1O36A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
b'IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o36A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o36A02
1RD3B 1C5WB 3SV6A 1BITA 2FM2A 4OS5A 3N7OA 4I8JA 4A1XA 1C1TA 1MZDA 2BDHA 3MFJA 2BY5X 2GT8A 2OLGA 1NU7B 1FPHH 1FY8E 4UDWH 2G8TA 4YOIA 1NO9H 4MPWA 1KXFA 1RRKA 1V2VT 4JYVH 3SNAA 1QB1A 3RXJA 4DCDA 2WUCA 1PPBH 1HAHH 2WPIS 4D7FA 1L1GA 1GGDC 1MAXA 1FN6A 3RXGA 1DUAA 2FS9A 2FOAA 2AERH 1BRCE 3MH4A 1IAUA 1GJ6A 8ESTE 2I6QA 3P95A 3EQ0H 3QZRA 1PJPA 1GJDB 4D7GA 1TGCA 2G4TA 1EATA 1SFQB 1ZMJA 3U9AH 3M5NA 1ZTKA 4INKA 1Z1IA 1O3FA 1ZHRA 2JETB 2VGCC 4KP0A 2A1DB 3Q3YA 4MNYA 2ZTZA 1TX8A 4KKDA 2P8OC 1A2CH 1J16A 1GI7B 3TNTA 4CRFA 2UUKB 2XBWA 3OU0A 1OXGA 2GDDA 3F9HA 4AYVB 1V2KT 4UD9H 2WPJS 1ARCA 4OGXA 2BD9A 3MU0A 1MKWK 2QN5T 1FY4A 1GBAA 1GI8B 3SZNA 1ORFA 3UFAA 4INHA 3QK1A 1KSNA 3OX7U 1TNJA 4UFEH 4YOJA 1DFPA 1WBGB 2GV7A 3I29A 5LPRA 1YPGH 2SGAA 1AWFH 3SU3A 3URDA 2GP9B 3LGUA 3RU4E 1QQ4A 1UCYH 1MTUA 2J2UA 2Z9LA 1HAPH 2Y7ZA 1O2HA 3BTKE 1A7SA 3KNXA 1SQTA 2ZFRH 1ZOMA 1G3DA 1AB9B 3S9BA 2G00A 4Q7YA 1JIRA 3FZDA 3D23A 6ESTA 1DXWA 1EP6A 1QURH 1QB9A 3PTBA 1TLDA 1UK2A 3EYDA 3ODFA 1C5PA 2FX4A 2BD5A 1V2PT 2ZU3A 1PQ5A 5FHTA 1HB0B 3ATMA 1W7GH 2PHBA 3SJKA 1NFXA 3VXFH 2ANKH 1O35A 1O5AB 1NY22 1P3CA 4JCNA 4GVUA 3DD2H 1RTKA 2BB4A 2PKSB 3TITA 1LHDH 1YBWA 2QY0B 1O5FH 4GAWA 1ELDE 1Z6JH 1IQIA 4JK6A 4Y8YA 1O2IA 1A0LA 1W3CA 4VGCC 2CV3A 4YM9A 1SGCA 2AGGX 2BDAA 1DVAH 2A4RA 3V0XA 1GHWH 2I6SA 4B75A 6GCHF 1ETTH 3MWIU 5GPIB 5DG6A 2Z7FE 5AFZH 2V6NA 3ZZBA 3HKJB 1TNHA 4B71A 3ZZ4A 2H5DA 4DGJA 3RXUA 1DWEH 3UNQA 4ABDA 4TYDA 1O3DA 2G4UA 2XBYA 1CGHA 1GGDB 4Y0ZE 3NKKA 1EPTC 1Y59T 4UFFH 3K6YA 1BRUP 3QN7A 4FVDA 3LPRA 3TH2H 1P01A 4R0IA 1C1NA 1NRNH 1P2QA 3ESTA 3F9FA 1GI4A 1MQ5A 1BOQA 3MH7A 1TALA 1HXEH 3EA8A 1ACBE 1BBRK 