5FPSA

Structure of hepatitis c virus (hcv) full-length ns3 complex with small-molecule ligand 3-aminobenzene-1,2-dicarboxylic acid (at1246) in an alternate binding site.
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
642
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
molecule keywords HEPATITIS C VIRUS FULL-LENGTH NS3 COMPLEX
total genus 202
structure length 642
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5fpsA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fpsA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5fpsA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpsA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpsA03
2V6NA 4DUGA 4B33A 1C5XB 2QP4A 4TTQA 3ZYEA 3GJXC 3NUMA 1RJXB 2W0MA 1ZZZA 2QY0B 1SSXA 2QXHA 2FODA 1G1MA 3NEJA 3PUVA 1TNLA 1IXZA 4DLUA 1IJFA 4H42U 1VPLA 2WPIS 3RXEA 1O0DH 4PC7A 4D2IA 2A45B 1GJDB 1IN5A 5A2MH 3ZV9A 1DANH 3TAHA 3F8TA 4LPSA 4BFVA 1OXSC 2ZDNA 2Q3MA 3SQHE 4PZYA 3MFYA 1NRPH 4TT3A 4UD9H 4C4PA 4IDHA 4URUR 1CKEA 2A30A 3EDXB 4XOJA 1VHTA 5JB9S 3E8LA 2TPIZ 3FGNA 4PZLA 1A1VA 1W8BH 3U6KA 1WXQA 3BIFA 4LX0A 4DLRA 1UK2A 1N8OC 2ZJYA 1RVDA 2ZI2H 5G3YA 1EP5A 4Q7ZA 1S1MA 3ZZDA 5A0FA 2JETB 2RAPA 5LDDC 4PO9A 4NYJR 4KI0A 1KDQA 1T4VH 4I4LA 1OPXA 1T4GA 3I77A 2ZCKP 2ZAOA 5FR2A 2JIZD 1A3BH 1GHWH 1KI6B 1ZD8A 4MGKR 1SGPE 1G30B 4SGBE 1V6DA 1PJPA 2TGDA 5AK0A 4ASUA 2BM0A 4TMTA 2RGAA 5L3QA 4AGJA 2DE8A 1O3JA 3UR6A 4Q9JA 2DFNA 2OD3B 2CEAA 3MLEA 3KCGH 4HB3A 1P61B 1W2HA 4NYMQ 4ZDWA 3RRMA 1TA6A 2DY1A 4P33A 1G8HA 3CPJB 4O3UA 4AY2A 1R5NA 2OUAA 1RE0A 1ELOA 4AGKA 4IOLA 3TH5A 4KHZA 1CQQA 2CXVA 4Z1MD 4JL8A 3CF2A 1D5CA 3DZ8A 1CJMA 4ABEA 1H8DH 1XTKA 3SNBA 5L3QB 1RS0A 5G4BA 5DNYB 3KQHA 2GCOA 5CK4A 3TGKE 5EUMA 2XC5A 3K70C 4EIWA 4Q02A 3GY8A 1O3OA 1DICA 1KDQB 3OIWA 2HT1A 3QKRB 2JLVA 1CT2E 1GCDA 3UFAA 4MYUA 1YPHC 1VCIA 1DSUA 3T34A 3MRSA 4BUJA 1AFQB 2D1JA 2V7QD 3D6TB 1OP0A 2ZM5A 1T8MA 1G4UR 4JZFH 3RXTA 3X1XA 521PA 4ZROA 1GGDC 3VB5A 2AN9A 2Y7ZA 3SI4H 5SZIA 4A6XA 1N2CE 2ZRNA 2G1KA 2HNTF 3AF1A 4CR9A 5JDUB 1C4V2 4PHHA 1LF0A 2HF9A 1AUTC 4K8YA 5TCAA 4CEHB 3TNSA 1A4WH 3PUWA 4A0HA 4X2YA 4FUCA 2O52A 1Z8GA 1QIXB 7LPRA 2SNVA 3K0SA 3DPUA 4PFSA 2F3RA 2A1DB 2GVFA 4KP0A 3U1JB 1RC8A 2R44A 3CS0A 2THFB 5LD2C 3RC5A 1XD2A 2OBOA 2PHBA 1TYNA 4DURA 2WSMA 5EZ5A 2FI3E 5EGMA 1Z6XA 4BOHA 1VMAA 4IOMA 4RFSA 1WBDA 1X6VA 9ESTA 2A9KA 3CENA 3AW1A 5FTLA 3IBYA 5E0GA 2BD2A 4D4JA 1Z0FA 4FCTA 1KDOA 1O2HA 3THXA 1GJ5H 5DP8A 2ZSBA 2GBLC 4RCYA 4ITRC 3B9FH 4V0KA 2FSIA 2XC0A 4XD7A 3GJ0A 1KZ7B 1MABB 2YWGA 2FFBA 1ZSJA 3QF4B 1D2MA 4LSGA 5IRCD 2GD4B 1KKLA 2O8DA 3MNCA 1JBKA 2TMKA 4GNKA 1SMFE 2DWQA 1G7TA 3NC1C 1XWIA 1ZTKA 4OQLA 1XU4A 1VITH 3AF0A 1SVWA 4XWKA 3F68H 1ANDA 2AWOA 2NU0E 2XCFA 3MU4A 5A8YA 2BKUA 2JLXA 2BY5X 1P2TA 5GXPA 3EPKA 1P60A 4IVPA 1W10U 2NU2E 1QQUA 1C1VH 1MV5A 2W26A 2Q0HA 2VHTA 3MU5A 2GZ7A 4X0WU 2D06A 5KDDA 1O39A 5KDOA 5E2OA 1TRYA 5FUWA 1ELAA 4JL6A 6LPRA 2R3UA 1VZQH 1Z6GA 3RWOA 4TYPA 3BFXA 4MNYA 5F3WB 3FZDA 4BTIB 3IILA 3FZZA 4YXWA 2R2WU 1SGFA 2O8EB 4Q9HA 2BMDA 2J0UA 2AXPA 2V6JA 2VPPA 2PKSC 1DAGA 4NL4H 1MD7A 1XMIA 4PC2A 3IO5A 2HF8A 1ACBE 2GXAA 3X1YA 4FWIB 2FPZA 4ISHH 1NT1A 1TNGA 2G6BA 1E0SA 4ARZB 4AOQA 2ILNA 1G5TA 2RH5A 4TYQA 3MU0A 3ADBA 3SS8A 4CRFA 3WMFA 5CK5A 1YYY1 2C8YB 3EE0B 3MWYW 1ZIOA 1OV4A 4QGAA 2CLCX 1YM0A 3X1WA 4YMUA 3U4QA 2CJWB 4LGMA 2BQ7B 1NO9H 4I8GA 1W46A 4BTTB 1E1RA 1KZGB 4DLVA 1ZSLA 1N6PA 1C5QA 3Q7PA 3V0XA 1S6HA 2UWLA 2WUCA 3DT0H 1SQ5A 1GRQA 2OLKA 5HKKD 3QVVA 4BNRA 1FI8A 1G32B 2AIQA 1CRQA 3E90B 5FBEA 1Z6TA 1YPMH 1QB9A 1C2JA 4HLDA 4UNRA 1GGDB 4JJKA 1JJVA 3OE7D 5HM2A 1YLDA 5EZ6B 3IIMA 1MKWH 3EA8A 3FP8E 5JBBS 3W34A 1F5KU 2J9NA 2VEDA 3KXKA 3CX6A 2RGNA 1H8IH 1QB1A 4LZ1H 5IYTA 1TEXA 2W5EA 4LJ7A 3Q3XA 4KYIB 2Q6FA 5KO2A 3PFIA 1C9PA 1XZPA 2WJVA 2WMNB 1HAYB 1CGIE 1D9ZA 4CZ2A 4Z8XA 3UMSA 1TX7A 1G2MA 1LHFH 1RRKA 3STIA 3JVVA 4Q5IA 5LBIA 1X1SA 2G00A 2ZDKA 4IXMA 2XTMA 1ZNYA 1GMHG 2CE2X 1OYYA 4EPRA 821PA 2A7CA 3GY3A 1I4TD 5JS7A 3IHWA 2O8EA 4YMWA 3ZS9A 2OQ5A 3ZZ9A 2DBYA 3RU4E 3BRWD 2PSYA 2C9OA 5J4QA 1AZZA 1W2GA 4EFLA 3UXMA 5JB8S 2VH6A 2W3IA 4EQ6B 4ASUD 1ZJKA 2WAYA 3I32A 4XIGS 2B5TB 5FUVA 2EU8A 4OI2A 1DVAH 1AS3A 3EAJA 1BYUA 2ZR0A 4P32A 1VCWA 1T0JB 1R10A 4WZBE 4E03A 3GPLA 2Z4SA 4UKDA 4D82A 4P4UA 1TNHA 1WE2A 2HXSA 4X8LA 3NXPA 3ATKA 2ZGXH 3VEQB 4Z1MA 1SBWA 2F1RA 3E0PB 1HAVB 3PENA 3WYFA 1G9XA 4RI0A 4JZIA 1CHOF 4JVNA 1QFKH 1Z28A 5FBWB 2ZJ5A 1OYTH 1O5FH 7GCHG 1GI6A 1O32A 4IFBA 5CYOA 2F9OA 1GKUB 3WBKA 4AX9H 2I6SA 2XNSA 2O8DB 1PQAA 4ZKNU 1BDAA 3U3OA 3W9YA 3GJ6A 5GJWC 2ZJZA 4OK5A 1O2IA 1ESTA 2ZFSA 1GUAA 4F4CA 1SXJD 3F3YA 4WH6A 1XPUA 2HEIA 3S9BA 3VXEH 1ELFA 3Q77A 1IJEA 4Y0AA 3SO3A 3WMEA 3LGYA 4F91B 2BY6X 3ZVLA 4MA4A 4Q9IA 2Q9CA 3B5JA 2FTMA 2IJOB 2XZOA 3ZZ6A 3ZLJA 1OWHA 3S1AB 5H1YA 4Y8XA 3EWSA 2IXGA 2CMKA 3LDAA 2GXUA 2WOOA 3TMKA 1S96A 1SXJC 2ZNKH 3LC3A 2EFGA 2A5KA 3KL4A 1O2JA 1VDZA 2OLGA 1COWA 1SQOA 5CHAC 4RN6A 2ZITA 4PHFA 4BFZA 2ZS8A 4DIIH 1Z5ZA 1MU6B 2ZFPH 3V3MA 1D2EA 2VP2A 4OS7A 1K2I1 2ZANA 3PJRA 2OV2A 4QGGA 2CCJA 1UKVY 5TVKA 1VCOA 3HU2A 3DOFA 1Y3UA 3IQWA 3B23B 2HLDD 