5FPSA

Structure of hepatitis c virus (hcv) full-length ns3 complex with small-molecule ligand 3-aminobenzene-1,2-dicarboxylic acid (at1246) in an alternate binding site.
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
642
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords HEPATITIS C VIRUS FULL-LENGTH NS3 COMPLEX
total genus 202
structure length 642
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5fpsA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fpsA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5fpsA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpsA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpsA03
4OI2A 2NG1A 1N0VC 1GG6C 4L9WA 4DCSA 3CUEF 2BOVA 1QZXA 3GYLB 2GZ8A 1OX1A 3KDSE 2ALVA 4LHWA 4IXNA 3UWIA 1TE0A 1YR7A 1AK2A 2C78A 5DO4H 3K0FB 1HY3A 4ABYA 1WTGH 4OI4A 2ZU3A 5DHFA 2YKGA 4ZHMU 3GOVB 4JLDA 3EZ7A 3PIRA 4A7IB 3LQRA 1SHZA 1FPCH 2D1JA 3I62A 4IFBA 2EC9H 1IQFA 4EPYA 2VVUA 4G1UC 2ZGHA 1YQTA 4TMKA 2ZM5A 3Q7QA 3U6BA 3AF2A 3GEIA 4QM7A 1EGAA 4WXRA 1N3BA 4LZ1H 1DT2A 1EAXA 1M74A 3ND9A 4DIDA 5F03A 1YCPH 4XVUA 1MO3A 4PSVA 2FU5C 2PKAA 2XZOA 3U8RH 1B0FA 2GXQA 1C1VH 5T6FA 3RS0A 2W83A 2HOBA 1TGTA 1VKJA 3OF5A 2B5TB 4JBXA 4KI0A 1YKTA 2QY9A 1HAVB 2A30A 4IDPA 1DX5M 4DC9A 3P1JA 2VIQA 3W6NA 3AK5A 4HYYA 5EUQB 3KF2A 3WMEA 2Q6TA 2QROA 3D7MA 3ZYEA 3U9AH 5FPTA 1P62B 1PYTC 3I72A 5EW2H 3PR1A 1ZHRA 4DIHH 1GJ5H 3R7WB 3SOSA 4POAA 1XJQA 1TFXA 4BAHB 2GMTB 4Q1DA 1W36D 4YMTA 1T5LA 1QGFA 4PSAA 2GBLC 4GUXA 2W6ID 3R9WA 4LUCA 3RXGA 1NVVR 2ZGXH 4GRAA 1TOCB 3MH4A 1FZQA 3LWNA 2HV8A 2C4FH 1ETUA 2OLKA 4KTSA 5CIQA 1DAHA 3D49H 4X6MA 1O5BB 5GJVC 3K53A 2STAE 1CVWH 4RKFA 1KIMA 5DG6A 4PAOA 2V35A 1NRJB 2FSHA 1JJVA 2IW3A 3U3JA 4XBBA 3RRZA 2Y6TA 1GKUB 1BUIA 1TF2A 2IEYA 2BDHA 3QK1A 1AKEA 3FOZA 1ZPZA 3ADBA 3ZVFA 4HFPB 1EZXC 1BOFA 2OESA 2WBLC 4A5TS 4AG5A 2YHSA 1HJ9A 3LIWA 3LBIA 4K81B 2XTZA 1O2VA 1TEXA 1CP2A 2FX3A 3ITIA 1F0TA 2ZHEH 3SJ9A 1FTSA 4JZDH 5T6GA 2JLXA 3ZZUA 1O3MA 1ETRH 4LJ4A 4ZKRU 2O8DB 3MNCA 4B2IA 4OYHA 4WMFA 3HK6B 4CEIB 3BG4B 1A46H 2CNWD 4WXPA 4K3JA 1T3HA 4NDZA 3BN9A 5KHOC 2NMVA 4B32A 3RDZA 1P5ZB 3T35A 3I78A 2XNSA 1JRTA 3U44A 2JH0D 2RHDA 1G3UA 4MPWA 1GKYA 1YC0A 3LC3A 3T15A 4AYWA 3F0TA 2CLDX 3ZD7A 5KDLA 3AVXA 1GI6A 2PX3A 3SU8A 2CXVA 1G7RA 1SGFA 2OFWA 5C4GB 3KQBA 2HT1A 4NIYA 1CULC 1Z08A 1Y59T 2OXSA 1R0WA 1W44A 3RM0H 2XRCA 2W6IA 4RJLA 2ONJA 3X2SA 5C18A 1EQ9A 2ZI2H 4LZZA 3ZZ3A 2F1RA 1YP9A 2WJVA 4MYHA 5FTJA 2F3CE 2QIQA 3E5HA 1CBWC 4ZPXA 4WOPA 2B8OH 1O2QA 3NUMA 1VR1H 4Q2KA 4W9MC 4KSCA 1P60A 1C5LH 2ZE7A 4CEHB 2C9CA 2QF0A 4ASHA 4ZDKA 1N1LA 621PA 3MFJA 4X6NA 2Z3EA 4CT4B 4XSHA 3J81k 3OEED 1WOFA 4GMDA 1C5NH 2VBCA 1AFEH 4JKYA 1JECA 4LYJA 5E2PA 1KSNA 2BVSH 3C5HA 1YYY1 1BRBE 3GY2A 1OXXK 4QHSA 5TDHA 4R71A 2W7SA 1G9IE 1NO9H 2ZS9A 1V2TT 1WV7H 1UPTA 2GDDA 1TNKA 4I31A 1Z2CA 1IQMA 1E2LA 3HKIB 2AWOA 5CE1A 3NDPA 3FB4A 2PJRA 5TARA 2F4LA 3SQXA 2B92A 5JECA 4BAOB 1AIXH 1O5DH 3OEHD 1BMAA 1Z63A 2J9RA 1DSTA 2NGRA 2BVNA 3B1XA 5K8IA 6LPRA 1F5RA 3UG7A 5T3HA 3SEAA 3SNAA 2VHJA 2YWGA 1JXMA 4I81A 2XB4A 3TIUA 1MH1A 1VCIA 3MNXA 1AS0A 4NCJA 1NN1A 1E9FA 4GP7A 4ZIRA 5ESTE 2JDIA 2J1LA 1C5XB 4HB2A 3GJ6A 1QR3E 3AKCA 2ZAOA 2WM9B 2ZI6A 1NPMA 4ACBA 5EP3A 4YMWA 4M1MA 1TQDA 4DSOA 2IYLD 3DMDA 2OFOA 2R6FA 4NZYA 1RS0A 2MMGA 1CA0B 4GSYA 4LX0A 3UQVA 3RC8A 2GV6A 4OHVA 3KB2A 3EASA 2JIZA 2O8DA 2QGRA 4PPQA 1NESE 1PV4A 1Z71A 2HRVA 3KHVA 1VECA 1GM5A 3CR7A 2SNVA 4IVPA 4FUHA 1G7CA 1AB9B 1NF3A 1W12U 3QXXA 2WOJA 4MKGA 1S8FA 4RI0A 1BTUA 3TUJC 2Z9GA 2PEZA 4XE4A 4TQUS 2W0MA 1O3JA 2BY5X 1Y3UA 1ZCAA 1GBIA 1N6LA 2ECKA 1G8YA 4YDSA 1U6QA 1NJGA 1EZUC 1TL7C 2QA5A 2WICA 1W13U 1SQ5A 2HNTE 1SOZA 4ABBA 1J14A 1TNDA 3O8CA 1E9EA 1A5GH 4B43A 1S96A 2RGCA 2ZDLA 4AYVB 3WNDA 2DY1A 3SV7A 1XD2A 1KSHA 3Q8XB 7KMEH 1GZSA 1CA0C 3HKJB 2OQ5A 2WTUA 1IQNA 1GBFA 5GCHG 2VP5A 4QG7A 3QF4B 5TJXA 2Q6DA 4QJ4A 1DPFA 4F49A 3TJOA 1ESAA 3ATLA 4C0AC 1A0HB 3QZQA 1BTZA 2CJWB 3FAOA 1SGEE 2FFAA 3EZ9A 2ZROA 4KVAA 4NCHA 2ZAMA 1KTSB 1SVMA 1SGQE 3TK1A 2VP6A 2IL1A 1O2RA 3SV9A 3SJAA 2TBSA 4DDVA 1L1NA 1JOUB 1E94E 3KGPA 4CRGA 3W8RA 4AG6A 2FSIA 3A85A 5G4BA 3K6YA 4D2IA 3QUSA 4LJ8A 4QGFA 3RHFA 3S9BA 2GF9A 1DOJA 4B33A 3T2NA 2ZRHA 4EFNA 1ZD9A 1TQ6A 3IHWA 4MDSA 3DOEA 4RSPA 1RTFB 3LPRA 4WF8A 4HB3A 3BIVH 3A82A 1XCGB 3WYFA 3S9AA 1YR9A 3VNUA 1KO1A 3ATIA 3TU7H 1L2TA 1H65A 3Q3KA 1WMSA 4CIDA 2VNTA 4A6LA 1FAXA 4HZIA 1IAQA 5JDUB 1UK4A 3ZVBA 4ABJA 5EQRA 2BCGY 2CK3D 3WBKA 1XD9A 3U60B 1ID5H 1TF7A 5L8VA 3RXKA 3IKJA 3NKVA 2FSGA 2TIOA 1GWAA 3V12A 4DLUA 2GXSA 2NZ8A 1M7GA 5A0FA 1J15A 4NCIA 4PZLA 2VIVA 2ZTYA 1CJUC 3IDQA 3HR8A 4EAQA 2NO6A 2CV3A 1DARA 4OK6A 3URDA 1EASA 1FPMA 5CYOA 1K1LA 1G3IA 2B21A 1Z0FA 1N5KA 2BMFA 1Z1IA 1NI3A 5JB9S 2PZGA 1OF1A 4ZDWA 1F0UA 3MWIU 1YZQA 1C5YB 3RMOH 1TADA 1TMTH 2IJD1 3GJ7A 4Y8YA 3T28A 3N5CA 2RGNA 1P9UA 1FNIA 2GKSA 2P65A 1XU4A 1ZNZA 3NIBA 2JLYA 1T9HA 4JLPA 2PCLA 1FMJA 2Q6GA 5FPKA 3DM5A 2BBWA 3FKSA 2XX3A 1GJ8B 1MMJN 2AS9A 2JGNA 4B3BA 4ASUA 4I8KA 2HJVA 3MO6A 1GHBF 4M22A 2HGTH 2QGZA 4WXVA 1EKBB 1DY8A 2BY7X 2J7PD 2DFLA 4URWR 3WNBA 5L3SA 1Z7KA 2E9SA 