5FPSA

Structure of hepatitis c virus (hcv) full-length ns3 complex with small-molecule ligand 3-aminobenzene-1,2-dicarboxylic acid (at1246) in an alternate binding site.
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
642
Chain Sequence
b'GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEPATITIS C VIRUS FULL-LENGTH NS3 COMPLEX
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 202
structure length 642
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5fpsA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fpsA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5fpsA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpsA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpsA03
1FJSA 4OS1A 4GP7A 2C8ZB 4K81B 1ZJ6A 4EJSA 1QNJA 1NZQH 5KDLA 3QKTA 1S84A 4ZDJA 2ZJYA 2VHJA 5FOVA 2GF9A 4H4FA 3SJ9A 3AF1A 3GOVB 3VFEA 1SXJA 1YRBA 1C9KA 3SR0A 3BEIB 4PROA 3T61A 3JVVA 3AKEA 5CITA 1VITG 3T15A 5C4MA 1DG3A 4CRFA 4E5UA 1I2MA 2HLDA 5JBAS 1QBKC 4HI0E 2HT6A 3P17H 3K9GA 1JECA 1Q3XA 1U0JA 4TYWA 1LPGB 4YZUA 2CJIA 3U2QA 4KGAA 4CHAC 1TU3A 2GZHA 2YHSA 1ZOMA 4M1SA 1KY9A 1D3TB 2WPMS 2W3IA 4LPSA 5HZKA 3A89A 1BMFA 2FGJA 4UFDH 1TUIA 2FZLA 3M7TA 4OYHA 3BB4A 1TGBA 4B2PA 3BIUH 2IYTA 4D4JA 2ZCHP 2XSZD 3RU4D 1CO7E 4I7YH 2J1LA 1OJLA 1W47A 1N6PA 1Q1QA 2VHTA 3K09A 2FPKA 3RS5A 2XWAA 2DPXA 3HYTA 4HAXA 1JOUB 2OP9A 1DXWA 1JI0A 2FX4A 1ETSH 1IJEA 1G1MA 4UNPA 4O3TA 1GBEA 4A92A 1QL9A 3NH6A 1NN3A 1S81A 5LH8A 5FBLB 1I4DD 2RGBA 4B3FX 4MKIA 3B8JA 4NFFA 2BOVA 4FXGH 2ZQ5A 2HYIC 4M1WA 3PUXA 1RJ9B 4JYVH 3W8NA 1WQVH 1TBQH 2FWRA 2VWOA 3SJOA 4PAOA 3ATKA 4A0HA 1T8LA 5TARA 3IHLA 1O5EH 3LO5A 5GJWC 2XTZA 3ZZ4A 2FH5B 2LWIA 4RFSA 2B21A 1V2KT 3QZQA 4M8NE 1XRJA 1ZTLA 4LHYA 4OI2A 3MHWU 4TLCA 2QGZA 1K2I1 3EPHA 4TMKA 2BXUH 1IHSH 1O3PB 4UONA 4UE7H 3GD7A 1W12U 2FA9A 2NO9A 4Q80A 5HXFA 1BTZA 4LV8B 2W7SA 4MRPA 3K0FA 1XKAC 2VH5R 4ESTE 4KSBA 3TPIZ 1Q0UA 2IA5A 1Y3XA 1Q3HA 1A0HB 3PYHA 2ZHQH 1HH4A 2O8CA 5DNYB 1AM4D 2HJVA 5HM2A 1G3UA 2ZNKH 1R4AA 3L0SA 2W26A 4US1R 3A4NA 1WP9A 2WBLC 3AVYA 2HCJB 3N2EA 4MUBA 1ANDA 1QDEA 4U7DA 1P2MA 1JR3D 1ZCAA 2UZIR 1H1BA 4CH2B 1X1RA 1LKAA 2TGAA 4INLA 1FQJA 3AW0A 3LPRA 5FUWA 4YC7A 4D76A 2J3EA 1K1JA 1TOMH 2Q3FA 3W5JA 1GHAG 3AUYA 4PPFA 1MQ6A 4X8MA 2BQ6B 2XXAA 2G77B 1R5OA 1COWD 2AYWA 4EJSC 3X1ZA 1W4CA 1H8EA 1A1RA 1II0A 4EIWA 3BIVH 4IBLH 3W94A 3ESTA 2ALPA 4NYIQ 1XM1A 3ZVAA 2IS1A 2VIQA 1SXJC 3W6NA 1S3SA 1OWEA 5EU8A 3MH7A 1XXHB 5DKMA 1VG8A 2O52A 1EUFA 4N1AA 1GJAB 4HLDA 4B2AA 2C93B 2IYQA 4OQLA 3DUXH 1P62B 3HR8A 5CHAC 1BKDR 2QGNA 1UK3A 1VR1H 1E2IA 2ZU1A 4MDFA 4DT1B 3D62A 4LZ4B 4L15A 1Z3IX 1IQIA 2Z9JA 4K60A 1TX4B 4ASUD 2ZR0A 1MZDA 2B9LA 3IO5A 2F1RA 4NCNA 2EI7A 3K65B 3K6YA 4EPXA 3NUMA 3K09C 4M9SA 4Q4HB 5E7MA 1NP6A 2FOFA 1XUIA 5AWFC 4C2UA 3A83A 5KNBA 4AIIA 3BSQA 2C4FH 3QKRB 2C5LA 4WXRA 4US2R 4AN7A 2OINA 1SGFA 4V0NA 3ELAH 3EZ2A 1GBKA 4BQSA 1OF1A 1UBCA 1SQ5A 4LV5B 5JZVA 5J4VA 1WA5A 1KTTB 1O2MA 2EI8A 3B8HA 4MGKR 3K2UA 3CPJB 1H9IE 5DHFA 1TRYA 1DAKA 2PGBB 4LHVA 3TVDA 1T6NA 5T6FA 3GJ3A 3ZD7A 2P94A 4X2XA 2BVSH 7GCHF 3SNDA 2IXEA 1O2VA 4KBGA 1R5BA 3ZZUA 3FVQA 1GJ5H 1Z6JH 2FOHA 3PG5A 1EFCA 3CF6R 4NONA 3I8SA 2V54A 2A5YB 3I3SR 4G5OA 1TRNA 2K1QA 4M1OA 4DBLC 1KLTA 3R8CA 4DDWA 3E5HA 3ONWA 4QBFA 1ZNYA 2EFDB 3VHXA 4ZKDA 4NPHA 3U44A 1CXZA 1ZVQA 3UMRA 1S1CA 3QPWA 2XOKD 2JLZA 2OZEA 2QGRA 5CM9C 2VP2A 1OLOA 1HB0B 3AM1A 4NCJA 2XBYA 4AG6A 1AFEH 1W0KD 4R7ZA 1B5GH 4HDQB 1LVMA 3LGYA 2ZPTX 4KELA 1A7JA 2CLDX 1NG9A 4A1VA 3VNVA 4ZV4A 2XZPA 1T0HB 5EP3A 1XTKA 3DM9B 2O8FB 2W6ID 5DJ7A 2DYKA 1W5TA 3M61U 2OHFA 3VXFH 2SFAA 3W95A 5GJ4B 2J34A 5JCPA 2VIOA 1O39A 3UWOA 1TB6H 4V0LA 2GZAA 3O8DA 4BTUB 4QM7A 1EJMA 1RC8A 2WJYA 5IK2A 2GCTB 2A5JA 3BH7A 1QB9A 4Y0AA 4OBEA 4KJZA 4FUHA 1AKYA 1LVBA 2GEDA 1BMMH 1CLUA 1M7HA 3S7HB 3F5FA 3CKLA 4B44A 1VITF 1T31A 3AKCA 1YPJH 3RRMA 1CA8B 2PKAB 2GT7A 1NVVR 2BD3A 4ZIRB 2CK3D 1E4VA 4Q1BA 2J46A 3NHBA 1IXSB 4ARZB 4ZROA 4IHQA 2AXPA 1BMLA 1C1TA 1NESE 2ESTE 5FH9A 3W9YA 2SGQE 4W5JA 4KVAA 1X8LA 3V3MA 4OK6A 2BTCE 4X8SH 1EFRD 2A4QA 3D31A 3A85A 3FMFA 2O0HA 3AF0A 5L30H 5L3QB 1GI3A 1A2KC 1C5TA 2BQWB 1C5ZB 3SBKA 2REOA 5FCKA 2F91A 1AVWA 3BV9B 2W2VA 4AKGA 3ZVCA 1M1YE 4ZCIA 2SGDE 1XKBC 4RY2A 1YE8A 8ESTE 2AMDA 4DVGA 1ELEE 4OM9A 4GMXA 2D1JA 2ZTYA 2EW1A 3A4MA 4SGBE 2C77A 4RKFA 4C0QC 2HALA 3U3KA 1L4UA 1KO7A 2GKVE 1DUAA 1P2OA 4U30A 2X2FA 3N7OA 1W7AA 3QXCA 4WH8A 2O8BB 3DA9B 4UFGH 1W13U 3VKGA 5F8ZA 4TLEA 2IWHA 1NNEA 3Q5DA 1CT0E 4CEIA 2Z43A 1U6QA 3EAQA 4FXPA 4RD4A 3TQCA 1PYTC 1C5SA 4BFTA 3FFGA 2NU0E 1CF4A 4TQUS 2UWPA 4HFPB 3SE0A 2K5UA 1E2MA 4PTLA 1ANEA 2I3BA 4M22A 3AP1A 1O2XA 1US8B 3RC4A 1WQ1R 5AUNB 1VCPA 1GRRA 3THWA 1FNMA 2FTMA 3BF6H 1W4BA 4IEIA 2VH0A 2NPFA 4ESVA 5FTLA 1RFNA 2DHRA 2G6BA 3T12A 1GPZA 3SN6A 5GIBA 2H9TH 1ANKA 1EGAA 1VMAA 5DGXA 1NFYA 2NG1A 2YC4C 1IAUA 1D6WA 1FOEB 1IOEA 2V55B 4TY7A 1H8HD 5FXLA 4DSNA 4UEHH 3RU4E 3F68H 4I32A 5GJCA 1E2NA 3RXVA 1VJ9U 1A3BH 4Q9LA 3QQ5A 3FVFB 2BBTA 2B8WA 4ZKOU 2IBMA 1PV4A 1S85A 5A8ZA 4TMTA 4LHWA 2F9LA 3ZZ3A 2FJUA 1WAYB 1FAKH 4TSFA 2BB4A 1AUTC 2OQ5A 4Y76A 8KME2 2RDLA 4D0GA 2VIIA 4YMVA 