5FPSA

Structure of hepatitis c virus (hcv) full-length ns3 complex with small-molecule ligand 3-aminobenzene-1,2-dicarboxylic acid (at1246) in an alternate binding site.
Total Genus 202
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
202
sequence length
645
structure length
642
Chain Sequence
GSVVIVGRIILSGSGSITAYSQQTRGLLGCIITSLTGRDKNQVEGEVQVVSTATQSFLATCVNGVCWTVYHGAGSKTLAGPKGPITQMYTNVDQDLVGWQAPPGARSLTPCCGSSDLYLVTRHADVIPVRRRGDSRGSLLSPRPVSYLKGSSGGPLLCPSGHAVGIFRAAVCTRGVAKAVDFVPVESMETTMRSPTDNSSPPAVPQSFQVAHLHAPTGSGKSTKVPAAYAAQGYKVLVLNPSVAATLGFGAYMSKAHGIDPNIRTGVRTITTGAPVTYSTYGKFLADGGCSGGAYDIIICDECHSTDSTTILGIGTVLDQAETAGARLVVLATATPPGSVTVPHPNIEEVALSNTGEIPFYGKAIPIEAIRGGRHLIFCHSKKKCDELAAKLSGLGINAVAYYRGLDVSVIPTIGDVVVVATDALMTGYTGDFDSVIDCNTCVTQTVDFSLDPTFTIETTTVPQDAVSRSQRRGRTGRGRRGIYRFVTPGERPSGMFDSSVLCECYDAGCAWYELTPAETSVRLRAYLNTPGLPVCQDHLEFWESVFTGLTHIDAHFLSQTKQAGDNFPYLVAYQATVCARAQAPPPSWDQMWKCLIRLKPTLHGPTPLLYRLGAVQNEVTLTHPITKYIMACMSADLEVVT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords HEPATITIS C VIRUS FULL-LENGTH NS3 COMPLEX
publication title Detection of Secondary Binding Sites in Proteins Using Fragment Screening.
pubmed doi rcsb
source organism Hepatitis c virus (isolate bk)
molecule tags Hydrolase
total genus 202
structure length 642
sequence length 645
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-12-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02907 Peptidase_S29 Hepatitis C virus NS3 protease
A PF07652 Flavi_DEAD Flavivirus DEAD domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.820.10 Mainly Alpha Orthogonal Bundle RNA Helicase; Chain A, domain 3 RNA Helicase Chain A , domain 3 5fpsA05
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5fpsA02
2.40.10.120 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 5fpsA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpsA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 5fpsA03
1GDNA 1KY3A 3OAAD 2GP9B 3KXIA 4NIVA 5JYIA 4PANA 4ZPXA 3B8HA 2WPIS 5L3QB 3CKLA 3F1SB 3ADKA 3W90A 3QVUA 1KO7A 4OQFA 5JRJA 1L0ZA 4GSYA 3OF5A 1GSIA 1GDQA 5CM8B 1AGJA 1FI8A 1PPHE 2O8TA 3K6YA 3NWUA 1KDRA 1PPFE 1N8OB 1JXOA 5GDSH 4QXAA 2R0LA 1NFYA 1C2JA 4EFLA 3FP6E 1QA7A 3CX6A 2JLVA 2OQ5A 1HAZB 3L0OA 1EFCA 2WVJA 4WMDA 3X1DA 3W6OA 3VR4A 3DM9B 1YPMH 1JNYA 1V2TT 4QT8C 1DE7H 2ZROA 1ELEE 2QT0A 3C15C 1S3GA 2LWIA 2QMHA 4D8NA 2XNIA 3U44A 1C5VA 4LC0A 1R5NA 3I29A 1O5EH 3IQWA 2ATVA 2WV5A 2UZIR 5LDDC 3P92A 1Z8FA 1C5NH 3ZZ8A 4RVCA 2ZGHA 3SYLA 3WP0A 2GETA 1EWQA 3ZVRA 3EA7A 1X86B 2VSXA 4JKIA 1QB6A 4YLUA 4HAWA 3I61A 1JAIA 3CENA 1UK3A 1UTKA 3ZV8A 4HAZA 2AXNA 1G5PA 2PUXB 5DP9A 3OE7A 3FFBA 1F6BA 1BTHH 5EP3A 3VB7A 2IHYA 2TGDA 1DPFA 3RRYA 1T31A 2DFTA 2C9OA 2A7QA 3RS0A 1EESA 1BMFD 5FBLB 2HV8A 1ZNZA 3FYHA 4ZXYH 2ZFRH 1IHSH 2QY0B 1EGAA 1R5OA 2PLRA 4VGCB 1DOJA 1AHTH 3KJGA 3A36A 1D9ZA 1YPGH 1QCPA 3IQXA 1HAVA 2A5JA 4P3YA 1DSTA 3DDCA 2A4GA 3MOCA 2IF2A 4CT5A 3GY8A 3DMNA 1ELDE 2WAXA 1UVUH 3BTWE 3P95A 2EYQA 1GOTA 5A0BA 2X2EA 3RP2A 3BJIC 3NIBA 3C4JA 1KK3A 1NMZA 1HIAA 4CRCA 1C4V2 1DSUA 3SI4H 3EASA 1SGDE 5FXLA 1U0LA 5FL3A 3LW7A 2VHJA 4RFSB 3TBKA 1G21E 4E03A 3EDXB 5L2YH 3QXCA 2GVDC 4LJ6A 1GBDA 2C9YA 3QVVA 1S81A 2LPRA 3K0FA 3QEOA 3K9LA 2UUKB 1YYY1 1SB1H 3FOZA 2FZZA 1VZQH 1UDWA 1G8FA 1EZQA 4ABHA 4ZDJA 5EPNA 4GSOA 5FR2A 3GY4A 2KBEA 2G00A 2HYDA 1JRTA 1GVZA 3NBZC 4F4JA 1HAYB 3C8UA 2GCNA 4ARZB 1AFQB 2ZM5A 5KU1A 5BPEA 7KMEH 1OWEA 1ELBA 4Q48A 1THPB 2QRNA 3AGPA 1UKYA 1NFUA 1NBMA 3DOEA 2BY5X 4OS7A 1OP8A 2DWQA 2W5EA 2KAIB 1R4AA 1O2YA 1GRRA 4LYHA 2PX3A 5JMTA 2PZEA 1Y3XA 1DTSA 2W2TA 5LBIA 1BBRK 1P72A 1TMBH 2SFAA 1QRAA 1GJAB 4XOJA 2WMNB 1ZGVA 4LK4A 4YXWD 5J4HA 5EW2H 2BVNA 4KFUA 1KJZA 1L4YA 2B7DH 5AR1A 3M5MA 3B23B 5G3ZA 1QQ4A 3SFVA 4DSOA 1G3EA 3TNSA 1ZJDA 4HLQB 3QPVA 1RIWB 4GI7A 1XWIA 2AD1A 4DUGD 2MSEB 3NKKA 3NHBA 5FL7D 2CE7A 2P5TB 1DWBH 3ZZUA 2CV3A 1THRH 2ZRMA 5JFGA 1G3QA 1YRBA 5C67A 1T4VH 3K0AB 1Z0KA 3Q7PA 3PG5A 2BVSH 4TTQA 2Y82A 1C5OH 3OEED 1AZSC 2CE2X 2WSSA 1XEWY 1TF5A 3QTVH 3OEHA 2BMFA 3UKDA 3CB4A 4QM7A 1EX6A 3MSXA 4BFYA 1BITA 4OQXA 1ZBDA 4KVGA 3DKPA 4X1PU 1ZLRA 4JK6A 1RRPA 1OXVA 1K1PA 2FPMA 1W7XH 5HCIA 1TNHA 1VJ9U 5B58C 4NBSA 3GJ4A 1FY5A 1Z0IA 1XVOA 1G3BA 4Q7KA 4A36A 2ZU1A 2P0EA 3UWKA 3IKJA 3K53A 1P12E 4MKGA 2P16A 3L82B 2ZR7A 4Q9IA 2IPHA 3V7TA 1UADA 4XBCA 1L1GA 1LW7A 1OX1A 2A2XH 2XYAA 1AB9C 4AK9A 4Q7MB 3VR1A 4JT2A 3OAAA 5EE9A 4AKHA 2ONKA 1P06A 3QIAA 5CJ2A 1T8MA 4MDFA 1SLVB 1TMKA 4ABBA 1ELVA 1HPGA 2QMUA 5TVKA 1AS2A 3ZZ0A 2F9BH 4D4KA 2ORWA 3MH6A 3B82A 3ZVDA 1SVPA 1EFRD 5L3VA 1U94A 3TR0A 5J47A 1D3PB 2BYAX 3M1IA 2FOBA 2HALA 1BJVA 2ANWA 5LD2C 2Z9IA 4FU7A 2ZTZA 4K8YA 2QQEA 3KKMA 1F7ZA 2J4IA 2NGRA 1IN4A 1E38B 1XMNB 4OHVA 5AF9H 2ZEJA 3SW2B 5A4JA 4IFEA 5IRCD 2WIBA 4FUIA 1Q57A 1EUFA 3NKVA 1CEEA 5A09A 3VNVA 3IBYA 2F7SA 1Z0AA 2AX4A 1F2UA 4F49A 1KXBA 2W58A 1TNKA 4EPWA 4ISIH 3UREA 4W7SA 4IDPA 3QXXA 4LJAA 4KFRA 1ZJKA 4ISOA 2J0SA 1CR2A 1D6RA 2A2ZA 1Z29A 2P6NA 2OO7A 5GJBA 2ANYA 2ZDNA 4U5XA 4BQSA 1GJ9B 1TNDA 1UTJA 2ZHDA 4DB4A 3RMOH 2I1QA 3VPKA 2ZHWH 4OK5A 1W4CA 1ID5H 3PQCA 1GNPA 2QP3A 2QXHA 1W4BA 2QROA 1M8PA 3M36A 2W7SA 3U69H 3PYHA 1KO4A 1BMFA 1CULC 4BAQB 4ABDA 1X1SA 2J5XA 2WMOB 4PXAA 4AGJA 1R7RA 