1YHNA 2FF7A 3GLIA 2FI5E 3BTME 1ZIPA 3JZMA 2LPRA 4X1PU 1IQHA 1P2TA 4CRAA 3OU0A 4BOHA 1EAIA 1N6XA 4JZFH 1XXHA 3EAQA 3KQLA 1ONBA 4HI3A 3OSYA 2O0HA 3A7VA 1DELA 4Q18A 4EDHA 3LDAA 4GOXA 5JB8S 1AMHA 3PB1E 1R7RA 4LZ4B 1GGDB 3KQCA 1II0A 5J4YA 4F91B 1P10A 1G8HA 2YYZA 3I8XA 4Q4JB 1Q1ZA 4Q1EA 2ILNA 2ZRNA 4NYJR 2Z7FE 4MDEA 2ZF0H 1LY1A 1GMCG 4A92A 2UWPA 1MV5A 2ZUCA 5A5GA 3PV0A 1XZQA 3KUCA 1TBQH 3TK9A 1C5SA 2OAP1 1NRQH 4E7RG 4HEJA 3SE0A 3GPLA 4GP6A 4IDOA 1QFKH 1Z2AA 3AASA 2F55A 2P6RA 2ZU6A 4WIAA 2HYDA 3B9FH 4ISLA 3KQHA 1ZRKA 4IKEA 1FXYA 2ZEBA 2QG6A 1B0UA 1ZM7A 4BZXA 5EXMA 3PV2A 1VHTA 1SVPA 2ZVQX 1C2LA 3M5MA 3L3TA 2ERXA 1FY1A 4DB2A 2BDYA 2JLZA 4Q4HA 2BQ7B 4XWAA 3VU9B 2GZ7A 4ZXYH 2NO1A 2D74A 1M6NA 1PUJA 3DKPA 4U01A 1FP6A 2JJ1D 1DS2E 1O3YA 3SNCA 3OYPA 1VJAU 3LO5A 4MYCA 5DKMA 4ZI2A 1NU9A 1YBWA 3U1IB 4I7YH 1EWRA 3TNTA 4KJZA 3FHCB 4BNRA 4B47A 1Y3YA 1O5EH 1AGPA 4Y10E 1VTKA 5HPYB 2WPDD 2RGNC 1THRH 3RSLA 5DNYB 3PV5A 3K9GA 1A1RA 2FFHA 3GLFA 3WNCA 4X8TH 2I4IA 4M8NE 3Q5EA 3UPUA 1ELVA 1M8PA 3F9FA 1HV7A 2H7VA 1E3MA 3UREA 5T6DA 1UTMA 4LHYA 2XCFA 4KITB 5EPYA 2OSBA 2IS4A 4DIIH 4ZDIA 1Z0DA 3GP8A 4Y79A 4Q7YA 4KTUA 1MCTA 5ELXA 3A1TA 2HPQH 4IVQA 1GOTA 3LGIA 1TPSA 1S2MA 1SXJB 4MH0R 2J0UA 1E2IA 3UK6A 4A8JC 4R2HA 2FZZA 4G5RA 3RS2A 4MQAA 4IN1A 3I92A 1OKXA 2ZQ2A 5F9FA 4NP6A 2EFGA 1O3CA 3UIRA 1AZTA 1O2XA 4U02A 2XNDD 4ISHH 3SI4H 5A09A 3T61A 3IG6B 1CHGA 1B0EA 5EJEA 3GYMA 2C95A 1K5DA 3IBYA 2RGGA 1II9A 2XJ9A 1K21H 3RANA 1MTNB 4Y76A 2HCBA 2C9YA 2VA8A 1I4LD 1P73A 5LGOA 2IXEA 2H6MA 4DCTA 3MD0A 3VKWA 2BM2A 3RXBA 5LPFA 1VCQA 2ZJAA 2WPHS 1AUJA 3Q00A 1QY6A 1HURA 4UDWH 1ZPBA 4YXWD 4GAWA 3UWKA 5CDFE 1QL9A 2BTCE 3TNFA 4HAYA 3QXSA 4H6TA 1DAIA 2XNIA 4AC9A 2R9PA 3QI2A 2LKDA 4M9QA 1T91A 1AQYA 1SI5H 4Q5IA 2ESTE 1FI8A 1O3HA 3WMGA 1W3CA 4RD2A 2XWAA 1GRNA 4KHZA 2ZYVX 4ON9A 4Y7AA 4UJ5A 2M5TA 1NVUQ 4M9FA 4RCYA 2PR3A 3CNLA 1GMDF 1KDTA 2QBYA 2NU1E 3V13A 3KNXA 1HT1E 2ERYA 1Z5ZA 1P7CA 3EC1A 5DP7A 3A8BA 1W0KD 4FMDB 3CWQA 3TGJE 3AGQA 2G88A 2GVDC 4YC7A 2WHXA 2P3SA 2QXHA 1EJNA 1XKBC 1JR3D 4GLYA 1W0JD 4B34A 1AN0A 3D3QA 3LVRE 1FZZA 1IY2A 4LV5B 1XMSA 2P6NA 3EIEA 4W5JA 4D4JA 4B6EA 4QKQA 3ASZA 2G51A 3G82C 1JNYA 4G5QA 4LSGA 3DM9B 5G3ZA 2YVUA 3KJHA 3HDTA 1HQYE 1OPHB 2J2UA 1G4AE 3WRYC 3P4YA 3WP1B 3BERA 2BIFA 1P09A 1CEEA 2JDID 5C5NA 5HGGA 3L6PA 2VQSA 1RFLA 1KO7A 5B64A 3DEFA 3SYNA 4DDWA 3H1TA 1C1NA 2EFCB 1P2KA 2XZLA 3GLHE 1RPZA 2I3BA 1O3FA 3P8NA 1Z8FA 2CLSA 2BY9X 1OXUA 1OWIA 1AD8H 1TABE 4OS5A 4OS4A 1IN6A 1BMMH 2YWHA 4TLEA 3S9CA 2WWIA 4NCKA 1A1VA 4TQAA 5F98A 2J0SA 2BY8X 1TX7A 1BS1A 4AYYB 1NFUA 4UKDA 2Q1JA 4DURA 1U94A 5FUXA 1O30A 4AX9H 1WA5A 4L4UA 5EW1H 4KO8A 5E0HA 4B2LA 3GCNA 1A61H 1ZJ6A 3BRWD 1SMFE 2HNTF 2BKUA 5SZIA 4FINA 4LOAA 3E16B 3H86A 5H8WA 1JXPA 2FN4A 4KFSA 1ZAKA 5CK4A 1FMLA 3GLGE 5A8XA 4I99A 4MVNA 4DCUA 3SJ8A 1O3NA 2R2WU 1C2MA 1FJSA 2B9LA 2W2TA 3A1WA 3RMLH 5CMXH 4U32A 1QG4A 4FIDA 2FFBA 4AFUA 2R6GA 4ZH8A 5JS8A 1JQLB 4Q02A 3GJ3A 3SC3A 5DH9A 1G36A 1K22H 2ZPTX 1SLWB 1K1NA 2ZYUX 2GP9B 4HI0E 3SU3A 4NE2A 2WKPA 3GCGA 4X8MA 3BV9B 2C8YB 1LF5A 4HDOB 3RXVA 4GHTA 2GXAA 2HXSA 2AKAB 5FR2A 1ZVQA 1UCYE 3VPKA 4IDQA 2OG2A 2HYIC 5FPSA 2BDBA 1SLUB 1ZJDA 2GKVE 3QVVA 5H4IB 3FHTA 3L0OA 3A36A 3HYTA 5HM2A 1UBCA 4Q4LA 3ATWA 1BBRE 3RLYH 1C4Y2 3BJIC 1KXEA 1II8A 4UONA 3KXLA 1PPZA 1P2VA 4I1SA 5JWRA 4CHAB 1CTQA 4M21A 4BTTB 2QU8A 4E06H 5AWFC 3EE0B 1E0SA 5GCHF 2ORVA 5CLLA 4DLVA 4Q21A 1DOAA 1E0JA 2XJ4A 1TPPA 3OIVA 2CL6X 1CHOG 1GBJA 1WQSA 2VSFA 1P9RA 5DN6A 3IWMA 2REXB 1ZU5A 5A2MH 4TYWA 3EA0A 1CT0E 2ZR9A 3LGVA 2BMEA 2F9LA 3WBJA 1TQ2A 4B74A 5IF9A 1Y63A 2ZFTA 2TRMA 1P3CA 2BY6X 2ZC9H 3D6TB 1BRAA 3R3GB 3SGAE 2IEZA 2FV8A 3ZGXA 3NXSA 4EPXA 4RFSB 4EFLA 1GI8B 4RVCA 3BGWA 1FV9A 1ZHMA 2HVXA 2OQUA 2Z9KA 4QBIA 3SYKA 2XZPA 1H8DH 1PVOA 1P2OA 1TALA 2EW1A 1OOKB 4WWYA 1N5JA 2ZRGA 1ZTJA 5B30A 2PFEA 3BTGE 4D8NA 1HGTH 1BYIA 2ZE6A 3CPHA 2A45B 2VO1A 4NPHA 1CSOE 3RXUA 4X2WA 3BAFA 3TGKE 1O3GA 2IYQA 2V4ZA 1O5FH 3BOSA 1NFYA 1OP2A 2Q3HA 2ZFSA 4U30A 1MTNC 4KLZA 1EXMA 3QKSB 2JJ8A 1OYQA 1QBNA 3QKUA 1UBEA 5TCAA 2P3TB 1FNNA 3NBFA 4M7GA 1Z0IA 1P61B 2PWXA 1TRYA 3HJNA 3NBZC 3OE7D 2IS6A 3P95A 2ATXA 1QHSA 4Q7MB 2SGEE 4FUJA 4PZZA 4KVGA 2ZDMA 4JL8A 4AI6A 5EG4A 4KBGA 1GCDA 4HLQB 4LJYA 2PBRA 2O0JA 2RGDA 4ZHLU 2ZTSA 1AS2A 2YNBA 3SQEE 4PC1A 5FI1B 4V0LA 1GKIA 4PO8A 1TQ0B 1XXHE 2R3UA 4ZUHA 5FPYA 3K65B 3QSYA 3D31A 4EPTA 4DBLC 4FU7A 4DLXA 1AB9C 2JJ2D 3R7WA 4TTQA 4H6SB 5CLQA 2BEJA 2FPKA 1GL9B 3NDBB 5BXQC 2GETA 1JBKA 1A5HA 3RU4E 1MRSA 1QHRB 3G0HA 2WMOB 4K8YA 1QA0A 1OWJA 4KFUA 3A58B 2ZJOA 3F3YA 4JLOA 1WP9A 3CX8A 5DP5A 1VG9B 2EA3A 4OQFA 2UUYA 5FCRA 1DXPA 3RXLA 3NHBA 1AWHB 1M7BA 2QPOA 3FWYA 5TMPA 2EYUA 4Z8XA 4D0LB 1P2QA 1QA7A 1RJ9A 2DPXA 5DPAA 4UFDH 2AL7A 1MKWK 4YONB 4A0RA 2BLQA 1SGYE 3ZQ6A 1HUTH 2EI6A 4AB9A 3TH5A 2Q6FA 1EPTA 2FZLA 3QDZB 3BWDD 1OV4A 2ZPRA 1CIPA 2UZ3A 3MNSA 3M7UA 4NHOA 2CL0X 5L3QA 2O9QA 2OUKA 3PEVA 1SB1H 2A4GA 2QP4A 3D62A 1HA3A 1X7AC 4TSFA 1LFDB 2IYRA 1KMQA 4O3TA 2PKAB 5JSZA 3B5JA 4M1YA 1HAGE 3MHWU 1OH5A 1Q44A 2K1QA 2IYXA 4BAQB 1SKYE 2V0BA 5F9HA 4P31A 5CIWA 1RYFA 4BTUB 3K9NA 2C99A 1GHYH 