5FPSA

Structure of hepatitis c virus (hcv) full-length ns3 complex with small-molecule ligand 3-aminobenzene-1,2-dicarboxylic acid (at1246) in an alternate binding site.
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
642
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords HEPATITIS C VIRUS FULL-LENGTH NS3 COMPLEX
total genus 202
structure length 642
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5fpsA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fpsA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5fpsA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpsA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpsA03
3EZ6A 1BRUP 4DC9A 6CHAB 3DT0H 2GD4B 1EAUA 2NG1A 4D2IA 1FN6A 3M7QA 4H1VA 5FTJA 1FQKA 1THRH 5DSZA 4CEIA 1P01A 1JR3E 5JBBS 2G3YA 1BTXA 3I77A 2ATVA 2VWMA 4Y0ZE 4WA7A 1SPJA 4QJ4A 4JBYA 1B23P 3MU5A 1VTKA 1NVVR 4IN1A 2ZU3A 2JAQA 3KX2A 2XSZD 1VITH 1YZGA 4WAUA 2OBLA 2R3UA 2ZSEA 3QY0A 3M6AA 4PPFA 4A8JB 3FVFB 5KDLA 1XKBC 2VVUA 2UUYA 4A82A 5C3NA 3GY8A 3LU9B 3SU8A 2J46A 3OIYA 2NO9A 1HV7A 2TIOA 1AUTC 2ASEA 3BG4B 3T5GA 4LYAA 1WBDA 2BD2A 4PO1A 1BMNH 3KKMA 1Z0JA 3FTQA 2FEQH 1CA8B 2PKAA 1SLUB 3BTKE 4KKDA 3RSOA 2N42A 1DE7H 2W6JA 2R2AA 4D6PA 1CBWC 5A8ZA 3LGUA 3TVTA 3I29A 2EFHB 1ZRBA 4J0QA 2W7SA 2YKGA 1MO4A 2ZGXH 1XTKA 1OXGA 1CA0C 1XUGA 3QGNB 2QPOA 1W36B 3FMIA 1Z8GA 3FPAA 2GX4A 2PV9B 3STJA 1HYLA 2HRVA 3MAAC 4A8JC 2QN5T 1VITG 4IDHA 1MBMA 3L33A 3W6NA 3VHLB 2OSBA 2OFXA 3TGJE 1XTIA 2BOKA 3B7GA 1MUEB 1FXYA 1V2TT 4E03A 3R9WA 1UCYK 2BD3A 2VP2A 1C5WB 3MNCA 821PA 3ODDA 3LGYA 3SV8A 3Q3JB 2VWLA 2A7QA 4BAQB 2V55B 3K0SA 3GLGB 4DCUA 1KTTB 2EI6A 121PA 1T9HA 2ERYA 1ZPCA 1C5MD 2BEKA 4UFFH 1GTVA 2PX3A 3IEVA 3A80A 3LH1A 2FM2A 1NC6A 4E06H 2TBSA 4TYDA 5EE3A 2REOA 3KFXA 3BIFA 4QBIA 1XUFA 2IJD1 1AWFH 5DHFA 2Z7FE 1GCDA 1O3JA 3LQQA 3B8HA 1QHXA 2NU2E 2QXGA 4OQLA 3RC3A 2XZPA 4UXIA 4RKFA 3TJOA 3RXCA 3AUXA 1Z0AA 3K09C 4LJAA 1HJAB 1IQMA 3A87A 1QBVH 1ZUIA 3NBYC 4NCYA 1TNHA 1T4GA 1AGRA 3MNBA 4FUJA 3AUYA 2C77A 2C4FH 3M5MA 1JWTA 1DPOA 4AD8A 1ONBA 4CW7A 4UJ3A 3V3MA 2W6JD 3SUEA 2IX3A 4ZXYH 1Q3HA 1GRRA 5JJIA 2G0NA 4IVRA 4M22A 1LW7A 2CMYA 3K8YA 2Y6TA 4IW4E 5KUTA 3QX5H 4EFMA 1GL1A 2XAUA 1O30A 5EXLA 3MU1A 1NMYA 4X8SH 1GJ8B 2BMDA 1OYQA 2VHUA 4PXAA 3OY5U 2WYJA 2HJVA 3ZZCA 1XUJA 1Z6TA 3V12A 2K1QA 3FMOB 2RMKA 2OHFA 1X3SA 5JDUB 1O3FA 1E2FA 1DE0A 1T8NA 4RZUA 4US1R 1EPTB 4NCKA 3QE0A 2GDDA 4LBWA 1U94A 3M5NA 4PX9A 2XNDD 1ZM7A 4IRUB 2SGDE 3K0FB 1A3BH 4MUBA 2FN4A 2IYTA 1G8PA 3U44A 1Z08A 2F43A 3U8TH 3VEQB 1RJ9A 2ZETA 1A7SA 3FFAA 1GOTA 1TQ6A 3THXA 2GCNA 2QF0A 4AKIA 2VO1A 3SU0A 1ZUNB 1ZM3A 3AW0A 1GBBA 4MQAA 4ABJA 3F68H 3BG8A 1KXDA 4Y7AA 1S3SA 2QAGB 1I4TD 2VHJA 1NLZA 1TQ0B 4M4SA 1PVOA 4H42U 5FOXA 6GCHG 1O3AA 2PR3A 1O3HA 4BLOA 1AE5A 4M2LA 5IT5A 1OIWA 2P8OC 1VZQH 4LI0A 4R2HA 1KO1A 3ATWA 3VR1A 2NU4E 3GLHE 2R6FA 1RFLA 1KNXA 4IC6A 3BEUA 2D62A 3X1WA 2QC2A 5TXGA 2D06A 5HMAA 3AW1A 4PZLA 3ADKA 4OL0A 1COWD 4IXMA 1RRPA 3QNUA 5DO9A 4NIXA 1EPTA 1EB2A 5LPRA 2FO9A 1NN0A 4EPVA 4UFEH 2C8WB 5EZ6B 4RD0A 3C1KA 1U99A 1X1RA 1H8HD 8KME2 3U60B 4B3CA 4FCVA 3QXJA 4K5ZA 3D65E 3U6KA 2BD5A 2QEQA 4W5HA 1OIVA 4M1OA 2DE9A 1U9IA 3KKOA 2CL6X 5EP4A 4ARZB 5KNBA 3U3JA 5EG4A 3RS5A 2CV3A 4PC7A 1GDNA 4TPYA 4P4TA 2BMGB 4Z6AH 4AYTA 1UTQA 2J7PD 3F3YA 4CRFA 1A0LA 2FNAA 3ZQ6A 3UQOA 1QRWA 2IA5A 1AE8H 1O3MA 1ZD1A 1Z07A 2ZRHA 1E9DA 5FI0B 4QGAA 3M36A 4WXRA 4JSYA 1Z1JA 2P93A 3SYLA 4V0KA 2A5GA 3SQEE 3GEHA 1V2UT 4YM9A 1WDTA 5GVRA 1KY9A 3I4LA 2IYZA 3P70B 1GHXH 2I6QA 1LV7A 1MTVA 1O2QA 2ERXA 2ZE5A 2ZRFA 2QBYB 4QJ5A 2BMJA 4OS1A 3IQWA 5IRCD 3HU2A 3RS3A 2ZFTA 3D7MA 3BEIB 1U0JA 3J81k 1AM4D 2HEIA 4YOIA 4KLZA 1D4PB 2GBLA 4D4KA 1G3BA 4D7FA 1KI6B 1NMXA 1XPRA 2O0JA 3RXVA 1IHTH 3TR0A 2ZCLP 1IQPA 2ZYTX 2QSZA 3ZD6A 1IY1A 2H18A 2WBLC 4P4SA 2FFBA 3H86A 1L4DA 1N5IA 5HZHA 3ETLA 4D4LA 3AVWA 5P21A 3ZV8A 3LW7A 1WOFA 2ZQ1A 5I25A 3WXMA 1BRBE 4QC2A 6Q21A 2VLIA 2WJGA 3TQCA 1KLIH 1EJMA 4NA8A 1GJCB 1AWHB 3NKVA 5DISB 2XNSA 4Q9HA 1E2EA 3V13A 2QRNA 3PLBA 1CVWH 3DD2H 5DI3B 5K0HA 3EZ2A 3U3OA 2YYZA 3HKIB 1VG1A 3OAAA 1QHHA 2ZUDA 4AIIA 2HPPH 4P4SB 5FOVA 3CONA 4TZ0A 3SI4H 1O2TA 1C2KA 3T1VA 3IIMA 4K69A 3VQTA 3T28A 4SGBE 1XXHE 2A5KA 5JI2E 4LYJA 2UWPA 3DHKH 1K1MA 2IWHA 2Y82A 2I4IA 4WF8A 4TMXA 3O8RA 1GI8B 3EA9A 2PEZA 1TMUH 2OTVA 2NTYC 3A37A 2O8DB 3AVZA 1W5TA 2YZ2A 1O2HA 2FOCA 2VIDA 1SVOA 1GJBB 5A0CA 4WMFA 2XTMA 1O2ZA 4D0NA 1GKUB 3BTFE 1PPEE 3I8SA 4HLUA 5LPEA 2WSSA 4RD1A 1LF5A 2UKDA 2GJ9A 1E2LA 3RAPR 1Q2WA 1BMFD 4AORA 1L7VC 3WYAA 5F98A 3QPWA 3MFYA 1N6NA 1OH5A 3P6ZB 2XSZA 5C2JB 2A30A 1YM0A 3S0NA 5KSPA 4LJ9A 2DB3A 2HNTF 4AG1A 2QRZA 4ABFA 3M3SA 2PWXA 1XTQA 3CRW1 1ANBA 1TAWA 1TRNA 3BTME 4H6SB 2Q9AA 2ORVA 4XSHA 3PLPA 4D76A 1JAIA 2V3CC 4DY7B 3W3ZB 3IBYA 2IYSA 3EXAA 4AYVB 4QJ3A 1QVAA 5CHAC 1M7GA 3LLUA 1GI6A 3GLHA 2FI5E 1K6MA 1W4BA 2GF0A 1ETSH 3CS7A 4LHZA 2RAPA 5CB6A 2ZHFH 1X7AC 1YPHE 2OZEA 3AVXA 3KQCA 1GBFA 3Q3YA 4TQAA 5AHGH 1OOKB 5D3MB 4DB4A 1BZXE 5E7MA 1MKXH 4I7YH 1XX6A 2ZM5A 3UTUH 1QBKC 1U8AA 5C4MA 4CR9A 2J5XA 1XJ0A 3TW8B 1NU7B 1C9TA 2EWWA 3RU4E 4YMVA 4FVBA 3MWLA 