2KE5A 3M5LA 2Q6GA 2VL7A 3NH9A 2GTPA 2A5GA 1F2TB 5F6MA 1UVOA 2ZREA 3JZMA 3BV9B 2G4TA 3RNLA 3OY6U 1P9RA 1TPPA 2RA0A 4LWZA 1ZOMA 1LCYA 4PROA 1XEFA 5FPKA 4D0GA 4MPVA 4N0EA 2KJQA 1HAVA 4G3XA 4X1PU 2W2TA 4GCHG 1O2LA 1SGEE 2QMHA 3EZ2A 1XPRA 2R0KA 4Q7LA 2XBXA 8ESTE 4EPVA 1IQFA 2NZJA 4NGAH 5E4FA 3MNSA 1XJ0A 2EVWX 4RCZA 3RXRA 3QXJA 2OK5A 2ERYA 4ZKEA 4R2HA 1OFUX 4ASHA 2VIDA 4J2YB 2JATA 5JCPA 2WPDD 1R0WA 4K1EA 1GMDF 4C0AC 2AGEX 1ID5H 5FOUA 2VP5A 1Z83A 1TAGA 2ZG0H 4ZHAA 2WPMS 3HPRA 2X19A 3PV2A 3OEHD 4G5GA 5C18A 4LPKA 4X6OA 2JH0D 2ZF0H 3M37A 4E06H 1SHYA 1ZNXA 2C93B 4LJYA 3AK5A 3RXHA 1PPGE 3MWIU 1SVSA 1O5AB 1A0LA 3CP7A 1P2JA 1U8AA 5IHPA 3AVVA 5HZHA 4OHVA 3AVZA 4QNMA 3TJUA 1O30A 2XXLA 2AFQB 2BHRA 5D3MA 1P62B 4O3TA 1GM5A 1WV7H 1Z8JB 1FX0B 1GNRA 4OS6A 3CR7A 1MKWK 4DGJA 3ADCA 4AC9A 1F2UA 4GMDA 1UCYH 5HYOA 4WWYA 4WXVA 3KXLA 4B6EA 1BT7A 1P3EA 4JBYA 4Y8ZA 4WXRA 3LNCA 5F8XA 3GOVB 3ZD7A 4EPYA 2PEZA 1BUIA 1YPHE 1VITF 4LJ8A 3PV5A 1MTVA 3KL6A 1E2PA 4OHZA 4GMXA 1PQ7A 1RIWC 1TBZH 3RLYH 3NZIA 4ZMAH 1CHGA 1SGTA 3SYJA 1T5IA 1IAUA 1F6BA 1SVPA 3M61U 3CRVA 1XJCA 3PYHA 3TNTA 2ZPRA 1C4Y2 5EG4A 3FYHA 2KB0A 2VGCC 3P32A 2BZAA 2D3WA 4JMYA 1E2FA 1S0QA 1C1NA 3QPUA 4DIHH 4HB0A 2A2QH 1NBMD 2DFTA 1KGDA 1JB1A 2VIPA 3H7TA 3VXFH 3PV0A 5F8ZA 2WKRA 4OHWA 2Y82A 3HU1A 3AVQA 1HURA 3F1SB 4YOJA 1XDBA 2QP9X 1ZSKA 3U60B 3NCLA 2FMXA 1LVGA 1SULA 5TMPA 3E3TA 3FVQA 2XNIA 5EE9A 3B6EA 3OFNA 1P11E 4LJ6A 1ZP6A 2UZIR 2L0XA 3AVWA 1Q1EA 2HCBA 3I5YA 4ILEA 2J2UA 1WTGH 1HA3A 1UTOA 2V3OH 4O03A 2GZDA 4ZPXA 1VIAA 5EE3A 5EQSA 5FUYA 1KI2A 3P70B 1GTVA 2HXYA 1Z6YA 2JLRA 4AYXA 1EAWA 3QKUA 1INCA 1P03A 5B6LA 1YR6A 1NY6A 1KXCA 4JZKA 5FTKA 5K8LA 1S3SA 4CRAA 2ZIAA 3B9QA 5T6GA 1UTMA 4MQBA 4PC1A 3B9PA 3VTKA 2W00A 1FL9A 3TSWA 1WF3A 4DCUA 4BTUB 4YC7A 5L30H 3BWDD 2IYZA 3B78A 3PEYA 4TLDA 1FY3A 1LO6A 4B3FX 2YOFA 1P3CA 4Q7KA 1FMLA 2VSFA 2RCNA 3C27B 1HE8B 3W95A 2RGDA 4QGFA 3SJKA 3FMOB 3EX7C 3ITIA 2RB4A 1Q0UA 2O5VA 1E0JA 2OC0A 3OIVA 2FOEA 4BQSA 4A82A 1EFUA 4YO9A 2QF0A 2F9LA 3A6PC 1EUFA 2AD5A 4PQRA 1DVRA 3CW2A 3LY5A 4C0SA 4D8NA 4DLZA 4MITA 1IY0A 1NTPA 4XD7D 3VKGA 3UNRA 2OFXA 2KSQA 1W0JA 3H5CB 5IK2A 4UXIA 3DD2H 1S85A 1TNJA 1MCTA 4QBHA 4X2XA 3QK1A 1EAIA 1XUFA 1SHZA 2CVHA 2IUUA 4KFSA 3AB3A 2XNDA 4FU9A 1FFHA 2XEXA 2UKDA 4C0BA 4Q1CA 2PX0A 1X7AC 2X2FA 4CEJB 2V1UA 4OK6A 2EC9H 1TBQH 1AGJA 1NSTA 4BFXA 3QXCA 4V02A 3CX8A 3TAUA 2NO7A 5DPAA 2BBOA 2GRJA 3U1IB 4QFMA 4J1YA 2F3TA 2ZDLA 2BBSA 1XEWX 1BMMH 2QZ4A 3CRRA 1KJWA 4ZIRB 4NHOA 2GP9B 2GILA 4INLA 2A7QA 4HDQB 1V2NT 5DGJA 4DSOA 1O3DA 2C9YA 3W3AA 4E7NA 1DAMA 1G5PA 5JI2E 1QL9A 4BLQA 4IDNA 4U30A 4GCHF 1WB9A 1FY5A 3K9LA 3E6PH 1TUIA 2QENA 3PV4A 4EPXA 4HUTA 2QF3A 4FVDA 1E9EA 1HRTH 1W11U 3UPUA 2SNWA 1W4BA 2FSGA 1KO7A 1NRNH 1M2OB 1E37B 1F92A 4A5TS 2J94A 3THXB 1Q31A 1DSTA 1SVMA 1ZMXA 2CN0H 3A4NA 1ELTA 1P2MA 3THWA 2NG1A 3T29A 3K53A 3MGCA 4R0IA 1TGCA 1DO0A 3RC4A 1N6NA 1ZMNA 1RGQA 3C5CA 3C8UA 4D81A 5K8TA 3PLBA 3UOPA 4HGCA 4TMVA 2CCKA 2XJ4A 1SGIB 3UIRA 2BWJA 1NLZA 3QTOH 2A3RA 5HE9A 4A4DA 4FUFA 1NL3A 4BLRA 3E16B 3V00A 2Y7XA 2GCTB 2XWBI 1MTUA 4LYAA 1BTHH 1FIWA 4E22A 1ZC4A 3LA6A 4CF7A 1BBRE 4WVFA 2PH1A 2OP9A 3G0HA 1NRRH 2JJ2D 4M7GA 3RS2A 1GHXH 1K22H 4M53A 3IUYA 1O2ZA 4QKQA 1PZNA 3TR5A 1P9UA 3TUZC 1HIAA 1TMTH 3UKDA 2CK3A 4DB4A 4PX9A 4LOAA 3GISB 1DEKA 3BTME 1Z63A 2UUYA 3GLFE 5DH9A 3AVUA 3EARA 1DITH 1Z71A 5L2ZH 3TGPA 3TJOA 2WPJS 4JVLA 1B7XB 1LW7A 5AUNB 1M1YE 1AHTH 2HPQH 2UUKB 4CRDA 2IUSA 2KBFA 4CREA 1N5IA 4BAQB 1VGCB 1GBLA 5GPIB 2DFKB 2XJ9A 1V2KT 4PPNA 2PUXB 1PPFE 1EZSC 3GJ8A 1T6NA 4GP7A 3LD9A 1TPSA 4JLOA 4GHTA 2ZAMA 3A8BA 3SU0A 4YZUA 1IXSB 4DUGD 3SUFA 4P4SB 2UUFB 2JJ8A 1VYTA 3NHBA 3RRYA 4B75A 2AGIX 1W0KA 2FEMA 4J0QA 1ZCBA 3GFOA 4MDSA 4Z54A 1VYVA 3PMHB 4OHXA 3QZRA 4W5HA 4WOPA 2WPDA 2HCJB 421PA 1LVYA 3ZH9B 3LJOA 2UUJB 1NNEA 2V1XA 4M22A 3GCNA 3U44A 2BDCA 2VLIA 3UWOA 1E4YA 3P8FA 1H9LB 1EB1H 3K0FA 3QXSA 3L8ZA 5G53C 4ZI3A 1HJ9A 1GL1A 1S6FA 1GBFA 3LDXH 4IN1A 2OO7A 4OQMA 1XTIA 2VTKA 3Q8XB 2Z83A 6Q21A 1QF9A 1TQ4A 5GVRA 4S35A 1GBHA 1XUIA 3U69H 1E2HA 1PPCE 3LX8A 2XOKA 3WMGA 2JH5D 5SZKB 3SNDA 2YC2C 4AG5A 3NDBB 4KU4A 1E2MA 4AORA 1GJCB 2AD1A 1TB6H 2QORA 3HGPA 2BQWB 4TSFA 1KYIA 3NBFA 3K0FB 4AG1A 3LT3A 3QDZB 4D4KA 5J4VA 4EQ6A 1VG9B 4IXNA 3PLKA 1GILA 1UBEA 3GEHA 2IYTA 1JI0A 1O2SA 4OK3A 2CV3A 2JIZA 1TPAE 1Z6JH 5KNBA 3RS3A 2F83A 3CKLA 4V03A 2FOHA 5C20A 1HY3A 4HB4A 5J47A 2QN5T 1P3JA 5CM9C 5L6NH 5CM8B 4YDSA 2Z9JA 3LVQE 4A2QA 1X1RA 4P4SA 4GBMA 1NJFA 2BX3A 5DP6A 2F6RA 4MKHA 1HEIA 4C3ZA 2ONJA 2AKYA 3GCGA 2GKSA 2STAE 1E9AA 1ELGA 4U7DA 3A87A 3MWJA 4ZIRA 2QROA 5EP2A 1GBCA 4QJ5A 1AB9C 1YZNA 1JJ7A 3GMTA 4PC6A 4HAYA 1FPMA 2A7JA 4KGAA 1F2SE 2FLBH 2H9EH 4B48A 1NN1A 3A1TA 5F98A 2XTTB 2MSDB 2A4QA 5FPHA 2BY9X 1D3QB 3TQCA 4OS1A 4V0MA 1ELVA 5FTJA 1IQKA 2GMTB 5DP9A 2I4IA 2P59A 4E7RG 5FOXA 1G19A 2ZUDA 4M1KA 1MKXH 3MJHA 4XTRA 221PA 3OFND 3A1VA 2HGTH 2A5DA 2JAQA 2YJTD 3EA7A 1ZTJA 2FIRH 3RXCA 5FCRA 3ATMA 3QSYA 1ZPBA 3P26A 2BY7X 1EFTA 3B13B 1QHGA 1M6NA 4UNPA 1GCTC 2JA1A 3PMBB 1A7JA 2FOMB 1YP9A 4R7ZA 1NROH 4AIIA 1T8OA 2GEUA 2J38A 3V13A 1OXTA 5CIWA 2PWXA 3VX3A 