2H9EH 4A7IB 2HRVA 4O03A 4RKJB 1A61H 3A7TA 1C1OA 1HPGA 4JMYA 1CU1A 2VGCB 4KTCA 1Q31A 1W11U 4B2BA 1SI5H 1TQ7B 2P8OB 4JZ1A 4LXBH 1K9OE 2FOMB 2BYAX 1QIXB 1P2JA 3KQEA 4UFDH 1W8BH 1HJ9A 4NZLA 1O3KA 1RIWC 2VIQA 6GCHG 1ELGA 3ATIA 4MNVA 2FOGA 1BRBE 1HAOH 1GI1A 4OS7A 3QX5H 1EXFA 5EQSA 2FIRH 2FX6A 2FOCA 2IOTA 1J17T 1FY3A 1VITH 4H6SB 5A0BA 4ZXYH 2VVUA 4MPXA 3SQEE 2OC0A 1UTOA 3UY9A 1AQ7A 1NN6A 1FN8A 1MD8A 4MVNA 2PSYA 3QWCH 1ZMNA 3RC5A 1ZZZA 2FI3E 1BRAA 5I46H 1T8MA 2Y82A 2OC8A 4RSPA 2SNWA 5A0CA 5A8XA 2VWMA 1P2KA 1TBZH 3H7TA 3GCTG 1GJ7B 1SPJA 3MYWA 2OTVA 4B76A 1NM6A 1Q3XA 2TGPZ 2XRCA 2Z9JA 1KXAA 2OUAA 2QYIA 1C1WH 3RXOA 1UJ1A 3KL6A 3M3TA 3T62A 4CR5A 1DLEA 1EJAA 1CBWC 1UTLM 1W2KH 4PROA 1P2IA 2FI4E 3E16B 2W5EA 2PR3A 3I77A 1UK4A 1T31A 3SU4A 1GVKB 2BQ7B 1GBBA 1Z8RA 1Z71A 2FP7B 1A1RA 5ESBA 8GCHF 1JXPA 3LGTA 1O2NA 1P12E 2GCTC 1C9PA 2J38A 2NU3E 1VGCC 1YM0A 1D3TB 1V2WT 1KXDA 1FIWA 1IQLA 3A86A 4ZMAH 2WUBA 3E1XB 3OY6U 2CHAC 3GCHC 4IC6A 2Q6GA 5EU8A 1KXBA 4VGCB 3R3GB 1QBOA 1YCPK 3UUZA 3GY4A 4YZUA 5G4BA 2GX4A 3UPEA 1NZQH 1GBIA 1O3IA 2P3TB 1AI8H 2R2WU 3S7KB 2ZDNA 4CRDA 3AAUA 1VCPA 3UREA 2OQ5A 2ZP0H 4I32A 1X7AC 1S82A 2BXUH 1JBUH 3SHAH 1Y5AT 4BXWA 4I8GA 2Z9IA 4GCHF 3U8TH 8KME2 1FV9A 3LDXH 1L1NA 1EPTB 1T4UH 2O8MA 1AFQC 1VZQH 4OS2A 1C5TA 1E38B 4AFQA 2Q1JA 4NIXA 4A1TA 2PGBB 1YLCA 1AU8A 1N8OC 1QJ1B 3W94A 1LO6A 1UVOA 1S84A 1JRTA 1O3GA 1CT4E 2WPLS 1ZSLA 1O30A 1G30B 2ZDMA 3ZZ7A 2SNVA 2FYQA 1KLIH 1SOTA 4XBBA 4H42U 1P06A 2B9LA 2CMYA 5A8ZA 3KGPA 4E7NA 1NRSH 2ZFTA 3BF6H 3L6PA 1F92A 5DPAA 4ABFA 1EAIA 1TMBH 2Y5FA 1GI0A 1RIWB 1EX3A 1O2WA 1KLTA 1LVBA 2ZECA 2XC5A 4XSKU 1GBHA 3NUMA 4Y8XA 3MHWU 4NA9H 5F8TA 1TA2A 3BTHE 1GMHF 1GBDA 1ZJDA 1H4WA 2PTNA 3RLWH 2GZ7A 4BNRA 2H2ZA 1BT7A 1O33A 3EDXB 2FLBH 1C5VA 3BV9B 1E34B 3NCLA 4CH2B 1THRH 1LCYA 2EA3A 4FUFA 1CGJE 4GHTA 5A0AE 1G2MA 4NIVA 