1O36A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o36A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o36A02
1C5ZB 2VH0A 1D3QB 1LVMA 2VIDA 1Z1IA 1CA0B 1Y3UA 1J14A 1MAYA 2VIPA 1UCYE 2BTCE 1P3CA 3JZ1B 4X2XA 2UUJB 1VCPA 4AFSA 4NIYA 2R3UA 3S9BA 2P95A 4XSKU 1ESBA 1FPCH 5F8TA 1QJ7B 4GVUA 3NK8A 4UONA 2A5AA 1WUNH 1DY8A 2OQUA 3KL6A 2PTCE 2TGAA 1PPZA 4H6SB 5DP5A 3D65E 1ZTJA 1PQ7A 3SUFA 3MHWU 2PUXB 5LH8A 3Q76A 2H1UA 2BY6X 1BMMH 1T7CA 2VB0A 5TCCA 4E05H 2R9PA 2VH6A 3ZV8A 1K9OE 1TGTA 1EZSC 2ZGCA 1NTPA 1AB9C 2GX4A 1TNHA 2O8TA 4CBNA 1QA0A 1PQ8A 3EGKH 4YOIA 1NU7B 3DHKH 5EXNA 4IMQA 2C4FH 3PB1E 1BJVA 1Y3YA 1NRNH 3E8LA 2QA9E 3V3MA 5C5OA 2XRCA 1P2JA 2BMGB 1K1OA 2B8OH 4Y71A 3ITIA 4AB8A 4CREA 3MH5A 1O3BA 2P8OC 4YZUA 4MNWA 3W95A 3LU9B 1ANDA 4X1PU 2OUAA 3NPSA 1GG6C 1DWBH 3KF2A 1WYKA 1RGQA 2P3UB 1O39A 1O5DH 1UTOA 2CXVA 2Z9GA 5EPYA 3MU1A 1YCPK 3ZVDA 1DSUA 1T8MA 4Y8XA 1QBNA 1UVTH 3SHAH 2HVXA 1HXEH 1YYY1 5C2ZA 1EPTA 4BAHB 1GHAG 2GKVE 1BA8B 1A0LA 3RLYH 2Q6GA 4U2WA 1BB0B 2TPIZ 4ZKRU 1TE0A 1C1TA 2H5CA 2D1JA 4I8KA 3A80A 4CRCA 1TNKA 3EYDA 4YOJA 2FI5E 1FY8E 1C2DA 3EA7A 4WVPE 5HYOA 1V2JT 1P57B 2B5TB 1O2TA 1JRTA 1VR1H 3HPTB 2W7SA 1GBLA 1HAYB 1TGBA 1P2KA 1THSH 2PKSC 2V6NA 4HFPB 1RTLA 1C5QA 3HKIB 1TRNA 3B8JA 3U8TH 2GCHF 1N6YA 2ZC9H 2VVCA 1GL1A 2FS9A 8GCHG 1O5FH 3SV8A 4DG4A 2FMJA 3RU4T 3ZZBA 1ID5H 1WQVH 1AKSB 3PLPA 1AWFH 3MU0A 1P9SA 4CRAA 4IMZA 1V2WT 3V0XA 4I33A 1BITA 1EJNA 1VCWA 1FI8A 2Q6DA 3CENA 5IYTA 2VU8E 3TH4H 1AFQB 1H9LB 4WXIA 3SNAA 1GHVH 3M5LA 1AD8H 1MD7A 3Q3KA 2GVFA 3RXHA 5A0BA 1RTFB 1Z71A 1TA2A 2BX3A 5AFYH 5L2ZH 2G00A 1DOJA 1QTFA 2NU4E 1BBRK 1FDPA 1DXPA 3P92A 3SU5A 1J9CH 1F5RA 2GMTC 2BXTH 2CHAB 2G4TA 4XE4A 1G3DA 2HGTH 1TMTH 5JPMH 1SB1H 3LJOA 4CBOA 2WV5A 3C1KA 5EPNA 4E7NA 4ZMAH 1PJPA 1J8AA 3A8AA 2JH0D 1GBTA 1UTQA 3URDA 1QRWA 1P2IA 2Z94A 1EZQA 1WAYB 1NFXA 1GBHA 3BN9A 4ZUHA 1MTNC 2GD4B 2AMDA 3BTWE 3I29A 2VNTA 4GHTA 1MTNB 1S6FA 4Y11E 4KTCA 2TBSA 2BQWB 1LVYA 2WYJA 1TYNA 1K28D 3ZZCA 1ORFA 1U6QA 1EAIA 3RXQA 2HPQH 3IITA 1K21H 4FUDA 3BTDE 4ZH8A 5E8EH 2JKHA 3I77A 1DUEA 2Z3EA 1DS2E 1O3IA 1P03A 3EAJA 5FX5A 1ZSJA 1V3XA 3CS0A 3RXGA 5GDSH 4ABGA 1V2MT 5ETXA 3ZVEA 2FXRA 1MZAA 1QNJA 3ATKA 1C1QA 5HMAA 1W7XH 4UD9H 5DGJA 3TGIE 1HLTH 1O36A 3GYMA 2ZDLA 3KQCA 1E0FD 4THNH 2AIPA 1ZRBA 3T2NA 1HIAA 1G32B 4MVNA 2FOBA 1GHYH 1KXBA 2H9EH 1KTSB 2ZCKP 1LPZB 2BQ7B 4LXBH 1KXEA 5FPSA 3A8CA 4U01A 3OU0A 1FAXA 3A7WA 1P02A 1EPTC 1SOTA 5JBBS 3JZ2B 3VB3A 3FANA 1L1NA 3UNRA 4MNVA 5EXLA 1QBVH 4ABBA 1ZHMA 1DLEA 5CHAC 1DPOA 3ELAH 3BF6H 5TCAA 3H7OA 4AG1A 5EW2H 2ALVA 2Z3CA 2RA0A 2ZECA 1BZXE 1L4DA 1ZGVA 3MO3A 1BRCE 2H5DA 4K8BA 4ASHA 1KIGH 1MU6B 2ODYB 2ZHQH 2BZAA 3NWUA 4ISLA 1TABE 1EOJA 1KXDA 1P01A 5DP8A 1DM4B 2WINI 5FXLA 1HGTH 2IJOB 4FU9A 1ABJH 4GSOA 1W7GH 3PMBB 1RJXB 1RTKA 1GBDA 3KEEA 2ZHEH 1QQ4A 3MH6A 4KGAA 5C5NA 4RKOB 2O8WA 2NU2E 3A84A 3M7QA 1P2MA 3ATWA 1IQKA 2BD8A 2THFB 1ELDE 5EQSA 1FNIA 1PPCE 2O8UA 3Q3YA 3VB6A 2V0BA 1GWAA 4KKDA 2BY7X 4UFGH 1TALA 4CRDA 1O2IA 4A1VA 1OWEA 4MG3A 3SZNA 1IHTH 1OX1A 1TX7A 1UK3A 1Z8JB 3BTKE 4BXWA 2AGGX 1QBOA 3M5MA 1E38B 2ZNKH 1JIRA 5GJ4B 1A2CH 1K1PA 3LT3A 1BMLA 1T4VH 4FUFA 1O2YA 1BT7A 1GVLA 2ANYA 1S85A 2IOTA 2AFQB 1YPHC 1SFQB 1TNGA 2BDGA 1ETRH 3TH3H 1OWKA 2ZDKA 3BV9B 5DG6A 3ZVFA 1SGRE 1PPBH 3GICB 3SJKA 3PV4A 2BD4A 3GY7A 2H9HA 3A7ZA 5FPTA 2ZTYA 4KELA 1HAVA 1E37B 1XVMA 2F9UA 2FOCA 2BDHA 4NIXA 2Y80A 3RXOA 1ELEE 2BDBA 4DVAU 2A45B 1GHBG 4HI3A 1ELTA 3GDUA 1GI9B 1LVOA 2F9VA 5GPIB 1K1MA 1SMFE 4YT6H 2ZQ1A 1HJAB 1FIZA 2ASUB 2A0QB 1HAGE 1Z8RA 4XBDA 1TQ0B 4I8LA 1LKBA 1K2I1 3VPKA 3O8BA 2FYRA 3G01A 4IC5A 1T32A 4JZDH 3U69H 5I25A 4AOQA 3RXTA 1UMAH 2QF0A 4FUGA 3KQBA 3GCNA 1Y59T 2I6SA 1ANBA 1NFWA 2JETC 3R0FA 1WTGH 1XMNB 4AORA 2JETB 4AYVB 1WQSA 2XWAA 5JB9S 3MH4A 5FBIA 4Q7ZA 3T62A 3ATMA 1BIOA 1DDJA 1W0ZU 4NFEA 1KXAA 1RS0A 4A1XA 2FYQA 5FHTA 3SNBA 4JYTA 4TY7A 1FMGA 2CJIA 2ZU4A 4X0WU 1OPHB 1HAOH 1GHWH 1Y5AT 3VGCC 2FIRH 1BTPA 1GJBB 4XOJA 1O2GH 1AQ7A 1BCUH 2BB4A 2ZFSA 1O3EA 1PPGE 1CA8B 2J2UA 1M9UA 2FI3E 1IQEA 4IS5A 1D9IA 1FN6A 1HDTH 4SGAE 1TONA 5F03A 1C1VH 1LHCH 1TMUH 5A8ZA 1BTWA 3QX5H 1V2QT 1GI5A 1ZOMA 2BOHB 1FXYA 1G3EA 4IBLH 1YPJH 4D7FA 1D3DB 2UUKB 5FAHA 1A46H 1F92A 1YPEH 3TNTA 2AERH 1HAPH 1GJCB 4WH6A 1IQLA 1O2RA 4AZ2B 1BTUA 1BRAA 1GJ7B 4FXGH 4CRBA 2OC7A 1MQ6A 3PLBA 1YCPM 3E3TA 2C8WB 2PFEA 3KCGH 1C1PA 1ZMLA 1CGHA 1H1BA 3PMAB 4MPWA 4JZEH 1QIXB 1EAWA 2BY9X 4B2AA 2WPIS 1P06A 3SJOA 3BTME 1TWXB 3RUOA 2B7DH 2WPMS 1TX8A 3ATIA 4MNYA 4MPXA 4DT7B 2W5EA 3GCTG 2VIOA 4OS5A 1W11U 1ELGA 3L33A 3H5CB 1QQUA 4A6LA 3UIRA 1TIOA 2A4GA 5EQQA 3NZIA 3OY6U 1SQAA 3MNXA 5HM9A 1GJ8B 2FP7B 3OX7U 1EZXC 1NO9H 2ODPA 1JMOH 4ABFA 4NIVA 2NU0E 2HNTC 1GDNA 1L2EA 2VIWA 2A1DB 1GJ5H 4YOGA 2VWLA 1SLVB 1OKXA 1HAVB 1CT0E 2PUQH 2SGDE 2XNIA 1UO6A 1AU8A 1XKAC 1GJ6A 4JK5A 3UREA 2VJ1A 1HB0B 1QB9A 1HXFH 2SNWA 1L4ZA 2EEKA 2TGPZ 3UQVA 4LZ1H 3F9HA 5BRRE 1GHAF 2OQ5A 4D8NA 1MBMA 1VJAU 3LKWA 1NRPH 4AFZA 3SU6A 1C4U2 4NFFA 3L6PA 1SLUB 2J92A 1O3MA 5B6OA 1OYQA 1XUHA 1BTXA 3RC6A 2HNTE 2VIVA 3LGIA 1SQTA 