1D2NA 3GLGA 2C99A 4RSPA 1QG4A 1ZC4A 5FUVA 3NBZC 1D2MA 1XFAA 3RP2A 3LWNA 3VNUA 2CXVA 4LC0A 1R2QA 1GWNA 1XEWX 3RXBA 3DVLA 3L33A 1RFLA 1GBAA 1ZD9A 2ZHFH 2IS4A 3MWKA 1MU8B 3P1JA 5EXPA 3DHKH 3RS0A 2LKDA 1YQTA 3A37A 3UPEA 2OXRA 4M53A 3CENA 5CDFA 3T5GA 1D3DB 1VYUA 1XCPA 2EYUA 3ZDQA 3B23B 1EX6A 2XZLA 1DY8A 4AFUA 1YF4A 421PA 2BEJA 2GRJA 4C7OA 1ARBA 2DY1A 1XCGB 2AKYA 1MH1A 1YPGH 1BB0B 4UD9H 1QG2A 1OFUX 2OUKA 3NWUA 3VB5A 1OOKB 5EXTA 3LJOA 1BBRE 1FMGA 3NWJA 2ZGHA 4MITA 3T34A 4ABYA 3ND9A 4F92B 1D3PB 3NTUA 2ATVA 2MSEB 3RXAA 3MTYA 1QB6A 4P4UA 2Q6FA 1BO6A 1LDTT 2CNWD 1T8UA 1WBDA 3GY7A 1FV9A 1GNRA 4KCGA 1GHZA 2ZRHA 4JT2A 2VGCC 5EODA 2ZG0H 4JLAA 1ZR0A 1JR3E 3PMJA 4Q7YA 1YP9A 3QEOA 1CJKC 4IOMA 4BLSA 4YLGA 2X2EA 3SOPA 2TRMA 2OFOA 2EWVA 2YOFA 2OFXA 4PC3A 4RSGA 2GAOA 3SNEA 2V6IA 1A5GH 2IYUA 4H6SB 4ABIA 1WQSA 3RXIA 3OE7D 3U60B 2MSCB 4JZFH 2Z6BD 1HJAC 1E1QD 4Y71A 4NCYA 1B0UA 1VCMA 1O2JA 3UIRA 2V35A 3KZ1E 2C8XB 3GMTA 5FBVB 2OG2A 4BFVA 1VYTA 1U94A 1O2OA 4U00A 2GCNA 2BD4A 4DEXA 3SQHE 1G3BA 3GY6A 1QHYA 3VX4A 3GDVA 1FQ3A 2SNWA 1KDTA 3LNCA 4LI0A 3QNUA 4E7NA 3SYJA 5FBRB 2C78A 1QHXA 2ZSEA 1SOTA 5DP6A 2UWOA 1WF3A 4K1SA 2D8WA 3MU1A 3VB6A 2Q6GA 1HAHH 1MKXH 4MH0R 4A6LA 2ZTXA 1J99A 5LBIA 2GZ9A 1VTKA 1JPJA 2IF2A 1YKTA 5JFGA 4TTPA 2VIPA 2W58A 4F4OC 2J59A 4L4UA 1F0UA 3DFJA 4TYQA 2AGIX 1NRQH 3GLHB 1GBJA 1O2KA 2VHUA 5L3VA 2N1BA 3BFVA 2ZRKA 3SGBE 3UQVA 3WYGA 1AGPA 4P4SB 1SSXA 1ZTJA 4D4LA 2H17A 3CLVA 2WPIS 1G17A 1S6HA 2FE4A 4JMYA 1OFIA 2VIVA 4AD8A 3QTOH 1JXMA 3SDZA 3PFIA 1G20E 5CK5A 1TX8A 1PLJA 5KSPA 4BFYA 1PPCE 3P8GA 2ZGJA 3TU7H 4KYIB 1GKIA 2BHRA 4QBIA 3PCRB 3UIEA 1RXPA 4FN5A 2GXSA 1THRH 1ZPCA 2E1RA 4DCUA 2QT0A 2J9RA 2BVXH 3BS4A 2BKUA 1DWDH 3SV7A 2AXNA 1Q31A 4Y7BA 1HAOH 1YZQA 1BUIA 1P2KA 1W0ZU 1XTJA 1W2HA 3A36A 1HAVA 1C4U2 4V02A 3IQWA 3KNXA 4ZUHA 2VINA 3RXRA 5KDDA 1KYNA 3BTEE 2G55A 4DCSA 2P6NA 3BEUA 1AWFH 1P2UA 3PUVA 1V2VT 1O2LA 4MTBA 4LRWA 1SL3A 1W1WA 4LY6A 4K69A 1NMZA 2GGVB 2ASEA 5I46H 3OEHA 3I78A 3TAHA 1O3BA 3WMGA 1PVOA 1P2IA 2W6JA 1FI8A 2ZPQA 5ABWA 2ZRMA 1Q22A 4GSYA 2C3SA 2BMJA 2IYYA 5CK4A 4IN2A 3EZ9A 2JDID 1ELBA 2PSYA 1GI5A 4KODA 1XX9A 1P2JA 4X1QU 1NKSA 1O3OA 3CRMA 1O5GH 4NP6A 4PFSA 3TR5A 2ZWLH 1GFIA 2XEXA 4MYCA 2VF7A 4XBBA 3SI7A 3ZZTA 4EKDA 2A30A 2QG6A 4R2HA 1BRBE 2H18A 2FF7A 1GCTC 2BLVA 4MPXA 1QBNA 3U6KA 1C1SA 1DPFA 1NT1A 2WPDD 3L6PA 2OCBA 1RRPA 1Y3UA 2WUCA 4YT7H 3QWCH 4MGIR 1NIJA 1N6OA 1ZUNB 4UXJA 2VTKA 1JB1A 2H5CA 1TX7A 2BX4A 1J9CH 3BRWD 5FR1A 4ON9A 3ZVFA 2KAIA 2ZCLP 3RXSA 2G51A 3LJJA 4RZ2A 1W14U 1KDOA 1OV4A 2FNAA 4MGYR 2Z7FE 5EW2H 2OC8A 1ZGVA 7KMEH 1P10A 2WPJS 1IQMA 1MT0A 2J7PA 3QF4B 4PHTA 3FKQA 4BFUA 3OEED 1C1UH 4NA9H 1P9UA 3TR0A 1B23P 3CNOA 4FUEA 2OXSA 1QA0A 3U8TH 3UMFA 1DE7H 2NWNA 3KFXA 4PSKA 5FOWA 2RGEA 2VP0A 2QPAA 4IKEA 3GJ7A 1O2WA 3MJHA 3QDZB 1UTNA 1NMXA 1FFHA 2ZSBA 4JYTA 3U98H 1FUUA 4C0HA 2QIQA 2H6MA 3FZDA 1KXDA 1ZYOA 1Q1BA 1PLLA 2PMDA 1KAOA 4B43A 3H84A 1K22H 5A0FA 2QI9C 3Q77A 4FMDB 4B35A 1G3QA 4PPQA 3TGKE 1OP8A 2WMOB 3AVPA 2CF9H 3W3AA 1P3CA 3K9LA 1IQNA 4Q7JB 4B34A 4JYUH 1W11U 1II9A 2OBLA 4LYHA 1WB9A 2GK7A 1N8OC 3B9PA 1MOZA 3UOUA 4TL8A 2H9HA 3K0AA 4HAVA 4OS4A 4J0QA 5JSZB 3AVWA 1I4TD 2C90B 5A0BA 4TMXA 1GVLA 1E35B 2C98A 3GCTG 5GWZA 2P5SA 3TRFA 2VLIA 1ACBE 2P67A 2Z94A 4HUQA 2XBWA 2ANBA 1BTUA 1E32A 4FU9A 2VIWA 3S7KB 1BOFA 3LLMA 4ABDA 2ZUBA 4CRWB 5AJWA 4W5WA 3A8AA 2FP7B 4XVUA 4ASHA 1SVLA 1RIWC 1W10U 5KUTA 1EP5A 1TPPA 1N6IA 2VL7A 1OWKA 1C4OA 3X1XA 3ZJYA 1OS8A 2ZDAH 2JJ1D 2RGXA 3U8OH 2OC1A 2R2MB 3NK8A 1MQ5A 4IOKA 1QBVH 3HGNA 2JIZA 4BZXA 2ZP0H 3RXFA 1XUHA 3TH2H 2GXUA 2C8VA 1RPZA 1RRGA 2JAQA 2EFGA 1CVWH 3ZVBA 4LJ4A 1OHHA 4RZ3A 2HLCA 1C1QA 1P11E 3EA5A 4O03A 1NS3A 2WJHA 2JJ2D 2ZVPX 2N46A 2WPKS 5JJIA 4M9ZA 1TPZA 2DCUA 1BHXF 2O8DA 1XJ0A 1GDUA 4ZAEA 1J2JA 4PO1A 3T06B 4XJXA 1EJAA 2FFAA 2YWHA 3HPTB 2HCBA 4C3ZA 3U69H 1NRNH 4NZQA 3GPLA 2W7UA 1IY1A 1ELAA 1WOFA 1LB1B 2OE2A 1EAIA 3L0OA 1BYUA 1FPMA 5TXGA 2FM2A 4Y8ZA 4Z0KA 1AIPA 4PQYA 1GVKB 1R8SA 3RXDA 2FSGA 1OIVA 2B92A 2YWFA 1YZNA 5AJVB 4MYTA 2HLDD 2IYWA 2P8OC 1U8AA 4ILEA 4CREA 1R7RA 1M8PA 4OQNA 3MGCA 1P72A 1MRNA 3KKQA 4LDJA 1SGPE 1EZSC 2JLSA 4F7WA 5LGOA 1EX3A 1T3HA 3T5FH 4CW7A 4BAOB 1KYIA 3SFZA 1UADA 3E1XB 2NU4E 1E96A 8LPRA 2FI3E 4DOQA 1MD7A 3GJXC 2ZQ1A 3HWSA 1YZTA 1GZSA 1P9WA 2R9PA 2GKSA 1BBRH 1S0UA 2VSFA 4DCTA 1SFQB 3GLIA 3Q3XA 4MYUA 1E0AA 1W36B 3EARA 5DP3A 1DAHA 4PZYA 2GX4A 5B57C 1AB9B 3A7VA 3GLFB 1OE0A 3O47A 1E0SA 1UCYK 9LPRA 1N2CE 3PEYA 4XBCA 1WMSA 1Q3TA 1YM0A 3IDQA 2AIPA 1UVPA 4QL3A 1KK3A 4E09A 1A82A 4JZ1A 3RDZA 1XP8A 1F0RA 3KQHA 1GVNB 5EZ6B 3EASA 3IEUA 4UNRA 4DLVA 2GCOB 1SOZA 1XPUA 2VPPA 3SV2H 2Y5GA 2WAYA 2J38A 4OI0A 2NGRA 1GGDC 4HUTA 2ZPSA 4GMDA 3BTDE 4BAHB 1Z0DA 1K1OA 3AVVA 4FMCF 2VP5A 1G3RA 3AK5A 1W2KH 4QHSA 5BWMA 3DOFA 1JJVA 5A4JA 3U1JB 1N0UA 1SVPA 4C4PA 5J47A 1OYTH 5JRZA 2AERH 1V2NT 1HIAB 4YDSA 2CBZA 4D7FA 1YPHC 1GSIA 1RJ9A 2BLQA 4EPWA 1C5UA 3LVQE 3I5XA 1R10A 4XFQA 4B3DA 5JPMH 4CT4B 3VB7A 3ZZBA 2KE5A 3IEVA 3VR3A 3RXKA 2QRZA 3NHAA 2LPRA 1P06A 5GJBA 2TIOA 4BOHA 4LSGA 2JA1A 2WV4A 2RGNC 2O8CB 1G3EA 4MVNA 1CJVC 3A81A 1QF9A 2ZKSA 