4A1VA 1MCVA 3RS0A 2Z5FA 1JRTA 1N6PA 2ZCHP 2EVWX 1CEEA 2LPRA 2RB4A 5J4SA 3RS7A 2QM7A 4CBNA 4EDHA 1GGDC 2OESA 1FMLA 3PEYA 3MSXA 1AMHA 1TNJA 4K81B 4X8VH 1ZC3A 1SXJB 3ZZ6A 4PAQA 1OWDA 3NG1A 4X8LA 1TX8A 4D7GA 1CJTC 1CA0B 2TGPZ 4NYJR 4MTBA 3P4YA 5EP3A 5HKKD 2X77A 4XDEA 3EPKA 1NTPA 2LCFA 1G4UR 4WW0A 2BHGA 3SU3A 2O52A 2ZRMA 3K0AB 3D3QA 3MJRA 2KI5A 3CZQA 1BA8B 1V2JT 1JEEA 2Y5HA 1CO7E 3UFAA 3SNEA 1KO4A 4ZI3A 6GCHF 4F93B 4HAUA 1GVNB 1VR1H 3A8AA 1T5IA 4LOAA 2I1VB 2ZSDA 3EC1A 2AR7A 3SU4A 2JLVA 1PJPA 2XYAA 5BXQC 4WIAA 4U7DA 4GAWA 4II7A 1G8FA 2HALA 3EE0B 1BDAA 1ZMLA 1YPHC 1K5DA 1VIYA 1BRCE 3NK8A 4HAWA 3PEWA 4NG9H 2GCHG 3M0EA 5EZ5A 1U81A 4TQ9A 3RUOA 4B74A 4JLJA 1LF0A 2TRMA 1GBJA 1P3EA 4NA7A 1HE1C 1A5TA 1DM4B 4QNRA 1V2PT 2A2XH 1D2NA 2VH5R 4MLFB 4F4IA 1EWRA 1C5OH 1VHTA 2KJQA 5AJWA 4KELA 3BD9A 1E0FD 1P2NA 1LS1A 1CTQA 1XKAC 1WF3A 3TLXA 1LCYA 3PTNA 4A6XA 1GBAA 4KXFB 3OAAD 3KTAA 5CLQA 4UFGH 1GHBG 1O2MA 1W47A 1KDQB 1KJWA 5E0GA 4D8NA 4M9FA 3OSYA 2XXAA 3SJCA 3SJZA 2YOGA 1KI1A 3OESA 2BM1A 2UUKB 4YT7H 1P57B 1SFQB 4PO8A 2VTKA 4L9SA 3SNDA 1GBCA 5C2ZA 3BB3A 2V6NA 2QN6A 1GI5A 4OGYA 5CIQA 2EI8A 2OBNA 1BMAA 4XOIA 1O3YA 2CHQA 3B82A 1ESAA 1S96A 1O2YA 4OS5A 1Z28A 3M5OA 2CBZA 1NO9H 5AUNB 1C5NH 3N2IA 5HGGA 2B6HA 2NGRA 2C98A 3E6PH 3AP3A 3VKHA 2BBOA 4Q9KA 2ZI6A 1TPPA 1E1QA 3MCAA 2ULLA 3HGNA 4DURA 3GYMA 1L2EA 1CJKC 5GVSA 1F0SA 1BT7A 2P65A 3BFKA 3SU5A 4Q7XA 1Z06A 3F6UH 3SNBA 4D0LB 1C1YA 2MSEB 3VNUA 2V6IA 2A2ZA 4O3TA 4OI4A 1XCPA 1Q0UA 2GMTC 1A4WH 3KKQA 4A7IB 1FZZA 2AGGX 3ZVEA 4BXSA 2J9NA 2QCYA 3Q3XA 2W2VA 3NIBA 2WAXA 2FU5C 3QF4B 1E99A 3AF4A 2CMKA 1TF7A 2RGXA 4N0EA 2QMOA 5AJXA 2GBLC 3RLFA 1XCMA 3X1DA 1XMJA 1RTLA 1MKWH 2FXRA 3LRPA 1E2DA 2QGNA 4NYMQ 1TU3A 1G1MA 3LD9A 2VVCA 3QVVA 3SI3H 1Z6JH 4DHEA 1XB2A 4NZYA 3K65B 3K9LA 3FMPB 2W7UA 4B33A 1KTVA 1MCTA 2ZTXA 3NTUA 1QGFA 2A2QH 4CBOA 4HUQA 3NC1C 4PPNA 5G53C 3K6ZA 2H5CA 3P27A 3SQXA 2ZQ2A 3GOVB 3MG9A 1RFNA 4B76A 2ZI4A 3TK6A 5G40A 1HB0B 2W6ID 3GLIE 1C2LA 1IOZA 1M7HA 3A88A 1HURA 4LSGA 3ELAH 1WQSA 3W90A 3WP0A 4DLTA 2P94A 1DO0A 1HFDA 4JYBA 4I81A 1YPEH 5CE1A 1YZUA 4RZXA 1BIOA 1BTPA 3S9CA 3DZ8A 3TUIC 1RRCA 2UZ3A 3VMFA 4ZKNU 2JETC 3Q9LA 3EGKH 1E4VA 1G9IE 1F92A 5CHAB 1HBTH 2AN9A 3QTOH 1P06A 2XNIA 1EAWA 1DARA 4DSOA 1VCWA 1A0HB 1GI9B 1O2LA 2ZRJA 8ESTE 2AIQA 1IHSH 2ZGBH 3S1AB 2VHTA 3TSZA 1SLWB 5AUPB 4LJ4A 1F5LA 4INHA 2QP9X 3JZAA 1OXSC 4MGIR 1ZPBA 1GBEA 1AY6H 8GCHF 1X8KA 1O3LA 3LBIA 1XZPA 1C1RA 2AFIE 1YLDA 2BY8X 2VIPA 4LJ6A 4DCVA 1MT0A 2SGPE 5AVDA 3BV9B 3RRMA 4DCDA 4IS5A 3SZEA 4YONB 2OILA 3SN6A 3KDSE 1CGIE 3ESTA 3A8DA 1O37A 4ABEA 2VGCB 1A46H 2GT7A 4RZ2A 2G77B 1KK0A 5JECA 4SGAE 4AB8A 1FY4A 4BAKB 1GKIA 4AG5A 4HZHA 4NBSA 3SS8A 4DLVA 4KYIB 4JYUH 2ANCA 4URYR 3GLIB 4PTLA 2ZJAA 3QXHA 2E1RA 5DYIA 1B7XB 3RM0H 4CHAB 2FF7A 1PPBH 1TOMH 2GK7A 4CIDA 4KV9A 2ALVA 4GRAA 1OYWA 3TNSA 3TR5A 4OHWA 1DLEA 2EEKA 3SUDA 2QAAA 5G3ZA 1AJEA 4PZYA 4JLBA 1SXJA 2K5UA 4LX0A 1T0HB 1F60A 4CRBA 1UBCA 2V7QA 4Q2KA 3G0HA 5EQSA 1D3PB 4THNH 4JVMA 1ARCA 3F9GA 4MYUA 4V0MA 3UMSA 2Y5GA 5FCRA 2H17A 4A6PA 3DKPA 2REXB 3H5CB 4WVPE 3R7WA 4PZZA 4LJ8A 2BC9A 1YBWA 4V0NA 1J2JA 2IEZA 4F49A 3K0EA 2JDIA 4CHAC 5TMPA 1O0DH 1IAQA 1M8PA 1G7RA 3WHLA 1CR0A 1BCUH 2IW3A 4NCIA 1XF9A 1ZIOA 1T6NA 1G5TA 3MHWU 5AF9H 5EXTA 5FTKA 3CWZA 2VP9A 1US8A 5F8TA 4WY3A 2IT1A 4JS0A 3TK1A 1MQ6A 1SVWA 3AF2A 2VYFA 2ALPA 1ZU4A 1R10A 2BXUH 4D4MA 2XC4A 1TNIA 2VVVA 4GHTA 1XUHA 5H1YA 2FOHA 3CH4B 3UG7A 1C2JA 1AHTH 3X1ZA 3R8FA 1G4AE 5E7IA 1QBNA 1KMQA 2GZDA 4TLDA 2VWNA 1ZGVA 1MTNB 1LHFH 1FFHA 4Z1MD 1T0JB 4YOJA 1P7CA 2ASUB 1NZQH 4M21A 2CLDX 4U32A 2ZRPA 4QRHA 1GI1A 3TVDA 4RD2A 1H8DH 1Z63A 1L1GA 4KSBA 1LHDH 2O8MA 5JS8A 3U3RA 1W2HA 1QIXB 1A2CH 1SB1H 2ODEA 1P6XA 3ADBA 1WQ1R 2JDID 1P2UA 5J40A 1E2NA 1ELEE 1DICA 2BKUA 4OQFA 3MU4A 3A83A 4OGXA 1JIMA 1HH4A 4DOQA 4GUXA 2QI9C 4HDQB 4TL6A 3CS0A 5TCCA 4FUEA 2FOAA 1C5PA 1H9IE 3H7TA 1QHYA 2ZHQH 1Z3IX 3A4LA 4A2QA 3K0AA 2UVQA 1INCA 3PMBB 2VSFA 1XEFA 1DAEA 4CR5A 1C5UA 4PAOA 3ZZTA 1E94E 1K1LA 1UHBB 3RHFA 2TPIZ 4Y8ZA 1Z7KA 2B7DH 1SBWA 3PJRA 3ASZA 1E2MA 3UMRA 4OK5A 4DT1A 3FHTA 2A7CA 1OWJA 4Q02A 5BYKA 3H2YA 4JZIA 4ZO4A 4WWYA 4NH0A 1Z6EA 1P9SA 3RXQA 1VG0B 4ZH8A 1G6OA 1KZ7B 1D8TA 2EC9H 1RYHA 3UWOA 3QKRB 3QUMP 2V6JA 1P4SA 4IC5A 3U4QB 1SQ5A 5GJVC 4A1XA 2VRWA 4F7WA 1QB6A 2IXEA 5FBVB 3O8BA 3BH0A 2ZC9H 4D9RA 2ZJ2A 2ZRCA 5FBRB 4R9UC 5ELXA 2BX3A 3CLVA 2GXAA 1G3IA 3F5FA 1HAHH 2BD8A 2FDCA 5JFGA 1O38A 1NN1A 1P12E 2HLCA 3LVQE 2D26C 3S69A 1OE0A 4K1EA 1FPMA 2OLGA 4CH8B 1GMCG 1HJ9A 1I4LD 4DXAA 3Q7PA 3HKJB 1W10U 3OTJE 1ELGA 1G3MA 3GLGE 3AKYA 3HR8A 1GWAA 3LDXH 1IQIA 1FQJA 1TRMA 4URXR 2X8AA 3PWBA 4X6NA 3P4XA 2IS6A 5FUXA 2VIOA 3WP1B 2PKSB 4MDEA 3A82A 1KGDA 2GCTC 3IQXA 2F1IA 5DP5A 5JWRA 2Y5FA 2ONJA 2LWIA 1S82A 2XJ4A 1OB2A 3THWA 1OJLA 1DWEH 1KO8A 1RKBA 3PO1B 3QGJA 2FPMA 2GNOA 4ASUD 3SBEA 4TY6A 1Z8IB 3PMHB 4JLOA 1JBKA 1EG7A 4C4PA 1H9LB 3W6OA 4EFNA 2FTLE 2Z9LA 2WKPA 2GJSA 4O9VA 4MKGA 1FNIA 2CVFA 1JEDA 1UVPA 1DAKA 2GT8A 1IHUA 1EUFA 1LVGA 3EARA 2Y81A 3TGIE 1GJ6A 3AP2A 4ZCMA 1EJAA 4BGDA 1AVGH 4X2XA 1KMHB 2OAP1 3I61A 4GL2A 2X2FA 3OZXA 5SZJA 4Q1EA 