1VZQH 3T5FH 1A3EH 3ZZ7A 4BAKB 3D23A 3SU1A 1EKBB 4XFQA 1C2GA 2Z9KA 1KXFA 2VGCC 1EB1H 5PTPA 1G9IE 3M5OA 2XWBI 5G4BA 3BTHE 3CP7A 1F2SE 3S9AA 4BTUB 2VWNA 2TIOA 6GCHG 1CA0C 1DANH 2CF9H 4DJZB 4H4FA 3BIVH 2O8MA 4Q7XA 3TK9A 4F4OC 4ISNA 3MU4A 2QGRA 2RDLA 1PYTD 4NWLA 3A85A 4O3UA 3ZVCA 2ZP0H 5DP6A 3SJ8A 1V2RT 3DT0H 1H8DH 1GHXH 2W26A 2XC5A 2WUCA 2ZFTA 1AVGH 3FP6E 3AAVA 3SUEA 1O2PA 2ZTZA 2ZFRH 3H7TA 1MKXK 3MWIU 2QYIA 3F1SB 2O8LA 2A5KA 3U8OH 5CMXH 1TGNA 2HPPH 1UVOA 3OSYA 4KTSA 3RM2H 1VITG 5LGOA 3KQEA 2KAIA 1GVZA 1B0FA 2GZ8A 1H9HE 5A8XA 2Z9JA 4I8GA 4CHAB 3DFLA 5A8YA 2J95A 4X2YA 3LC3A 4JYUH 3DA9B 3MH7A 2EI7A 4MNXA 2A4RA 3M3TA 4I7YH 1MQ5A 4OS2A 2GCTC 2A32A 4NA8A 1IOEA 4XDEA 2WYGA 1IAUA 2GCTB 3EE0B 4GPGA 1V2TT 3RMOH 3SN8A 2FTMA 1UVSH 1HNEE 1CBWB 3ENSB 2A7HA 1MKWH 1ZMNA 2F9PA 2HOBA 2GP9B 4X8VH 1DFPA 4K60A 1PPHE 4K69A 1CHOG 1UCYH 2DE8A 4Y76A 3OY5U 2XCFA 3A7VA 2P59A 3F6UH 3IWMA 3M7TA 3UOUA 1J17T 3NUMA 1FLEE 1SL3A 2BHGA 1HCGA 2F83A 3M7UA 2J34A 1LVBA 1EX3A 3ZZ8A 3FVFB 4Y8ZA 1V2PT 1SSXA 1AO5A 1EATA 1T31A 1BRUP 5ESBA 3TPIZ 2ZKSA 1HJ8A 1ZMJA 2DE9A 4XBCA 5E2PA 1ARBA 2A7CA 1FY4A 4NSYA 4X8UH 1GJ9B 3BTFE 2ZZUH 3BTEE 3HATH 2NU3E 3PYHA 2ZPQA 1LDTT 1SG8B 2NU1E 5I46H 3QZRA 1O35A 1O3HA 4UDWH 1ZZZA 1ZHPA 3QTOH 1ELAA 1WCZA 3RXDA 2ZHWH 4X1RU 1A61H 4DW2U 2VWOA 1QL9A 1Z1JA 1P09A 3ZZ4A 1GVKB 1AFQC 2PW8H 2ILNA 1BHXB 1BOQA 3PTBA 1DXWA 4ZXYH 2AEIH 4MPVA 1O2XA 3E91A 1AY6H 4MLFB 2F91A 3UNQA 4Y6DA 1GMCF 2AH4X 3RDZA 4JZ1A 1MTSA 1AE5A 3RXEA 1AI8H 3O8RA 1DWCH 4RN6A 1C5RA 3RP2A 4CR9A 1S81A 1SHHB 3TJOA 3BEUA 1LHFH 1GBJA 2CHAC 3MNSA 3MOCA 5L2YH 3RU4D 1OSSA 1TRYA 1GGDC 3M3VA 5T6GA 2AS9A 3SV9A 2R3YA 1G36A 1O32A 3F9GA 3VXFH 1HPGA 1GGDB 3E16B 1SGDE 4ABJA 1SI5H 3NKKA 2SGEE 3S69A 1GJ4H 5C3NA 4X6OA 1Q31A 1C5WB 1GBFA 2V3OH 2XYAA 2AGEX 1C2MA 1BTHH 1IQHA 1W10U 2BVSH 3E0NB 2C8ZB 2STAE 4AFQA 2HLCA 2R0KA 4WJG2 1C5NH 2PR3A 1O3KA 5BPEA 3SORA 3RXUA 2TGDA 4YESB 2FLBH 1ZYOA 4E7RG 2FZZA 3A89A 4ZROA 4NZQA 1VGCB 1S0QA 2KAIB 5K7RA 1XKBC 1O5AB 2ZG0H 1UJ1A 1DICA 3DD2H 1ZTLA 1F7ZA 4HTCH 5AF9H 1ACBE 3ODFA 3U9AH 2OC1A 1NN6A 3VEQB 1J16A 1C2FA 1EUFA 3U98H 3R3GB 2ZO3H 4NGAH 1DWDH 5EU8A 1P2OA 2ZU2A 2BVRH 4FVBA 4FUCA 1SLXB 1H4WA 4TYDA 4B2BA 2W3KA 1MAXA 1NS3A 1HAHH 3O8CA 1HV7A 1SGFA 3MFJA 4CR5A 1Z6JH 1GHBF 2BY8X 5K0HA 4IN1A 1ELFA 1JWTA 1C1WH 1YGCH 1ARCA 1Q2WA 1L0ZA 3A82A 2XBWA 1CHGA 4IN2A 1FZZA 1HAIH 2A4QA 1WTHD 2GDDA 2RG3A 4K8YA 2RA3A 3TJVA 5A0CA 2BOKA 4LZ4B 2P16A 4MDSA 1IQMA 4YTAA 1O2MA 3ZYEA 4ZXXH 4LOYH 3VXEH 3SQEE 4FUBA 1VITH 2BDCA 1G3CA 3LH3A 3EQ0H 1C9PA 1G2MA 1O33A 5F8XA 2Y82A 3MO9A 4ISHH 3SU2A 4ABHA 1TMBH 1HAZB 2ZGBH 2AYWA 2QV1A 2Z6BD 4JYVH 5GCHG 5AFZH 4X8SH 4AGJA 4LK4A 1C5MD 1KLIH 1H8IH 3EA9A 5E0JA 1SFIA 2BYAX 3S7KB 5LPEA 2XC0A 3RXFA 2J94A 4E06H 2YNBA 1SGTA 3S0NA 1FQ3A 3KNXA 2C3SA 3QLPH 4BNRA 2TGTA 1NRQH 1C5TA 1MCVA 2FI4E 1XX9A 1MKXH 2WPLS 4X2WA 4X1QU 2GDEH 2OD3B 3D62A 1PPFE 4Y7BA 1NROH 3SU3A 1ZPZA 1BTZA 2EC9H 3SUDA 4A1TA 4ISOA 1V2VT 4FU7A 1UK2A 5A2MH 2QXJA 6CHAB 1CE5A 1GL0E 2BD9A 2PSXA 4IW4E 3E1XB 3FAOA 5DKMA 2BD5A 1NFYA 2IN2A 4WMDA 1AFEH 2UUYA 3QGJA 5EQRA 1MZDA 3RXIA 3E90B 3SI3H 4JZFH 1LPKB 1T8OA 1GBIA 1V2NT 3QWCH 1YKTA 2G55A 1T8LA 2PV9B 3GISB 1O3PB 3HK6B 4GCHG 5J4QA 2BDAA 2DUCA 3BEIB 4ISIH 4UFEH 4A92A 5CE1A 3MTYA 1YC0A 3BTQE 5EG4A 1O3LA 3RXAA 1C5PA 4XBBA 3SGQE 1GMHG 2HWLB 2QY0B 2Y5HA 3U8RH 4A5TS 3KHVA 1MKWK 4ZHMU 1ELBA 4DY7B 2VVUA 4Y8YA 2ZHFH 1NRRH 4RSPA 1F0UA 1HJAC 5EODA 1D4PB 1LMWB 2W3IA 1V2KT 2G4UA 1UCYK 1O2QA 4VGCB 3T27A 4ABIA 1C4V2 4UEHH 1IQNA 4NG9H 1THRH 1A0HB 4WMFA 3RXJA 3LH1A 1TGCA 1UK4A 3MNBA 4WWYA 1OWHA 1G37A 2BDYA 3V7TA 2GTBA 1O3NA 3VB4A 1KLTA 3TJNA 1C1UH 1TPSA 3LPRA 4WH8A 2BD2A 3KQDA 3ZVGA 4DURA 1KDQA 1V2ST 1PYTC 1ZSLA 1XXFA 5HM2A 1X7AC 4X1SU 1HRTH 2C90B 3RXBA 3RXSA 2VINA 1GI4A 1EQ9A 1MMJN 2EA3A 2D8WA 3UWIA 3RXMA 1TB6H 5FBEA 3ESTA 1FY1A 3GOVB 1Z6EA 2OINA 3RXVA 1OWJA 1OXGA 1ZPBA 2F9BH 2HALA 2V3HH 1GCTB 3STJA 3W94A 4YLQH 5C1XA 4M7GA 2R0LA 1XUIA 1JOUB 1FUJA 1YPKH 3TH2H 3V13A 1KXCA 7LPRA 1GBKA 1CU1A 3LOXA 4O97A 3TGKE 4OGXA 2BLWA 2PLXA 4ABAA 2CMYA 1FONA 1WSSH 2WPKS 2JH6D 3ZYDA 4Z6AH 5DK1A 2FTLE 5ESTE 1XUFA 2PGQB 1KYNA 1NFUA 5JYIA 1IQJA 4HZHA 3SGAE 1TAWA 1C4Y2 2FO9A 4TWWA 3P8NA 3O8DA 1G3BA 3TNSA 1SGPE 6GCHF 3BG4B 1A5GH 1AGJA 1IHSH 1SVPA 1C2LA 3A88A 1Y3VA 2SGQE 1BJUA 4OGYA 1L1GA 1SBWA 4OS4A 1O0DH 2XCNA 1FY3A 1C5UA 5F6MA 1E34B 4CH2B 3QO6A 3ZZAA 1OP0A 4BTTB 2C8XB 3RC4A 2C93B 2ALPA 3MI4A 5IDKA 1O3GA 3ZZ3A 1SC8U 4FUIA 1XVOA 2PKAA 2ZI2H 4FVDA 2BD7A 1O38A 5A09A 1IQIA 1ZGIA 2STBE 1GBEA 2PSYA 4JMYA 5EOKA 3RMNH 1A1RA 4BAMB 1F0RA 2CF8H 1SGNE 4U32A 3TK5A 4K5ZA 1UTNA 1C5VA 4UFFH 2G52A 3AVZA 2UWLA 1NY22 1LHDH 2FEQH 3RMMH 1MUEB 2Y81A 2J38A 1O3AA 3U1JB 3SJIA 1EAXA 1C5SA 1S82A 4H6TA 1EP5A 4DGJA 6LPRA 4NCYA 5E0GA 2A7JA 3LC5A 4CRGA 1JXPA 1O3DA 1Z7KA 3PMHB 2BD3A 3QGNB 4INKA 4UE7H 3P17H 1ETTH 5C67A 1GPZA 1NZQH 3STIA 3T28A 4OS1A 5DPAA 2BZ6H 1AUJA 2FLRH 5GWZA 2GV6A 1CHOF 5LPFA 1UTLM 1E35B 1OP8A 2ZDMA 3SV2H 1NC6A 1P3EA 3MMGA 3QTVH 1SGIB 3HK3B 1RRKA 4U30A 2SFAA 1ZTKA 4WF8A 