4BLOA 4DLSA 4KI0A 4OGYA 3RXUA 3KKOA 4IXNA 3KF2A 5FUYA 5GJVC 3SHAH 3LVRE 2Y80A 4DG4A 1GMDF 3VAAA 1P9RA 1Y3AA 5HGGA 3SN8A 2HV8A 2Q9CA 1V2ST 4DSOA 4PPNA 2VO1A 3P4XA 3CBQA 3A82A 1VCIA 1O3KA 1ZJDA 4Q02A 4UQOA 2OLJA 5FBWB 3I4LA 5DE3A 2XXAB 1KI1A 1DPOA 1P3EA 4ZHAA 2GP9B 1C1VH 1V3XA 2ZRNA 2CHVA 1DFPA 1PUIA 1Z08A 2YNBA 5HE8A 4B33A 4G5GA 1C2JA 3K6ZA 4XE4A 4CDGA 3MLEA 4J2YB 4M21A 1ZZZA 2A2ZA 3Q7QA 1X3SA 2RHDA 2Q9AA 4OQFA 1TQDA 3PV4A 4AG2A 5EXSA 1KNXA 5JWHA 1O3YA 3M5OA 1MO4A 3LW8A 1EP6A 2YOGA 4TWYA 1G19A 4BLQA 2P5TB 4NIVA 1RTLA 1OPHB 3CF0A 2P59A 1R0WA 5FPYA 2ZIQH 5GDSH 1CULC 4MDEA 4XWAA 3KDSE 2QZ4A 2LCFA 3IWMA 4JL8A 3LOXA 3K53A 3V7TA 1O0DH 2QSYA 4GUXA 1V2OT 3ZZ6A 1O5FH 4OL0A 4Y0VA 4OHVA 4KXFB 1XXHA 1UKVY 4TTRA 3HK6B 1MO3A 3BTHE 4BGDA 2P0EA 4JVSB 4DWJA 1IXZA 3NCLA 5LB2A 2P3SA 1BTHH 1XTRA 2ZRFA 4B6FA 2REXB 3L82B 3Q9LA 2A4GA 3UANA 1BTWA 1TMKA 5HZHA 2F9MA 2ZAMA 5C20A 1GHWH 2GEVA 2FXRA 4DT1A 2WAXA 2ZR7A 4LBYA 1F5RA 1BIOA 1TNGA 4ZH8A 5LPRA 5DP5A 1WUNH 3OYPA 2H92A 5EOKA 3TVTA 4N0EA 1CR4A 1M7GA 1F48A 3RHFA 4Q4HA 2GILA 3GCTF 4QJ3A 3VGCB 4FCWA 2R0LA 1PYTD 4M1YA 4GI7A 2A32A 3QEJA 3QKRA 2DFLA 3HPQA 2HWLB 3NKKA 4NSVA 1GAJA 1GG6B 4HDCA 4WZAE 3SU6A 5IYTA 3L0IB 1W0YH 5JI3E 2IYRA 4XVRA 2QM7A 1YPKH 1HE1C 4NYMQ 3D65E 1GI6A 1SLWB 1DAGA 4QOSA 1A4WH 2UZ3A 1DO0A 1TNJA 2SGEE 3UNRA 1LS6A 1YPEH 5EQTA 1GL0E 1N6XA 2BCJQ 3NDBB 2VSOA 1O36A 1JEEA 2ZS9A 2CF8H 4AG1A 4IMQA 1ZBDA 1O33A 1WYKA 2OBQA 1CR0A 3VFDA 3M7QA 3RDPA 2BMGB 3AKYA 4DVAU 3THOA 1KO4A 3I5YA 1GOTA 2PV9B 3DHWC 5AK0A 2H1UA 2BOKA 4GPTA 3ZLJA 1GMCF 1S6FA 3BFKA 2P3UB 3A8CA 1HAIH 1XXFA 3TVJB 2CLSA 5JI2E 5TJXA 2BZ6H 3ZS8A 2OAP1 2GESA 4XOIA 4ISLA 1F5KU 3PQCA 1T32A 1FY5A 1O2NA 3X1DA 1DADA 1DVRA 2OC7A 4QJ5A 1KSHA 3I92A 4RCYA 1AMHA 2EFEB 8GCHG 2ZI5A 3ZYCA 3VR1A 1NROH 2ZU0C 1H8DH 3I32A 2O8FA 3MO9A 3UTUH 1C2HA 2HJGA 3TLXA 1RKBA 1G2MA 4A2PA 2V3HH 2A4OA 4LJ7A 4NYJQ 2ZA5A 1DAIA 4PSVA 4FWIB 1ZTKA 4Y8YA 2FYQA 4BLRA 1DS6A 2A31A 3B1WA 2EI6A 3B1XA 1M34E 1ZSLA 5DN6A 2Z5FA 1AJEA 1IY2A 3O8RA 2PX3A 5H8WA 3CNNA 2XTTB 4X6NA 5HTKA 4X2VA 2Z3EA 2F1JA 2PKAA 3LBHA 1BS1A 3WMEA 2XCNA 1XMSA 3CONA 2ORIA 3MCAA 4CEJB 1KSFX 1IJFA 4ZIRA 2FSFA 2G83A 3WRYC 1T5LA 3QPVA 4ARZA 4LPKA 2VGCB 1UEJA 2QXGA 4A6XA 3BEFB 5JBBS 2BC9A 1G3CA 5HE9A 2J45A 4KLZA 1G37A 1LVOA 1WCV1 5HR5A 1NBMA 1M7BA 3ZD6A 5L3QA 1MV5A 1C1NA 1P09A 3H7TA 1YKSA 4TPIZ 3REFA 1OH8A 1KXEA 3KL6A 3HJNA 1E34B 4KP0A 1NPMA 5AFZH 3CM0A 2O8WA 1IQLA 3KUDA 1W44A 1QL8A 4CRAA 2QY0B 3TK5A 4CEIB 1KO8A 3IIMA 1ZU4A 3C5HA 4BANB 2JETB 4V0OA 1ETRH 2P3TB 1GL1A 4HZHA 4OKSA 1ABIH 3RXOA 1TPOA 1FP6A 1UM8A 2XNDA 3E16B 4MLFB 1KO1A 5TCAA 2XNIA 1ZRBA 1TIOA 4Q4AB 1DS2E 2O8BA 3THWB 3FHTA 1O37A 4BZPA 2IPHA 2CCKA 1G9XA 5FTKA 3JZ1B 3GCGA 2EVWX 1Y3VA 5JMTA 3NBFA 1XEXB 4WBSA 5F3WB 4Z8XA 5KOYA 1KMHB 1U9IA 4UNNA 1CHOG 3KX2A 1HDTH 3IILA 4QJ4A 1LPZB 2Y82A 3ZIAA 1E2JA 1ZNZA 3PEWA 1E2QA 5GVSA 3FFBA 1US8A 2ZVQX 2NMVA 2GJ9A 1ARCA 4PR0A 3TUZC 3JZAA 4D9QA 3BE4A 4TMVA 5JYIA 2VJ1A 1FTNA 2WOOA 4BEBA 2BDCA 1H4WA 1LV7A 4OQMA 3NXSA 2GT8A 5GNDA 2BVRH 3RAPR 1UBFA 1OXGA 5C2JB 1LNZA 2FU5C 1XD9A 2B7CA 2JH6D 1SGEE 1GKUB 3ADBA 4G01B 5DGJA 1C4Y2 1CRQA 1ETTH 4GSOA 3UATA 2BVNA 4LJYA 2R3UA 3ZVMA 1P01A 1DXPA 1WRBA 4C0KA 3FE2A 1B7XB 1BTPA 4Q7ZA 5EPYA 4ITRC 4JLVA 1C5NH 2Z9IA 1UTKA 5KHOC 2AX4A 1TAWA 2QV1A 1SKYB 4CEHA 1IN8A 3IIJA 1ANCA 4X6PA 2ZI6A 4PO8A 4OHWA 2BLWA 1A0LA 3LQRA 3AF4A 1BRAA 2G4UA 1U90A 3HP1A 6GCHG 3TW4A 3LIWA 3WRXC 3CRVA 4O2RA 4O2LA 1E98A 2ZUCA 4W9MC 1MR3F 1GJ4H 3OFNA 3FMPB 1C5OH 2OQUA 3GCNA 1N6NA 1IQKA 5JS8A 3L8YA 2AMQA 4Y6DA 1VCWA 4NCKA 1HAYB 2ANCA 3F0TA 1GL9B 1PJRA 1X8KA 5EPNA 4A4DA 3HDTA 1XBTA 3RS4A 1II8A 1V2MT 1OXXK 1G16A 2JH0D 6CHAC 4HAYA 1FMJA 2A5IA 2QXHA 5CYPA 3W6OA 3P27A 4D2IA 1AE5A 3ZVNA 4Q9JA 1FY8E 5JS7A 4S35A 4YQFA 4BFSA 1KI4A 4D81A 1T8NA 2C9CA 4GFDA 5AJXA 2ZRDA 1V2TT 1Z2CA 3C8UA 4HEJA 4NL4H 1W49A 1TGSZ 1EQ9A 1BTXA 1AS0A 4CT5A 5KSYA 1JR6A 4O25A 2XX3A 5HYOA 6ESTA 1J17T 1DTSA 2CVHA 2C9YA 3BXZA 3OZXA 4R0IA 1QJ1B 3WNCA 1KXAA 1FN8A 3I77A 4JJZA 2O8LA 5FUXA 1EFUA 5AHGH 3CB4A 1W46A 1XPOA 2FODA 4U01A 3STJA 3T26A 3CNLA 3TIUA 3F9GA 2W2XA 4KSCA 4RD6A 2CHGA 1ZUIA 4RD3A 4C0SA 2FO9A 3ADCA 4A1TA 2WWYA 1OSSA 1ZC3A 2XJ4A 1OYWA 4YONB 1PQ5A 2VWMA 4Q4JA 3TK9A 4RJLA 3WP1B 1CJTC 1YCPM 4WWYA 3D6TB 1WCZA 4A2QA 3JZ2B 3RXMA 4PAQA 4AYXA 4CRBA 2DFTA 1TBRH 4E03A 2HNTE 4IDOA 3HR7A 1KK2A 1Z6YA 2IF0A 3SU8A 1GDDA 2WYJA 4YT6H 1AFQB 1EB2A 5FR2A 3T1QA 3K70B 1TE0A 1ZM2A 4WW0A 2ASUB 2ZRCA 4HGCA 3EX7C 4P4SA 1ZINA 1FY1A 4LXBH 4UXIA 2A2XH 1YZKA 4M0LA 4Q01A 1M74A 4FUDA 5GADl 3FZZA 2GF0A 4DLTA 2AGGX 1O38A 2PT5A 2ZZUH 1GWAA 4HTCH 1N0WA 4W5HA 4A0GA 1OW3B 3BFXA 1CBUA 4BWYA 4IDNA 2XAUA 4F4JA 2ZJ5A 4EDHA 4NHOA 2GDJA 2FOBA 3DD2H 1CEEA 3OEHD 4JLKA 2BD9A 1N25A 2AK3A 1TA6A 2W6JD 4CZ2A 5D3QA 1C5XB 3VKWA 4URUR 2ZHWH 2VWLA 1FY3A 1SVIA 2Q9BA 1NMYA 3JZMA 5F03A 1ZIOA 2JGNA 3RS3A 3C1KA 1KZGB 1AA9A 4FUFA 4RCZA 1R6BX 2MSDB 1A0JA 1SKQA 2Y81A 1GI4A 1A4RA 2ZI9A 2VEDA 3MG9A 5SZIA 5DISB 2BM1A 5DPAA 4Q1EA 4R98A 3UOPA 1E37B 1ZNWA 2QMEA 4FINA 3DFLA 2FN4A 3LGVA 1FZQA 3VTKA 4EPRA 1PPBH 5PTPA 3QY0A 4YXWA 3RXPA 4AI6A 4I1OA 