1WB9A 1DTSA 2ZE7A 4BLQA 3RRNA 2BOHB 1P75A 4Y76A 3FKSD 1E0KA 4ZIRB 4UNRA 3PO1C 4B2BA 1QDEA 3EASA 1OYTH 1ZLRA 4BNRA 3LGIA 2PGBB 2G5VA 5DYGA 1E1QD 5LBIA 1TLDA 1FONA 3QVUA 1NVVQ 4JMYA 2GJAA 1GVLA 2YWGA 4MITA 4HUQB 1C4Y2 2P6NA 4FXGH 2ZEBA 1ESBA 2F9BH 3EYDA 1U0LA 1CBWB 2ZU2A 5E2PA 1YPGH 2OXSA 4MKFA 1WTGH 5DIFA 1KKMA 1IN5A 1A5GH 2BBTA 1KI8A 1LTQA 3P8GA 4XE4A 1C5RA 1E2KA 1O3EA 4NDZA 3UATA 1LHCH 4M9XA 2Q0HA 4Q9JA 3KJIA 4IOKA 5JHHB 2AWOA 2QPTA 5E0JA 5ABWA 4Y0VA 4NCNA 3SHCH 1N6YA 3BTQE 3ZZ8A 1L2TA 4X1RU 4A2PA 5FL3A 1M2OB 1QL9A 3FVQA 2WOOA 1V2KT 1MAXA 1KHTA 4U2WA 3BTTE 2RCEA 1NF3A 1SC8U 1AZTA 4FMDF 2QG6A 2Q3FA 4TL8A 3UR6A 3ZVMA 2D2EA 4TWWA 4DLZA 2ZRDA 1RPZA 4GOJA 2WKQA 1O3IA 3PENA 2QF3A 4PPQA 1K9OE 1F0TA 2O8EB 3O8DA 2ZRBA 1C5LH 3HR7A 3BH7A 4HB2A 4RN6A 3LO5A 2ODNA 2UWLA 3PVSA 1N8OC 4D0GA 4X6MA 2NO1A 4M1SA 2OINA 1X6VA 2GRJA 3PFIA 3DKVA 1WSSH 1P9UA 1GWNA 1OP0A 1MO5A 1W0JA 1OB5A 1TB6H 4FUFA 4FMBB 4LV6A 1PPHE 2A32A 3UR9A 2OBOA 4F92B 2WPMS 1FIZA 3RMNH 1WTHD 4LCBA 2OUAA 1TYNA 2XBYA 1VYUA 3SDZA 2FA9A 3K9XB 1K1NA 3GD7A 3HJNA 1F2SE 1YP9A 1IN4A 4A2WA 4Y10E 2F9UA 4X8TH 1BOFA 4ASHA 2JLZA 1I2MA 3JVVA 1XPOA 2F9MA 4TLAA 2YNBA 3E1SA 4X1PU 4QM6A 5AFZH 1KI7A 3MLEA 3W5JA 1J17T 3MU0A 2ZDMA 5SZHB 2PTCE 3AVTA 1KI2A 2PHBA 1AIXH 2IYXA 3OU0A 1ELFA 2CGAA 3K0FA 3FFBA 5DP7A 1ETUA 4L15A 2XWAA 4KJZA 4GBMA 2PLXA 4A0HA 3AP1A 1RXPA 4JKIA 2C9CA 4TWZA 3B23B 1OWKA 2FLBH 4FWTA 1N6LA 1LPGB 1AKSA 3U61B 4O03A 1WXRA 1DADA 2Q6DA 2ZANA 1MD7A 5A4JA 2Q3MA 4GP7A 2C3SA 3QKTA 3SGAE 1R8QA 3UY9A 2ZQ5A 3VX4A 4Q4JA 3EIEA 1QL7A 4US0R 1CS4C 2B8TA 1D5CA 3PB1E 5G41A 3LPRA 1GJ9B 2R8RA 5GADl 4LDJA 4Y6DA 1U6QA 4OS6A 2H2ZA 5F9HA 1BJVA 5FX6A 3GJ8A 3E0PB 1XTRA 1E6CA 1Z0IA 4IOLA 1O32A 2A7JA 3SHFA 3A8BA 4LGMA 3LXXA 1NLYA 2ZP0H 2HYDA 2B0FA 2C78A 3LGWA 3QPVA 1CE5A 1G7TA 1IJEA 4JZ1A 2RKOA 4DCTA 1A2KC 4U30A 1UAAA 3EWAA 4F4CA 1EX3A 4AG6A 4YDHB 2H57A 1NVXQ 2XNDA 1O5DH 3UOPA 5LD2C 2JLUA 1OLOA 3C7KA 2Z3DA 2ANYA 1OPXA 1GNQA 4PANA 1SLXB 4GOXA 3BGWA 2FJUA 1Q21A 3QXCA 5D3MA 6CHAC 4P0TA 4Q7KA 2SGAA 3DM5A 3RC8A 2D3WA 2NOAA 3RP2A 4URWR 1T91A 2PZFA 1BUIA 2IPHA 1JR6A 4HI3A 4LBZA 1AZSC 3HDTA 4Q7ZA 2BZ6H 2PT7A 4CRCA 1BO6A 2FZLA 4BTIB 3LA6A 1FPHH 4DLUA 1SGQE 2BB4A 2A4GA 4H4FA 1EX7A 3QPUA 1P2MA 1PUJA 1GL7A 1QF9A 3LOXA 3F9EA 1YE8A 4H1UA 1FUKA 1XU4A 3HWSA 4B6FA 2WPJS 1UBEA 1YR6A 4MGYR 1TQDA 1BITA 2BWJA 2XITA 1O3CA 2LNCA 4WMEA 1J8AA 5L8VA 1S8FA 4AKGA 1CJVC 4K8BA 4PR0A 3PG5A 5D3QA 3PV4A 1F2TB 3K6YA 3A85A 1KMHA 2R0KA 3THYA 3REGA 5F6MA 1VIAA 4TYNA 1DT2A 3PWCA 5J4VA 1ZNWA 1VG9B 1KY3A 1QHRB 3SU1A 1C1MA 5KDOA 3RMLH 4LBYA 3LX8A 1SKYE 2QP3A 3OEHD 4D9QA 5FHTA 1O2KA 3M35A 1EFCA 1OP2A 1NN5A 1W0KD 4BZXA 1YZTA 3KHVA 1K1IA 3NBFA 3EIHA 3MYWA 4UKDA 2WV9A 4AYXA 3OF5A 1UVUH 4QT8C 3SO3A 1GI2A 3BN9A 3RXUA 1O35A 2CCKA 2GCOA 2CCGA 3RS4A 4A0RA 4M9QA 3OIWA 5A2MH 5A5GA 3A4NA 1ZD9A 5L3RA 2ZFQH 1TA2A 1E1RD 1YCPH 3IKJA 4TT3D 2ESTE 5G4BA 2FSFA 2OT3B 1X8LA 4GLYA 1YVDA 1YR8A 4RD3A 4RFVA 1KAOA 3AGQA 1DVRA 1PQAA 2GVFA 5JRZA 3BTGE 2F1HA 1QNJA 1MTSA 3OEHA 1O3PB 2IXGA 2CK3A 1KDOA 4OHZA 5C5NA 2BLWA 2FSIA 5FTLA 2WWIA 2GKVE 5L2ZH 1FN8A 1OHHA 4X8MA 2PW8H 4DJTA 2G83A 4JIMA 4OS4A 4LZ4B 3CX8A 4DEXA 2BDYA 1UKZA 3RRZA 1IXZA 1KXCA 4PHTA 2J2UA 2ZPRA 1D3DB 4PHFA 2WSMA 2G1KA 4U01A 3LLMA 4B2PA 2VF8A 1G291 1HY3A 1E0AA 2VIQA 1NG1A 4IXNA 1NRPH 3RXRA 4CT5A 4MKHA 3GJ6A 3LBHA 3GMTA 4Y79A 1ZSLA 3THYB 1SHKA 3GICB 3E0NB 3V4RA 3NDPA 3RDZA 2A5AA 1Q20A 2CEAA 2FOEA 4QG7A 3AKDA 1TU4A 4URUR 5EP2A 3V4FA 4X0WU 1FI8A 2CK3D 3L3TA 2JIZA 1H1BA 3PMAB 4JBWA 1O2JA 4NSYA 2QTVB 4D82A 2FMXA 3MMPA 2FX3A 1GHAF 1VKJA 1PZNA 1ETRH 2HYIC 3D6TB 1ZYUA 2JH6D 1EWQA 2FFQA 3TU7H 3MNSA 2ZFRH 2WPLS 1E1RA 1H4WA 5HM9A 4TT3A 5L3QA 1N25A 2BLOA 2YNMA 1MZDA 3CNLA 2FOGA 2UWOA 4AFSA 2GMTB 5E8EH 2YC2C 2OC1A 3CENA 4XVQA 4FUDA 2CHAB 4AX9H 4NGAH 2F9LA 3I92A 3NHBA 1QVRA 1GBDA 4MNWA 1SGPE 1TNDA 1XNJA 2WJIA 1FLEE 4R0IA 4ARZA 3MRSA 2A5YB 1L1JA 2ZVQX 4DWJA 3B9FH 3ZVGA 3ZZ4A 1V2OT 1VECA 1IQLA 3TIUA 2SFAA 3QQ5A 1F5KU 5UKDA 5L3SA 1A82A 1NKSA 1K1PA 3KIDU 3AASA 3NC0C 4HTCH 1QA0A 3VAAA 4HLDA 1CKEA 4HYYA 2BQ7B 1GL6A 3T62A 1UKYA 2A1DB 3ZVNA 1CJUC 5DKMA 1QHGA 3BK7A 1DY8A 1ZSJA 2OFOA 2ZDVH 1RRFA 5J5CA 1DG3A 5BWMA 4C2UA 4JLDA 3QWCH 1FTNA 4DUGA 4M9SA 2AK3A 4EPTA 2E87A 1EASA 1OFIA 4MH0R 3T34A 5L2YH 4R2IA 1SOTA 3MO9A 1OXXK 4X6PA 3OYPA 3U9AH 1OSSA 1NU9A 4LHYA 1BTUA 3UMFA 3GFPA 4Q1FA 1Y59T 5F2EA 3VGCC 1Q1ZA 2C99A 4KVGA 1T8TA 4ZI2A 1EFTA 2ZU4A 1YR9A 3KZ1E 1E9AA 3T29A 3GJ4A 4E07A 5H70A 1EX6A 2BY9X 3IBGA 3ZZDA 1R0ZA 2E9SA 5AUOB 1P2IA 3CO5A 4Y71A 5IK2D 4DLYA 2QM8A 4URVR 5FR1A 4PC3A 1GVZA 1Q3XA 1SHZA 5T6DA 8GCHG 4KP0A 4CREA 1WV7H 2YOHA 1LVOA 4VGCB 4YOGA 2WV4A 4QFMA 4TMVA 4KFSA 3SV6A 4LZZA 2PUXB 4ILEA 2VA8A 1CT0E 4KO8A 1YF4A 4C3ZA 5C1XA 2YV5A 2F9OA 2ZGCA 3AM1A 2VIWA 1JECA 1UADA 3GLIA 1WRBA 1TE0A 4V0LA 4K46A 4YZUA 4F38A 1TPSA 1E9SA 4KODA 3W8RA 3SHWA 4RKOB 3BC1A 5DNYB 4X2YA 1RIWC 1GJDB 2QROA 3QZRA 5DGXA 1M34E 1GJ7B 4PC6A 3W34A 2IUSA 3GP8A 3LFUA 3T12A 4KVAA 1DUAA 4HAVA 1DWDH 3F8TA 1CR1A 4IDNA 1ZW6A 3CBQA 3PUZA 2OM2A 4ZDIA 4IGDA 1MD8A 1G16A 2ZU6A 4MPXA 1AS0A 1H8IH 