4ZHLU 1CT2E 5LPRA 2XW9A 1O2JA 1AHTH 3QDZB 1WU1A 2ZGJA 3VB7A 3T26A 2A4OA 1W2KH 1JIMA 2FDAA 1KDQB 1S0RA 4X6PA 1GMDG 2FOMB 1LCYA 1C1RA 4GLYA 2QXHA 1ETSH 1SQOA 2A5IA 2R2WU 3P8OA 3SW2B 4K1TA 1EXFA 3K6YA 1XXDA 1ZPCA 5FCRA 1O2KA 4ZHAA 1TOCB 3Q3XA 4Q80A 1O37A 2CN0H 1YPGH 1O34A 2ANMH 2H2ZA 2R2MB 1KSNA 4ZKOU 8GCHF 1QHRB 4MPUA 1FJSA 1OOKB 3BSQA 5T6FA 1Z8GA 1LTOA 1YLDA 5C1UA 3FP8E 1AMHA 1V6DA 2D26C 1EZUC 1FIWA 7GCHG 2PGBB 3M36A 4F49A 4AYYB 3RU4E 1KLJH 5FCKA 1NPMA 2W7UA 3WY8A 2AMQA 2HRVA 2PTNA 1QJ6B 1DE7H 1ZRKA 1YPLH 4ABDA 1CO7E 3RM0H 2ZU3A 4KP0A 1XUGA 2H9TH 2UUFB 1QRZA 1SLWB 3RMLH 4A7IB 1C9TA 3GDVA 2SGAA 4CHAC 1GI1A 2AGIX 3LGYA 3FP7E 4Y7AA 2QAAA 4I32A 2A31A 3NCLA 2J9NA 4QT8C 1OS8A 3MNCA 1O5CB 1IQFA 1OYTH 1B0EA 2BLVA 1C1MA 2PHBA 3SNEA 4ESTE 1QY6A 3ZVAA 1C5XB 3AW1A 1V2LT 2BY5X 3PWCA 1WV7H 1TNLA 1RIWC 1CBWC 1Q3XA 4OS7A 2EI8A 1AUTC 2Y5GA 2CGAA 4AB9A 3ODDA 4B2CA 1RIWB 2G5NA 5EGMA 1AB9B 1O5BB 1W8BH 3PROA 3QUMP 4TPIZ 1TLDA 1Y8TA 2ZGXH 2ZA5A 4JZIA 8KME2 3BTGE 1C2EA 4B1TA 4DCDA 2BLOA 1AZZA 1DWEH 4INHA 4I8HA 1O2OA 1SHYA 1CQQA 2PKAB 1LHGH 1MTVA 1NRSH 1DSTA 4D9RA 1MU8B 1W0YH 4MQAA 1LQEA 2ZHDA 5JDUB 3GYLB 2IPHA 2FS8A 2P8OB 1INCA 2O9QA 1BQYA 8LPRA 3BG8A 5DP4A 2WV4A 1GG6B 1P12E 2RCEA 1TFXA 1IQGA 1GI0A 1MTUA 3M3SA 2BDIA 4NWKA 3SV6A 5J4SA 5T3HA 1BTYA 1SPJA 1AE8H 2QXIA 3GY8A 1WBGB 1TOMH 2ZQ2A 1RFNA 2OC8A 1HBTH 1MCTA 2QIQA 1E36B 1O3JA 2VWMA 4H42U 5E2OA 1DLKB 4Q7YA 1GDQA 2AMPA 4YO9A 1TPPA 1DY9A 1Z8IB 2EI6A 1O5GH 2G81E 2OP9A 3VB5A 2PKSB 3GY6A 3E0PB 6ESTA 1S6HA 1ZLRA 4X8TH 4O3TA 3E6PH 5C20A 1B5GH 3UY9A 3UTUH 5A0AE 5AVDA 3A8DA 3D49H 3B23B 3SNDA 1PPEE 2OTVA 1F5LA 2D2DA 5GCHF 2F9NA 2GT8A 1BMAA 2SGFE 3Q77A 4DIIH 4D7GA 4Y0YE 2ZFQH 1EOLA 1SR5C 2A2QH 1UTKA 1P9UA 1LQDB 3DFJA 1ELVA 1GI3A 4K2YA 5EXMA 2FOFA 2FESH 1GBMA 3PLKA 1NM6A 4FUJA 1G30B 3PMJA 1PFXC 1UVPA 1P10A 3EDXB 1J15A 2M5TA 1EASA 1ZJDA 1O2NA 3SBKA 1W14U 1EJMA 4WXVA 1K1LA 2I6QA 3KIDU 2GMTB 3SV7A 4AN7A 1O2WA 4ZAEA 1C5YB 5EW1H 1QB1A 1S5SA 3P95A 5DO4H 4D9QA 3PM3A 1RXPA 1D3PB 1W3CA 3RXLA 1UHBA 3BIUH 3SO3A 3RLWH 3ZZ6A 1VGCC 4X6MA 5T6DA 1THPB 2UWPA 3TITA 2FWWA 1MTWA 1JBUH 2GV7A 4I8JA 2OXSA 1O2LA 1D3TB 2BLQA 2UWOA 1MH0A 2FOEA 3A7YA 1QGFA 5FX6A 1TA6A 2ZU5A 3SQHE 1W13U 1P04A 1T8NA 1XUJA 2CV3A 2F3CE 2XXLA 3AASA 2ZCHP 4INLA 1C5LH 4FUHA 4GCHF 1CGIE 4X6NA 3UPEA 4BANB 1F0SA 1TQ7B 1C1SA 3TGJE 2QF3A 2SNVA 1O2UA 5HXFA 1QRXA 1FN8A 3K65B 5GIBA 3UOPA 1YLCA 1N1LA 3HKJB 2QN5T 1GMHF 1ELCA 2OBQA 1A5HA 1C2IA 1V2UT 3ZZDA 4J1YA 3LGTA 2PWXA 4GAWA 3S9CA 1DVAH 2XTTB 3LGWA 2OCVB 1KY9A 2P94A 3HGPA 2BM2A 2FODA 3PWBA 1LKAA 2Z3DA 3AW0A 1GI2A 2GCHG 1GCDA 1GDUA 4BAQB 1Y5UT 4Y79A 2P3FH 1SGEE 3UR6A 2B0FA 3I78A 4BXSA 3ZVBA 2FPZA 2SGPE 3CS7A 2LNCA 4DIHH 1F0TA 1A0JA 2OBOA 3UFAA 1D6WA 1AVWA 1QURH 1XUKA 1YPMH 2GGVB 2QC2A 2XC4A 1K1JA 1YM0A 1GI7B 2Z9LA 2ZCLP 2HNTF 1EPTB 1O3CA 2VVVA 3ZZ5A 4MTBA 1GMCG 5L6NH 1P2QA 1N6XA 1GJDB 2TRMA 3A7TA 1SGFG 3SU0A 4GUXA 1C1OA 5CHAB 3A86A 1SGQE 2P3TB 3RXKA 3QZQA 1GI6A 1VJ9U 3Q00A 3FZZA 1G2LA 9LPRA 3GCHC 1QR3E 1S83A 2ZDAH 1GJAB 1YF4A 1MBQA 4YT7H 1LO6A 1ZSKA 3GCHB 4CH8B 1HFDA 4FUEA 4B74A 3UNSA 1QA7A 3UWJH 6CHAC 3F9EA 3A81A 3U1IB 3M5NA 1K1NA 4CRFA 1ZR0A 3GDSA 3GCOA 4AFUA 2Z9IA 3HGNA 3TU7H 5ABWA 1TNJA 1A7SA 1TGSZ 1ANEA 1BDAA 1YBWA 3NXPA 3MU8A 2G5VA 5DP7A 2ULLA 4Q2KA 1NT1A 1MD8A 2VIQA 1Y3XA 1EB2A 2J4IA 2Z7FE 4K1SA 1DITH 4I31A 4ZKNU 2G51A 1QJ1B 4NA7A 2YOLA 4NSVA 4Z0KA 2ZTXA 2Y6TA 3P8FA 3B9FH 1C5OH 2ZWLH 1GBCA 4NA9H 4RKJB 2OC0A 5E0HA 1AVXA 1FV9A 4BAOB 5C1YA 1YP9A 3IG6B 5GXPA 4AG2A 1D6RA 4Y0ZE 3P6ZB 1O2SA 2ANWA 4B76A 2BQ6B 1XM1A 1FY5A 4ABEA 5DP9A 5JB8S 1PQ5A 2A2XH 4VGCC 1UHBB 3BEFB 1WOFA 4BOHA 2ZFFH 2P93A 1KTTB 7KMEH 3C27B 2Y7XA 2BX4A 4Y10E 1HUTH 2AIQA 1A5IA 2NWNA 3PTNA 3SOSA 1NESE 9ESTA 1QB6A 2WUBA 1YCPH 3GCTF 1QCPA 1A4WH 3UUZA 1EAUA 3GY2A 1NU9A 4IGDA 5DP3A 1BBRE 1ZHRA 3QK1A 1SGCA 3P8GA 1FPHH 1HYLA 1EP6A 4TWYA 1GBBA 2XBYA 3OTJE 1VCQA 3UQOA 3OYPA 4OS6A 1A3BH 1AWHB 3RXRA 1K22H 2K1QA 1OWDA 4AGKA 1YPHE 1QL8A 4PROA 2C8YB 3K2UA 4B73A 1GCTC 2FOGA 1ESAA 1GHZA 4AX9H 3MYWA 1DUAA 4IC6A 1P11E 1UVUH 2ZF0H 1ZJKA 1QL7A 3A87A 3A7XA 4TY6A 2F9OA 4B75A 1B7XB 1O31A 3GY5A 4KTUA 1HIAB 2QXGA 5JBAS 5L30H 1C1NA 4JK6A 3AAUA 2FX6A 1O2ZA 1TNIA 4O9VA 2H6MA 5FPYA 2ANKH 1CGJE 3M35A 4J2YB 3K9XB 4JCNA 1GMDF 1GI8B 1SGYE 3RC5A 4HGCA 3FFGA 3DUXH 3GY3A 4DOQA 2G8TA 2YNAA 2ZEBA 3BG4C 2GZ9A 3VGCB 3T25A 3M61U 1ESTA 1BBRH 1UTMA 1UTPA 4GHQA 1AN1E 3TIUA 5HGGA 1PQAA 1BHXF 1OWIA 3SU4A 5H4IB 4WY3A 1LPGB 3ZZ9A 1UTJA 2GT7A 1BRBE 7GCHF 1S84A 3SUGA 3BTTE 3ZV9A 2B9LA 4ZKSU 2ZDVH 3LGUA 3LGVA 2BVXH 1CT4E 2V35A 3RXPA 3SI4H 3LJJA 3TJUA 1HAXB 2Y5FA 2Q6FA 3SNCA 2FOHA 1K1IA 2ODQA 3A83A 1VITF 1SOZA 2Y7ZA 1EJAA 1TRMA 2WPHS 3LIWA 1LHEH 3MO6A 2QCYA 2WPJS 1C2KA 3VFEA 3N7OA 3GY4A 4K3JA 3LDXH 1AZ8A 3UR9A 1JRSA 1CSOE 4NZLA 3QN7A 4R0IA 4WMEA 4O03A 1P05A 1H9IE 1C2HA 4X1NU 2FOAA 4X2VA 5TJXA 1W12U 5F8ZA 7ESTE 3LONA 2ZIQH 1P0SH 4R8TB 2ZU1A 4D76A 1O2VA 3MU5A 1TBQH 3V12A 5JBCS 4B71A 2FX4A 4BTIB 4YM9A 1RD3B 1DX5M 1GBAA 1O30A 2ESTE 1N8OC 3L3TA 3F9FA 1P8VC 1OP2A 2ZFPH 1ANCA 2XBVA 3A8BA 4FU8A 4NIWA 1N8OB 3SGBE 1AKSA 1T4UH 2ZGHA 5DJ7A 3T29A 3KN2A 1TPOA 8ESTE 3K6ZA 3SHCH 3FZDA 1Y5BT 1L1JA 1DT2A 3F68H 1HJ9A 1BUIA 3EA8A 2OLGA 2Q1JA 5AHGH 2ZPSA 2ZDNA 3KGPA 4K1EA 1TX6A 1BMNH 1F5KU 2GZ7A 3ATLA 4YLUA 1CVWH 5JBTA 2BXUH 2XBXA 3TLOA 1V2OT 4SGBE 1Y3WA 2ZPRA 1TBZH 2FM2A 2LPRA 3P70B 3PO1C 3S7HB 1O2HA 5SGAE 1O3OA 3PO1B 1QFKH 3SJ9A 1TBRH 4UFDH 1P2NA 3TK6A 3RXCA 1C2JA 1O3FA 4TPYA 3URCA 1O5EH 3TVJB 1AIXH 1TPAE 1ABIH 1FAKH 3M37A 2JH5D 2VGCB
