2DE8A

Crystal structure of porcine pancreatic elastase with a unique conformation induced by tris
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Elastase-1
publication title Tris(hydroxymethyl)aminomethane induces conformational change and crystal-packing contraction of porcine pancreatic elastase.
pubmed doi rcsb
total genus 57
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2006-02-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2de8A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2de8A01
2D8WA 3QGNB 1P04A 3GDSA 4H42U 1DWDH 3MH7A 3M5LA 4YZUA 2PFEA 3RXDA 2R9PA 4DG4A 4DW2U 1AMHA 1WTGH 3MU8A 3NPSA 1EXFA 1UVPA 2BDYA 1HFDA 3GCHB 4FUBA 3ATIA 4JZEH 2G51A 1TGBA 1S6FA 1J9CH 2XYAA 5TCCA 1GBFA 4UFEH 2ZGBH 1LCYA 4BOHA 2O8WA 2Z9GA 2AIQA 2OBOA 1MU8B 3SO3A 3ZVEA 1TPPA 2TGDA 3RXVA 3AVZA 1ID5H 3ZV8A 3PLPA 1CA0B 2FDAA 3SN8A 1P12E 4LOYH 4B75A 1GMCF 5EGMA 1AWFH 4GPGA 5FPSA 1C5ZB 2AMDA 1RRKA 4BTTB 1NN6A 2J95A 2JH5D 4CBOA 3PMJA 1C2EA 4AYYB 2Y5FA 1MBQA 1BTXA 2BDIA 2BDGA 5B6OA 3RXGA 1TRMA 1A5HA 2Z3CA 3TH3H 1C1RA 1HGTH 3U8TH 1DLEA 1TOCB 3LGUA 2TPIZ 2Y81A 1QQ4A 4DJZB 1ZR0A 1GMCG 1O3IA 2KAIB 1C5UA 4A7IB 5FBIA 4X2WA 1MAXA 5ABWA 4OGXA 3SW2B 2ZU5A 3FZZA 4GVUA 1XMNB 1EB2A 2UUKB 1UCYE 1RD3B 1YM0A 1O3NA 2DE8A 3KCGH 1HJAC 3O8DA 2UUFB 1XVOA 2C8YB 3L3TA 1NT1A 1TFXA 5FCKA 5EQRA 3M7QA 4MPUA 4FU9A 1F5RA 3UNRA 1GL0E 5FX5A 1O2PA 2DUCA 1V2NT 2OC0A 1TGTA 3GY7A 2B7DH 1C4V2 5JBCS 3G01A 2BOKA 1WOFA 1V2JT 2H6MA 3M5OA 3S7HB 2ZGJA 1BT7A 3LOXA 4Q7YA 2EA3A 1K1IA 5E0JA 1C2FA 3L33A 3TJUA 1H8IH 4CR9A 4BXWA 3GCNA 4ZROA 1NM6A 1IQNA 4DURA 3F9HA 1HAYB 3RXIA 1GBBA 2TGAA 3A88A 4ESTE 3SOSA 2SGQE 2O8TA 1EZSC 4PROA 5FAHA 3LH1A 2VIWA 2BX4A 1GHVH 3A87A 7LPRA 1C2IA 1HBTH 5BPEA 1HAXB 2XCNA 2P16A 3VGCC 5EODA 2Z6BD 3UNQA 4IGDA 3RXKA 1H8DH 5DJ7A 3F68H 3GICB 4B2CA 1CE5A 1QL9A 1K28D 3MO9A 5JPMH 3Q3KA 4I32A 2BQ7B 5F6MA 2OP9A 3VB3A 4DVAU 1MKXK 1C2LA 1DM4B 4YLUA 3UR6A 2GV6A 4BAKB 2CHAC 4Q80A 1MBMA 2BY5X 1QCPA 1O3PB 2ZFQH 1V2ST 3JZ2B 2BVSH 2AERH 2ZC9H 2ZGCA 3Q77A 1BBRE 5CHAC 3UIRA 1C2JA 1UTKA 4FVDA 1KY9A 4J2YB 1HIAA 1YCPM 1QHRB 2FIRH 2ODPA 4ISIH 1SMFE 2FPZA 3MOCA 3AAVA 4J1YA 1KXFA 1L1JA 1B5GH 1BZXE 1FN6A 1P2KA 1NTPA 2OD3B 4K5ZA 2C8WB 3QTOH 1SC8U 2GP9B 1SHHB 4H4FA 1RGQA 3M3VA 4R8TB 2R3YA 2VIVA 1XUFA 4ZKOU 1ELGA 1Q2WA 1DUAA 4NFFA 1AVWA 2W5EA 1GJAB 3SJ9A 2VIQA 2V3HH 3GCHC 4D7GA 1JXPA 1JBUH 1O38A 3A84A 1GHBF 3AASA 1O2NA 5DK1A 4JCNA 1QR3E 1BB0B 2BLQA 5C20A 3QX5H 1V2PT 2F9OA 1HRTH 1CGHA 1KTSB 1K21H 1GVLA 1DOJA 2G55A 4X8TH 3P17H 5C5OA 2XCFA 1ZRBA 2G4TA 1OKXA 3SHCH 4INKA 2NU4E 1PFXC 5E2OA 3TPIZ 1GHBG 2QC2A 4FUJA 2CJIA 1DVAH 4DGJA 4JZIA 1C5NH 1KIGH 1JMOH 4UFDH 3UOPA 2R0KA 3V0XA 1AFQC 2Z9LA 1K1MA 1ZTKA 1L1GA 1QY6A 2ZA5A 1TQ0B 1PPEE 4D8NA 2BLVA 2P3FH 1ACBE 5H4IB 4AGJA 1D3PB 4UDWH 1BHXF 3UUZA 1GDUA 1EATA 3ENSB 6CHAB 3PWCA 2VGCC 5E0HA 2BY7X 3F6UH 5GXPA 2CN0H 2GTBA 1ZTJA 3LGYA 2O8LA 2VJ1A 3UY9A 2FLRH 1LKAA 2A32A 2A45B 1J15A 1P01A 4ZUHA 5A8YA 4MNXA 2GZ9A 3TIUA 8LPRA 2FS8A 2EEKA 1CU1A 2GZ7A 1E38B 1F0SA 4YLQH 1SSXA 1T8LA 4X2YA 2PWXA 2OINA 5HGGA 4ZKRU 5GCHF 1GMDF 2F9BH 4YO9A 1UHBB 1WYKA 2ODYB 3GY2A 1LVBA 4X1SU 2XBYA 3LT3A 3U8OH 1DS2E 1GJCB 1KSNA 1CA8B 1O2WA 2HNTF 2BZ6H 1AY6H 5EW1H 2QYIA 4E06H 3BF6H 5GCHG 3D49H 3RXPA 1GMDG 4D7FA 4B76A 1A3BH 1VJAU 5LPRA 2HGTH 1BCUH 1EJMA 5JBAS 3T27A 1HAVB 1HXEH 1IQHA 1CVWH 2NWNA 3LGTA 4JYUH 2SGPE 5HM2A 3VB4A 5GPIB 5LH8A 4I8LA 4A1VA 2PR3A 4B74A 5DG6A 5TCAA 2VVUA 1HJ8A 2ZIQH 1C5YB 1EX3A 1EOLA 3SU2A 5T6DA 1P3CA 3RXLA 1P2JA 2VWOA 1HAHH 3U8RH 2Q6DA 3E90B 5AFYH 1EZQA 4WMFA 1EAUA 2F9NA 2ESTE 1YLDA 1Z7KA 2ULLA 3U69H 3V13A 3A8DA 1HJ9A 1D4PB 2A7HA 1ZHRA 2HALA 4VGCC 1LHCH 5T3HA 1OYQA 1SGYE 3IITA 1NRQH 1C2KA 1FY4A 4RN6A 3ATLA 4Y7AA 5LPEA 2RG3A 3IWMA 2BD4A 1FI8A 2ZDMA 4NA8A 2BOHB 1ARCA 3C1KA 1INCA 2ZEBA 2ZPQA 2XXLA 1NPMA 2BM2A 1GBIA 4CR5A 2AIPA 5L6NH 5HM9A 1BDAA 1O3HA 3UPEA 1GJ8B 1GJ6A 1O3GA 1F0TA 2UUYA 3UQOA 1GBCA 1VGCC 1TB6H 4CBNA 2WYJA 1S84A 1AO5A 3SZNA 4WF8A 4RSPA 5I25A 1A5GH 2Z3DA 3ZVBA 1YPEH 2SGFE 1QTFA 1ZPZA 2YNBA 2FI5E 4F4OC 1ZYOA 1DX5M 1O5CB 1ARBA 1SFIA 3NKKA 1JRSA 1O3DA 1P2OA 3L6PA 2FXRA 2STBE 1S0QA 3PWBA 1G3EA 1B0EA 3TK6A 1V2KT 1GCTC 3T5FH 2J4IA 3P8OA 3SU3A 1ETSH 2XC0A 3LC3A 1J17T 5G4BA 5A8XA 1P2QA 3BSQA 1ETTH 2ZG0H 1O5FH 4QT8C 5EXLA 1K1OA 2XTTB 4Y71A 3A7XA 2HRVA 4FU7A 1GI5A 3UWJH 1Y3VA 3LH3A 1G37A 1TBRH 1V2VT 1GDQA 2FI3E 3P95A 4H6TA 2BZAA 3U1JB 3RXFA 1EP5A 1CO7E 2ZFTA 4IN2A 4CH2B 3STIA 1Q3XA 3FP7E 3LONA 3SU5A 2Q1JA 5GJ4B 2H2ZA 1FIWA 3OTJE 5LPFA 2P3TB 1YP9A 1DICA 1IAUA 1RS0A 4ABIA 3O8RA 2QCYA 3STJA 1EASA 1GBEA 5T6GA 3S0NA 1GI6A 1GDNA 1GGDC 1O2UA 4YT7H 5JBTA 1V6DA 1AUTC 4ZHMU 4MQAA 2C93B 1G32B 1W7XH 3P6ZB 5A0AE 4X1QU 5TJXA 1HJAB 3NK8A 2C8XB 1DY9A 2UWOA 4XDEA 4DT7B 4ISHH 3EAJA 1ZJKA 1KXDA 3I29A 1TX8A 2FO9A 3QUMP 3WY8A 1OWEA 3SI3H 1C5OH 1GI7B 1LHDH 4KGAA 3HPTB 1GBLA 3BTWE 3E8LA 2BYAX 3RXCA 2IJOB 1FY3A 1GI8B 3U98H 3PLBA 5BRRE 1QJ1B 2QAAA 1EOJA 1KDQA 1W10U 5EQQA 1F0RA 3ZZ7A 4JZFH 1Q31A 1TLDA 1JIMA 1EB1H 4Y8XA 4UEHH 4IN1A 1TWXB 3SHAH 1C5QA 3BTHE 4ABHA 3SQHE 4BAHB 4ABBA 1K1NA 