB2A 2QY9A 1RIWB 4NCHA 1KIGH 2QF3A 4Q7JB 1TQ0B 3PV2A 3LDXH 5IK2D 1Y5BT 1QL9A 3ESTA 4TYDA 2NO1A 5FH9A 3PLPA 4OK5A 4Q1AA 2ZR9A 3PUXA 1PQ7A 2UUFB 4QM6A 2C9CA 4HEJA 2G1JA 5DSZA 1NY6A 1UK2A 3UOUA 1YZNA 4FUDA 2PEYA 1E0AA 1D8TA 1G8PA 1FL9A 1CEEA 1F5RA 2QQ0A 1JMOH 2WPKS 1FTSA 5KSZA 5P21A 3E90B 3MCAA 1WDTA 4TYYA 3IKJA 4A6LA 5JBCS 3ZS9A 1O2IA 2GV6A 2QTHA 3TJNA 5J4KA 1BMFA 3LLUA 2J95A 1R0ZA 2G0TA 3HYRA 1L4YA 5K8TA 3IEVA 1KYNA 1J8AA 3A82A 1UEIA 1SXJD 2XB2A 2F9VA 1TGSZ 4JVNA 2WBLC 1AZSC 2UZ3A 5ELXA 1XB2A 4KV9A 4B2AA 3ONWA 4I1SA 1ZUHA 2J0UA 4BAKB 2BZ6H 5DO4H 2OBQA 2RGCA 1QQ4A 2ORIA 3CENA 3CPEA 1D6RA 2AK2A 4LBYA 1NESE 3AP3A 2GZ7A 3G5UA 3E70C 1UM8A 2Q3MA 3A1UA 3SBDA 3T34A 3BTKE 2FG5A 2SGQE 4A0HA 1WXQA 1SI5H 3I1FA 4B2PA 5KNCA 4OJKA 2RGGA 1FY5A 2SGEE 2OQ5A 3ZD7A 2VF7A 4IVPA 1TQDA 2IN2A 1V2KT 1CRPA 721PA 1QCPA 4P0TA 1JJ7A 1Z8RA 2GVDC 3Q8XB 3LU9B 2ZPRA 3W6PA 1C4OA 1YF4A 2FWRA 2VHUA 3A1TA 1ZM4A 4EAQA 5EXPA 1AGRA 3SYKA 2OG2A 2PH1A 4QC2A 4QOSA 1F2UB 3RXCA 1DARA 1C1QA 2BLOA 3WRXC 5FUXA 4WVFA 4D80A 5J4YA 4NYMR 1RC8A 3LW7A 1C4V2 3KB2A 2A5FA 1MTSA 3BG4B 4JJKA 1G5PA 5BPEA 2WWGA 1OH6A 1M74A 1SVOA 4YT7H 2CHAB 3F9FA 3SJIA 1RJ9B 5EW1H 1Z2AA 1JXPA 3FPAA 1UDWA 4TTRA 3SN8A 2XBYA 2QAJA 1C5MD 4HLDA 4KTSA 1N5JA 4IFBA 4RD4A 1LNZA 3C5HA 4YC7A 1K5DA 5C1BA 5A09A 4AG6A 1WBDA 1GHBF 1THSH 3AAVA 2GILA 3SJOA 1O37A 1UTLM 1J70A 2BEKA 4EPRA 4BAHB 2GAAA 3QKRB 2B7BA 3EIQA 1GBDA 3LW8A 2OBMA 1O3NA 2GJKA 1SHHB 2GMTB 6LPRA 1HBTH 3SJBA 4B2IA 2GZDA 5SZKB 2LPRA 4OI4A 3QOFA 2F83A 1FY3A 5JBBS 3A86A 2W2VA 5JWHA 4EIWA 4CEHB 2V9PA 3KEEA 1ELBA 4ZKEA 4JS0A 3U44B 4ZO4A 4XBBA 1GI1A 3EZ7A 1NJGA 1TNKA 3U1IB 2GBLA 4IFEA 1S1CA 5FUYA 3UQOA 3T25A 1X8KA 2L0XA 1TX4B 1ZZZA 3IEUA 1U81A 2CF9H 4BEJA 2HCJB 1E69A 1WOFA 1YGCH 5KOYA 2ZRIA 1Q2WA 2GF0A 4MGIR 4A1VA 2FF7A 2H5EA 1MTNB 1E2KA 1CJKC 2ZUDA 1TAWA 1G3CA 4WZAE 3D8BA 3L3TA 2J34A 