chains in the Genus database with same CATH superfamily
1C5ZB 2VH0A 2EQNA 1D3QB 3H09A 1LVMA 2VIDA 1Z1IA 1CA0B 1Y3UA 1J14A 1MAYA 2VIPA 1UCYE 2BTCE 1P3CA 3JZ1B 4X2XA 2UUJB 1VCPA 4AFSA 4NIYA 2R3UA 3S9BA 2P95A 4XSKU 1ESBA 1FPCH 5F8TA 1QJ7B 4GVUA 3NK8A 4UONA 2A5AA 1WUNH 1DY8A 2OQUA 3KL6A 2PTCE 2TGAA 1PPZA 4H6SB 5DP5A 3D65E 1ZTJA 1PQ7A 3SUFA 3MHWU 2PUXB 5LH8A 3Q76A 2H1UA 2BY6X 1BMMH 1T7CA 2VB0A 5TCCA 4E05H 2R9PA 2VH6A 3ZV8A 1K9OE 1TGTA 1EZSC 2ZGCA 1NTPA 1AB9C 2GX4A 1TNHA 2O8TA 4CBNA 1QA0A 1PQ8A 3EGKH 4YOIA 1NU7B 3DHKH 5EXNA 4IMQA 2C4FH 3UAIC 3PB1E 1BJVA 1Y3YA 1NRNH 2K0QA 3E8LA 2QA9E 3V3MA 5C5OA 2XRCA 1P2JA 2K8IA 2BMGB 1K1OA 2B8OH 4Y71A 3ITIA 4AB8A 4CREA 3MH5A 1O3BA 2P8OC 4YZUA 4MNWA 3W95A 3LU9B 1ANDA 4X1PU 2OUAA 3NPSA 1GG6C 3DSGA 1DWBH 2OK5A 3KF2A 1WYKA 1RGQA 2P3UB 1O39A 1O5DH 1UTOA 2CXVA 2Z9GA 5EPYA 4DT4A 3MU1A 1YCPK 3ZVDA 1DSUA 1T8MA 4Y8XA 1QBNA 1UVTH 3SHAH 2HVXA 1HXEH 2J97A 1YYY1 5C2ZA 1EPTA 4BAHB 1GHAG 2GKVE 1BA8B 1A0LA 3RLYH 2Q6GA 4U2WA 1BB0B 2TPIZ 4ZKRU 1TE0A 1C1TA 2H5CA 2D1JA 4I8KA 3OEHD 3A80A 4CRCA 1TNKA 3EYDA 4YOJA 2FI5E 1FY8E 1C2DA 3EA7A 4WVPE 5HYOA 1V2JT 1P57B 2B5TB 1O2TA 1JRTA 2F43B 1VR1H 3WWBA 3HPTB 2W7SA 1GBLA 1HAYB 1TGBA 1P2KA 1THSH 2PKSC 3EE7A 2V6NA 4HFPB 1RTLA 1C5QA 3HKIB 1TRNA 3B8JA 3U8TH 2GCHF 1N6YA 2ZC9H 2VVCA 1GL1A 2FS9A 8GCHG 1O5FH 3SV8A 4DG4A 2FMJA 3RU4T 3ZZBA 1ID5H 1WQVH 1AKSB 3PLPA 1AWFH 3MU0A 1P9SA 2KZ4A 4CRAA 4IMZA 4F48B 1V2WT 3V0XA 4I33A 1BITA 1EJNA 1VCWA 1E79D 1FI8A 2Q6DA 3CENA 5IYTA 2VU8E 3TH4H 1AFQB 1H9LB 4WXIA 3SNAA 1GHVH 3M5LA 1AD8H 1MD7A 3Q3KA 2GVFA 3RXHA 5A0BA 5B6LA 1RTFB 1Z71A 1TA2A 2BX3A 5AFYH 5L2ZH 2G00A 1DOJA 1QTFA 2NU4E 1BBRK 1FDPA 1DXPA 3P92A 3SU5A 2KCPA 1J9CH 1F5RA 2QF5A 2GMTC 2BXTH 2CHAB 2G4TA 4XE4A 1G3DA 2HGTH 1TMTH 5JPMH 1SB1H 3LJOA 4CBOA 2JIZD 2WV5A 3C1KA 5EPNA 4E7NA 4ZMAH 1PJPA 1J8AA 3A8AA 2JH0D 5F53A 1GBTA 3NRLA 1UTQA 3URDA 5CDFE 1QRWA 1P2IA 2Z94A 1EZQA 1WAYB 1NFXA 1GBHA 2VBCA 3BN9A 2HVYB 4ZUHA 2WSSD 1MTNC 2GD4B 2AMDA 3BTWE 3I29A 2VNTA 4GHTA 3KQ5A 1MTNB 1S6FA 4Y11E 4KTCA 5GNDA 2TBSA 2BQWB 1LVYA 2WYJA 1TYNA 1K28D 3ZZCA 1ORFA 1U6QA 1EAIA 3RXQA 2HPQH 3IITA 1K21H 4FUDA 3BTDE 4ZH8A 5E8EH 2JKHA 3I77A 1DUEA 5KGOA 2Z3EA 1DS2E 1O3IA 1P03A 3EAJA 5FX5A 1ZSJA 1V3XA 3CS0A 3RXGA 2KFWA 5GDSH 4ABGA 1V2MT 5ETXA 3ZVEA 2FXRA 5C0TA 1MZAA 1QNJA 3ATKA 1C1QA 5HMAA 1W7XH 5KECA 4UD9H 5DGJA 3TGIE 1HLTH 1O36A 3GYMA 2ZDLA 3KQCA 1E0FD 4THNH 2AIPA 1ZRBA 3T2NA 1HIAA 1G32B 4MVNA 2FOBA 1GHYH 1KXBA 2H9EH 1KTSB 2ZCKP 1LPZB 2BQ7B 2WV9A 4LXBH 1KXEA 5FPSA 3A8CA 1EFRD 3OU0A 1FAXA 4U01A 5DN6D 3A7WA 1P02A 1EPTC 1SOTA 5JBBS 3JZ2B 3VB3A 4FOUC 3FANA 1L1NA 3UNRA 2IJD1 4MNVA 5EXLA 1QBVH 4ABBA 1ZHMA 1DLEA 2F4LA 5CHAC 1DPOA 3ELAH 3BF6H 5TCAA 3H7OA 4AG1A 5EW2H 2ALVA 2Z3CA 2RA0A 2ZECA 1BZXE 1L4DA 1ZGVA 3MO3A 1BRCE 2H5DA 4K8BA 4ASHA 1KIGH 1MU6B 2ODYB 2ZHQH 2BZAA 3NWUA 4ISLA 1TABE 1EOJA 1KXDA 1P01A 5DP8A 1DM4B 2WINI 5FXLA 1HGTH 2IJOB 4FU9A 1ABJH 4GSOA 1W7GH 3PMBB 1RJXB 1RTKA 1GBDA 3KEEA 2ZHEH 1QQ4A 3MH6A 4KGAA 5C5NA 4RKOB 2O8WA 2NU2E 3A84A 3M7QA 1P2MA 3ATWA 1IQKA 2BD8A 2THFB 1ELDE 5EQSA 1FNIA 1PPCE 2O8UA 3Q3YA 3VB6A 2V0BA 1GWAA 4KKDA 2BY7X 4UFGH 1TALA 4CRDA 1O2IA 3PV2A 4A1VA 1OWEA 4MG3A 3SZNA 1IHTH 1OX1A 1TX7A 1UK3A 1Z8JB 3BTKE 4BXWA 2AGGX 1QBOA 3M5MA 1E38B 2ZNKH 1JIRA 5GJ4B 2YMSD 1A2CH 1K1PA 3LT3A 1BMLA 2IPQX 1T4VH 4FUFA 1O2YA 1BT7A 1GVLA 2ANYA 1S85A 2IOTA 2AFQB 1YPHC 1SFQB 1TNGA 2BDGA 1ETRH 3TH3H 1OWKA 2ZDKA 3BV9B 5DG6A 3ZVFA 1SGRE 1PPBH 3GICB 3SJKA 3PV4A 2BD4A 1NBMD 3GY7A 2H9HA 3A7ZA 5FPTA 2ZTYA 4KELA 1HAVA 1E37B 1XVMA 2F9UA 2FOCA 2BDHA 4NIXA 2Y80A 3AK5A 3RXOA 1ELEE 2BDBA 4DVAU 4YXWD 2A45B 1GHBG 4HI3A 1ELTA 3GDUA 1GI9B 1LVOA 2F9VA 5GPIB 1K1MA 1SMFE 4YT6H 2ZQ1A 1HJAB 1FIZA 1W0JD 2ASUB 1W0KD 2A0QB 4Q4LA 1HAGE 1Z8RA 4XBDA 1TQ0B 4I8LA 1LKBA 1K2I1 3VPKA 3O8BA 2FYRA 3G01A 4IC5A 1T32A 5HKKD 4JZDH 3U69H 5I25A 4AOQA 3RXTA 1UMAH 2QF0A 4FUGA 3KQBA 3GCNA 1Y59T 2I6SA 4P00A 1ANBA 1NFWA 2JETC 3R0FA 1WTGH 1XMNB 4AORA 2JETB 4AYVB 1WQSA 2XWAA 5JB9S 3MH4A 5FBIA 4Q7ZA 3T62A 3ATMA 1BIOA 1DDJA 1W0ZU 4NFEA 1KXAA 1RS0A 4A1XA 2FYQA 5FHTA 3SNBA 4JYTA 4TY7A 1FMGA 2CJIA 2ZU4A 4X0WU 1OPHB 1HAOH 1GHWH 1Y5AT 3VGCC 2FIRH 1BTPA 1GJBB 4XOJA 1O2GH 1AQ7A 1BCUH 2BB4A 2ZFSA 1O3EA 1PPGE 1CA8B 3N7EA 3OEED 2J2UA 1M9UA 2FI3E 1IQEA 4IS5A 1D9IA 1FN6A 1HDTH 4SGAE 1TONA 5CHBA 5F03A 1C1VH 1LHCH 1TMUH 5A8ZA 1BTWA 3QX5H 1V2QT 1GI5A 1ZOMA 2BOHB 2M2AA 1FXYA 1G3EA 4IBLH 1YPJH 4D7FA 1D3DB 2UUKB 5FAHA 1A46H 1F92A 1YPEH 3TNTA 2AERH 1HAPH 1GJCB 4WH6A 1IQLA 1O2RA 4AZ2B 1BTUA 1BRAA 1GJ7B 