1E2MA 3A1SA 5EOKA 3UWJH 1U9IC 1XMVA 3QJYA 1GFIA 4XWOA 4DIEA 1NIJA 3W34A 1ZJKA 3OE7A 1KAGA 1E4YA 5EP2A 2FS8A 3NEYA 3PM3A 3IIJA 3KTAA 1FNMA 3UNRA 1MD8A 4DY7B 1UMAH 3AH8A 4TN1A 2ZQ1A 1XPUA 1EB1H 2ZR0A 2WPMS 5FXLA 3U7EB 2ZU5A 1TA6A 5FBLB 2CCGA 1UTNA 4Q4HB 4PANA 4M9ZA 4IMZA 4Y7BA 4CRCA 1TONA 4QBGB 2BBSA 1NM6A 5GVRA 2UKDA 2YZ2A 1O3PB 4M1WA 4C2UA 2BDGA 3AUYA 4ILEA 1GJAB 3LBNA 3U7GA 2KAIA 1DPOA 2H57A 4HAWA 4BRUA 5CB8A 3SQHE 1KXBA 1UKEA 1NY22 1FMGA 3MRSA 1XNJA 1V2PT 2QPAA 3GJ8A 3VFEA 5F8TA 2A31A 3MFYA 2ZEJA 3TLXA 3FZDA 1TX4B 1YPLH 4NFFA 3RXRA 1Z6EA 1QVAA 4X0WU 4IOMA 3RM2H 1GDQA 3EDXB 2FOMB 4CBNA 2XBYA 5C1YA 2JLSA 1T0JB 4CW7A 2JLVA 4YLQH 1DAEA 1F3OA 4C3ZA 3K6ZA 1SGNE 2LCFA 3LJOA 4JZIA 2OD3B 1P0SH 2PH1A 2UWLA 1KAOA 5HKKA 3HGNA 3THWB 4HDCA 1DITH 3U3MA 3SU2A 3U3RA 4RSGA 4WBSA 1QIXB 1RIFA 1P2MA 5JHGB 1F2SE 4CEJA 1ABJH 5AK0A 4OQXA 1NS3A 2ZDAH 3W5IA 1KXDA 1S4QA 3QF7A 4ZCLA 2QXGA 2QRZA 5UKDA 1LPGB 3VU9A 4KKDA 2FYQA 3P70B 2QMUA 1QHNA 1FP7A 1ZMJA 3AW1A 2N1BA 2BXUH 4JVNA 5CJPA 1JQJC 1SKQA 1PFXC 2JLWA 1OE0A 1NRNH 1U81A 4Q4AB 1UM8A 4EPRA 3BF6H 2J4IA 3I1FA 1EXFA 1UAAA 2ZS7A 3EA9A 4LI0A 4L8GA 3F9HA 3LH3A 2DWPA 4Q9LA 2WPIS 2IK8A 1N6NA 1X86B 1YPMH 4HUQB 3LKWA 1U8ZA 3UMSA 5FBEA 1EX7A 1U9IA 2ZQ5A 1JEEA 4FWIB 2QAAA 4LHVA 4UD9H 3FFBA 3EIQA 2A5YB 1GJDB 3FKSD 2MSDB 2G1KA 4DT7B 3M61U 3S69A 4DRZA 2G00A 3RS3A 4D26A 4FCTA 2FOCA 2XTTB 4RZXA 3WXMA 5EP1A 2QE7A 2A2ZA 1NRSH 4ZKDA 1D6RA 1QHXA 3MU0A 4JZ1A 2LKCA 1D3TB 1UDXA 3P26A 2Y5HA 1PJRA 3VNVA 3LGYA 2OC8A 1ACBE 4Z54A 2Z6VA 1FIWA 1VCMA 3U7FB 4CGZA 4OS7A 4A0GA 1Y5AT 4PX9A 4KELA 3LGTA 2SFAA 2WKRA 4GCHF 1DXWA 4PTLA 4M4SA 4ABEA 3NH9A 5EXNA 3SU1A 4FMCB 1AKSB 1XXDA 1A4WH 1SXJC 4RKOB 4Q7LA 1Z6AA 2QTHA 2F9UA 4NSVA 4G5SA 3V9PA 1ZNWA 1L7VC 4OS1A 1VYVA 5BYJA 2O8EB 4K69A 2CLCX 3SUEA 3BK7A 4Q66C 2NPIA 1QHGA 5EQSA 1MU8B 3SJBA 3A8TA 1O2UA 1VYUA 5J4QA 1Z8GA 2FMJA 2QN6A 5EQQA 3GLGA 1F48A 3CF2A 3OFND 2H2ZA 1THPB 3PUWA 4IVRA 1LVGA 3QX5H 4ITRC 3B23B 1C2FA 5C2ZA 5J5CA 5AF9H 1GHWH 2V7QA 3UUZA 2GRJA 4ASUD 1T8LA 3RWMB 1SPJA 3CS0A 1DDJA 2ZHFH 1OWDA 3ZDQA 1VG0B 2ANKH 4D9RA 4BRWA 5A4JA 1MO5A 1OS8A 2BXTH 1B23P 2HJGA 3TAHA 3M5NA 5H68A 3TW4A 3F8TA 1PPCE 4ZMAH 4R0IA 3NBXX 3LA6A 4JLNA 2OCYC 2W26A 1TWXB 4NCNA 1O3KA 1LHCH 4B71A 1D9XA 4BQSA 1SLVB 3B1ZA 4BLRA 2C8XB 3Q3XA 2AK3A 2QI9C 3SNBA 3Q72A 5CK5A 1V2ST 5DYIA 1GJCB 3BTHE 5AJYA 1QBVH 3TRFA 3ODDA 2R6CA 4CHAC 4TMZA 5FHTA 3RU4T 2PW8H 2O8MA 1LPZB 1VCNA 1AGJA 3EARA 2G4TA 1TGNA 4R98A 2A32A 3LH1A 2BQWB 3SJZA 3ICEA 2ZP0H 2NTYC 2ORIA 1BKDR 4HAUA 1BJVA 2WMNB 2A0QB 5GWZA 1AZSC 5TXGA 3K0AB 4B3FX 3NCLA 4D7FA 3AF0A 4AYTA 9ESTA 2ZI5A 4RD0A 1BT7A 1YZNA 3N7OA 4PO1A 2VIWA 2OBLA 4A0FA 3IHLA 2ZDVH 2HWLB 1MKWH 3PMHB 1XX6A 1S3GA 3KCGH 4HLCA 4ZHAA 2VL7A 1C1MA 1WBGB 1VJ9U 2G8TA 1D3PB 4GSOA 2F91A 5SZHB 1Q20A 3AF3A 5J4LA 2AMDA 2VP4A 3SFVA 3QE0A 1CGHA 8GCHG 4CREA 4PC3A 4JK5A 2CF9H 2QV1A 1IQGA 1N6PA 1ANEA 4JS0A 3CWZA 4XH9B 3ZZ5A 5AR1A 3GMTA 3SGQE 3CPJB 2FEMA 3FKQA 2A5FA 5EU8A 1O2IA 1QB9A 1IM2A 4DDTA 4XOIA 1C2JA 2FLBH 2OBNA 2VPPA 5JPMH 3AEZA 3AF4A 3IIMA 4AG1A 3ESTA 2AFQB 3ZIAA 4OHXA 4CDGA 4VGCC 3CNOA 1P8VC 1RJXB 3VR6A 4TMXA 5JJKA 3GEHA 4JSTA 1RJ9B 3UWOA 3TJUA 2AGEX 3VB7A 1VIYA 2ZRBA 2Q9AA 5JRZA 5HZHA 1RW4A 1E37B 1O2GH 2MMCA 1UVUH 4CRWB 5F3WB 4Q03A 4X2XA 4V02A 4LY6A 4A9AA 4SGBE 2J95A 1DG1G 1MTVA 4IRUB 4MA4A 1W7GH 1EX6A 4UNRA 2RCEA 1GVLA 1O33A 3SW2B 3ZVNA 8GCHF 2W6JD 4A1FA 1SQAA 1BHXB 2F1IA 4QL3A 4WH8A 4BGDA 4BLQA 2VVCA 5IK2D 1HAYB 1Q31A 1W0YH 2C96A 2WSSD 4DT1B 1EX3A 3ZVDA 2VHCA 1N8OC 2NIPA 1W7XH 4GPTA 1ELCA 3KJEA 3TNSA 4JJZA 5IYTA 4NGAH 3I4LA 1C2KA 1KKLA 2WUBA 3C15C 2J94A 3GFTA 4TLAA 1ESNA 1KI2A 2P67A 4MUAA 1BQYA 2XAUA 4M1TA 5PTPA 5JEDA 1T4UH 2UUFB 3GDVA 4CF7A 1NVWQ 3KZ1E 1SGRE 1EK0A 1CJKC 2G52A 3OFNA 1HIAB 3MU5A 3A89A 1S83A 2ZU1A 1WE2A 4ARZB 1SBWA 2DYKA 1BMFD 4C0QC 3PLPA 1G20E 4Y0AA 3KUDA 3SN6A 4B3DA 1M34E 1E2NA 3AVZA 1SZPA 2WWFA 4C30A 4C0SA 1ZTLA 3AW0A 3OESA 3PEUA 3ZZDA 1GBEA 2BBOA 4NL4H 1JALA 1GHXH 1KXFA 3LAWA 2XC4A 4TYPA 2VH5R 4JLAA 3GCHC 1INCA 5DI9A 2WAXA 4Q4JA 1UDWA 1TIOA 1NBMA 2D06A 2FNAA 4ERNA 2SGDE 2FESH 2D2FA 2ZCHP 4A1XA 3A8CA 2VHQA 4KU4A 5L2YH 3QQ5A 1GBLA 4NKRA 1SLXB 4CRDA 1E9BA 1P2IA 3PV4A 4Q9JA 4MRVA 1AKSA 1Q2WA 3BFXA 2O8TA 2ZUDA 4FU8A 3I77A 4E22A 3KQUA 4DDUA 1O2ZA 3BTDE 3GY4A 2XCNA 2ZR7A 1UTJA 3BH7A 2G55A 3Q85A 4ISOA 1AU8A 1OFTA 3A83A 1O5GH 1N5LA 5BWMA 3SN8A 4X8HA 3OEEA 5DI3A 4C7OB 2AERH 2A4OA 1J9CH 3ZZCA 1C5VA 1D3DB 4URZR 5IHPA 1W47A 3M3TA 3RXPA 1CJMA 2XITA 2ONKA 2WSMA 1KO8A 4B48A 1HJAB 1AA9A 5A8ZA 2H9HA 5A0CA 4NWKA 4LJ9A 3KX2A 4FUDA 4EPVA 5LDDC 1T8NA 4Q9IA 1ZMNA 1IHSH 1QF9A 2WZQA 1OW3B 2BOHB 5J4KA 2H17A 1D3QB 2JLQA 1V2NT 2F9OA 1E9DA 3X1XA 4UFFH 1GP2A 3ZVRA 4R9UC 2GCTC 2QT1A 5CDFA 3DL0A 2CJIA 4TZ0A 2FG5A 4P4SA 1PUIA 2KSQA 5TB5A 1HDTH 1GMDG 1BBRK 3EPLA 3LX8A 4GZLA 4NYIR 1E1QA 3TH3H 4XBDA 3MWKA 3LC5A 1HEIA 2PKSC 1GNRA 2ZG0H 1CRQA 1I4TD 1FL9A 3B6EA 3THOA 2GAAA 3TIFA 4QHYA 4OS6A 3GCOA 5K7RA 2EQBA 1KXAA 1DLEA 3HPTB 2Y5GA 1BA8B 4PC2A 1RTLA 1ZSLA 2C90B 2PLFA 3E8LA 4GL2A 3B7GA 5EZ6B 2W00A 2P59A 1JRSA 2QQEA 4B76A 5EZ5A 1NSTA 4CZ2A 