1AY6H 5I25A 3GFOA 3W90A 3CF2A 1UK2A 3UK6A 3KQUA 3LC5A 1D9XA 3A1VA 2KAIB 4B71A 3M36A 5SGAE 1SVKA 4HZUB 3PWCA 4L5BA 1JWTA 3TJUA 1V2JT 1GI7B 3HKIB 1YZLA 4O0MA 1EZUC 4NWLA 4DSUA 1RIFA 3SOSA 2B7BA 1CHOF 2J7PD 3PUYA 1EAWA 4V0ME 1VITH 1A5HA 1AS3A 4IMZA 3Q00A 4K1EA 3SS8A 4YDHB 4FUCA 721PA 2C04A 1NN0A 2BWJA 1HLTH 3M5LA 4KLNA 1E0JA 3UWJH 3TE6A 3ZVDA 3HPRA 1ELFA 3VU9B 1K9OE 4ABGA 2THFB 1IHUA 1ORFA 4I99A 3KCGH 2JASA 1KDQA 3LGIA 3LFUA 2ZJBA 1IQFA 5C5OA 1O5AB 2A1DB 1IQPA 1O3IA 3UPUA 1SULA 2QQEA 1B0FA 1JALA 1GITA 2WWIA 1ABJH 4C2TA 1NVVQ 2WYGA 1I4LD 3Q72A 2G0TA 4NH0A 2P93A 1TA2A 1GJ9B 3BWDD 2UKDA 2SGFE 1FNNA 4QKQA 1DEKA 1GKYA 3KQCA 4JBXA 3ATWA 4HAZA 1Y5UT 2ZS7A 4JKIA 1NY6A 5GCHF 3RC6A 5ESBA 2OESA 4DLXA 3EG5A 4QRHA 1S9HA 3GCOA 2ZEJA 3BERA 3B82A 1QHGA 3FOZA 4HUQB 1S0QA 3PMAB 4PAMA 4TL7A 1V2PT 1NN1A 1GI9B 4AC9A 3S9BA 5CJPA 4X8LA 1OB2A 3PWBA 6GCHF 4P32A 2BDAA 5JSZA 5F8XA 3BTKE 1KY3A 2QAGA 2DFKB 4A82A 5LDDC 4URZR 4NIXA 2QENA 1JXOA 2CHAC 4LOAA 3UXMA 4LBZA 1C2EA 1EASA 1O3EA 1CU1A 4P3YA 2G4TA 1UMAH 3K0EA 2B8TA 4C9BA 1DLEA 2J4IA 3BB1A 3M6AA 2ZE7A 2O8UA 1P73A 1YBWA 1QQ4A 3B1ZA 4LHXA 1FUKA 2GCHG 3AH8A 4YLUA 3A7YA 1Q20A 3H86A 3IG6B 3QK1A 5L3SB 1KI8A 1TBZH 2UUYA 1XTIA 2HXYA 1T4VH 2F1IA 1JR3A 1SB1H 2ZDMA 1TEVA 4ZHMU 4ZXYH 2ZGXH 3RSLA 3A86A 4P31A 2R6AA 5JEDA 3SNBA 1DG1G 4DB2A 2GVZC 1TAGA 4X8UH 3U3MA 2QBYA 5E7JA 1OYQA 1BIFA 1A3EH 1G3DA 4B76A 1FTSA 2FFQA 5DO4H 1SVSA 1GBIA 4X6OA 3LY5A 3B9QA 2M5TA 1AKEA 3P26A 1MAXA 1E9RA 1Q21A 1COWA 3QKUA 3GLGE 2YC2C 4RI0A 2Z6VA 4ZKNU 3PIRA 3I1FA 4Q4LA 3FFAA 2BY7X 4DZZA 2OUAA 4NA7A 3OHMA 1XTSA 1GBLA 4VGCB 5DYGA 4OGXA 3A7XA 2FPLA 4QM6A 1TGNA 3ITIA 1TEXA 1W5SA 4OJKA 1Y3WA 4DLZA 3P20A 3AF3A 1BOQA 3SNAA 2GNOA 4EQ6B 2RB4A 3PV5A 2CMYA 1BCUH 1F6BA 3AVXA 4MQBA 1Z47A 3UR9A 1Y8TA 3NDPA 3AKDA 3GLIB 1HXFH 4I33A 2H5EA 1J15A 2ZGBH 4AG5A 2VBCA 1OXTA 4I1VA 1SMFE 4YO9A 2P6RA 4LJ6A 2ODNA 2VVCA 3MFJA 2TGTA 1DARA 3BG4B 1TQ2A 5C67A 1MKWK 4YLQH 1HRTH 4QBHA 4YOIA 9ESTA 3T62A 4LWZA 4GOJA 2VWNA 1ZPZA 4DJZB 5JBQA 5J4SA 4JZKA 3V00A 2QRNA 4H1VA 3OU0A 3UUZA 1AHTH 1L1GA 1YU9A 2OD3B 2BM2A 1BRUP 3KQEA 2PGQB 2XTNA 1GJCB 2G00A 1KKLA 3GLFA 2ZDLA 2TBSA 3EAJA 3LXXA 2ATXA 2WHXA 1XD2B 1G7SA 3QGNB 3ATLA 5F98A 2R44A 4WIAA 3B5JA 4IVRA 1Z0JA 2OSBA 4FW9A 3U5ZB 3AVZA 3M1IA 5BYKA 2GCOA 4Q66C 1HT2E 3HU2A 5EQRA 1NRJB 1C1WH 3F6UH 3TBKA 4YTAA 5FL7A 1SBWA 4ABFA 1INCA 4IW3B 4LBWA 1DICA 2I6QA 4B2IA 3AQ4A 2KI5A 4ERNA 4Q19A 2ZDKA 3C14C 2DFNA 2ZIAA 1HPGA 2F4LA 3ADKA 5FHTA 2QAGC 1X6VA 1KIMA 4B2LA 2FSHA 4JBWA 4AOQA 3SUEA 1HIAA 5G3ZA 4DIHH 3VR4A 5AUOB 3TQFA 1JPNA 4GOXA 1P2TA 3PTNA 3KB2A 2YJTD 2ULLA 2G8TA 3LH3A 5AUPB 2NOAA 3RS2A 1V2WT 5BN3A 4B3XA 2ANMH 3EIHA 2G9NA 3LH1A 3T1TA 4II7A 3W34A 3TSWA 2I4IA 1G64A 1SHHB 3BIFA 1UJ1A 1ZM7A 5DI3A 3RLFA 5GXPA 3B1VA 1DY9A 3QXSA 1SGWA 1A5IA 3UNSA 4F4CA 2XBVA 4B75A 4BRUA 4Q7KA 5KYKA 1NIPA 1AN0A 1Z0AA 2Y7ZA 3W8RA 1GHVH 4X8HA 5CLLA 3BH6A 1U99A 3TKLA 1EFHA 1UCYE 3MO3A 3SYNA 2J9NA 1S82A 3LA6A 2F83A 1N5LA 2G0NA 3S9AA 3FP6E 1SQAA 1FUJA 5DH9A 1GI2A 3OESA 2F9OA 2XB4A 2QP4A 1DX5M 2JLQA 5J40A 2BV3A 3RXHA 3KQLA 2ZPRA 2D26C 5HKKA 1GL6A 3K9XB 2VP6A 3DKVA 1TU4A 3KKPA 3LW7A 1MD8A 1KO5A 1CBWC 3PEVA 3F9EA 1EFRA 3FDIA 4NDZA 3GY5A 3CPHA 4LV6A 5BW8A 1SGQE 1XPRA 3RC3A 4MRVA 2ZS8A 3BH0A 3RNLA 2GMTC 4PSAA 3D23A 5FOUA 1ID5H 1N6RA 3PVSA 2CCGA 2ZRJA 2FOEA 3LBIA 2ZO3H 4Q5IA 3EXAA 2D2EA 2BMDA 3EA7A 2ZI7A 2HF8A 5EXXA 1W36C 1D3QB 4CRCA 1TQ4A 1AB9C 2D3WA 3LXRA 3EC2A 4AK9A 1GBMA 2ZYVX 2ZDNA 1E2LA 5E0GA 4GL2A 1GMHG 1EAXA 1LHEH 3GEEA 1NG1A 3DZ8A 1ZW6A 3A84A 3DMDA 2GD4B 3QI2A 1ZRHA 4Y7AA 1ZM4A 1FXYA 2BQ7B 1P04A 4I8KA 3FWYA 2A2QH 2XXLA 2A4RA 2AIQA 2BD8A 2NO0A 1KZ7B 1IN5A 5JLJA 3E3TA 2WJJA 1C5MD 1XU4A 2ZCKP 3RMNH 2A78A 1Z6GA 3UG6A 5C46F 2CJWB 3FB4A 3LGWA 1W4RA 1Z6XA 1G6HA 5CLQA 3CX8A 1SPJA 2Q1JA 4Q1FA 3SUFA 1LS1A 5KO2A 3LGTA 2N42A 1LF0A 2GCHF 3PR1A 4IOJA 2PWXA 1E2DA 4DLRA 2TMKA 1F2UB 2GZDA 2QA9E 2EEKA 3GEIA 4NCHA 2R0KA 1OH7A 2ALVA 2G1JA 2GAAA 1H8HA 3E91A 3MWYW 3HU1A 4LYJA 4BZQA 3NXPA 1WBBA 3GQBA 1QURH 4UDWH 1IN6A 3SNHA 1FZZA 4LBVA 3BGWA 1W8BH 2OCYC 3RVBA 4TLAA 2J94A 1KLJH 2FI4E 3C7KA 1QVRA 2OO7A 1MU6B 4UXHA 1SGFG 4TT3A 2KSQA 4K8BA 1O2SA 1JQLB 4MQAA 1MO5A 2R2WU 2BBSA 1AIXH 1TF7A 4ISIH 1KGDA 5K0HA 3B60A 1JRTA 2X8AA 4ZDIA 3IPYA 4KTUA 3W5IA 221PA 4LGMA 3FGNA 5KTYA 1QRWA 1UK4A 1PPHE 2V3CC 2GWHA 1OWJA 5DN6D 3L8ZA 3FKSA 1MTNC 1UPTA 3SZEA 2W0SA 1RTFB 2O8EB 5LPEA 1CRPA 3AAUA 4Z1MA 3MH5A 3Q8XB 2W5EA 4B3CA 1J70A 2CLCX 5C18A 5KNCA 2ZHEH 3AB3A 4LUCA 4WAUA 1GJDB 2PT7A 5KU1A 4IXMA 2WOJA 5LB4A 2ERXA 3L0PA 5DHAA 2W3KA 3S1AB 5K8TA 3RXLA 2XRCA 1WTGH 2J92A 3LGUA 4D9RA 1LO6A 3TSZA 1OFTA 2OV2A 2NU1E 1GP2A 4OJQA 1UVOA 3WY9A 5AUQA 2Z9LA 4RD2A 1NBMD 1FAXA 1DWEH 3SJBA 4TZ6A 6CHAB 4CEJA 4XOJA 1GUAA 3KQBA 1ELCA 1EFTA 4JZEH 4N0DA 1O2HA 1DWCH 5JRJA 1G18A 2ZRAA 2A5AA 4YOGA 4XTRA 3TGJE 2C9OA 1H9HE 4K46A 4IW4E 5TCCA 3A1SA 5B6OA 5H1YA 4QHTA 4FMCB 3QX5H 4WOPA 2WJVA 1UHBA 3OE7A 3ZS9A 1UAAA 4NA8A 1WBGB 1QHIA 4A36A 2PBRA 2PKSC 4CBNA 2VF8A 4NWKA 1R0XA 2HRVA 3P8NA 1AKSB 3D7MA 4G0NA 2QN5T 4WVPE 2OK5A 3NEYA 1O2IA 4IVQA 3CRRA 1CA0B 3M0EA 2ONJA 