2DFKB 3LGVA 2J7PD 2RB4A 3BTQE 5BN3A 2GK6A 3NEJA 3LO5A 1CA0B 3KX2A 2N42A 4RKEA 3THYA 4GMXA 4M9SA 3NDPA 1Z0FA 2C90B 1LF5A 2QSZA 4M21A 1QF9A 2R6AA 1EZSC 1P2JA 4AYYB 3G0HA 1QBKC 3MUFA 4JZDH 2EFCB 2R3YA 3M6AA 3GJ6A 4FUFA 4JLOA 2NO7A 1E2KA 1XMIA 5TCAA 1MQ6A 1OWJA 1THSH 2GEUA 1W2GA 3WBJA 3SZEA 1RJXB 5AK0A 4Y0AA 4B3FX 2CCJA 4C4PA 3ICEA 1SOZA 2CBZA 1UEJA 2AXPA 2F83A 3U5ZB 3Q77A 4M0LA 3NXPA 4TL6A 2P65A 1Z8RA 1W1WA 2NZ8A 2QP9X 1G8PA 3RXTA 3Q5DA 4KLZA 3SEAA 2O52A 3WMGA 2EFHB 1FY1A 4GRAA 3PM3A 4KAXA 4ZKSU 4KTUA 1Z6GA 2PW8H 2O8DA 1BZXE 1O38A 4RZXA 1NT1A 4IRUB 4PZLA 4TYWA 3R7WA 1ETSH 4C0JA 4EQ6A 4D4JA 1UKEA 1CJMA 1SULA 3KB1A 4Q4AB 3LX5A 4AG5A 1ZMLA 1GBTA 5JLJA 4FINA 4S2EA 1ZRKA 3WNCA 3GCHC 4ASUD 2V7QD 2UKDA 1WXQA 4NIXA 1QG2A 2ZGBH 2Q3HA 1G4AE 1F2SE 3F9FA 1G36A 2HJGA 2GDDA 4X6MA 2QRZA 4DG4A 4YXWA 4ACAA 1CVWH 1XCPA 1TQ2A 1FV9A 5DIFA 1I4LD 3TGJE 3KXLA 4S35A 2IWHA 1AKYA 3M5LA 1PZNA 2W0SA 4V0LA 3E70C 2Y5HA 1SKYE 2Y80A 1E0FD 3H09A 2BBTA 2BDYA 1OFUX 1G3CA 2JKHA 3MU5A 4DUGA 4GOKA 5FL7A 2HDNB 5FFMA 4K3JA 4BFTA 4Q02A 4DEYA 4QGFA 1HJ8A 3MH5A 1K1MA 1ZPZA 4DJZB 4YQFA 1SQ5A 3R9XA 1N6XA 2XW9A 4NYIQ 4CEIB 3OEEA 3LGUA 4MYCA 1YCPM 2GCTB 1BMLA 2R6DA 4FUDA 1R2QA 1L4ZA 1C1MA 5AJYA 1H9HE 2IYZA 4EJSA 4X1NU 2ERYA 3QG1A 3NXSA 2WPHS 3SJKA 5C5NA 1P2VA 1ESMA 2O0HA 4CHAB 2X19A 2WIAA 2FWRA 4Q4LA 4H1VA 3L6PA 5G3YA 5ABWA 4D0NA 4Z51A 3P4XA 3EGKH 5JI2E 2FLBH 4DLTA 2FTMA 2IYLD 5J5CA 3NZIA 2ZQ5A 2AR7A 1MQ5A 3VKHA 1II8A 2ZFPH 1C1PA 1N0WA 1E99A 2MSCB 3NDBB 4N0DA 3BFKA 4AD8A 2FE4A 2V8OA 1TX4B 5JEEA 4LY6A 2PCJA 3MG9A 1C5YB 2TPIZ 1GRNA 2G9NA 4B2IA 4JJKA 3AKEA 3AVYA 2GGVB 1ZYOA 2BDCA 5C18A 1AUJA 1KZ7B 1S0RA 1GL9B 2D2EA 5FCRA 1N3BA 4PAOA 1HCGA 2AGEX 2EI7A 2VHUA 4QBIA 4NCIA 2GAOA 1C5MD 1LTOA 2WPDD 2TGAA 1GZSA 2GKVE 2WWWA 1FAXA 1E2NA 4JSTA 1EFRA 4TMZA 3SHCH 3T5GA 4A8JB 4KJZA 1UDXA 2G1JA 1AZ8A 1G4UR 3KB2A 1T7CA 1HQYE 3GJ0A 2OEPA 2QMEA 3L2OB 2EI6A 4C7OB 1IQNA 1OXXK 2HF8A 3RRNA 3OY5U 2TGTA 4HAYA 3U4QB 1J99A 1GAJA 1GBFA 3GLHA 2OAQ1 4TPIZ 3HDTA 2QSYA 4FWIB 3I62A 2Y81A 3A8TA 5A0AE 4D0LB 5FPKA 5FPSA 1CU1A 2CN0H 3K9XB 3ZZ5A 4I99A 4YMSA 3EWAA 3TQFA 3DZ8A 1Y3YA 4A2QA 1XDBA 4MNWA 1UEIA 3HGPA 3FP8E 1P2OA 1EAXA 3MAAC 2H1UA 3RXGA 4M8NE 1VCWA 1DT2A 1YE8A 3UWOA 3ZVCA 5FBIA 2ZCKP 3T12A 1ZYUA 1C2EA 2VO1A 2P3FH 1J90A 4MPXA 4DBLC 1G9XA 1SVOA 1T8UA 2F9MA 1OXGA 5FTKA 4INLA 3PWCA 3PR1A 3TVDA 4MYUA 5EXSA 1DAHA 2DWPA 1VYUA 3E8LA 4CR5A 1RGQA 2BMGB 4ACBA 3CNNA 1J14A 2BMDA 3C14C 1WUNH 1UPTA 4X2YA 1AFEH 5DP5A 3RXVA 1SGYE 1AQUA 3LWNA 1EAUA 3SOPA 3LGIA 2FLRH 5B2ZA 2HJVA 1BO6A 1RFLA 1Y63A 1NVXQ 5DP4A 3M3VA 3ELAH 3TJVA 2R9VA 3CRMA 4QKQA 2ZYUX 2JLUA 1JOUB 3PEVA 2O9QA 1AQYA 1YF4A 1DLEA 3UG6A 3A7XA 5GIBA 1FLEE 1TU3A 5TCCA 1NMXA 3FMIA 3RLFA 3NG1A 3GCGA 3LOXA 5ESTE 3BEFB 5KTYA 3RC6A 2ZP0H 1O39A 3RWOA 5C2ZA 1Q20A 1VG0B 3EIEA 4CH8B 3WHLA 3VB3A 2Z9GA 1A1VA 1O2WA 1VGCB 2W26A 1GPZA 4QNMA 1O2KA 2GMTB 4FUGA 4BTUB 5L3SB 4B6FA 1N5JA 4PO9A 3FKQA 3SI7A 1V2OT 1W7AA 4M1TA 3SZNA 2PKSB 2BQWB 1C2DA 1O2TA 3SQXA 1O2LA 1DVAH 1LHFH 5DYGA 1ZAKA 1CJUC 3ECCA 2G55A 1KI2A 1GITA 1OLOA 1DARA 1BHXF 4A2WA 3GEHA 4G3XA 2W2VA 1JWTA 4Z8YA 4G1UC 1OH5A 3QF7A 2FI4E 5DN6D 1T8NA 5UKDA 1MO5A 4KSCA 4ASUA 2O8CA 4IDNA 4AURA 2V7QA 1WQSA 3TK5A 4JLPA 2PTNA 521PA 3LAWA 2VHQA 3EC1A 2CL7X 4YMVA 1ANEA 4TMWA 1YHNA 2ZE6A 4MQBA 2VGCC 4MDSA 1GBJA 1LS6A 4XOIA 3TNTA 2OCBA 1EX7A 4JIMA 1V43A 3SO3A 2J9NA 4RFVA 1IAQA 4PAQA 1G30B 1AWHB 4DDWA 1CA8B 1W7GH 4IHQA 4IKEA 4URZR 4I8JA 3ZZBA 3S9BA 3IO5A 4JLAA 1KJYA 1BT7A 2ZQ1A 3KF2A 2ZYVX 1KMHA 1AIXH 1OYQA 1YPKH 2FFQA 1V2KT 1A82A 1ANBA 2O8LA 2RMKA 4GPGA 4CEHA 4OI4A 3L0SA 3OX7U 3ZD6A 3A6PC 2GZ7A 1GL6A 3GLGA 4R2IA 2XWBI 3MWYW 1OH8A 1NF3A 3QK1A 5FBVB 3BIFA 3EA9A 4XVRA 2J34A 1MRSA 3RMLH 2ZRAA 4X8LA 5DO4H 1BQYA 1VCPA 3LGWA 2FX3A 4ABAA 1E2GA 1MKXK 2PJZA 3IWMA 2ZSAA 3OTJE 2BY8X 3M7TA 1FMGA 4B76A 2JAQA 4QBHA 3KN2A 2PT5A 4IOKA 1O3JA 3BIUH 2IYSA 3RXPA 1BOQA 3EXAA 2WUCA 1NU7B 4X8TH 4Q1CA 2ALVA 2PLXA 3ZLJA 4NTZA 2A5DA 1R6BX 2GEDA 1ZNWA 2I6SA 2WKQA 1YVDA 3L8YA 1SOTA 4HGCA 2ASUB 5AUNB 2FM2A 2B21A 1DS2E 4Y7BA 2PLFA 3E5HA 1J8AA 4NSVA 1NZQH 4Q9KA 4DLVA 3AKDA 2ZGXH 3MNBA 1Q31A 1KI7A 1ESNA 1P2SA 2WPLS 1LVOA 4G5OA 1JR6A 3VB6A 3LDXH 1MTVA 1HDTH 2GA8A 3K9NA 9ESTA 3HATH 1P4SA 2ZRFA 1KI6A 1AGRA 1F92A 5KDOA 1WOFA 3RU4D 2WPDA 4DLWA 2ZFSA 2XOKD 3KQLA 2ZHEH 1SFQB 4ABGA 1ZSKA 1J7KA 1ZP6A 5CLLA 4RKJB 1Z6AA 4IXMA 2C04A 4CBOA 2J1LA 4PR0A 4WY3A 1DO0A 4V0NA 1AGPA 2VIVA 3N7OA 2C03A 3BGWA 1JRSA 1G7CA 4YO9A 3BBPA 3DFLA 1E9EA 2F3CE 5DI3A 4M1KA 1KI8A 4MLFB 2KI5A 4AZ2B 1LY1A 2ZJ5A 1TWXB 3ND9A 1KXDA 2VA8A 5HZKA 1U9IA 2J46A 3A80A 1R8QA 1C1QA 5GNDA 3LT3A 3ZZ7A 4UNPA 4FXPA 1HURA 4AYVB 2WV9A 4PHTA 5KNCA 1P9SA 3BTGE 2EWVA 3QBTA 1E94E 2IN2A 2ZDMA 1QJ7B 1UK4A 1ZNYA 4RD4A 5E3HA 2QENA 3FMOB 4BAOB 2GK7A 4I8GA 5H4IB 2GTBA 4KELA 2KWIA 4LJ9A 3K1JA 2HCBA 3PUXA 1O2JA 2ZDVH 1XJCA 2EVWX 4V0KA 3QZQA 4Q47A 1GBBA 2OLKA 1LTQA 1KOFA 2NIPA 2YWEA 3HU3A 1UCYH 1E37B 1HV8A 2QA5A 4TQ9A 2C99A 1BOFA 1DAFA 2IYRA 2FOGA 3U3KA 5FBQB 4PZZA 3ZGXA 4NZQA 1X6VA 1O3HA 1PVOA 1Z0DA 4DT1B 3I5YA 4MGKR 4LHYA 5EGMA 4C3ZA 2OBNA 3VNUA 2IOTA 4KFSA 4BRWA 2ZPRA 1HY3A 5EE5B 3SJOA 1QHHB 1EK0A 4OS6A 5EZ5A 2SNVA 2HOBA 4WWYA 1C4Y2 1AY6H 5JB9S 2PV9B 2Z94A 3LXXA 5F98A 1DANH 1FONA 5AUQA 4URXR 2A0QB 1J9CH 