4JZEH 5C1BA 3BEIB 3E0NB 1E32A 4DVAU 2ANCA 3CZPA 4YZUA 3MUFA 1SGIB 2DBYA 3HU1A 3LQQA 3LY5A 1ZYOA 3TJVA 4Q47A 3VR2A 4JCNA 2VRWA 2NU4E 2CDNA 1E35B 1T3SA 1F7ZA 4P32A 3RC5A 2W0SA 3GDSA 1L4YA 2ATVA 4EJSA 1W4AA 3MOCA 3LW7A 2PSYA 1V5WA 3JZ1B 1W48A 1MQ6A 1G3EA 1S0QA 4US1R 4YMUA 4HTCH 1ELGA 5GJWC 3U1JB 3L8YA 2GZAA 1GGDC 2LWIA 2QY0B 3RXSA 5L30H 1AWFH 3E3TA 3CBQA 3R9XA 2GX4A 3IILA 2GK6A 3PMJA 1YZGA 2CVHA 5AUPB 1O39A 4K8BA 4JYUH 4NCYA 5DJ7A 4TY6A 4WZBE 2FMXA 1GITA 1U98A 2OFXA 1G1MA 4HATA 2VWOA 5EE1A 5K8TA 4JBWA 2GJ8A 3A87A 3RXTA 1OWKA 4NONA 4ABFA 1DVAH 721PA 4KODA 1SFQB 1E1QD 4NA8A 5ETXA 1V2MT 1QJ7B 2EU8A 1P3EA 4Q1AA 1GRRA 1ANBA 5E8EH 1FY5A 5FFMA 1S6FA 2TGTA 4N1AA 1XM1A 4URXR 4TL6A 5B57C 1SL3A 2DE9A 3ZVCA 5L3QB 4LYAA 2WWXA 2Z9LA 1IQEA 3ND8A 3LBHA 3A88A 1ZZZA 3TVJB 3VKHA 2PEYA 5EGMA 2GT8A 2FXRA 1C9PA 2J41A 2X19A 1KI7A 1ELEE 3H5CB 3KFVA 2GCPA 2RKOA 4Y8XA 1CF4A 2EWVA 2YWFA 4OHYA 1NJFA 4WZAE 4NA9H 4BASA 4KCGA 3EX7C 2AWNA 2H1LA 5J47A 3BIFA 3QNUA 2Z5FA 1F2TA 1SVIA 1XMJA 4KP0A 2BDAA 3KIDU 1VYTA 4U00A 3M5LA 3EA8A 8ESTE 3BG4C 3UATA 3E0PB 2V1XA 3D8BA 4XWKA 5CM8B 1UKZA 1FOEB 1S0RA 3OHMA 4LGMA 2IXFA 4XTCS 2F9PA 3O8BA 4QOSA 3BIUH 5H1YA 4PQYA 3H7TA 1MT0A 1BCUH 4O03A 5FTLA 2YC2C 1OXGA 2PZFA 4IMQA 2WJGA 2WPLS 5FOWA 3NPSA 4YQFA 3UIEA 1E2DA 2GEVA 2XB2A 5CB6A 4D4KA 1F2UB 1HXEH 1J70A 1J8MF 2ZFPH 2G4UA 3RXOA 3I3SR 1GHVH 5EXSA 2GHIA 4MITA 2EFDB 5HCNA 4WY3A 2REBA 1ZUHA 4GI7A 1LO6A 5GJ4B 1U2RA 2YC4C 4TSFD 1XUHA 4D0NA 5HE8A 2ZDKA 5JBQA 1A7SA 1VZQH 1SXJE 4BFVA 3QXJA 2ZS8A 1ABIH 4PQFA 2PLXA 2QAGC 3ZQJA 4ABAA 2Z4RA 3H7OA 1IN8A 5BW8A 3B85A 4OBEA 4XTRA 3FP6E 2FPMA 4FMCF 3U6KA 3BTFE 1LNZA 1E9CA 1AUTC 1GDUA 1H8HD 4P4SB 4IJMA 1OIWA 1GUAA 2VSOA 1XEXB 1MRNA 1MCVA 1DO0A 2IYUA 2BD8A 1Q21A 3K1JA 3U8OH 2NU3E 1ARCA 3FZZA 1BITA 4X1SU 3EYDA 3NC0C 4HDQB 5JEEA 3T1QA 1QHIA 4TWZA 1CT4E 1G41A 3B1YA 2AK2A 2RH5A 4TYYA 3JZ2B 3REFA 3NHAA 5DGJA 4TPIZ 3U61B 5DGXA 1AO5A 5G41A 2XW9A 2QTVB 2CK3A 1PJPA 3BE4A 1OP0A 4ZKNU 1HAXB 4SGAE 3GJ4A 2FZ4A 3TR5A 1A5TA 1CGIE 1NVVQ 1OFHA 1EP5A 2ZZUH 3TBKA 1TAWA 5JWOA 1ETSH 1OYTH 3X1DA 2GDJA 3DHWC 1KZ7B 2FOLA 3QKTA 1GHBG 1HIAA 1D9ZA 1Y5UT 1R5OA 3PLKA 2JEOA 1KIGH 5CJ2A 3ZZ8A 2BD7A 1H8ED 4XD7D 1T32A 4AYXA 4FCWA 1IY0A 4DXAA 2V6IA 5DP9A 1KK2A 2ORWA 2C98A 1H4WA 1MABB 2OBOA 1S3SA 2CL7X 3CO5A 4H1UA 5AFZH 2QM8A 4YMVA 3SOPA 3V4RA 4TYDA 1IQLA 1W46A 1JR6A 1C4U2 1SGPE 3L2OB 3Q3YA 2V6NA 4PR0A 1SGTA 1H8HA 1B7XB 1D4PB 1KYNA 4ABIA 4K46A 4Z6AH 1V3XA 2YOFA 3ZZAA 3GY3A 2IUUA 2VH6A 5GJBA 1VGCC 1CJTC 4US0R 3NWJA 3E1SA 1ZC4A 5JRJA 3MCAA 2GCHG 1F5KU 2QAGA 1Z1JA 1Y3WA 1GBKA 4WW0A 2A2QH 4LC1A 1A82A 3W8NA 5LB2A 4G3XA 4ARZA 4L5BA 1Q3XA 2ZFRH 1PLJA 1SOTA 2WSSA 3RNLA 4G01B 4B2PA 4X1QU 2FIRH 1AQ7A 2FX6A 2FM2A 3SHCH 4NIVA 3HK3B 1CXZA 1WYKA 2ZJ5A 2ODQA 2FDAA 1ZBDA 3GQBA 1P9WA 3DZDA 1YZKA 3DFJA 2Q9BA 2BCJQ 1IN4A 3V7TA 3P27A 4AG2A 3MLEA 2BJWA 4K2YA 1S1MA 4M9SA 1MAYA 3FMOB 2G0TA 4MNVA 2B0FA 4PROA 4I1UA 3IPXA 2VIIA 3PFIA 3K9LA 1GJBB 1EATA 4W5WA 3DFLA 3EW9A 3A37A 1T4VH 3AP1A 1C5TA 2H16A 3SV2H 3LVQE 1M9UA 4PO9A 2J59A 3U3KA 2EYQA 3GICB 3EQ0H 4LBWA 3NTUA 4BANB 3U2QA 1EZSC 2QP9X 4JVSB 2H5DA 4DG4A 2BVXH 4CEIA 1MKXH 2GCHF 2JLRA 1V6DA 3C16C 1P2UA 1BJUA 1RRCA 3NZIA 4NYJQ 2ZJ8A 1CBWB 5FOUA 1DLKB 2WJHA 5E7IA 3MH5A 3KKMA 1GBMA 5B6LA 2YV5A 3SFZA 1KXCA 3OY6U 1W36B 1LW7A 3EPKA 1GWNA 1HBTH 3U4QB 5E0JA 2XC0A 1NKSA 2JASA 5DYGA 1MKYA 1OWEA 1Y3AA 1GI9B 1ZW6A 5B58C 2P94A 5HE9A 1TQ7B 4JSYA 4JLVA 1ZCBA 6CHAB 1LF0A 2BDIA 2VU8E 3B9PA 4ABHA 4M1OA 1TTTA 5JJIA 3F9EA 2W7UA 1EAWA 1SVOA 1GHAG 3MWJA 2P0EA 1XCMA 3NBYC 5G3YA 4I8HA 2BC9A 2BDTA 5L2ZH 5FCKA 4DLZA 1E0AA 2IC5A 3KQEA 1IN7A 2WPDA 1UJ1A 1GDDA 2ZETA 2F1HA 4LPSA 1XTQA 4MGZR 5EE0A 4TYQA 3SORA 2BD3A 5L3RA 3A1UA 2AGGX 2WUCA 4NMMA 3SUFA 1XD2B 2BHRA 2OXCA 2UWOA 4TT3A 1IQPA 2YWEA 4H42U 1WBBA 1V2LT 3WYGA 2A4QA 4B2AA 4LJ7A 2Q21A 3C14C 3SJIA 3SJKA 1UF9A 4JVMA 2FOHA 3MAAC 1BRCE 4NFEA 1VITG 4BEBA 3KQNA 2BX3A 3PTNA 2XXAA 5J40A 4B35A 1O3OA 4XSKU 2VWLA 1UK2A 4J0QA 4HB0A 2WOOA 5DSZA 2RGAA 4LYFA 2BMGB 4B6FA 2W58A 1ANKA 1EFHA 1KDRA 3RS4A 9LPRA 2ODWA 2QUZA 5TVKA 1FUKA 4GMXA 4PC6A 1QRXA 4WJG2 1EFTA 2CCKA 2P16A 2ZDNA 1O2TA 2DHRA 5EXTA 2J87A 1KK0A 3TR0A 4Q7XA 5DP4A 3QKRA 3CH4B 2O8FA 3SS8A 1T8MA 1G19A 1BDAA 2F1JA 4UNNA 2DFTA 3LDXH 3VGCC 1ZUIA 3UY9A 4Z1MA 2R2MB 1U0HC 4C0KA 1D9IA 1G291 4I32A 4N0EA 3T1OA 1PLKA 4NYMQ 2C3SA 4YM9A 1YZLA 5C3NA 2RGEA 4H9GA 2VB0A 3GLGB 3SHWA 1N25A 2C77A 3TPIZ 3PTBA 1COWA 3CPEA 1NTPA 1KLIH 2C9OA 1E98A 1IXSB 7LPRA 1OYWA 4ZI3A 2IHBA 3KQKA 1WQVH 5IRCD 7GCHG 2A5GA 1MABA 2D26C 2IJOB 4I33A 4BTIB 1Z22A 1D6WA 2N46A 3VX3A 7ESTE 2OP9A 5JBBS 4YLUA 4FCVA 4KLNA 2WIBA 2J5XA 1GBAA 3SQWA 1FQJA 2OAQ1 4I8LA 2ANWA 2WYGA 3TH4H 5JI3E 5M04A 1BTYA 1S0UA 3ADCA 4XDEA 4KXFB 1W8BH 1Z6XA 1OIXA 3CP7A 2XBXA 3S1AA 3QPUA 1Q3HA 1G4UR 4LBVA 1MO4A 1RTKA 3ZYDA 1VIAA 1L8QA 1NN3A 5ANRB 2O8CB 3U98H 4THNH 2ZECA 2G81E 4II7A 3BH0A 2A5DA 1IXZA 1NG1A 4IEEA 4PHGA 2Y7XA 2IOTA 3QVUA 4H1VA 1V2VT 4L16A 2ZREA 3B13B 1O2PA 1ANDA 3A7XA 4C7OA 4Z0KA 5J4SA 3ZJYA 1GG6B 1GL6A 1T6NA 2B8WA 4X1RU 2QNRA 4AWXA 5C46F 4A8JB 4V0OA 4BZQA 1HYLA 2KBEA 