3K9NA 3VGCC 3WP0A 1OYYA 1U8YA 1TUEA 5K8IA 1V43A 1P5ZB 2WKQA 3BTTE 2FMXA 2CN0H 4DCVA 1SVWA 1D6RA 2PX0A 3MMGA 1HT1E 1GG6C 4KYUA 3BBPA 2EU8A 3ZIAD 4LYFA 5B64A 2ANKH 4CYMA 4DT7B 1VGCB 4Q4AA 2FZZA 4WA7A 5FOSA 4IJMA 2ZYTX 1Z29A 4PHHA 2B5TB 1EOJA 5EGMA 2G3YA 1JEDA 3MUFA 2Y6TA 1GBFA 5JB9S 1XEXA 1CGIE 3PENA 5K8LA 3DOEA 5CE1A 1KMHA 3T29A 2BD5A 3IHWA 1SR5C 2O8MA 2RMKA 3A88A 3CH5A 4US0R 2ZU4A 3AUXA 3SHFA 4NIWA 4WF8A 1ELDE 3GY8A 2G1KA 2A5FA 2QTFA 4GP6A 4KO8A 3THYA 4TMWA 2AHOA 4RD0A 1ZD8A 1GHAF 1L8QA 4JKYA 4BE7B 5C1YA 4DUGD 4IDHA 3ZZ0A 3MWIU 2ZYWX 1KMQA 2IYZA 5IDVA 1C2FA 3N5CA 5D3MB 1X8JA 4CEHB 2XNSA 2ZC9H 1DT2A 1Y59T 2B8OH 3E0NB 4XWOA 1QRZA 4K5ZA 1QHRB 1A46H 2WV9A 3LQQA 4TQAA 4D25A 2GZ8A 4MPWA 5FI1B 3U7HB 2WKRA 1JJ7A 2YWGA 1BA8B 4BECA 1AQYA 2OCVB 1K1IA 1NM6A 3QG1A 1UJ2A 4JYCA 4OK3A 3SQEE 4FVDA 3GJ8A 4NTZA 1GDQA 2AL7A 1LVYA 1GI0A 3R7WB 1FL9A 1KOFA 3QVUA 2JDIA 1CIPA 2Y5HA 4JVNA 5A8YA 1GIAA 1II8B 5K8UA 3TLOA 4FUIA 1O2RA 3CPEA 4PC6A 2KBEA 3UREA 3MSXA 1Z8RA 2ODYB 1P2VA 2HEIA 1GMHF 2IEYA 2YWEA 2RCEA 3OSYA 5E3HA 4MUAA 1C1RA 2AN9A 2VYFA 1J16A 1KAGA 2IUUA 1YCPK 3VX3A 4HATA 3KL4A 2C96A 2ZRPA 3GJ0A 3ATIA 5JEEA 2R6FA 4MNYA 2NTYC 1UCYH 1TGCA 1JXPA 2P95A 3FMIA 5K7RA 3T5DA 3GYLB 4ZCMA 3U4QB 2A7QA 2UUFB 1UBEA 4MYHA 2AFQB 2AS9A 2BY6X 2GJ8A 1KHTA 1Q44A 3RMOH 1VZQH 1W2GA 3BK7A 4ZKRU 2JCSA 4A1XA 1TMBH 1G8PA 4MPVA 2A7CA 1EZXC 4MDSA 1G41A 1ZRKA 1DWBH 2JETC 3SJIA 3B9FH 1U0LA 2PSXA 1HCGA 1LHCH 3B85A 3UWIA 4CRDA 2AWOA 3NC0C 5EE3A 3S9CA 1XNJA 1IQJA 1NN5A 1KDPA 3SEAA 2I1VB 3ZZ9A 3SU0A 3EWSA 5P21A 2BD2A 3V0XA 4Q00A 5B30A 1VPLA 1E9CA 4HAUA 3GDUA 1R0YA 1HE8B 5FTJA 2PHBA 4LYAA 3PO1B 1E36B 4GBMA 4RFVA 3AGPA 2V1XA 4Q4JB 2BDYA 1HFDA 7LPRA 2FYRA 3FHCB 2ZJAA 4CIDA 3F8TA 3P32A 2HNTF 1GBTA 4R9UC 4PZZA 1TNIA 2F9VA 5T6GA 2ANWA 2BD7A 1LF5A 4F93B 1E1RD 1SHKA 3GJ4A 2V6NA 3ZVEA 2F43A 4R71A 3TJZA 1WDTA 5F9HA 4BFWA 2SGPE 1AWHB 2EA3A 4PHGA 2KBFA 4GCHG 1HYLA 5FTMA 4EPVA 3A4LA 1J8MF 4EPYA 1RGQA 4ABJA 2OBOA 2FMJA 3H1TA 2FDCA 3OAAD 4BEJA 3QN7A 3PM3A 1O35A 1OKKA 2JLYA 1IQHA 3A80A 4X1PU 4YM9A 3VPKA 1TABE 4DIIH 3X1WA 4JLNA 2O8TA 5FFMA 2CHAB 5SZHB 1C2KA 3RM2H 3ODDA 2W0MA 2Z3CA 2H1LA 4TMZA 1HQCA 5EJEA 2JJ1A 1CKEA 5AVDA 4NFEA 4DGJA 1DSUA 3F3YA 1NRRH 2DE8A 4M1TA 3IUYA 4XD7D 1HV7A 3BG8A 4NZYA 2Q6DA 3MU0A 4Q7LA 2RGCA 3LH5A 1CHGA 4Q03A 1GHYH 1QJ6B 1J7KA 1M9UA 3H5CB 2H57A 1BDAA 2R6GA 1PPFE 4E22A 4FCTA 2ZFPH 3H2YA 3DMNA 1MABA 2G5NA 4FUBA 1DDJA 2X77A 4NG9H 1NI3A 2ZI3A 5DP8A 2KB0A 2PUXB 4MKFA 4A8JC 2QY9A 4XIGS 3E70C 1G4AE 1G5PA 2V4ZA 2XC4A 2FI5E 5H68A 3RYTC 1YLCA 4YXWD 3LX8A 3P4YA 3SYLA 3VB3A 1SLUB 1HURA 1XB2A 3T28A 1S5SA 1LHDH 2FG5A 3BB3A 1UTOA 2EQBA 4LHZA 2GJAA 3QZRA 3KKMA 1KDRA 2WWHA 4IDPA 1VCOA 1O2TA 4PPGA 1C5RA 4ISNA 2OM2A 1SGDE 3MH6A 2J7KA 3GY4A 3LLUA 2AGEX 3VR2A 1S2MA 2SNVA 2WWFA 1GBBA 4AFQA 3M4YA 1G8HA 4Q9HA 1YGCH 2BYAX 5J4QA 2H5DA 1N0VC 3KJHA 2FV8A 5HCNA 1Y5BT 3GCHC 4HZUA 3M37A 2F55A 4DDUA 3PUWA 5G41A 1QGFA 1KDQB 1HEIA 1NVXQ 3SV9A 2WMNB 1Z28A 3F9FA 1XUJA 2ZJZA 4OHXA 1UBGA 1XTQA 3FANA 1KI6B 2IWRA 3TUIC 4JLOA 1IY0A 3LD9A 5TVKA 2RAPA 1YR9A 1DAMA 1D8TA 1E94E 1NBME 2AKAB 3ZVLA 4DW2U 3VU9A 5L2ZH 1ZPBA 1C5WB 3JVUA 3UG7A 1OWIA 2VU8E 1JNYA 3E1SA 3EQ0H 4GHTA 4B74A 1F60A 2OILA 3U3JA 3UFAA 2BBOA 3G01A 3RC5A 2V7QA 1S9DA 3I8XA 4ZO4A 1J8YF 4Z51A 2V6JA 3SUDA 3I73A 1P8VC 2F3CE 4BAKB 1QHHB 1O2QA 4Q1CA 2JLVA 2PR3A 2LNCA 1XEWY 3K0CA 5HMAA 4GAWA 2FOGA 1GILA 3A58B 1KI2A 4JLPA 4Q1AA 3WYAA 4L16A 1G8YA 1AFQC 2QAGB 1O3GA 2FOAA 3WHKA 3K70C 2PFEA 4AKEA 4IRUB 3QXXA 2UUJB 1G4UR 5G4BA 5FI0B 1C1MA 1BH2A 1E9EA 2D2FA 4HSEA 1O3FA 4IFEA 4O3UA 3U7GA 2WUBA 4Q18A 1OH6A 2QORA 1LY1A 3EIQA 3SO3A 3H4MA 4A0RA 5J4LA 1LHFH 3X2SA 4M9FA 4U32A 1E9DA 5F6MA 3IQXA 1ESAA 4L8GA 5FOXA 1HJ9A 4NMMA 4KV9A 4ABAA 4PZLA 5JECA 4A9AA 2P16A 2RGNA 1T4UH 1LQDB 4AX9H 1HY3A 3DEFA 2C03A 3STIA 2O9QA 4CVNA 2WJIA 3IBYA 3G0HA 2BLOA 1QIXB 2QBYB 2ANYA 3T1OA 3TSOA 3RXTA 3QLPH 1NF3A 3LAWA 3SW2B 1IN4A 2IN2A 4SGAE 1WE2A 1UDWA 3SZNA 5L3SA 3EDXB 2E87A 1SGTA 1A7SA 1ESBA 1O3LA 5IDKA 1F0TA 4C0BA 5DI9A 1F92A 4ZPXA 3PB1E 1ZHPA 4EFNA 2FEQH 1OT3A 3OTPA 3GFPA 2HT1A 3MNXA 3ZH9B 1F3OA 4H9GA 1AZSC 2XZOA 2FOLA 1RJXB 1VG0B 1EJNA 3A6PC 821PA 2V1UA 3QIAA 1DVAH 4EPTA 4F4IA 4GOKA 1U2RA 1SXJD 3CS0A 1YLDA 1MRSA 1Z1IA 1P7CA 1CBWB 1ZM3A 5E4FA 4XVQA 5DG6A 1SGIB 3G5UA 3SGQE 5EQQA 1ZLRA 1O30A 4P4TA 2DWQA 1JMOH 1GDNA 2IXFA 4Q9KA 2ZF0H 3QOFA 4KHZA 4KBFA 3TNSA 1RYFA 1Z83A 1YJ5A 2GMTB 3T2NA 4EQ6A 1BMFD 3NKVA 1O32A 1P03A 1O2GH 2ODWA 2SGAA 3GJ6A 3OX7U 1EPTA 2ZROA 3NBYC 1YHNA 4DCNA 1TX6A 4Q21A 1H8IH 3KXIA 1W36D 1E6CA 1KNQA 3EA9A 5C3NA 4GCHF 1FX0A 1XMNB 3AV0B 1DUEA 2FEOA 3A1TA 3WNDA 5GVRA 2XB2A 5C5NA 2BCGY 3AAVA 1MTSA 1HXEH 2G81E 1YR6A 2EFCB 2C95A 1CE5A 5EG4A 3K0CC 5CM8B 5FL7D 2FFBA 5E0HA 2ZE8A 1DAEA 4RZUA 4EFLA 2IYSA 1P3JA 3LC3A 4P33A 1O34A 3A1UA 1XD2A 1ZHRA 4TPYA 2HPQH 3UR6A 1EXMA 3CR7A 4GZLA 4AY2A 1TYNA 5L6NH 1P9NA 1KSGA 3C4JA 3B1YA 3MU8A 4LOYH 4B47A 5CB6A 2ZU3A 3I29A 3ZQJA 5J4HA 2BMEA 2QL6A 1RE0A 2L0XA 4H42U 3W6PA 2ZI4A 3OY6U 2RCNA 4B2BA 3RMMH 2OLKA 1Q1ZA 3C5CA 1OXVA 1JIRA 1NLYA 2IOTA 1P6XA 1HUTH 2ZSFA 1DBSA 1G21E 2HYDA 