3ZJYA 1RYFA 2O8CB 2BY5X 3A58B 3NH9A 4TYPA 3HU3A 1OPHB 3KL4A 4C0SA 1PYTC 2GV6A 4O97A 1THPB 4MRPA 4BZPA 3UREA 1A5HA 2CF8H 1TX6A 4P33A 1RJXB 1AFEH 3UPEA 2DBYA 3U7FB 3UKDA 2ZIAA 1HAOH 2KBEA 2YC4C 3AQ4A 3BFVA 3PYHA 5B6OA 1GIAA 4DZZA 3IITA 1OIXA 4QL3A 1NFWA 4WZAE 3S7HB 3ZZ3A 1MH0A 2L0XA 2DWQA 2WWYA 3UNQA 2IBMA 1W0ZU 3A36A 1O5CB 3UXMA 2ZKSA 1FV9A 5FPTA 3KQHA 1ODFA 3P8OA 3RXPA 2QA5A 1MBQA 1CGHA 4OM9A 1XVOA 1SVSA 1YRAA 4DEYA 2WUBA 1E9EA 1P03A 1V2MT 2NPFA 3TNFA 2NO7A 1AO5A 4XFQA 1T3SA 5KYKA 1FDPA 3GCOA 2C5LA 1GHWH 1C2EA 5FTMA 1ZC4A 1MTNC 1BMMH 2NU3E 4LJ7A 1AVXA 1Q12A 5FOUA 4I31A 1TX4B 4M8NE 3DOFA 2GZ9A 4CRWB 1O39A 3BAFA 4IVPA 3VR3A 4CEIB 1E2QA 3FE2A 1KDTA 4RKEA 1NI3A 2OC8A 4I1OA 1AU8A 3REFA 4TLBA 1YPKH 2VSXA 3KKPA 3LNCA 4CVNA 1ELDE 4B2CA 2QV1A 1TUIA 1G36A 3IG6B 4ABYA 1Y3VA 4BFVA 1ZGIA 4ISIH 2D1JA 3P8NA 1E79D 1NY6A 3FB4A 3WRYC 4NL4H 3CP7A 1NSTA 2RG3A 2XC0A 1HGTH 4DDWA 1Y5AT 5E95A 1WXQA 1G5PA 2DR3A 5CK5A 2GDJA 3BOSA 1BQYA 1YPMH 4AZ2B 3OIUA 4JVLA 3AH8A 2F3RA 3GDSA 2QP4A 1P2OA 1EZXC 4PHHA 1ZP6A 5DI9A 5HE8A 2JLQA 3VB4A 1FW6A 4B32A 1ZM9A 1BB0B 5CIWA 1S4QA 1SL3A 5CM8B 1P3JA 1QZXA 1HDTH 2GTBA 1SVPA 2HXSA 1W7GH 5J4KA 2VH6A 1GNRA 2CXVA 4C2TA 1Z29A 1P72A 4KTUA 4UFDH 3W6PA 5FPSA 2Z9GA 2WPHS 3LGTA 4ISOA 3BRWD 3QKSA 1DDJA 2BQ6B 1P2JA 2EFEB 2ZSAA 5C67A 2ZGHA 1N5KA 1UTJA 4DW2U 4KI0A 4CEJA 4MYHA 5DI3A 2OG2A 3HPTB 2BDAA 2X19A 2KSQA 3LY5A 4CRDA 3EDXB 1KAGA 1NESE 3MOCA 2ZFPH 2FP7B 3ITIA 5F8ZA 4JLVA 3U98H 1M74A 4JK6A 3RXHA 4B2AA 2O9QA 1KLTA 3RRYA 2GCHF 1GDUA 2C8VA 2XXAB 1KSHA 2GWHA 4HUTA 5E2OA 2WPKS 1QHIA 2HNTC 1SOZA 1P0SH 2G5NA 1U9IC 4ZKDA 1OYYA 4RY2A 1AKEA 2BVRH 4NU0A 1RZ3A 1KKLA 1FOEB 2AERH 3QJYA 5DP4A 2B9LA 2NZJA 1TALA 4DT1B 1DXPA 4YQFA 4Q4JB 1DS2E 4HDOB 2OP9A 3RXTA 1YQTA 1O2XA 3ZZBA 1BTWA 1TAGA 3K70B 4IFEA 3BS4A 3TKLA 3CNOA 1GHYH 1T8LA 4TWYA 4MDSA 3TJUA 1SGFG 4KITB 3SJKA 2SHKA 3PXGA 4B35A 3CKLA 3PUXA 4QGHA 1GSIA 3S9AA 4UNQA 1HUQA 3RXMA 4DLWA 2IF0A 4QHTA 1N5JA 1FY5A 1SULA 5LB2A 4FUCA 2ZPSA 3R3GB 1U8ZA 2B8OH 3GLHB 1ZJKA 4YMSA 3RU4D 1P2TA 2H92A 3AGPA 3L0PA 3MO3A 4M0LA 2HXYA 2A45B 2XJ9A 1EFRD 1DX5M 1AQ7A 1FUUA 4PQRA 3EC2A 1KO5A 3LONA 1QTFA 2ZF0H 2GTPA 5K8TA 3FHCB 4JT2A 4GMXA 2O8UA 2BVNA 5HXFA 2Z3EA 3C16C 5K8LA 1XD8A 1AZZA 1U98A 4BAMB 2ATXA 4MRRA 3T1TA 2PL3A 4XOJA 4CH2B 1ZNXA 4E22A 4TY7A 1W1WA 2F7SA 3LQRA 2O8WA 2P6UA 2OLKA 1VITF 5H8WA 3BG4C 2HCBA 1J7KA 4LYHA 1GRQA 5JBTA 3EW9A 2O0KA 1QG2A 2ZE8A 4KFRA 1HT2E 2JA1A 1DXWA 4EQ6B 1E98A 1WMSA 1DELA 3HGPA 2GESA 5KU1A 2AX4A 2ZR7A 3MUFA 4DSUA 4Q18A 1DFPA 2O8TA 4DDUA 1SVIA 4WZBE 1LFDB 2A4OA 4LK4A 2V3HH 1R2QA 1HCGA 4MYCA 3C15C 5F9FA 2IYWA 4QNMA 1M9UA 3FDIA 1GFIA 1HYQA 5G3YA 2WM9B 1QRXA 3BJIC 3ZVBA 2IWRA 2AMPA 4ESTE 2FH5B 1KK1A 1ZHRA 3TK9A 4WMDA 3M1IA 1HUTH 4WZ6A 4LK2A 4AYWA 1SFIA 3TJNA 1RC8A 2XTZA 2BY7X 2IUTA 4JLNA 2J0VA 3CIOA 1T4UH 2ZR9A 2BMEA 3I3SR 4OK3A 2CN0H 1TGTA 1GMHG 1GG6C 1B0EA 1HJAC 2H9HA 2ZCKP 1SKQA 2XWBI 4MYTA 3PMJA 1UTMA 2RDLA 4TSFA 4HB4A 3ATLA 1GHBF 5CDFA 2CE7A 3GJ0A 2DHRA 1AS2A 4K8YA 3QG5A 1VYVA 5GCHG 1N6KA 1SHHB 5IDVA 3NBXX 4JLKA 4KGAA 1CQQA 2CJWA 1TMTH 3A7WA 3SJBA 4XBDA 2PH1A 2ZJ8A 1LKAA 5EUQB 1CF4A 3E16B 1RTKA 1TFXA 4EJSC 2QT0A 4R7ZA 3OX7U 1UCYE 3JVUA 1NPMA 4DBLC 3PEVA 2QA9E 1N8OB 1Z83A 1LQDB 3IWMA 5DN6A 4DIIH 3C4JA 5GCHF 1RRGA 4I8GA 3RANA 2DCUA 4Q21A 221PA 2XBVA 2WWWA 2PSXA 1JNYA 5KDDA 2A31A 3RXOA 2PCJA 1C1TA 5TVKA 2P95A 3TBKA 5CK4A 4ISHH 2GJKA 4NMMA 1NBMA 1XMSA 2VF7A 1IN8A 2ZYUX 3P20A 3ZIAA 2VWOA 2ZFSA 4AG2A 1XXHA 1N2CE 3K1JA 2FSHA 4P31A 4JJZA 4OHYA 4DLSA 3ZVLA 3RLYH 1SQTA 1OXTA 1UVSH 4JMPA 1IAUA 4K3JA 2XBXA 5JBQA 1DEKA 1M7BA 1RW4A 1Y3WA 3SGBE 1NFXA 3Q76A 2BX4A 3CPEA 1O2GH 2A5JA 3ND8A 3E91A 1RVDA 5CB8A 2XGJA 2R0LA 4D81A 4BFTA 2WHXA 4PQYA 1BOQA 3PV5A 5JZVA 2EYQA 1N6XA 3RDPA 1BYIA 4TQUS 1E2IA 4Q00A 4HDCA 3FMFA 3LWNA 5FL7A 1BBRK 2IF2A 4ZKEA 2BD7A 2Y8EA 1SXJC 2R3YA 2ZWLH 1P10A 2MSDB 3ZIAD 4L16A 2P5SA 4TTQA 1G2MA 2H5EA 4LC1A 5B6LA 3FYHA 3SU6A 3CX7A 2F6RA 1H9HE 3ND9A 1N3BA 1S6FA 1U2RA 2ZECA 4ABAA 2CHVA 2V8OA 1GI3A 1NY22 1CP2A 2GK6A 1LDTT 1S84A 4JKYA 2QXJA 4NWKA 1CXZA 1E9CA 1IXRC 5TY0A 1NP6A 4C9BA 1JOUB 2FTMA 3SQWA 2N46A 2GEDA 1ESTA 3AKCA 1TONA 2XXLA 4IHQA 1DOAA 1X8JA 2GVDC 2RA0A 1XMVA 1SGEE 1BH2A 1FX0B 1HAGE 1ZHPA 3GDVA 1YZKA 1NT1A 1G41A 4TYQA 2A4RA 3DDCA 1M6NA 1G9XA 1P11E 2ZA5A 3R20A 5C1YA 5H4IB 1I2DA 1SGIB 4AFZA 1O2OA 1TBRH 1KI4A 2VHCA 1XEWY 1O87A 4PFSA 1WBBA 3ENSB 2O8CA 4ZV4A 3PTBA 5A8YA 1Z1IA 3A7XA 1GJ4H 2G9NA 3UNSA 1Z5ZA 1O5EH 1JALA 4KSCA 1KXFA 1ZMNA 1E38B 5HCIA 1H8EA 3O8CA 1EATA 1EGAA 2J45A 3GJ3A 2QBYA 4EKDA 2FODA 5GJ4B 2AGEX 1EFUA 1AQYA 1OT3A 3T25A 4LOYH 4DB2A 4QHYA 2HJGA 1QY6A 1R4AA 4OQXA 4AURA 4G5SA 4X1SU 5DP3A 1AGPA 4RI0A 5TCAA 2IHBA 1G3CA 3AVUA 1YPLH 1C4V2 1ZMXA 1SQAA 4YT6H 1GKYA 1G19A 3A1WA 4V03A 621PA 3C27B 2FPZA 4QBFA 4JLPA 2P3SA 2IXFA 1JXMA 2J41A 1GNPA 1BTYA 3QKSB 1QFKH 2OAQ1 3GY4A 3GLFE 1W13U 1W7XH 1EB1H 1BBRE 3KQDA 4XBBA 1FAKH 2BVXH 2XW9A 2IHYA 1DSUA 1GBIA 1C1QA 4LWZA 3ADCA 5E0HA 4KU4A 1ZHMA 1RJ9B 1NLFA 4DVAU 3AF1A 1S3GA 1B0UA 2ZRLA 1O2UA 1NIPA 1KDPA 3A8CA 4DT7B 4EPRA 1PQ5A 1SGRE 2FOFA 1C9PA 3PUYA 5GPIB 