1XFAA 1QHHB 2GXUA 2FOAA 1UKYA 3R8CA 3BB1A 1GVNB 4AIIA 1O31A 4HGCA 3KQDA 3CS7A 1C5OH 1O2MA 3V0XA 2EWWA 1C5UA 5JCPA 3E91A 3CB4A 2ZRIA 1NBMD 4MYTA 1P01A 5DI3B 4INHA 3KKQA 3SNDA 3T12A 3AVTA 6GCHF 4Q7ZA 3KXIA 1O2JA 4AKIA 4Z1MD 3RRMA 1Z07A 5JJLA 2ANMH 1TNHA 2WV4A 2H9TH 1PLLA 2R9VA 5FUVA 1E9AA 3IBGA 2VJ1A 1XTIA 3SHAH 4CVNA 1F60A 1A2BA 1YPHE 2OC7A 4X8OA 2A5IA 2ZPSA 4RKEA 3LH5A 3A7ZA 5JFGA 1TGBA 3REGA 3DPUA 3F1SB 3T27A 1COWD 5E0GA 2VGCC 3E6PH 2GEDA 2AYWA 4YOIA 1LHDH 3NC1C 2A5KA 4RD4A 2WWHA 1SSXA 3SU6A 5JBAS 2C04A 1WBDA 4IGDA 3QKRB 2YOGA 4KV9A 2GCOB 2X1VA 4LBYA 1XXFA 1GCTC 1KK1A 4Q7KA 2SNWA 2AX4A 3N70A 1OFIA 2GESA 1ELFA 2GTPA 1TBRH 1DG3A 1E2FA 1G17A 4X8VH 1IQKA 1KI8A 1OWHA 1Z29A 1L1JA 4BEJA 1KI4A 1W11U 1ZOMA 4JL6A 2IYWA 3DUXH 1OHHD 1FN6A 3GDUA 4FMBB 3BC1A 1XTRA 2JAQA 1C1SA 1XF9A 1UVSH 1GPZA 2UUJB 3ZS9A 2GAOA 1EZQA 4O3UA 4QHTA 5EE5B 3H84A 2THFB 4TLCA 5FUWA 1E1RD 2ZA5A 4QC2A 3E2IA 3RXHA 1QRWA 1CHOF 4AFSA 1QB6A 2C8ZB 1GAJA 5E7MA 5HMAA 2GV7A 1BO6A 5T1VA 2ZRPA 3MNBA 2FPLA 1OH6A 1MO6A 3EAJA 2EI8A 4Y0YE 1NMYA 1L2EA 3SHFA 1T5IA 3A81A 5FOXA 1W2HA 5FAHA 3UFAA 1GNPA 1LVYA 4QNRA 1IOZA 1TX8A 4YT7H 3DOFA 4TL9A 4EPWA 3PO1B 1X8KA 3N2IA 2CE2X 2ZSFA 2OT3B 1E4VA 1Z47A 3DHKH 5FTNA 2AMQA 4WH6A 4ESHA 1HYQA 1HAVA 2ODPA 4WXIA 3B1VA 2G6BA 5B2ZA 1YPGH 5KDDA 2Z0MA 1LQEA 4LHZA 4BFUA 2XOKA 1NY6A 4ZCMA 4PXAA 2ANYA 1MTSA 3EIHA 2HT6A 4JL5A 4N0DA 2GCNA 2Z9JA 4DJZB 3GY5A 1MU6B 1KJZA 1NN5A 1G3RA 3TSWA 1G8GA 4CR5A 3SU5A 2ZRJA 2XC5A 3BTKE 2OCAA 2GILA 2IWHA 1BOQA 2PMDA 1QBOA 1BBRH 2VF8A 1CRPA 4S35A 1UTQA 4JIMA 1AJEA 2X8AA 3RU4D 1WB9A 3HPQA 5EXXA 4B44A 2R6AA 1KY9A 1VG8A 3CKLA 5SZKB 1XWIA 3MU4A 2QBYB 5CM9C 3HYRA 1KGDA 2GZ9A 2FDCA 2AFHE 1PPFE 3GFOA 2JJ2A 4V0KA 3HU3A 5KSPA 4LC0A 1ZUNB 3KL4A 1SHKA 3THYB 2G3YA 2D7DA 3R20A 4O3MA 3C7KA 1GI2A 4RN6A 6GCHG 4OL0A 1EAUA 2J9NA 2GCOA 1C1YA 4OHWA 1V2OT 3K09A 1YR8A 2DFNA 4P33A 2FOFA 3SI7A 5TV2A 2XGJA 4A8JA 3A8AA 1C5RA 2VEDA 4QM6A 3MMPA 4D76A 3PUYA 2O5VA 3PMAB 4W5HA 2QL6A 1ZD8A 2OM2A 3B8JA 5I46H 4ZKEA 1JAHA 1N6HA 4OQLA 1ZSKA 4MG3A 1IJFA 3BB4A 2ZE8A 5G53C 4LXBH 4O2LA 1O5CB 2DFKB 1S9DA 3VB4A 1L4UA 2IPHA 1AVGH 3BSQA 1KHTA 1XX9A 1TUIA 2ZJ2A 1IXRC 1OSSA 4DSUA 4ABDA 1RYHA 2J7PA 1PPHE 2J0VA 2E87A 4PC7A 1HFDA 1GVZA 2E1RA 2C93B 4UFEH 3LU9B 4WMEA 2BLVA 1E99A 4DGJA 1I2MA 2B8TA 1G21E 4FMDF 1WCV1 1EOJA 4JKIA 5DIFA 1PZNA 1RIWC 2P5TB 3FMPB 3QZRA 3O47A 1VITF 3CW2A 1C1WH 3P8OA 1D2MA 5FR1A 1SVKA 1ESBA 1XP8A 3RVBA 3PWBA 1R2QA 2F43A 5EQTA 1G3MA 4O9VA 4YOGA 1C4OA 4I8GA 2GNOA 5KNDA 2YOHA 4URYR 4KAXA 1LTOA 3ZVMA 2A7HA 4A36A 1AS3A 2G1JA 1UJ2A 3W95A 1BIFA 4MKHA 1LMWB 1XEXA 2A7QA 2Y5FA 4RCZA 2JH6D 3Q77A 4FW9A 1O35A 1TMBH 2W3IA 1QHHA 2AFIE 2ZSAA 4CEHA 2FODA 2O8CA 4CR9A 1W49A 4KYUA 3BH6A 3I8SA 3PUZA 4DCNA 2WWWA 3UKDA 3FVFB 3TJZA 8KME2 1XXHB 4AURA 5KYKA 1P2JA 2R3YA 3H2YA 3T5DA 3WRXC 2BLWA 3HGPA 1G7SA 2PLRA 4XFQA 2AN9A 1BB0B 3W3AA 5IK2A 4E03A 1Q3TA 2ODNA 3KXKA 1O2WA 2FEQH 1SXJD 4PZYA 1GBTA 1W10U 1YPEH 2R2AA 4YT6H 3TITA 3LFUA 3S1AB 1OXSC 2HF9A 4Q9KA 1LVMA 2XWBI 3K2UA 4ISIH 4AFZA 2QAJA 4CBOA 1KLTA 4TWWA 1OP8A 2FI3E 5FOTA 1US8A 3AVUA 3K0CC 1KMHA 4IDHA 2F83A 3TKLA 4V0NA 2ZI7A 1AE8H 2Q3MA 1IHTH 1C1OA 3VR4A 2XTMA 3M4YA 4IXMA 2DWOA 2V1UA 1S6HA 3THXA 3THWA 1G6HA 3PO1C 3GEEA 3P20A 4LV6A 1CE5A 3EZFA 1WDTA 2C8VA 2J34A 5K0HA 1LKAA 1CS4C 2AIPA 4C0BA 1MR3F 2YOLA 1G2LA 3B2EA 3P6ZB 4V0MA 2IHYA 3FHOA 2C03A 1H9IE 3ECCA 1YPJH 3MU1A 3ZZ4A 2BQ6B 2ZYWX 1C5QA 1EG7A 1NC6A 1UTPA 2QN5T 5L6NH 3PEYA 2CMYA 1NL3A 4JZKA 2ASUB 4L9SA 5DN6D 1FY3A 1O3LA 1LKBA 1MBQA 2ZIAA 2OLJA 1F2UA 3DO6A 1XMNB 2CHAC 1O3DA 3LLMA 1F92A 3F68H 3T34A 1UEIA 2W5EA 1W1WA 5GADl 2D62A 2A2XH 1QJ6B 3OAAD 4IC5A 1C5ZB 1Z8JB 1C1UH 1R0ZA 1E2JA 3GJ0A 5AJXA 3WYAA 3ZZTA 3UTUH 1G3BA 5HZKA 4QBFA 1C2DA 3KKPA 4AK9A 1EOLA 2V3HH 3ZV8A 1OSNA 2OTVA 4LJAA 1K9OE 4Q80A 1F2TB 5CHAC 1JWTA 2ZHWH 3QPWA 4NG9H 1H9HE 2OK5A 2P6UA 4MNYA 3U4QA 1CJVC 1N0UA 1XUJA 1NG9A 1UFQA 2Q3FA 2TPIZ 3GJ5A 1X6VA 3SNHA 1CR1A 2JH5D 3L0IB 4NSYA 5D3MB 2H1UA 3LRPA 1ARBA 2ZO3H 3IO3A 2WJIA 5DHAA 3ZLJA 2P93A 4EKDA 2PGQB 4M1KA 2ZIQH 1O2SA 3QG1A 1E2HA 1SR5C 4TQ9A 1K2I1 4A1VA 5D3MA 5ABWA 2BZAA 1Y3XA 1H8EA 4OGXA 2VHTA 4ISNA 3M5OA 1I2DA 3W94A 1T31A 2G0NA 1EPTB 1SGFG 1UK3A 3CF6R 2CJWA 1AZZA 1JI0A 4K1TA 1GILA 3PQCA 3K0AA 1JIMA 4K1SA 3AAUA 1HAIH 1E2GA 4MRSA 2ZANA 2Y81A 1ZRHA 2ZVPX 4UE7H 4ZO4A 5GDSH 2GF0A 4NH0A 1A4RA 2QA9E 4P4TA 1KNXA 3CONA 4IW4E 2Z83A 1Z6JH 4IOLA 1Z0JA 1DSUA 1EUFA 3K0FA 3K0SA 1EFCA 2TGAA 3VB6A 3QXHA 4DUGD 1O2OA 4Q00A 2FO9A 2ZPQA 2IA5A 3F6UH 1KK3A 1UCYH 5SGAE 1GL7A 5C20A 2AD5A 4Q7JB 2VP9A 1W2GA 2GEUA 1G6OA 2NWNA 1Z0KA 2I6QA 3QOFA 5KSZA 1KLJH 1TNJA 2EEKA 4HLUC 2NOAA 2GA8A 8OHMA 4HZUB 2GVFA 1J16A 2ZJZA 2Q0HA 1UVTH 1AHTH 1XEFA 3FPAA 3G01A 2XXLA 3ZZ0A 1YCPM 5HM9A 1XCPA 1AE5A 2ODYB 1O0DH 1LHGH 4UQOA 5FX6A 3TK5A 2PHBA 4RKJB 4NU0A 4Y0VA 1C1RA 1LVBA 1UHBB 3BTWE 4O0MA 5D3QA 5DLQC 3AVWA 3TH2H 3ZVLA 1SHHB 3IQWA 4LV8B 3TQFA 5A8YA 5C67A 5EPNA 2AEIH 1KI1A 1Z6TA 2WWYA 1OB2A 2QMOA 4F38A 1P04A 4QXAA 4DVGA 1DEKA 2GMTC 3TSOA 2YNMA 1TMUH 2Z43A 3ODFA 3RABA 1K1IA 3OY5U 2SGAA 5DISB 1JAIA 3RMNH 4C2TA 1HV8A 