4K2YA 3KGPA 3SJKA 3M7UA 1VITH 4ISLA 3VGCB 4NSYA 1GI0A 1YC0A 5J4SA 3QTVH 1YPKH 2A7JA 1A0HB 3SGAE 3R0FA 4UFGH 1TGNA 1H9LB 1WSSH 1C4U2 2SGDE 4AB8A 3T62A 3A82A 3NWUA 2R3UA 3OYPA 5JB8S 2Q6GA 4Y0YE 2VIOA 1AU8A 3P70B 1TYNA 2H5CA 1TBQH 4MNWA 4AFUA 1Z71A 2PW8H 1DXWA 2QN5T 2BMGB 3KHVA 3LJJA 3SJOA 2CHAB 5DP9A 1UK3A 4Y6DA 3ATWA 4Y79A 3T25A 2IN2A 1Z8IB 4RKJB 1BJUA 1EZUC 2A5AA 3M3TA 3QO6A 2QF0A 2ZU1A 3BV9B 3RU4D 4HFPB 1DFPA 1FY1A 1FNIA 1VCQA 3AW0A 1EAWA 5F8XA 4CRAA 4LK4A 3MH4A 4FUCA 2CV3A 2RCEA 5CE1A 3BG4B 2VH0A 4INHA 2V6NA 1UJ1A 4MG3A 1QIXB 1OOKB 1P09A 1D9IA 2FOEA 2P8OB 1N8OC 2GT8A 2VVVA 2XW9A 5DGJA 1OWIA 2ZNKH 1XUJA 2I6QA 1Y59T 3LPRA 1AD8H 2XC5A 2ALPA 1AE8H 1OSSA 1SLUB 1V3XA 3MH5A 4OS2A 3UTUH 2BTCE 3SUDA 1UCYH 2ZFSA 2P93A 1CHOG 4E7RG 1KLTA 2QXIA 2SNWA 2HNTC 1FMGA 1T8OA 2XRCA 1GBTA 1ZHPA 4IC6A 1BMAA 4H6SB 3GY6A 3FANA 1MZDA 1QL8A 1O2JA 4GAWA 3RLYH 1FY8E 1QBOA 4O3TA 1SLXB 1SR5C 4AFZA 1O5AB 4WVPE 1QRWA 1Y3XA 1C1OA 1MTVA 5HXFA 1HAOH 1JOUB 3RLWH 5JDUB 1TNJA 1CHGA 2FYQA 5F8TA 1C1SA 2ILNA 5AF9H 1V2WT 4TY7A 1AFQB 2ZECA 1OWDA 1WTHD 1YYY1 1MU6B 1GI1A 3V12A 3LC5A 4WH8A 5E8EH 1GI2A 3RC5A 4DIHH 3PROA 1SOZA 3A81A 3FAOA 2BD2A 2RA3A 3PLKA 3HGNA 2J38A 1ELAA 1KTTB 1XM1A 3UREA 4B73A 2CMYA 4WXVA 3TGIE 1AVXA 6GCHF 1O2ZA 5EU8A 1F92A 3KF2A 3RXOA 1SGDE 1TNGA 1VCPA 1WQSA 2VGCB 4U30A 1YPLH 1WUNH 1TALA 1C5TA 4X1PU 1VCWA 1YGCH 5EPYA 3URDA 4TWWA 1TAWA 2ZDKA 3M36A 1P3EA 1DT2A 2LPRA 3HK6B 5C3NA 2Y6TA 2BVRH 1UO6A 2A4RA 1OWJA 5F8ZA 4ZAEA 3NZIA 3KQBA 2ZFFH 4IMZA 3TJNA 1GHAF 3C27B 1O2HA 3M35A 3H7OA 1P03A 1F5KU 3IG6B 6GCHG 1C1QA 1C9PA 4BTIB 1D3TB 2FI4E 1XVMA 3OU0A 1B7XB 1OS8A 1NESE 3QWCH 1G30B 2P3UB 2ZCHP 3LDXH 5IYTA 3M5MA 5EQSA 4AFQA 2FOCA 4F49A 1O32A 1P2MA 4SGAE 3BEUA 4I8GA 1U6QA 1GHAG 1BBRH 3LGIA 2SGAA 1GVZA 1E34B 1AIXH 1QA0A 1FAXA 1J14A 1O0DH 1PJPA 1YF4A 1MUEB 1BRBE 2FOFA 4NIXA 1MQ5A 3S7KB 1SFQB 2VU8E 4I31A 3SV7A 5EXMA 1K2I1 1LQEA 1O3KA 1MTUA 1ABIH 5C67A 5IDKA 1W12U 4AG2A 5DP7A 1KXBA 2FZZA 3A89A 1ZPBA 1GJBB 2A2XH 2DE9A 2A1DB 3E1XB 1C1TA 4XSKU 1QJ7B 4HGCA 3D62A 3SBKA 2W7SA 4YT6H 4B2BA 3UWIA 4NFEA 1P02A 1P9SA 2P95A 1C1PA 2ZFRH 2V0BA 3GYLB 2AYWA 3LJOA 1GBMA 3HK3B 1UTQA 1N1LA 4CRCA 1C2MA 2O9QA 2FM2A 2EI8A 2FOBA 4TPIZ 1O3MA 4UONA 1LHEH 2WINI 7KMEH 1C2HA 4GCHF 3MO6A 2F91A 3UR9A 2PLXA 2CF9H 1WCZA 3SNCA 5GWZA 1DSUA 4VGCB 1O39A 2ZU2A 1NFYA 3TNTA 1QB6A 2FESH 1MCVA 4GCHG 4O03A 3QZQA 3BG4C 4X6PA 2VINA 3KQDA 1AZ8A 4D76A 3W95A 2G5NA 2FTLE 2UUJB 2Y82A 5CMXH 3TVJB 5I46H 1OXGA 2P8OC 2Y80A 1NU7B 2NU1E 3P92A 3MHWU 4ABFA 1TA6A 1FLEE 2BHGA 2FOGA 3BTEE 3SJ8A 1V2QT 1XUHA 4DOQA 2XC4A 1AI8H 1VGCB 2GX4A 4NGAH 1S5SA 1QJ6B 4GSOA 5AVDA 1GI4A 1BTYA 4KTUA 4K3JA 2QIQA 2JH6D 1XUIA 5ETXA 4MTBA 4AGKA 1DLKB 3E3TA 2WPJS 1T8NA 2EI7A 2ZU3A 4NZQA 1OX1A 2WPKS 3P8FA 1GI3A 1BTZA 5T6FA 1W0YH 2Q6FA 1GCTB 2GVFA 1LPGB 3R3GB 3ZZ6A 3RU4T 2XBVA 1TRYA 2GMTB 2Z3EA 1G9IE 1S6HA 1DDJA 4NCYA 1P10A 2K1QA 2FOHA 1TMTH 1QBVH 1HAZB 4E05H 2BVXH 4KKDA 3K6YA 4LZ1H 1FJSA 1P2IA 3KN2A 2ZF0H 1G36A 2OQ5A 2P94A 3ZZ5A 1CGJE 1K1JA 1ZGIA 2TGTA 2A4QA 1TNKA 2J34A 3F9GA 1H9HE 1SOTA 3I78A 1BTWA 4X6OA 2HWLB 1B0FA 3NXPA 1C5WB 1S0RA 2GZ8A 5EPNA 4ZKSU 3SNEA 1AKSA 4K8YA 7ESTE 4OS4A 3V3MA 4MPWA 4ZXXH 4M7GA 1F7ZA 2XNIA 4HI3A 3SJIA 2A31A 1GGDB 1FIZA 2BY9X 1BJVA 3Q76A 1V2RT 4IW4E 1TRNA 1C9TA 5A0CA 2B8OH 4YESB 2FP7B 4I8JA 2EI6A 2QXJA 1BTUA 2RA0A 3BN9A 2OLGA 4FU8A 3T29A 3LGWA 4Q7XA 4ABAA 1ZMLA 3S9CA 1RFNA 2F9UA 1OP8A 1GBHA 4MPVA 3PTNA 3Q3XA 4B2AA 3S9AA 1ZSLA 1HAIH 5EOKA 5E0GA 4AZ2B 1A46H 1TMUH 4BAQB 1DITH 8GCHF 3GCTF 4NSVA 1VZQH 1V2LT 5DKMA 4JMYA 3SNAA 1E35B 1AQ7A 1Z8JB 3ZZ3A 1A1RA 2GCTC 3ZZ8A 1IQJA 3H5CB 4NIYA 1HAGE 1KLIH 3TJVA 1DUEA 1LQDB 2P59A 1ANBA 4GLYA 2QGRA 3DFLA 4SGBE 3GDVA 3P8GA 2W26A 1BTPA 8GCHG 1TIOA 3EA8A 1AVGH 4CRFA 3GCTG 1FUJA 1O3LA 5FHTA 1O5EH 3A7WA 4HTCH 3BIVH 1O3EA 1PQ8A 4UE7H 1BRAA 3RM2H 4B1TA 3GCOA 3UFAA 1GCDA 3TJOA 1D6RA 1O5BB 1A0JA 1K9OE 3BEFB 1QB9A 1QRXA 2VWLA 2PGBB 2A2QH 1PPBH 2M5TA 3MU5A 4TY6A 1MKWH 3SV6A 5K0HA 3ZV9A 3F1SB 1O2LA 2QF3A 1HIAB 1UMAH 1FZZA 3QGJA 1P11E 5A09A 3EDXB 3SGBE 4U32A 2ZHEH 1CT4E 2G8TA 2ANKH 3BTQE 1TGCA 1WBGB 1NRPH 1BHXB 2ZGXH 3BTGE 1THSH 2R2MB 4OS1A 3RMLH 4TWYA 3CP7A 1W14U 2F3CE 4XFQA 1C5PA 2ANYA 4FUHA 1O2OA 3EA9A 1C5LH 2BDHA 2B0FA 1LVMA 1P05A 1N8OB 2VIPA 1NC6A 1DPOA 3A8BA 1FV9A 1WU1A 1C1NA 5C1YA 1EQ9A 4K1EA 4YTAA 1F2SE 1HUTH 3S9BA 2ODQA 5JYIA 2AGEX 4AFSA 4YM9A 4ZMAH 3SUGA 2F83A 2FWWA 3LU9B 2Y7XA 1AE5A 1SLWB 1SGIB 1UTPA 1ZGVA 3URCA 1SGRE 2GMTC 3N7OA 1W11U 1Z6EA 1SGCA 3UOUA 2BQWB 3RXHA 1P57B 4A6LA 3A8CA 1C1VH 1BOQA 2BD8A 2FX4A 1D3QB 1XUGA 1KYNA 1SLVB 1XXDA 2BD9A 1IQFA 2R0LA 3CENA 5ESBA 5E2PA 1W2KH 2B9LA 4K1SA 1EAXA 4FUDA 4FUIA 4AB9A 4Q7ZA 8KME2 1SQTA 3M7TA 3GY5A 4Y8ZA 3RXSA 1PQAA 2WV4A 5HYOA 5A2MH 3OSYA 4BTUB 2H5DA 2BLWA 1W0ZU 4MVNA 3DT0H 1NY22 1O3AA 1WQVH 2FTMA 3ZZCA 4TYDA 1SHYA 2ZZUH 2BD3A 3D23A 3SUEA 3CS0A 3QN7A 3O8CA 2ZP0H 1YPGH 4NIVA 1SQOA 2ANWA 2GGVB 3HGPA 4X6MA 1QB1A 2C90B 4WY3A 4D9QA 1DWBH 2AGIX 3HKIB 1FDPA 4JZ1A 4YOJA 5SGAE 2J94A 3RDZA 1XKBC 1L4DA 4A1TA 1TNHA 1NRRH 4WWYA 1GJDB 2GCHF 1GBJA 4MDSA 1FQ3A 8ESTE 2HLCA 