2QGZA 2VWOA 2IN2A 1T8NA 4XOIA 4G5RA 4FUEA 2IS1A 3NH6A 2WYGA 2WYJA 2IEZA 2V6IA 1RW4A 3SHCH 2K1QA 3T1TA 3ZZ4A 4FW9A 3IPXA 1PUIA 3A37A 4NFEA 3HKJB 3RXGA 3L0SA 3CNNA 1W48A 1YZTA 5E7IA 3EIHA 4LBYA 5B30A 1PV4A 5BN3A 1KLTA 1FNMA 4DJZB 1XTRA 4B35A 3TK9A 4RZXA 3SJAA 1IY2A 4EDHA 1F7ZA 1A5IA 3UIEA 1FTNA 3OF5A 3I73A 3RYTC 2ZUCA 3MNBA 2QTVB 2F43A 2WKQA 3HPQA 2VA8A 1DUAA 2CCGA 3I5XA 3P27A 5BWMA 2PGBB 1K1NA 4O25A 4NCJA 1ESMA 5JSZA 3L8YA 1YZUA 3TJVA 2QA9E 1KK0A 2RCEA 5A4JA 2NPIA 2GDEH 1W7XH 4Q1FA 1Q2WA 2OHFA 3BXZA 4Q18A 4JKIA 1T3HA 3SOSA 4O2RA 4WMEA 4B2PA 1N6XA 3MWKA 4PXAA 1O5CB 4LC0A 4YMVA 1NC6A 2FA9A 1SFQB 3EPLA 3ZZCA 5E8EH 1NKTA 2CE7A 1VKJA 2ZRCA 4G5SA 2PSXA 3ZS8A 2VWNA 3TJZA 3KQLA 3FP6E 4YESB 4AURA 4GL2A 1YQTA 4JSTA 4FU7A 3FKSD 3ZVDA 1C1PA 2Z5FA 2A2XH 3QEJA 4K81B 3S7KB 3FMIA 2PW8H 1ANKA 3RDPA 1XTJA 1WCZA 3D23A 1P5ZB 3EZ7A 2QXJA 1OJLA 3EYDA 3D8BA 3P6ZB 1TOCB 3Q76A 1GMDG 2F3CE 1J8MF 1E2IA 3VX4A 3R9IA 4ZV4A 4JBXA 3BD9A 1OF1A 3FFBA 1NBME 5BN5A 3TU7H 4U2WA 3ZQJA 2MMGA 2Z9IA 3WYGA 3SQXA 1Y3YA 4L5BA 5JS8A 3G5UA 3OIUA 3THYB 3BH6A 4JLKA 1W4AA 5HZKA 3PROA 1GBKA 1KYNA 3P8OA 3ND9A 1O3KA 8GCHF 3MU8A 2W83A 3FOZA 2YC4C 2M5TA 2WWXA 1GI9B 2IS4A 2DHRA 1C5NH 4D7FA 4IFEA 3ZVGA 5FBRB 3W6OA 2B0FA 4MDFA 1S83A 4ZI2A 3O8DA 1QHNA 1U94A 1XUJA 1AZSC 2YOGA 5GJCA 4JL5A 4OGYA 4OBEA 1FN6A 4WA7A 1LVMA 1HQYE 1QHHB 1CBWB 2ZO3H 4Y8YA 2ZFQH 1KIMA 4H6SB 4LHVA 4X6PA 3R3GB 2G81E 2C78A 3LOXA 1P9SA 3OTJE 3VR4A 1XXHA 5HGGA 4HAWA 4YDHB 1Y3XA 3LONA 2OILA 1YKSA 3MOCA 3I61A 3GDVA 4C30A 4WMFA 3TK1A 3SJIA 1DS6A 4G5OA 2ODBA 3RXBA 3A8DA 3KNXA 4NP6A 1O34A 1OWIA 1YPLH 1JBUH 1XUGA 3LGIA 3FANA 3ZVRA 4BANB 1CBUA 4D80A 2GCOB 3KQEA 4JVSB 2OBNA 4ZDKA 3M3TA 121PA 2UVQA 3E70C 1DWCH 2Z9LA 1GBIA 4Z6AH 4Q7YA 1XF9A 3L43A 2A2ZA 3MI4A 1KO1A 1ODFA 2ODYB 1NI3A 1JXMA 2XBYA 4EJSB 3A1WA 5DIFA 2YWEA 1THRH 1UJ1A 3KQNA 1W44A 5JBQA 2P3TB 3OY5U 2N42A 3IHLA 1UBFA 5T1VA 2GAOA 3A8AA 3QBTA 2PFEA 3QPVA 4G01B 2Z4RA 3UMFA 2O8BA 5E2PA 4X2WA 4KV9A 1NF3A 4Q48A 3SHAH 3CNLA 1EJNA 1DADA 2XSZD 4I1OA 1W0KD 5DGXA 3KQDA 3I1FA 1NPMA 1HE1C 4NG9H 3W8RA 4CIDA 5ABWA 3UREA 4CRWB 4BGDA 4AYTA 1O3MA 1NN6A 5C1UA 1FZZA 4KELA 3CRQA 4TWZA 2P6RA 1XD2B 1Z06A 4TYDA 2FX4A 2BJVA 1P2QA 2WJJA 1GBEA 1U0HC 4PR0A 4TTPA 2QMEA 2IWHA 2LCFA 1QHXA 1WYKA 1THPB 1Q1BA 2B7BA 4QJ3A 1V2WT 1QL8A 5SZHB 2A32A 3HK3B 4OYHA 2ASEA 4ZHLU 4US0R 1OW3B 2GF0A 2WJGA 1F5LA 8LPRA 2QM7A 4B3BA 3LXRA 4L4UA 1DOAA 1ZHRA 2WVJA 3EC2A 3T15A 1GL0E 1Q21A 2Z94A 1RYFA 3QUMP 4JYVH 4WZAE 3ESTA 1FN8A 1YHNA 1NSFA 3TVDA 4WAUA 4NE2A 2FWRA 721PA 1OKXA 1LHEH 4MUAA 1NRSH 2QV1A 3QIAA 4RZ3A 4Y0ZE 4LV6A 3GY2A 4Q01A 1TAWA 1KI8A 4BXSA 2OINA 1X8KA 2AEIH 4MYCA 2ZPSA 1G17A 3NDPA 1EB2A 3LV8A 4HLQB 3PTNA 3LQRA 1Z6AA 3KEEA 4JLAA 1BITA 1P0SH 2KI5A 4Q4JB 2IYVA 1C5MD 2QA5A 2ZRHA 4D0NA 3ICEA 2CNWA 5BRRE 2O8BB 1NVVR 3QBVA 1OH8A 3ZZ7A 1CO7E 3MH4A 4ZKOU 2GBLA 2ZRAA 2GDDA 3RXVA 2BDBA 2W2VA 1E94E 4B47A 1EPTB 1XX6A 1BRCE 4XH9B 1AN1E 4PANA 4ABBA 3HJNA 1FXYA 2E1RA 2JLWA 4R9UC 2IW3A 1LFDB 2SFAA 4L16A 3AASA 4C0QC 3S0NA 1ZBDA 2CLDX 4QXAA 3GYMA 1C9KA 1ARBA 4JYTA 1KY2A 1TONA 3SUEA 4IOKA 2ATVA 2GZ8A 3TLXA 4DEYA 4X8UH 4RY2A 1P2IA 4H1VA 1C1YA 1SGFG 4LV5B 4DT1A 1Z2AA 2OT3B 1SI5H 1BMNH 4X1NU 3OHMA 4PHTA 1LKAA 2Q1JA 2QSYA 3EXAA 4DVAU 1R4AA 4ESTE 2AS9A 2VINA 1UADA 1TMBH 4CT5A 2GV6A 1K6MA 5EXTA 2QSZA 3FVFB 3A8TA 3QX5H 1HUTH 4CBOA 1OE0A 1XTQA 1P01A 5T6FA 1XCPA 3UG6A 1PVOA 3VKHA 1DFPA 4LV8B 5E7JA 1GKYA 3RMOH 1J8YF 1TOMH 3LVRE 2PKSB 4QBIA 1UBCA 1CULC 5ELXA 4A0FA 4BZQA 3A7TA 1I2DA 3SV6A 3C1KA 1NVWQ 2HRVA 1HFDA 2ZWLH 5CJ2A 3H86A 4Y6DA 3T1VA 1KTVA 1E2QA 3AF3A 1ZM3A 4DLTA 1KSHA 4QJ4A 2P3SA 3V9PA 3QVUA 1UTJA 3QNUA 4Z0KA 1FV9A 4FCWA 1Q12A 3RMNH 3GJ4A 3CNOA 2XTZA 3M7TA 3KUDA 3T06B 2GZHA 3JVUA 1C5ZB 3U61B 5J4LA 2IYSA 1UDWA 2QAGA 3ADDA 1X8JA 3Q72A 2WHXA 1JIMA 4TMXA 1C1TA 1GI2A 5FOVA 1CTQA 3LH5A 2WBLC 2W6JA 1SL3A 3EIQA 4YMSA 1GHVH 1PYTC 1J17T 3KJEA 3DHKH 1QCPA 2VO1A 4QNRA 2JLSA 5BN4A 4FUGA 1QR3E 2GCPA 2BMFA 2MMCA 1QA0A 1SXJE 5EE5B 1AJEA 1YR7A 1T5LA 2C9CA 4Q7JB 2VWMA 1UTQA 2QN6A 3TSZA 1WTHD 5DE3A 2VRWA 2FE4A 3EGKH 4JLNA 5AUQA 1C9TA 4AD8A 1TX4B 2RHDA 3B8JA 1SGRE 2BDTA 4NA9H 4MLFB 3GCTF 5L3RA 2PLFA 1DAHA 1E4VA 3SN6A 2PL3A 3CPEA 3EPJA 3ZZ3A 5C4MA 2WWFA 1TQ7B 4RKJB 1E32A 1NVUQ 2A5YB 1JQJC 4UXJA 4MYTA 1NRQH 2GT8A 1JAIA 3FWYA 4ABFA 2REBA 3TE6A 4A0RA 1EPTA 3DKVA 5EQTA 5FPTA 1UBGA 3TLOA 3GLIA 1FW6A 3K0EA 1O5DH 1KXAA 1O2KA 1WMSA 5JI3E 3MO3A 5KU1A 2ZU6A 2Z9GA 5DO4H 4OS5A 1CJVC 1W5TA 5C1YA 4GZMA 1TADA 1ZJDA 3PMAB 3SZEA 2ZSFA 2ZRFA 1U8ZA 2FSFA 4IDPA 3RS7A 4HLUA 5GJVC 4E09A 1VTKA 3M36A 3AKEA 2ANWA 1A4RA 3B1WA 5I46H 4YONB 4MRRA 3M3SA 4INHA 2TRMA 1X3SA 2IYRA 2CF8H 2ZGCA 1BJVA 1O3HA 2GHIA 1VCQA 3BB4A 4P31A 3E1XB 3MD0A 2BY8X 2A5JA 4JVMA 2Z3CA 2BCGY 5AR1A 4URWR 1IN6A 1G36A 2B8OH 2D7CA 5FCKA 5A0CA 1WBGB 1RRCA 1ZNZA 3BEIB 4KSBA 2A7HA 1UEIA 2C5LA 3B8HA 3AKYA 2IL1A 1CR2A 1E2KA 3SW2B 2BOHB 2NU4E 4TTRA 1CSOE 2P5SA 1AQUA 1FNNA 1C1RA 1O5EH 1FQ3A 4ZDIA 4ESVA 2KAIB 1MOZA 2ZSEA 3PEUA 3UG7A 3NHAA 1OFTA 4IVRA 2FS8A 4U00A 2CF9H 2ZCLP 3ZZBA 5JCZA 1P2NA 1AN0A 3OSYA 1R2QA 4ERNA 2IYUA 4ZXXH 3FTQA 