1OHHA 4S2EA 5BQ5A 3TUZC 3MU8A 4LDJA 5LD2C 2F7SA 2Q9CA 3VKGA 3VX4A 1C2GA 3AVPA 3RRYA 5DP8A 3GLFB 2PT7A 1HLTH 3KEEA 4GHQA 3OEHA 3SZRA 3X1YA 1KY2A 2AD1A 3HU2A 2FLRH 1O38A 1CA8B 3DVLA 3IUYA 4M0LA 4HLUA 1WRBA 2HCJB 3ZIAD 3D23A 3AVQA 3LONA 3PITA 1EP6A 3IO5A 1FTNA 1Q1EA 4OM9A 3QENA 3S7HB 3SYJA 4XIGS 1IQIA 3DD2H 2AIQA 2JETB 1ZMXA 3T1VA 4PSKA 1ZTKA 1XMIA 4ZKOU 1OIVA 3EA5A 7GCHF 1R5BA 3DT0H 1OKKD 2BEKA 3C8UA 3C27B 4DW2U 1QL8A 1BMLA 1ZNYA 3AGPA 1TX6A 5FOSA 2H92A 2QEQA 5F8XA 4B3CA 1D8TA 1T0HB 1ZM2A 4Y0ZE 1QBKC 2P3FH 4AB8A 2FWWA 2HPPH 3M6AA 3I32A 1QVRA 2OXRA 5DK1A 2FP7B 1YRAA 4DEXA 1ZHPA 1IONA 3UANA 1V43A 2NPFA 2F6RA 5JBCS 5FOVA 1QURH 3W9YA 4TT3D 5JWHA 3U5ZB 6ESTA 2Y80A 1K1MA 5HKKD 3ZZ7A 3I5YA 1HT2E 4UNQA 3P32A 3STJA 2XYAA 3PEWA 2DE8A 3A7WA 3TQCA 3M0EA 1WTHD 1PPGE 2VTKA 2BLOA 1IQJA 3SJCA 3P8FA 2BX4A 5A0AE 1OH7A 1J7KA 3ZS8A 3T5GA 3MH6A 3F5FA 4TL8A 3EPJA 4AKHA 4G5GA 4EQ6A 2FEOA 1DY9A 2ZTZA 2A1DB 2UVQA 2X77A 2WPKS 4MLFB 1KSFX 4D7GA 2F3RA 1EJMA 2STBE 3LNCA 2IS2A 3WP0A 2F43B 5FUYA 1KDPA 3VR1A 1TOMH 4DHEA 1DAFA 1P57B 4F4IA 1XTKA 4JBYA 2ZCLP 4NIWA 1OPXA 2YJTD 5GPIB 3RXQA 4A1TA 1SGCA 2D3WA 2XSZA 4LK4A 1DUEA 3QO6A 2V8OA 4F4OC 1CR2A 2J92A 2KWIA 1LQDB 4BLOA 3DZ8A 1MTWA 5B6OA 4V0ME 1Y5BT 2NO9A 4DJTA 2VYFA 2BV3A 3U44B 2RCNA 3A7YA 5KTYA 1FUUA 3VR3A 2TGDA 2A4RA 3TGIE 2OLGA 1GIAA 4MYUA 5CYPA 2GD4B 4A2PA 3JVVA 3QXCA 3LJJA 1O5AB 4WVPE 5FTKA 4TLBA 5CHAB 1X1RA 4H4FA 4NYMR 2KAIB 4UEHH 5KO2A 1GNQA 3KTAB 1MH0A 1A0LA 3QIAA 1MOZA 1YRBA 4X1NU 5FL7D 4B3GA 3PYHA 1KSGA 1NT1A 4QNMA 3ZV9A 4TTPA 1FPHH 2R62A 4EIWA 1ELTA 3EXAA 1OH8A 1HNEE 1XUKA 4B75A 3NK8A 4PHFA 1EB2A 5JCZA 3B60A 1SKYB 2PUXB 4KYIB 3E90B 1V2KT 3K70B 1JPNA 1HCGA 1AY6H 4MUBA 1GBHA 5TCCA 4ZXXH 4AKGA 5BN5A 1NIPA 1AN1E 3EZ6A 4J1YA 1HE1C 3ZZ6A 1TPOA 5GXPA 1W0KA 3GLHA 1J17T 1GL0E 5EXLA 4Q1BA 221PA 1GJ9B 2XNDA 4KGAA 1TGSZ 2XXAB 1J99A 3I29A 5FBVB 1C1TA 5KPDA 3IEVA 121PA 1DAMA 3EC2A 3H4MA 1FY8E 1AFQC 1ZINA 4LOYH 1V2JT 2VSXA 1RRKA 5BPEA 2OZEA 2XBWA 2BDCA 3PUXA 2GZHA 2IUSA 1U0LA 2CNWA 2A5JA 1E36B 3RLWH 2V7QD 5J4HA 3IEUA 1KY3A 5AUNB 2RA3A 1IN5A 3VB3A 1Q1QA 2F3TA 2FS9A 3B9QA 3FE2A 1KKMA 4FD2A 5GIBA 4IOKA 5H70A 3SI3H 1WXRA 2BKEA 4BWYA 5LPRA 4NTZA 3CM0A 1YPKH 4XJXA 3ZYCA 2B7DH 3R0FA 3LXRA 2HF8A 4U2WA 3PROA 1ZGVA 1DTSA 4WMDA 1NLFA 1QHYA 4HZHA 2CE7A 2KBFA 1T8TA 4DLTA 2IBMA 2MSCB 2Z3CA 4X8SH 1FW6A 3LGWA 3JZAA 1G64A 1TAGA 1F6BA 1KSJA 2WINI 1PPEE 3V4FA 2ZWLH 5AJZA 2RHMA 2H5CA 1ZM4A 1NNEA 3R8FA 4X8UH 1NMXA 5E3HA 1A7JA 1P11E 1SXJA 4BPBA 3AP2A 2GK7A 1WUNH 2BD2A 3QBTA 4L15A 4EUNA 1W5TA 3RXEA 4BZPA 2X2EA 2FX4A 4AFQA 3FDIA 3VR5A 1FY4A 1GI5A 2RGBA 4KFTA 4BFSA 4DEYA 3LT3A 2P3UB 1JR3A 2VH0A 3D65E 3C5CA 1RXPA 3CH5A 1KI6A 2EI7A 2OUAA 3Q9LA 2BM0A 1HAOH 3TUIC 4Y71A 1IHUA 2XSZD 3UR6A 1KMHB 1N2CE 1WF3A 2SGQE 5E4FA 3CRMA 2F9MA 2QPTA 1U8YA 1RGQA 1K28D 3IITA 2OBMA 2R0KA 1EWQA 5C1XA 1KYIA 1TNIA 1N0WA 2DWQA 3LD9A 1YVDA 3E70C 4EJSB 1Q0UA 2MSEB 5FPHA 5LD2B 4YESB 3DA9B 4MNWA 3W6PA 4JYVH 4JLMA 1ZLRA 4CRBA 4DLWA 5A0BA 1DICA 2ZU4A 1IY1A 1JB1A 1GRQA 1US8B 1BTHH 3IPYA 3A4NA 3SUGA 3T62A 4BXSA 1E96A 4ZROA 3ATMA 3MWYW 3U69H 2O0KA 1C2HA 4UJ3A 3BTTE 1V2WT 5KOYA 2GVZC 1HAPH 4DKXA 3AAVA 3VGCB 1DUAA 1AZ8A 2A5AA 3A80A 1E0KA 4KTCA 1PQ8A 4EQ6B 3BB3A 4AKEA 2QAGB 3UOPA 1CT2E 3RXJA 1XTJA 1MBMA 2PT5A 4R7ZA 1NKTA 3IIKA 3TAUA 3GCTG 3BS4A 3QTOH 3BFKA 1BRUP 4PPFA 1NFXA 2CMKA 3QBVA 1DADA 2GJ9A 4HUQA 1JBUH 1FIZA 1AI8H 3UNSA 4XVRA 4LJ5A 1ESMA 1YGCH 1Z28A 3U7HB 1Q57A 1PQ7A 2WYJA 2OINA 2EVWX 1NVXQ 5EE9A 5LBIA 3BEUA 1CBUA 4PHTA 2HEIA 4ZDJA 1L4DA 3MGCA 1C9TA 1P75A 2A78A 4AN7A 3P4XA 2FTLE 5C2JB 1SG8B 1IJEA 2A7JA 2QXIA 5F8ZA 4I1VA 4MGIR 1MD7A 1O3IA 2GBLA 3CZQA 1II8B 4ZAEA 1DAKA 4LK2A 3P8GA 1G37A 1Z6GA 1BYUA 3A8DA 3W5JA 3RC6A 4PFSA 5IT5A 4OS2A 1N6OA 1E0FD 4M9XA 5DP3A 1XB2A 5L3SB 2IN2A 2DUCA 1RD3B 3AVOA 5BYKA 4RZUA 5I25A 4KFRA 1W2KH 1JPJA 1C5PA 1DM4B 4X6OA 4O25A 3A1VA 1TLDA 3SO3A 4ESTE 5GNDA 1RE0A 1DWCH 1A2KC 3TMKA 3EGKH 3TLOA 2OCPA 4G5OA 2WV9A 3SZEA 1I4DD 2ZJBA 3WMFA 4OKSA 1HAZB 3URCA 1KI6B 2JATA 1YLCA 3VMFA 2RA0A 3T5FH 2ZRFA 3GLIB 3ADKA 2JKHA 1D2EA 4IW3B 4D4LA 1TNLA 2QTFA 4YTAA 2R8RA 1LS6A 4FUIA 3HATH 2FOBA 1C2EA 4QGHA 1D2NA 2RDLA 5KNCA 5JLJA 1BMNH 2YINC 4HAXA 5JI2E 2B6HA 1BIOA 3QWCH 4QGAA 2BYAX 2J46A 3QLPH 2RAPA 4JYCA 2V54A 4OGYA 1HH4A 2GJAA 2VIDA 1J90A 1M7HA 4DB4A 1OT3A 3OTJE 3FYHA 4URUR 2HLCA 1OB5A 1WAYB 1DVRA 1RRPA 2OC0A 1NU7B 4TMWA 4DCDA 1O87A 2W2VA 2IUTA 1ZGIA 3OIYA 2V3CC 5JBTA 4OJKA 2BM1A 1XPOA 5FBIA 2D4HA 2IT1A 3MWLA 1BTXA 3UXMA 5FBQB 4M53A 4UFGH 2O8UA 1DANH 2O8LA 1GL1A 3PG5A 5AUQA 1JJ7A 1T3LA 2BD5A 2GJSA 1KDQA 4M1SA 2RGXA 4QJ5A 4F4JA 1LHEH 1NBME 3SJOA 3FGNA 1CO7E 3A6PC 3MI4A 1MUEB 4JMPA 1TA2A 2NU2E 1YPHC 4K5ZA 2TMKA 1VHLA 2ZRLA 1H9LB 3FP7E 2ZRCA 2YNAA 3T1TA 2GT7A 2VWNA 1DE7H 1OLOA 3C41J 3UMRA 3QF4A 4BFXA 1VITH 1MTUA 1K1JA 4LPKA 4J2YB 4OI0A 1J2JA 2G9NA 1CGJE 1WXQA 1SC8U 4B2CA 1MQ5A 2IYZA 3CRRA 1R8QA 3UOUA 3VQTA 1GJ4H 4GDFA 5KSYA 2TGPZ 5DP6A 1C1QA 2C5LA 1A0JA 3QTVH 1TGCA 3S7KB 3DKVA 3STIA 1YLDA 2JETC 4Q19A 4BLTA 2GCTB 1O2LA 1FX0A 4CH8B 3RSOA 2GTBA 2O8BB 1ZR0A 3W6OA 1GMCF 1DWBH 1RVDA 