2BDCA 3O8BA 1LPZB 3BEIB 2O8MA 4BNRA 4K69A 1ELDE 4IBLH 3SQEE 4FUGA 6ESTA 4BANB 2PUXB 3ZZBA 1LKBA 1ZSJA 2VB0A 1O3BA 2BXUH 1P8VC 1DE7H 2GCHG 1EKBB 4X0WU 3A80A 2Z7FE 4I8HA 4ZH8A 4CREA 3PM3A 1CSOE 4CRDA 2Y7ZA 3CS7A 1O5GH 4K1TA 1DWEH 4NG9H 1C1WH 3RC4A 2OTVA 1O2QA 2ANMH 4XOJA 4DCDA 1MAYA 1CBWC 1EJNA 4IC5A 2W7UA 2TIOA 3I77A 2PKSC 4NWLA 1QURH 2VIDA 1O2YA 2VVCA 1E0FD 4BAMB 2YOLA 1ELCA 1MZAA 2TRMA 4IMQA 1BRCE 2OXSA 3E0PB 2GT7A 1H4WA 1GBDA 4KTCA 1MD8A 2UWLA 2IOTA 1BUIA 4FXGH 1ANDA 2AMPA 1P9UA 3TH2H 1YLCA 3ZVDA 1DWCH 1E36B 3DA9B 1O3CA 2WV5A 1TX6A 1C5XB 1YCPK 4X1NU 3ZVCA 1Z1IA 4A5TS 1Y3YA 1H9IE 1S82A 3ZYEA 2SFAA 4ZHLU 3MTYA 5FCRA 4GHQA 1UK2A 1RXPA 1ORFA 1ESTA 3A7TA 4NWKA 3VEQB 3ZYDA 1MKXH 1L0ZA 3MFJA 1ABJH 1DANH 1QQUA 1N6YA 4RKOB 3RMNH 3RXEA 1IQMA 1SGNE 1SGQE 1HLTH 3JZ1B 3GY3A 3MNCA 4B71A 1SVPA 4INLA 4OGYA 2BQ6B 2R2WU 3U9AH 1NZQH 1TE0A 1GL1A 1N6XA 1S83A 2F9PA 3GY8A 3TGJE 1IHTH 1ZOMA 3RUOA 3KQEA 2PHBA 2ZPRA 2Y5HA 1AUJA 1A2CH 1QA7A 2BDBA 3TK5A 1GJ5H 7GCHF 1RIWC 1TBZH 2BXTH 3OX7U 3VXEH 4UFFH 4Z0KA 1GG6C 1THRH 4ZXYH 1NFWA 5C1UA 1FPHH 1ZHMA 4CHAC 1GVKB 3BTKE 3ZZDA 4I8KA 3T28A 1LDTT 2Z9JA 4HZHA 3MNSA 1PPCE 4ISOA 4D9RA 4XBCA 2AGGX 3M5NA 4WMEA 2ZQ1A 2XBWA 1P0SH 3EQ0H 3QZRA 3A85A 4NA7A 7GCHG 1NFUA 1NRNH 3MU1A 3OY6U 5EXNA 3K2UA 1UTNA 3KNXA 4Y0ZE 2ZCLP 1LHGH 1J16A 2ZTYA 3SNBA 1ZRKA 1V2UT 2BX3A 1YPHC 1NS3A 2ZO3H 2C4FH 5ESTE 3HATH 3HKJB 5DPAA 1UVUH 1TPSA 2OC8A 1SGFA 1QL7A 2JETC 2PGQB 2F9VA 3RMOH 1O2GH 1O31A 2WPMS 2STAE 2XWBI 5J4QA 1ANCA 1UTOA 2VWNA 1G2MA 2PTCE 3E6PH 1HXFH 1O3OA 1A4WH 1O3JA 2PKAA 2V3OH 2YNAA 3RXRA 1PPZA 5A8ZA 2ZHFH 2ZHQH 3AAUA 1Y3WA 4AG1A 5C5NA 3SV8A 3E0NB 1HCGA 1Y3UA 2A0QB 1FY5A 1GMHF 2D26C 1C2DA 3TLOA 2PTNA 3F9EA 1O35A 1KDQB 2JH0D 1FONA 1OYTH 3EYDA 3F9FA 3MU4A 2ZDAH 4Y10E 4E7NA 2ZFPH 2A5IA 1Y5AT 1Z6JH 1IOEA 1ZJDA 3M61U 3DFJA 4X6NA 1C2GA 3PV4A 2QY0B 3K65B 1UHBA 2GCTB 1GMHG 4IS5A 1LVOA 1BMLA 1G3CA 1SGTA 4U01A 2QA9E 3MU0A 3E91A 3ESTA 1JIRA 1TNIA 3ATMA 1PPFE 1VITF 1AB9C 2WPLS 1WAYB 1K1PA 2ZDLA 3UNSA 3RXBA 1G2LA 1C1UH 1OWKA 2GD4B 4JYTA 2ZCKP 1RTFB 3MYWA 2VH6A 4XE4A 1EPTA 1RTKA 1HAVA 1BRUP 1TGSZ 2A4OA 1HDTH 3GY4A 2FMJA 4ABDA 1VITG 4OS7A 3BTTE 4JYVH 3PTBA 2AEIH 1LPKB 2D2DA 3SUFA 2A7CA 4U2WA 4MNYA 2Z94A 2AS9A 1SQAA 4O9VA 3TNSA 2J9NA 1SGFG 4OS5A 4A92A 1ESBA 1O37A 4YOIA 3GOVB 3PO1C 2WPIS 3MH6A 1J8AA 1F0UA 2HNTE 1HYLA 1BQYA 1O2VA 1CGIE 1GHWH 4MPXA 2GKVE 2VWMA 4I7YH 1ZTLA 4WXIA 1ZLRA 1EP6A 9LPRA 3BTDE 5F03A 3GISB 3RMMH 4WMDA 3DD2H 1MTSA 3P8NA 1IHSH 1UVTH 3KQCA 1IQEA 5K7RA 1CT2E 1UCYK 1UTMA 1UTJA 1QBNA 1K1LA 4FUFA 1MMJN 5EG4A 4AN7A 2FODA 2HPQH 2UWPA 5LGOA 2A5KA 4DY7B 3ZZ4A 5DP8A 1SGPE 3ATKA 1SB1H 3MWIU 1PQ7A 1A3EH 1L1NA 3RXQA 1CQQA 3EGKH 2TGPZ 2NU3E 1ELTA 4WJG2 4ABGA 3ZZ9A 5FPYA 1YPHE 1PYTD 2H9EH 4Y11E 4ABJA 1O5DH 1TNLA 1THPB 2CGAA 5L2YH 6LPRA 3EE0B 3B23B 1MTNB 4MLFB 5JBBS 4WH6A 3RM0H 4BXSA 3SNDA 4X8VH 4THNH 1ANEA 1FN8A 1NFXA 2WPHS 3QDZB 2OC1A 1GHXH 1XUKA 2BY6X 4CRGA 1YPMH 1CA0C 1C5VA 1D3DB 1KXEA 1Z8GA 3M37A 2FOMB 3VB6A 4Y76A 5L2ZH 1NO9H 1UVSH 1OPHB 1G3DA 1XKAC 4XBDA 3TK9A 2JKHA 1HPGA 2G81E 5C2ZA 3U1IB 5GDSH 1FPCH 2ZI2H 4NA9H 1O36A 3SORA 1DSTA 1D6WA 1SL3A 1HB0B 1TOMH 1PQ5A 4KELA 4O97A 1EZXC 3ZVGA 2PKAB 1AWHB 4DIIH 2WYGA 1W3CA 3VXFH 1BMNH 1VJ9U 1AFEH 2G4UA 4GHTA 1T7CA 2J2UA 1BMMH 1BIOA 1W8BH 2H1UA 2PSXA 1AN1E 3M3SA 1O2IA 2ZHDA 1BBRK 3AW1A 2HPPH 5DP4A 1A7SA 1F5LA 2B5TB 2VNTA 5EW2H 2WUCA 4JZDH 4OS6A 1ELFA 4ISNA 2FEQH 2C8ZB 1AHTH 3A8AA 3EA7A 4K8BA 5L30H 1TX7A 1BA8B 3SU0A 2TBSA 3ODFA 3DUXH 3PMHB 1Y5UT 1LO6A 5FBEA 1GBKA 1XX9A 2PV9B 1C4Y2 5PTPA 2FLBH 3SU4A 1IQGA 3TITA 3PMAB 1CBWB 3RC6A 2XBXA 5AHGH 1TQ7B 4NZLA 2PKSB 5JB9S 1EPTB 4KTSA 1TABE 3RXJA 3OY5U 2G00A 1YBWA 1YPJH 1A61H 1RJXB 1K22H 3TH4H 2AH4X 4FVBA 3VB7A 1SI5H 1QRZA 3FFGA 1MQ6A 1KXAA 1W13U 4Z6AH 3DHKH 2W3KA 3SGQE 3QK1A 1ZZZA 2ZHWH 2BD5A 1SPJA 1IQLA 4A1XA 1ZMJA 2H9HA 3PB1E 1X7AC 5DO4H 3E16B 2Z9IA 4UD9H 3SU6A 2ZTXA 1NRSH 1VR1H 1TA2A 2V35A 4ZHAA 1ELEE 1YKTA 2ZPSA 1ELBA 2G52A 4YOGA 3VPKA 1O34A 4Q2KA 1YCPH 1P06A 1ZSKA 3SV9A 1BTHH 1E37B 3KIDU 4KP0A 1OWHA 5DP5A 1C5RA 2ZU4A 4X1RU 3MI4A 1UVOA 3ZZAA 1O33A 1W7GH 3ITIA 3TU7H 3Q3YA 1IQIA 1KXCA 4ZKNU 2HOBA 3RXAA 1C1MA 4JK5A 2BB4A 1O2RA 2NU2E 2Y5GA 4LZ4B 3A86A 1S85A 2QV1A 3A7VA 3A83A 3ZVAA 1GHYH 5FPTA 1RIWB 1UTLM 2AFQB 2ASUB 4X8UH 3FZDA 1GG6B 2QXGA 1TPOA 2ALVA 2WUBA 3NCLA 1LVYA 1MD7A 3MNBA 4ASHA 4CHAB 1MTNC 1JWTA 3K9XB 3BIUH 4AX9H 1Y5BT 4ABEA 1AGJA 1O2SA 2IPHA 3KEEA 1GJ7B 1OP0A 1A0LA 1AKSB 1HNEE 1P2NA 1JRTA 2I6SA 3NUMA 1NROH 1SGEE 1M9UA 1ZMNA 2BY8X 2FS9A 3B9FH 3A7ZA 3ODDA 4BAOB 1BITA 1PPHE 1Z1JA 2ZGHA 2OCVB 1EAIA 1HAPH 3ZVFA 3RU4E 1ELVA 9ESTA 1H1BA 1KLJH 2JETB 4AORA 3LGVA 4I33A 3ELAH 3W94A 4AYVB 6CHAC 1ESAA 2Z9KA 1MTWA 3GYMA 4GUXA 2W3IA 3SI4H 2XWAA 4FUEA 3SV2H 2H9TH 3RXUA 1O2TA 1RTLA 1T4UH 1G3BA 2KAIA 4XBBA 2ZDVH 4Y7BA 1XXFA 5DP3A 3A7YA 4TPYA 3T26A 2OBQA 1L2EA 1HV7A 1TPAE 2QXHA 2BDAA 1ETRH 4MNVA 3K6ZA 1O2MA 4NIWA 3S69A 1A5IA 1L4ZA 1WV7H 4LXBH 5GIBA 1S81A 2AMQA 2SGEE 1GPZA 2FOAA 3B8JA 3BG8A 1V2MT 5FXLA 3PYHA 5DP6A 2ZQ2A 2D1JA 1GHZA 1O30A 1GI9B 1GJ4H 1UK4A 3LKWA 4X8SH 2THFB 1V2TT 3LIWA 3FP8E 2J92A 3D65E 1AZZA 4CRBA 1AB9B 2OQUA 1QNJA 3H7TA 4X2VA 1C5SA 1SBWA 1Z8RA 3SU1A 1FXYA 3VB5A 1EPTC 2HVXA 1C5MD 2BD7A 5FX6A 2ZDNA 3MMGA 3MNXA 1FAKH 1MKWK 2ZTZA 2SNVA 3Q00A 4AOQA 2C3SA 4X2XA 2OUAA 1TONA 1T31A 1PPGE 2BLOA 3BTFE 1LHFH 1V2OT 2LNCA 1MH0A 3QLPH 2PSYA 1LMWB 5AFZH 3T2NA 2FYRA 2EC9H 2RDLA 5HMAA 1PYTC 4JK6A 1T32A 1T4VH 4R0IA 3RXMA 3TGKE 2GV7A 1GJ9B 3BTME 1T8MA 1O3FA 2CF8H 1IQKA 3MO3A 1GWAA 2G5VA 3RXTA 3FVFB 2GDEH 3VFEA 1DY8A 5A0BA 3PMBB 2PUQH 3RP2A 1O2XA 3PO1B 3FP6E 1DXPA 2GDDA 1EUFA 3GDUA 1MCTA 2OC7A 5CHAB 5C1XA 1Y8TA 4O3UA 1ZPCA 4Y8YA 4CH8B 1NU9A 1O2KA 2O8UA 1GBAA 1SG8B 1LTOA 2A4GA 3V7TA 1QGFA 2FX6A 1TMBH 2CXVA 1CHOF 3KL6A 2ZWLH 1CT0E 1QFKH 2NU0E 3UQVA 2ZKSA 1OP2A 4K60A 1EJAA