3TAUA 4B76A 1L4DA 3WY9A 4Y0VA 3U3KA 2PKAA 4I99A 3RMNH 2NO0A 2OTVA 4B2CA 4GPGA 1MZDA 2GCPA 4LWZA 5A4JA 3X1ZA 1Y3VA 2REOA 2X2FA 1C5NH 2FLRH 2H7VA 4RCZA 1Z8FA 4NIXA 2FXRA 2GNOA 4DKXA 2OCAA 5K8UA 3K0FB 1X6VA 4HYYA 4DWJA 3KKOA 4GI7A 2ANMH 2UZIR 2BM0A 3QF4B 4OHYA 4ILEA 1VG0B 2PR3A 4IDHA 2OC8A 5DP3A 3GEHA 1YP9A 3A83A 3BIVH 2Y8EA 4F49A 4NA9H 2JLSA 3B78A 6Q21A 4B43A 1SQAA 3C7KA 4KTCA 1XXHE 3QNUA 3U3JA 5AF9H 1ZHPA 3A81A 3GFTA 3KUCA 1JIMA 2V6IA 3QZRA 5FTMA 1GKUB 4A2WA 5G3ZA 2JIZA 4LHYA 3SNEA 1VGCC 4DJZB 1EFHA 3LLMA 2VB0A 1BOFA 5B57C 2O8BA 2ALPA 1UBFA 5T6FA 1NSTA 5B30A 1O2LA 4DLXA 4RJLA 1SG8B 2ZRPA 4LJ8A 4U5XA 4KSBA 1E2HA 1BMLA 4NYJQ 1RRGA 3M0EA 3A36A 1KNXA 3B9QA 1GI0A 4GSYA 4MNXA 2FX3A 1N0WA 2ULLA 2F3RA 1YM0A 2NOAA 1Y3WA 2ZRLA 3I78A 3NBZC 2D1JA 3RXEA 2H9HA 5FX5A 2C98A 1UVTH 1N6IA 2XOKA 4FMDF 1KKLA 4ARZA 2TGPZ 3QDZB 1TEVA 5JCZA 3FGNA 1OHHD 3A7WA 1XM1A 2JEOA 2QP4A 1FUJA 3E3TA 1S1MA 1W44A 3LONA 5J4QA 5L3QA 2ZEJA 2IL1A 5FAHA 2OLKA 4Q4HA 4URVR 1EATA 5IYTA 1Q1BA 2YWGA 1Q1ZA 3IDQA 4DLVA 5EQRA 2BEJA 5AJYA 2Z9JA 2R2MB 2BCJQ 5JHHB 1W4RA 1G3UA 1L7VC 1UBGA 2HVXA 1HNEE 4K1EA 2I1QA 3L8ZA 4A82A 1ZAKA 4RZ3A 3SGBE 3W95A 2ZRGA 4MQBA 3E91A 1DAFA 1FNMA 4L4UA 1O2TA 3KQBA 3A87A 2ZRAA 1HAPH 1DXWA 1NO9H 2OESA 2D2FA 1P10A 4CIDA 5JFGA 2J87A 1ZGIA 2P2LA 3E1SA 1QL7A 2ZRMA 1KSFX 4Y11E 1O2WA 3MNXA 4M1OA 3ZZDA 3BS4A 1AI8H 1MD8A 1QA0A 5JBTA 2HCBA 1IQMA 2PKSB 5ANRB 2PLFA 2V6JA 1SVPA 1AK2A 2ZDLA 5A8XA 1ZJDA 3OU0A 2DE8A 2AFQB 3QLPH 2FOHA 4C2TA 2JETC 3NEYA 1JRTA 4DSOA 4PSKA 2ZGCA 1QHHA 2EFEB 2YWHA 3LC5A 2NO7A 2FZZA 3DZ8A 2A32A 3R7WB 2KI5A 5EE3A 1Q31A 4RFSA 4A8JA 5JWOA 1WUNH 4HDQB 5GCHG 3BC1A 5DGJA 3AF4A 1UKYA 1GL1A 2WSSA 3VFDA 3A8DA 5E3HA 1CBWB 4OI2A 5EXNA 4QBFA 2ZRJA 1RRPA 4O97A 4B71A 3RXKA 1F2TB 3J81k 1TBZH 1CGIE 5FOVA 1ABIH 2FPZA 4CF7A 1IQLA 4ZI3A 2V54A 1HV8A 3SUEA 2YVUA 1GBHA 3MMPA 1O3LA 