4JS0A 4QJ5A 1F5NA 3WRYC 3TQCA 4SGAE 1DXWA 2RA3A 1K1JA 2DHRA 2PKAB 4LJ7A 1RJ9B 1NFXA 1KI4A 4QHYA 4JZEH 3AVZA 4Z0KA 4J2YB 1NTPA 3EA0A 1E2JA 3SN8A 2XZOA 4DWJA 1IAUA 2BM1A 4EDHA 3C16C 1ZUIA 1E2LA 1O36A 2ZI2H 4RKFA 1Y3UA 7LPRA 1Q3HA 2QG6A 4ESVA 5LH8A 2EQBA 1WCV1 5BW8A 4GNKA 4V0OA 1WAYB 1IY1A 1KYNA 3U8TH 1K28D 2A5FA 2ZS8A 2XC5A 4KODA 3K70D 2Z0MA 2ZI6A 2ZI3A 4C2TA 2C8ZB 2C8XB 2KE5A 2Q9AA 1CHOG 2GJKA 3AUXA 2GBLC 1Q22A 3TLXA 3F68H 5K8LA 5DN6A 1MZDA 4AYWA 2A7JA 4QNRA 3GPLA 1BMMH 3EZ7A 1TGBA 2WPMS 3VU9A 2H9TH 3GCNA 1KSJA 4M9XA 4TTRA 4GT1A 2ZGCA 5C4MA 5KO2A 3R9IA 4PROA 3VXEH 1BUIA 4DZZA 4TYDA 1KK2A 4E05H 1NI3A 3GCTG 3FGNA 2OAP1 1MH1A 2A4QA 3TJOA 5DG6A 4Y8XA 2CF9H 3EAJA 1G3MA 3A7YA 1D9IA 2ZE8A 2FSGA 3TH3H 3I73A 4MUBA 1O3LA 2RA0A 3QF4B 4Z8XA 1LVYA 4LJ4A 2FEQH 1DEKA 1XTRA 2HVXA 2OC1A 2YWHA 1JR3D 2BD9A 1VPLA 4P4SA 3BOSA 4X6PA 1QVAA 2VVVA 1YLDA 3SUEA 1N6KA 3JZAA 2A5GA 1EXMA 2STBE 4HZIA 3N70A 1P2QA 4TWZA 2ZRDA 4MKIA 3AF3A 1WE2A 4BEBA 4A0FA 2NPIA 1JIMA 4CRWB 3GY7A 2C93B 4DCTA 1O87A 1ORFA 2C78A 3KQKA 2ZDKA 2Z3DA 4WXRA 5EXNA 3OYPA 1N2CE 1JJ7A 3PMJA 4OS4A 4ZO4A 3D65E 4Q9HA 6CHAC 2GVFA 4URVR 1DOAA 1AB9B 2BDAA 5E0JA 4IVQA 4JLMA 5G40A 1Q1BA 2ZJ2A 4TLAA 1ELCA 3B1VA 2C8WB 4ISLA 4H1UA 1GBCA 1AWFH 3B78A 3H7TA 3T1VA 1W36C 4K5ZA 3FFAA 5GWZA 2RHMA 4RD3A 1TRYA 2JLYA 3D62A 4E7NA 2I1VB 1GHYH 1E32A 3MH4A 2R2WU 3L0IB 4KTCA 4OKSA 3TITA 4LYFA 2THFB 2O8BA 1QBNA 4TL9A 4XBDA 3I72A 1Z6YA 2BX4A 3I8SA 1G8GA 3RXHA 1P04A 5LD2B 2FMXA 4HZUB 2WBLC 2A4OA 1CTQA 3P8NA 2XOKA 3FB4A 3LJOA 2IUTA 3TSZA 3GICB 1EASA 3PLKA 3ZZ6A 2ZU0C 4WZBE 5I46H 1W0YH 3A86A 4X1SU 5LPRA 2A1DB 1XFAA 3WBKA 3A1WA 3FDIA 1GKYA 4YESB 3X1WA 4XH9B 5JS8A 1SBWA 3ETLA 3QGJA 3AVXA 3A8AA 4RJLA 1NJFA 3A1SA 5SZIA 1DO2A 1G5RA 4QFMA 4BZQA 3LNCA 3LRPA 1TLDA 1GI2A 2Z7FE 4FCWA 1NN5A 5GJVC 3K0SA 1HJ9A 2ZG0H 1US8A 3GLFB 1GWNA 3UQVA 5FOUA 1RTLA 2ZHQH 2BIFA 1YQTA 3CP7A 1OWKA 5K8UA 4GMDA 1C1WH 5D3MA 1SFIA 3EZ2A 3H84A 1W10U 2GX4A 3S1AB 1HTWA 2JGNA 2RGNA 5JWOA 3T06B 1P57B 4ZCMA 5C5OA 1EB1H 4FUHA 3AVOA 4NWKA 3Q8XB 4B3CA 2VP0A 4YLQH 2FN4A 1Q0UA 5JJIA 1GNQA 4LI0A 1S96A 3F9EA 1AS3A 3SUFA 3V00A 1OS8A 1BCUH 1C2LA 1W5TA 2R0KA 3P8OA 3G82C 1EX3A 1TQDA 1GHVH 1Z8GA 2ZRCA 4HLUA 2ZU5A 3KFXA 2GZHA 3PITA 4OJKA 1C2IA 1N6IA 2BCJQ 4QC2A 2D4HA 4Q19A 2XX3A 3GFTA 5FUVA 1GHAF 3UK6A 2ZRIA 3SGBE 1CSOE 4RZ3A 1XKAC 3HGNA 1IONA 5JSZA 4JLKA 2UWLA 3SI3H 3D31A 1MKWH 4PPQA 3AH8A 2OC7A 5AJXA 2FPKA 3P1JA 4GAWA 4X8VH 1XPRA 4TMKA 1DBSA 4XBBA 1QRWA 4FUEA 1C2FA 1A7SA 3U7GA 4NMMA 2YC4C 3OY6U 4KGAA 4JYVH 1OKKD 2F9OA 3NTUA 1L4DA 2CLSA 1DXPA 2Z6VA 4Y10E 2H57A 2PGBB 2IL1A 2VH0A 2GJ8A 2HNTF 2HT1A 3CF2A 3PWBA 3S69A 1K5GA 3A83A 1G17A 2O8WA 1P2NA 1IHTH 1GBLA 1SGCA 2VYFA 3RXUA 2V1XA 2AKAB 4WOPA 1E2FA 3EA8A 2J38A 1GMCG 4N1AA 3KIDU 3IHLA 1MD8A 1M1YE 5BYKA 4WXVA 2BWJA 3TU7H 1BTWA 1EJAA 4WJG2 1EG7A 4LYJA 3TW4A 3B1ZA 1G2LA 3D3QA 3B60A 5DP7A 3ZZAA 2W0MA 3E1XB 3UTUH 4TTPA 1FP6A 4GP7A 4I1VA 2NU0E 2RG3A 5E0HA 3ZQJA 1ZIPA 5KSPA 3LC5A 5G4BA 2BD4A 3DVLA 4Q1BA 2FDAA 3CONA 3G5UA 2OINA 5EG4A 4MPVA 1R0YA 2ZTSA 3UNRA 1Z06A 1W4RA 3PUVA 3QY0A 1B5GH 2G0TA 4LBZA 1LHDH 4US2R 3UANA 1GBHA 1P02A 1QNJA 1YPLH 3GY2A 1HEIA 3I32A 3P20A 2TRMA 1ESAA 3PEYA 2WWIA 1U6QA 3KUCA 1VG1A 2F43A 1WBGB 2XNSA 1A0LA 1JR3A 3IILA 1R10A 2H1LA 4AG6A 4A1TA 1ZM9A 2WKRA 1UVTH 3UR9A 2H16A 1ANKA 2C3SA 2WYGA 1XTSA 3I1FA 2CMYA 4MG3A 3RXSA 4JZKA 4NL4H 1CS4C 4WAUA 4PFSA 1KO1A 1SQAA 1P2KA 1BB0B 1KSGA 2Q6FA 1VCMA 2A78A 2FZ4A 2J9RA 3TJZA 2J7KA 1S6FA 3W95A 1EQ9A 1EPTA 5TMPA 2PH1A 2KJQA 2OZEA 2VU8E 1GMHF 2JLQA 4OHWA 4C0QC 4CRAA 2WJJA 1DWEH 4DC9A 3KQNA 2W6ID 3NWJA 4D6PA 1IJEA 3RUOA 4B32A 5E7IA 4ZKEA 3TGIE 4HB3A 3HP1A 4WZAE 4TWWA 3TKLA 4A15A 2O8FB 1NJGA 3HPTB 1IN7A 1NMYA 2OXRA 4BAKB 1NG1A 2XTTB 1A5TA 3F3YA 4MKFA 2HEIA 2BOHB 2OC0A 2HWLB 4DJTA 1OE0A 1D8TA 5HTKA 1GI3A 3K8YA 2QAGB 1XX9A 1BH2A 1C1NA 4B2PA 2D7DA 3KDSE 3SQEE 3HKIB 5J4VA 2O0JA 1XPUA 3LC3A 1X1RA 1DAKA 1TGSZ 5J4SA 1OSNA 5C1UA 4DVAU 2AMDA 2ZU4A 2JDID 2PGQB 2ZI9A 1B0FA 2D62A 3EE0B 3P8GA 4FI3C 4NE2A 4IC5A 4FIDA 2ZA5A 1G3RA 5BQ5A 1CXZA 2VVUA 3LGTA 1TU4A 3EC2A 4MQAA 4M9ZA 3GOVB 4NIYA 2VIOA 2HT6A 1NLYA 3H86A 4LGMA 2F1JA 3EAQA 3E90B 5FR1A 3IPYA 5LPFA 3BF6H 3RAPR 1TA6A 3MRSA 3DZDA 2RGDA 4D26A 1KDQA 1V5WA 1ZTKA 3SN6A 2ZRJA 3AAVA 5CYOA 3IBGA 1LQDB 1Y3AA 4UFDH 2VH6A 1W2KH 2WJHA 2ZANA 4CRFA 3QXHA 3C41J 3I78A 1JB1A 2XWAA 4TQAA 2YV5A 1ZMXA 1G64A 5A0CA 1K22H 2ZE7A 1UKZA 1T5IA 2OSBA 1U81A 1DG3A 1IQIA 1JBUH 1TX8A 2FSHA 1HE8B 2IYWA 4BLPA 2DWOA 2FA9A 1FUKA 1KY2A 3QPWA 2BC9A 5CLQA 2GDEH 1T9HA 3F9HA 3MU1A 4ESHA 1KO5A 4C9BA 2ZI5A 4OS1A 1ABIH 1UM8A 1TRNA 5LB4A 5CJPA 4NYJQ 3FTQA 1P62B 3ADBA 5C2JB 3KUDA 3QDZB 1XUKA 3BTEE 2AK3A 4QBFA 3Q00A 3E1SA 2OBOA 4I31A 4I1OA 1CRQA 3FVQA 4YM9A 2JCSA 3HYRA 3SHWA 4UDWH 3B6EA 1U8ZA 4NKRA 1WCZA 3LV8A 4QGHA 4N3NA 3F9GA 1H8IH 1HXEH 3GJXC 2CF8H 3M5NA 5T3HA 1OT3A 2BLVA 4TWYA 2QN6A 2YWFA 1GTVA 3UQOA 4TMXA 5IF9A 1OKKA 3LBIA 4D82A 4AOQA 1SR5C 3C5CA 3CPHA 3REGA 4F7WA 1IXRC 1GJ7B 3MFJA 5FTMA 4YT7H 4HUQB 2J94A 1Y3VA 4II7A 3LGYA 5TARA 1XUHA 5CHAB 4E07A 4DCUA 2J0QA 4HDQB 4O2LA 2EW1A 1ZHPA 1HYLA 2J92A 3DKVA 1UFQA 1WYKA 2PZFA 3MWKA 2AWNA 1N6YA 2I3BA 1C5TA 3H1TA 3TH2H 4X1QU 1O3PB 3STJA 2X77A 4TZ6A 4ZHAA 4TLDA 4C2UA 2ERXA 2ORVA 2ZJAA 1G5TA 3U3MA 1T0HB 