5DO4H 3AVYA 4CRGA 3TAHA 4C0AC 1UJ2A 1I4DD 1HV8A 2C9YA 1S83A 5FR2A 1AB9B 2RGNC 4C30A 1EP5A 4BPBA 2R6AA 3ZVFA 2DE8A 2PGQB 3MH5A 4X8OA 4I1UA 3I32A 5GDSH 1UDXA 1FP7A 4GCHF 2VB0A 3CRQA 1O2IA 3AF0A 3STIA 2P3UB 1DUEA 3ZZ0A 1WE2A 2Z43A 1E2HA 2GHIA 3SFZA 1KTSB 1P02A 1GMHF 3I78A 3BBPA 3B2EA 3QUSA 1JXOA 1K21H 1NJGA 1CIPA 1OWHA 1TGSZ 2AFQB 3PUWA 3ATMA 4DLXA 5KTYA 2BEJA 1P3CA 5LB4A 2A4QA 2QYIA 5FUVA 3MI4A 2XC5A 1QJ1B 2BDGA 1AB9C 1W46A 2QSYA 3B1VA 3BB4A 721PA 4TL7A 4DIDA 1T4VH 4MRNA 3A89A 1XJCA 1UMAH 5H68A 1CGJE 3FANA 4F91B 4ZKRU 4KLNA 1ZYOA 1FL9A 3OEED 1CRPA 1WU1A 4K1TA 4F4JA 3AAVA 3RS2A 4IEEA 2H7VA 1BBRH 4BWYA 1E36B 2AFHE 2OBMA 1R5BA 3K70C 1VCPA 1H65A 3MO6A 1Y63A 4NHOA 2QXHA 5FUYA 1II0A 2F83A 1XM1A 2JJ1A 3H84A 2A7HA 1QL8A 1GI4A 1TIOA 2CJIA 2VIVA 5EJEA 1FPCH 2SNWA 1SGCA 2XZLA 1VG8A 2Z83A 4JL8A 2XEXA 3JZ2B 5KNCA 2XOKD 4TPIZ 1K5GA 3GJ7A 4M9ZA 1P5ZB 3WMGA 1OHHD 3UWIA 5DP8A 4AKHA 1SMFE 1THSH 1KK2A 2J0UB 4U02A 1EPTC 1K1JA 1II8A 2VNTA 4TMTA 1C1NA 1TNKA 2P67A 1TRYA 2FE4A 1E32A 4N0DA 2EI7A 1J16A 3KJEA 3QBTA 1P2VA 3T2NA 5K7RA 4Q01A 1CHOG 1XUIA 4ABHA 1W36D 1CHGA 4EAQA 1F0UA 2OV2A 2TMKA 3HYTA 3QXXA 1DITH 2C8ZB 5J4YA 2CF9H 2ZYVX 2A5IA 1OS8A 2BDIA 3AVVA 4V0OA 2IN2A 4BZQA 1N0UA 2WTUA 1GMDF 4E5UA 5C4GB 4B34A 2GGVB 3KEEA 3TMKA 3LC5A 1IXSB 4KAXA 1G32B 2XB2A 1NIJA 1YHNA 1TWXB 1GBHA 4FXPA 2V9PA 2EFGA 5GJCA 1NBMD 5B64A 1DSTA 4I1VA 2ORIA 1KK3A 4AK9A 4X6OA 4ERNA 5JHGB 3GFOA 2W0MA 4HGCA 3M3VA 1IQFA 1SXJE 3VGCB 2HUPA 3WNBA 4UONA 1J99A 5BYJA 3BH6A 2NZ8A 5HKKA 3TUJC 3C8UA 2FS9A 4K1SA 2G1JA 1DLKB 2AXPA 1IQEA 1W0JD 3CPJB 4FU9A 2FEMA 1JR3A 1UK3A 2KAIA 2G55A 3M7UA 3NKKA 3K0CC 4TZ6A 2D2DA 1SXJD 4NA9H 2HT1A 4B3DA 1MRNA 1G18A 2WIAA 1D9XA 3WHKA 2BXTH 2CLSA 3RXSA 2Z4SA 1EOLA 1K1OA 1SR5C 1Q1EA 3LJJA 2D7CA 1AQUA 3NWJA 1NKTA 3SE0A 2WJYA 2ZXUA 4QM7A 3RXGA 3G82C 2JLWA 5FBWB 3NHAA 2FDAA 1G3QA 4ZKOU 1OKXA 1PPZA 4Q4AB 4JLMA 2ANWA 1G7SA 2Z0MA 1UTKA 1A5IA 4UEHH 3TSOA 1FNMA 1SGYE 1F2UB 3N70A 3UG6A 3GCNA 3SUFA 1S6HA 4ZDKA 1GCTB 1P73A 4C0JA 3OIVA 3GY6A 2BQWB 1Z47A 3GCHC 4WXIA 1N6IA 3SJAA 1HA3A 3CW2A 1ZJDA 1TPOA 1F2TA 1VJ9U 2Y80A 3W95A 1TQ2A 2ZI9A 1KSJA 1W4CA 4FMCF 4XIGS 3LH3A 3ZYDA 4FUGA 4CT4B 2PLFA 1CHOF 4WH8A 5IK2A 4IKEA 4DIEA 4B44A 4ZMAH 2ORWA 1DAMA 2PMDA 4B48A 1BRAA 1O34A 1W14U 1A1RA 4N1AA 4JYVH 2GV7A 2F9NA 3TNTA 3U6BA 4MGZR 4C0BA 3DFJA 4E09A 3RLWH 2F1JA 3B9PA 2IYLD 1YLCA 2YVUA 2IYVA 4R98A 2FG5A 2Q6TA 1W12U 5HPYB 1JIRA 3ZYCA 1HTWA 5T1VA 1A2BA 3UNRA 3SFVA 5HTKA 1K28D 2WPDD 9LPRA 1WQVH 1ZINA 1Z6YA 1TBZH 4UNSA 1KO7A 1BMFA 3G01A 1GMDG 4TL9A 3E1XB 4G1UC 3MH7A 4DG4A 2ANBA 4JT4A 2GAOA 1Z6XA 3DZDA 1W4RA 1D2MA 1E2JA 4B6EA 2ODBA 2RGGA 4NE2A 2EA3A 5IDKA 3ZZUA 4Q7MB 3ZS9A 3TUZC 5FOSA 2JKHA 3CRMA 4R71A 3C5HA 1MO6A 5JJKA 1EXMA 2V3OH 3FZZA 1PJRA 1P9WA 1R0YA 2YOLA 1L4ZA 5FX5A 1UCYH 2CHAC 1O31A 1NFYA 3AV0B 3GCHB 3CNNA 5A0AE 4G5RA 3F0TA 2A78A 2WAYA 3RXKA 3DOEA 3IO3A 3PUVA 3RXDA 2Q1JA 2QE7D 3CZPA 2OCVB 1C5QA 3OFNA 1BIFA 4AYYB 1KY2A 1FP6A 4W5JA 1FY3A 5EODA 1KNQA 1G3DA 2AYWA 4AOQA 5JB9S 3QEOA 1C1SA 4D80A 1G3UA 1R0XA 2OCPA 3OEEA 2GEVA 3VXFH 5B2ZA 1W0YH 1V2VT 4EJSA 3GISB 3AEZA 2BY6X 2LKDA 4B43A 4O3MA 2QAJA 1Z0DA 5ANRB 4ACBA 2JH0D 4RVCA 1HQCA 2WVJA 1IQNA 1O2WA 1F6BA 1YKSA 1J14A 1EP6A 3UK6A 1G8YA 3D62A 3PV0A 2I3BA 1SGTA 1ZAKA 1T8OA 4M1MA 2C90B 4CRAA 2XTNA 1W7AA 1ELOA 2DWPA 4PC1A 3SJ9A 4TLCA 1QA7A 4B47A 2VP6A 3SHAH 3CR8A 3LGVA 4MNVA 4BFYA 1HT1E 4C0QC 1OV4A 4O0MA 3M37A 5KPDA 1E2PA 3B60A 1KSNA 1IQHA 1KLJH 4WH6A 2PZEA 3H09A 5AUQA 5JEEA 5FPKA 1ELBA 2OE2A 1EFRA 1Z22A 2QAGA 1ANDA 1OH6A 2G8TA 4HAXA 5EE9A 4BFSA 1OH8A 1S81A 4CDGA 1R8SA 3LC3A 1ID5H 1O3NA 1R5OA 1SLVB 1S1CA 1ZU5A 5E7JA 1SVKA 1SGWA 2R9VA 3EX7C 1ZOMA 1NRNH 4Y0YE 3RC4A 4EPYA 4Z51A 4XD7A 3BORA 1QQUA 3OFND 3GLGA 2WZQA 1PYTD 2ZGJA 4ACAA 2J0UA 4XTCS 3E90B 3ADDA 2VQSA 1KXBA 3TH4H 2O8BA 1SGNE 4LC0A 1K8RA 3RXLA 1NRQH 1O2RA 4IEIA 1C5VA 3EIQA 4JZKA 1GBKA 1W44A 1UTPA 3LKWA 3P8FA 5DGJA 4IMQA 1Y5UT 3N5CA 2AD1A 3SOPA 1MAYA 4A8JA 1ZMJA 3VB5A 3TGPA 1BS1A 4OI0A 1W4AA 2VBCA 3SV2H 4DSTA 1GL0E 2ZS7A 1GITA 3IUYA 2C2HA 2OCBA 1T31A 2MSCB 1G64A 3UOUA 2F4LA 1NL3A 2ZDNA 1ZNYA 1A1VA 4BEBA 2CJWB 5B30A 2WICA 3AAUA 5BW8A 3ZYEA 4UNNA 2UZIR 2ODYB 4U5XA 2JASA 1W11U 4RD4A 4GDFA 1FY1A 3KGPA 3GY5A 1KDRA 2R9PA 2PSYA 4ZCIA 1MZAA 3CPHA 4WXPA 3WNDA 4M1TA 2BMFA 4GSOA 4MG3A 1P04A 4YXWD 3U3MA 3TAUA 2FS8A 2YJTD 3BTHE 2ZVPX 2HF8A 3CRVA 4B3XA 4AGJA 4PSAA 4BRWA 5FOWA 1GHZA 1R7RA 3LBNA 1X1SA 4O2LA 1G37A 3P1JA 1YCPK 2XTTB 3Q85A 1AA9A 4KTCA 2GF9A 3SYJA 3K09A 2QENA 5LDDC 1OWEA 1AKSB 3FP7E 2PX0A 4KFUA 3THWB 1SHYA 2ZAOA 3SNCA 2V35A 3H7OA 1C5SA 1L1NA 4HLCA 1TL7C 2O0HA 2GA8A 1NVUQ 2HDNB 4HZIA 3SU2A 5SGAE 1LNZA 4RSPA 4RKJB 1O5GH 1S2MA 4EQ6A 2ZU1A 2WPDA 2QL6A 3BERA 2C95A 1TA6A 2PMKA 4S2EA 3THXB 5GXPA 1XPUA 1G20E 3K9GA 3TH3H 4CF7A 1YZQA 1RIFA 4IBLH 1W2GA 3RVBA 1QRZA 4A36A 3MNXA 1MV5A 4LPKA 1T5LA 1UTOA 4FIDA 1UBFA 2ZI2H 2VHQA 1C4U2 3WYGA 1W8BH 1D3QB 2BOVA 3IILA 3FKSA 2RGAA 4EJSB 4V0ME 4C7OB 3RABA 3AVOA 4AWXA 2KB0A 1P8VC 5JLJA 5C1UA 2IC5A 3WBJA 1J90A 1OWIA 2OO7A 5DK1A 2VEDA 4BRUA 2KE5A 1KJYA 2DPXA 1SZPA 2REBA 2W0SA 4OKSA 