1SQTA 4KBFA 5SZJA 1JMOH 1ZC3A 1C5WB 1HPGA 2ZU0C 4QT8C 1PQ5A 4DOQA 2ZRDA 1V2RT 5JHHB 1KZGB 3RAPR 1RC8A 1D6JA 2O8BA 4OK5A 2FFQA 3LOXA 4CH2B 2ZKSA 4EJSC 1OXTA 1E79D 2R6DA 1TPAE 3L82B 3H09A 4ABGA 2ZYTX 4D80A 4X2YA 5LH8A 2OCBA 4MRRA 2QXJA 1RKBA 1O3EA 3M35A 3RC4A 1GJ6A 1KDOA 3PXGA 2BZ6H 4QGGA 2ZNKH 1UADA 1QRAA 4Q1CA 3OX7U 1F0SA 4R8TB 4PAQA 4A82A 3THXB 5P21A 1P4SA 4E05H 3T06B 1G7TA 4ZKSU 4Y11E 2ZHQH 2NU0E 2WV5A 2J0UB 1K1OA 3C4JA 1XVOA 3SUDA 1NN0A 4P0TA 1E38B 2VIOA 4JVLA 5IDVA 2VP2A 1YKSA 2P8OB 3ATKA 2ZU2A 5C1UA 1U0JA 2FI4E 8LPRA 2IYYA 3GCHB 2QENA 3FP8E 1P05A 1XEWY 1Z6YA 4DZZA 2BWJA 1ZU4A 2ZE5A 4MKIA 3O8RA 3BXZA 2K5UA 4PQRA 4JYTA 1BMFA 2ASEA 4B2BA 4LBZA 3AQ4A 4C0LA 4MGYR 3UMFA 3UQOA 2A3RA 3PVSA 1P06A 2PTCE 2BOKA 1NMZA 1KJWA 2JJ1A 1BTPA 3UNQA 2CXXA 2AGIX 3CX7A 4AGJA 3SDZA 4GOJA 4ZIRB 3EG5A 2HLDD 2CEAA 2QT0A 4AY2A 3CIOA 4W7SA 2O8EA 1GBCA 4B1TA 2W3KA 4BE7B 4E07A 3KN2A 3QEJA 2FSFA 1NROH 1TYNA 4US2R 2QC2A 4K1EA 4OQNA 4YDHB 1EFRA 1G16A 1CU1A 4RFSA 2G5NA 1P12E 2ZITA 2VINA 2IS1A 4ZV4A 1TF5A 1KO5A 3SGBE 1SHYA 5F2EA 1MZAA 1XBTA 2BHGA 1KO4A 2ZRMA 1S82A 4FVDA 2ZSBA 1NRRH 1QQUA 4WAUA 4JLBA 1U90A 4BECA 3EA7A 3RXDA 5FL3A 3CF0A 3W90A 3GCTF 1C5MD 3ZZBA 1E69A 5C4MA 4Q4AA 3MH7A 3MJRA 3SBKA 3CX6A 4YOJA 1E79A 2QSZA 3EWAA 1XZPA 1N6RA 1XD8A 2JCSA 4U5XA 2ANBA 1SGDE 2XTNA 1UVOA 4HSEA 3RUOA 2CF8H 1K1PA 5ESBA 1XJ0A 5HCIA 3L0PA 1HTWA 1A3BH 1K8RA 4DCVA 5DO9A 4QBHA 2CBZA 4YLGA 2NZJA 1G5RA 4PPNA 5E95A 4DUGA 4X2VA 4M2LA 2PV9B 2ZCKP 3AKYA 4FI3C 4D25A 4YXWA 1UCYK 3TK6A 4BAMB 1AVWA 2IXGA 4UXJA 1MAXA 4BAKB 4DT1A 3CLVA 1PPBH 2BMDA 1TU4A 2DCUA 1FUJA 3KJIA 1L1GA 1P3JA 1QRZA 1G30B 1P72A 2A9KA 4DLYA 3SU0A 3SBDA 4A0HA 5L3VA 2FWRA 4D6PA 5JMTA 3KL6A 3NVAA 4FUFA 1FDPA 1KTVA 2ZFFH 4JJKA 2CHGA 4FXPA 3SR0A 4QJ3A 2PSXA 2D2EA 1E2EA 2HNTC 1E2PA 1P02A 1ZMLA 1X8JA 6CHAC 1W14U 5K8LA 1RZ3A 3BORA 1UHBA 1ELBA 2ZRKA 1Z83A 3ASYA 2WIAA 1P03A 1VPLA 1XKAC 2BBTA 4TMVA 3VTKA 3HP1A 2J7KA 1ESTA 3P17H 1O34A 2NO0A 1GMHG 2QP3A 1R5NA 5E2OA 4B3XA 2SGPE 4OQMA 3QGJA 4K60A 3OTPA 4A2QA 3LGUA 4TY7A 2LNCA 3RXIA 3BG8A 3PCRB 4FXGH 1V2QT 1NN6A 1LDTT 1GI4A 3CENA 1GI0A 1F5LA 5AVDA 3RLFA 1GJ7B 3EPHA 3RC3A 2QMEA 4GOKA 1LTQA 3GLFE 1E9SA 4GFDA 1Y3VA 2PJZA 2VWMA 1GDNA 1FONA 4CT5A 4D0GA 3IGFA 4NZQA 4AORA 5AUOB 1ZIOA 4ACAA 4MPUA 1M2OB 1SVSA 1O36A 3K9XB 2AH4X 3RRNA 3A86A 1WU1A 4MPXA 2CVFA 1W4BA 2PX0A 4JYBA 4JT2A 1ZD1A 3LLUA 1HRTH 4TMTA 4JT4A 3FANA 4UXIA 3NH6A 2ZSDA 5JYIA 1E34B 2AXNA 2OHFA 2A7CA 2REOA 2J38A 1ZRBA 2C8WB 1TEVA 4D82A 3WY8A 1W4RA 4F92B 1C4V2 1R4AA 4YMSA 2G5VA 1Z8IB 1EFRD 5JZVA 2GZDA 1YF4A 2ZHDA 1O32A 2EFEB 2WPJS 5HXFA 4PHHA 5JS7A 5CITA 2X2FA 3MG9A 3F9GA 2HALA 4F93B 1THSH 5LB4A 4HAVA 1GTVA 3THYA 4D9QA 2WWGA 3G5UA 4JLKA 5FL7A 3VFDA 1S1CA 1LHFH 1DS6A 1HJAC 2VIPA 4BFYA 1VGCB 3H0KA 1N5IA 2WKQA 5KSOA 1E9RA 3V3MA 4URVR 1TUEA 4MRNA 1DAGA 3NXPA 1FFHA 1S9HA 1O2HA 1P9SA 3QG5A 3T26A 3L33A 2GWHA 3ZVEA 421PA 3FVQA 1IBRA 1GVKB 2ZRAA 3M7QA 1XTSA 2IYVA 3AVYA 1XUFA 3KB1A 1UTLM 3MMGA 1YZUA 4C0JA 1SVLA 4NA7A 3FFGA 2AMPA 4IFEA 1DWDH 1E2QA 3RMMH 2QCYA 4INLA 5LPNA 3NWUA 2IYSA 3TE6A 1DBSA 1AIPA 1QDEA 4BUJA 3M3SA 1XPRA 1GI7B 1YCPK 2BVRH 4GVUA 4F7WA 4FWTA 4FUGA 3UR9A 2ZI4A 3ZVAA 4HAZA 1DFPA 4HLDA 2XOKD 3R9IA 2P8OC 3GY7A 4ZCIA 5G40A 3AB3A 1R0XA 1G5TA 4G0NA 1YE8A 3GD7A 3K8YA 4P3YA 1GHZA 5DE3A 4RD6A 4I1OA 2UZIR 2AR7A 3GLHB 1KDQB 4Q9HA 1QNJA 1G32B 3Q7PA 1O3AA 1V2UT 5E7JA 4IBLH 2BD4A 1AKYA 3OAAA 2PCJA 1QB1A 4BFZA 1ETTH 2HDNB 1LPKB 1TRMA 2Y82A 2NO7A 4LYHA 5EXPA 1SVWA 1W0ZU 3VHXA 1L4ZA 821PA 4I4LA 3KFXA 4AD8A 2VF7A 1G8PA 2WJYA 1FAKH 3O8DA 1GBBA 3TJNA 4HUTA 1XVMA 1GBDA 3GY8A 1NRPH 4E5UA 3BFVA 3RXCA 521PA 4MQBA 4IOJA 1N6YA 2W6JA 1CLUA 3GY6A 2HUPA 1C9KA 4Q1FA 1UKVY 1YM0A 1S81A 2PZEA 1CQQA 5KPJA 5FX5A 3SV6A 3N2EA 3GJXC 4RY2A 1N8OB 3FTQA 4GZMA 4E09A 2OO7A 4IC6A 1TU3A 3X1WA 1JEDA 3RP2A 4MPVA 1QCPA 1XRJA 5GJCA 4NYIQ 3AUXA 4WZ6A 4TYNA 1FN8A 3Q76A 1XDBA 2QM7A 1TPZA 3K0CA 2V55B 4MTBA 3QEOA 5C5OA 1R6BX 3L43A 4OHZA 3MTYA 1VCPA 3V00A 2XBVA 3NG1A 3L8ZA 3GLIE 2AHOA 2IYTA 1UBGA 4WVFA 3RXMA 4D4MA 1ZPCA 4AOQA 4IEIA 3ELAH 4A15A 3QUMP 3K9HA 2RB4A 1N6KA 2H18A 4TWYA 4LRWA 2RG3A 3PENA 2Z94A 1T7CA 1VDZA 3E1XB 3MJHA 2PUQH 2P5SA 2ZTXA 1VG1A 1Z0AA 3PMBB 1NY5A 3ADDA 2ZFQH 2CGAA 1ZP6A 1LCYA 5EE3A 3PLBA 1XJCA 3KJGA 2IX3A 1BTWA 4B73A 5KUTA 3LV8A 2IF0A 2R65A 1HQCA 2JLUA 2JIZD 1NFWA 1J8YF 4IS5A 3M7TA 2OILA 4N3NA 1F0RA 3I5XA 3AV0B 3GISB 3VHLB 5HYOA 4BFTA 3T25A 2WVJA 2V3OH 2DB3A 2VP0A 1AM4D 1X3SA 3A7TA 1HUQA 3MYWA 4XOJA 1B5GH 1UTKA 1ZNXA 1S84A 2FH5B 1PQAA 1A2CH 3QPVA 2B7BA 1O2YA 4X6PA 1RRFA 4ESVA 1Q12A 3VB5A 1ODFA 4CEJB 4GNKA 3I61A 1UTOA 4PAMA 1SGWA 4TL7A 1DWEH 3K09C 4F4CA 2FPZA 1Y8TA 3SNEA 1SQOA 4BLSA 3ENSB 2ODBA 3CRQA 4NBSA 3SV8A 3ICQB 4OI1A 1SFIA 3KKNA 2O8WA 2IWRA 1M1YE 5K8UA 5J4VA 1QL7A 3BTEE 1Q1BA 4MNXA 1FQKA 1R0YA 3QY0A 3ZVGA 1W36C 3M1IA 1GMHF 2ULLA 4FU9A 2QYIA 1KNQA 4U7DA 3W3ZB 4A4DA 3LXXA 2J3EA 1AQUA 4GT1A 3RWOA 4A6XA 5BN4A 1Z3IX 1UO6A 1LS1A 1QQ4A 3ZZ9A 3VEQB 3BTQE 3UPEA 3VXEH 2VLIA 3SBEA 1P9NA 3M3VA 1K6MA 1T8OA 1OXVA 2O8FB 4GPGA 4Z8YA 4LJ6A 4IHQA 1BZXE 1ZYUA 2FA9A 2ZGJA 5AFYH 1UEJA 