4NG9H 2VJ1A 4XVQA 2VGCB 1VMAA 1T0JB 4HI0E 3SYNA 2DE8A 4CR9A 1XD2B 3TAHA 3T29A 3PV5A 2PFEA 1SVIA 1V2LT 4YMUA 1X3SA 2C9CA 2PCLA 4BLRA 1PQ8A 1OYYA 3MJRA 3A58B 3QKSB 1T8TA 2XB4A 1Z5ZA 1HB0B 2FEOA 4OL0A 4SGBE 4PC7A 1S84A 3KQDA 3THXA 3RXEA 4BXSA 4NIWA 2OV2A 1XKBC 5J40A 1GMCF 4IS5A 4ZI3A 3RRZA 1P9RA 2XC0A 4XWKA 3TLOA 2VIIA 2VF8A 2JLZA 1NRNH 1EXFA 4LDJA 2Z9LA 1CT0E 4DCDA 1QZXA 4DLSA 4EJSC 3CR7A 4ZHMU 2WPKS 2B9LA 2Y8EA 4LZZA 2GNOA 4Y76A 1QRXA 1F60A 2HLCA 2IF0A 4CVNA 6GCHG 1V2UT 3U7HB 3RYTC 2WWHA 1OJLA 3ODDA 3CRVA 3U3RA 3SORA 3U3OA 1EFHA 1O2HA 3ATLA 4UONA 1GI0A 1E79D 1UTMA 1H4WA 2GD4B 3K0EA 3MNXA 4P0TA 1C5QA 2B92A 5T1VA 4O03A 3KTAB 4M22A 1KIGH 4GP6A 2CHAC 2VP6A 2RGBA 4E7RG 3IEVA 5FOVA 1A46H 4XWAA 4UEHH 2ZUDA 4M53A 2QMOA 2W6IA 1T8LA 2FOMB 2ULLA 1K6MA 4DW2U 3RABA 1YR6A 2ODQA 1L4UA 2WWXA 3CH4B 1TPAE 3BSQA 2W6JD 1DDJA 4V0MA 2IXFA 2VP4A 2NPFA 4NONA 2BD8A 3FMFA 2H17A 5AFYH 1TPOA 4PAMA 1RVDA 2DPXA 2C8VA 4KKDA 4IOMA 5DJ7A 1BIFA 3QX5H 1FN6A 3SNAA 2P95A 3N2IA 1IJFA 1AN0A 1KTSB 1O5GH 3WY8A 1A4RA 2ANKH 3BXZA 1C9TA 1F0RA 4G0NA 1O2PA 1XXHA 4JKYA 1G291 1TNLA 4OJQA 2GV7A 4INKA 2VWLA 1F2TA 2JDIA 3SYKA 4GVUA 1TPPA 1VR1H 3BS4A 3SU0A 2CL6X 3R0FA 4POAA 4KBGA 2AIQA 1OIVA 2Z3EA 2V9PA 4JBWA 3W94A 4D80A 1F5KU 2SGEE 3P26A 1GNRA 5BRRE 3TVJB 3EPJA 3LLUA 3LY5A 4LJ5A 3UMSA 2QAJA 3IGFA 2BKEA 4M2LA 5A0FA 1AKSA 2ZITA 4H6SB 2GZ8A 4MNXA 1RRFA 1P73A 2ODNA 5FH9A 5HMAA 2VL7A 3OIUA 4C30A 2VIDA 1GI9B 3ZZTA 2GCOB 3GLIA 1QHIA 3LDAA 1O2IA 3GISB 2WJIA 2GBLA 2F1HA 2TIOA 1G8YA 4PQYA 5EU8A 2XEXA 1AVGH 4GCHG 2ORIA 2QGZA 1XBTA 1FDPA 1ELOA 2A5IA 1I4TD 1TL7C 4UNQA 4INHA 1WQVH 3PMAB 3UNSA 4FCTA 2QF3A 2GZDA 1RPZA 4KSBA 4NYMR 1ELTA 4ZDIA 4CYMA 3MGCA 1II0A 4L15A 4UXJA 2JLXA 1EJNA 1KY9A 4XSKU 1WTHD 2AD5A 1RW4A 1P61B 4Q9LA 3GLIE 2WSSD 2BLQA 4LV6A 2R6GA 1E2MA 2UUYA 1DAIA 1UF9A 1U2RA 4EPXA 1NN0A 4IEEA 4ZROA 1F0TA 4DSNA 4MGYR 4I8KA 1T6NA 2O8UA 1FTSA 3VFEA 4TMTA 5ANRB 5HM9A 4W5WA 2G4UA 1NVVQ 1LHCH 1CJTC 1TOCB 4JL5A 2E1RA 1P3CA 3JZMA 4M7GA 2Q6TA 4AKIA 3T27A 3ASZA 1FPHH 4A1VA 2HGTH 3UOPA 3D6TB 5FHTA 2QY9A 5IDVA 2IBMA 1HJAC 621PA 2IUSA 2XZPA 2VBCA 2NOAA 1W5SA 1VCQA 1UCYE 2V35A 2PSXA 1MR3F 1MCTA 4UJ3A 5EPYA 2IA5A 5TV2A 1K1LA 8GCHF 1HUQA 5DK1A 4YOJA 3AM1A 3THWA 1R5BA 1XJ0A 4OI0A 3CWQA 1G37A 2QZ4A 2OT3B 1FL9A 1O33A 2ZJOA 1CQQA 3RC3A 1UCYK 3RXIA 4DGJA 4XTCS 5E2PA 1VKJA 1KSHA 1MT0A 2XSZD 2A31A 2QF0A 1C5ZB 3ITIA 1NC6A 1ZUHA 1XX6A 5SZHB 1UHBA 1SL3A 5A8ZA 1NRJB 4X0WU 2Q9CA 3MU0A 3WNDA 3MHWU 1IOEA 1CLUA 3KZ1E 4H4FA 5JBQA 2FO9A 3CPJB 3P6ZB 1GUAA 1UK2A 1N25A 1SXJD 1RC8A 3QKRB 1N6OA 1QHRB 2CDNA 4M1MA 1LMWB 1DPOA 2QXIA 1AFQC 4A0RA 1GDDA 4OGYA 1SVWA 5E4FA 1Z3IX 5FI0B 2IJOB 4CW7A 2XCFA 3EPLA 2C98A 2ODEA 5AJZA 2CGAA 1EAIA 1E2PA 1VTKA 1GWAA 3FFGA 1N6LA 2WKPA 4KFTA 2BBWA 2IUUA 1AM4D 2RHDA 2IYYA 4JZ1A 4A5TS 3LFUA 1C1VH 3HPRA 3TAUA 2AGIX 2GCHF 1GBEA 5K8TA 1MKYA 2WICA 2XXAA 1R0XA 6CHAB 3L0PA 2IJD1 1E79A 3GDUA 4LHWA 3B9QA 2B5TB 3QG5A 1A0JA 5FBWB 5HZHA 1C9PA 3O47A 2OBMA 1YZLA 3E0NB 2VB0A 3QNUA 2BBSA 2IYQA 3QZRA 2HRVA 2V1UA 1C1OA 4F4OC 1W36B 4UNNA 1AU8A 1ZOMA 2BHGA 2YNMA 1E2HA 3U60B 2XTZA 2ZJZA 2FTLE 4AB9A 5AUPB 2ZE5A 4WA7A 5L8VA 4BTIB 3ZVLA 5JZVA 3BH6A 1ZCAA 3AGQA 4FWTA 4A6XA 1QGFA 2W6JA 4CBNA 5L3RA 1S9HA 3JVUA 2ZFQH 4LHVA 5E7MA 3SJIA 3OIWA 1J15A 6GCHF 2AFQB 2WWGA 3B2EA 2Z6BD 2ZI7A 2VWOA 1G8HA 1M6NA 2CCGA 3QXJA 4YOIA 3T61A 4DIDA 3AP3A 3ZYEA 3GQBA 3RANA 4HSEA 3U44B 1HAIH 1E4YA 2CLDX 4I8HA 2RGAA 1ZD9A 1FNIA 2KB0A 4RZUA 4YDHB 4MRRA 2WZQA 3HU1A 5FX6A 4Y71A 1KK1A 3VR3A 2OCVB 3L3TA 1RXPA 1EFUA 2F1IA 4QHSA 1GI4A 3PCRB 1BBRE 4DDVA 2B8WA 1G32B 4NHOA 3GMTA 1OKXA 1ZINA 4DLRA 3NC1C 1NO9H 5GXPA 1XEXA 4DCNA 3A37A 1PYTC 1U9IC 4XDEA 3SV7A 4R0IA 4JLJA 4F38A 2H8KA 4TN1A 3TMKA 1DX5M 2QTHA 1I4DD 2F55A 3LX8A 1BDAA 1NSFA 4XJXA 2AFIE 4NU0A 4RD1A 3O8RA 4UQOA 1GHBF 1K1OA 4W5HA 1FX0A 4GUXA 3D7MA 2RGEA 1UO6A 1HAVB 1T3SA 1CGIE 1TGNA 1D3QB 3VTKA 5FI1B 1WF3A 1RRCA 2VF7A 1NY5A 1W49A 2FGJA 2ZR9A 2G8TA 3A89A 4Q4HA 3GCOA 1IM2A 3LBHA 2GZAA 1MMJN 3LD9A 2CJWA 1HIAB 4R71A 4YTAA 1NKTA 1ZPCA 1U99A 2V55B 4HB4A 1O35A 1KI9A 1OPXA 3IDQA 1LPKB 4KLNA 1NRQH 1Z2AA 2ZSDA 3SNHA 3VKGA 2F3RA 4LJ8A 4M4SA 1TGTA 2ZUBA 5G41A 4K8BA 1E98A 4HLDA 3K0FB 4DIHH 2BY6X 1BYUA 4LOAA 1NKSA 3P8FA 2B8TA 2QCYA 3ZH9B 3E91A 1MABA 1LFDB 4JZFH 1CRPA 5C1XA 1T3HA 3LA6A 4JYBA 4GCHF 1LQEA 2WWYA 3QO6A 3DA9B 3MTYA 1HE1C 2GJAA 4I33A 4EFMA 1FW6A 3TIUA 4MGZR 2DFNA 2R6CA 5FAHA 3HK6B 1O2NA 1R8SA 1O3YA 2DR3A 1D5CA 3ATWA 1IY0A 3AVWA 4D25A 3U6KA 1C5RA 1WTGH 1SVKA 2VIQA 1TUEA 1AQ7A 1O5FH 4H6TA 2JJ1D 1HAPH 1Z07A 1NIPA 2R62A 1FPMA 1MD7A 4AKGA 1FZQA 2QXJA 1DAMA 2LCFA 1E9CA 3A4NA 3WHKA 4AG1A 3ZZCA 3DEFA 3VR6A 2QPTA 3QXSA 1TTTA 4PHFA 3MNCA 1ZZZA 4Q4JA 3FKSD 3DMDA 1UTOA 3GYMA 3W3ZB 2R3UA 4OBEA 3PENA 4PSAA 3ZV9A 2SGPE 5KDLA 3RXOA 4AWXA 4K60A 1LKBA 1OPHB 1N6RA 1ELGA 2D1JA 1QBOA 1XD9A 1G20E 2QM8A 3PMBB 4Q00A 3SJZA 1P7CA 3QLPH 3K9GA 2W00A 3KKQA 1CIPA 1KKLA 2XSZA 2FF7A 1T4UH 3MO6A 1EWRA 4IW3B 3E16B 2NQ2C 4Q21A 1TBQH 1HV7A 4D4MA 5DP6A 2ZVQX 3VR5A 2ZIQH 3ZZ3A 4D9QA 3TUIC 4ITRC 2QA9E 1S1CA 3TIFA 1DUEA 5FPYA 1SXJA 3B8JA 1MKWK 2DE9A 1SGNE 1A2CH 4R98A 2ZVPX 4TSFD 3MFYA 2ZPQA 1ARBA 2SHKA 5H68A 1X8JA 1D6JA 2OXSA 3JZ1B 1MUEB 5D3QA 2Z3CA 1GJBB 2SGAA 2AEIH 1LNZA 3OFND 2BVXH 5GJWC 1OH6A 3ZS8A 