chains in the Genus database with same CATH superfamily
2D8WA 3QGNB 1P04A 3GDSA 2W6ID 4H42U 1DWDH 3MH7A 3M5LA 4YZUA 2PFEA 3RXDA 2R9PA 4DG4A 4DW2U 1AMHA 1WTGH 3MU8A 3NPSA 1EXFA 1UVPA 2BDYA 1HFDA 3GCHB 4FUBA 3ATIA 4JZEH 2G51A 1TGBA 1S6FA 1J9CH 2XYAA 5TCCA 5C94A 1GBFA 4UFEH 2ZGBH 1LCYA 4BOHA 1W0JD 2O8WA 2Z9GA 2AIQA 2OBOA 1MU8B 3SO3A 3ZVEA 1TPPA 2TGDA 3RXVA 3AVZA 1ID5H 3ZV8A 3PLPA 1CA0B 2FDAA 3SN8A 1P12E 4LOYH 4B75A 5T1VA 1GMCF 5EGMA 1AWFH 4GPGA 5FPSA 1C5ZB 2AMDA 1RRKA 4BTTB 1NN6A 2J95A 2JH5D 4CBOA 3PMJA 1C2EA 4AYYB 2Y5FA 1MBQA 1BTXA 2BDIA 2BDGA 5B6OA 3RXGA 1TRMA 1A5HA 2Z3CA 3TH3H 1C1RA 1HGTH 4FOUC 3U8TH 1DLEA 1TOCB 3LGUA 2TPIZ 2Y81A 1QQ4A 2JJ2D 4DJZB 1K0HA 1VKYA 1ZR0A 1GMCG 1O3IA 2KAIB 1C5UA 4A7IB 5FBIA 4X2WA 1MAXA 5ABWA 4OGXA 3SW2B 2ZU5A 3FZZA 3KYFA 4GVUA 1XMNB 1EB2A 2UUKB 1UCYE 1RD3B 1YM0A 3F2GA 1O3NA 2DE8A 3KCGH 1HJAC 3O8DA 2UUFB 1XVOA 2C8YB 3EE7A 3L3TA 1NT1A 1TFXA 5FCKA 5EQRA 3M7QA 4MPUA 4FU9A 1F5RA 3UNRA 1GL0E 5FX5A 1O2PA 2DUCA 1V2NT 2OC0A 1TGTA 3GY7A 2B7DH 1KMHB 1C4V2 5JBCS 3PV2A 3G01A 2BOKA 1WOFA 1V2JT 2H6MA 3M5OA 3S7HB 2ZGJA 2HVYB 1BT7A 3LOXA 4Q7YA 2EA3A 1K1IA 5E0JA 1C2FA 3L33A 3TJUA 1H8IH 4CR9A 4BXWA 3GCNA 4ZROA 1NM6A 1IQNA 4DURA 3F9HA 1HAYB 3RXIA 1GBBA 2TGAA 3A88A 4ESTE 3SOSA 2SGQE 2O8TA 1EZSC 4PROA 5FAHA 3LH1A 2VIWA 2BX4A 1GHVH 3A87A 7LPRA 1C2IA 1HBTH 5BPEA 3H09A 1HAXB 2XCNA 2P16A 3AK5A 3VGCC 5EODA 2Z6BD 3UNQA 1MABB 4IGDA 3RXKA 1H8DH 1OHHD 5DJ7A 5KEDA 3DSOA 3F68H 3GICB 4P00A 4B2CA 1CE5A 1QL9A 1K28D 3MO9A 5JPMH 3Q3KA 4I32A 2BQ7B 5F6MA 2OP9A 3VB3A 4DVAU 3PV5A 1MKXK 1C2LA 1DM4B 4YLUA 2KZ4A 3UR6A 2GV6A 4BAKB 2CHAC 4Q80A 4OM9A 1MBMA 2BY5X 1QCPA 1O3PB 2ZFQH 1V2ST 3JZ2B 2BVSH 2AERH 2ZC9H 2ZGCA 3Q77A 1BBRE 5CHAC 3UIRA 1C2JA 1UTKA 4FVDA 1KY9A 3OAAD 4J2YB 1HIAA 1YCPM 1QHRB 2FIRH 5CDFE 2ODPA 4ISIH 3OE7D 1SMFE 2FPZA 3MOCA 3AAVA 4J1YA 1KXFA 1L1JA 3MQKC 1B5GH 1BZXE 1FN6A 1P2KA 1NTPA 2OD3B 4K5ZA 1COWD 2C8WB 3QTOH 1SC8U 2J5UA 2AHME 2GP9B 1SHHB 4H4FA 1RGQA 3M3VA 4R8TB 3PRBA 2R3YA 2VIVA 1XUFA 4ZKOU 1ELGA 1Q2WA 1DUAA 4NFFA 1AVWA 2W5EA 1GJAB 3SJ9A 2VIQA 2V3HH 3GCHC 4D7GA 1JXPA 1JBUH 1O38A 3A84A 1GHBF 3AASA 4Q4LA 1O2NA 5DK1A 2M2AA 1QR3E 1BB0B 2BLQA 4JCNA 2YMSD 5C20A 3QX5H 1V2PT 2F9OA 1HRTH 1CGHA 1KTSB 1K21H 2K0QA 1GVLA 1DOJA 2G55A 4X8TH 3P17H 5C5OA 2XCFA 1ZRBA 2G4TA 1OKXA 3SHCH 4INKA 2NU4E 1PFXC 5E2OA 3TPIZ 1GHBG 2QC2A 4FUJA 2CJIA 1DVAH 4DGJA 4JZIA 1C5NH 1KIGH 1JMOH 4UFDH 3UOPA 5EIYA 2R0KA 3V0XA 1AFQC 2Z9LA 1K1MA 1ZTKA 1L1GA 1QY6A 2ZA5A 1TQ0B 1PPEE 4D8NA 2BLVA 2P3FH 1ACBE 5H4IB 4AGJA 1D3PB 4UDWH 1BHXF 3UUZA 1GDUA 1EATA 3ENSB 6CHAB 3PWCA 2VGCC 5E0HA 2BY7X 3F6UH 5GXPA 2CN0H 2GTBA 1ZTJA 3LGYA 2O8LA 2VJ1A 3UY9A 2FLRH 1LKAA 2A32A 2A45B 1J15A 1P01A 4ZUHA 5A8YA 4MNXA 2GZ9A 3TIUA 8LPRA 2FS8A 2EEKA 1CU1A 2GZ7A 1E38B 1F0SA 4YLQH 1SSXA 1T8LA 4X2YA 2PWXA 2OINA 5HGGA 4ZKRU 5GCHF 1GMDF 2F9BH 4YO9A 1UHBB 1WYKA 2ODYB 3GY2A 1LVBA 4X1SU 2XBYA 3LT3A 3U8OH 1DS2E 1GJCB 1KSNA 1CA8B 1O2WA 2HNTF 2BZ6H 1AY6H 5EW1H 2QYIA 4E06H 3BF6H 2KCYA 5GCHG 3D49H 3RXPA 1GMDG 2JJ1D 4D7FA 4B76A 1A3BH 5C17A 1VJAU 5LPRA 2HGTH 1BCUH 1EJMA 5JBAS 3T27A 1HAVB 1HXEH 1IQHA 1CVWH 2NWNA 3LGTA 4JYUH 2SGPE 5HM2A 3VB4A 5GPIB 5LH8A 4I8LA 4A1VA 2PR3A 5HIYA 4B74A 5DG6A 5TCAA 2VVUA 1HJ8A 2ZIQH 1C5YB 1EX3A 1EOLA 3SU2A 5T6DA 1P3CA 3RXLA 1P2JA 2VWOA 1HAHH 3U8RH 2Q6DA 3E90B 5AFYH 1EZQA 4WMFA 1EAUA 2F9NA 2ESTE 1YLDA 1Z7KA 2ULLA 3U69H 3V13A 3A8DA 1HJ9A 1D4PB 2A7HA 1ZHRA 2HALA 4VGCC 1LHCH 5T3HA 1OYQA 1SGYE 3IITA 4DT4A 1NRQH 1C2KA 1FY4A 4RN6A 3ATLA 4Y7AA 5LPEA 2RG3A 3IWMA 2BD4A 1FI8A 3F3BA 2ZDMA 4NA8A 5DN6D 2BOHB 1ARCA 3C1KA 1INCA 2ZEBA 2ZPQA 2XXLA 1NPMA 4F55A 2BM2A 1QZ8A 1GBIA 2AIPA 4CR5A 4B6FA 5L6NH 5HM9A 1BDAA 1O3HA 3UPEA 1GJ8B 1GJ6A 1O3GA 1F0TA 2UUYA 3UQOA 1GBCA 1VGCC 1TB6H 4CBNA 2WYJA 1S84A 1AO5A 3SZNA 4WF8A 4RSPA 5I25A 1A5GH 2Z3DA 3ZVBA 1YPEH 2SGFE 1QTFA 1ZPZA 2YNBA 2FI5E 4F4OC 1ZYOA 1DX5M 1O5CB 1ARBA 1SFIA 2LP6A 3NKKA 1JRSA 1O3DA 1P2OA 3L6PA 2FXRA 2STBE 1S0QA 3PWBA 1G3EA 1B0EA 3TK6A 1V2KT 1GCTC 3T5FH 2J4IA 3P8OA 3KYGA 3SU3A 1ETSH 2XC0A 3LC3A 1J17T 5G4BA 5A8XA 1P2QA 3BSQA 1ETTH 2ZG0H 1O5FH 4QT8C 5EXLA 1K1OA 2XTTB 4Y71A 3A7XA 2HRVA 4FU7A 2WHXA 1GI5A 3UWJH 1Y3VA 2XOKD 3LH3A 5GNDA 1G37A 1TBRH 1V2VT 1GDQA 2FI3E 3P95A 4H6TA 2QE7D 2BZAA 3U1JB 3RXFA 1EP5A 1CO7E 2ZFTA 4IN2A 4CH2B 3STIA 1Q3XA 3FP7E 3LONA 3SU5A 