1C2DA 3ZVBA 4CVNA 1W3CA 2P67A 1OP2A 2EI7A 1IN4A 3ZZ0A 1HCGA 3PG5A 1C5RA 5A0BA 2VP4A 3A83A 2FP7B 1WU1A 3E0NB 1M7GA 4BAMB 3ZD6A 2D74A 5TDHA 2H17A 1C5WB 1OFIA 1LHDH 1OP8A 1F5NA 3UOUA 1W0JD 4X8TH 4JT4A 2Y80A 3QG1A 2RGXA 4M9ZA 2A4GA 4MRPA 3MO6A 4PSVA 3L33A 1A1RA 3TBKA 1A61H 1ZYUA 1E79D 1Z8FA 2VHQA 1O38A 1E9BA 1C5UA 1BHXF 2NU1E 1KO5A 3DZDA 1LHGH 2ZUBA 1N8OB 1A2CH 1OIWA 4Y0VA 2SGDE 3B85A 4RFVA 5AJVB 5HXFA 5LPEA 3QKSA 1CE5A 3A1SA 2G0NA 4X8HA 2OG2A 1JAHA 1E35B 1O2OA 4G5QA 1TGNA 1DPFA 5CJPA 5BW8A 9LPRA 2H1LA 1P9WA 3F9GA 2PKAA 3SU4A 3UNSA 1DG3A 4KKDA 3OU0A 4TYNA 1KMHB 1N5LA 2VHCA 1YPEH 1F3OA 4QGHA 1K21H 2BD9A 1VIYA 1IAQA 3LBIA 1CJUC 4HYYA 5JHHB 4URYR 3T27A 4K1TA 4PQFA 5J4SA 4Y7BA 3U7EB 4TMKA 1JECA 2TGPZ 4AFQA 1TNDA 1SGNE 3B2EA 4Y10E 5HR5A 1CR0A 4D9QA 5FTNA 3M1IA 4YTAA 4D4LA 3AP1A 1IXRC 1J15A 1EFRD 4IW3B 1D6RA 5FFMA 5H68A 4EJSA 1O33A 1OSSA 5C2ZA 2PBRA 3SYKA 4HI3A 2PT7A 3RXOA 3C14C 1Z0KA 1XZQA 4MNVA 3NBXX 3EW9A 1KI3A 2VGCB 2WV4A 1TF7A 2BM1A 3GLIE 3GDSA 3GLGB 2R9PA 4KTSA 4LDJA 3SNCA 3H1TA 3M3VA 2ZI9A 2VNTA 1QHRB 3BOSA 1DE0A 1GDQA 3PXGA 1XB2A 4KAXA 1O35A 5E95A 1HBTH 3RANA 4TQUS 3SR0A 1AVXA 3SNAA 1IBRA 3CWZA 1OPHB 1EOLA 1Y5AT 3VNVA 1J70A 5A09A 4GOXA 2FOBA 1F2TA 2YV5A 1GPZA 2NPFA 2BYAX 1K5GA 2H18A 1G64A 3T1OA 4SGAE 1XUHA 1Z1JA 4R2IA 1XP8A 4QHYA 2HT6A 3NPSA 1V2RT 5L3SB 2CK3D 2HLDA 1TF5A 3CZPA 1K1IA 1V2LT 1GG6B 1JEDA 4PQYA 1VGCC 4TLAA 1S84A 2R0LA 1IOZA 2FOGA 2P8OC 2BD4A 5K8IA 2PZGA 1E38B 3THYA 1K1OA 3BH7A 1HT2E 4FN5A 2AGGX 1C5OH 1EZXC 1NN3A 1AIPA 4HEJA 3A86A 4NSYA 3QO6A 1BOQA 2XB4A 1II9A 2WMOB 4F92B 3KUCA 5TXGA 1CF4A 3VR5A 1GKIA 3D31A 5AF9H 4FXPA 3A89A 1W13U 3EASA 4XFQA 2V3HH 2ZYWX 3A7VA 2IXFA 4JZDH 3K0AA 3ZGXA 5HKKA 4QM7A 4URZR 5CB8A 1JOUB 4LK4A 1QB6A 4DIEA 3BTFE 1SB1H 1FY1A 4DCNA 3A80A 4DDUA 1OOKB 1O2UA 4LI0A 4B3XA 1OWDA 1N6KA 4D76A 2IOTA 2IWRA 4NIVA 4CHAC 5JWOA 3GCHC 3MWLA 1Y3WA 1GL7A 2V9PA 1P2KA 1O3AA 5DI9A 3SYLA 1A7SA 2ZR9A 4ESHA 1QZXA 3L2OB 1ELEE 3SHFA 1SHHB 1DOJA 1TBRH 2GJ9A 1Q20A 4CRBA 1FOEB 5FBQB 3U3MA 2BD7A 1C2GA 2VP6A 3U7HB 2FV8A 2GVZC 1FUUA 2BMEA 2A0QB 1LV7A 4A8JC 3GCOA 2DE9A 3MU1A 2BKEA 5KSOA 3LBNA 1THSH 1W1WA 4NPHA 4GHQA 2C95A 1MH0A 1LQEA 5JBCS 4LCBA 2FEQH 3KTAB 3SFZA 2P3UB 3SYNA 2SHKA 5GJ4B 2PZEA 4XE4A 4C0JA 1AB9B 2ZEJA 4A36A 1XCGB 4EJSC 3H4MA 3ZZTA 3RXIA 4I99A 1P73A 1G7SA 4GLYA 4TLBA 5EXMA 1AZ8A 3KJGA 3PWCA 2ORIA 1YKTA 2R8RA 3BC1A 1G3DA 3VB4A 2WM9B 3L82B 3UUZA 1G41A 5FAHA 4Q1BA 4ZAEA 4BWYA 2IYWA 4FUIA 2H9TH 2J0SA 1NG9A 1UTKA 3W94A 3QOFA 3GQBA 1D3TB 2TBSA 4BEBA 2P65A 3L3TA 1PUJA 1G3QA 3LJJA 1PFXC 2FS9A 5SZJA 4MPWA 4Q21A 1JWTA 1SXJA 3C16C 1YZQA 1GI0A 2GCHF 3ATIA 3CM0A 3AP2A 4NIWA 1G21E 1BMFD 2ZHWH 4GAWA 4LYFA 2C04A 1D2NA 2EA3A 3KIDU 4KO8A 5EP1A 3V7TA 5L2YH 4B2LA 2OCYC 5LPNA 1ZU5A 3BG4C 1C5PA 4MKIA 1HJAC 3T25A 1O2QA 1DO2A 4I7YH 4MPXA 2XX3A 3I8XA 4N0DA 2JJ1A 5H4IB 5EXPA 2WWYA 5C46F 5FL7D 1O3IA 1BO6A 2C8WB 1U0JA 4ZO4A 4DT1B 1BRBE 1W4RA 1GNQA 1RYHA 3H84A 1XXHE 3N7OA 1TABE 2I1QA 4CHAB 1O3CA 1AU8A 1O37A 3R8CA 4FUJA 2W2XA 4HUQB 1GI3A 4A0GA 2FU5C 1AY6H 3TK5A 2DWPA 1XD9A 5KUTA 3RLFA 2P2LA 3PO1B 3AF4A 1TQDA 2ZCHP 1RJ9B 4PAQA 3DM5A 3RXJA 4BLOA 1NRJB 1FQJA 5BYKA 4Q4LA 3ZQ6A 1VCMA 2PR3A 3QGJA 2ZP0H 3W5IA 5KSPA 3T61A 2QCYA 4A92A 2GNOA 3RXQA 3M0EA 4ACAA 2ZDVH 3RSOA 1GL6A 1EOJA 3R0FA 1RKBA 1AWFH 3DO6A 3VR3A 3TITA 3TIUA 2FOAA 1GVLA 1E99A 2OCAA 2J0VA 3BTQE 1LVBA 1PQ5A 4DWJA 2HJVA 3PR1A 3QZQA 1ZCAA 1E0KA 1HUQA 1QRAA 2EI6A 2O8UA 3TRFA 4ZKRU 2AERH 2PZFA 1SLUB 3TUIC 2QYIA 5D3MB 1QG4A 2REOA 2WTUA 1E1QA 2O8WA 3KB2A 4CEIA 3LLUA 2OUKA 3SC3A 2A4OA 3MJRA 1T8TA 5DI3A 4F38A 8OHMA 4D6PA 1TGTA 3ZYDA 4V0OA 4W5JA 3I72A 1E1RD 4NYIQ 1GI1A 3N2EA 4YXWD 2ZGJA 1SLVB 4K1SA 3I92A 1KDRA 1BJUA 1GMCG 3WNCA 1O2NA 1P09A 1TL7C 4KXFB 3BTHE 1H65A 2WSSA 1DAIA 2VWLA 2F7SA 3S9CA 3GY7A 4DJTA 2C8ZB 4IRUB 4FU8A 2JDIA 4B2IA 1EJAA 2EFDB 1OKKA 4ABAA 3PEVA 2BMGB 3A7YA 4EAQA 1O3GA 1L8QA 4FUHA 1QNJA 3GLHA 3K9XB 1RFNA 2DCUA 4O97A 1VG8A 2ZJOA 2SGQE 3DEFA 1YRAA 1AKSB 2WWIA 1FX0A 2NGRA 2ZDAH 3WRXC 2GETA 4X8VH 5B2ZA 2WICA 3R8FA 4L9SA 4K60A 4GSOA 3HU3A 1UJ2A 4TQ9A 2R65A 1EAUA 3LW8A 1SR5C 2XW9A 3AP3A 3F9FA 1QVAA 3N2IA 1GJ9B 3SN8A 3GFPA 3A88A 1C5YB 1SOZA 1S81A 5EP3A 3SUGA 2J1LA 2IYYA 1EWQA 4LUCA 2VVVA 1YRBA 1OYQA 4X6MA 4XWAA 1AFQC 1G3RA 5DISB 4XVRA 4HI0E 4WH8A 2RHMA 621PA 5P21A 1KXFA 3ELAH 3T26A 3KKNA 4PSAA 4LJ9A 4HAZA 4M9FA 1TFXA 1K8RA 1ZJ6A 5G40A 2X2EA 1O3NA 4BLSA 3CPHA 1G16A 2A5FA 1C2KA 2WV5A 4JLVA 5B6OA 2DPXA 2Y5FA 2AK2A 1GRRA 2ZU5A 2WZQA 4C2UA 2YWFA 4FUBA 2QGNA 1GI4A 2Y5GA 1RTLA 3SGQE 4AI6A 1KSJA 4C2TA 2CVFA 1OH7A 3AVTA 2BLVA 1SHKA 3SU2A 2J92A 4NA7A 2F1JA 3TGJE 4HZUA 1VR1H 1KNXA 1S1CA 1TLDA 2RGNC 2IT1A 3AV0B 4DEXA 5B58C 1NIJA 2QE7D 4QC2A 4B2CA 4NMMA 4LK2A 1OB5A 2FI4E 3VQTA 1HAZB 1C2FA 4II7A 2DWOA 3V4RA 1BYIA 2ZECA 2WINI 4QOSA 3SQWA 4Q4HA 2XSZA 4I8KA 2X1VA 1L4DA 1FONA 2ZS9A 2ZI6A 3F5FA 4MNXA 4M21A 3FHTA 2J7KA 1MD8A 1Q3XA 5FBIA 3E1SA 4ZKDA 1U0LA 5IDVA 2BDAA 2EQBA 2G4UA 3LIWA 1MR3F 6ESTA 1JQLB 3DUXH 4X1RU 1NIPA 4AYWA 1C1QA 1BZXE 4M1TA 4M9XA 4WZ6A 1AMHA 4B74A 2H5DA 3U6BA 3SJOA 3CBQA 4F4IA 1KHTA 5HPYB 4NYMR 