1H8HD 2HXYA 2UZ3A 1E96A 1YZKA 1KTTB 5HE8A 1VHTA 3PV4A 1Z2CA 2BZAA 2QUZA 1SZPA 1W3CA 4JYTA 3FE2A 3GFOA 4H42U 3SNDA 1XF9A 1DLKB 3PO1C 1O3CA 5L30H 2QIQA 4K69A 5C3NA 1U98A 3A87A 1SXJE 4X2WA 2VWNA 2ANBA 3TW8B 2H9EH 3MU4A 4Q9JA 4KBFA 5DP3A 2VP5A 3T1QA 3AAUA 2QBYA 2N1BA 3TRFA 2ZCHP 1SGTA 1Z7KA 3T2NA 4ZDWA 2R44A 1A3EH 3IIKA 1RYHA 2E9SA 2BLWA 2QGRA 5C46F 4TYQA 2QL6A 2QQ0A 1IN8A 1PFXC 1J70A 2OTVA 3UR6A 5EE0A 3D49H 1FFHA 2NWNA 1CBWB 2WUBA 3EG5A 4HFPB 1NL3A 5KPDA 4BLTA 3HU2A 2FMJA 2QV1A 3HK3B 5DGJA 4NZYA 4ABFA 1KSNA 2BZ6H 4I4LA 1KK0A 1X8KA 3Q7QA 1QBVH 2CHGA 7ESTE 4I1SA 2C8YB 4X8OA 3JVVA 3PROA 3ZYDA 3RC4A 3MWIU 1IN6A 3D23A 5SGAE 2DCUA 1XTKA 1TQ0B 1F2UB 2BY9X 2V6JA 2Y7ZA 5KSOA 3P32A 4WF8A 2CEAA 1XEFA 1IXSB 3SJAA 7GCHF 1GG6B 4RN6A 5TY0A 1LV7A 3NK8A 1BMAA 2REXB 3AF4A 4QJ4A 2J0UA 1WU1A 1XTIA 5EQTA 2A3RA 4ISHH 1SLWB 5GJ4B 4KCGA 1YCPH 4ABIA 3AASA 1O2UA 4DSTA 1A3BH 1YZUA 3SR0A 2BKUA 2J45A 2ESTE 1FY3A 2XXLA 1MRNA 2GTPA 2YINC 4B1TA 1SG8B 1XUIA 4HAUA 3BEUA 1AA9A 1BS1A 2RGNC 1BTYA 3NUMA 4F93B 4JMYA 4OM9A 4C0SA 4OK3A 1V2NT 2DFLA 3SU4A 1O5DH 4RSGA 5FOTA 2VP2A 3PJRA 1ZTLA 1EOLA 2QYIA 3THYB 4OYHA 4ESTE 3RHFA 4KVAA 4OI2A 4HLUC 2Z9KA 1UTPA 2BEKA 4B3XA 2F6RA 3GP8A 4KP0A 2OLGA 4YC7A 1E0AA 2BLOA 3CX8A 4CIDA 2FIRH 2RCNA 1YPHE 5T6GA 4UE7H 2WJYA 4FMCB 2ZZUH 3VMFA 2YOGA 2D7CA 2PMDA 1KAGA 4TY6A 4UKDA 3H7OA 3TH4H 1C2KA 1MO4A 1F3OA 3U2QA 4CEJA 1CR4A 4ON9A 2ZRBA 1CJVC 1YRAA 1ESTA 1HAOH 3KQEA 4D7FA 1FOEB 5FPTA 2FI5E 2H18A 1TFXA 2O8DB 1O30A 1VJAU 2FFAA 3HWSA 3PLBA 3DL0A 3RLWH 3R7WB 4GHTA 4EQ6B 3SYJA 4Z6AH 5HXFA 1MU6B 1XMSA 2JJ1A 3KL4A 3TK1A 1XUFA 5J4KA 4UFGH 5GCHG 2G52A 3OZXA 1O5BB 1TAGA 1DY8A 1M34E 4KU4A 1W8BH 2BMEA 1GFIA 3K70C 4MRVA 2PX0A 2IS6A 1XD8A 1P75A 2RKOA 4PHHA 2HNTE 2XCNA 3A8CA 1PQAA 2ZPSA 3FKSA 3W6PA 4ERNA 1OXSC 3AKCA 3WNBA 3ZVEA 2H5EA 3TSWA 1IXZA 2BDHA 2BY7X 1F5LA 1G3DA 4O3MA 1CF4A 4IGDA 2EYUA 3MNSA 1VIAA 2SGFE 1EP6A 1DICA 4FU9A 1HGTH 4NCJA 4NA7A 3BE4A 2OE2A 3FMPB 1Y3WA 4FW9A 4K46A 4W9MC 3BTHE 3SZRA 5F8XA 1EKBB 2IS1A 5FUYA 1Y8TA 3BTTE 5I25A 3SU1A 1QA0A 3KKPA 1MKXH 2JATA 3PV2A 1HT1E 1MO6A 5A5GA 1E9DA 1BJUA 1Z1IA 1LKAA 2RH5A 3UMFA 4G01B 4TSFA 4EJSB 1G19A 1CGHA 4IMQA 3BTFE 4K1TA 4A1XA 4OK6A 5M04A 2AMQA 2O8EA 3H5CB 1PYTD 1O2VA 2AKYA 4DVGA 2QPAA 1TRMA 2PEYA 1UBFA 2BJWA 1NRSH 5L3QA 4GBMA 3P70B 2VHTA 4L5BA 1XTJA 3OFNA 4Q7LA 4ZAEA 2H5DA 1H8HA 1NESE 4Q7YA 5EQQA 5CM9C 3I4LA 1II8B 5A8XA 3VX4A 3Q85A 3RNLA 1EPTC 3W5JA 3B9FH 1D2MA 4MVNA 3VXFH 4JLBA 3UATA 5H8WA 2D06A 2RGGA 1P3JA 2CHAB 2VPPA 1EATA 2EFDB 4IDHA 3FHOA 4CRGA 3ZIAD 1QR3E 1JEEA 4IOLA 2P5SA 3JZ2B 4DHEA 4PQFA 1BYIA 1LF0A 2ZXUA 4M1SA 4QL3A 4IOJA 4U00A 2A32A 1BTZA 3EIHA 4QJ3A 1QHSA 3RXFA 2IS4A 4JT4A 2D3WA 2PTCE 1JAHA 4C0HA 3FWYA 3QWCH 4OI1A 2PSYA 1X8LA 1Z22A 3M35A 2R2AA 4WW0A 3SJCA 2CXXA 4M1OA 1PPEE 3U8OH 3FP7E 1BRBE 4YMWA 4FMDB 2WPJS 2BD7A 1P2TA 1XTQA 1OHHD 4Z1MD 1ANDA 5CB8A 2ZEBA 1A0HB 1IBRA 2QAAA 5EODA 3UWIA 3CH5A 3U7EB 2ZRHA 1A7JA 1FY4A 2I4IA 1H65A 3GLHB 1H9LB 3B9PA 1GJ6A 3U8RH 1C1YA 3UPEA 2YKGA 4D2IA 2QN5T 5HR5A 1SGFG 3MO9A 4HTCH 3SGQE 2VSOA 2ZU3A 1IQLA 1OFTA 1JBKA 4MITA 1S83A 4TMVA 3PLPA 2NMVA 1LVGA 3FZDA 1S82A 4Y6DA 2RGCA 1OYWA 2XITA 1SGIB 4BFSA 1GGDB 3H0KA 2ZU2A 4K1EA 1PLLA 2EFEB 3IUYA 4NYIR 9LPRA 1Y5UT 2FDCA 3VAAA 4G5GA 2FOEA 2DY1A 4AB8A 3R3GB 1L2EA 2Z9JA 4LSGA 1D4PB 5FTLA 2G1KA 4LOYH 4LRWA 2L0XA 4RFSA 1D6WA 1E69A 1DADA 1S8FA 4Q1AA 1PJRA 3QI2A 1M7HA 1UTLM 3U1IB 1W0JD 2QE7D 2BM0A 1ZSJA 1P5ZB 5IT5A 5IYTA 2DYKA 1NLFA 1OFIA 1VHLA 1XXDA 4BAHB 4EKDA 2YNBA 3FVFB 4B44A 1VITF 1TPZA 1VCNA 5HKKD 4DLZA 3SNCA 2BTCE 4ARZA 2BDIA 5A8YA 3WP1B 2G77B 1LCYA 2NO1A 3GJ8A 4DY7B 3LQRA 2MMCA 1A4WH 2C77A 3C5HA 1PPGE 3C1KA 1TA2A 1I2MA 4I81A 2AH4X 3N5CA 1CP2A 2KAIA 2D2DA 5C4GB 3VB4A 3SDZA 1H9IE 2FXRA 4UNRA 3UFAA 1E2QA 5KUTA 4DSUA 1UTQA 4GZLA 1S0QA 1BRCE 1GILA 3CRQA 1UVPA 1HJAB 4WH6A 3PB1E 4O9VA 2ILNA 3A7TA 4L8GA 1Q3XA 1Q44A 4AI6A 2GHIA 3ICQB 3PFIA 3IIJA 1HAXB 1ARCA 4Q18A 2YOHA 1N0UA 1WMSA 1KIMA 1NLZA 2VSFA 2R8RA 3DT0H 5PTPA 2FODA 1YLCA 1MAYA 2XTNA 2STAE 2BD3A 4RD0A 3SU8A 2P59A 1AVWA 1I2DA 3U98H 3WXMA 4X6NA 4EAQA 3BERA 2O8CB 4E5UA 5BN5A 3FANA 2YOFA 3SS8A 3URDA 3K0AA 4YDSA 1FMLA 1D2NA 1GVKB 1SGWA 2QM7A 1W48A 3W8NA 5BXQC 4DLXA 2AMPA 1KAOA 2BMJA 3SV6A 4AORA 3QE0A 5KSYA 1NFWA 3V0XA 4B35A 4Y0YE 1QY6A 1QB9A 4NH0A 2B7BA 1IQPA 1LVBA 4H9GA 3WYFA 3ZJYA 1RZ3A 1B7XB 3W5IA 2HLDD 3I8XA 1BMNH 2Y5FA 2GF9A 3NH6A 4PX9A 5CE1A 1SHYA 1KMHB 1W4AA 4OS5A 1TF7A 5GCHF 3VHXA 1QVRA 3OU0A 2NO6A 4C0BA 3SJ9A 4B2BA 4JYCA 1ZJ6A 4JBXA 4CEHB 3SC3A 3GLGB 1ZUNB 4GFDA 2OILA 1ZM2A 2J41A 3M7QA 3V3MA 4L9WA 2XC4A 1O2XA 1QTFA 4AG2A 4LBWA 5TB5A 3UUZA 2EI8A 1AUTC 2RCEA 2E87A 4DT7B 3SBDA 1GHAG 4Q01A 3HJNA 1VG9B 1G9IE 2V3CC 2A7CA 3VKWA 1AKEA 2NU1E 1PQ7A 1YZNA 3FHCB 4Q7ZA 1O2MA 2ZSFA 1GI1A 3NH9A 5DGXA 4Q1DA 1CHGA 1IQKA 3BD9A 4RSPA 3BK7A 3DM5A 1UJ2A 1S6HA 2FX6A 1NBME 3T34A 3ZIAA 2JLWA 3QOFA 2G5NA 2J59A 4B71A 3MMPA 1SHHB 2ZNKH 1X7AC 1TNJA 4KO8A 1CKEA 5JEDA 2ZKSA 3RC8A 3LQQA 2BQ7B 1O2GH 2ZR0A 1KXCA 2G0NA 3TR5A 4MPWA 3UMRA 1ZCBA 4FXGH 4RI0A 3ESTA 1KI6B 4O3UA 1ZM4A 1PQ5A 1SLXB 5HCNA 1C5SA 1Z47A 1P10A 1VG8A 2KBFA 2QP4A 2P8OC 1TF2A 4X2XA 3CS7A 3Q3KA 3CRW1 5HM2A 3S0NA 1OW3B 5CK5A 4ZMAH 4A1FA 4AC9A 2B8OH 2FS8A 2FESH 2WOOA 1OHHA 4Z1MA 1WRBA 4U2WA 1SSXA 