2J38A 1ZPZA 1COWA 2WWGA 1O36A 1IQJA 3FHOA 2RHDA 3FZDA 2RHMA 3PEUA 1JPJA 4AFQA 1NRRH 1E96A 4GNKA 1HAVB 1GGDB 4LPSA 2F1RA 4NPHA 1GG6B 2GJ8A 3BXZA 1SKYB 1C2FA 2GCPA 3NPSA 2ZJ5A 2H8KA 4Y8XA 2RGEA 2ZTZA 4NFEA 1TQ4A 2DFKB 2F3CE 2D8WA 2PKSC 1E0JA 1OW3B 4OHXA 2P16A 2CL0X 5EP1A 4XWKA 3QIAA 3ATKA 4TMKA 4JLAA 2FWRA 5K8UA 2ZI7A 2F9PA 1GAJA 1YC0A 3BTWE 1OFUX 3RMMH 3V00A 3RXFA 5AJZA 1N6HA 3R9IA 4JCNA 1O3OA 3X1XA 1D9ZA 1UEIA 5EQRA 4BEJA 1L8QA 2BIFA 3KXLA 1LMWB 1Q57A 4CZ2A 4BUJA 2VP5A 3W9YA 3P17H 4Q9LA 1IJFA 3VNVA 1HJ8A 3IIKA 3GYLB 2C8XB 1EJNA 1KSGA 1C5ZB 3B1ZA 3EA8A 2H16A 1GHVH 1ABJH 2ANMH 1T8MA 2H9EH 1F0RA 1O5FH 4Z8YA 1FY8E 2FZZA 3GY7A 3QDZB 2ZR0A 3EAQA 2EFCB 1OP8A 4VGCC 1TPAE 5DLQC 3HATH 2RGDA 4D25A 1N6OA 2BDTA 2ILNA 1XX9A 3HU1A 3DA9B 1BHXB 2BDHA 2O8EA 2OK5A 3CUEF 1KIMA 1HIAB 4BLTA 1TGBA 1E0SA 1Q44A 4I8KA 1V2WT 5CJPA 3SW2B 2BLVA 2QXIA 4ZROA 3SN8A 4GI7A 4GP6A 1X86B 4JK5A 1TX7A 3ZZ5A 5KSZA 1VDZA 2ODQA 5J4HA 4X1NU 2FFHA 1LHEH 1MABB 3DM9B 1HEIA 1HQYE 2VSOA 2ZHWH 5TARA 1JB1A 1NN6A 4M1WA 5BN5A 2OFWA 7KMEH 3TITA 1ZUHA 3MH4A 1HAYB 1JPNA 4CEHB 4FUBA 5T6FA 4HEJA 1JMOH 1F5NA 4BAOB 5IF9A 3QOFA 3I62A 2Z9IA 3LX5A 2FSGA 3ZQJA 3ZVDA 1ANEA 2PEYA 3RWOA 4LHXA 4NIYA 1FZQA 1YU9A 3FWYA 1NM6A 4Q1DA 4PAMA 4DDTA 2JEOA 1TADA 3LV8A 5F3WB 1TNLA 3RMOH 3PV2A 3ECCA 4GFDA 5LPNA 4BXWA 3N2EA 2JJ2A 2XCNA 3GY3A 5CJ2A 2O8BB 1D6WA 3GPLA 2B92A 3T5FH 1XD2A 1SI5H 2BM0A 4NIWA 3MH6A 3SBKA 1B5GH 1NY5A 1TMBH 4YXWA 3KQEA 2W58A 4DCNA 5HYOA 4Q9IA 1AZ8A 1D6RA 4QBGB 5ESBA 1CR2A 3M7TA 1TF5A 3CB4A 3E3TA 1PUIA 4NWLA 1MU6B 3FAOA 1P2QA 2GP9B 4GCHG 3A81A 2G0TA 5CM9C 1J70A 1DWBH 3SR0A 4L5BA 3DMNA 2HNTE 1WBGB 1VGCC 4E7RG 2IS2A 1US8B 1K22H 3EZ7A 4B3GA 4LUCA 4AY2A 1H8ED 4ZIRA 3K0CA 2OQ5A 1VCMA 1P9NA 5A8XA 4BFUA 1HAVA 421PA 2Q6FA 3KQUA 1BTZA 1ZJ6A 3SYNA 1RRKA 4R8TB 3MWIU 1UFQA 2WUCA 4P32A 3HPQA 4X1QU 3RU4T 4J2YB 3MWKA 1Z6GA 1F48A 5F03A 4GT1A 1S0QA 1MU8B 3EAJA 1XD9A 1S0UA 3NXSA 3THOA 2ZS9A 7GCHG 3CF2A 1P60A 1AGJA 4QXAA 4F4OC 4I8HA 2IL1A 4IVQA 4HZUA 4I32A 2W26A 4UQOA 1S1MA 5K8IA 1ZZZA 2MMCA 2THFB 1NRJB 1E34B 4BECA 2AWNA 1AUJA 4XD7D 4Q48A 3R0FA 4MA4A 1WA5A 1TTTA 3E2IA 1NVWQ 1EQ9A 2TGAA 3ZH9B 3LAWA 4I99A 5T6GA 1L0ZA 5AFYH 4G01B 2J95A 2VP4A 3EWSA 2X1VA 1G30B 2DFNA 2IK8A 1DOJA 5FPHA 1GM5A 2HLDD 3ZD7A 2ODWA 2G51A 3R8CA 4TN1A 3T35A 2I6SA 2DFTA 1D9IA 4JVSB 2PUQH 3SV7A 4ZDJA 3GJ5A 3VHXA 1WAYB 9ESTA 2AEIH 3MD0A 4ABDA 2HGTH 1LVBA 3QF4A 1ESNA 4B2IA 3EZ9A 2AH4X 5IHPA 2GZ7A 1UEJA 4FU7A 3UUZA 1E9BA 2ZJYA 1VCQA 1KSFX 5KOYA 3F1SB 3OTPA 1CBUA 1QB1A 4WXVA 1GUAA 1GL9B 3OE7D 5JWOA 3T26A 3M4YA 2C04A 1XJQA 2ZSFA 4O25A 3ZS8A 1EZQA 4XBCA 1ZCAA 3KUDA 1QHSA 2H6MA 6LPRA 4IN2A 2ZTSA 2OXCA 3M3TA 2SGFE 3BEFB 5F8XA 3SOSA 1W2KH 1MR3F 5BPEA 1MTUA 1O2SA 5LD2B 3KTAB 1XBTA 3A1VA 2ZIQH 1WCV1 3NBZC 5FAHA 2ZRGA 5KSYA 3ZVRA 1RD3B 3AK5A 5CLLA 3ODFA 3SZNA 2IUUA 1PLLA 2W2XA 1GHAG 3BTDE 2AIPA 3KN2A 4NYIR 5GIBA 5AR1A 2IEYA 3ZZ7A 2ZUBA 1MTWA 3RXJA 1LPKB 4RJLA 4B2LA 2Y7ZA 1P09A 1IQGA 2B7BA 1SVLA 3T27A 3OE7A 3IPYA 4FW9A 3VR5A 5J47A 3RC6A 4TMWA 3W94A 4L9WA 5I46H 5EXXA 3T5DA 3K2UA 1MKWK 2VJ1A 3B8JA 1SSXA 2JH5D 1MO3A 4X8HA 2Q9CA 1RGQA 1T3HA 1C1OA 1C4OA 1PQ8A 2AMQA 4HSEA 3GLFA 2CE2X 3Q5DA 5LH8A 1S9HA 3DVLA 1JXPA 3P95A 2SGEE 3ZGXA 1E9FA 3B6EA 4OJKA 4AKEA 2P2LA 4NTZA 3F9HA 3E70C 5TDHA 3X1YA 4FMCB 1A61H 5JEDA 1VMAA 1BJUA 3UIEA 2G81E 1Z2AA 1Y5BT 4A6LA 4NCJA 1ARBA 4LJ5A 1Q3TA 2ODPA 1TBQH 4XH9B 4GZMA 2ZE6A 4NYIQ 1QBOA 2KAIB 5DHAA 4JSTA 2BCJQ 4WVFA 1ZM2A 2WOJA 2QTFA 1LB1B 1D6JA 4M53A 2FV8A 4NCHA 3DO6A 1LY1A 1PFXC 3SJIA 1V43A 5B57C 4NFFA 1EZUC 2RGCA 1U8YA 2IYRA 1QJ7B 5TJXA 4AFUA 4C0LA 1U90A 1AFQC 1YCPM 2O8LA 1GCTC 3ZDQA 2J7KA 4M1KA 3SBDA 1U0HC 3Q72A 3QK1A 1AN1E 3SQHE 3PLKA 3TVJB 2YINC 2FI4E 3IIJA 3E5HA 5L6NH 4RZ3A 3SJ8A 4G5GA 4HAYA 4S35A 1Y3YA 2F3TA 2BYAX 4ZUHA 2C93B 2FPKA 4YO9A 3KJGA 5CITA 2PCLA 1E3MA 2ZSBA 4IDOA 4QGFA 4A1FA 5EOKA 3A1SA 3NWUA 4YLGA 4UXHA 3T15A 2MMGA 3L0SA 4FCWA 1QRAA 4FINA 1QHNA 2BVSH 2PJZA 3FFGA 2IYYA 5FOTA 4OS7A 4I4LA 3CF0A 4ZHAA 3V7TA 1AFQB 3ZVAA 1UTLM 1BMLA 3LT3A 2ZDLA 5E3HA 1IN6A 2AD5A 4O2RA 1VJAU 5A09A 1Q31A 2NMVA 3FKQA 3ONWA 1LTOA 2PT5A 3D49H 1EFHA 2WMOB 1EESA 3U5ZB 1SGDE 3VKGA 2EW1A 1EZSC 2YHSA 2ZYWX 1Z6AA 3U8OH 2H1LA 1C2GA 3LXRA 4DLRA 4UDWH 4Q1CA 3S1AA 2Q21A 3QO6A 4ABIA 2EWVA 1UO6A 3ZV9A 4YMWA 2P0EA 3KQBA 3UWKA 2D2FA 2YWFA 3QEJA 3C14C 2CCJA 5A0BA 2XCFA 1Z71A 3FGNA 2FOBA 3BTEE 8LPRA 1E69A 1W49A 3DFLA 4URZR 1NNEA 2CNWD 2DYKA 3W5IA 5JCZA 4EIWA 5BRRE 5KHOC 2ZUCA 3BE4A 4XSKU 1ZIPA 3N7OA 3I8XA 3NEJA 2JATA 1OH7A 1Z8JB 1PLJA 5TB5A 3PR1A 4QKQA 2QUZA 3VB6A 3IGFA 3DEFA 2AL7A 1HAIH 2XB4A 1GMCF 3PQCA 5DE3A 2BJVA 1DAIA 1ZRKA 3TRFA 4Y0AA 3GCTF 2WYGA 3A8TA 2J59A 2ZHEH 3VFDA 5DG6A 1JI0A 2D4HA 4Q4HB 1OF1A 5C20A 4A0FA 5C18A 2PTNA 2JLRA 1WYKA 2O8FB 2WIBA 2OEPA 2GZ8A 1CSOE 2AHOA 1IY0A 4OK6A 3B1XA 3B9QA 3TPIZ 5EQQA 3KKNA 8OHMA 1XXHB 1UVOA 2YWEA 3HPRA 1JJ7A 2Z94A 3C41J 2FLRH 4JL6A 1NBME 3WMEA 4YC7A 4O3UA 3URCA 2P3TB 3SNAA 1XCGB 4MVNA 2QY0B 4TTPA 5EW2H 1J9CH 6ESTA 3DHWC 4OS2A 2ZZUH 1Z8RA 4LY6A 3U4QA 2ZPQA 1L4YA 5FPYA 1ABIH 2XOKA 3RNLA 5EU8A 1PPCE 3CWQA 1CT4E 1XD2B 