4FXGH 4CRBA 2OC7A 1MQ6A 3PLBA 1YCPM 3E3TA 2C8WB 2PFEA 3KCGH 1C1PA 1ZMLA 2RDEA 1CGHA 1H1BA 3PMAB 4MPWA 3VG8A 4JZEH 1QIXB 1EAWA 2BY9X 4B2AA 2WPIS 1P06A 3SJOA 3BTME 1TWXB 3RUOA 2B7DH 2WPMS 1TX8A 3ATIA 4MNYA 4MPXA 4DT7B 2W5EA 1K0HA 3GCTG 2WPDD 2VIOA 4OS5A 1W11U 1ELGA 3L33A 3H5CB 1QQUA 4A6LA 3UIRA 1TIOA 2A4GA 5EQQA 3NZIA 3OY6U 1SQAA 5C0UA 2L74A 3MNXA 5HM9A 1GJ8B 2FP7B 3OX7U 1EZXC 1NO9H 2ODPA 1JMOH 4ABFA 4NIVA 3F2FA 1E1RD 2NU0E 2HNTC 1GDNA 1L2EA 2VIWA 2A1DB 1GJ5H 4YOGA 2VWLA 1SLVB 1OKXA 1HAVB 1CT0E 2PUQH 2SGDE 2XNIA 4AC9A 1UO6A 1AU8A 1XKAC 1GJ6A 4JK5A 3UREA 2VJ1A 1HB0B 1QB9A 1HXFH 2SNWA 1L4ZA 2EEKA 2TGPZ 3UQVA 4LZ1H 3F9HA 5BRRE 1GHAF 2OQ5A 4D8NA 1MBMA 1VJAU 3LKWA 1NRPH 4AFZA 3SU6A 1C4U2 4NFFA 3L6PA 1SLUB 2J92A 1O3MA 5B6OA 1OYQA 1XUHA 4Z1MD 1BTXA 3RC6A 2HNTE 2VIVA 3LGIA 1SQTA 1VZQH 3T5FH 1A3EH 3ZZ7A 4BAKB 3D23A 3SU1A 1EKBB 4XFQA 1C2GA 2Z9KA 1KXFA 2VGCC 1EB1H 5PTPA 1G9IE 3M5OA 2XWBI 5G4BA 3BTHE 3CP7A 1F2SE 3S9AA 4BTUB 2J98A 2VWNA 2TIOA 6GCHG 1CA0C 1DANH 2CF9H 4DJZB 4H4FA 1SKYE 3BIVH 2O8MA 4Q7XA 3TK9A 4F4OC 3W1EA 4ISNA 3MU4A 2QGRA 3FN8A 2RDLA 1PYTD 4NWLA 3A85A 4O3UA 3ZVCA 2ZP0H 5DP6A 3SJ8A 1V2RT 3DT0H 1H8DH 1GHXH 2W26A 2XC5A 2WUCA 2ZFTA 1AVGH 3FP6E 3AAVA 3SUEA 1O2PA 2ZTZA 2ZFRH 3H7TA 1MKXK 3MWIU 2QYIA 3F0PA 3F1SB 2O8LA 2A5KA 3U8OH 5CMXH 1TGNA 2HPPH 1UVOA 3OSYA 4KTSA 3RM2H 1VITG 5LGOA 3KQEA 2KAIA 1GVZA 1B0FA 2GZ8A 1H9HE 5A8XA 2Z9JA 3OTPA 4I8GA 4CHAB 3DFLA 4Q63A 5A8YA 2J95A 4X2YA 3LC3A 4JYUH 3DA9B 3MH7A 2EI7A 4MNXA 2LELA 2A4RA 3M3TA 4I7YH 1MQ5A 4OS2A 1UW7A 2A32A 2GCTC 4NA8A 1IOEA 4XDEA 2WYGA 1IAUA 2GCTB 3EE0B 4GPGA 1V2TT 3RMOH 3SN8A 3U28C 2FTMA 1UVSH 1HNEE 1CBWB 3ENSB 2A7HA 1MKWH 1ZMNA 2F9PA 5FL7D 2HOBA 1YY3A 2GP9B 4X8VH 1DFPA 4K60A 1PPHE 4B6EA 4K69A 1CHOG 1UCYH 2DE8A 4Y76A 3OY5U 2XCFA 3A7VA 2P59A 3F6UH 3IWMA 3M7TA 3UOUA 1J17T 3NUMA 1FLEE 1SL3A 2BHGA 1HCGA 2F83A 3M7UA 2J34A 1LVBA 1EX3A 3ZZ8A 3FVFB 4Y8ZA 1V2PT 1SSXA 1AO5A 1EATA 1T31A 1BRUP 5ESBA 3TPIZ 2ZKSA 1HJ8A 3FKSD 1ZMJA 2DE9A 4XBCA 5E2PA 1ARBA 2A7CA 1FY4A 2QE7D 4NSYA 4X8UH 1GJ9B 3BTFE 2ZZUH 3BTEE 3HATH 2NU3E 3UB0A 3FOAA 3PYHA 2ZPQA 1LDTT 1SG8B 5EJLA 2NU1E 5I46H 3QZRA 1O35A 1O3HA 4UDWH 1ZZZA 1ZHPA 3QTOH 1ELAA 1WCZA 3RXDA 2ZHWH 3CNRA 4X1RU 1A61H 4DW2U 2VWOA 1QL9A 1Z1JA 1P09A 3ZZ4A 1GVKB 5T1VA 1AFQC 3DSPA 2PW8H 2ILNA 1BHXB 1BOQA 3PTBA 1DXWA 4ZXYH 2AEIH 4MPVA 1O2XA 3E91A 1AY6H 4MLFB 2F91A 3UNQA 4Y6DA 1GMCF 2AH4X 2YMSB 3RDZA 4JZ1A 1MTSA 1AE5A 3RXEA 1AI8H 2KCAA 3O8RA 1DWCH 4RN6A 1C5RA 3RP2A 4CR9A 4HG6A 1S81A 1SHHB 3TJOA 3BEUA 1LHFH 1GBJA 2CHAC 3MNSA 3MOCA 5L2YH 3RU4D 1OSSA 1TRYA 1GGDC 3M3VA 5T6GA 2RFKC 2AS9A 2J98B 3SV9A 2R3YA 1G36A 1O32A 3F9GA 3VXFH 1HPGA 1GGDB 3E16B 1SGDE 4ABJA 1SI5H 3NKKA 2SGEE 3S69A 1GJ4H 5C3NA 4X6OA 1Q31A 1C5WB 1GBFA 2V3OH 2XYAA 2AGEX 1C2MA 1BTHH 1IQHA 1W10U 2BVSH 3E0NB 2C8ZB 2STAE 4AFQA 2HLCA 2R0KA 1FX0B 4WJG2 1C5NH 2PR3A 1O3KA 5BPEA 3SORA 3RXUA 2TGDA 4YESB 2FLBH 1ZYOA 4E7RG 2FZZA 3A89A 4ZROA 4NZQA 1NBME 1VGCB 1S0QA 2KAIB 5K7RA 1XKBC 1O5AB 2ZG0H 1UJ1A 1DICA 2V7QD 3DD2H 1ZTLA 1F7ZA 4HTCH 5AF9H 1ACBE 3ODFA 3U9AH 2OC1A 1NN6A 3VEQB 1J16A 1C2FA 1EUFA 2WHXA 5HIYA 3U98H 3R3GB 2ZO3H 4NGAH 1DWDH 5EU8A 1P2OA 2ZU2A 2BVRH 4FVBA 4FUCA 2XNDD 1SLXB 1H4WA 4TYDA 4B2BA 2W3KA 1MAXA 1NS3A 1HAHH 3O8CA 1HV7A 1SGFA 3MFJA 4CR5A 1Z6JH 1GHBF 2BY8X 5K0HA 4IN1A 1ELFA 1JWTA 1C1WH 1YGCH 3F2GA 1ARCA 1Q2WA 1L0ZA 3A82A 2XBWA 1CHGA 4IN2A 1FZZA 1HAIH 2A4QA 1WTHD 2GDDA 2RG3A 2J5UA 4K8YA 2RA3A 3TJVA 5A0CA 2BOKA 4LZ4B 2P16A 4MDSA 1IQMA 4YTAA 1O2MA 3ZYEA 4ZXXH 4LOYH 3VXEH 3SQEE 4FUBA 1VITH 2BDCA 1G3CA 3LH3A 3EQ0H 1C9PA 1G2MA 1O33A 5F8XA 2Y82A 3MO9A 4ISHH 3SU2A 4ABHA 1TMBH 1HAZB 2ZGBH 2AYWA 2QV1A 2Z6BD 4JYVH 5GCHG 5AFZH 4X8SH 4FETA 4AGJA 4LK4A 1C5MD 1KLIH 1H8IH 3EA9A 5E0JA 1SFIA 2BYAX 3S7KB 5LPEA 2XC0A 3RXFA 2J94A 4E06H 2YNBA 1SGTA 3S0NA 1FQ3A 3KNXA 2C3SA 3QLPH 4BNRA 2TGTA 1NRQH 1C5TA 3WW7A 1MCVA 2FI4E 1XX9A 1MKXH 2WPLS 4X2WA 4X1QU 2GDEH 2OD3B 3D62A 1PPFE 4Y7BA 1NROH 3SU3A 1ZPZA 2PP6A 1BTZA 2EC9H 3SUDA 4A1TA 4ISOA 1V2VT 4FU7A 1UK2A 5A2MH 2QXJA 6CHAB 1CE5A 1GL0E 2BD9A 2PSXA 4IW4E 3E1XB 3FAOA 5DKMA 2BD5A 1NFYA 2IN2A 4WMDA 1AFEH 2UUYA 3QGJA 3PRBA 5EQRA 1MZDA 3RXIA 3E90B 3SI3H 4JZFH 1LPKB 1T8OA 1GBIA 1V2NT 3QWCH 1YKTA 5EJZA 2G55A 1T8LA 2PV9B 4ACAA 3GISB 4B6FA 1O3PB 3HK6B 4GCHG 5J4QA 2BDAA 2DUCA 3BEIB 4ISIH 4UFEH 4A92A 5CE1A 3MTYA 1YC0A 3BTQE 3PRDA 5EG4A 3FO8D 1O3LA 3RXAA 1C5PA 4XBBA 3SGQE 1GMHG 2HWLB 2QY0B 2Y5HA 3U8RH 4A5TS 3KHVA 1MKWK 4ZHMU 1ELBA 2JJ1D 4DY7B 2VVUA 4Y8YA 2ZHFH 1NRRH 4RSPA 1F0UA 1HJAC 5EODA 1D4PB 3GS9A 1LMWB 2W3IA 1V2KT 2G4UA 1UCYK 1O2QA 4VGCB 3T27A 4ABIA 1C4V2 4UEHH 1IQNA 5HIZA 1KMHB 4NG9H 1THRH 1A0HB 4WMFA 3RXJA 3LH1A 1TGCA 1UK4A 2CK3D 3MNBA 4WWYA 1OWHA 1G37A 2BDYA 3V7TA 2GTBA 1O3NA 3VB4A 1KLTA 3TJNA 1C1UH 1TPSA 3LPRA 4WH8A 2BD2A 3KQDA 3ZVGA 4DURA 1KDQA 1WXRA 1V2ST 1PYTC 1ZSLA 1XXFA 5HM2A 1X7AC 4X1SU 1HRTH 2C90B 3RXBA 3RXSA 2VINA 1GI4A 1EQ9A 1MMJN 2EA3A 2D8WA 3UWIA 3RXMA 1TB6H 5FBEA 3ESTA 1FY1A 3GOVB 1Z6EA 2OINA 3RXVA 1OWJA 1OXGA 1ZPBA 2F9BH 2HALA 