2ZSAA 1CTQA 4TYNA 2ZU2A 1IHTH 3Q3YA 4IN1A 2YZ2A 3URDA 2BM0A 1WU1A 5DI3B 1C2MA 1IONA 2NO7A 1MTWA 1GCDA 4A1FA 3TH3H 1LCYA 2WWGA 2WPHS 3AEZA 1JBUH 2QQ0A 5FPHA 4ZI2A 1N6HA 2DR3A 3SUGA 3DT0H 4PQRA 3EZ7A 4LCBA 4LX0A 4HDOB 4AYYB 2ZQ2A 1QHSA 5C2ZA 2W00A 2HXSA 2ZRGA 3GLHE 4I8HA 3TJOA 5DSZA 1O3JA 3RLYH 2ODQA 2PL3A 2J0QA 2QYIA 4Y0YE 4MNVA 3SU5A 1F5NA 1LTOA 1E9FA 1MTNB 1ZP6A 3GJ5A 3VHLB 1H8ED 4NKRA 2GDDA 2HOBA 2PJZA 2AMPA 1FW6A 1E79A 1ELTA 4V0MA 5EZ5A 5HKKD 1AVXA 3DDCA 1S96A 3V4RA 4EFMA 2UVQA 1UTMA 1E38B 1GBCA 4X2YA 1EG7A 5DP9A 2PZEA 1QBOA 4VGCC 1G32B 1J90A 1G8GA 2ZFFH 2ONKA 1K5GA 1DSTA 2BZAA 4FUGA 1K1MA 4KTCA 4K1TA 4XSKU 3SGAE 3B7GA 1NSTA 3BTFE 4FVBA 5EE9A 4DDVA 3P70B 1N6YA 4QGFA 4Q47A 4GVUA 4AYWA 2B7DH 1W0JA 4Y0ZE 1QRAA 2BJWA 2F6RA 2JLWA 4JLDA 2XW9A 2IHYA 1ZMNA 2QMOA 4ABEA 4JJKA 1EPTC 1Q2WA 2FSIA 3P8FA 1AGJA 3QGJA 4JCNA 3EPJA 1DE0A 5E8EH 2EWWA 1FP7A 2HNTC 1T3SA 1BZXE 1F2TB 3BG4C 2FX6A 5CIWA 2A45B 1O31A 2QROA 3TNTA 1NY22 2FWWA 2WV5A 3Q7PA 2WPLS 1FN6A 3MO6A 5AF9H 5DP7A 1G5TA 2Z4RA 3U1IB 2P2LA 4URXR 1P2NA 4TL9A 4BAMB 2PKSB 2F9UA 3FYHA 3AGQA 1EAUA 5H4IB 1MBQA 5CB8A 4QHYA 4RKJB 1SHZA 2FTLE 2NO6A 1UO6A 1UVUH 2QN6A 3P6ZB 1P61B 1MCVA 2X1VA 1IN7A 2PTCE 1ZHMA 2VH6A 1S4QA 2ZDVH 2W83A 4Q1DA 1OH5A 5KPJA 3IKJA 1SGRE 5AJZA 1VJAU 2CV3A 4HLCA 2PLXA 3SZRA 1TQ0B 4ACAA 2BEKA 1KK0A 1NC6A 3J81k 2BDBA 2ZFSA 3TAUA 3P8OA 3B78A 1YVDA 2FIRH 2QXIA 1E2HA 3MNBA 4AGJA 5F8TA 1THPB 2PUQH 3X1YA 2ZJ8A 2CJWA 2Z83A 3AASA 3KGPA 3GISB 2JLRA 4IC6A 5TY0A 5EXMA 3ZVRA 5JHGB 4D4KA 5C4GB 1OIXA 1GNPA 1NLFA 3R3GB 1G3IA 1N3BA 1B0EA 3AVTA 1MBMA 1YR7A 1Z8GA 1P2SA 1EK0A 2GETA 3ATMA 4ZDWA 4JLJA 4LZZA 1UVSH 1F2UA 4TT3D 4IOLA 1G7TA 1NTPA 4QGAA 1OSNA 5AR1A 2KJQA 2D4HA 1OIWA 3AP3A 4DEYA 2IEZA 3ZZ5A 2JLUA 4WVFA 5JBCS 2LKCA 1P57B 5FX6A 2FPZA 3CRW1 3NH9A 4U02A 3UWKA 1L0ZA 4ZI3A 2UWLA 5A09A 3A8BA 3RU4T 2ZYUX 3V12A 4DLWA 5IK2D 5BN4A 3REGA 1ZMLA 1XEFA 2A7HA 1MMJN 1S3GA 4E05H 3FKSD 2XJ9A 3THXB 3SI3H 3E6PH 3A87A 1MO6A 1UFQA 4Z1MD 3EYDA 3PXGA 3SJCA 3KJIA 4U2WA 1X7AC 4THNH 3S0NA 3QE0A 3ZV8A 3RSOA 5EE1A 2V0BA 3DZDA 3FAOA 1DAFA 3PMHB 2CXXA 2CHQA 4JZIA 4ISOA 3DL0A 5DLQC 1F2SE 3M3VA 1UF9A 2WIAA 3ND8A 4B2CA 3PV0A 3B13B 6Q21A 2O8EA 1QA7A 1OB5A 3I72A 3TUJC 1V6DA 3ZVGA 3RABA 1NL3A 3L43A 2D74A 3CWZA 1L2EA 3FTQA 4WXVA 1AZZA 1A1VA 1N5KA 4D0NA 2Z9KA 1MTUA 4OS7A 3G82C 1GRQA 1U98A 4DY7B 2PCLA 4E07A 2H9EH 1E9AA 1SC8U 2J0UA 5T1VA 3S1AA 1CT4E 3CRQA 2BY9X 1UHBB 5KDOA 3CR8A 3VXEH 4TQ9A 2Y8EA 2RGDA 1FONA 1E2KA 4OQXA 1DELA 1TNKA 4KFSA 1EWQA 1MKYA 2I1QA 1OX1A 3AVUA 2QAJA 2Y5FA 3B6EA 3SQWA 4URVR 1ONBA 3KXLA 2ZUDA 4FMBB 3RM0H 1TADA 1E2PA 3GEHA 1MTVA 621PA 5LPFA 2XITA 3A8DA 4AKHA 4HB2A 1BQYA 1SLXB 2G52A 2H2ZA 4GHQA 1WV7H 1U81A 5FBEA 1C2GA 5FX5A 1SXJE 3TK1A 2ODPA 1OWDA 6LPRA 4UJ3A 1AKSA 3ZZAA 1KJWA 2GJSA 2IUSA 4R8TB 2Z9GA 1P4SA 1NKTA 1T5IA 1T3LA 1KY2A 2VA8A 1L4ZA 1HTWA 5C1XA 1YPMH 5FPTA 1O3CA 2YOLA 3VEQB 4QG7A 1SI5H 2ZTZA 4LJAA 1Z63A 1AGRA 1K21H 1CGJE 5ETXA 1DO2A 1QHNA 4NYIR 1S1MA 4FI3C 3EW9A 1NY5A 1HV8A 3U8RH 3THYB 4I8LA 1LQEA 4JL6A 1KXFA 1RW4A 3QBTA 1GL7A 2QPOA 5EW1H 2YOHA 3GLFE 4PQFA 5JJKA 2WIBA 3EE0B 1TNHA 2E9SA 4AWXA 3QENA 2RA3A 3SU4A 1XF9A 2NPIA 1Z7KA 4TSFD 2DB3A 1KJYA 3KFVA 5DK1A 1D9IA 1TALA 2FX3A 3H0KA 3QXJA 4AORA 1FMLA 2QNRA 3KHVA 2WWXA 3CP7A 2CCJA 2W2TA 2QTVB 1ELOA 5FBQB 4X2WA 5ANRB 1NN6A 3BN9A 3PV2A 4PC2A 2ZTSA 1Y5AT 1K28D 1NFXA 2VRWA 1ESTA 5D3MA 1XMJA 3VB4A 3PLBA 3U61B 4BXWA 5LD2C 1Z6AA 3SJZA 2TGDA 5ESTE 5JWOA 4OS6A 5B2ZA 5EUQB 5EQSA 1TPAE 4D26A 2F3RA 1HA3A 1SLVB 1GMDG 3ZYDA 1VIAA 2OT3B 4DIEA 4A8JB 1KIGH 1D6JA 3KUCA 1E9SA 2WSSA 2JH5D 3NG1A 1G30B 4NCIA 1Z5ZA 3R7WA 1K1PA 1TQ7B 3M5NA 3SFVA 2GZ7A 1C4V2 3KN2A 3MNSA 4MRNA 3KTAB 1E0FD 1XJQA 1MH0A 1V2RT 1MKWH 3LKWA 4NSYA 2AFIE 5ELXA 3H7OA 2V3OH 2QE7A 1Z22A 2GA8A 2J0SA 4QC2A 1E2FA 3RXQA 4DDTA 3OTJE 3R9XA 2A5GA 1VHLA 5HCIA 3L3TA 4CHAB 3SU3A 1OP2A 5L8VA 4DKXA 2DBYA 1E3MA 3SJ8A 2D7CA 3BD9A 2F1HA 3KQNA 4CR9A 3GCHB 4GZMA 3E8LA 1CT2E 2D7DA 1HUQA 2QCYA 4TYPA 2ZJOA 4MNWA 3GP8A 2OLGA 1BITA 3U4QA 1YC0A 4X0WU 3ZZ7A 1Q12A 1MAYA 1CGHA 2GXQA 5JWRA 1CA0C 2MMCA 1NO9H 4I81A 1CQQA 3TMKA 1XZPA 2IXGA 2H7VA 2P6UA 4YMUA 4CRGA 1W7GH 4X1NU 4JS0A 4FD2A 4UKDA 2IJD1 4HB4A 1SGCA 3TH5A 3U3OA 3RLWH 2BDGA 2QM8A 3RRNA 1VGCC 2H16A 4MRRA 1LMWB 2F43B 5E2OA 2NZ8A 1Q1EA 4GNKA 4GPGA 1XJCA 4ZHLU 1W7XH 4BRWA 1VKJA 3KJEA 2OFWA 4NBSA 5C1UA 1N1LA 121PA 1P0SH 8GCHF 4QT8C 2AWNA 2IT1A 2ZM5A 1C5LH 1BJUA 4KTSA 4BFXA 4FCVA 2QXJA 2ZE5A 1D9ZA 3MYWA 4INKA 1OKKD 1X1SA 3RRYA 1GG2A 4NU0A 1D4PB 3HATH 1T8MA 2C2HA 1IQGA 2VHQA 4XSHA 5A2MH 1NRSH 4ABBA 4V03A 2A5DA 2Q0HA 3LX5A 4DIDA 3QKSB 3K70D 5E95A 4NE2A 3OIYA 4X1SU 1UVTH 2HPPH 2XWBI 5A5GA 4F49A 3K0SA 1PZNA 1RTKA 2HGTH 1F7ZA 4G5RA 4V0KA 3MJRA 1VCNA 4GRAA 1T91A 1TQ6A 2WWWA 1C5VA 1MUEB 1T8TA 1GNQA 4Q2KA 3MOCA 1PUJA 5JDUB 4F38A 3OIWA 3SBDA 3BAFA 2BOHB 3PJRA 3SHWA 2GDEH 2DE9A 1OP0A 3TIFA 1Z71A 1GMCG 4B73A 1HGTH 1TONA 4BASA 5F2EA 2BDHA 1UTJA 1MABB 4HLUA 2JEOA 2OCPA 3RWMB 5HPYB 3OF5A 4MA4A 5CMXH 1P60A 1XX6A 2WSMA 1EATA 1NU7B 2QMHA 4M4SA 4XDEA 2J2UA 1KKMA 2FEMA 2ZETA 1CS4C 2O0JA 4EJSB 1ESMA 1QJ7B 2DWOA 