1NY22 4EFMA 2C90B 3U5ZB 3SGAE 2IEYA 5JHGB 1W12U 5F2EA 4GFDA 2O9QA 1KDPA 2CNWD 5J40A 4LJAA 2QT0A 1AGPA 2O8CA 5J5CA 1W4CA 1UKEA 2AXNA 2ANYA 1YJ5A 2FPLA 4RD4A 1DWEH 3O8CA 2ZE6A 5CMXH 1CJTC 1SGWA 2VB0A 3I29A 1I4DD 1TMKA 1JNYA 3RC8A 5AJZA 2VQSA 1N25A 5C3NA 3A58B 1K9OE 3KF2A 2W6ID 3NXSA 1XUKA 2KWIA 2CJIA 1E9SA 4R98A 3KN2A 4DLXA 4GOKA 2D8WA 1E36B 1N6HA 4ON9A 1UTNA 2CGAA 3REFA 3HYRA 2XXAA 2ERXA 3ONWA 1QJ1B 4OGXA 3Q00A 1H1BA 4NCIA 1VITG 1IY1A 4NA8A 1TGBA 4YMTA 3FE2A 2QPOA 2OXSA 1MQ5A 5JRZA 5A5GA 1P04A 1QDEA 4FMDF 4BXWA 4TLEA 2ONKA 1L0ZA 3BB1A 4AYYB 2GZ9A 3LKWA 2XNDD 2TGTA 1ZNWA 1JRSA 2ZVPX 1A46H 1D9IA 1YZLA 5J4HA 3KHVA 5K7RA 1W49A 1O2GH 1BKDR 4CYMA 5IK2D 2EWWA 4DT7B 3LRPA 4K5ZA 1VHLA 2FX3A 4HAVA 3O8BA 1F2UB 5DG6A 3TJNA 5JZVA 1GDDA 1BHXB 1P75A 4LYJA 1PYTD 4Q4AB 2FH5B 3BJIC 3WP1B 1MBQA 1GBDA 1V2ST 4M4SA 1EP6A 1FUKA 1VYUA 1L2EA 1WXRA 2WWHA 2ZJ2A 1BIOA 1H9HE 3UQOA 1C5SA 1WUNH 2YNAA 1GFIA 4PO8A 4O3MA 3RC3A 2I1VB 4I1SA 5LD2B 2OLJA 2ODPA 4OHYA 1WQVH 4PTLA 5CDFA 2FX6A 2XCNA 4Q1DA 4B76A 5E3HA 3OEED 1Q1QA 4X8OA 3QENA 1ETSH 1A5TA 3QF4A 1SVIA 2F91A 1OLOA 2FM2A 2F43B 2ZTYA 1NG1A 1ZVQA 1SKYB 1AE8H 4A1VA 3TUJC 1FTSA 3BH0A 4I8LA 4XJXA 3U8OH 4MRVA 3GD7A 3SJ9A 1AE5A 1VCPA 4RD3A 3ZZ5A 2JETC 4JJZA 5IF9A 1UCYE 3ZYCA 3O8RA 3VR6A 3CRMA 3MMGA 3SBDA 4QBFA 4MVNA 1NFXA 1ARCA 1YBWA 2ZC9H 3U4QB 4DCSA 1UK3A 2FOLA 4XSHA 2DFLA 1C5VA 1L4ZA 2YZ2A 3URCA 3UANA 4B34A 5GVSA 1U9IA 1IOEA 1J90A 1OXXK 2H5CA 2QTHA 3ZIAD 4NWLA 1QHIA 1KY3A 2XITA 4JSYA 5TARA 3RXAA 3UK6A 2BMJA 1Z08A 2AIPA 1ESBA 2JKHA 4V0ME 5LB2A 1RTFB 2ZRJA 5LGOA 2ANBA 2F1HA 2G0TA 4PAOA 1FPHH 2ZGBH 2UWPA 2ZRLA 1MABA 1OHHD 2PV9B 2ALVA 1TPOA 3EG5A 4DSTA 2ZI7A 1W36D 1AGRA 3GCHB 3ZZ8A 3PQCA 1KIGH 3RC6A 2REXB 3D65E 2C98A 3Q85A 2JDID 1EWRA 4AK9A 4TQAA 2AMDA 4X6NA 1EZUC 4PC3A 1PPBH 1BTPA 2OBQA 4QG7A 1GHZA 2YWHA 4KLNA 1U8YA 1IQMA 1TNIA 3M5OA 3VB6A 1FPCH 4EPTA 3SV2H 1H8EA 1Z6EA 4WY3A 4UFGH 3F9HA 1QTFA 3WP0A 2H16A 1HB0B 3QXHA 1LKBA 2OC8A 4UJ3A 3T1QA 1GJBB 4CT4B 4KTCA 1B0FA 1DS2E 2YVUA 2RGGA 3THOA 3ZVCA 4TMWA 1Z29A 1T7CA 1QRWA 2N1BA 3SJ8A 1LDTT 4MG3A 4TN1A 4Q4HB 1BQYA 1KLJH 2FZLA 3CONA 1W7GH 3TVTA 3NK8A 4Q7MB 3EAQA 2NMVA 1L4UA 4UFFH 1E6CA 4H1UA 2BC9A 1KLIH 1CA8B 4PZZA 2ZHQH 4DSNA 4FUDA 4OL0A 1ZMJA 2GZAA 2Y5HA 1YC0A 1XMVA 2NIPA 2QQ0A 3SNHA 2XBWA 3VPKA 5SGAE 2BB4A 4LHXA 1BTUA 4Q4JA 4BE7B 3U2QA 3IIJA 3DHWC 1KO4A 3S7HB 5AUPB 2OSBA 1S82A 5H70A 2Q9BA 4RFSB 1YR8A 1XVOA 2G55A 7KMEH 2QL6A 2EI8A 2BXTH 4LJ5A 3ETLA 4GPTA 1T32A 3GLFA 2CHVA 1M34E 4TMZA 2G51A 4OI4A 3FDIA 3LLMA 5JMTA 4DDVA 4JKYA 2R6CA 2KAIA 1O2RA 2IF2A 2WJIA 3RXPA 5AWFC 4MGIR 2C8VA 4Q2KA 2LKDA 1GVNB 4ZHMU 1TQ2A 4ZXYH 4KFRA 1IQEA 2XOKD 4RSPA 1XM1A 1N5KA 3AEZA 5E7MA 2FG5A 3QY0A 3Q9LA 1TRNA 3NG1A 2ZSAA 4NYIR 4ZCIA 1H8ED 3IPYA 3AVPA 1HXFH 3U8TH 3MCAA 2GAAA 2HNTC 2BVXH 5DN6D 2BVSH 3E5HA 1P02A 2VIOA 1GMCF 1EZQA 2IUTA 3F0TA 2EW1A 4M1MA 1U99A 3D7MA 2AHOA 1V2QT 1EQ9A 3S9AA 1IN7A 1E2GA 2PUQH 5JJKA 3MH6A 2P6UA 5JWRA 3U7GA 1U90A 1ZAKA 3KKPA 4HLCA 1T31A 2B8WA 1D3DB 5EXSA 2ZFFH 3GLHB 5ANRB 1OXGA 4DLYA 5TV2A 5EPYA 3ZVAA 1TEVA 2YKGA 2C96A 4I32A 4BRWA 1N6YA 2AMPA 1IONA 2H6MA 2A5IA 2ZYVX 1WQ1R 3SOPA 3QGNB 2BZ6H 2FFAA 1MH1A 2X8AA 3B60A 1HV8A 3M6AA 2FOFA 4NFFA 3RM2H 1AKEA 1ZU4A 6CHAC 3PB1E 1G18A 4CH2B 2ODNA 2OCBA 3MMPA 3TH2H 3FHCB 4CW7A 2OBMA 2J87A 4UDWH 5ESBA 1D6JA 4GZLA 2AK3A 2IYQA 3FFAA 1OWJA 4IJMA 2XXAB 5DP4A 1P8VC 1VJ9U 5DN6A 2HALA 4PPFA 1DELA 1S8FA 2V8OA 3OAAD 4GRAA 5L3VA 1E2LA 1QVRA 3IBGA 2IC5A 6GCHF 3LH1A 1BS1A 3PEWA 1XKBC 2AYWA 5GCHG 2ECKA 2ZHFH 3FAOA 1E34B 2ZZUH 2RA3A 5C2JB 5ESTE 1CHOG 2A5AA 2V3CC 3W8NA 2GJKA 3SUDA 2Q6DA 3IEUA 2WKPA 2QAGC 2ZDMA 2ZRDA 4XSKU 3MAAC 4KSCA 4UNQA 2YYZA 3S1AA 4JBWA 1JRTA 1W0ZU 4ZCMA 1M7BA 2QP3A 2R3YA 1Z3IX 2VIWA 4DB2A 2WUBA 1A0HB 2R6GA 1IQHA 2FGKA 4ZCLA 4RVCA 1QA7A 1QHHA 6CHAB 2JLUA 2BCJQ 2PJZA 1YZGA 4KBFA 3AUXA 4B43A 4AFSA 1Z1IA 1OB2A 3AF2A 5DK1A 2QAGB 1GL9B 2ZJAA 2VIQA 1TNKA 4JYBA 2QM8A 3IQXA 4P4TA 3MNXA 4YLUA 1NP6A 3Q3YA 3KQBA 3NTUA 4Q1AA 1PQ8A 3LW7A 1GJ4H 1O3PB 2ATXA 3LU9B 2Y81A 2BM2A 1GSIA 4ABDA 1N0UA 4BFUA 2D2DA 3BN9A 1DAFA 3CF6R 3LH3A 4F4JA 2F9MA 1VG0B 3PIRA 4I33A 2BVRH 2HUPA 2ZRMA 4PHGA 3VAAA 4MRSA 2WPHS 1EXFA 4JK6A 4UJ5A 3KKMA 1DG1G 2CHAB 4KCGA 2XTNA 1XKAC 2VU8E 1GNPA 2OC7A 1CJKC 1ETUA 2AR7A 2EYUA 4I1VA 3K09C 1QBOA 1B0EA 2B9LA 1WCV1 3DVLA 2TGAA 1W0YH 3FKSA 5KDLA 2CJWA 1JR3E 2ORWA 5DYGA 1AO5A 4EUNA 4KTUA 2DYKA 3T12A 4DVGA 4XDEA 1PPEE 1GHBG 4OJQA 2OCVB 2BXUH 1KKMA 1IQGA 3BTKE 3E91A 4OI1A 5FX6A 1L1JA 5TJXA 5FX5A 1NESE 5JPMH 5KSYA 1GG2A 2XBVA 2G9NA 3ODFA 2VBCA 3H7OA 4XSGA 3HYTA 4LBZA 5EXLA 3IITA 4EKDA 2D7DA 3O47A 2D2FA 4NZYA 4AN7A 3ASZA 2PCLA 1RIFA 2OAP1 2AMQA 1G7RA 4LBVA 1TUEA 4TPIZ 5K0HA 4LHZA 5FOTA 5TCCA 4Y11E 3WY8A 1G6HA 2HOBA 4TT3D 3VGCB 2QPAA 2FOCA 3ASYA 1KK1A 1Q44A 2A78A 1LHCH 1P4SA 3KZ1E 3MG9A 1Z22A 1CR1A 4BZXA 1C1SA 2GVDC 4JZEH 3DOEA 4ISOA 2R2MB 2FFQA 1ANBA 4VGCB 3LGWA 3C41J 1CIPA 1UHBB 4S2EA 5B57C 3AVYA 4RJLA 1CT0E 3NWJA 1P2OA 3A8CA 2F9UA 5JECA 2BD8A 4G0NA 1DE7H 2IS2A 1XTSA 4AFUA 3DMDA 3SBKA 4A8JB 2IS6A 3RXKA 3M7UA 2HYIC 1ZUNB 4MKGA 3TIFA 4CGZA 1V2PT 2I6QA 