4TT3D 3PXGA 4X1RU 5FBRB 2XBYA 2G81E 4RCZA 1E0JA 1O2QA 2ODPA 1KDTA 1QG4A 2SGDE 1VYVA 1SMFE 2XNDD 2R6FA 5DI3B 4PTLA 2ZJBA 4MRNA 4NGAH 1JQLB 4DXAA 5AHGH 3MYWA 3CZPA 3AVTA 2XRCA 4GL2A 1RE0A 1CR1A 2CCKA 1VITH 2ZFTA 1N6PA 3QEJA 1MBMA 3I77A 1O3NA 4Z54A 3EW9A 2FYRA 4BNRA 1DAGA 4WVPE 8OHMA 4O2RA 2VLIA 5CITA 2GT7A 4CGZA 1XVMA 3SUDA 1J8MF 3Q3YA 3LH5A 4LX0A 4AFZA 1H1BA 2G88A 1ZRBA 2TBSA 2BQ6B 3RDZA 2NO0A 4QG7A 2SGQE 1YPEH 2ZIAA 1O32A 2GJSA 1FAKH 1W0JA 1XMJA 2QE7A 4BWYA 1PV4A 1GMHG 3BTDE 4NZLA 5EQRA 3UY9A 3SU2A 2OXCA 1XJQA 2A30A 3BG8A 4A0GA 3DHWC 1YGCH 4U32A 1MTSA 5CIQA 2Z5FA 1Z8JB 1O3BA 3LPRA 3AVPA 4LZ4B 1GHZA 5HKKA 2Q3FA 2OCYC 1TNIA 4PO1A 1A1RA 1DITH 1Z08A 4IMZA 5AVDA 2BDBA 3AQ4A 3CF6R 3CPEA 4Q4AA 2A4RA 1PLJA 3TK6A 3GJ7A 3DUXH 4PQRA 4DLYA 1XB2A 1UAAA 4O97A 2W3KA 3K0CA 2OBQA 1NIJA 2FG5A 1PJPA 4B48A 4Q03A 3LLMA 2GEVA 5FTJA 1ZIOA 4O3TA 3SUGA 5F8TA 1WBBA 3U1JB 1EZXC 3U7FB 1HRTH 2QPOA 4F92B 5AJVB 4RD2A 3M7UA 3ATIA 4UJ5A 1COWD 4ZXXH 1TX6A 2ZU6A 3V4RA 2ONJA 4TL7A 3B85A 5T6DA 5JRZA 2C2HA 1TBZH 4B3DA 3VU9B 1E9AA 3N2EA 1WV7H 1O5CB 3Q5EA 3QKTA 2NU3E 4CEIA 2P6UA 4X8UH 3DPUA 4L4UA 1NSTA 3U3JA 4BFVA 1IQGA 1G7TA 4XFQA 1C1RA 2WTUA 1V2PT 3TVTA 6Q21A 1Z71A 1TEVA 4FUCA 1P9NA 5KOYA 2ZS7A 2EC9H 2GV6A 3NVAA 3T28A 4J1YA 4DDTA 5B6LA 2ZDAH 2HLDA 2X2FA 2A5AA 3RS5A 1TX7A 3DHKH 2AWOA 4LPSA 3WYAA 5TXGA 4NCNA 5JJLA 1XRJA 1KLJH 1ETRH 1Z8IB 3RVBA 4P4SB 4MYHA 1N6HA 3NBXX 1HNEE 1YR9A 1DWCH 4R7ZA 2IEZA 3CW2A 4PC6A 2P3UB 2F4LA 5L2ZH 4GZMA 1GVLA 1T32A 4PZYA 2ZRNA 2ZJ8A 5JECA 2ZRKA 4ZIRA 3ZVGA 4BRUA 4AYXA 1VYTA 3PO1B 2K5UA 1FNNA 4B2CA 2JEOA 4AFUA 5JJKA 3LH1A 4BOHA 2BDGA 1F0SA 2CNWD 2UUFB 1MTNC 5ESBA 2ODYB 1ZC3A 3ZVBA 4GOXA 1TMUH 3T1TA 1NP6A 1T4GA 1SGQE 4IJMA 4YOGA 2FSFA 2ZRLA 1MTWA 3EZFA 4A8JA 1EFTA 2ZRGA 1CO7E 4IBLH 3AVQA 4PSKA 3V4FA 1E35B 3T35A 4G5SA 1GM5A 3KXKA 2JH6D 4E06H 2IS2A 2BOKA 2O8BB 2ZREA 1KKMA 3ZS9A 4C7OA 1TQ4A 5GJCA 2BX3A 4BAMB 1V2MT 3REFA 4MDEA 1YZGA 3GDVA 2W2XA 2J2UA 3AW1A 1C1SA 1TEXA 4NFFA 1HA3A 1O3OA 3U4QA 3OSYA 4TLCA 1FP7A 2Y5GA 4OHXA 1FIWA 4IW4E 3RXLA 4NPHA 1E0KA 4ZCLA 2OLJA 3RS7A 1V2VT 4O25A 3NBFA 1Z0JA 1G6HA 1TABE 2EEKA 5JBBS 3SV9A 3RDPA 5EXMA 1C5PA 5H70A 4BFUA 1CT4E 1SC8U 1O31A 1EAWA 4JLNA 2QTFA 4QRHA 4TT3A 1Q1ZA 1OWDA 2Z4RA 3NBYC 2XZLA 2XNDA 1K8RA 1P9WA 2V3HH 3AF1A 1US8B 1T3LA 2HYIC 3TSOA 1KNQA 2W7UA 2OHFA 1W44A 4JCNA 2WSMA 4ZIRB 1JIRA 3SNBA 4Q2KA 4DOQA 3W3AA 3RU4T 5D3MB 1Z6XA 1YKSA 3M5OA 4CDGA 3GCHB 2O5VA 4WVFA 2ATXA 3F6UH 2FV8A 1NN1A 4Q66C 4B3BA 421PA 1C5LH 1ZNXA 1SGEE 1M74A 4B75A 4JLVA 4AIIA 5B30A 2CMKA 1YZQA 1GP2A 3PMHB 1BRAA 1DY9A 4C0KA 3PEUA 2B6HA 2QAGC 3RXAA 1NRRH 3M4YA 5EUMA 1QL8A 4QGGA 1LS1A 3Q3XA 2Z83A 3KKOA 2A45B 1GVNB 4URUR 4IDQA 4EPTA 4A92A 4R9UC 1G18A 5L3SA 4A6PA 5JSZB 2GCPA 5E95A 3QKUA 1A2KC 2FJUA 1OV4A 3EARA 1GI8B 3BH7A 2QU8A 1ZR0A 4B73A 1U8AA 2BBOA 1C5XB 3ZVNA 1VCIA 4BTTB 2PZGA 1SVLA 5JHHB 4JZIA 3AUYA 1ETTH 3U61B 1S2MA 2XBWA 4Q1EA 4ABYA 1ZGIA 1D3TB 2F9PA 2AS9A 2GAAA 4AFQA 4FN5A 1GBKA 2AFHE 1C2MA 1HAGE 3LBNA 1XU4A 4M9FA 4JBYA 3M37A 2YC2C 3RXRA 2IXGA 4WZ6A 4HDOB 3GLHE 1S85A 5DKMA 2FH5B 1TONA 4R8TB 2CJIA 5IK2D 2W83A 2V3OH 1W47A 2J0VA 1TALA 1YCPK 3D8BA 5C20A 1JXPA 3RSOA 3A7WA 1V2ST 1NM6A 3K70B 2J7PA 1QJ1B 1FIZA 4D76A 2OG2A 2ASEA 1COWA 4HDCA 2WWFA 2EFGA 2O8MA 3A4MA 3FPAA 4DEXA 1KLIH 1QIXB 1W0KD 1GBAA 2BDTA 3WRXC 1KLTA 3SFZA 4B34A 1O2SA 2YWGA 1L1NA 2PJRA 1RRKA 2OP9A 3AF2A 5EW1H 2EA3A 3PUWA 2V54A 1K21H 1PUIA 4TYPA 5EXXA 1E9SA 2NG1A 1GJ8B 4PPGA 1AK2A 1TMTH 5E2OA 1OXUA 2ZHFH 2JIZD 2IK8A 2IYVA 3TUZC 4JVMA 4ZI2A 5DH9A 1ZTJA 1TGCA 2FSIA 1O3IA 4JVLA 3RSLA 3F0TA 1SXJC 3BFXA 5C1BA 4US0R 1J17T 5IHPA 2F43B 3DO6A 4U02A 5HYOA 3CWZA 1N0VC 2BV3A 4IVPA 1GBMA 1KDPA 3BIVH 2GXQA 2IW3A 5CHAC 3R8CA 3CR8A 5DHFA 1P6XA 1E2IA 3K9HA 1TAWA 1TADA 3T1OA 3GD7A 2Q21A 3AVVA 5F8ZA 3HPQA 1D3DB 2QI9C 1YR7A 2HXSA 1ZMNA 2OBLA 4CZ2A 4XWOA 3LXRA 3R20A 1O5AB 2YZ2A 4OQLA 1EPTB 4AKEA 1P03A 2ZSEA 1KHTA 1E34B 4JVSB 1D2EA 2CNWA 2H92A 1V2WT 1S4QA 3KJHA 5KPJA 1KXFA 1KNXA 3EWSA 1JALA 4LXBH 2H6MA 4TY7A 3MCAA 4Q7XA 4PPNA 2JASA 3B1XA 1KDOA 1YM0A 1QQUA 4ZHLU 1U0JA 4K81B 4AFSA 4THNH 1O3FA 4JMPA 1YBWA 1E6CA 1WP9A 3EQ0H 3LVQE 1P11E 3K6ZA 2IYTA 1TPSA 1K1IA 3ZZ4A 2DUCA 5JBAS 2P3SA 5H1YA 1XCGB 1XUGA 1MZAA 1O3GA 2FPLA 3A7ZA 1LB1B 1E36B 1Z6JH 3S7HB 3SQHE 8GCHG 3RXMA 2Q3MA 4PSVA 4PO8A 5P21A 1P9UA 3T25A 2Q6GA 3K09C 3LONA 3ATKA 5JB8S 1L7VC 1ZW6A 2XTMA 2IEYA 1DVRA 1ELFA 1QHXA 2VTKA 3ZVAA 3B1WA 1A5GH 4EPYA 1INCA 4MNVA 4GOJA 3UIRA 2A5KA 2AN9A 1Q3TA 1A2BA 4NA9H 2VHCA 1LPGB 4MRSA 5EP4A 1FY8E 5FUWA 1TE0A 4QBGB 4B3GA 2ZECA 3RRMA 3GLGE 4EIWA 3WMEA 3VGCC 4FD2A 2PEZA 1KDQB 2OD3B 3EZ6A 2AL7A 2RGXA 4L9SA 3RXCA 1HT2E 4AN7A 1TQ6A 4LCBA 1S5SA 3UNQA 2XJ9A 1SVSA 2FPZA 3ODFA 1XZQA 2WOJA 5GVRA 4PC2A 1Z83A 4QHTA 3QENA 1YPHC 2QC2A 4ZCIA 5LGOA 2V6IA 2VH5R 2WHXA 1GCTC 1O3DA 4DT1A 1Q12A 2ZWLH 4ZUHA 3H2YA 2WINI 3AVUA 3T26A 5E8EH 3ZYCA 3UOUA 2WAYA 3J81k 2GJ9A 1QHHA 3I3SR 1DWDH 4HB0A 1ZHRA 2JETC 4KV9A 2GCHG 3VB5A 2LKCA 5FTNA 1ZVQA 1AO5A 2ZAMA 3SU5A 3A81A 3S9CA 3OTPA 2PKAA 1RJ9A 3W9YA 1P09A 2FEMA 3OHMA 5AFZH 1XZPA 2ECKA 3X1YA 6ESTA 1L1JA 2H7VA 3BB1A 4KYIB 3F5FA 3EX7C 3T5DA 2HPQH 4AY2A 2MSDB 2REOA 2FNAA 4UXHA 3BB4A 1R0WA 3IO3A 4K8OA 1KXAA 3SHAH 2ZYTX 3AP1A 3PVSA 1BA8B 1EJMA 5DSZA 4LYAA 1S9DA 4IDOA 