2Q1JA 5GJ4B 2H2ZA 1FIWA 3OTJE 5LPFA 2P3TB 1YP9A 1DICA 3DSPA 1IAUA 1RS0A 3OTPA 4ABIA 3O8RA 2QCYA 3STJA 1EASA 1GBEA 5T6GA 3S0NA 1GI6A 1GDNA 1E1RD 1GGDC 1O2UA 4YT7H 5JBTA 1V6DA 1AUTC 4ZHMU 4MQAA 2C93B 1G32B 1W7XH 3P6ZB 5A0AE 4X1QU 3SYJA 5TJXA 1HJAB 3NK8A 2IJD1 2C8XB 1DY9A 2UWOA 4XDEA 4DT7B 4ISHH 3EAJA 1ZJKA 1KXDA 3I29A 1TX8A 2FO9A 3QUMP 3WY8A 1OWEA 3SI3H 1C5OH 1GI7B 1LHDH 4KGAA 3HPTB 1GBLA 3BTWE 3E8LA 2BYAX 3RXCA 2IJOB 1FY3A 1GI8B 3U98H 3PLBA 5BRRE 1QJ1B 2QAAA 1EOJA 1KDQA 1W10U 4XRNA 5EQQA 1F0RA 3ZZ7A 4JZFH 1Q31A 1TLDA 1JIMA 1EB1H 4Y8XA 4UEHH 4IN1A 1WXRA 1TWXB 3SHAH 1C5QA 3BTHE 4ABHA 3SQHE 4BAHB 4ABBA 1K1NA 4K2YA 3KGPA 3SJKA 3M7UA 1VITH 4ISLA 3VGCB 4NSYA 1GI0A 1YC0A 5J4SA 5C0UA 3QTVH 1YPKH 2A7JA 1A0HB 3SGAE 2KX4A 3R0FA 4UFGH 1TGNA 1H9LB 1WSSH 1C4U2 2SGDE 4AB8A 3T62A 3A82A 3NWUA 2R3UA 3OYPA 5JB8S 2Q6GA 4Y0YE 2VIOA 1AU8A 3P70B 1TYNA 2H5CA 2VBCA 1TBQH 4MNWA 5IK2D 4AFUA 5B6LA 1Z71A 4M9FA 2W6JD 2PW8H 1DXWA 2QN5T 2BMGB 3KHVA 3LJJA 3SJOA 2CHAB 5DP9A 1UK3A 4Y6DA 3ATWA 4Y79A 3T25A 2IN2A 1Z8IB 4RKJB 1BJUA 1EZUC 2A5AA 3M3TA 3QO6A 2QF0A 2ZU1A 3BV9B 3RU4D 4HFPB 1DFPA 1FY1A 1FNIA 1VCQA 3AW0A 1EAWA 5F8XA 4CRAA 4LK4A 3MH4A 4FUCA 2CV3A 2RCEA 5CE1A 3BG4B 2VH0A 4INHA 2J98A 2V6NA 1UJ1A 4MG3A 1QIXB 1OOKB 1P09A 1D9IA 2FOEA 2P8OB 1N8OC 2GT8A 2VVVA 2XW9A 5DGJA 1OWIA 2ZNKH 1XUJA 2I6QA 1Y59T 3LPRA 1AD8H 2XC5A 2ALPA 1AE8H 1OSSA 1SLUB 1V3XA 3MH5A 4OS2A 3UTUH 2BTCE 3SUDA 1UCYH 2ZFSA 2P93A 1CHOG 4E7RG 1KLTA 2QXIA 2SNWA 2HNTC 1FMGA 1T8OA 2XRCA 1GBTA 1ZHPA 4IC6A 1BMAA 4H6SB 3GY6A 3FANA 1MZDA 1QL8A 1O2JA 4GAWA 3RLYH 1FY8E 1QBOA 4O3TA 5FL7D 1SLXB 1SR5C 3UB0A 3F0PA 4AFZA 1O5AB 4WVPE 1QRWA 1Y3XA 1C1OA 1MTVA 3VG8A 5HXFA 1HAOH 1JOUB 3RLWH 5JDUB 1TNJA 1CHGA 2FYQA 5F8TA 2KCAA 1C1SA 2ILNA 5AF9H 1V2WT 2EQNA 4TY7A 1AFQB 2ZECA 1OWDA 1WTHD 1YYY1 1MU6B 1GI1A 3V12A 3LC5A 4WH8A 5E8EH 1GI2A 3RC5A 4DIHH 3PROA 1SOZA 3A81A 3FAOA 2BD2A 2RA3A 3PLKA 3HGNA 2J38A 2XNDD 1ELAA 1KTTB 1XM1A 3UREA 4B73A 2CMYA 4WXVA 3TGIE 1AVXA 1UW7A 6GCHF 1O2ZA 5EU8A 1F92A 3KF2A 3RXOA 1SGDE 1TNGA 1VCPA 1WQSA 1SQRA 2VGCB 1YPLH 1WUNH 4U30A 1TALA 1C5TA 4X1PU 1VCWA 1YGCH 5EPYA 3URDA 4TWWA 1TAWA 2ZDKA 3M36A 1P3EA 1DT2A 2LPRA 3HK6B 5C3NA 2Y6TA 2BVRH 1UO6A 2A4RA 1OWJA 5F8ZA 4ZAEA 3NZIA 3KQBA 2ZFFH 4IMZA 3TJNA 1GHAF 3C27B 1O2HA 3M35A 3H7OA 1P03A 1F5KU 3IG6B 6GCHG 1C1QA 1C9PA 4BTIB 2LELA 1D3TB 2FI4E 1XVMA 3OU0A 5EJ1A 1B7XB 1OS8A 1NESE 3QWCH 1G30B 2P3UB 2ZCHP 3LDXH 5IYTA 3M5MA 5EQSA 4AFQA 2FOCA 4F49A 1O32A 1P2MA 4SGAE 3BEUA 4I8GA 1U6QA 1GHAG 1BBRH 3LGIA 2SGAA 1GVZA 1E34B 1AIXH 1QA0A 1FAXA 1J14A 1O0DH 1PJPA 1YF4A 1MUEB 1BRBE 2FOFA 4NIXA 1MQ5A 3S7KB 1SFQB 2VU8E 4I31A 3SV7A 4ACBA 5EXMA 1K2I1 1LQEA 1O3KA 1MTUA 1ABIH 5C67A 5IDKA 1W12U 4AG2A 5DP7A 1KXBA 2FZZA 3A89A 1ZPBA 1GJBB 2A2XH 2DE9A 2A1DB 3E1XB 1C1TA 4XSKU 1QJ7B 4HGCA 3D62A 3SBKA 2W7SA 4YT6H 4TT3D 4B2BA 3UWIA 4NFEA 1P02A 1P9SA 2P95A 1C1PA 2ZFRH 2V0BA 3GYLB 2AYWA 3LJOA 1GBMA 3HK3B 1UTQA 1N1LA 4CRCA 4B6EA 1C2MA 2O9QA 2FM2A 2EI8A 2FOBA 4TPIZ 1O3MA 4UONA 1LHEH 2WINI 7KMEH 1C2HA 4GCHF 3MO6A 2F91A 3UR9A 2PLXA 2CF9H 1WCZA 3SNCA 5GWZA 2RFKC 1DSUA 4VGCB 1O39A 2ZU2A 1NFYA 3TNTA 1QB6A 2FESH 1MCVA 4GCHG 4O03A 3QZQA 3BG4C 4X6PA 2VINA 3KQDA 1AZ8A 3FKSD 4D76A 3W95A 2G5NA 2FTLE 2UUJB 2Y82A 5CMXH 3TVJB 5I46H 1OXGA 2P8OC 2Y80A 1NU7B 4P02A 2NU1E 3P92A 3MHWU 4ABFA 1TA6A 1FLEE 2BHGA 2FOGA 3BTEE 3SJ8A 1V2QT 1XUHA 4DOQA 2XC4A 2L6OA 1AI8H 1VGCB 2GX4A 4NGAH 1S5SA 1QJ6B 4GSOA 5AVDA 1GI4A 1BTYA 4KTUA 4K3JA 2QIQA 2JH6D 3FN8A 1XUIA 5ETXA 4MTBA 4AGKA 1DLKB 3E3TA 4FETA 2WPJS 1T8NA 2EI7A 2ZU3A 4NZQA 1OX1A 2WPKS 3P8FA 1GI3A 1BTZA 5T6FA 1W0YH 2Q6FA 1GCTB 2GVFA 1LPGB 3R3GB 3ZZ6A 3RU4T 2XBVA 1TRYA 2GMTB 2Z3EA 1G9IE 1S6HA 1DDJA 4NCYA 1P10A 2K1QA 3N7DA 2FOHA 1TMTH 1QBVH 1HAZB 4E05H 2BVXH 4KKDA 3K6YA 2QF4A 4LZ1H 1FJSA 1P2IA 3KN2A 2ZF0H 1G36A 2OQ5A 2P94A 3ZZ5A 1CGJE 1K1JA 1ZGIA 2TGTA 2A4QA 1TNKA 2J34A 3F9GA 1H9HE 1SOTA 3I78A 1BTWA 4X6OA 2HWLB 3UAIC 1B0FA 3NXPA 1C5WB 4Z1MD 1S0RA 1W0KD 2GZ8A 5EPNA 4ZKSU 3SNEA 1AKSA 4K8YA 7ESTE 4OS4A 3V3MA 4MPWA 4ZXXH 4M7GA 1F7ZA 2XNIA 4HI3A 3SJIA 2A31A 1GGDB 1FIZA 2BY9X 1BJVA 3Q76A 1V2RT 4IW4E 1TRNA 1C9TA 5A0CA 2B8OH 4YESB 2FP7B 4I8JA 2EI6A 2QXJA 1BTUA 2RA0A 3BN9A 2OLGA 4FU8A 3T29A 3LGWA 4ASUD 4Q7XA 4ABAA 1ZMLA 3S9CA 1RFNA 2F9UA 1OP8A 1GBHA 4MPVA 3PTNA 4XD7D 1NBME 3Q3XA 4B2AA 3S9AA 1ZSLA 3OEHD 1HAIH 5EOKA 5E0GA 4AZ2B 1A46H 1TMUH 3FOAA 1DITH 4BAQB 8GCHF 3GCTF 4NSVA 1VZQH 1V2LT 3F2HA 5EJZA 5DKMA 4JMYA 3SNAA 1E35B 1AQ7A 1Z8JB 3ZZ3A 1A1RA 2GCTC 3ZZ8A 1IQJA 3H5CB 4NIYA 1HAGE 1KLIH 3TJVA 1DUEA 1LQDB 2P59A 1ANBA 2JDID 4GLYA 2QGRA 1YY3A 3DFLA 4SGBE 3GDVA 3P8GA 2W26A 1BTPA 8GCHG 1TIOA 3EA8A 1AVGH 4CRFA 3GCTG 1FUJA 1O3LA 5FHTA 1O5EH 3A7WA 4HTCH 3BIVH 1O3EA 1PQ8A 4UE7H 3WWBA 2RDEA 1BRAA 3RM2H 4B1TA 3GCOA 3UFAA 1GCDA 3TJOA 1D6RA 1O5BB 1A0JA 1K9OE 1SKYE 1QB9A 1QRXA 2VWLA 3BEFB 2PGBB 2A2QH 1PPBH 2M5TA 2YMSB 3MU5A 4TY6A 1MKWH 3SV6A 5K0HA 3ZV9A 3F1SB 1O2LA 2QF3A 1HIAB 1UMAH 1FZZA 3QGJA 1P11E 5A09A 3EDXB 3FO8D 3SGBE 4U32A 2ZHEH 1CT4E 2G8TA 2ANKH 3BTQE 1TGCA 3PRDA 1WBGB 1NRPH 1BHXB 2ZGXH 3BTGE 1THSH 