4WXIA 5IDKA 1X86B 1ONBA 1G3MA 4EFNA 4FD2A 1NFYA 2H9HA 5EXNA 2NWNA 3VNUA 2BLQA 1KXDA 1V43A 3MSXA 2GJSA 1MTSA 4GSYA 1A5HA 1CP2A 1J7KA 1O2YA 5B64A 2AL7A 4UONA 4DCDA 1DXPA 1E79A 1V2OT 2HYDA 3AGQA 4H4FA 1FMGA 1RTKA 2RDLA 1KOFA 2AFHE 3NC0C 3GJ7A 1HAGE 1L4YA 5FI1B 1KI6A 2H92A 4NIXA 3V12A 3TW8B 1OH5A 4TZ6A 1WA5A 4FXGH 3REGA 4RKEA 4NCYA 3VU9B 1MU8B 2ORVA 5CLLA 2FF7A 2HVXA 3QG5A 2JH6D 2NOAA 3HR8A 1SQTA 3A81A 3W6NA 1JPNA 1UVUH 1NVXQ 2V7QA 2XRCA 1G4AE 4NTZA 1LS6A 1HQCA 3RS5A 4UQOA 3QE0A 5KSZA 6GCHG 3U7FB 3GYLB 2D2EA 2CLSA 5GADl 1B0UA 1NN0A 1ESNA 3HDTA 4A2PA 4LJ4A 1XMNB 1J99A 4D4MA 4OM9A 1U9IC 4MNWA 4F4OC 3NEYA 5EW1H 4Y76A 1QBVH 3R20A 3BTDE 1TPZA 3ZVFA 4B3CA 3GEIA 5IT5A 1TA2A 3HGNA 2PKAB 2QU8A 1B5GH 1MKXK 1LNZA 3GLFB 4JMPA 2OM2A 5JWHA 3IKJA 2CL7X 5EXXA 3K65B 1XBTA 1ZUHA 3OEHA 1ZMLA 3M7QA 4C0KA 3ECCA 3ENSB 2DR3A 2J4IA 1H8HD 5EOKA 4A1TA 1BCUH 4IC5A 1FP6A 4HDCA 2ASUB 3GJ3A 1CA0C 2F55A 1JR3A 4JCNA 2CL6X 2J0QA 1QL7A 3GY5A 2C77A 2XYAA 1YPKH 2GEVA 1Y8TA 1CLUA 3J81k 1E2JA 1RPZA 3TGIE 4KFTA 2CHQA 1FUJA 4K46A 2MSCB 3SU8A 1KSFX 1L1GA 2KBEA 3OIYA 4AG2A 1R5OA 2G1JA 4NZLA 2W7UA 1SLWB 5CB6A 4NCKA 5A8ZA 3B7GA 4RD1A 5TB5A 2Z7FE 1FY8E 1UCYK 2NO0A 1XNJA 4CEIB 1UTLM 3I78A 3AUYA 4N3NA 3QUSA 2MSEB 4PPQA 1SKQA 3CR8A 1XVMA 4UE7H 1Z0DA 1C2EA 4U32A 5AJWA 1F0SA 4DDTA 2G52A 1E2DA 1O2VA 1NM6A 2FO9A 2VF8A 1IQPA 1YR9A 5E0HA 1CT4E 2P5TB 1MZDA 3SU3A 3SI7A 2P94A 4H9GA 1KI7A 2VSXA 2JLQA 1UKZA 1E96A 2R2AA 2FESH 3GP8A 1ELBA 1KXEA 3RXMA 4MYHA 4HSEA 2PLXA 4RD0A 5FBLB 2D26C 4MQAA 1OKKD 4LZZA 2VIVA 2FGJA 3RS4A 2HLCA 1MMJN 1G2LA 1U98A 4H6TA 3AQ4A 1HIAB 3UMRA 3CIOA 3TR0A 1YPGH 2ODEA 1KAGA 4TZ0A 3L0IB 4MTBA 1MO6A 4IMQA 1A2BA 4XTCS 5F9HA 1CS4C 3A7ZA 2C8XB 3ODDA 2BDHA 1CRPA 5CE1A 3GCTG 1ZM4A 3DFJA 5FBVB 5DP3A 3DM9B 2WJHA 1Z07A 2RGBA 3E2IA 2RKOA 4C0HA 3C5HA 1A0JA 1EPTC 2PT5A 2K5UA 4LY6A 3KFXA 3L0OA 4TPYA 3X1DA 5GJBA 3BORA 4F49A 4O0MA 1LTQA 2ESTE 2ZJBA 1CGHA 2P16A 2VIIA 5EQQA 3T2NA 3HWSA 4WW0A 4D25A 4Q66C 3RWMB 5JJLA 2JGNA 3H09A 4BAKB 1XMSA 2UWOA 1S0UA 3KFVA 4IDQA 2ANKH 1MRSA 3SJZA 4IN2A 3TH3H 1NLFA 2GWHA 1C1OA 2JJ2A 1TRMA 3NKVA 5GCHF 1JR6A 1C2MA 5EODA 5J4YA 2JLZA 4UXHA 1FMJA 4M1YA 3QWCH 2Z0MA 3K0AB 4HLUC 1COWD 5HCNA 3BB3A 1M7HA 1UAAA 1HNEE 3GEEA 2ZQ1A 4A1FA 2G3YA 3SV8A 4WMDA 3GDUA 4G1UC 1QRXA 1NKSA 1J16A 1MUEB 3UPEA 2QIQA 3DA9B 1NFUA 4AZ2B 2EFHB 1KK3A 1XXFA 2F9NA 2O0KA 5C5OA 4US2R 2HJGA 3SE0A 2ZHEH 2BJWA 1Y63A 2H8KA 2BDIA 1BIFA 5F9FA 1KI9A 4R8TB 1IN8A 1DARA 1F0RA 1FLEE 4OQNA 3B1ZA 1T91A 2D62A 2O8FB 3ZV8A 1SVOA 2WJYA 5JLJA 4AG6A 2VP9A 3K1JA 3SDZA 1II8B 2QBYB 2ZEBA 4MKFA 3QXXA 1QBNA 2GK6A 1WAYB 2QTFA 1HTWA 1E9CA 5AFZH 3MO9A 3KTAA 2GGVB 3P17H 4JLMA 2FWWA 2O8TA 3L6PA 3BSQA 2GCNA 3LPRA 4DBLC 1LPZB 4MPUA 3T5DA 4US1R 1CVWH 4YOIA 1FDPA 4Q00A 2W3KA 1GMHF 3GLIB 3PLPA 4LRWA 3VR2A 4JLJA 2PTNA 4MH0R 3QQ5A 4IEIA 3OE7A 4QT8C 2QQEA 3FHOA 2H2ZA 3IGFA 2V54A 4BECA 1GIAA 5CDFE 5EPNA 5BPEA 1GZSA 5HTKA 1LPKB 4QM6A 3SI3H 2HWLB 4HB2A 1U2RA 1LPGB 1BB0B 4DXAA 1DY8A 1HDTH 1DX5M 3AH8A 3SJBA 2EEKA 1MQ6A 3CX7A 3OZXA 4TL8A 4E07A 5AVDA 3FMFA 2GJ8A 4OQXA 4BRUA 1SFIA 1QBKC 1V5WA 5L3SA 2Y8EA 1CR4A 4B6FA 4AKEA 4BFWA 3ATWA 1DLEA 1O3EA 1LQDB 2OFOA 2EYQA 3PCRB 3TNFA 1XCMA 3UTUH 4GVUA 3BF6H 2C99A 5DJ7A 1Q22A 5EW2H 2N46A 2FPMA 1GDNA 2DB3A 2O8MA 1ZM7A 1YPJH 3HR7A 5BYJA 2RGCA 1BTXA 2ANMH 4P0TA 1DTSA 2FLRH 3KXIA 1G5RA 3AVOA 1T8LA 2QI9C 4B3DA 4XBDA 4FIDA 4B71A 1N0VC 2B6HA 3RXDA 1OFHA 2VYFA 1ZHPA 2EWVA 4OS2A 1WBBA 1CBWC 1F48A 3BTGE 3H2YA 5A0AE 2JASA 1O5GH 2NQ2C 4DOQA 3Q3KA 5AUOB 4NBSA 1SLXB 3K09A 1MTNC 3RP2A 4NU0A 1GWNA 3RRZA 4NZQA 1NMXA 5FH9A 3MUFA 2H57A 3TH4H 3CLVA 3SEAA 4X1SU 3KGPA 4W9MC 3CH5A 4OQFA 4Y0YE 1EASA 1CU1A 3CB4A 5DP5A 4CEHA 4AB9A 1GBBA 3BE4A 4Q7XA 4BFYA 1HYLA 5LH8A 1I4LD 3P8GA 5LB4A 1GBAA 2XZLA 1JALA 4IW4E 1C2IA 3PUZA 3BTWE 3ZZUA 3LQQA 4Q03A 1OH6A 5EE0A 5GWZA 2O8LA 1KJYA 5AFYH 2R9VA 4NYJQ 2IBMA 1MAYA 2NO9A 1E9FA 4FMCB 2GJAA 1ORFA 1WRBA 3KQKA 3OYPA 3W5JA 1UO6A 2BV3A 2FTLE 1QJ6B 1B23P 3A4LA 3WNBA 3CWQA 5EQRA 3ZVEA 5DO9A 1O2XA 3HATH 4B2BA 4NKRA 3UY9A 2YINC 2FZ4A 3RHFA 1U81A 5HM9A 1GI7B 4DZZA 2H5EA 1O5BB 1G37A 2Q9AA 7ESTE 2W6JD 3DDCA 2J59A 4IC6A 4TY7A 5TY0A 1YE8A 3K0CA 3V4FA 3ZDQA 1E3MA 3I8SA 1JR3D 3TK6A 2ZFTA 1LF5A 1ANEA 5C4GB 3RMMH 3UR9A 2GX4A 2FYQA 2QPTA 4HUQA 4UFEH 3RU4D 1N6LA 3EIEA 1ZPCA 2PMKA 1OHHA 4AFZA 1E2EA 4Z51A 1D9XA 4R71A 4Y79A 3AKDA 4A1XA 3BTEE 1PLKA 2CL0X 1WP9A 4CRCA 1GAJA 4RZUA 1ABJH 1N0WA 3SORA 1EFRA 3ZIAA 3GLGA 5EJEA 4RKFA 1EX6A 2ZRIA 3NBYC 2VH5R 2AX4A 4IGDA 1L2TA 3H0KA 3AAUA 1Y3VA 1GRNA 2ZYTX 2WPKS 1P2VA 3NIBA 1UDXA 1O3LA 1ZM2A 2G83A 1DAKA 1MBMA 2BD3A 1O3YA 3QKTA 3M5NA 4HDOB 4ISNA 2QGRA 1AZTA 1KNQA 4ZUHA 1XPOA 3MH5A 1AIXH 4DKXA 2EFEB 3UQVA 4ABJA 2GDJA 4ABYA 3X1ZA 1EKBB 5G41A 1XFAA 4C0LA 4W7SA 3CUEF 1LY1A 4GT1A 3JZ2B 1HPGA 1GHYH 1KSNA 3QF7A 4YQFA 2W6IA 5KPDA 3VU9A 3LC5A 1KI4A 1E9RA 1IM2A 3SQEE 2OEPA 3SBEA 3ZJYA 2ULLA 3K70B 2NTYC 3C15C 5JYIA 2ZRGA 4Q19A 4RSGA 3MTYA 2IHBA 4L15A 5UKDA 1CA0B 1HXEH 2Z6VA 3BBPA 4KYUA 2UZ3A 3EZFA 3KKOA 1XD8A 1N1LA 3WRYC 3MH7A 3WHLA 2ZTZA 4LHWA 1S4QA 4LZ4B 1JPJA 1EGAA 5C1XA 4V0NA 1NZQH 1NS3A 