1C5NH 3GDVA 2F9NA 2AMDA 1BTYA 3PB1E 2P3FH 3G01A 3A8BA 5JBBS 2H1UA 1CGIE 1P2MA 3K65B 1NU9A 1G37A 4IN2A 3A84A 3T26A 4ISNA 2Z3EA 1HDTH 1TB6H 1ZJKA 1HAVA 1A0JA 4FUGA 1HGTH 2ZZUH 3Q3KA 2UUJB 3QGJA 1GBEA 2BDIA 1DXPA 1CBWB 2JKHA 3ZVCA 1F0RA 4WMEA 3SU6A 2BDCA 4AB9A 4OS4A 1QHRB 2OINA 5HM2A 4DT7B 1ESBA 1VGCB 3FP8E 4MNXA 1GMHG 1ZPCA 3VGCC 2ZDVH 2BD3A 2CHAB 1A0HB 1TPAE 1XUGA 1PPCE 1TBRH 2LNCA 3GY7A 4NSVA 3V13A 1ZLRA 2FYRA 3A7VA 5JDUB 1C2FA 1NFUA 5FX5A 3P6ZB 3UTUH 3GYMA 1NESE 3NPSA 4NCYA 4M7GA 4NGAH 3A88A 1QR3E 3SGQE 4AFZA 3MH6A 3RXAA 5CHAC 1C2DA 2G52A 2HVXA 3PV4A 4ZHLU 1W12U 1MH0A 2O8UA 4FUEA 2XNIA 4K5ZA 1THPB 1AE8H 3QUMP 5T6DA 1EB2A 2D26C 1TRNA 4R8TB 1EKBB 1SC8U 1ID5H 1IQMA 1GHAG 1S0QA 4YT6H 2VIDA 3HKIB 4B73A 2FOBA 4MNWA 1KXEA 1BJUA 1OWEA 1P9UA 3HGPA 2QCYA 1TNIA 1EAXA 2ZTYA 1GMDF 1O3NA 1N8OB 3UWJH 2QXHA 3SNCA 4FU8A 3GOVB 1TX7A 3SV9A 1RS0A 1UK3A 2BY8X 1SL3A 2HNTE 1C2HA 1OOKB 2BQWB 1PPZA 2ZTXA 1V6DA 1NTPA 1E0FD 1BDAA 1YPEH 3Q76A 3HPTB 1HJ8A 4IW4E 1QBNA 3M5LA 4XE4A 1TPSA 2J4IA 2NU4E 3ATLA 2AIQA 3PTNA 2Y80A 3AAVA 2BVSH 5DP7A 1ELCA 1J15A 1O3CA 3EGKH 1O3HA 4KTUA 3SW2B 2OP9A 1CHOF 3P17H 3A7ZA 1L1JA 3TGKE 1EJNA 3ZYEA 1FY1A 2Q6FA 5GWZA 1TYNA 2GGVB 5F6MA 1Y3WA 2HWLB 1C1UH 2FLRH 3A8AA 1O34A 1MTSA 2XBXA 1E35B 3SNEA 5FBEA 1V2OT 2GZ9A 5JBTA 3A81A 2UUFB 1TPOA 2A7CA 1AVXA 2BM2A 3P70B 1AZ8A 2V35A 4ZKSU 2ZGJA 3QZQA 4YT7H 1SGFG 2ZCHP 1BMAA 5EODA 3OYPA 2PKAA 1A4WH 5H4IB 2O8LA 4BXSA 2ZWLH 5FAHA 5E0GA 3BTQE 2A5IA 3TNSA 2QXGA 3RXLA 2ZHFH 3T27A 2BOKA 4NFFA 2C3SA 3RMNH 2OQUA 4WF8A 1TQ0B 2ZO3H 3RXDA 2BMGB 5ESTE 1GHYH 4ABBA 1YCPM 5EXNA 2UUYA 2ZU5A 3VGCB 1VR1H 2XXLA 3T5FH 3L33A 1F5KU 1DWDH 2FZZA 1CHOG 2GTBA 5C5OA 3PWBA 4K60A 2QF0A 3ZZ8A 1SG8B 1OYQA 1DS2E 4RN6A 1K22H 4GSOA 1ZRBA 3KEEA 1D3PB 2ZGHA 4IBLH 2UWPA 1KDQA 3SV2H 1EB1H 4A5TS 2OXSA 2ZDKA 5CHAB 1SGTA 3MTYA 