1WRBA 1F5LA 3BEIB 1TOMH 3MU5A 2J94A 1ONBA 2GK6A 1G8HA 4WXPA 3SNCA 3DZDA 1CJTC 3DM9B 2BY5X 2XBWA 3M7UA 3RXJA 3GLFB 4XOIA 2IS2A 4M4SA 3A7XA 2Z9LA 4MRSA 1ZU4A 4IS5A 5GPIB 3OEEA 2F3CE 1Z07A 1KOFA 1YU9A 4B3BA 2DBYA 3LXRA 2IK8A 4D9QA 2VP6A 1DDJA 4K5ZA 1JAHA 2WIBA 2FFAA 1CGHA 3V7TA 1FIWA 1QJ7B 1RJXB 2QMOA 2AGEX 2Y81A 4MUBA 4IOLA 1UADA 3LDAA 3BTFE 3M37A 1THRH 3W8RA 2FOLA 1VHLA 3RXMA 3ECCA 2AKYA 3EZFA 4ABIA 2CNWD 3I73A 3ZV8A 1MBQA 4ERNA 1P75A 1S85A 3BBPA 2ZU2A 1GMCG 2BD7A 2FTLE 4GLYA 1SHKA 1UHBA 4Q9KA 4YT6H 3MO6A 3AASA 4GT1A 2IUTA 2AK3A 3CBQA 2ZRHA 3TJZA 2BWJA 3MD0A 3K65B 3BTEE 1W4AA 1QFKH 1UVSH 1O2XA 3JZ2B 1Z0DA 5FOUA 2JAQA 1MU8B 3PO1C 4TTPA 1FP7A 1XUHA 5LH8A 3RU4T 4J0QA 5KDOA 2RH5A 3EAJA 2RGAA 2QUZA 4IDOA 1J9CH 4RKFA 4HAUA 1DWDH 4ZROA 5AFZH 1YYY1 4INLA 1NN5A 3RMMH 3HYTA 2BD9A 3IHLA 2ZQ2A 2A2XH 3BRWD 1SGIB 1CHOG 1CJVC 5DN6A 3TJUA 1O3KA 3T15A 1LY1A 1GBIA 4RVCA 4P3YA 4X8VH 4Q2KA 4M9FA 3UXMA 4MYUA 3B1VA 1QB6A 2MMGA 4G1UC 1KDQA 5AUPB 1O34A 4EPVA 1BMFD 3OFNA 1OT3A 5EE0A 1YPHE 2AIPA 4CGZA 1R7RA 2PFEA 5GJVC 1B5GH 1G18A 4JVSB 4AURA 3QZQA 3PEYA 2I1VB 1DS6A 4TY6A 1IQIA 4MGZR 2GT7A 2AGIX 3ZZ4A 3OEHA 5FPHA 1MKXH 1IQEA 4ZDKA 1AS2A 1VDZA 3TRFA 1KXBA 3M3TA 3UR9A 3SC3A 2GZAA 4PC3A 5EE1A 4LYJA 5JRJA 5JZVA 5CIWA 4O3UA 1LHGH 1V2TT 4ISNA 4URUR 1G30B 3BOSA 4I81A 2VA8A 3KL4A 2BMGB 1BO6A 4DB4A 2VRWA 3ZJYA 3GP8A 4YONB 1R5OA 5FBLB 5FTKA 1KY9A 3DKVA 1TMBH 1M6NA 1I4DD 3GYLB 3LY5A 4Y8ZA 5KPDA 3LVRE 3ICEA 2WPMS 3K6YA 2EYUA 1B7XB 1NRJB 3FZDA 2A4QA 1O0DH 1GMHF 5BN3A 4DRZA 2BY8X 2OAP1 3JZAA 3SNHA 2ZROA 3CONA 4KP0A 1TYNA 5I25A 3B7GA 1IQPA 3AVOA 3UWKA 3ZZTA 4JLAA 3SHWA 1ZRKA 3ZYEA 3FKQA 3HU3A 4B3CA 1FPMA 4Q19A 1EOJA 3RXGA 3T5DA 4KCGA 5AJZA 1BMAA 2FI3E 2PZGA 1BTXA 5B58C 2BM1A 4MUAA 3A85A 2ZDNA 3BFVA 3PEVA 4V0ME 3OIYA 4A2PA 3I5XA 2WYGA 3KKNA 2NU3E 3DOEA 4F4CA 3M36A 1G2MA 5BRRE 2IS6A 4A4DA 2XC0A 