2ZA5A 1GWAA 1OWEA 1ELDE 4TYYA 2BBWA 1II0A 2ZIQH 2IF0A 1SKYE 2NZ8A 2R6DA 3WXMA 4W5WA 2OBLA 1P12E 3WYAA 1HJ8A 5FPYA 4L9WA 3K9GA 1OWKA 4X8SH 1H9IE 1DWDH 3BTTE 1A2KC 2P8OB 4JT2A 4F7WA 1O31A 4M9SA 3TQFA 3EPHA 1FQKA 1ZRHA 2BEKA 2E87A 1T3LA 3T5FH 2JEOA 3SU6A 4DLSA 1GJ8B 1F5RA 3W90A 7GCHF 4TLCA 1Q1ZA 2ZFRH 1XEWY 4AKHA 1GBJA 1XRJA 4BPBA 3K6YA 1W14U 2AKAB 2WOJA 1UEJA 3U9AH 1ETRH 3K0CC 4B2AA 3W6PA 4DLWA 1DY9A 2B21A 2CHAC 4XVQA 5I25A 5ETXA 3RXFA 1SGCA 1AFEH 2FZZA 3RXSA 4FI3C 3RM0H 3HKIB 4HAUA 1KY9A 1II8A 2QBYA 1ZD1A 3CF0A 4AKGA 2G88A 3C4JA 2ZU0C 1DLKB 5T3HA 3QTVH 2BX4A 3NBZC 2FMJA 3A85A 1UF9A 4AYVB 4UNSA 2VJ1A 5KHOC 2BTCE 1O2MA 1YLCA 4A7IB 4BASA 4UEHH 3EC1A 3SV9A 2ZE5A 2JLYA 3TPIZ 3SU5A 1DT2A 1GJAB 1AS2A 3CS7A 3LFUA 1ZR0A 4X1QU 2ZGHA 3QEOA 1ZRKA 2HV8A 1IQJA 4BLPA 4Y7AA 3M5MA 3Q5DA 1E2NA 1M8PA 2FXRA 1R0ZA 3SJCA 2J3EA 2QUZA 4JLBA 2XGJA 3D49H 1NVVQ 1JXPA 5D3QA 1Y3AA 3X2SA 3LGTA 4IKEA 2FSHA 3LGVA 1ZD9A 3KX2A 2OXRA 4M2LA 2ZU4A 3HK6B 1WSSH 2O0HA 1MCVA 1G3UA 4TY6A 4A2WA 5KNCA 2BHGA 1RRGA 4KODA 2Z3EA 3EZ6A 4IEEA 3ZVMA 2NU3E 2ZKSA 2GCHG 4C9BA 1W5SA 4DY7B 4AB8A 1QHSA 5LPRA 3B1YA 2HDNB 2QRNA 1M9UA 3VB3A 2CBZA 5EE1A 4QHTA 3R9XA 2G5NA 2R6FA 5BQ5A 1R0YA 1AK2A 1XEXA 1FIZA 2IPHA 3K9NA 1IHUA 5A8XA 2WV9A 4I8JA 1FP7A 4KBGA 3GFTA 4NIYA 1LVOA 3PTBA 1GI8B 1UK4A 2SGPE 4C7OA 3PM3A 3OX7U 4KFUA 1FAXA 4MRNA 3AW0A 1JEEA 1KK2A 1BRAA 3BEFB 2VVUA 3RRNA 2BBTA 2YOLA 1TU3A 2BOVA 4FWTA 2FDCA 4M1WA 2AWNA 4D26A 2OFWA 1AM4D 2VHUA 3DFLA 1S0RA 1YU9A 2VVCA 1KI1A 5AHGH 1MZAA 1AD8H 2GT7A 2OC1A 4DG4A 1J14A 1HJAB 5FUXA 4ACBA 1F0TA 4ABHA 3RABA 5KOYA 2GV7A 4JLDA 4TL7A 4TL9A 3R7WA 1EESA 2WIAA 2G77B 3LO5A 2G5VA 2PMDA 1N6IA 2J9RA 4FMBB 1TE0A 1Y5UT 5HE8A 4K2YA 4NWKA 1OX1A 4O2LA 1PLJA 2GA8A 4MGZR 2ZS7A 2ZVQX 2FJUA 5EU8A 4ABIA 1AUJA 2D4HA 1R8SA 1HYQA 1E69A 3A1UA 3BAFA 1R7RA 1IQNA 1OYWA 1JIRA 1C1WH 3A82A 2QEQA 4GPGA 3T5GA 4FMDB 1YCPK 1V2UT 3IWMA 1P05A 3BEUA 1NBMA 4Z8YA 2FYRA 1E1QD 3VKWA 4DHEA 3SHWA 4IVQA 2J5XA 5DI3B 3LGUA 5M04A 2Z6BD 2YOHA 3ICQB 4HATA 2BDYA 4IDOA 4PSKA 1K1MA 1Z8IB 4X8MA 4BZPA 4KVAA 2IK8A 2NO1A 4V0LA 3RS0A 2TIOA 4GUXA 2Q3FA 1N6OA 2ALPA 3PUXA 1TQ6A 4YLGA 1G8PA 4I31A 2PTCE 2QMOA 2BDGA 1GOTA 1C1MA 1NLYA 4QBGB 1GVKB 1MRNA 2GXSA 1ZC3A 5CITA 2OQUA 1TQ0B 3N70A 8GCHG 4WJG2 2W58A 1XXHB 1OIVA 2B7DH 1C5TA 1ELCA 1ZYOA 1I2MA 2YNBA 3GICB 3RXUA 3U98H 1P7CA 1T0HB 4URVR 4Q9LA 3PITA 1SZPA 4A9AA 1MAXA 2FN4A 2P3FH 2FFHA 1RZ3A 1Y59T 4M0LA 2ZQ2A 1DPOA 4P3YA 4BFSA 3SZNA 4DCVA 1NU7B 3GY4A 2ODQA 1J8AA 4HFPB 1YZKA 1HLTH 2JJ1D 1ANCA 1G6OA 2QMUA 5JEDA 4DIDA 3RLWH 2BLWA 4TSFD 3QJYA 2LNCA 1MT0A 4KVGA 4B32A 4NCHA 4A8JA 3WBJA 5H8WA 5FHTA 1KJZA 4MUBA 5PTPA 1K1LA 3JZAA 1R8QA 1IQIA 1ETTH 2YHSA 2A4RA 1G3CA 1UMAH 2AH4X 1VJAU 2QY9A 1YF4A 2O0JA 5DYIA 4RD2A 3RXLA 5FL7A 1UFQA 1Z0AA 4CBNA 2GK7A 4YOGA 1BH2A 2IYLD 1O2WA 2Z43A 4JZ1A 4CRGA 1G3IA 3IIKA 1OS8A 1G9IE 1R0XA 1EX7A 1EAXA 4NSVA 2ZRKA 4BLTA 4JIMA 1US8B 4BAOB 1OT3A 3G82C 1G7CA 2VF7A 2ZU3A 3UWIA 4JLPA 3JZ1B 2GKVE 2F4LA 3P92A 3QLPH 1KAOA 1FZQA 1G291 4IOJA 2GXQA 1HAOH 1UVTH 5CIQA 1GCTB 5K8UA 5L8VA 1L7VC 2ZR7A 3F9EA 5JEEA 1G8GA 2WPLS 1D3PB 3SV7A 1FNIA 1BBRH 4ZKSU 1P6XA 3VFEA 4XBBA 2ZE7A 5DHFA 1VG1A 1Q3HA 4THNH 4UFDH 1XEXB 1D8TA 3CZQA 3RSLA 3BFVA 3AVXA 5FXLA 5FOSA 1XX9A 1M74A 4IMZA 3UATA 4QL3A 4LC1A 1A5GH 1O3BA 3QN7A 3URDA 1HAXB 5AJXA 2Q21A 3C7KA 4KJZA 3VB7A 4VGCC 2GCTC 1C4U2 1KXBA 4DCTA 5JFGA 1LTOA 1UTPA 1Z2CA 2QNRA 2F9PA 5DLQC 3ZVNA 4PO1A 4FINA 2C03A 1C1UH 1TIOA 1E9DA 3D62A 4UNNA 1GBTA 3BS4A 5AJYA 3W3ZB 1BA8B 3SFVA 4YT7H 1RD3B 3UWJH 3FP7E 2PEYA 3P1JA 3SGBE 4FCVA 4AWXA 3GJ5A 4BFTA 2GMTC 5DHAA 2WAXA 2CMYA 2Q3HA 2BIFA 4POAA 2ZI3A 4ISLA 4XWOA 1O36A 2IA5A 1ZTLA 3BFKA 1ZHMA 2X77A 2P95A 4PAMA 4WBSA 5FR1A 2B8TA 1GDUA 1O3FA 3SZRA 2VHJA 2ZETA 4M9QA 1ZLRA 1ZIPA 1YGCH 3SNEA 4KLZA 2O8CB 1UHBA 1S2MA 4D7GA 3BERA 4IBLH 3A7XA 1QRZA 2GTBA 3CH4B 1GP2A 3R7WB 3IO3A 3VGCC 4HTCH 3EA9A 1GITA 1NY5A 1F60A 3RVBA 1V2JT 4BAHB 4INKA 4ZH8A 1KMQA 1OSNA 2YNMA 1FAKH 1TF2A 3T35A 3AAVA 2QT1A 3BIVH 1J9CH 2W7SA 3Q5EA 3A7WA 3EA5A 1T8UA 2ZYUX 3I62A 8KME2 2IYXA 1UM8A 1Z7KA 4LBWA 2G8TA 1GHAF 2PCJA 3TVJB 5C5NA 2ZROA 5CLQA 4Q4AA 1BMAA 1Q57A 2QXGA 1TX6A 2QRZA 2NO6A 2C2HA 1H4WA 2V0BA 2J7PA 3A4MA 4HAXA 1ZUIA 1G3BA 1JMOH 1HGTH 4M1SA 1NJGA 1KTSB 4YT6H 5CHAB 2WIBA 2CXXA 5FOWA 4IHQA 4FMCF 1K28D 3OEEA 1TTTA 5FPSA 1US8A 1PPHE 5HCIA 2QC2A 1FY4A 1V3XA 2ZRPA 1E98A 1SGYE 4PPGA 1W36C 4ZDJA 3P20A 3DKPA 1QY6A 1V2VT 4HZUB 1BTYA 4D9RA 1VECA 3I3SR 4RD6A 5GIBA 1KO8A 5C1BA 3LX5A 1NFWA 1TGSZ 1SVLA 5DP7A 1HT1E 2Z3DA 5KTYA 1QHYA 3DMNA 4LXBH 4GP6A 3MHWU 1ZM9A 2P0EA 4WIAA 2P93A 4JYCA 4LYHA 4M8NE 2J95A 3OESA 1SC8U 5EP4A 4ARZA 1Z47A 2ANCA 2OZEA 2OTVA 2ZE8A 1HV7A 3K9HA 1P10A 5FI0B 1EFHA 1JXOA 5JBAS 2ZQ5A 3IEVA 1DM4B 4I1UA 4WVPE 1UKYA 4YM9A 2Z9KA 2J7PD 2B92A 2F9BH 3GLHE 3QPWA 2WWGA 2STBE 4E5UA 3OAAA 5JSZB 1GHBF 2J0UB 3PUYA 1AQ7A 2XZPA 2CHGA 1SGDE 2J41A 2RG3A 3VR1A 1OXVA 1SOTA 3LAWA 3UWKA 1T3SA 3B1XA 4GI7A 2OXCA 3A84A 1KMHA 1DAEA 3TSOA 1IHTH 3FKQA 3EQ0H 1EG7A 3M4YA 2RMKA 1DUEA 4K8OA 3U8RH 4JS0A 4ISIH 1SQAA 4GOJA 1YVDA 5F8TA 3M35A 4OKSA 2QG6A 2B7CA 