1YWUA 2R2MB 4OS1A 3RMLH 4TWYA 5HIZA 3CP7A 1W14U 2F3CE 4XFQA 1C5PA 2ANYA 4FUHA 1O2OA 3EA9A 1C5LH 2BDHA 2B0FA 1LVMA 1P05A 1N8OB 2VIPA 1NC6A 1DPOA 3A8BA 1FV9A 1WU1A 1C1NA 5C1YA 1EQ9A 4K1EA 4YTAA 1F2SE 1HUTH 3S9BA 2ODQA 5JYIA 2AGEX 4AFSA 4YM9A 4ZMAH 3SUGA 2F83A 2FWWA 3LU9B 2Y7XA 1AE5A 1SLWB 1SGIB 1UTPA 1ZGVA 3URCA 1SGRE 2GMTC 2KFWA 3N7OA 1W11U 1Z6EA 1SGCA 3UOUA 2BQWB 3RXHA 1P57B 4A6LA 3A8CA 1C1VH 1BOQA 2BD8A 2FX4A 1D3QB 1XUGA 1KYNA 1SLVB 2HLDD 1XXDA 2BD9A 1IQFA 2R0LA 3CENA 5ESBA 5E2PA 1W2KH 2B9LA 4K1SA 1EAXA 4FUDA 4FUIA 4AB9A 4Q7ZA 8KME2 1SQTA 3M7TA 3GY5A 4Y8ZA 3RXSA 1PQAA 2WV4A 5HYOA 5A2MH 3OSYA 4BTUB 2H5DA 2BLWA 1W0ZU 4MVNA 3DT0H 1NY22 1O3AA 1WQVH 2FTMA 3ZZCA 4TYDA 1SHYA 4ZCNA 2ZZUH 2BD3A 3D23A 3SUEA 3CS0A 3QN7A 3O8CA 2ZP0H 1YPGH 4NIVA 1SQOA 2ANWA 2GGVB 3HGPA 4X6MA 1QB1A 2C90B 4WY3A 4D9QA 1DWBH 2AGIX 3HKIB 1FDPA 4JZ1A 4YOJA 5SGAE 2J94A 3RDZA 1XKBC 1L4DA 4A1TA 4RI0A 1TNHA 1NRRH 4WWYA 1GJDB 2GCHF 1GBJA 1H8HD 4MDSA 1FQ3A 8ESTE 2HLCA 2BDCA 3O8BA 1LPZB 3BEIB 2O8MA 4BNRA 4K69A 1ELDE 3KQ5A 4IBLH 3SQEE 4FUGA 6ESTA 2IPQX 2PUXB 4BANB 3ZZBA 1LKBA 1ZSJA 2VB0A 1O3BA 2BXUH 1P8VC 1DE7H 2GCHG 1EKBB 4X0WU 3A80A 2Z7FE 4I8HA 3DCLA 4ZH8A 4CREA 3PM3A 1CSOE 4CRDA 2Y7ZA 3CS7A 1O5GH 4K1TA 1DWEH 4NG9H 1C1WH 3RC4A 2OTVA 1O2QA 2ANMH 4XOJA 4DCDA 1MAYA 1CBWC 1EJNA 2EY4C 2F4LA 4IC5A 2W7UA 2TIOA 3I77A 2PKSC 4NWLA 1QURH 2VIDA 1O2YA 2VVCA 1E0FD 4BAMB 2YOLA 1ELCA 1MZAA 2TRMA 4IMQA 1BRCE 2OXSA 3E0PB 2GT7A 1H4WA 1GBDA 2YMSC 4KTCA 1MD8A 4YXWD 2UWLA 2IOTA 1BUIA 4FXGH 1ANDA 2AMPA 1P9UA 3TH2H 2K8IA 1YLCA 3ZVDA 1DWCH 1E36B 3DA9B 1O3CA 2WV5A 1TX6A 1C5XB 1YCPK 4X1NU 3ZVCA 1Z1IA 4A5TS 1Y3YA 2QF5A 1H9IE 1S82A 3ZYEA 2SFAA 4ZHLU 3MTYA 5FCRA 4GHQA 1UK2A 1RXPA 1ORFA 1ESTA 3A7TA 4NWKA 3VEQB 3ZYDA 1MKXH 1L0ZA 3MFJA 1ABJH 1DANH 1QQUA 1N6YA 4RKOB 3RMNH 3RXEA 1IQMA 1SGNE 1SGQE 1HLTH 3JZ1B 2F43B 3GY3A 3MNCA 3WW7A 1BMFD 3W1EA 4B71A 1SVPA 4INLA 4OGYA 2BQ6B 2R2WU 3U9AH 1NZQH 1TE0A 1GL1A 1N6XA 1S83A 2F9PA 4F48B 3GY8A 3TGJE 1IHTH 1ZOMA 3RUOA 3KQEA 2PHBA 2ZPRA 2Y5HA 4ACAA 1AUJA 2KM0A 1A2CH 1QA7A 2BDBA 3TK5A 1GJ5H 7GCHF 1RIWC 3CNRA 1TBZH 2BXTH 3OX7U 3VXEH 4UFFH 4Z0KA 1GG6C 1THRH 4ZXYH 1NFWA 5C1UA 1FPHH 1ZHMA 4CHAC 1GVKB 3BTKE 3ZZDA 4I8KA 3T28A 1LDTT 2Z9JA 4HZHA 3MNSA 1PPCE 4ISOA 4D9RA 4XBCA 2AGGX 3M5NA 4WMEA 2ZQ1A 2XBWA 1P0SH 3EQ0H 3QZRA 3A85A 4NA7A 2V7QD 7GCHG 1NFUA 1NRNH 4AC9A 3MU1A 3N99A 3OY6U 5EXNA 3K2UA 1UTNA 3KNXA 4Y0ZE 2ZCLP 1LHGH 1J16A 2ZTYA 3SNBA 1ZRKA 1V2UT 2BX3A 1YPHC 1NS3A 2ZO3H 2C4FH 5ESTE 3HATH 3HKJB 5DPAA 1S6LA 2WPDD 3F2FA 1UVUH 1TPSA 2OC8A 1WDIA 1SGFA 1QL7A 2JETC 2PGQB 2F9VA 5EJLA 5KECA 3RMOH 1O2GH 1O31A 2WPMS 2STAE 2XWBI 5J4QA 1ANCA 1UTOA 2VWNA 1G2MA 2PTCE 3E6PH 1HXFH 1O3OA 1A4WH 1O3JA 2PKAA 2V3OH 2YNAA 3RXRA 1PPZA 5A8ZA 2ZHFH 2ZHQH 3AAUA 1Y3WA 3OFND 4AG1A 5C5NA 3SV8A 3E0NB 1HCGA 1Y3UA 2A0QB 1FY5A 1GMHF 2D26C 1C2DA 3TLOA 2PTNA 3F9EA 1O35A 1KDQB 2JH0D 1FONA 2WV9A 1OYTH 3EYDA 3F9FA 3MU4A 2ZDAH 4Y10E 4E7NA 4Q63A 2ZFPH 4RT0A 2A5IA 1Y5AT 1Z6JH 1EFRD 1IOEA 1ZJDA 3M61U 3DFJA 4X6NA 1C2GA 3PV4A 2QY0B 3K65B 1UHBA 2GCTB 1GMHG 4IS5A 1LVOA 1BMLA 1G3CA 1SGTA 4U01A 2JIZD 2QA9E 3MU0A 3E91A 3ESTA 1JIRA 1TNIA 3ATMA 1PPFE 1VITF 5DSFA 1AB9C 2WPLS 1WAYB 1K1PA 2ZDLA 1YLNA 3UNSA 3RXBA 1G2LA 1C1UH 1OWKA 2GD4B 4JYTA 2ZCKP 1RTFB 3MYWA 2VH6A 4XE4A 1EPTA 1RTKA 1HAVA 1BRUP 1TGSZ 2A4OA 1HDTH 3GY4A 2FMJA 4ABDA 1VITG 4OS7A 3BTTE 4JYVH 3PTBA 2AEIH 1LPKB 2D2DA 3SUFA 2A7CA 4U2WA 4MNYA 2Z94A 2AS9A 3U28C 1SQAA 4O9VA 3TNSA 2J9NA 1SGFG 4OS5A 4A92A 1ESBA 1O37A 4YOIA 3GOVB 2J98B 3PO1C 2WPIS 3MH6A 1J8AA 1F0UA 2HNTE 1HYLA 1BQYA 1O2VA 1CGIE 1GHWH 4MPXA 2GKVE 2VWMA 4I7YH 1ZTLA 4WXIA 1ZLRA 1EP6A 9LPRA 3BTDE 5F03A 3GISB 3RMMH 4WMDA 3DD2H 1MTSA 3P8NA 1IHSH 1UVTH 3KQCA 1IQEA 5K7RA 1CT2E 1UCYK 1UTMA 1UTJA 1QBNA 1K1LA 4FUFA 1MMJN 5EG4A 4AN7A 2FODA 2HPQH 2UWPA 4HG6A 5LGOA 2A5KA 4DY7B 3ZZ4A 5DP8A 1SGPE 3ATKA 1SB1H 3MWIU 1PQ7A 1A3EH 1L1NA 3RXQA 1CQQA 3EGKH 2TGPZ 2NU3E 1ELTA 4WJG2 4ABGA 3ZZ9A 1FX0B 1YPHE 1PYTD 2H9EH 5FPYA 4Y11E 4ABJA 1O5DH 1TNLA 1THPB 2CGAA 5L2YH 6LPRA 3EE0B 3B23B 1MTNB 4MLFB 5JBBS 4WH6A 3RM0H 5F53A 3SNDA 4BXSA 4X8VH 4TSFD 4THNH 1ANEA 1FN8A 1NFXA 2WPHS 3QDZB 2OC1A 1GHXH 1XUKA 2BY6X 4CRGA 1YPMH 1CA0C 1C5VA 1D3DB 1KXEA 1Z8GA 3M37A 2FOMB 3VB6A 2J97A 4Y76A 5L2ZH 1NO9H 1UVSH 1OPHB 1G3DA 1XKAC 4XBDA 3TK9A 2JKHA 1HPGA 2G81E 5C2ZA 3U1IB 5GDSH 1FPCH 2ZI2H 4NA9H 1O36A 3SORA 1DSTA 1D6WA 1SL3A 1HB0B 1TOMH 1PQ5A 4KELA 4O97A 1EZXC 3ZVGA 2PKAB 1AWHB 4DIIH 2WYGA 1W3CA 3VXFH 1BMNH 1VJ9U 1AFEH 2G4UA 4GHTA 1T7CA 2J2UA 1BMMH 1BIOA 1W8BH 2H1UA 2PSXA 1AN1E 3M3SA 1O2IA 2ZHDA 1BBRK 1H8ED 3AW1A 2HPPH 5DP4A 1A7SA 1F5LA 2B5TB 2VNTA 5EW2H 2WUCA 3N7EA 4JZDH 4OS6A 1ELFA 4ISNA 2FEQH 2C8ZB 1AHTH 3A8AA 3EA7A 4K8BA 5L30H 1TX7A 1BA8B 3SU0A 2TBSA 3ODFA 3DUXH 3PMHB 1Y5UT 1LO6A 5FBEA 1GBKA 1XX9A 2PV9B 1C4Y2 5PTPA 2FLBH 3SU4A 3GS9A 1IQGA 3TITA 3PMAB 1CBWB 3RC6A 2XBXA 5AHGH 1TQ7B 4NZLA 2PKSB 3DSGA 1E1QD 5JB9S 1EPTB 1E79D 4KTSA 1TABE 3RXJA 3OY5U 2G00A 4I86A 3WWFA 1YBWA 1YPJH 1A61H 1RJXB 1K22H 3TH4H 2AH4X 4FVBA 3VB7A 1SI5H 1QRZA 3FFGA 1MQ6A 1KXAA 1W13U 