1GBFA 6CHAC 1CE5A 4BAQB 4X1RU 1O2RA 2ZNKH 3FP7E 3O8DA 3U8OH 1OS8A 2A2QH 3V3MA 1GBLA 2ZFSA 1CQQA 4CH8B 1JIMA 4HFPB 2VNTA 4FVBA 5C20A 1HBTH 5AHGH 4E06H 1S6HA 1ZMLA 4B2AA 1O5CB 2XBVA 3F1SB 1O3EA 3W95A 1DLKB 1GG6C 1UVSH 1AMHA 4GPGA 1H9HE 4YLUA 5AF9H 1P2NA 3P8NA 5FX6A 3UQVA 1PPHE 1G3EA 4BAHB 3SUDA 1AWHB 4BAOB 3U8RH 1UTPA 1CA8B 1MCTA 2QIQA 4ASHA 2R0LA 5C1XA 4D76A 2VIWA 2V0BA 4ZKOU 1XUFA 4QT8C 3HGNA 5EPYA 4K3JA 2CF9H 1TOCB 1D9IA 2GKVE 2FWWA 1DWCH 1S81A 3KIDU 1E37B 1DDJA 4WMDA 1GI6A 3GY5A 2IPHA 1ELFA 3A87A 3SORA 1D3DB 3M5OA 1SR5C 1SLVB 1OYTH 4Q7XA 1ESAA 1MU8B 1TRMA 1VITG 1BHXF 2XWAA 2PKAB 1MMJN 1EZUC 3T28A 4ISOA 1DICA 1B0EA 1PQ7A 3LC5A 2ZHWH 5JYIA 1DY8A 1O2KA 4ISLA 1BTXA 1OWIA 3TGIE 3AASA 1MTWA 2CF8H 1HRTH 3RXEA 1OWKA 1LDTT 1O2GH 3BEFB 1XMNB 2HGTH 1ZGIA 2A4OA 1TNLA 2XCNA 7ESTE 2EI8A 1GI2A 1OP0A 4CHAC 1N1LA 1FZZA 5EXLA 3FP6E 1HIAB 4DURA 2A0QB 1QQUA 1SGQE 5T6GA 1IQHA 1KXCA 1C9TA 2P95A 2BXTH 3GY2A 2ZA5A 4WH8A 4WMFA 1KDQB 1FIZA 3H5CB 3VB4A 1F5LA 1XVMA 3QTVH 1YPLH 1SGYE 4WWYA 2ZU1A 1AIXH 3RC4A 1Z1JA 4K8BA 4X8SH 4X0WU 1O5EH 5E8EH 5CMXH 2M5TA 1XVOA 3C27B 1SFIA 4ZUHA 3KQBA 3TH3H 1NFWA 1UVUH 3SQHE 2SGFE 1AY6H 1ZRKA 3VXEH 5DP8A 5HGGA 1O2PA 3O8CA 1BMLA 1THSH 5A8YA 1XM1A 4ABJA 2FEQH 3SU0A 3ZVAA 1KTSB 3M37A 1FNIA 1UMAH 1L4ZA 1XUJA 4O97A 3TU7H 2TRMA 2Z9KA 3M7TA 1WCZA 1QTFA 1P04A 2AGEX 3T29A 4ZROA 3U1IB 1QRXA 3E6PH 4WXIA 1YF4A 5JBCS 2BLQA 3EE0B 1QBVH 2BD2A 3RP2A 3M5MA 3SV7A 1YLDA 2NWNA 3M3SA 2W26A 1C2JA 5LPFA 1GJ5H 1JOUB 1SHYA 1O2MA 7GCHG 1BHXB 1HYLA 1BBRE 3DFJA 1QFKH 2J95A 4D8NA 3GCOA 3IITA 6LPRA 5EW1H 3GCTF 2XTTB 4CRAA 1O36A 4NSYA 1C4Y2 2C4FH 1B5GH 1MTNC 1SMFE 3KHVA 5HMAA 4A1VA 5DP4A 3VB7A 1GBKA 2ODYB 3HK6B 1EPTA 1SBWA 1GHVH 1MZAA 4IMQA 1MD7A 3BTEE 1LKBA 1P3EA 1A46H 2ZQ1A 1Y3XA 3SV8A 4A92A 5E2OA 3SOSA 2Z6BD 3BIVH 2ZGXH 4NWKA 2PGQB 3FZZA 4DJZB 