4KYIB 1MQ5A 4WXVA 2YNAA 3A8AA 2VSXA 2G1KA 1EB1H 4R98A 2IYWA 3RSLA 4D8NA 4LV8B 2XNDA 1EZSC 1JXMA 2NU1E 2LKDA 2Y7XA 5FOTA 3B85A 4ZKOU 1EKBB 2AWOA 1C2HA 5KPJA 4EQ6A 1RYFA 4AYVB 3VNUA 3FMOB 3A8TA 3UMRA 3NEJA 2V4ZA 1TNHA 1GJBB 3CM0A 2OCVB 1B0FA 5FTNA 1GI6A 1NRPH 1M7HA 1NP6A 1MQ6A 3I92A 2BDBA 2WPIS 4ZDWA 2W3KA 2B6HA 1QA7A 2FS9A 4HUQB 1L8QA 4IN1A 1GL7A 1AE8H 3G82C 2QSZA 1NI3A 4FWTA 5EP4A 4IEEA 1E1QA 3M4YA 1X1RA 3IBYA 4PXAA 3B13B 4BRWA 4PQFA 2GCNA 1P2KA 5JBQA 2CXXA 5A8YA 1Z63A 1NVVR 2SFAA 3SV2H 3A7YA 4KI0A 1XMJA 2GVFA 1O3EA 3THWB 4E09A 1NU7B 3KDSE 3LGWA 1K8RA 1BRUP 4V0NA 1GNQA 3ODDA 1S6HA 3V3MA 3IQXA 4V03A 1EJAA 2VINA 1UKEA 3ZYCA 2C8YB 2QEQA 1UK4A 4WMEA 5H68A 3E6PH 2HJGA 3PJRA 4D81A 4RZXA 3SW2B 2VP9A 2BBWA 2HALA 1AWHB 1GJCB 1G4UR 4V0MA 4PANA 4CW7A 1U8ZA 1T8MA 2WJGA 5TCAA 2IUSA 3HDTA 4X6NA 1NKSA 5FOXA 4R7ZA 4LOYH 2J0VA 5AK0A 3F1SB 1KHTA 4O2LA 2UUYA 3PEWA 1FX0A 2YINC 4F91B 5E0GA 3K70D 3CRW1 1AUJA 4HZHA 1FTNA 3A58B 1SBWA 2ZWLH 1R2QA 2JIZD 2CK3D 1T3SA 2ZVPX 5JLJA 1GDUA 1RGQA 1S5SA 2DUCA 4U00A 2OFWA 1SVWA 1S83A 3IO3A 1Z8IB 2VPPA 1ELEE 1BBRK 3OZXA 2ZC9H 1XUJA 5HMAA 4UFGH 2BDAA 1W36C 4EDHA 1ZR0A 4PQYA 2PBRA 4B34A 4AB8A 5BWMA 4RKOB 1R10A 1E1RA 1SZPA 1CRQA 2FZLA 2H9EH 3VPKA 2OFXA 3CRMA 2FPKA 1BHXF 1AGPA 3E8LA 2XOKD 3EIEA 3SU0A 2FEOA 2OT3B 1T8NA 1SKQA 5EW2H 3CS7A 3HPRA 4IVRA 1EJMA 1SXJB 5TDHA 3FMFA 5LB4A 4HATA 1PYTD 1ODFA 3GCGA 2CVFA 1O2KA 1W0KD 2QL6A 5AUOB 4HAXA 1BTZA 2I6SA 1ZMJA 1KNQA 1Q3HA 3UOPA 5BW8A 1FDPA 2Z83A 4Q7KA 821PA 3E0NB 4X8LA 4PQRA 1C9KA 2Z9KA 3T06B 1VCQA 1T4VH 3SQHE 1ZHRA 1A4WH 3K53A 2GZHA 3K70C 3DDCA 2ZA5A 1RRKA 4XJXA 3KZ1E 1DITH 2ZE6A 1GJDB 4GVUA 2BV3A 1XCMA 1NIPA 1Q22A 3ZVNA 2Z4SA 3BFKA 5SZHB 2F9LA 1TRMA 1RFLA 1NVVQ 5AJXA 5FCKA 1LHFH 3N70A 2BTCE 3KJGA 4OS1A 3SZEA 5CB6A 1SVLA 4CZ2A 3FHTA 1GBJA 3FP8E 2KAIA 4DDWA 5JHGB 1VTKA 4TMZA 2GKVE 2HWLB 1AY6H 