4Z6AH 3DHKH 2W3KA 3SZEA 3SGQE 3QK1A 1ZZZA 2ZHWH 2BD5A 1SPJA 1IQLA 4A1XA 1ZMJA 2H9HA 3PB1E 1X7AC 5DO4H 3E16B 2Z9IA 4UD9H 3SU6A 2ZTXA 1NRSH 1VR1H 1TA2A 2V35A 3F0OA 4ZHAA 1ELEE 1YKTA 2ZPSA 1ELBA 2G52A 4YOGA 3VPKA 3ZIAD 1O34A 4Q2KA 1YCPH 1P06A 1ZSKA 5KGOA 1BTHH 3SV9A 1E37B 3KIDU 4KP0A 1OWHA 5DP5A 1C5RA 2ZU4A 4X1RU 3MI4A 1UVOA 3ZZAA 1O33A 1W7GH 3ITIA 3TU7H 2OK5A 3Q3YA 1IQIA 1KXCA 4ZKNU 2HOBA 3RXAA 1C1MA 4JK5A 2BB4A 2WZQA 1O2RA 2NU2E 2Y5GA 4LZ4B 3A86A 1S85A 2QV1A 1NBMD 3A7VA 3A83A 3ZVAA 1GHYH 5FPTA 1RIWB 1UTLM 2AFQB 2ASUB 2KR7A 4X8UH 3FZDA 1GG6B 2QXGA 1TPOA 2ALVA 2WUBA 3NCLA 1LVYA 1MD7A 3MNBA 4ASHA 4CHAB 1MTNC 1JWTA 3K9XB 3BIUH 4AX9H 1Y5BT 2KCOA 2WSSD 4ABEA 1AGJA 1O2SA 2IPHA 3KEEA 1GJ7B 1OP0A 2L74A 1A0LA 1AKSB 1HNEE 1P2NA 1JRTA 2I6SA 3NUMA 1NROH 2V3MA 1SGEE 1M9UA 1ZMNA 2BY8X 2FS9A 3B9FH 3A7ZA 3ODDA 4BAOB 1BITA 1PPHE 3NRLA 1Z1JA 2ZGHA 2OCVB 1EAIA 1HAPH 3ZVFA 3RU4E 1ELVA 9ESTA 1H1BA 1KLJH 2PP6A 2JETB 4AORA 3LGVA 4I33A 3ELAH 3W94A 4AYVB 6CHAC 1ESAA 2Z9KA 1MTWA 3GYMA 4GUXA 2W3IA 3SI4H 2XWAA 4FUEA 3SV2H 2H9TH 3RXUA 1O2TA 1RTLA 1T4UH 2KCPA 1G3BA 2KAIA 4XBBA 2ZDVH 4Y7BA 1XXFA 2CK3D 5DP3A 3A7YA 4TPYA 3T26A 2OBQA 1L2EA 1HV7A 1TPAE 2QXHA 2BDAA 1ETRH 4MNVA 3K6ZA 1O2MA 4NIWA 3S69A 1A5IA 1L4ZA 1WV7H 4LXBH 5GIBA 1S81A 2AMQA 2SGEE 1GPZA 4RT1A 2FOAA 3B8JA 3BG8A 1V2MT 5FXLA 3PYHA 5DP6A 2ZQ2A 2D1JA 1GHZA 1O30A 1GI9B 1GJ4H 1UK4A 3LKWA 4X8SH 2THFB 1V2TT 3LIWA 3OEED 3FP8E 2J92A 3D65E 1AZZA 4CRBA 1AB9B 2OQUA 1QNJA 3H7TA 4X2VA 1C5SA 1SBWA 1Z8RA 3SU1A 1FXYA 3VB5A 1EPTC 2HVXA 1C5MD 2BD7A 5FX6A 2ZDNA 3MMGA 3MNXA 1FAKH 1MKWK 2ZTZA 2SNVA 3Q00A 4AOQA 2C3SA 4X2XA 2OUAA 1TONA 1T31A 1PPGE 2BLOA 3BTFE 1LHFH 1V2OT 2LNCA 1MH0A 3QLPH 2PSYA 1LMWB 5AFZH 3T2NA 2FYRA 2EC9H 2RDLA 5HMAA 1PYTC 4JK6A 1T32A 1T4VH 4R0IA 3RXMA 5HKKD 3TGKE 2GV7A 1GJ9B 3BTME 1T8MA 1O3FA 2CF8H 1IQKA 3MO3A 1GWAA 2G5VA 3RXTA 3FVFB 2GDEH 3VFEA 1DY8A 5A0BA 3PMBB 2PUQH 3RP2A 1O2XA 3PO1B 3FP6E 1DXPA 2GDDA 1EUFA 3GDUA 1MCTA 2OC7A 5CHAB 5C1XA 1Y8TA 4O3UA 1ZPCA 4Y8YA 4CH8B 1NU9A 1O2KA 2O8UA 1GBAA 1SG8B 2GJGA 1LTOA 5CHBA 2A4GA 3V7TA 1QGFA 2FX6A 1TMBH 2CXVA 5C0TA 1CHOF 3KL6A 2ZWLH 1CT0E 1QFKH 2NU0E 3UQVA 2ZKSA 1OP2A 4K60A 1EJAA
chains in the Genus database with same CATH topology
2D8WA 3QGNB 1P04A 3GDSA 4H42U 1DWDH 3MH7A 3M5LA 4YZUA 2PFEA 3RXDA 2R9PA 4DG4A 4DW2U 1AMHA 1WTGH 3MU8A 3NPSA 1EXFA 1UVPA 2BDYA 1HFDA 3GCHB 4FUBA 3ATIA 4JZEH 2G51A 1TGBA 1S6FA 1J9CH 2XYAA 5TCCA 1GBFA 4UFEH 2ZGBH 1LCYA 4BOHA 2O8WA 2Z9GA 2AIQA 2OBOA 1MU8B 3SO3A 3ZVEA 1TPPA 2TGDA 3RXVA 3AVZA 1ID5H 3ZV8A 3PLPA 1CA0B 2FDAA 3SN8A 1P12E 4LOYH 4B75A 1GMCF 5EGMA 1AWFH 4GPGA 5FPSA 1C5ZB 2AMDA 1RRKA 4BTTB 1NN6A 2J95A 2JH5D 4CBOA 3PMJA 1C2EA 4AYYB 2Y5FA 1MBQA 1BTXA 2BDIA 2BDGA 5B6OA 3RXGA 1TRMA 1A5HA 2Z3CA 3TH3H 1C1RA 1HGTH 3U8TH 1DLEA 1TOCB 3LGUA 2TPIZ 2Y81A 1QQ4A 4DJZB 1ZR0A 1GMCG 1O3IA 2KAIB 1C5UA 4A7IB 5FBIA 4X2WA 1MAXA 5ABWA 4OGXA 3SW2B 2ZU5A 3FZZA 4GVUA 1XMNB 1EB2A 2UUKB 1UCYE 1RD3B 1YM0A 1O3NA 2DE8A 3KCGH 1HJAC 3O8DA 2UUFB 1XVOA 2C8YB 3L3TA 1NT1A 1TFXA 5FCKA 5EQRA 3M7QA 4MPUA 4FU9A 1F5RA 3UNRA 1GL0E 5FX5A 1O2PA 2DUCA 1V2NT 2OC0A 1TGTA 3GY7A 2B7DH 1C4V2 5JBCS 3G01A 2BOKA 1WOFA 1V2JT 2H6MA 3M5OA 3S7HB 2ZGJA 1BT7A 3LOXA 4Q7YA 2EA3A 1K1IA 5E0JA 1C2FA 3L33A 3TJUA 1H8IH 4CR9A 4BXWA 3GCNA 4ZROA 1NM6A 1IQNA 4DURA 3F9HA 1HAYB 3RXIA 1GBBA 2TGAA 3A88A 4ESTE 3SOSA 2SGQE 2O8TA 1EZSC 4PROA 5FAHA 3LH1A 2VIWA 2BX4A 1GHVH 3A87A 7LPRA 1C2IA 1HBTH 5BPEA 1HAXB 2XCNA 2P16A 3VGCC 5EODA 2Z6BD 3UNQA 4IGDA 3RXKA 1H8DH 5DJ7A 3F68H 3GICB 4B2CA 1CE5A 1QL9A 1K28D 3MO9A 5JPMH 3Q3KA 4I32A 2BQ7B 5F6MA 2OP9A 3VB3A 4DVAU 1MKXK 1C2LA 1DM4B 4YLUA 3UR6A 2GV6A 4BAKB 2CHAC 4Q80A 1MBMA 2BY5X 1QCPA 1O3PB 2ZFQH 1V2ST 3JZ2B 2BVSH 2AERH 2ZC9H 2ZGCA 3Q77A 1BBRE 5CHAC 3UIRA 1C2JA 1UTKA 4FVDA 1KY9A 4J2YB 1HIAA 1YCPM 1QHRB 2FIRH 2ODPA 4ISIH 1SMFE 2FPZA 3MOCA 3AAVA 4J1YA 1KXFA 1L1JA 1B5GH 1BZXE 1FN6A 1P2KA 1NTPA 2OD3B 4K5ZA 2C8WB 3QTOH 1SC8U 2GP9B 1SHHB 4H4FA 1RGQA 3M3VA 4R8TB 2R3YA 2VIVA 1XUFA 4ZKOU 1ELGA 1Q2WA 1DUAA 4NFFA 1AVWA 2W5EA 1GJAB 3SJ9A 2VIQA 2V3HH 3GCHC 4D7GA 1JXPA 1JBUH 1O38A 3A84A 1GHBF 3AASA 1O2NA 5DK1A 4JCNA 1QR3E 1BB0B 2BLQA 5C20A 3QX5H 1V2PT 2F9OA 1HRTH 1CGHA 1KTSB 1K21H 1GVLA 1DOJA 2G55A 4X8TH 3P17H 5C5OA 2XCFA 1ZRBA 2G4TA 1OKXA 3SHCH 4INKA 2NU4E 1PFXC 5E2OA 3TPIZ 1GHBG 2QC2A 4FUJA 2CJIA 1DVAH 4DGJA 4JZIA 1C5NH 1KIGH 1JMOH 4UFDH 3UOPA 2R0KA 3V0XA 1AFQC 2Z9LA 1K1MA 1ZTKA 1L1GA 1QY6A 2ZA5A 1TQ0B 1PPEE 4D8NA 2BLVA 2P3FH 1ACBE 5H4IB 4AGJA 1D3PB 4UDWH 1BHXF 3UUZA 1GDUA 1EATA 3ENSB 6CHAB 3PWCA 2VGCC 5E0HA 2BY7X 3F6UH 5GXPA 2CN0H 2GTBA 1ZTJA 3LGYA 2O8LA 2VJ1A 3UY9A 2FLRH 1LKAA 2A32A 2A45B 1J15A 1P01A 4ZUHA 5A8YA 4MNXA 2GZ9A 3TIUA 8LPRA 2FS8A 2EEKA 1CU1A 2GZ7A 1E38B 1F0SA 4YLQH 1SSXA 1T8LA 4X2YA 2PWXA 2OINA 5HGGA 4ZKRU 5GCHF 1GMDF 2F9BH 4YO9A 1UHBB 1WYKA 2ODYB 3GY2A 1LVBA 4X1SU 2XBYA 3LT3A 3U8OH 1DS2E 1GJCB 1KSNA 1CA8B 1O2WA 2HNTF 2BZ6H 1AY6H 5EW1H 2QYIA 4E06H 3BF6H 5GCHG 3D49H 3RXPA 1GMDG 4D7FA 4B76A 1A3BH 1VJAU 5LPRA 2HGTH 1BCUH 1EJMA 5JBAS 3T27A 1HAVB 1HXEH 1IQHA 1CVWH 2NWNA 3LGTA 