3WYFA 2FYQA 2BM2A 3H4MA 2FOMB 2R2WU 5HCNA 5L3VA 1ACBE 2VPPA 3LH5A 1SGFA 4FUHA 3QG1A 3NEYA 4MPVA 5EUMA 5DN6D 5M04A 4J1YA 2J87A 4DDVA 3P26A 2A3RA 1GILA 2P8OB 1XXFA 1Z8FA 4ABGA 1O5BB 4YLUA 1ZSKA 3NH6A 2J0QA 1CLUA 1HXEH 1YR7A 1P2SA 2XZOA 2JGNA 4HB3A 4GPTA 1R0WA 1G8GA 3BSQA 2GEUA 2GCTB 4G5QA 2A5FA 1TUEA 3BWDD 3ZLJA 2J94A 4L4UA 2A5DA 1IQKA 2RCNA 1G3EA 4NONA 2UUFB 3QZQA 1O3KA 2VGCC 2FGJA 2RA3A 1XTJA 4UJ5A 4B3FX 4W9MC 2R62A 4OHVA 2FPLA 5JWHA 1AI8H 4MPUA 2FI3E 2ZREA 4FMDB 2G4TA 1FTSA 2HV8A 4BTUB 5J4QA 4AI6A 3SORA 3X2SA 4FD2A 3SUGA 2VINA 4CGZA 1XTSA 1ELCA 2J4IA 4LZ1H 4YDSA 2VU8E 2W3IA 1ZRHA 2AKAB 2KWIA 2ZROA 4C0HA 4WOPA 3MWYW 2WWFA 5C46F 2IS1A 2FGKA 1HE8B 3NVAA 1Z0FA 4A15A 4NZLA 3TSWA 5FBQB 1VPLA 3QKUA 3HK3B 2BKEA 2IOTA 1CR4A 5TV2A 1YYY1 4AGKA 2ZNKH 5CYPA 2FEOA 2V7QD 4FUIA 2QORA 2BDBA 1JBUH 3QN7A 4NYJQ 2EFDB 1UF9A 4TYYA 2HLDA 5FUWA 4ABBA 1PV4A 2ZAMA 3A86A 2YOFA 1RE0A 4KFTA 5HE9A 1HIAA 4ZPXA 3WRXC 3AVPA 2FYRA 4RFSB 2Y7XA 3T06B 4MUAA 1FNNA 4G5OA 5EGMA 1DS6A 1Q22A 3MJHA 3VXEH 7GCHF 3Q77A 2CDNA 2H1UA 1OKKD 5L30H 2GXQA 1PLKA 1F7ZA 2JJ2D 5EE0A 1QJ6B 2C8YB 3URDA 4JJKA 1GDQA 4WBSA 1C2HA 4ESHA 2QIQA 4EPWA 3ICEA 1VYTA 2QZ4A 1IOEA 3QBVA 5KO2A 2WMNB 1W0KA 1CRQA 3JZ1B 5FH9A 4U00A 1W3CA 3Q8XB 4Z1MA 4TSFD 2NO0A 4E05H 2V0BA 1FX0A 4BLSA 3NUMA 2AK2A 3BIUH 1ZTKA 3Q00A 4Y11E 4Q47A 1NJFA 2WKRA 1GI0A 2JLXA 4FI3C 2FWWA 1RTFB 1O3GA 1N0VC 2NO6A 2BD4A 3RXAA 4OJQA 1LPZB 4POAA 3TW4A 4MRSA 2GETA 2OCYC 1F5RA 2GXSA 1W48A 4YMTA 5DH9A 1AVWA 1SVMA 4XJXA 4ISNA 4OI2A 1J8MF 1XVMA 2C9OA 4Q80A 1NRSH 3WNCA 2F55A 4BFZA 3WY8A 3KB2A 1FAXA 1KI9A 1TPZA 3QF7A 2W5EA 2ZJOA 2FZ4A 4ZHLU 4RFSA 1E79A 3MTYA 3I5XA 1P2KA 1FJSA 3V0XA 2ZHDA 1IN7A 1WP9A 1TEXA 1SQOA 4YESB 5KPJA 2B8WA 2G52A 1XEWX 3A7YA 5T3HA 4TTRA 3KNXA 3IHWA 2FX6A 4QGGA 5EPYA 4UNPA 3K9HA 2GKSA 4E7NA 1DAHA 3CRRA 4TYWA 2CHGA 3P92A 1QHHB 1YPJH 5A0FA 1XEXB 3A84A 1XMIA 3ZZAA 4K8OA 4IW3B 2GCOB 1ORFA 4JZDH 5B58C 3MGCA 5FCKA 1G17A 5GJBA 2CNWA 4ZKSU 1Y3XA 3I73A 4IJMA 2G88A 2STAE 3W3AA 1WCZA 1IONA 3VU9A 1C2MA 1OXVA 5BN4A 4MKIA 1C1VH 1T3LA 3U44B 2GILA 4INKA 1HAPH 2HT6A 3SNHA 3TJVA 2NIPA 1TGNA 2BBWA 4GMDA 4XWAA 4HB0A 1P9RA 4P4UA 2QAGC 4A92A 3EPHA 1ZM4A 4DUGD 1LS6A 3TIFA 2WINI 4LHWA 2PJRA 1Z0KA 1TOCB 3U3KA 4XVUA 2R6GA 4Q4HA 4LHVA 1MKXK 4HZUB 4KBGA 3T1QA 1EK0A 1O2VA 4A4DA 1AK2A 1JR3D 3O47A 1QR3E 3H1TA 2P3FH 1UBGA 3LJOA 2QQEA 4TMZA 4W7SA 1DWCH 4RSGA 4D26A 1OSNA 1GVKB 2ZDAH 3D31A 1WUNH 1KI3A 3GJXC 4JL5A 2JJ8A 3QLPH 4RCZA 4X2WA 3R9XA 1KXEA 5EXMA 3RWMB 521PA 3DUXH 2QT1A 1YZNA 3RYTC 2F9VA 2V4ZA 1KOFA 3GFTA 1UK4A 2J0SA 1FUJA 2O8FA 1QQ4A 1OFHA 1ZVQA 4Q7LA 1A4RA 5JBCS 3TLOA 1V3XA 3L43A 4XWOA 1Q1BA 2A9KA 1NFUA 2ANKH 2Z9JA 3E8LA 5DJ7A 4WJG2 4V02A 1A7JA 4DVGA 4NKRA 2IS4A 2J7PA 1ETTH 2OXRA 3VB7A 2J1LA 5EQTA 3SGQE 2R2MB 1ELTA 1JJVA 1PPFE 4Q7JB 4BFWA 2JLYA 1MOZA 2Q3HA 3KXKA 1YKTA 2GAAA 1T7CA 4I8JA 1DBSA 2B21A 3IO5A 3Q5EA 4GPGA 1OFTA 4ON9A 1UVTH 2FESH 2YNAA 2PKAB 3F9FA 2N1BA 4AC9A 3TH2H 1G7CA 2GXUA 3TK5A 5KSOA 1G6HA 5JB8S 4XVRA 2QNRA 4Q66C 3U7EB 1C5YB 1OKKA 3WBKA 2R6CA 4CEHA 5HR5A 1E9RA 4A9AA 5DPAA 5E4FA 2JLSA 4X8UH 3NZIA 3EA7A 2W3KA 2WSSD 2Z3CA 4Z8XA 4KTSA 4HFPB 1B0FA 5EE1A 2G6BA 2QGRA 2QPAA 2XX3A 3SYKA 2W6IA 1GJ5H 3RSLA 3L8YA 4FCTA 3G5UA 3ATIA 3RXBA 1NG9A 4G0NA 2H5DA 1E35B 1Y8TA 4GHQA 2IYQA 1MABA 2OLJA 1TEVA 1ZCBA 1T32A 1HXFH 1C1PA 3VKWA 4QBHA 4BASA 1TQ7B 3I1FA 2VP0A 2ZRIA 3SI7A 5AJVB 1JQLB 3A1TA 5JYIA 3AVQA 1Z2CA 3AF3A 3MU8A 5AWFC 2ZI5A 3QTVH 1G5RA 3V9PA 1V2QT 4ISLA 1VHLA 1JAHA 1LO6A 3A4MA 5AK0A 1ANCA 4DGJA 1CJMA 3BB1A 2RGNA 4C0KA 1UK2A 4ASUA 2FOLA 3GLFB 2ZU0C 5GNDA 1CULC 1C1UH 1NN3A 5FBIA 5FI1B 1TMKA 3A7TA 3IPXA 1BKDR 1O2PA 4BFXA 3QENA 4K60A 1QG4A 1T8UA 4I33A 1AKYA 5KNDA 4LXBH 1IY2A 3D23A 2D74A 1BYUA 1YZLA 3KFVA 3Q7QA 5CYOA 1GBMA 2QMEA 3D8BA 1DANH 1QCPA 1II9A 2TGTA 1HAXB 2HWLB 4UD9H 2VL7A 4ZCLA 3BIVH 1PPGE 5JBAS 4FU8A 3DPUA 3U7GA 1E4YA 2BHRA 3VX3A 5EE5B 1UJ1A 1OXUA 3GQBA 2G00A 2FX4A 2NQ2C 3K9NA 1ANKA 1L4UA 3RC5A 5J4LA 4Q1AA 2NPIA 2CXXA 1VCNA 3VPKA 1O3BA 2WJVA 2O5VA 3VFEA 3MMGA 1XRJA 4BLPA 5JMTA 3BFXA 2ZU5A 1UDWA 2ZRNA 3GDUA 4RCYA 3UWJH 1YJ5A 3U1IB 1KDQA 1E37B 5JSZA 5IYTA 3TH5A 1TGCA 4MGKR 1MQ5A 3PM3A 2ZI3A 3JZMA 1V2LT 1MH1A 2B7CA 3I5YA 5JCPA 1HLTH 4LV8B 3AKEA 1GRNA 1NSFA 1R6BX 4KBFA 1LVYA 3L0IB 3H0KA 1O33A 4CEJB 2GZHA 1S0RA 3UQVA 3U2QA 3TE6A 3HP1A 2P6RA 2NU1E 1IBRA 4Q03A 4A5TS 1DY9A 1AN0A 4CYMA 3SC3A 3A7ZA 2ZDKA 4DIHH 5EXNA 5CDFE 1EAIA 4GVUA 4ZHMU 3T61A 2AS9A 4AB9A 2WJHA 2BTCE 2LKCA 4BLRA 1EKBB 3VR4A 2RH5A 3RXIA 1DAFA 4C7OA 1Y3UA 3RXEA 3AB3A 2STBE 3ZVCA 2RGBA 3DMDA 4EPXA 2WWHA 2IYUA 2OBQA 4B73A 4Q5IA 3TQFA 4L8GA 1G2LA 1KYNA 1RS0A 4IFBA 1UTNA 3MWJA 4AN7A 1MKYA 3L0OA 2ZRKA 1JRSA 3NXPA 3B13B 2BLQA 1N0WA 3B1WA 4B75A 2Q9BA 4UE7H 2OUKA 4DCSA 1ZNZA 2WPIS 3ZZ9A 3EA5A 3NDBB 2C03A 1NMZA 2QE7A 1S85A 1EXFA 5L3QB 2Z6VA 4ITRC 1P62B 3S7KB 1Y3AA 4MNYA 4US2R 1LQEA 2EU8A 2OC0A 4ESVA 4NP6A 4Z54A 5SZIA 1DG1G 1O3DA 3UIRA 2IJOB 1DAGA 3VR2A 2ZPTX 4KYUA 2WJJA 4OBEA 3P32A 1ELVA 4YTAA 4OQNA 3WMFA 3KQLA 3KQKA 1UPTA 3FP6E 4JYCA 1V2NT 2EQBA 2QGZA 3PIRA 3SZRA 4NIVA 1II8B 2HF9A 3FP8E 2A0QB 2VIIA 