2O8CB 1KY3A 3OTPA 4UXJA 4I8JA 2PGQB 4DCUA 4LCBA 2H1UA 3EAQA 3SQXA 1UCYK 1O2NA 2V3HH 2Y7ZA 1DO2A 2EFDB 2OBNA 1SQTA 1EPTA 1KI7A 1T8TA 4KVGA 1FNIA 2FX6A 5C3NA 2IYZA 1BTHH 3TR5A 4C30A 3L6PA 3TNTA 1EAIA 1LHEH 5E95A 3NTUA 4BZPA 4WXRA 4ABGA 4FUBA 4U2WA 1WMSA 3BG8A 3U60B 2QBYB 4ABDA 1JPNA 5D3MB 1PYTC 1HQCA 3H7TA 1A46H 3RC6A 4BAMB 3AKEA 221PA 1YZLA 2BD4A 2WSSD 3UUZA 4GOKA 1GPZA 2BXUH 3LV8A 4DEYA 3KKPA 4BGDA 3SU4A 3ZVEA 2ZSFA 1VJAU 1E4YA 2HLDA 3KX2A 2VP4A 4Q4AA 4MNWA 1DLEA 2OCBA 4BTUB 1KY2A 4OGXA 1XFAA 2TBSA 3UR6A 1WQVH 2R62A 4FUJA 4C0BA 3MH6A 3ZZCA 1VZQH 2WJIA 4XSGA 4P32A 2GX4A 2QM8A 1THPB 2WV9A 1OFHA 4KFSA 2V8OA 3T2NA 3VKHA 4NZQA 1YQTA 1JR3A 1NM6A 3RC3A 5L30H 1XEFA 1UBCA 3PMAB 4QG7A 1P2JA 3OEED 1P2QA 3B1ZA 1V3XA 3NC0C 3TNFA 2PSYA 5KUTA 4O0MA 4Y0YE 4EFLA 3OX7U 4ZMAH 3M5LA 2WMNB 4D82A 1MZAA 3BWDD 5JEEA 1CXZA 1G17A 4I1OA 2NO6A 3P26A 2C04A 4NZLA 2QRZA 4FI3C 2FODA 1SC8U 5ESBA 3PUWA 3X1DA 5T6DA 4TL6A 2R6GA 1OW3B 1AJEA 3KQKA 5C1YA 2F9PA 2PCLA 3P32A 3GDVA 2YOGA 4A8JC 5BN5A 2CBZA 4Q7ZA 3QBTA 3KIDU 1KXEA 2SGFE 2F91A 3NDPA 2C3SA 3IPXA 3CNLA 2WHXA 3OYPA 3Q00A 1E32A 1DICA 4X8HA 1P01A 2OINA 4TL8A 4L16A 2Z5FA 4LBZA 1N25A 2D7CA 2EFGA 4GHQA 4GP7A 5KSOA 1NFUA 4HTCH 1GI3A 2ANCA 4A92A 1CVWH 1NZQH 4NIVA 1FZZA 2G5VA 1HCGA 1Z0IA 3QO6A 2GCTC 5DN6D 1NMXA 1UK3A 5L8VA 5JI2E 5BYKA 1C2IA 2H8KA 3TSOA 2ORVA 2BDYA 2WM9B 3OFND 2C93B 7LPRA 4CRFA 2G4UA 3IUYA 5C20A 1HIAB 2BVNA 1Y5UT 1W7XH 2PJZA 2BCGY
chains in the Genus database with same CATH superfamily
1XKAC 4NCXA 3MAAC 1M1NA 3VDNB 5B6IA 2BJWA 3U40A 3AU9A 4DGJA 3NPMA 3VKUA 4NI5A 1SIUA 2CVHA 1TT5B 5JMPA 3TK5A 4GGOA 4E2XA 4B3SB 5BRAA 3JWGA 5FO0A 3TJRA 4D3DA 4GUXA 3QXHA 3ELAH 2B7LA 1P60A 3H2YA 1LQUA 4Z8YA 4ZJUA 1HDIA 4F71A 1M34A 1T9ZA 2Z5VA 2YIDA 1KO1A 3Q7IA 2VDVE 4P3KA 2CCGA 3AUFA 5C1OA 3DT8A 2OUIA 4KW7A 1Z0AA 3UXEA 4C3ZA 3UMVA 1EP1B 1OC2A 