2V3HH 1GCTB 3STJA 3W94A 4YLQH 5C1XA 4M7GA 2R0LA 3SYJA 1XUIA 1JOUB 1FUJA 1YPKH 3TH2H 3V13A 1KXCA 7LPRA 1GBKA 1CU1A 3LOXA 4O97A 3TGKE 4OGXA 2BLWA 2PLXA 4ABAA 2CMYA 1FONA 1WSSH 2WPKS 2JJ2D 2JH6D 3ZYDA 4Z6AH 5DK1A 2FTLE 5ESTE 1XUFA 2PGQB 1KYNA 1NFUA 5EIYA 5JYIA 1IQJA 4HZHA 3SGAE 1TAWA 1C4Y2 2FO9A 4TWWA 3P8NA 3O8DA 1G3BA 3TNSA 1SGPE 6GCHF 1OHHD 3BG4B 1A5GH 1AGJA 1IHSH 1SVPA 1C2LA 3A88A 1Y3VA 2SGQE 1BJUA 4OGYA 1L1GA 1SBWA 4OS4A 1O0DH 3WWFA 2XCNA 1FY3A 1C5UA 5F6MA 1E34B 4CH2B 3QO6A 3ZZAA 1OP0A 4BTTB 2C8XB 3RC4A 2C93B 2ALPA 3MI4A 5IDKA 1O3GA 3ZZ3A 1SC8U 4FUIA 1XVOA 2PKAA 2ZI2H 4FVDA 2BD7A 1O38A 5A09A 1IQIA 1ZGIA 2STBE 1GBEA 2PSYA 4JMYA 5EOKA 3RMNH 1A1RA 4BAMB 1F0RA 2CF8H 2EY4C 1SGNE 4U32A 3TK5A 4K5ZA 1UTNA 1C5VA 4UFFH 2G52A 3AVZA 2UWLA 1NY22 1LHDH 2FEQH 3RMMH 1MUEB 2Y81A 2J38A 1O3AA 3U1JB 3SJIA 1EAXA 1C5SA 1S82A 4H6TA 1EP5A 4DGJA 6LPRA 4NCYA 5E0GA 2A7JA 3LC5A 4CRGA 1JXPA 1O3DA 1Z7KA 3PMHB 2BD3A 3QGNB 4INKA 4UE7H 3P17H 1ETTH 5C67A 1GPZA 1NZQH 3STIA 3T28A 4OS1A 5DPAA 2BZ6H 1AUJA 2FLRH 5GWZA 2GV6A 1CHOF 5LPFA 1UTLM 1E35B 1OP8A 2ZDMA 3SV2H 1NC6A 1P3EA 3MMGA 3QTVH 1SGIB 3HK3B 1RRKA 4U30A 2SFAA 1ZTKA 4WF8A 4ZHLU 1CT2E 5LPRA 1VKYA 2XW9A 1O2JA 1AHTH 3QDZB 1WU1A 2ZGJA 3VB7A 3T26A 2A4OA 1W2KH 1JIMA 2FDAA 1KDQB 1S0RA 4X6PA 1GMDG 2FOMB 1LCYA 1C1RA 4GLYA 2QXHA 1ETSH 1SQOA 2A5IA 2R2WU 3P8OA 3SW2B 4K1TA 1EXFA 3K6YA 1XXDA 1ZPCA 5FCRA 1O2KA 4ZHAA 1TOCB 3Q3XA 4Q80A 1O37A 2CN0H 2XOKD 1YPGH 1O34A 2ANMH 2H2ZA 2R2MB 1KSNA 4ZKOU 8GCHF 1QHRB 4MPUA 1FJSA 1OOKB 3BSQA 5T6FA 1Z8GA 1LTOA 1YLDA 5C1UA 3FP8E 1AMHA 2KR7A 1V6DA 2D26C 1EZUC 1FIWA 7GCHG 2PGBB 3M36A 4F49A 4AYYB 3RU4E 1KLJH 5FCKA 1NPMA 2W7UA 3WY8A 2AMQA 2HRVA 2PTNA 1QJ6B 3PV5A 1DE7H 1ZRKA 1YPLH 4ABDA 1CO7E 3RM0H 2ZU3A 4KP0A 1XUGA 2H9TH 2UUFB 1QRZA 1SLWB 3RMLH 4A7IB 3MQKC 1C9TA 3GDVA 2SGAA 4CHAC 1GI1A 2AGIX 3LGYA 3FP7E 4Y7AA 2QAAA 4I32A 2A31A 3NCLA 2J9NA 4ASUD 4QT8C 1OS8A 3MNCA 1O5CB 1IQFA 1OYTH 1B0EA 5DSFA 2BLVA 1C1MA 2PHBA 3SNEA 4ESTE 1QY6A 3ZVAA 1C5XB 3AW1A 1V2LT 2BY5X 3PWCA 1WV7H 1TNLA 1RIWC 1CBWC 1Q3XA 4OS7A 2EI8A 1AUTC 2Y5GA 2CGAA 4AB9A 3ODDA 4B2CA 1RIWB 2G5NA 5EGMA 1AB9B 1O5BB 1W8BH 3PROA 3QUMP 4TPIZ 1TLDA 1Y8TA 2ZGXH 2ZA5A 4JZIA 8KME2 5EJ1A 3BTGE 1C2EA 4B1TA 4DCDA 2BLOA 1AZZA 1DWEH 4INHA 4I8HA 1O2OA 1SHYA 1CQQA 2PKAB 1LHGH 1SQRA 1MTVA 1NRSH 1DSTA 4D9RA 1MU8B 1E1QD 1W0YH 4MQAA 1LQEA 2ZHDA 5JDUB 3GYLB 2IPHA 2FS8A 2P8OB 1INCA 2O9QA 1BQYA 8LPRA 3BG8A 5DP4A 1COWD 2WV4A 1GG6B 1P12E 2RCEA 1TFXA 1IQGA 1GI0A 3OE7D 1MTUA 3M3SA 2V3MA 2BDIA 4NWKA 3SV6A 5J4SA 5T3HA 1BTYA 1SPJA 1AE8H 2QXIA 3GY8A 1WBGB 1TOMH 2ZQ2A 1RFNA 2OC8A 1HBTH 1MCTA 2QIQA 1E36B 1O3JA 2VWMA 4H42U 5E2OA 5KEDA 1DLKB 4Q7YA 1GDQA 2AMPA 4YO9A 1TPPA 1DY9A 1Z8IB 2EI6A 1O5GH 2G81E 2OP9A 3VB5A 2YMSC 2PKSB 3GY6A 3E0PB 2AHME 6ESTA 1S6HA 1ZLRA 4X8TH 4O3TA 3E6PH 5C20A 1B5GH 3UY9A 3UTUH 5A0AE 5AVDA 2GJGA 3A8DA 3D49H 3B23B 3SNDA 1PPEE 3KYGA 2OTVA 1F5LA 2D2DA 5GCHF 2F9NA 2GT8A 1BMAA 1YWUA 2SGFE 3Q77A 4DIIH 4D7GA 4Y0YE 2ZFQH 1EOLA 1SR5C 2A2QH 1UTKA 1P9UA 1LQDB 3DFJA 1ELVA 1GI3A 4K2YA 5EXMA 2FOFA 2FESH 1GBMA 1YLNA 3PLKA 1NM6A 4FUJA 1G30B 3PMJA 1PFXC 1UVPA 1P10A 3EDXB 1J15A 2M5TA 1EASA 1ZJDA 1O2NA 3SBKA 1W14U 1WDIA 1EJMA 4WXVA 1K1LA 2I6QA 3KIDU 2GMTB 3SV7A 4AN7A 1O2WA 4ZAEA 1C5YB 5EW1H 1QB1A 1S5SA 3N7DA 3P95A 5DO4H 4D9QA 3PM3A 1RXPA 1D3PB 1W3CA 3RXLA 1UHBA 3BIUH 3SO3A 3RLWH 3ZZ6A 1VGCC 4X6MA 5T6DA 1THPB 2UWPA 3TITA 2FWWA 1MTWA 1JBUH 2GV7A 4I8JA 4F55A 2OXSA 1O2LA 1D3TB 2BLQA 2UWOA 1MH0A 2FOEA 3A7YA 1QGFA 5FX6A 1TA6A 2HLDD 2ZU5A 3SQHE 1W13U 1P04A 1T8NA 1XUJA 2CV3A 2F3CE 2XXLA 3AASA 2KCYA 2ZCHP 1BMFD 4INLA 1C5LH 4FUHA 4GCHF 2JDID 1CGIE 5IK2D 4RT1A 4X6NA 3OFND 3UPEA 4BANB 1F0SA 1TQ7B 1C1SA 3TGJE 2QF3A 2SNVA 1O2UA 5HXFA 1QRXA 1FN8A 3K65B 5GIBA 3UOPA 1YLCA 1N1LA 4XRNA 3HKJB 2QN5T 1GMHF 1ELCA 2OBQA 1A5HA 1C2IA 1V2UT 3ZZDA 4J1YA 3LGTA 2PWXA 4GAWA 4I86A 3S9CA 1DVAH 2XTTB 3LGWA 2OCVB 1KY9A 2P94A 3HGPA 2BM2A 2FODA 3PWBA 1LKAA 2Z3DA 3AW0A 3SZEA 1GI2A 2GCHG 1GCDA 1GDUA 4BAQB 1Y5UT 4Y79A 2P3FH 1SGEE 3UR6A 2B0FA 3I78A 4BXSA 3ZVBA 2FPZA 2SGPE 3CS7A 2LNCA 4DIHH 1F0TA 1A0JA 2OBOA 3UFAA 1D6WA 1AVWA 1QURH 1XUKA 1YPMH 2GGVB 2QC2A 2XC4A 1K1JA 1YM0A 1GI7B 2Z9LA 4TT3D 2ZCLP 2HNTF 1EPTB 1O3CA 2VVVA 4RI0A 3ZZ5A 4M9FA 4MTBA 1GMCG 5L6NH 1P2QA 1N6XA 1GJDB 2TRMA 3A7TA 1SGFG 3SU0A 4GUXA 2LP6A 1C1OA 5CHAB 3A86A 1SGQE 2P3TB 3RXKA 3QZQA 1GI6A 1VJ9U 3DSOA 3Q00A 3FZZA 1G2LA 9LPRA 3GCHC 1QR3E 1S83A 2ZDAH 1GJAB 1YF4A 1MBQA 3OAAD 4YT7H 1LO6A 1H8ED 1ZSKA 3GCHB 4CH8B 1HFDA 4FUEA 4B74A 3UNSA 1QA7A 3UWJH 6CHAC 3F9EA 3A81A 3U1IB 3M5NA 1K1NA 4CRFA 1ZR0A 3GDSA 3GCOA 4AFUA 2Z9IA 3HGNA 3TU7H 5ABWA 1TNJA 1A7SA 1TGSZ 1ANEA 1BDAA 1YBWA 3NXPA 3MU8A 2G5VA 5DP7A 2ULLA 4Q2KA 1NT1A 5C94A 1MD8A 2VIQA 1Y3XA 1EB2A 2J4IA 2Z7FE 4K1SA 1DITH 4I31A 4ZKNU 2G51A 1QJ1B 4NA7A 2YOLA 2W6JD 4NSVA 4Z0KA 2ZTXA 2Y6TA 3P8FA 3B9FH 1C5OH 2ZWLH 1GBCA 4NA9H 4RKJB 2OC0A 2WZQA 5E0HA 1AVXA 2KM0A 1FV9A 4BAOB 2KCOA 5C1YA 1YP9A 3IG6B 5GXPA 4OM9A 4AG2A 1D6RA 4Y0ZE 3P6ZB 1O2SA 2ANWA 4B76A 2BQ6B 1XM1A 