1S3GA 1BTZA 3QKSB 3EA0A 2HPPH 3U3JA 1V2MT 5T6DA 4I8HA 1TU4A 4DW2U 3K6ZA 2QAAA 3QI2A 1DXWA 2JCSA 2PGQB 1Z0IA 4MDEA 3B82A 3U44B 2ZPQA 2R62A 1N5JA 2W0SA 3P4XA 4TL6A 1MTWA 3T62A 3NKKA 1W47A 4XBCA 5CYPA 4NDZA 3FB4A 4M1OA 3K70D 2BLOA 1T4UH 5G3ZA 5JRJA 4KITB 2J46A 1L1NA 3RMLH 5E0JA 2J34A 3VHXA 4IS5A 2BOKA 1EXMA 2ZJ8A 3KJIA 1ZRBA 1DBSA 1SPJA 4U5XA 4XVUA 2V4ZA 1QQ4A 1CGJE 4L8GA 1WDTA 4F93B 1RFLA 1NU9A 2BVNA 1W7AA 2OAQ1 4LOYH 3ADKA 3IG6B 1CXZA 1AQYA 2XWAA 2ZTSA 1S9DA 1TWXB 2GEDA 2WSSD 2OCPA 3NWUA 1R5BA 2GESA 1K1PA 2WWWA 3KQUA 2PJRA 5DKMA 1T9HA 4GDFA 3AGPA 1UVSH 1MO3A 2GF9A 1FJSA 4RKOB 3FPAA 3CRW1 3HPTB 2ZHDA 3FMPB 1G20E 1KTTB 2C3SA 1U6QA 1ZPZA 1BBRK 2E9SA 2C4FH 3GLGE 3U3RA 3R9WA 1OXUA 5FL3A 3ZZAA 2ZI4A 3A36A 3D3QA 3RUOA 1IHSH 4C7OB 2HNTE 2A31A 2LPRA 1GG6C 5GNDA 3TKLA 1P72A 4EPWA 2FI5E 2ZXUA 1ZW6A 2PX3A 1AKSA 1MKYA 4MGYR 1AI8H 1RRPA 1O2TA 4K8BA 4QHSA 4E05H 1UPTA 1OIXA 2H7VA 1S9HA 3QKRA 3LBHA 2XC4A 1MO4A 1YCPM 1LS1A 1AVGH 3Q3JB 1SVKA 1HAPH 1C2HA 4U01A 1NMZA 1TALA 3BG8A 1ZGIA 5J4KA 1P2SA 3U3KA 1BMLA 1WOFA 1KSGA 2QXIA 3K8YA 1VCNA 3EWAA 4URXR 3L0PA 3GY6A 1N6RA 4DSUA 1Z0JA 1E0FD 4B3GA 2CDNA 1PJRA 1SXJB 1AA9A 1WQSA 3P95A 3RDZA 2ZSDA 2BEJA 3NVAA 5BXQC 3RU4T 1A3EH 2R6AA 1XXDA 1EK0A 3S69A 4X2VA 2ZU1A 1GVZA 3T28A 4O9VA 5KNDA 5JJIA 1P57B 2BD5A 1EX3A 2F9VA 2V35A 2EFCB 1ABIH 1O87A 1HAIH 2IHYA 1C2LA 3KJHA 1EFCA 2SGFE 2ODWA 1IQLA 1BTWA 1GBMA 3EZ9A 1D6WA 1AS0A 1V2TT 5FTMA 4B73A 3HP1A 3VFDA 3UNQA 4BEJA 2DUCA 4A6LA 1AKYA 4NH0A 1E0AA 1MTNB 1UVPA 4CEJA 1P2UA 1BOFA 1Y5BT 2XAUA 4N1AA 1QGFA 3TW4A 1G3EA 3BGWA 3G01A 1O2PA 2FNAA 1Q3TA 2FPKA 4YLQH 5DSZA 1A82A 4JK5A 1SGQE 3FFGA 1GJ7B 1PPZA 1G8YA 3RAPR 5LPFA 5F03A 4OI0A 2V55B 1ESAA 1RJ9A 2VH0A 1HH4A 1EJMA 3AKCA 4K3JA 3PWBA 4FVBA 5JBTA 1P06A 4DRZA 1GI5A 5HMAA 4CR5A 3MYWA 1X8LA 3AM1A 4LHYA 2IX3A 4Y71A 2RGEA 1H8HA 3KB1A 2IJD1 4D0LB 3KKQA 1LB1B 4TWYA 5C67A 5EUQB 1AWHB 3WNDA 1YCPH 3P4YA 2F1IA 4A6PA 3PMJA 2OE2A 4ABGA 1R6BX 1RXPA 4CH8B 1N3BA 4Q80A 3LWNA 3OTPA 1XMJA 3I4LA 4DC9A 4B1TA 2LKCA 1PLLA 1GHAG 3BIUH 3THWB 1SG8B 1ZINA 2ZPTX 3CO5A 2IXEA 1D4PB 1S5SA 1QURH 1GJ6A 4K69A 2SGEE 2ZRBA 4NONA 2H1UA 1P9NA 3WY9A 2AFIE 1ZGVA 5KPJA 4B44A 1QJ7B 2ZU2A 3LXXA 2I3BA 4HZIA 4WF8A 2XB2A 3N5CA 3Q7QA 4HZHA 1XJQA 3P8NA 3K2UA 3DL0A 4OS4A 2SGAA 4RZ2A 4Q47A 3KQCA 2ZTXA 1TMUH 1QG2A 3B1VA 2FDAA 1W36B 1C4OA 2QAJA 2O8FA 3ATLA 4Q9KA 1TX8A 2VSOA 3STJA 2BQ6B 2OESA 2P6NA 3SU1A 4Q1EA 1MO5A 3ND8A 4TWWA 3PO1C 1EATA 4QRHA 4WXPA 1BMFA 1HAHH 2FEOA 1RRFA 3BG4B 4AKIA 1BRUP 1C5LH 1DWBH 5GDSH 3KDSE 1K1JA 1J2JA 1K5DA 2LWIA 4NCNA 4I81A 4U02A 3BK7A 2Q6TA 1Z8RA 1CEEA 2J45A 4A15A 3WHKA 1RIWB 1NMYA 4JYUH 1G8FA 1NN5A 1LMWB 2VP0A 2Y6TA 3PVSA 2QE7A 2ZI5A 5KYKA 3IDQA 1W2KH 1KDTA 4TYWA 1AVWA 4DDWA 4OJKA 3VMFA 4CDGA 1DDJA 3F6UH 3VHLB 1F0UA 2PLRA 3MFJA
chains in the Genus database with same CATH superfamily
1S02A 2V6NA 3NHSA 4N5LA 4ZAVA 5JDCA 4UTNA 3H5AA 3C74A 3HBMA 4NFHA 1Y4DE 2BZGA 1C5XB 2QP4A 1W93A 2AX3A 4TTQA 5EIAA 4B33A 5CB6A 5KCZA 3ZYEA 4JP8A 1XAHA 2JKYA 3GJXC 1DMRA 5ITZB 2K2QB 1DQSA 1SEVA 2V7BA 4IHAA 4ISBA 4MV4A 5JZOA 4O1HA 3NUMA 4FYKA 1T1JA 3SX4A 4AUMA 5JATA 1RJXB 2W0MA 1ZZZA 2QY0B 1S8NA 3MD9A 1RADA 2C8KA 1SSXA 2QXHA 2FODA 3O84A 1G1MA 1CZKA 3NEJA 5F2KA 3PUVA 1TNLA 1IXZA 3LL4A 2P9CA 3WQBA 3LDGA 5DYNA 4R1OA 2PX2A 1G1AA 4DLUA 4G25A 3A4TA 3U7QB 2PXCA 4C1NA 1IJFA 4KN8A 2FWJA 3PTAA 4H42U 1OBVA 1VPLA 2AH5A 2D0OB 5K05A 2WPIS 3RXEA 3ANSA 3SFTA 4P93A 4DDHA 1O0DH 2I6GA 4PC7A 1VE6A 2FFRA 1C7IA 1QZUA 3HHEA 2A45B 4FZJA 4HFMA 4PYKA 4D2IA 1PJBA 1RLUA 1NW6A 5BNTA 4GSLA 5HA5A 3UC9A 2C84A 1GJDB 1IN5A 1GL3A 4H3KB 4EI9A 5LKRA 5A2MH 4HADA 3M34A 3ZV9A 1DANH 1GUDA 2BE7A 1G2QA 2FSVA 2WHEA 5IAOA 1PU2A 3OLXA 3DSGA 3TAHA 3G68A 3F8TA 3QPDA 4LPSA 2ZATA 2NADA 5AP9A 1USGA 4KWEA 2OGTA 1OXSC 4INAA 3KR0A 4BFVA 3QMWA 2ZDNA 1PFGA 2FF5A 3SQHE 2Q3MA 3HDYA 3HO6A 2AN4A 3QPCA 1N2XA 2OHVA 1N1MA 4PZYA 5ENVA 5IXYA 3MFYA 3GEDA 1NRPH 1NNSA 4HTFB 4X7PA 2QN1A 4DOMA 4TT3A 4P1ZA 4UD9H 1ZD3A 1ZLYA 2Z9DA 4FNMA 4JA2A 4X1YA 1QUFA 4Y2PA 2DG2A 4C4PA 4IDHA 4URUR 1CKEA 3DE5X 5B3JA 3LLVA 2A30A 1M1UA 2YXEA 3K2QA 3ZEIA 3EDXB 4XOJA 5CGZA 1EVQA 3EQ8A 3QUBA 1VHTA 2X3FA 2QYSA 4TSKA 5JB9S 4CJXA 3E8LA 2TPIZ 3FGNA 2WPNA 3HYCA 1O7JA 3KWJA 4PZLA 4CG2A 2CVZA 1A1VA 2Q6OA 1LZLA 1W8BH 3GOHA 1FVOA 1Y37A 3TZ6A 1F7VA 5CDTA 3U6KA 1WXQA 3U17A 3BIFA 3PA8A 1B0PA 1JMYA 4EB3A 4LX0A 2O7NA 1TEHA 4DLRA 3EFOB 2GYWA 1KU0A 1X7GA 4L5AA 3ROKA 4EATA 1UK2A 4ME6A 3MJEA 2C2KA 3C3CA 4LSZA 4MPRA 1N8OC 1JAXA 3AHDA 2ZJYA 2OHOA 2MIIA 2NUAA 4YAWA 4LAFA 1ZONA 1RVDA 3M2TA 3SLRA 1Z5GA 2ZI2H 3HRKA 3N8KA 4OBXA 2AG6A 2BJHA 3WX0A 3WWZA 5KC8A 2ACEA 1VMKA 2VPIA 5B36A 3NHLA 3FTEA 1J8VA 2BHNA 1L4KA 4E4TA 3D9QX 3L7DA 3C2QA 1DEXA 1THTA 3OZAA 5G3YA 3RB8A 1EP5A 1V1RA 4Q7ZA 1S1MA 3I1YA 3KVOA 3TXYA 3ZZDA 2OECA 3VC3A 5FV7A 2W98A 3FCXA 2JETB 1EFPA 1LDMA 2RAPA 3NHKA 3O82A 5A0FA 5K8VA 1XYVA 3I9V1 3VO8A 3L4BC 3VPAA 4WSOA 3BWCA 2XTAA 5LDDC 4PO9A 1M2WA 3BMCA 4WECA 4BYMA 3ECSA 4GOLD 1UMBA 4KI0A 4NYJR 1KDQA 1T4VH 4N47A 4I4LA 1LDEA 1C7RA 1N9GA 1OPXA 1PN3A 1T4GA 3BDVA 3JWPA 5CMLA 5HIKA 3KTOA 4O8ZA 3I77A 1YCDA