4JYUH 2SGPE 5HM2A 3VB4A 5GPIB 5LH8A 4I8LA 4A1VA 2PR3A 4B74A 5DG6A 5TCAA 2VVUA 1HJ8A 2ZIQH 1C5YB 1EX3A 1EOLA 3SU2A 5T6DA 1P3CA 3RXLA 1P2JA 2VWOA 1HAHH 3U8RH 2Q6DA 3E90B 5AFYH 1EZQA 4WMFA 1EAUA 2F9NA 2ESTE 1YLDA 1Z7KA 2ULLA 3U69H 3V13A 3A8DA 1HJ9A 1D4PB 2A7HA 1ZHRA 2HALA 4VGCC 1LHCH 5T3HA 1OYQA 1SGYE 3IITA 1NRQH 1C2KA 1FY4A 4RN6A 3ATLA 4Y7AA 5LPEA 2RG3A 3IWMA 2BD4A 1FI8A 2ZDMA 4NA8A 2BOHB 1ARCA 3C1KA 1INCA 2ZEBA 2ZPQA 2XXLA 1NPMA 2BM2A 1GBIA 4CR5A 2AIPA 5L6NH 5HM9A 1BDAA 1O3HA 3UPEA 1GJ8B 1GJ6A 1O3GA 1F0TA 2UUYA 3UQOA 1GBCA 1VGCC 1TB6H 4CBNA 2WYJA 1S84A 1AO5A 3SZNA 4WF8A 4RSPA 5I25A 1A5GH 2Z3DA 3ZVBA 1YPEH 2SGFE 1QTFA 1ZPZA 2YNBA 2FI5E 4F4OC 1ZYOA 1DX5M 1O5CB 1ARBA 1SFIA 3NKKA 1JRSA 1O3DA 1P2OA 3L6PA 2FXRA 2STBE 1S0QA 3PWBA 1G3EA 1B0EA 3TK6A 1V2KT 1GCTC 3T5FH 2J4IA 3P8OA 3SU3A 1ETSH 2XC0A 3LC3A 1J17T 5G4BA 5A8XA 1P2QA 3BSQA 1ETTH 2ZG0H 1O5FH 4QT8C 5EXLA 1K1OA 2XTTB 4Y71A 3A7XA 2HRVA 4FU7A 1GI5A 3UWJH 1Y3VA 3LH3A 1G37A 1TBRH 1V2VT 1GDQA 2FI3E 3P95A 4H6TA 2BZAA 3U1JB 3RXFA 1EP5A 1CO7E 2ZFTA 4IN2A 4CH2B 3STIA 1Q3XA 3FP7E 3LONA 3SU5A 2Q1JA 5GJ4B 2H2ZA 1FIWA 3OTJE 5LPFA 2P3TB 1YP9A 1DICA 1IAUA 1RS0A 4ABIA 3O8RA 2QCYA 3STJA 1EASA 1GBEA 5T6GA 3S0NA 1GI6A 1GDNA 1GGDC 1O2UA 4YT7H 5JBTA 1V6DA 1AUTC 4ZHMU 4MQAA 2C93B 1G32B 1W7XH 3P6ZB 5A0AE 4X1QU 5TJXA 1HJAB 3NK8A 2C8XB 1DY9A 2UWOA 4XDEA 4DT7B 4ISHH 3EAJA 1ZJKA 1KXDA 3I29A 1TX8A 2FO9A 3QUMP 3WY8A 1OWEA 3SI3H 1C5OH 1GI7B 1LHDH 4KGAA 3HPTB 1GBLA 3BTWE 3E8LA 2BYAX 3RXCA 2IJOB 1FY3A 1GI8B 3U98H 3PLBA 5BRRE 1QJ1B 2QAAA 1EOJA 1KDQA 1W10U 5EQQA 1F0RA 3ZZ7A 4JZFH 1Q31A 1TLDA 1JIMA 1EB1H 4Y8XA 4UEHH 4IN1A 1TWXB 3SHAH 1C5QA 3BTHE 4ABHA 3SQHE 4BAHB 4ABBA 1K1NA 4K2YA 3KGPA 3SJKA 3M7UA 1VITH 4ISLA 3VGCB 4NSYA 1GI0A 1YC0A 5J4SA 3QTVH 1YPKH 2A7JA 1A0HB 3SGAE 3R0FA 4UFGH 1TGNA 1H9LB 1WSSH 1C4U2 2SGDE 4AB8A 3T62A 3A82A 3NWUA 2R3UA 3OYPA 5JB8S 2Q6GA 4Y0YE 2VIOA 1AU8A 3P70B 1TYNA 2H5CA 1TBQH 4MNWA 4AFUA 1Z71A 2PW8H 1DXWA 2QN5T 2BMGB 3KHVA 3LJJA 3SJOA 2CHAB 5DP9A 1UK3A 4Y6DA 3ATWA 4Y79A 3T25A 2IN2A 1Z8IB 4RKJB 1BJUA 1EZUC 2A5AA 3M3TA 3QO6A 2QF0A 2ZU1A 3BV9B 3RU4D 4HFPB 1DFPA 1FY1A 1FNIA 1VCQA 3AW0A 1EAWA 5F8XA 4CRAA 4LK4A 3MH4A 4FUCA 2CV3A 2RCEA 5CE1A 3BG4B 2VH0A 4INHA 2V6NA 1UJ1A 4MG3A 1QIXB 1OOKB 1P09A 1D9IA 2FOEA 2P8OB 1N8OC 2GT8A 2VVVA 2XW9A 5DGJA 1OWIA 2ZNKH 1XUJA 2I6QA 1Y59T 3LPRA 1AD8H 2XC5A 2ALPA 1AE8H 1OSSA 1SLUB 1V3XA 3MH5A 4OS2A 3UTUH 2BTCE 3SUDA 1UCYH 2ZFSA 2P93A 1CHOG 4E7RG 1KLTA 2QXIA 2SNWA 2HNTC 1FMGA 1T8OA 2XRCA 1GBTA 1ZHPA 4IC6A 1BMAA 4H6SB 3GY6A 3FANA 1MZDA 1QL8A 1O2JA 4GAWA 3RLYH 1FY8E 1QBOA 4O3TA 1SLXB 1SR5C 4AFZA 1O5AB 4WVPE 1QRWA 1Y3XA 1C1OA 1MTVA 5HXFA 1HAOH 1JOUB 3RLWH 5JDUB 1TNJA 1CHGA 2FYQA 5F8TA 1C1SA 2ILNA 5AF9H 1V2WT 4TY7A 1AFQB 2ZECA 1OWDA 1WTHD 1YYY1 1MU6B 1GI1A 3V12A 3LC5A 4WH8A 5E8EH 1GI2A 3RC5A 4DIHH 3PROA 1SOZA 3A81A 3FAOA 2BD2A 2RA3A 3PLKA 3HGNA 2J38A 1ELAA 1KTTB 1XM1A 3UREA 4B73A 2CMYA 4WXVA 3TGIE 1AVXA 6GCHF 1O2ZA 5EU8A 1F92A 3KF2A 3RXOA 1SGDE 1TNGA 1VCPA 1WQSA 2VGCB 4U30A 1YPLH 1WUNH 1TALA 1C5TA 4X1PU 1VCWA 1YGCH 5EPYA 3URDA 4TWWA 1TAWA 2ZDKA 3M36A 1P3EA 1DT2A 2LPRA 3HK6B 5C3NA 2Y6TA 2BVRH 1UO6A 2A4RA 1OWJA 5F8ZA 4ZAEA 3NZIA 3KQBA 2ZFFH 4IMZA 3TJNA 1GHAF 3C27B 1O2HA 3M35A 3H7OA 1P03A 1F5KU 3IG6B 6GCHG 1C1QA 1C9PA 4BTIB 1D3TB 2FI4E 1XVMA 3OU0A 1B7XB 1OS8A 1NESE 3QWCH 1G30B 2P3UB 2ZCHP 3LDXH 5IYTA 3M5MA 5EQSA 4AFQA 2FOCA 4F49A 1O32A 1P2MA 4SGAE 3BEUA 4I8GA 1U6QA 1GHAG 1BBRH 3LGIA 2SGAA 1GVZA 1E34B 1AIXH 1QA0A 1FAXA 1J14A 1O0DH 1PJPA 1YF4A 1MUEB 1BRBE 2FOFA 4NIXA 1MQ5A 3S7KB 1SFQB 2VU8E 4I31A 3SV7A 5EXMA 1K2I1 1LQEA 1O3KA 1MTUA 1ABIH 5C67A 5IDKA 1W12U 4AG2A 5DP7A 1KXBA 2FZZA 3A89A 1ZPBA 1GJBB 2A2XH 2DE9A 2A1DB 3E1XB 1C1TA 4XSKU 1QJ7B 4HGCA 3D62A 3SBKA 2W7SA 4YT6H 4B2BA 3UWIA 4NFEA 1P02A 1P9SA 2P95A 1C1PA 2ZFRH 2V0BA 3GYLB 2AYWA 3LJOA 1GBMA 3HK3B 1UTQA 1N1LA 4CRCA 1C2MA 2O9QA 2FM2A 2EI8A 2FOBA 4TPIZ 1O3MA 4UONA 1LHEH 2WINI 7KMEH 1C2HA 4GCHF 3MO6A 2F91A 3UR9A 2PLXA 2CF9H 1WCZA 3SNCA 5GWZA 1DSUA 4VGCB 1O39A 2ZU2A 1NFYA 3TNTA 1QB6A 2FESH 1MCVA 4GCHG 4O03A 3QZQA 3BG4C 4X6PA 2VINA 3KQDA 1AZ8A 4D76A 3W95A 2G5NA 2FTLE 2UUJB 2Y82A 5CMXH 3TVJB 5I46H 1OXGA 2P8OC 2Y80A 1NU7B 2NU1E 3P92A 3MHWU 4ABFA 1TA6A 1FLEE 2BHGA 2FOGA 3BTEE 3SJ8A 1V2QT 1XUHA 4DOQA 2XC4A 1AI8H 1VGCB 2GX4A 4NGAH 1S5SA 1QJ6B 4GSOA 5AVDA 1GI4A 1BTYA 4KTUA 4K3JA 2QIQA 2JH6D 1XUIA 5ETXA 4MTBA 4AGKA 1DLKB 3E3TA 2WPJS 1T8NA 2EI7A 2ZU3A 4NZQA 1OX1A 2WPKS 3P8FA 1GI3A 1BTZA 5T6FA 1W0YH 2Q6FA 1GCTB 2GVFA 1LPGB 3R3GB 3ZZ6A 3RU4T 2XBVA 1TRYA 2GMTB 2Z3EA 1G9IE 1S6HA 1DDJA 4NCYA 1P10A 2K1QA 2FOHA 1TMTH 1QBVH 1HAZB 4E05H 2BVXH 4KKDA 3K6YA 4LZ1H 1FJSA 1P2IA 3KN2A 2ZF0H 1G36A 2OQ5A 2P94A 3ZZ5A 1CGJE 1K1JA 1ZGIA 2TGTA 2A4QA 1TNKA 2J34A 3F9GA 1H9HE 1SOTA 3I78A 1BTWA 4X6OA 2HWLB 1B0FA 3NXPA 1C5WB 1S0RA 2GZ8A 5EPNA 4ZKSU 3SNEA 1AKSA 4K8YA 7ESTE 4OS4A 3V3MA 4MPWA 4ZXXH 4M7GA 1F7ZA 2XNIA 4HI3A 3SJIA 2A31A 1GGDB 1FIZA 2BY9X 1BJVA 3Q76A 1V2RT 4IW4E 1TRNA 1C9TA 5A0CA 2B8OH 4YESB 2FP7B 4I8JA 2EI6A 2QXJA 1BTUA 2RA0A 3BN9A 2OLGA 4FU8A 3T29A 3LGWA<