1FY5A 3N99A 4ABEA 5DP9A 5JB8S 1PQ5A 3KYFA 2A2XH 4VGCC 1UHBB 2KX4A 3BEFB 1WOFA 1QZ8A 4BOHA 2ZFFH 2P93A 1KTTB 7KMEH 3F3BA 3C27B 1MABB 2Y7XA 2BX4A 4Y10E 1HUTH 2AIQA 1A5IA 2NWNA 3PTNA 3SOSA 4ZCNA 1NESE 9ESTA 1QB6A 2WUBA 1YCPH 3GCTF 1QCPA 1A4WH 3UUZA 1EAUA 3GY2A 1NU9A 4IGDA 5DP3A 1BBRE 1ZHRA 3QK1A 1SGCA 3P8GA 1FPHH 1HYLA 1EP6A 4TWYA 1GBBA 2XBYA 3OTJE 1VCQA 3UQOA 3OYPA 2QF4A 4OS6A 1A3BH 1AWHB 3RXRA 1K22H 2K1QA 1OWDA 4AGKA 1YPHE 4XD7D 1QL8A 4PROA 2C8YB 3K2UA 4B73A 1GCTC 2FOGA 4ACBA 1ESAA 1GHZA 4AX9H 3MYWA 1DUAA 4IC6A 1P11E 1UVUH 2ZF0H 1ZJKA 1QL7A 3A87A 3A7XA 4TY6A 2F9OA 1H8HD 4B75A 1B7XB 1O31A 3GY5A 4KTUA 1HIAB 2QXGA 5JBAS 5L30H 1C1NA 4JK6A 3AAUA 2FX6A 1O2ZA 1TNIA 4O9VA 2H6MA 5FPYA 2ANKH 1CGJE 3M35A 4J2YB 3K9XB 4JCNA 1GMDF 1GI8B 1SGYE 3RC5A 4HGCA 3FFGA 3DUXH 3GY3A 4DOQA 2G8TA 2YNAA 2ZEBA 3BG4C 2GZ9A 3VGCB 3T25A 3M61U 1ESTA 1BBRH 1UTMA 1UTPA 4GHQA 1AN1E 3TIUA 5HGGA 1PQAA 3DCLA 1BHXF 1OWIA 3SU4A 5H4IB 4WY3A 1LPGB 3ZZ9A 1UTJA 2GT7A 1BRBE 7GCHF 1S84A 3SUGA 3BTTE 3ZV9A 2B9LA 4ZKSU 2ZDVH 3LGUA 3LGVA 2BVXH 1CT4E 2V35A 3RXPA 3SI4H 3LJJA 3TJUA 1HAXB 2Y5FA 2Q6FA 3SNCA 2FOHA 1K1IA 2ODQA 3A83A 1VITF 1SOZA 2Y7ZA 1EJAA 1TRMA 2WPHS 3LIWA 4TSFD 1LHEH 3MO6A 2QCYA 2WPJS 1C2KA 3VFEA 3N7OA 3GY4A 4K3JA 3LDXH 1AZ8A 5C17A 3UR9A 1JRSA 1CSOE 4NZLA 3F0OA 3QN7A 4R0IA 4WMEA 4O03A 1P05A 1H9IE 1C2HA 4RT0A 4X1NU 2FOAA 4X2VA 5TJXA 1W12U 5F8ZA 7ESTE 3LONA 4P02A 2ZIQH 1P0SH 4R8TB 2ZU1A 4D76A 1O2VA 1S6LA 3MU5A 1TBQH 3V12A 5JBCS 4B71A 2FX4A 4BTIB 4YM9A 1RD3B 1DX5M 1GBAA 1O30A 2ESTE 1N8OC 3L3TA 2L6OA 3F9FA 1P8VC 1OP2A 2ZFPH 1ANCA 2XBVA 3A8BA 4FU8A 4NIWA 1N8OB 3SGBE 1AKSA 1T4UH 2ZGHA 5DJ7A 3T29A 3KN2A 1TPOA 8ESTE 3K6ZA 3SHCH 3FZDA 1Y5BT 1L1JA 1DT2A 3F68H 1HJ9A 1BUIA 3EA8A 2OLGA 2Q1JA 5AHGH 2ZPSA 2ZDNA 3KGPA 4K1EA 1TX6A 1BMNH 1F5KU 2GZ7A 2W6ID 3ATLA 1CVWH 4YLUA 5JBTA 2BXUH 2XBXA 3TLOA 1V2OT 4SGBE 1Y3WA 2ZPRA 1TBZH 2FM2A 2LPRA 3P70B 3PO1C 3S7HB 1O2HA 5SGAE 1O3OA 3PO1B 1QFKH 3SJ9A 1TBRH 4UFDH 3ZIAD 1P2NA 3TK6A 3F2HA 3RXCA 1C2JA 1O3FA 4TPYA 3URCA 1O5EH 3TVJB 1AIXH 1TPAE 1ABIH 1FAKH 3M37A 2JH5D 2VGCB
chains in the Genus database with same CATH topology
1C5ZB 2VH0A 1D3QB 1LVMA 2VIDA 1Z1IA 1CA0B 1Y3UA 1J14A 1MAYA 2VIPA 1UCYE 2BTCE 1P3CA 3JZ1B 4X2XA 2UUJB 1VCPA 4AFSA 4NIYA 2R3UA 3S9BA 2P95A 4XSKU 1ESBA 1FPCH 5F8TA 1QJ7B 4GVUA 3NK8A 4UONA 2A5AA 1WUNH 1DY8A 2OQUA 3KL6A 2PTCE 2TGAA 1PPZA 4H6SB 5DP5A 3D65E 1ZTJA 1PQ7A 3SUFA 3MHWU 2PUXB 5LH8A 3Q76A 2H1UA 2BY6X 1BMMH 1T7CA 2VB0A 5TCCA 4E05H 2R9PA 2VH6A 3ZV8A 1K9OE 1TGTA 1EZSC 2ZGCA 1NTPA 1AB9C 2GX4A 1TNHA 2O8TA 4CBNA 1QA0A 1PQ8A 3EGKH 4YOIA 1NU7B 3DHKH 5EXNA 4IMQA 2C4FH 3PB1E 1BJVA 1Y3YA 1NRNH 3E8LA 2QA9E 3V3MA 5C5OA 2XRCA 1P2JA 2BMGB 1K1OA 2B8OH 4Y71A 3ITIA 4AB8A 4CREA 3MH5A 1O3BA 2P8OC 4YZUA 4MNWA 3W95A 3LU9B 1ANDA 4X1PU 2OUAA 3NPSA 1GG6C 1DWBH 3KF2A 1WYKA 1RGQA 2P3UB 1O39A 1O5DH 1UTOA 2CXVA 2Z9GA 5EPYA 3MU1A 1YCPK 3ZVDA 1DSUA 1T8MA 4Y8XA 1QBNA 1UVTH 3SHAH 2HVXA 1HXEH 1YYY1 5C2ZA 1EPTA 4BAHB 1GHAG 2GKVE 1BA8B 1A0LA 3RLYH 2Q6GA 4U2WA 1BB0B 2TPIZ 4ZKRU 1TE0A 1C1TA 2H5CA 2D1JA 4I8KA 3A80A 4CRCA 1TNKA 3EYDA 4YOJA 2FI5E 1FY8E 1C2DA 3EA7A 4WVPE 5HYOA 1V2JT 1P57B 2B5TB 1O2TA 1JRTA 1VR1H 3HPTB 2W7SA 1GBLA 1HAYB 1TGBA 1P2KA 1THSH 2PKSC 2V6NA 4HFPB 1RTLA 1C5QA 3HKIB 1TRNA 3B8JA 3U8TH 2GCHF 1N6YA 2ZC9H 2VVCA 1GL1A 2FS9A 8GCHG 1O5FH 3SV8A 4DG4A 2FMJA 3RU4T 3ZZBA 1ID5H 1WQVH 1AKSB 3PLPA 1AWFH 3MU0A 1P9SA 4CRAA 4IMZA 1V2WT 3V0XA 4I33A 1BITA 1EJNA 1VCWA 1FI8A 2Q6DA 3CENA 5IYTA 2VU8E 3TH4H 1AFQB 1H9LB 4WXIA 3SNAA 1GHVH 3M5LA 1AD8H 1MD7A 3Q3KA 2GVFA 3RXHA 5A0BA 1RTFB 1Z71A 1TA2A 2BX3A 5AFYH 5L2ZH 2G00A 1DOJA 1QTFA 2NU4E 1BBRK 1FDPA 1DXPA 3P92A 3SU5A 1J9CH 1F5RA 2GMTC 2BXTH 2CHAB 2G4TA 4XE4A 1G3DA 2HGTH 1TMTH 5JPMH 1SB1H 3LJOA 4CBOA 2WV5A 3C1KA 5EPNA 4E7NA 4ZMAH 1PJPA 1J8AA 3A8AA 2JH0D 1GBTA 1UTQA 3URDA 1QRWA 1P2IA 2Z94A 1EZQA 1WAYB 1NFXA 1GBHA 3BN9A 4ZUHA 1MTNC 2GD4B 2AMDA 3BTWE 3I29A 2VNTA 4GHTA 1MTNB 1S6FA 4Y11E 4KTCA 2TBSA 2BQWB 1LVYA 2WYJA 1TYNA 1K28D 3ZZCA 1ORFA 1U6QA 1EAIA 3RXQA 2HPQH 3IITA 1K21H 4FUDA 3BTDE 4ZH8A 5E8EH 2JKHA 3I77A 1DUEA 2Z3EA 1DS2E 1O3IA 1P03A 3EAJA 5FX5A 1ZSJA 1V3XA 3CS0A 3RXGA 5GDSH 4ABGA 1V2MT 5ETXA 3ZVEA 2FXRA 1MZAA 1QNJA 3ATKA 1C1QA 5HMAA 1W7XH 4UD9H 5DGJA 3TGIE 1HLTH 1O36A 3GYMA 2ZDLA 3KQCA 1E0FD 4THNH 2AIPA 1ZRBA 3T2NA 1HIAA 1G32B 4MVNA 2FOBA 1GHYH 1KXBA 2H9EH 1KTSB 2ZCKP 1LPZB 2BQ7B 4LXBH 1KXEA 5FPSA 3A8CA 4U01A 3OU0A 1FAXA 3A7WA 1P02A 1EPTC 1SOTA 5JBBS 3JZ2B 3VB3A 3FANA 1L1NA 3UNRA 4MNVA 5EXLA 1QBVH 4ABBA 1ZHMA 1DLEA 5CHAC 1DPOA 3ELAH 3BF6H 5TCAA 3H7OA 4AG1A 5EW2H 2ALVA 2Z3CA 2RA0A 2ZECA 1BZXE 1L4DA 1ZGVA 3MO3A 1BRCE 2H5DA 4K8BA 4ASHA 1KIGH 1MU6B 2ODYB 2ZHQH 2BZAA 3NWUA 4ISLA 1TABE 1EOJA 1KXDA 1P01A 5DP8A 1DM4B 2WINI 5FXLA 1HGTH 2IJOB 4FU9A 1ABJH 4GSOA 1W7GH 3PMBB 1RJXB 1RTKA 1GBDA 3KEEA 2ZHEH 1QQ4A 3MH6A 4KGAA 5C5NA 4RKOB 2O8WA 2NU2E 3A84A 3M7QA 1P2MA 3ATWA 1IQKA 2BD8A 2THFB 1ELDE 5EQSA 1FNIA 1PPCE 2O8UA 3Q3YA 3VB6A 2V0BA 1GWAA 4KKDA 2BY7X 4UFGH 1TALA 4CRDA 1O2IA 4A1VA 1OWEA 