5GJBA 5CEFA 5AW4A 3HJRA 4KSYA 3EIHA 3RC1A 4S2UA 1OXSC 2JGFA 5HGJA 1V5WA 1NFFA 4REQA 4B47A 4RMIA 4K05A 3L0PA 2WKQA 1CR0A 1IZZA 1U7TA 4PCUA 4O4LA 3EUFA 3HDHA 2PRZA 1UC9A 1REQA 1ZIOA 3F9GA 4ISIH 1Y8RA 2P77A 1Z5WA 5DG6A 2I6GA 2FSVA 3C87A 3UWDA 1AKUA 4G0NA 2QE7A 1DUAA 1ODJA 3A6GA 4Y0ZE 3GGJA 1NVBA 3OPQA 2XDYA 3RM2H 2VATA 2VLBA 3U7FB 1KP9A 1C1UH 5KWJA 1AM4D 5F53A 2VTEA 1JQKA 1RI4A 3MJRA 4CEIA 3MNFA 3ASZA 3JZMA 1SIOA 2J8ZA 4ZI5A 1GG6C 3FKSA 2J9RA 2AL7A 1H4WA 4I4TB 2BEUB 2LGJA 3RHTA 2A9RA 5EZYF 1N8KA 3UWMA 1PFWA 2X3UA 4M0KA 2RB5A 4ESVA 3WMFA 4L7VA 4FMCF 5BWOA 2H1CA 2H7YA 1ZK4A 2G67A 4PS1A 1HPGA 3PO1B 4CN8A 2WYOA 2VDWB 3EDYA 1WCV1 3CR7A 3UK7A 3LC3A 5A5EA 3RSQA 5KX5A 4KIWA 2Y0BA 2Q49A 4TKVA 1ZLRA 4L3OA 4TQUS 3AHDA 1JQDA 2LR0A 2OM6A 1Y6RA 1GKYA 3SFZA 5DM1A 3PWZA 4ZT4A 2FNAA 1U0NA 3V4ZA 1J1IA 3F73A 4F46A 4HNSA 3PT9A 1ZIDA 2JJ8A 3SHQA 4WWHA 4PWYA 4TPYA 3DXFA 4NOLA 4CT4B 4TY7A 1QB1A 2GPAA 1P5ZB 1UDRA 4FB5A 3UFAA 1BBRE 5A1JA 1XDUA 3D6VA 1FYWA 4PRYA 2C97A 3ZHUA 4HGOA 1NURA 1LW7A 4XDGA 1C5QA 2WR8A 4QRHA 3GDGA 3L6EA 2R44A 4ZOQI 1YPHC 2AG6A 2G1PA 5A7FA 1WTAA 1YFKA 5CVJA 5JS1A 1WD5A 4Y6RA 1E3WB 5ETXA 1A3BH 3NWPA 3V8VA 3AHFA 2W6OA 3DV0A 3TD6A 4LWOA 2F9UA 1PFXC 2OHHA 1U2SA 1H6DA 4AICA 2WW8A 3X2SA 4R8LA 2Y76A 3WIOA 4GVXA 4IN2A 1T8PA 4LF6B 1ESCA 2C59A 3GJ5A 3TZCA 1U8UA 5L3ZA 2QP9X 4QJ3A 4FN5A 4PZYA 5BV2P 1YB4A 3EG5A 3IURA 4AJ2A 4MRNA 1ANDA 4GZ6A 4J2TA 1B76A 5ARBA 4I5FA 1LA2A 3B3FA 1THZA 3ZDQA 4M83A 4RWEA 2KCOA 4AMGA 2CUNA 2C78A 2BDCA 4PG5A 3MGGA 3W1EA 4FW9A 4CUKA 4K9KA 4RV5A 3W5VA 3HGNA 4E5UA 3LHFA 3BGSA 4JP1A 4C4ZA 3ZI0A 1NNI1 3PA8A 3B6IA 3T9BA 4RVDA 3NQ41 3URKA 1PG0A 4J91A 3D1JA 4XWGA 5T8KA 1SO8A 3GFQA 3ZDYB 4NECA 3DLIA 1ZK0A 3D0RA 3KNXA 1O77A 4G8CA 1T6BY 2AGGX 3LGXA 2QVYX 1ADFA 3HBAA 3NDBB 2DWPA 2WWHA 5ABWA 4C2UA 4BBZA 3BTHE 2WF7A 4DHEA 4HUTA 4P5PA 2VSOA 4QWMA 4CE6A 5F9MA