2FYQA 5DE3A 2ANCA 1IQJA 2HNTC 5HPYB 2R2MB 4B33A 2CXVA 4G5RA 4MA4A 3WYGA 1BIOA 4Q80A 1T8OA 1SHZA 1GJ4H 1V3XA 721PA 1MV5A 2F9UA 3A82A 1CGJE 5EXTA 1W0ZU 4BEJA 3BTKE 2H2ZA 1WDTA 3RXJA 1Z6TA 4P33A 1FN8A 4BLSA 5C1YA 4DB2A 121PA 4KYUA 1OSSA 5TDHA 3GY6A 4U30A 1QL9A 4OQMA 3BH0A 3SBEA 5IK2A 2VWMA 3A1TA 1P60A 2Q9BA 2PMKA 5GVSA 8ESTE 1T5LA 3B5JA 1RFNA 1SHKA 2CL0X 1FNMA 1SLUB 2GESA 4LHXA 3RS4A 1QFKH 4ZKNU 4A0HA 5TJXA 1XEWX 3ONWA 3IHWA 1W0KA 3CBQA 4RKOB 3P4YA 3QF4A 2ZYWX 3BG4C 1CBUA 3U6BA 4URWR 2PHBA 1RRGA 1FUUA 1AI8H 4OS2A 4UFFH 3GEEA 3STIA 4YZUA 4ASHA 3RS2A 3SOSA 3H4MA 3BWDD 3K2UA 4FUBA 4NFEA 1N5LA 3SGAE 5KDDA 3RM2H 2IXEA 1GHBG 3UWJH 4FVBA 3RLYH 3MO3A 3PIRA 3THXB 2JIZA 1FUJA 3BTME 3W34A 1NG9A 5DI9A 1CE5A 1VECA 3MD0A 1W46A 1AZTA 3LH3A 5KSZA 5CMXH 4RCYA 1NN6A 1Y59T 2H9HA 1HQCA 1GHWH 1GJ5H 1OIWA 2JJ8A 3GJ5A 2VIPA 1TQ7B 5JPMH 3VQTA 1CT2E 2F9NA 3ZDQA 1ESBA 1AZZA 4Y79A 4NDZA 4ZV4A 1H8ED 2OCAA 3VHLB 4KTSA 4YONB 3KNXA 2RAPA 4BASA 1E9RA 4X8SH 1GHXH 1HBTH 4NYJR 4W5JA 1WQ1R 4J0QA 2FI3E 2M5TA 4KXFB 1CJKC 1RKBA 3O8DA 4L16A 2FFHA 4B74A 1S0UA 3SU6A 5J4QA 4GLYA 3L43A 1E9BA 1N8OC 5DO9A 1NRPH 1GKIA 1MO3A 3EYDA 2H5CA 4HATA 1ZC4A 1O2OA 2J87A 2NZJA 1GBIA 1UKVY 3PTBA 1AJEA 1GMDG 3T15A 2V4ZA 1MAXA 5FOXA 1ODFA 2C95A 1BTXA 2OM2A 4HZUA 4HAXA 2XAUA 4Y0VA 2OUAA 2YOLA 1DUAA 4BZPA 3AEZA 5CYPA 1G7SA 2X1VA 1IQHA 1V2QT 5F9FA 2JH0D 2AERH 2P3TB 4XVUA 5EJEA 4F4IA 2NO9A 5KNDA 3EA5A 2ZQ2A 1G3IA 5LPNA 1GIAA 3CLVA 3CNLA 2P8OB 1BRUP 1PPBH 5J4LA 2ZTYA 4JL8A 2KSQA 4QOSA 1XXHB 5KHOC 4HAVA 1LHEH 3VX3A 1YR8A 4EPVA 2WYJA 2QT1A 3A4LA 1F2TB 1NY22 3ND8A 2XB2A 4MYTA 5LPEA 3GLFA 5KNBA 4BFWA 3LKWA 1KXEA 5BN4A 4WXIA 2GDJA 2UVQA 2SNWA 1BBRH 4I8LA 2G4TA 2ZDLA 1KZGB 2F9LA 2WJVA 4BLQA 3MWLA 1HH4A 2UWPA 1ELAA 1UMAH 3S1AA 1TB6H 2VINA 2BXUH 2A9KA 3ZZ9A 5JCZA 5F6MA 1VDZA 3SE0A 3KQCA 3ZVMA 2BD2A 5F2EA 3W6NA 1AKSB 5JI3E 3QSYA 4VGCC 1N5IA 1JMOH 3AKYA 1EOJA 4X8HA 4FVDA 1QB1A 3AW0A 1IQEA 1TOMH 4EPRA 5BYJA 3GLIB 4EUNA 1GRQA 3GLFE 2BHRA 3KEEA 1P2UA 1RS0A 3QTOH 4TLEA 2FOLA 3C7KA 1KSFX 5DYIA 1E4VA 1CR0A 1ZD1A 3ADDA 1LPZB 4LZ1H 1G6OA 3ZD7A 3VR2A 1E0SA 1DM4B 4A2PA 4GHQA 1WXRA 1TNGA 4YT6H 1FMJA 5F9HA 2FZLA 1G41A 4A7IB 3RWMB 5DP8A 2XGJA 1UTNA 5EOKA 3B13B 4FMCF 2REBA 3HR8A 4TL8A 4GPTA 4B43A 2AIPA 1DAEA 1ZM3A 2P67A 1FJSA 1Z6EA 2V6NA 3SBKA 1ZHMA 2VQSA 2JA1A 2QNRA 2B7CA 3BORA 1SQOA 4F4CA 1GL1A 4D7GA 1AE8H 4IVRA 2OFWA 4TPYA 1Z28A 2I6QA 4G5QA 4N0EA 3RU4E 1NVWQ 3P17H 4D9RA 2OUKA 4URYR 3MWJA 3R8FA 1O3MA 3T62A 2ZF0H 4TLBA 1ZU4A 2J95A 4U7DA 4LC1A 2VRWA 2G5VA 3Q76A 1WA5A 1BHXB 1TYNA 2JJ2D 2XJ4A 5K0HA 3VFDA 4MRPA 4JVNA 2YHSA 3O8BA 3UIEA 1W13U 4NA8A 3RMNH 5ETXA 2AHOA 3RXKA 4ZH8A 3TK9A 4PPFA 3EIQA 1JI0A 1NN3A 4RZ2A 3A1UA 4NSYA 4Q7JB 2GF0A 1B23P 4V03A 1RIWC 1IOZA 1K1NA 3Q9LA 1GI6A 1ACBE 1D9XA 1GL7A 3C27B 4QGAA 7GCHG 2G3YA 1P01A 2EWWA 2IWRA 3THWB 1HYQA 4CF7A 4C0LA 4WMEA 1FQJA 1WBDA 3EPHA 2QXGA 4DCSA 5FOWA 2FP7B 2NU4E 3QGNB 1C2GA 3BC1A 2FWWA 1W11U 1UHBB 4B6EA 3KHVA 3QUMP 1YJ5A 1N6NA 3IEUA 1G7RA 1HLTH 4BUJA 3A1VA 1C1TA 2QORA 4A4DA 1P8VC 3TGPA 5FCKA 2VVCA 1M7GA 4XD7D 2C96A 5HGGA 5GPIB 4MGIR 2ZTXA 1FPCH 4NCYA 4RD6A 3SQWA 4B47A 1JXMA 1KJWA 2LNCA 1OFHA 1LO6A 3G01A 1M9UA 1IQFA 2OK5A 3NHAA 4I32A 4X6OA 2AGGX 4ZDKA 1QURH 3NPSA 1XPOA 4IN2A 1F5RA 1NU9A 1ONBA 3QN7A 1KI3A 5F3WB 1W12U 1OWHA 3RM0H 1H8EA 4CT4B 1LHGH 4HYYA 1P2IA 4US1R 4JSYA 3V9PA 2VEDA 5B57C 1B0EA 4ZKRU 2LKDA 3O8CA 1O2RA 2WV4A 2XXAB 4KI0A 1F0UA 4LPKA 3Q72A 1RTKA 2O8FA 2J3EA 1MTNB 1ZMJA 1E1QD 4BFZA 2ZGJA 4CH2B 2Z4SA 1Q1EA 4LV8B 4DRZA 3KJEA 5HE9A 4FMBB 3Q3JB 5JDUB 1E1RD 1SPJA 3CNOA 4A9AA 3GY5A 2HCJB 1KTVA 1NVVR 2FS9A 5EXPA 3SJBA 2QAGA 2FX4A 4HUTA 2CVHA 1AN1E 3BN9A 3KCGH 3A85A 4MUAA 1HAHH 3AF0A 2FGKA 1UVSH 4CREA 2VP9A 4Q5IA 1HXFH 3CS0A 3CIOA 1A5IA 1A5HA 4FMDF 1SKQA 2NTYC 3EPKA 4LBYA 3QJYA 1CHOF 4BPBA 2HPPH 1OB2A 5FBEA 4M1WA 2GT8A 3OIYA 3E3TA 3TGKE 1O3AA 1QDEA 1MBQA 3BV9B 1QHGA 4EFNA 3CUEF 2PR3A 4KHZA 1YC0A 1P3EA 4U01A 2MMGA 2AYWA 1GI7B 1OOKB 4P4TA 6LPRA 2AK2A 3GCTF 2VIWA 3PUZA 5E7JA 4O0MA 1GMDF 2ZO3H 1OXTA 4BZXA 1GJDB 3QPUA 3EZ9A 2JH5D 1QRZA 2FFBA 3E0PB 1JPJA 4B2AA 2CHQA 1DE0A 1JPNA 3BB3A 2B0FA 3LJJA 1XEXB 1J2JA 1YZTA 3GYLB 2A7HA 3HR7A 5ELXA 1JR3E 4D4LA 3VEQB 3PEWA 3A7VA 2Q1JA 2D8WA 2R65A 1C4OA 2ZCLP 1LVMA 4DURA 1AD8H 1Q2WA 1QHYA 1DG1G 1V6DA 2FOHA 3UG7A 5AUOB 3SNEA 1CA0C 2OC8A 4BANB 1MH0A 1FX0B 3KKNA 3FAOA 5CDFA 3MMGA 5FX5A 4XIGS 1CBWC 3TUJC 4OGXA 3AK5A 2ZI4A 4R2HA 2K1QA 1JEDA 1M2OB 3FZZA 1SQTA 1SGFA 3KJIA 2JLRA 1NS3A 3S9AA 1KI1A 4C0AC 4XE4A 4Q4HB 1G1MA 2BVRH 4TYNA 2X8AA 2A2QH 3KQUA 4PHGA 1OYTH 2GILA 4Q1FA 2CJWB 1UJ1A 5LB2A 8LPRA 1OIXA 3CX7A 4Y8ZA 4BLOA 2G6BA 2CK3D 821PA 2P6RA 2ZRPA 2P94A 2FOAA 3V12A 4DKXA 1NPMA 5DNYB 3NEYA 4M9QA 1GG6C 3PTNA 5CDFE 4MNYA 1AE5A 4TYYA 1U8YA 4WBSA 5JWRA 2YNAA 1MABB 5JS7A 4HUQA 3F8TA 1R0ZA 1ANCA 4AX9H 4D81A 2ZUCA 1V2JT 1HUTH 4XSHA 5DISB 3L8ZA 1SGRE 3SV2H 1PPCE 1UBEA 3S7KB 5FOSA 5T6FA 4OQNA 3RC5A 3ZZDA 2ZETA 5FPHA 4BFXA 3PV0A 3K0CC 2F9VA 1S3SA 3WMFA 4JLDA 2Y7XA 4ILEA 2JJ2A 2OESA 3R9WA 2G83A 1OF1A 1SGPE 1SVMA 1N1LA 2FU5C 1F48A 3HKJB 4YLGA 1UBCA 1XD2A 1GI5A 5DLQC 4PC3A 4WMFA 5K7RA 1KGDA 1XMVA 3TJNA 1MCVA 1FQKA 2OFOA 3CF0A 4XTRA 1AS0A 4Q4JB 4TZ0A 3MJHA 5JWHA 2YJTD 2C4FH 1M7BA 5JCPA 1ZM7A 1OH7A 3QKSA 2CHVA 3M3SA 2PWXA 