4MG3A 3SZNA 1IHTH 1OX1A 1TX7A 1UK3A 1Z8JB 3BTKE 4BXWA 2AGGX 1QBOA 3M5MA 1E38B 2ZNKH 1JIRA 5GJ4B 1A2CH 1K1PA 3LT3A 1BMLA 1T4VH 4FUFA 1O2YA 1BT7A 1GVLA 2ANYA 1S85A 2IOTA 2AFQB 1YPHC 1SFQB 1TNGA 2BDGA 1ETRH 3TH3H 1OWKA 2ZDKA 3BV9B 5DG6A 3ZVFA 1SGRE 1PPBH 3GICB 3SJKA 3PV4A 2BD4A 3GY7A 2H9HA 3A7ZA 5FPTA 2ZTYA 4KELA 1HAVA 1E37B 1XVMA 2F9UA 2FOCA 2BDHA 4NIXA 2Y80A 3RXOA 1ELEE 2BDBA 4DVAU 2A45B 1GHBG 4HI3A 1ELTA 3GDUA 1GI9B 1LVOA 2F9VA 5GPIB 1K1MA 1SMFE 4YT6H 2ZQ1A 1HJAB 1FIZA 2ASUB 2A0QB 1HAGE 1Z8RA 4XBDA 1TQ0B 4I8LA 1LKBA 1K2I1 3VPKA 3O8BA 2FYRA 3G01A 4IC5A 1T32A 4JZDH 3U69H 5I25A 4AOQA 3RXTA 1UMAH 2QF0A 4FUGA 3KQBA 3GCNA 1Y59T 2I6SA 1ANBA 1NFWA 2JETC 3R0FA 1WTGH 1XMNB 4AORA 2JETB 4AYVB 1WQSA 2XWAA 5JB9S 3MH4A 5FBIA 4Q7ZA 3T62A 3ATMA 1BIOA 1DDJA 1W0ZU 4NFEA 1KXAA 1RS0A 4A1XA 2FYQA 5FHTA 3SNBA 4JYTA 4TY7A 1FMGA 2CJIA 2ZU4A 4X0WU 1OPHB 1HAOH 1GHWH 1Y5AT 3VGCC 2FIRH 1BTPA 1GJBB 4XOJA 1O2GH 1AQ7A 1BCUH 2BB4A 2ZFSA 1O3EA 1PPGE 1CA8B 2J2UA 1M9UA 2FI3E 1IQEA 4IS5A 1D9IA 1FN6A 1HDTH 4SGAE 1TONA 5F03A 1C1VH 1LHCH 1TMUH 5A8ZA 1BTWA 3QX5H 1V2QT 1GI5A 1ZOMA 2BOHB 1FXYA 1G3EA 4IBLH 1YPJH 4D7FA 1D3DB 2UUKB 5FAHA 1A46H 1F92A 1YPEH 3TNTA 2AERH 1HAPH 1GJCB 4WH6A 1IQLA 1O2RA 4AZ2B 1BTUA 1BRAA 1GJ7B 4FXGH 4CRBA 2OC7A 1MQ6A 3PLBA 1YCPM 3E3TA 2C8WB 2PFEA 3KCGH 1C1PA 1ZMLA 1CGHA 1H1BA 3PMAB 4MPWA 4JZEH 1QIXB 1EAWA 2BY9X 4B2AA 2WPIS 1P06A 3SJOA 3BTME 1TWXB 3RUOA 2B7DH 2WPMS 1TX8A 3ATIA 4MNYA 4MPXA 4DT7B 2W5EA 3GCTG 2VIOA 4OS5A 1W11U 1ELGA 3L33A 3H5CB 1QQUA 4A6LA 3UIRA 1TIOA 2A4GA 5EQQA 3NZIA 3OY6U 1SQAA 3MNXA 5HM9A 1GJ8B 2FP7B 3OX7U 1EZXC 1NO9H 2ODPA 1JMOH 4ABFA 4NIVA 2NU0E 2HNTC 1GDNA 1L2EA 2VIWA 2A1DB 1GJ5H 4YOGA 2VWLA 1SLVB 1OKXA 1HAVB 1CT0E 2PUQH 2SGDE 2XNIA 1UO6A 1AU8A 1XKAC 1GJ6A 4JK5A 3UREA 2VJ1A 1HB0B 1QB9A 1HXFH 2SNWA 1L4ZA 2EEKA 2TGPZ 3UQVA 4LZ1H 3F9HA 5BRRE 1GHAF 2OQ5A 4D8NA 1MBMA 1VJAU 3LKWA 1NRPH 4AFZA 3SU6A 1C4U2 4NFFA 3L6PA 1SLUB 2J92A 1O3MA 5B6OA 1OYQA 1XUHA 1BTXA 3RC6A 2HNTE 2VIVA 3LGIA 1SQTA 1VZQH 3T5FH 1A3EH 3ZZ7A 4BAKB 3D23A 3SU1A 1EKBB 4XFQA 1C2GA 2Z9KA 1KXFA 2VGCC 1EB1H 5PTPA 1G9IE 3M5OA 2XWBI 5G4BA 3BTHE 3CP7A 1F2SE 3S9AA 4BTUB 2VWNA 2TIOA 6GCHG 1CA0C 1DANH 2CF9H 4DJZB 4H4FA 3BIVH 2O8MA 4Q7XA 3TK9A 4F4OC 4ISNA 3MU4A 2QGRA 2RDLA 1PYTD 4NWLA 3A85A 4O3UA 3ZVCA 2ZP0H 5DP6A 3SJ8A 1V2RT 3DT0H 1H8DH 1GHXH 2W26A 2XC5A 2WUCA 2ZFTA 1AVGH 3FP6E 3AAVA 3SUEA 1O2PA 2ZTZA 2ZFRH 3H7TA 1MKXK 3MWIU 2QYIA 3F1SB 2O8LA 2A5KA 3U8OH 5CMXH 1TGNA 2HPPH 1UVOA 3OSYA 4KTSA 3RM2H 1VITG 5LGOA 3KQEA 2KAIA 1GVZA 1B0FA 2GZ8A 1H9HE 5A8XA 2Z9JA 4I8GA 4CHAB 3DFLA 5A8YA 2J95A 4X2YA 3LC3A 4JYUH 3DA9B 3MH7A 2EI7A 4MNXA 2A4RA 3M3TA 4I7YH 1MQ5A 4OS2A 2GCTC 2A32A 4NA8A 1IOEA 4XDEA 2WYGA 1IAUA 2GCTB 3EE0B 4GPGA 1V2TT 3RMOH 3SN8A 2FTMA 1UVSH 1HNEE 1CBWB 3ENSB 2A7HA 1MKWH 1ZMNA 2F9PA 2HOBA 2GP9B 4X8VH 1DFPA 4K60A 1PPHE 4K69A 1CHOG 1UCYH 2DE8A 4Y76A 3OY5U 2XCFA 3A7VA 2P59A 3F6UH 3IWMA 3M7TA 3UOUA 1J17T 3NUMA 1FLEE 1SL3A 2BHGA 1HCGA 2F83A 3M7UA 2J34A 1LVBA 1EX3A 3ZZ8A 3FVFB 4Y8ZA 1V2PT 1SSXA 1AO5A 1EATA 1T31A 1BRUP 5ESBA 3TPIZ 2ZKSA 1HJ8A 1ZMJA 2DE9A 4XBCA 5E2PA 1ARBA 2A7CA 1FY4A 4NSYA 4X8UH 1GJ9B 3BTFE 2ZZUH 3BTEE 3HATH 2NU3E 3PYHA 2ZPQA 1LDTT 1SG8B 2NU1E 5I46H 3QZRA 1O35A 1O3HA 4UDWH 1ZZZA 1ZHPA 3QTOH 1ELAA 1WCZA 3RXDA 2ZHWH 4X1RU 1A61H 4DW2U 2VWOA 1QL9A 1Z1JA 1P09A 3ZZ4A 1GVKB 1AFQC 2PW8H 2ILNA 1BHXB 1BOQA 3PTBA 1DXWA 4ZXYH 2AEIH 4MPVA 1O2XA 3E91A 1AY6H 4MLFB 2F91A 3UNQA 4Y6DA 1GMCF 2AH4X 3RDZA 4JZ1A 1MTSA 1AE5A 3RXEA 1AI8H 3O8RA 1DWCH 4RN6A 1C5RA 3RP2A 4CR9A 1S81A 1SHHB 3TJOA 3BEUA 1LHFH 1GBJA 2CHAC 3MNSA 3MOCA 5L2YH 3RU4D 1OSSA 1TRYA 1GGDC 3M3VA 5T6GA 2AS9A 3SV9A 2R3YA 1G36A 1O32A 3F9GA 3VXFH 1HPGA 1GGDB 3E16B 1SGDE 4ABJA 1SI5H 3NKKA 2SGEE 3S69A 1GJ4H 5C3NA 4X6OA 1Q31A 1C5WB 1GBFA 2V3OH 2XYAA 2AGEX 1C2MA 1BTHH 1IQHA 1W10U 2BVSH 3E0NB 2C8ZB 2STAE 4AFQA 2HLCA 2R0KA 4WJG2 1C5NH 2PR3A 1O3KA 5BPEA 3SORA 3RXUA 2TGDA 4YESB 2FLBH 1ZYOA 4E7RG 2FZZA 3A89A 4ZROA 4NZQA 1VGCB 1S0QA 2KAIB 5K7RA 1XKBC 1O5AB 2ZG0H 1UJ1A 1DICA 3DD2H 1ZTLA 1F7ZA 4HTCH 5AF9H 1ACBE 3ODFA 3U9AH 2OC1A 1NN6A 3VEQB 1J16A 1C2FA 1EUFA 3U98H 3R3GB 2ZO3H 4NGAH 1DWDH 5EU8A 1P2OA 2ZU2A 2BVRH 4FVBA 4FUCA 1SLXB 1H4WA 4TYDA 4B2BA 2W3KA 1MAXA 1NS3A 1HAHH 3O8CA 1HV7A 1SGFA 3MFJA 4CR5A 1Z6JH 1GHBF 2BY8X 5K0HA 4IN1A 1ELFA 1JWTA 1C1WH 1YGCH 1ARCA 1Q2WA 1L0ZA 3A82A 2XBWA 1CHGA 4IN2A 1FZZA 1HAIH 2A4QA 1WTHD 2GDDA 2RG3A 4K8YA 2RA3A 3TJVA 5A0CA 2BOKA 4LZ4B 2P16A 4MDSA 1IQMA 4YTAA 1O2MA 3ZYEA 4ZXXH 4LOYH 3VXEH 3SQEE 4FUBA 1VITH 2BDCA 1G3CA 3LH3A 3EQ0H 1C9PA 1G2MA 1O33A 5F8XA 2Y82A 3MO9A 4ISHH 3SU2A 4ABHA 1TMBH 1HAZB 2ZGBH 2AYWA 2QV1A 2Z6BD 4JYVH 5GCHG 5AFZH 4X8SH 4AGJA 4LK4A 1C5MD 1KLIH 1H8IH 3EA9A 5E0JA 1SFIA 2BYAX 3S7KB 5LPEA 2XC0A 3RXFA 2J94A 4E06H 2YNBA 1SGTA 3S0NA 1FQ3A 3KNXA 2C3SA 3QLPH 4BNRA 2TGTA 1NRQH 1C5TA 1MCVA 2FI4E 1XX9A 1MKXH 2WPLS 4X2WA 4X1QU 2GDEH 2OD3B 3D62A 1PPFE 4Y7BA 1NROH 3SU3A 1ZPZA 1BTZA 2EC9H 3SUDA 4A1TA 4ISOA 1V2VT 4FU7A 1UK2A 5A2MH 2QXJA 6CHAB 1CE5A 1GL0E 2BD9A