4LBVA 3EZFA 5GWZA 3B5JA 3GEEA 2I1QA 1KIGH 2J3EA 2SNVA 2CL7X 5DP6A 2BDCA 3TJZA 1EOJA 4Q4LA 4G3XA 4PSVA 1KYIA 4HLQB 3SJOA 1R5NA 1XUKA 1G8HA 2ZG0H 1V6DA 5JI3E 1ZBDA 1GBTA 3IHLA 2X2EA 3KL6A 1G21E 3PROA 2QY9A 4ZDWA 4INLA 1FMGA 1XMNB 2GZAA 2ECKA 4DJZB 1AD8H 4I8LA 4LYFA 1FMJA 2V54A 5PTPA 4Q4AA 1GJAB 5JPMH 1UKEA 4PQFA 2Z9KA 1HAZB 3GCTG 3B1YA 2R6DA 2WWXA 1CU1A 3DL0A 4IDQA 3W8NA 2BJWA 4BAHB 4YLQH 4W5WA 3VR6A 3M5LA 1JQJC 4B1TA 3T1OA 2ZTYA 3KF2A 3U1JB 1GPZA 3EA0A 2CVHA 3TGKE 1UM8A 4BANB 4PHGA 3LIWA 3MFJA 1C5XB 4OI1A 3U7HB 4M7GA 4Z0KA 1ZTLA 4P3YA 4TLEA 4HATA 4D4JA 1ZR0A 2DFLA 4JVNA 1SG8B 4NYMR 2OCAA 4KHZA 4MRVA 2HOBA 3VU9B 4PSKA 2BD9A 4BTTB 2V1XA 5FFMA 4DSNA 1A0JA 1QURH 3HK6B 3U8RH 3CX6A 3CH5A 1D3TB 1AIPA 2UUJB 3BF6H 1VGCB 1C2DA 2AXNA 3L2OB 2BZAA 3KCGH 1O2NA 1EAXA 1DPFA 4GOKA 3KQNA 4ZXXH 3CF6R 4IDPA 2D7DA 5SZKB 4PPGA 2Q6GA 4HAZA 1GG2A 4K2YA 5GJWC 2W00A 5L3SB 4Y8YA 4Q19A 3UANA 1P61B 1KXAA 1XP8A 3LVRE 1C1WH 5JJLA 4I1SA 1J15A 1MMJN 1O5AB 2PLRA 1C2IA 3SV9A 4GZLA 3A7VA 2JJ1D 2PZGA 1DVAH 1A3EH 4X2VA 1KJZA 4GSYA 3K53A 3EPLA 2AKYA 2SGQE 1E2GA 2P59A 1BTHH 2FIRH 2ZS8A 4A1TA 1F3OA 3QSYA 3QXSA 4HI0E 5FL7D 5FXLA 4ZAEA 2QMUA 5HZKA 3RM2H 4FVDA 1H8HA 3KJHA 1IM2A 4Q7YA 2J9RA 3WY9A 3L8ZA 1N5LA 2M5TA 5FBEA 3M61U 2KBFA 1UHBA 4HLUC 4JYTA 1J8YF 4JZFH 4IMZA 2QTHA 4QHSA 3HYRA 3PITA 5EPNA 1KI6A 1C9KA 2ZJZA 4H6TA 2F91A 3U69H 5JRJA 4KCGA 1TABE 1W36C 1XXDA 5HM2A 4Y7BA 2W2TA 2GVZC 1TF2A 5LGOA 3QKRA 2ZJBA 3B78A 2W83A 1XEXA 2DUCA 3S9BA 4M1YA 2QU8A 2EYUA 1UKVY 5FTNA 3LW8A 2VH0A 4B71A 3UPUA 1GI7B 3KXIA 1S9DA 3PCRB 4MNXA 1Q1QA 1ZTJA 2R65A 2R44A 2HCJB 3C5CA 3VTKA 4JZEH 1V5WA 4LJYA 4OQMA 2NWNA 4FWIB 1W5SA 4YMUA 2ZO3H 5DP9A 3ICQB 4H9GA 1XDBA 2C96A 3KUCA 1DO2A 1XWIA 3LDAA 2ZFFH 5BN3A 2FMJA 4RD6A 4BE7B 1FQ3A 5JSZB 1TNGA 2AMDA 3IDQA 2OQUA 1N6RA 4XTRA 1XFAA 1PQ7A 3OHMA 3GY2A 4BOHA 1V2ST 2H9TH 2CLCX 2GDEH 1LHGH 1GDDA 4PO9A 4LRWA 5ETXA 5LPFA 5C1BA 3A1UA 5AJYA 1HRTH 1ESMA 2PFEA 3ASYA 5ESTE 2B5TB 3OY6U 1NROH 1P05A 4N3NA 3CM0A 3I72A 1K2I1 2WV5A 5EXSA 3VB3A 3EQ0H 3Q3KA 1LKBA 2JETB 4A0GA 2Z4RA 4MQBA 1QB9A 5FBLB 1ELAA 1G3RA 1D2EA 4FN5A 4OYHA 3EG5A 1KZGB 2DWOA 1FIWA 1VCOA 5C5OA 3B85A 7ESTE 2ONKA 1VCIA 1AS3A 5BQ5A 2YWHA 1OX1A 1C5TA 5EXPA 1F2UA 2TGDA 2QQ0A 5CMXH 4NZQA 4UXJA 1ZD8A 3GCGA 1YRBA 1HNEE 3EPJA 3R7WB 3SEAA 4MDFA 2DY1A 5JS7A 3QI2A 2Z6BD 4BQSA 1MRSA 1GBLA 2JIZD 2P5TB 3GEIA 4B3BA 3NCLA 3FOZA 1XZQA 4DRZA 2OD3B 1NS3A 2G4UA 2QMHA 2BBSA 2ZITA 1YGCH 4IOJA 1S5SA 3KB1A 4Q1BA 2ZRAA 4PROA 1RIWB 2F43B 2BCGY 7LPRA 2BV3A 1V2RT 2PBRA 4XSGA 5EW1H 1BHXF 4JBXA 2O8DA 4PC2A 4MPWA 1GP2A 1HPGA 4LV5B 1N1LA 3IEUA 1LVMA 2V1UA 2XBWA 3CR7A 4NSVA 4QOSA 2J34A 2HPQH 4EFLA 3L82B 2J92A 1M1YE 2ZEJA 2OC7A 2JCSA 1GZSA 4EUNA 2HVXA 2XRCA 4DKXA 3K70D 4IOMA 2AGIX 1CT2E 3L6PA 2FFAA 3A6PC 2NU0E
chains in the Genus database with same CATH superfamily
3EZ6A 4P08A 1BRUP 1EDEA 4DC9A 6CHAB 2OV1A 3V3TA 1E3LA 3P9CA 1YBFA 3GVPA 3DT0H 1U3DA 1BEZA 1RU3A 2G1PA 2GD4B 1EAUA 2XWPA 3AINA 4I3GA 3H9EO 4REQA 2NG1A 4D2IA 1FN6A 3DE1X 3TRHA 3M7QA 4H1VA 2P27A 5HZMA 5FTJA 3TLYA 4EM6A 4I4IA 3VU3A 3LPNA 1FQKA 1THRH 5DSZA 1TKAA 3LVBA 4PGFA 2O5RA 4OAQA 3ZI4A 4MHTA 1P01A 1GPNA 5JBBS 1JR3E 1URPA 4CEIA 4PZUA 2G3YA 3HE3A 1BTXA 2PT9A 2J5UA 4N3BA 3I77A 2Q45A 2B99A 2ATVA 2FXVA 1JLLB 2VWMA 5IJ9B 2A7XA 1K86A 4Y0ZE 2ATEA 2JW5A 2OBXA 4WA7A 4XAQA 5KHAA 5ADUS 1F7UA 1QIMA 1SPJA 3OY7A 4HDKB 2M32A 4QJ4A 4RTNA 1XDWA 1C4WA 4HDSA 4JBYA 5EJ7A 1B23P 3D8TA 4FYKA 2X4IA 3ZPXA 3MU5A 3AC0A 4FB5A 3UH1A 1VTKA 4F3CA 1NVVR 5FO0A 4IN1A 8ABPA 3WJ1A 1R0KA 1RKVA 3ESBA 4PIVA 5LNK1 2ZU3A 2JAQA 4MCIA 1ZZEA 4ZZ2A 3KX2A 4P7KA 4G56A 2OCXA 1CUBA 2XSZD 2YBDA 4L8FA 3R6GA 1VITH 3LKVA 1MEEA 1W4LA 1M6VA 3PL5A 1YZGA 3W4KA 1NYRA 2GVNA 3H1AA 4QELA 4WAUA 2OBLA 2PPLA 3GJYA 3G79A 3LL7A 1PNRA 2WR8A 2R3UA 3JVIA 4HFNA 1TJ3A 4QLAA 5AKKA 2ZSEA 3QY0A 3M6AA 1RCFA 3KHTA 4O3FA 4PPFA 4QRIA 4A8JB 4J1TA 1B0AA 1VKZA 5DGHA 1BX3A 3FVFB 1U6JA 3HHPA 1XKBC 3GFBA 2BR4A 2UYYA 3HB5X 2VVUA 2UUYA 3LQ2A 5C3NA 2W90A 4JWTA 3D6NB 4A82A 3GY8A 3LU9B 3QU7A 4G85A 3SU8A 1JG6A 2J46A 2WHPA 2YICA 1M54A 4HPJB 4OTZA 4WK2B 2UXBB 3OIYA 3RYIB 5EIBD 1I4WA 2NO9A 1HV7A 4XQEA 4Q34A 2P4QA 4QU8A 2TIOA 4Y6LA 5CLGA 1FUYB 1AUTC 1N8KA 4EGFA 2WU0A 1F4LA 1UQTA 4WKCA 4A03A 1O9HA 2ASEA 3DC7A 2PL5A 3PE6A 4W9NC 5E3JA 1MOSA 2WM2A 3AHHA 4G36A 3BG4B 3NWEA 4GQAA 3UB4A 3T5GA 2UXDB 4LYAA 1JIVA 3IRUA 4HNHA 1WBDA 4KIUA 1RYDA 2BD2A 1GT6A 2EF0A 4PO1A 4XYMA 4Y7CA 1BMNH 5J3JA 2G5GX 2Q1TA 4WKGA 1DQSA 1EJ6A 1Z0JA 3KKMA 2PP6A 2GM9A 3FTQA 2FEQH 2B98A 1CA8B 2QTBA 2PKAA 4RA6A 1SLUB 1M2FA 1KBOA 3BTKE 4KKDA 4M99A 2D5CA 2GT1A 3RSOA 1QMGA 3UJDA 3TM5A 3WDLA 4Z4GA 2N42A 1DE7H 1QV7A 3TLGB 2W6JA 4ZICA 2BEWB 2R2AA 4D6PA 1CBWC 2LVBA 5IUJC 5I47A 3KELA 3OT5A 1VE3A 5A8ZA 2HHHB 3VZPA 3LGUA 3ELWA 4X94A 3TVTA 3I29A 2VAWA 4MUEA 4R8LA 2EFHB 4YMLA 2C8JA 3ML1A 3O8OB 1ZRBA 4J0QA 2W7SA 2YKGA 1MO4A 2ZGXH 1H1LB 1XTKA 3WG9A 1OXGA 1YLNA 4OP2A 4XGIA 5DXFA 1CA0C 4YTEA 3QU4A 3Q15C 4PNEA 2WHPB 4ZAGA 3DB2A 2QN3A 4IJ6A 1RXWA 3RU9A 4ZA2A 6NULA 3EHDA 2Y1KA 1XUGA 3W3AD 3RCBA 3QGNB 4B40A 4UMFA 4ZOLF 2QPOA 3KWMA 2O2HA