3MWLA 3RRZA 2JATA 2RG3A 2QT1A 1AU8A 3MU4A 5LPNA 2FDAA 2QSZA 2BKEA 1SXJB 3CIOA 1KXBA 1G8FA 1QB1A 3Q3KA 4DHEA 3Q3JB 3PEUA 1SFIA 1FPHH 4X6MA 2XTMA 2PW8H 3U9AH 2FLBH 2R3YA 1BMAA 1Z8JB 5EXNA 2CGAA 4O9VA 3ASYA 3NEJA 4Q7XA 5T6DA 1Z1JA 4RKOB 1DLKB 4LJ9A 4KFUA 3A7TA 5CHAB 2PCJA 4BFZA 1GJBB 1JQJC 2WICA 1IM2A 5C1BA 3CO5A 1ZGIA 4WJG2 1S8FA 1CP2A 2YINC 1O87A 5TDHA 1Z0FA 1SZPA 1NU9A 2R62A 3M5MA 1Z06A 4AFSA 3RXCA 3F1SB 1K1LA 1UEIA 5KNDA 4BNRA 1FPCH 3SV8A 2QMUA 2QP3A 4M9QA 3K1JA 3CH4B 2VP9A 2DWPA 4KAXA 5E7IA 4TL6A 2PEYA 5SZKB 5CJ2A 2V9PA 1VCQA 2XSZA 1DANH 1K6MA 2BHGA 2ZE6A 5FBIA 1YYY1 2V7QD 1KI6A 3U3RA 3TGPA 2NU3E 521PA 4ESHA 1CR1A 3PO1C 1AN1E 4Z54A 4L9WA 1BMNH 2A3RA 2GHIA 4XH9B 1ZSJA 4BLTA 5JJLA 4RFSB 1KSJA 4FU8A 4PC7A 2ECKA 2PTNA 1Z6EA 3KXKA 5A0CA 1QY6A 5TV2A 2J0VA 2GK6A 5FTNA 4AYVB 4BAQB 4JL5A 4JBYA 4GDFA 2QAAA 2NQ2C 4M2LA 4BTIB 1MKXK 1TNDA 3K0FB 2XCFA 1IBRA 1PQ8A 1QHHA 3TITA 4LZ1H 3HU3A 1XVMA 4A5TS 1HAZB 1OKXA 1D5CA 2FGKA 4N3NA 5EP4A 1O3HA 4CF7A 4DJTA 2NZJA 3QO6A 1P02A 4JVMA 1HYQA 3IPXA 1EWRA 5EP1A 2VP4A 2A7JA 4JSYA 5DIFA 3QXHA 5AJYA 3WMFA 2HVXA 1KTVA 2RGGA 4QGGA 3RWOA 1ELVA 2UUKB 1GBHA 3EGKH 2STAE 2JIZD 4M1MA 3MMPA 1AO5A 1BYIA 2ODEA 3TJNA 1P9SA 4ZXXH 4HLUC 2VNTA 2BIFA 2IJOB 3MU5A 2RA0A 1DM4B 4R2IA 2NU2E 2WJGA 1AZ8A 1OHHD 4K2YA 1M6NA 3HKJB 1P12E 1XDBA 4FUJA 2FLRH 4A7IB 4WZBE 2AEIH 3PUZA 1GI1A 4A0FA 3E0PB 1AD8H 1WSSH 1KI3A 1AUJA 2XYAA 1CSOE 3KEEA 2WM9B 4U5XA 3ZZDA 3AF2A 3QUSA 3CZQA 2J5XA 4HLQB 5AFYH 3NPSA 1MCTA 3ICEA 1V5WA 3WNBA 3KIDU 5TB5A 1ESNA 3LRPA 1W3CA 3RUOA 2AFHE 1AQUA 5UKDA 3M3SA 1EXFA 1EESA 1Z8FA 2Q21A 2ZXUA 1O3MA 3GICB 3V13A 1KTSB 2J87A 5BN5A 2PLRA 4MGZR 3CW2A 3TH4H 5JB8S 1QR3E 3SYKA 2QA5A 1EOLA 2R9VA 3QSYA 1O2ZA 1O5CB 5M04A 2VQSA 4G3XA 2ZRLA 1YR8A 5BRRE 1SKYE 1XUFA 3URCA 5CDFE 2CL7X 2GXAA 4JLMA 2OCAA 3LBNA 3DM5A 4Z6AH 1U0HC 4M7GA 2WINI 4JMPA 1O3DA 3QUMP 5DYIA 2IL1A 3B2EA 1EPTB 1QL7A 5L3RA 1OPXA 2CL6X 3KJGA 3GDSA 4ZDKA 1QRXA 4ASUA 1KJZA 1CJMA 4KFTA 4UFEH 1R0ZA 2VIDA 4HZIA 1GHXH 2P3FH 1VYVA 1FX0B 2ZHDA 3AVOA 1TNLA 2GEUA 1E0KA 4WZ6A 2STBE 3TW8B 2WZQA 1ZUHA 1JBKA 1G291 1TL7C 2QUZA 2IS6A 1T7CA 4TTQA 3SC3A 4E7RG 1PPZA 1IAQA 3ODFA 1N5JA 2IYXA 3AP2A 5EP2A 3PROA 1Z07A 4Q9IA 3T25A 4XTCS 1XWIA 5SZJA 4DB4A 5FAHA 3R8FA 4GLYA 3WY8A 1C5QA 1GBDA 1XMIA 2GBLA 1C1OA 3IIKA 4W7SA 1BRCE 3D3QA 3W3ZB 2BDTA 3ADDA 1GI8B 3QJYA 3LV8A 4KITB 4POAA 3UNQA 3U44B 1OWHA 2B0FA 3ECCA 3BTWE 4JZDH 2JJ8A 2ORVA 2GV7A 2CE2X 2SHKA 4ZMAH 3LU9B 2VVUA 3MRSA 2GCPA 3SU1A 3ETLA 4S2EA 4MRSA 2FFHA 4PC1A 1L4YA 3ZV9A 3TJVA 4RN6A 4BLPA 3U6BA 4KKDA 2FZ4A 2CE7A 2C8YB 2XOKA 2VB0A 3Q76A 1V2LT 4LJ8A 4A2WA 1CJUC 2QTHA 1DOAA 1ANBA 2CEAA 1GRNA 4LC1A 4G5QA 3FP8E 1W0KA 4G1UC 1A61H 2D2DA 1L4DA 3NZIA 2CMKA 3BJIC 3PMBB 1EB1H 1FIWA 3WHLA 3AVQA 1XUKA 1XD8A 1ZM9A 1IXRC 2W6IA 3VQTA 4Q48A 3PITA 4K8YA 3LDAA 1S83A 5IT5A 2V8OA 3SJKA 2OEPA 1RRFA 2BX3A 1XUGA 2ZU5A 1AK2A 1TRMA 1C2DA 4X8TH 1GM5A 2AH4X 4B3BA 3OIVA 4DRZA 3A8TA 3O8CA 2PZGA 2FESH 1E79D 4CH8B 1ZMXA 1AI8H 3F9HA 3NBXX 3ZZ8A 4JLBA 1Y63A 3OY5U 4KVGA 1GJ7B 1F5LA 4PX9A 2AD1A 2R6DA 1C5YB 5BQ5A 4D80A 1SQTA 1YCPH 2F9NA 2ZANA 4JT4A 4IVPA 1IQEA 2PH1A 2CK3A 2ERYA 4CBOA 1G36A 2P65A 2D62A 1XVOA 4TLDA 2Y7XA 1ZCBA 2C8WB 5E0JA 2ZRIA 4X8OA 1UKZA 1W0JD 4B6EA 1GHBG 1ODFA 2AD5A 2WKPA 4WXIA 5EE0A 1PPEE 3QPUA 3RXEA 2YYZA 2IX3A 2DUCA 4QGHA 3BTGE 1PPGE 2BJVA 3C41J 2YNAA 1TF5A 1W4AA 2PMKA 1RS0A 3S69A 1E2GA 3FHOA 5EXLA 2EFHB 3KKNA 1F0SA 3I62A 3EC1A 3V9PA 4OS5A 4X8VH 2VVVA 1HJAB 3EA8A 2YNMA 2ZFRH 1KLIH 1GVZA 4H6TA 1P2QA 2RHMA 3R9IA 1C9PA 2CL0X 4HB3A 3ZYEA 4MPUA 2IHBA 2ZJ2A 3SQXA 1AQ7A 1PFXC 5A0AE 1C2LA 2VSXA 4JK6A 4YESB 1O5BB 1FLEE 1KXCA 3T27A 1Q57A 4IGDA 1P75A 4C0AC 1UKYA 2GBLC 1F2TA 2MMGA 1QZXA 2RH5A 4TZ0A 2ZSDA 1WXRA 3BC1A 1QQUA 1G6OA 1C1YA 3HK3B 1QVAA 3VMFA 1EX7A 4B1TA 1BBRK 3GY2A 4PO9A 3WBJA 3U7FB 2ZU6A 3QTVH 4Y11E 4WMEA 5EUMA 1NJFA 1PLKA 4UFFH 1V2QT 1PQ7A 2GTPA 1T9HA 1H9LB 4NIYA 4B48A 5E2PA 3P95A 2ODBA 3BOSA 3UKDA 2OAQ1 3R20A 4OS2A 8OHMA 2Z3DA 1SG8B 1UTPA 3PLKA 1YPLH 1G9IE 1RD3B 1UTQA 4I4LA 1SGYE 4HB0A 1BT7A 3LDXH 1J14A 1Z8IB 1T0JB 1DOJA 5FCRA 2R6CA 1AZTA 2BDIA 2PLFA 3NIBA 4NGAH 4RZXA 3WYFA 4KU4A 3SHCH 1G2LA 4TWZA 5J5CA 2FS8A 1FDPA 4C30A 3GLGB 5FOTA 3E90B 5F9FA 4FMDF 3TGIE 1K5DA 4QFMA 1FY4A 4OHZA 3N2IA 3LT3A 1J8AA 1JAIA 1BHXB 5GCHG 1L1NA 2XBXA 4DUGA 4DCDA 1H65A 3MH4A 2ORWA 4PANA 4URWR 4GT1A 3RC8A 5L2YH 2GCTC 4AYTA 1ETUA 1HQYE 4A15A 4BTTB 3WBKA 4TYDA 4P0TA 2ZREA 4EUNA 4FWTA 1PJPA 4C7OB 5G3YA 3MFYA 1OXSC 1FNIA 1I2DA 4RD1A 1TPSA 2R8RA 3QF7A 1Z0IA 1YPHE 1E69A 1GJ8B 3GYMA 1L1JA 1THSH 3U7EB 1ZSKA 5LD2B 3K8YA 2EYQA 3THXA 4MG3A 1SQOA 3VR5A 2ZI2H 5HM9A 1ZIPA 1XCMA 4XBDA 1EKBB 1G5RA 2YV5A 3H09A 3EA0A 1RZ3A 1BTYA 1UTLM 2QF0A 2WTUA 1NRPH 2OXCA 4QNRA 1TLDA 2WVJA 5JCZA 1W48A 3ICQB 3C27B 1YRAA 2HF9A 1LKBA 2J0UB 1O2YA 3ZQ6A 2CDNA 5BYJA 1GCTB 4CGZA 3PTBA 3T1VA 3RS7A 2KWIA 4E06H 4Y10E 1GTVA 2CNWA 3EWAA 2JKHA 4URYR 4B32A 3WXMA 1VIYA 4D82A 1KK1A 1VG9B 3UY9A 4WMFA 3SNCA 1SHYA 2G88A 2GJKA 1FIZA 3A7WA 1ZYUA 4H1UA 4PXAA 4DURA 3FP7E 5B6LA 1LW7A 4JYBA 2FOCA 1HNEE 1C5PA 2ZRBA 2IW3A 5FPSA 1LHGH 4I8JA 2H8KA 1SGNE 