3KGPA 3LU9B 1E2EA 1ZD8A 2TGPZ 4DIIH 3LVRE 3KFVA 4LK2A 4V02A 3A8BA 3RS3A 4UD9H 1QHNA 1IY2A 1YP9A 2ANMH 1BTUA 4FCVA 5B6OA 2GCTC 5CB6A 2DBYA 3IIMA 5EP2A 1W2HA 1ETUA 4P31A 2OQUA 4X8MA 2A5YB 1C5WB 3K09A 3CM0A 4YMTA 1FTNA 1XXFA 2XBVA 1U0HC 3CO5A 4D0GA 4DDUA 1Q21A 4OHYA 4CHAC 4NYMQ 5DPAA 3KQHA 2ZJYA 4XD7A 1SXJB 2BJVA 4Y7AA 5F03A 3SU3A 1RTFB 3L33A 3NCLA 2BEJA 5EZ6B 2TMKA 1TUIA 2Q6DA 1B0UA 4P32A 1IQMA 3RXBA 2PBRA 1OP2A 4F91B 2GVZC 3M3TA 3A88A 2CLCX 4AYTA 3GEIA 4WH8A 4LUCA 3DD2H 4RY2A 3KTAA 3AV0B 1BTPA 4JL6A 1Y5BT 1VCOA 1L2TA 3QUSA 1P2MA 1S1MA 4E22A 3RXQA 1Z63A 1W36D 1IN5A 4KITB 1VITG 2N46A 3K65B 1TIOA 2QGNA 5BWMA 3X2SA 1FQ3A 3TH5A 1Q1QA 3SHFA 3FHTA 3M61U 1O3KA 4UFEH 4IFBA 4LHZA 1ABJH 1E1QA 3BAFA 2QBYB 1HFDA 3ADCA 4JYUH 2GRJA 1TBRH 1E1RA 2D2FA 4X2VA 1L8QA 221PA 3LIWA 1DELA 3GFPA 5A2MH 4A8JC 4ZKDA 5JBCS 1KO8A 3NC0C 4MH0R 3IG6B 4MPUA 1WSSH 5CK4A 4AGKA 2IC5A 4HEJA 1G2MA 1P0SH 1E3MA 3M0EA 4CRDA 5EE3A 3I5XA 4LJYA 2GXUA 1V2RT 3RXDA 1O0DH 2IHBA 2IYUA 4P4UA 5JHGB 4LBVA 3GDSA 2BB4A 2F1RA 2V0BA 3I92A 4M1YA 1KYIA 2FOCA 2RDLA 1H8DH 2ZC9H 1GCDA 2Y6TA 4MTBA 2YYZA 1NY6A 4DIEA 3UPUA 3E2IA 1YU9A 3OE7D 5B64A 2BM2A 1C5UA 2XBXA 1NVUQ 1JQJC 1OWIA 4GDFA 3OESA 1GG2A 2GWHA 1YPJH 1XM1A 1QL7A 1XUJA 2WM9B 4Y11E 2UUJB 4BECA 2GCOA 2HUPA 2W3IA 3TE6A 1J16A 3DOFA 3U9AH 3CZQA 4BGDA 1J8YF 1SKYB 1Y5AT 4A6LA 2ODWA 3VGCB 1XCMA 2J0UB 5FUXA 1C9KA 3TJUA 5J4YA 2HF9A 1O34A 2Z43A 3KQBA 2BD5A 1AMHA 1AVXA 3LW8A 1IHUA 1PPZA 4QM6A 2PT7A 4I7YH 4ISNA 2JLSA 3PUYA 5GADl 1O37A 4NP6A 5CIWA 1P05A 4JJZA 4I1UA 1GCTB 2IX3A 3P27A 1GJCB 2C5LA 3KL6A 4XSGA 1XP8A 2P93A 3TPIZ 4BE7B 4TQUS 1YKTA 2F3TA 2JETB 3ATMA 3B1YA 2O0KA 1C1UH 2DB3A 1ZRHA 5L6NH 1T91A 2OFXA 3AB3A 4IXNA 5SZJA 1NNEA 4FU8A 4Y0ZE 2OCPA 3V13A 1DS6A 3BRWD 3IITA 3OIVA 1VGCC 1Z1JA 4IN1A 8KME2 4HI3A 2P2LA 3SV8A 1FZZA 2GMTC 4FUJA 3W8RA 2CK3A 2WJGA 4V0ME 2GXSA 2CVFA 2YVUA 3IPXA 2FOFA 4ZKOU 5SZKB 1G16A 1AIPA 4LV5B 5DHAA 1JECA 2PKSC 4ABEA 2QEQA 1GL0E 1PUJA 1OB5A 3SJ8A 1NBMD 4HLCA 1OP0A 4K2YA 4CEJB 4E09A 5JBTA 1K5DA 4NCHA 5EXLA 1E2DA 1XXHE 2F91A 3MLEA 3GY3A 4UXIA 1JJVA 3THOA 5AJWA 2BOVA 3BFVA 3UXMA 3CRRA 4UNSA 1GGDC 1MTUA 4OHZA 1ZPBA 4K1SA 2ZAOA 4JK5A 4Y8YA 5IDKA 2G51A 4CRBA 1WB9A 3TNFA 1G3UA 2ZS9A 2EU8A 2VNTA 3MH7A 3RMMH 5KYKA 4MKHA 1KMQA 4WIAA 3BEIB 1O3EA 3ENSB 3DFJA 1A61H 1RIFA 1PLKA 1RD3B 2ZPTX 1ZU5A 3WY9A 3X1XA 3ZVFA 2GZ9A 3A84A 5AWFC 2D74A 4DLUA 1K9OE 2PL3A 5E0GA 3T5FH 4IC6A 5K8IA 3E6PH 1EP5A 1ZSLA 1C4U2 2R9PA 5EQSA 1K2I1 1O2ZA 2IYXA 1GKUB 2PUQH 2ODBA 4NCKA 1RYFA 2UWOA 4PC1A 2NU2E 3OEHD 3BG4B 1UBGA 2BCGY 4DCVA 1EB2A 1N5KA 5EE1A 5EUQB 5EP1A 1BKDR 3QKRA 2GKSA 3ASYA 2BXTH 4HZHA 2D26C 3HYTA 1XNJA 3X1ZA 3ZQ6A 4BXWA 1MU8B 2ZFFH 4NWLA 4WXPA 3AP2A 2QTVB 1VIYA 2Q0HA 1GDUA 3GJ3A 3QBVA 1II9A 2IT1A 3A8DA 1DFPA 1UVOA 4A82A 4B2LA 3MU8A 3URCA 4IEIA 1FXYA 1SI5H 4LWZA 2ALPA 1EZUC 4HB2A 3MI4A 1E9FA 3B7GA 1U90A 1NROH 1MOZA 1QJ6B 2ZSBA 1W14U 3QQ5A 2GXAA 1LDTT 2O8EB 1C2HA 5G53C 4ABJA
chains in the Genus database with same CATH superfamily
1GDNA 2AJTA 1RBQA 4NIVA 1R0LA 1NI5A 3E8MA 1KO7A 3DDZX 2JAUA 2CXQA 2VJCA 3QUCA 1KR2A 1L0ZA 3BDVA 1GSIA 2D1SA 3JV7A 4BTEA 3QFTA 4RE6A 3ZWBA 3RSSA 1C0PA 4J1QA 3HM2A 2TRSB 2BE9A 3UWMA 2G4VA 3BWMA 1PPFE 2I9KA 5GDSH 4QXAA 2R0LA 4IJVA 3G02A 2ODAA 3UAGA 4DLAA 3OQ1A 1QA7A 5EPUA 4W4TA 5EWJA 1UBLS 1WHTB 1SUPA 3L0OA 1EFCA 2QZZA 4WMDA 4XIIA 4R9SA 2Z30A 5HRCA 1WMBA 4JNCA 1Y1LA 1FDUA 3DM9B 1UK7A 3E22A 4L6AA 3HA5A 3FMGA 4KXYA 3C15C 1JZSA 2QT0A 4MWCA 4DE5A 2LWIA 1THTA 4D8NA 3E03A 4LC0A 1R5NA 5CXXA 3OOJA 3IQWA 1XQWA 2ATVA 3HVUA 2WV5A 2UZIR 3P92A 1Z45A 3T9DA 2FX5A 3NANA 4KSYA 3F71A 1MN6A 3QLUA 3WP0A 4JKIA 1EIZA 4HAWA 1JAIA 2H85A 4OAQA 3ZGVA 3LP8A 2P9JA 3CENA 2GPNA 3BN3A 3D6VA 1PDOA 4HAZA 3NTVA 1PGOA 3TFOA 1GCUA 4REQA 5DP9A 3UMMA 2Q5JA 5K4HA 2ZSJA 3UTCA 3G0GA 3OF2A 5EP3A 1T6XA 3SZUA 2IHYA 3JALA 2O7RA 1GCOA 3RRYA 1W29A 1EFPB 3PWSA 3TGWA 4KIJA 1I6WA 4ZXYH 2VN8A 3GU3A 3GRUA 1AV6A 1EGAA 1R5OA 1LDBA 2PLRA 4UBMA 3A36A 1D9ZA 1YPGH 4XPZA 1HE2A 3WIVA 2A4GA 3IAAA 3O8LA 1ELDE 3BTWE 3P95A 4DY6A 4PLYA 1I6MA 4Q3LA 5A0BA 3RP2A 4WHMA 1VJ1A 3BJIC 3VZRA 2VHYA 1H0HA 1C4V2 3SI4H 1SGDE 1FYXA 5FXLA 2XLBA 3LW7A 3H5IA 3TBKA 1G21E 4JMLA 1VBFA 3UV7A 3EDXB 3H7AA 4E11A 3QXCA 3AETB 1XUOA 2OLEA 4LJ6A 2OM6A 4LK3A 3GA0A 2UUKB 1YI0A 1VZQH 4Y1FA 2PYIA 4ABHA 4J1TA 4NDAA 1PR3A 1S2OA 5F2NA 1IOVA 3QPCA 1QWOA 2RIPA 1QPZA 2GCNA 4A1OA 5CD9A 2PV0A 5KU1A 5BPEA 2FUCA 3ZHXA 3J80A 1ZGAA 4AL4A 1UKYA 1NFUA 1NBMA 1VJDA 2BY5X 3PNLA 2WWVD 5KYNA 4OXQA 3WSVA 3NDJA 2W5EA 3C6ZA 1V1JA 4DLNA 1UWKA 2PX3A 5FLXA 2D4AA 3VDRA 4ERXA 1Y3XA 1DTSA 2W2TA 2R7MA 2H63A 3R6DA 3DAGA 1TMBH 2SFAA 4XOJA 4LK4A 3DSRA 4KFUA 4DLKA 1KJZA 4HVTA 5AR1A 3GNLA 3RVQA 5G3ZA 2XB9A 5AK4A 1QFMA 1O4WA 3UOGA 1SU8A 4UPEA 4HLQB 4X00A 1C1XA 1LPMA 1P0FA 5C0OE 1RMQA 3NHBA 2A0UA 3EWNA 3VDMA 3KZKA 2JVKA 2CV3A 4P98A 1G3QA 4LXUA 5C67A 3HVJA 2P35A 4JJ8A 1T4VH 3PLRA 3NWEA 1R00A 3TRDA 3P97A 3EXEA 4I5DA 3KSBC 1XEWY 1TF5A 3QTVH 1SOAA 2QOEA 3D8HA 2BMFA 2GM9A 1F17A 5AVVA 2HJ9A 4EBFA 4WY5A 3H1PA 4RT1A 5CYGA 1BITA 1O97C 1J20A 2WSLA 2RHTA 4KVGA 3S1LA 1LQTA 4JJFA 5K01A 1W7XH 4GXNA 5HCIA 2Z4TA 4NBSA 3GJ4A 2ZGVA 3SF8B 1SU7A 3FNIA 2OP0A 3EH2A 3GAZA 4JB2A 4WJKB 3GHYA 3Q3HA 5JO0A 2P0EA 5EZSA 3SLKA 4YACA 4MKGA 5JIBA 2O3JA