3AKEA 2ZGCA 1TBZH 3WHKA 3AF1A 1W5SA 2FGKA 4KSBA 3MO9A 4JLJA 1ELOA 2BMJA 4LCBA 1X8LA 4JMYA 1YR6A 1ORFA 2ODEA 3EZ2A 1RFNA 1MKXK 2H9EH 1OKKA 5AHGH 1O3BA 2O52A 2NQ2C 3LW8A 2WJJA 1UVPA 2J45A 2KB0A 1NZQH 2PGBB 2FJUA 3S0NA 5TY0A 3DMNA 4D81A 1CR4A 2IF2A 2BB4A 3TW8B 4Y8ZA 5F6MA 1JR3E 1Q22A 1CKEA 1Z8RA 2Z6BD 1AVXA 1RIWB 1G2MA 2QORA 4CYMA 1MZDA 2Y7ZA 4MGKR 2VVVA 6Q21A 4FUEA 3TVTA 3I73A 1EESA 2PKSB 1NSFA 4O97A 4TZ6A 1FLEE 2G83A 3P92A 2KI5A 1GG2A 1E6CA 4X8LA 1N6IA 1TMKA 3PUVA 4XVQA 2FOGA 1DO2A 2FGJA 2R44A 1W0JA 2BJVA 3SYLA 4UXHA 1VCOA 3IQXA 4TTRA 4DWJA 1AGRA 1HAHH 3CNNA 4C4PA 1H8IH 3B82A 3M37A 4TLDA 1HB0B 2KJQA 2FE4A 2OE2A 1DE0A 2I1QA 4A2WA 1O2KA 2P2LA 1E1RA 4E7NA 2GGVB 4RD3A 2V9PA 2ZI3A 2QSYA 2J0QA 1FX0B 1ELDE 2D8WA 5HTKA 2ZSEA 3B8HA 2QRNA 2F9VA 1WSSH 4Y6DA 3FMFA 4BXWA 1U99A 4TPYA 2BD9A 2V6JA 1LV7A 1G5PA 1R8SA 3QKSA 2ZXUA 3BBPA 5KU1A 1XUGA 2H5EA 4Q01A 2SGFE 4NIXA 2QF3A 2AKYA 2C2HA 3AKDA 3ETLA 2GJKA 3RXFA 4LHXA 4JK6A 1XEWX 3L0SA 3CRW1 3X1ZA 3TGPA 1FQ3A 3Q3JB 3SU4A 4RZ2A 3RDPA 2D7CA 4IN2A 3MO3A 4BFWA 2AXPA 4I8JA 3RXAA 1OJLA 2Z3DA 4OK3A 4R2IA 2OV2A 1L0ZA 5LPEA 4UNPA 1H1BA 5BRRE 1YU9A 1HJ8A 1KI9A 1YZTA 1ELAA 3VAAA 3RYTC 2QZ4A 4C0HA 4YO9A 5KDOA 1SULA 3UG6A 1A5IA 1GI1A 3SZNA 2ZJYA 2WAYA 2XEXA 2ALPA 3OIWA 3VXFH 2H8KA 2Z4SA 3U3OA 2W2XA 2CHQA 5GVSA 2Y8EA 2G77B 3GFPA 4BLPA 2F9NA 5KNBA 3A4MA 4DLRA 1W4CA 3B78A 1T8UA 4GBMA 3DDCA 1NP6A 2ZUBA 2FTMA 2CCJA 4IDNA 3K70D 3BEFB 1PYTD 2HXYA 5AJVB 3TSZA 1VCWA 4XSGA 1UBFA 4FVBA 1ZM9A 1EPTC 1AFQB 2FOEA 2UUKB 1C1PA 3QGNB 1TRNA 3FFAA 1Z06A 3CRVA 4DSNA 3JVUA 1WCZA 1XUIA 2I6SA 3B1WA 3ONWA 2CHVA 1KI3A 2OCVB 3Q5DA 1ZSJA 4AGKA 3LX5A 1IOEA 2N42A 1CR0A 3AP3A 1K5GA 2QE7D 4Q48A 4UNSA 1GSIA 2QQ0A 2VHUA 4MRPA 2KE5A 2ZI9A 3RS7A 1QTFA 1S85A 1G8FA 4DLSA 1W7AA 3HR7A 5FI0B 1JIRA 3C1KA 2D2DA 4MKFA 3EWSA 3WY9A 3A4LA 3ZH9B 1YJ5A 4EFMA 2EFHB 2OC1A 4RFVA 4RZ3A 1LB1B 1IAUA 1BHXF 3K70C 2ZGBH 3QN7A 1P6XA 3AVVA 2JA1A 1GHAF 3K0EA 1X1SA 1A3EH 1D5CA 2B7CA 2QMHA 1TQ4A 5EUMA 2CN0H 1E2KA 2HLDA 4XBCA 4OJQA 2I1VB 3RS5A 4C9BA 2QGNA 2RMKA 2F9BH 4NZLA 1O37A 1VMAA 4VGCB 4QFMA 2SHKA 3ZD6A 4HB4A 1EJAA 1JXOA 2OEPA 1U8AA 2OBQA 4CRFA 1G18A 1GCTB 3FMIA 5EP4A 2P95A 4LWZA 4AZ2B 1KOFA 4NWLA 2PTNA 1J8AA 1O2NA 5FH9A 1T4GA 3M36A 4FUBA 1ZM3A 1G3QA 2CHAB 3KKOA 4P4UA 5FBWB 3U8TH 3PWCA 1NLYA 4K8OA 4MDFA 1F5NA 3AM1A 3WHLA 2VGCB 5BN3A 2DR3A 4XD7A 4WA7A 1GI3A 1OYYA 5EODA 1QJ1B 3A84A 1KTTB 4Z51A 1HE8B 4FN5A 3NEJA 1WQ1R 3NKKA 5FBRB 4DSTA 2PMKA 1S5SA 1G9XA 1TB6H 4PPGA 4FUCA 4GCHG 4QRHA 3OZXA 3HPRA 5AJWA 2GDEH 2PL3A 3MSXA 3PJRA 1EFUA 1P2SA 5IDKA 4RD1A 4V03A 5HR5A 1G3DA 5FTMA 1NLZA 1TNGA 4O2RA 3TVDA 1P2NA 3CR8A 4INKA 4A6PA 3BD9A 1ANCA 1HXFH 3HWSA 1OFUX 1KJYA 2FYRA 5JSZB 2L0XA 3T29A 1LVOA 2R0LA 2Z9IA 1R10A 1C2IA 1RRGA 4HZUA 3OIUA 1G3CA 1QG2A 1BH2A
chains in the Genus database with same CATH superfamily
3BZWA 1S2DA 2KQUA 4GEGA 2NG1A 3D5QA 4OI2A 2I7XA 4MVYA 1N0VC 1GG6C 3GLTA 3OF2A 3AZQA 4F3YA 9ATCA 1MA0A 4ZU3A 5JFTA 4GWKA 1VDMA 2FQXA 2X9QA 4L9WA 1D7AA 3ITNA 3S0JA 3V8PA 4DCSA 3G2JA 3CUEF 2P79A 2HRRA 3K6SB 2BOVA 2YV4A 3D0QA 4LWOA 3RS8A 4QQRA 3ESAA 1QZXA 3GOHA 3GYLB 2GZ8A 1OX1A 3I2HA 4N0QA 4DTCA 3KDSE 2XNJA 2ALVA 4LHWA 1KEVA 2WF8A 4MCAA 1U80A 4IXNA 4U9IS 4XCVA 2ZIGA 3UWIA 2B98A 4E7OA 3AX6A 1TE0A 1AHHA 1YR7A 2G7MC 2V4UA 1AK2A 2C78A 5DO4H 2Q41A 1KGSA 3K0FB 5B1SA 4IQFA 1HY3A 4ABYA 1QRUA 3K9WA 1WTGH 4OI4A 3I6IA 2ZU3A 4F3CA 3UMMA 1F8UA 4I8DA 2I91A 5DHFA 1U7TA 3WLKX 2ALJA 2YKGA 2PUWA 4ZHMU 2PMWB 3SR4A 2ZZNA 3GOVB 3I39X 2HQBA 1FP4B 4JLDA 1VM6A 3EZ7A 5CB4B 4Y1FA 3PIRA 5F73A 3SWWA 4A7IB 4R1OA 1NVKA 3PD1A 1GZ5A 3PQ6A 3LQRA 5B6PA 1PEDA 1SHZA 2Q2NA 4LXQA 1C4WA 1FPCH 1E6LA 3T5CA 5JSQA 1QAQA 4D4HA 2D1JA 1KOLA 3I62A 4IFBA 3G5TA 2EC9H 4ZPJA 1JR4A 5C1IA 3ITEA 1IQFA 5B1IA 1NW7A 2A6PA 1E4EB 1SWVA 5JG7A 4B6OA 1KDZA 1IG3A 2VAMA 4HDRA 4WZZA 4EPYA 5C8YB 3NPMA 2VVUA 4EHJA 2XB6A 5LQKA 4G1UC 1E8NA 3U1VA 1J21A 2ZGHA 3EWIA 1NQAO 1YQTA 3DBLB 4KUGA 3ES9A 1IQ0A 1RQGA 2NTVA 3D2LA 3KQOA 3Q7QA 2DH6A 1NE7A 3AF2A 1IUNA 3T41A 5A2GA 3U6BA 4EKIA 3FPEA 3FBGA 9ABPA 3GEIA 1OAAA 4GS5A 5HOQA 3P8ZA 2HGZA 2QB5A 4V0RA 5FNZA 4F46A 1EGAA 4HEHA 4WXRA 1XHFA 1XZJA 1YH3A 3RKRA 1DFIA 1N3BA 3BILA 4LZ1H 1XDDA 1Y7PA 4QEDA 3WA7A 1GZ6A 1H2RS 1QO0D 1Z6PA 1DT2A 4PZUA 4XUEA 1EAXA 1B26A 1M74A 3ND9A 3NR2A 4CM5A 4DIDA 5EJ7A 4ND7A 4PG6A 5DK4A 5F03A 2EQNA 1JT9A 2X9LA 1YCPH 1XWFA 4LZAA 4AZ3B 1MO3A 3EYAA 3MILA 1BNCA 2FU5C 1PWZA 1UJCA 4PSVA 4QXQA 1U8UA 2F67A 4Y6QA 7YASA 3I9MA 1YBMA 2PKAA 3G5LA 4BU0A 3E9NA 2XZOA 3WGIA 3PRJA 4P6VF 3U8RH 1T15A 1TCCA 3AK4A 3GRPA 1DKRA 1NNSA 1RP7A 1B0FA 2GXQA 3N2KB 4P36A 5KAPA 3UTDA 2UUAB 1C1VH 1GGHA 1ML4A 5T6FA 5LLTA 3RS0A 3EDMA 4G41A 2IXBA 3F71A 2Y3IA 3KVYA 4C3UA 3LZCA 2EY4C 3QE3A 4KWEA 4EA9A 1K5HA 1M2KA 1M2HA 2W83A 2HOBA 2VPXA 2AN1A 4EA6A 4F8EA 1JIKA 1YDHA 4RPKA 1PGPA 2IHTA 5F12A 4ES6A 1TGTA 1VKJA 2OPHA 3NLLA 2O2SA 3A1NA 3OF5A 4HN4B 4DL9A 3UHOA 5HFAA 4PLTA 1DHTA 5E6SB 2B5TB 4JBXA 4RJJA 4KI0A 4Z9BA 2IY8A 4MWSA 4AN0A 2FYTA 2PJDA 3FR8A 1H6DA 1YKTA 2QY9A 1HAVB 2VOEA 1E6KA 1FBTA 3D6AA 3E4CA 3HB7A 4NI5A 5LC1A 3WQBA 2NXCA 3KWMA 4QYXA