1E1QA 1X86B 2JLXA 1AVGH 3EIEA 4AURA 2XNDD 4M9XA 2QP9X 4NZLA 2QEQA 4X1RU 4DXAA 1U9IC 4AGKA 4DLYA 4FU7A 3RXGA 4FIDA 3VKHA 4BUJA 2FS9A 1QTFA 2J95A 5FL3A 2IUTA 3CUEF 3IBGA 2BY8X 2CVFA 4LK4A 3LONA 1A2CH 2NIPA 4QNMA 1O3AA 1U8ZA 5IF9A 2ZITA 2O0KA 3CX6A 4RVCA 1A5TA 3CZPA 3ASZA 2HDNB 3DO6A 3TNFA 2PZFA 4WXPA 4YMWA 5EE5B 1VG1A 3L2OB 3GLIE 1KI9A 1TMTH 4BPBA 1O2UA 4IS5A 1D2EA 1ZJKA 5DP4A 2IC5A 4A6PA 2BMFA 1N8OB 3D8BA 2D06A 4JVLA 1HAGE 3M35A 1E1RA 2YVUA 5H70A 1QCPA 1LPKB 3GLHA 3D49H 4Q7MB 2ZAOA 1TFXA 4D0LB 4I1UA 4AB8A 5B58C 5J4YA 3DPUA 2PJRA 3QVVA 2F9BH 4DC9A 1LVGA 3E2IA 3KB1A 3OAAA 3FPAA 1T4GA 2FPMA 4TYYA 1MZAA 2QU8A 5KPDA 1HAVB 5CYOA 3CWQA 4KFRA 3Q85A 2ILNA 1RIWB 2IYVA 1IOZA 1AS2A 1NVUQ 4WMDA 2NO1A 1EZQA 3MI4A 1KI7A 1O5DH 1HBTH 2FOMB 2ZFTA 5BPEA 1SVMA 3HGPA 3EZ6A 3IGFA 1GHBF 2EC9H 1T8OA 1LTQA 3NC1C 4ZCLA 4B3GA 1V2UT 1C9TA 4TY6A 3IO3A 3SJAA 1E2EA 4IFBA 2BY5X 3ENSB 4XD7A 1C2IA 4INHA 4OK5A 2G5VA 4O97A 2IK8A 3O8BA 1DITH 1NSFA 1N5IA 1VDZA 1YZUA 2YKGA 2O5VA 3TK6A 3OFND 3HYRA 3MWJA 2A9KA 3VR6A 1M2OB 3SBEA 5G40A 3A1WA 1XXDA 2WSSD 1NFUA 4QBGB 3RXJA 4JK5A 1JIMA 4ZKEA 2GV6A 3GY3A 2A0QB 3SORA 2ZEBA 1TTTA 3OIUA 4TWWA 3UQOA 3K9HA 4RKEA 4NYMR 1RRCA 2F7SA 4YMTA 2B6HA 5A8XA 1KSNA 2QF3A 1QFKH 4M1KA 1TWXB 2XC0A 2I6SA 4CR5A 5IRCD 1HAPH 5T3HA 4QXAA 5G53C 1CR2A 3FMOB 2QE7D 4A8JA 1N6KA 1YZGA 2P8OB 2BBWA 4ABHA 4Y79A 4Y8XA 2J41A 3MNCA 4WY3A 3BTQE 3EPKA 2AR7A 2WPDA 1K1NA 1G7RA 1OFHA 1Z0KA 4I8GA 1A2BA 3ZGXA 3KTAA 3SI4H 5BXQC 2Z0MA 2X19A 4OI4A 3UMSA 1HJ8A 2XGJA 4MKGA 1AE8H 3AW1A 2F3TA 1VECA 5CIQA 4F91B 4IDQA 3C15C 3MAAC 4UNSA 1WTHD 1L2TA 5IHPA 2AK2A 4HYYA 5DO9A 2GTBA 2IS2A 3P92A 4MNXA 3EZFA 4AFZA 1PQAA 4BXSA 3EPLA 2A5KA 2VHCA 4O3MA 3R9WA 1N6LA 4PHFA 4IC5A 1O3NA 4UNQA 4HAWA 3QF4A 3OEEA 3KQDA 2GVDC 3KQKA 3QBVA 4D8NA 3A7ZA 1XXHE 1RYHA 3I61A 4YOJA 1FQKA 4TN1A 4D6PA 1Z2AA 7ESTE 4C0LA 1VHTA 1GGDB 4I1SA 4NYJR 2QPTA 2PEZA 3T35A 1ELGA 5GPIB 2BXTH 2OTVA 3SV6A 2XC5A 4WH6A 1ZAKA 3K0AB 1Y3YA 5KSZA 5TMPA 3Q5EA 4AB9A 1TMUH 3GFTA 4L9SA 1JAHA 1C1PA 3M7UA 3IITA 1TOCB 4LJ5A 3C16C 1Z6TA 4ISHH 4ACBA 4TLBA 2F9PA 4ZKSU 4EAQA 3NVAA 2HUPA 5JBTA 1HAXB 4IEEA 1ZD1A 1OXUA 3PLPA 2R2AA 4XWKA 2TGPZ 2Q6TA 1G3MA 3V4FA 4I31A 7GCHG 2Z4SA 1ZMJA 1XZQA 1R8QA 4DSTA 1SVOA 3CS7A 1NVWQ 4OI1A 1WXQA 4G5SA 3MD0A 4JSTA 4Z8YA 2QC2A 1NFWA 1S0RA 3QG5A 1XMVA 4MKHA 2Q3MA 3QKSA 2OBMA 1E9BA 3BTME 2IYLD 1O2PA 4D4MA 1L7VC 4K8OA 1R5NA 2R65A 5FPKA 1GJ6A 3BORA 1P05A 4XSGA 4K3JA 4YMSA 5J4KA 1ZNXA 1TF2A 1UDXA 4DLUA 3RMLH 5JHHB 2O8DB 3RANA 3R0FA 2RGAA 4UJ5A 1E4YA 1UKEA 4OHYA 4AKIA 1JRSA 2ZR9A 1TGTA 2ZGCA 2RKOA 2OC0A 4D7GA 4AZ2B 3ZZCA 1RRKA 1NJGA 2GVFA 2ZECA 3N70A 4J1YA 2ZFQH 3DKPA 1NLZA 3SU2A 4LK2A 4JIMA 2REBA 2OBNA 1BJVA 1LFDB 1RVDA 2JJ2A 4HI3A 5KSOA 1ZU5A 2TPIZ 3CX7A 1K8RA 1E99A 4C0JA 3M3TA 1G7CA 2Q3HA
chains in the Genus database with same CATH superfamily
4A03A 1MO2A 5HQJA 4OS1A 4GP7A 4D8YA 2GD6A 4YJ2F 4CKBA 2C4HA 1F8UA 4K81B 4LFBB 4EJSA 1T43A 1QNJA 4FLMA 1NZQH 4QFCA 5KDLA 4ZDJA 2ZJYA 4C3UA 5FOVA 3C3AA 3MFQA 4J16A 1QIKA 4H4FA 3SJ9A 3AF1A 4J7AA 1C9KA 3SR0A 3BEIB 4PROA 3INRA 3T61A 3AKEA 5LBUA 3T7SA 3T15A 1DG3A 4E5UA 1DOHA 2XA1A 5ALLA 1QBKC 1TZKA 2HT6A 3P17H 2G1AA 3U2QA 1ZQ9A 4ZOQI 2VWQA 4M1SA 3FWNA 4B85A 1D3TB 4AX4A 2W3IA 4YPVA 3EXIB 3L7DA 1HE3A 2MYNA 5ALKA 1MHTA 1TUIA 2PBZA 3M7TA 3MJ4A 2PYDA 1W47A 1N6PA 2VHTA 3EEQA 1N1GA 2JFYA 3PS9A 1FUYB 3RS5A 2XWAA 5AIAA 2DPXA 1JOUB 4CDMA 1DXWA 4HGYA 5JVDA 1AUPA 3RBVA 3EWIA 4UNPA 4O3TA 1C3VA 4WJLA 4M1QA 1S81A 3T6KA 3HY6A 5FBLB 4E5VA 3JQEA 4UPVA 2JARA 3G1TA 4PVDA 2WABA 2ZQ5A 3H75A 4M1WA 1P3Y1 1IZZA 3ODPA 3VG8A 1WQVH 5C17A 1JHPA 4PLTA 2OD7A 2I2XB 3IHLA 3LO5A 1FU8A 3FPCA 3ZZ4A 5HWSA 2D8MA 5A4FS 1V2KT 3QZQA 5IAJA 1G8KA 2NUAA 1IHSH 4G86A 5JSKA 4UE7H 3GD7A 3LM8A 1J23A 5F53A 4WSOA 5HJEA 2FA9A 2WG2A 5HXFA 4ZXPA 1YE3A 3L6RA 3CLKA 1BW9A 1A8QA 2VH5R 3VZBA 3DSOA 3OIFA 3OM9A 4KSBA 5K1ZA 3TPIZ 1XZEA 2IA5A 1XNGA 1Q3HA 3C6KA 5KZMB 2O8CA 3UGTA 1AM4D 4UMDA 1R4AA 3LK6A 3DNMA 2PGXA 4P34A 3ELUA 2PPLA 2VRCA 5KYVA 4MR8B 1IN1A 4Y6GB 2YVKA 2A0FA 2ZK7A 4MUBA 1EGHA 3S2YA 4RETA 4Z2AA 3PD1A 1X1RA 1LKAA 4FFLA 3I6YA 3I5UA 2EP5A 1IUKA 3AW0A 3LPRA 4F45A 3COVA 5FUWA 4IMIB 5CDSA 3KYGA 4IIHA 1K1JA 5DIZA 1XZKA 2C7VA 2O3RA 1DBWA 2W9XA 5KTOA 1Z6QA 5IAOA 1L4HA 1A1RA 5K9ZA 5EGNA 3W94A 2ALPA 5A1TA 1S6LA 3UMJA 3GJRA 3DC7A 3MH7A 4BBAA 4JUIA 1MQSA 2PSDA 4ZODA 1VG8A 4DZTA 4RV4A 3J80A 1EVYA 3GYGA 2JH8A 5CHAC 1UK3A 3AYXB 2WYVA 4MDFA 2XGOA 4LZ4B 2OORC 1REQA 3S99A 4B6GA 4PYJA 3HKEA 3OPXA 2QUHA 2JGLA 2I4RA 1APBA 3KKKA 3K6YA 3FO8D 4Z4HA 3D64A 3V32A 4K0KB 4RJ2A 1KFKB 3WLIA 4C2UA 4MTLA 2VT7A 4AIIA 3RUAA 4IV0A 2OHHA 4RPJA 4US2R 2OINA 1SGFA 4YX9A 5BSKA 2AG8A 4RVHA 2AZ4A 4WK0B 3EB9A 4OLJA 3TZQA 3ZJVA 4KAAA 1ZXXA 1G0OA 2PGBB 2WHEA 2P94A 3LHKA 4X2XA 2BVSH 3MBOA 3SNDA 4Y6LA 3U31A 4KBGA 2IW1A 3ZZUA 2X6QA 3JPWA 1Z6JH 2FOHA 4P7KA 3PG5A 1EFCA 5TS2A 3I8SA 3EVFA 4G5OA 2HIGA 3JWIA 1TRNA 1J09A 1CLEA 5IARA 4DBLC 3H11A 5FULA 3E5HA 1MJNA 1QDUA 3VHXA 3DWGA 4NPHA 3U44A 1UXKA 2PAAA 1S1CA 3QPWA 5HK9A 1OROA 2I22A 2QGRA 1PHPA 4P7BA 1GUBA 2I9KA 1OLOA 2IXAA 1HDYA 4N3CA 3CZRA 1A7JA