2WINI 4SGAE 1NRRH 1Q2WA 1NFYA 5IYTA 1AUJA 5C5NA 1NT1A 2EEKA 4X2VA 3TH4H 1DSTA 1QRWA 3MU1A 1F0SA 3V12A 1TWXB 1C2MA 1MBQA 3RXQA 2JH0D 4U2WA 4YESB 1O3OA 3EAJA 1O3JA 1CO7E 1T32A 2FESH 1GHXH 2C8ZB 2R0KA 3A82A 1K1NA 4NG9H 1EUFA 3ZZ6A 1WTHD 5HXFA 4Q7ZA 1GHBF 2XWBI 4CHAB 2FO9A 1O2UA 1AHTH 3JZ2B 3SHCH 2XW9A 1DOJA 4DW2U 1TOMH 3ZVGA 1K2I1 3KF2A 2ZIQH 3ZVFA 2ZCKP 2C90B 1P0SH 1WTGH 4CREA 3ZVDA 5F8ZA 3M7UA 3VB3A 3BTTE 1DE7H 1O2OA 3BTFE 4Y10E 1AFEH 1G3CA 1GVLA 1BA8B 1QJ7B 2GCHF 4IS5A 1P02A 1YGCH 4IC5A 1ARBA 2CGAA 2ULLA 3FVFB 1UTJA 2VH6A 2SGPE 1QL7A 4ZAEA 3LT3A 3SI4H 3PLPA 1SOZA 1QL9A 3B9FH 3HK3B 3PO1C 1BTUA 1RTLA 1V2JT 3A7YA 1GHBG 2BHGA 4I7YH 3MO6A 4CR9A 1KIGH 5JBAS 2TIOA 3P92A 2LPRA 4WVPE 1HAYB 3M36A 4Q80A 3MNXA 3CENA 2G55A 1GBCA 1RXPA 3OSYA 5A09A 1EP5A 2EI6A 5LGOA 2PUXB 1P09A 1HAZB 2C8YB 3ZVBA 4MPVA 2P93A 1C5OH 1O3LA 2W7SA 4GHQA 1TMTH 1O37A 3MMGA 3KN2A 4XBCA 3TJOA 1IHSH 4HGCA 4X6OA 4DVAU 4K8YA 3ZZ3A 1MKWH 4LK4A 1F5RA 1DUEA 2O8TA 3STIA 3GY3A 1GBTA 3SO3A 2BD8A 3ZYDA 4D9QA 3C1KA 1MTNB 2ZQ2A 3RXRA 2OC7A 2UWLA 1TNGA 1PPFE 2GCHG 2GVFA 2ZI2H 3L3TA 5EQQA 3BN9A 4TPYA 1TGTA 1K28D 4GLYA 2RG3A 2ZKSA 1FY5A 3KQDA 5FCKA 3RXSA 2AMPA 3LGWA 5K0HA 3MNBA 2FPZA 2WV5A 1O2ZA 4J2YB 5FXLA 1A5GH 1TA6A 4FUBA 1BTWA 2F91A 1GVZA 1UTQA 4AFUA 1OPHB 1OX1A 1OWHA 1AUTC 4HI3A 1HAGE 4NFEA 1C5XB 3PMHB 3PM3A 4ABGA 1GL1A 1MTVA 2OD3B 4H6TA 1EAUA 3PMAB 1ETRH 5AFYH 1HUTH 3MO3A 1C2GA 3ENSB 1QB6A 2FS8A 2PWXA 2ZDAH 3ZZAA 4AFSA 2OBOA 1K1MA 3ZZ9A 1B7XB 1OWJA 2BX4A 3S7HB 3VB5A 3BEUA 5FPTA 4ZKNU 1UTNA 1UHBA 1O5GH 1HLTH 2W7UA 3SBKA 1D3QB 3A7WA 1GHAF 2RCEA 3SN8A 2BX3A 2BLVA 2WPMS 1G2LA 2DE9A 3CS0A 4I31A 1EJMA 1H1BA 1TMUH 3MNSA 3AVZA 1QJ6B 4O3UA 1Y5UT 2GCTB 3TIUA 3CS7A 1HXFH 2AGIX 4OS1A 1SGEE 1ZHPA 2R3UA 2ANYA 2VIVA 4F4OC 5JPMH 1VCQA 1W13U 3GCHB 1KY9A 2H6MA 1WAYB 1AVWA 3JZ1B 2B0FA 3PWCA 1TIOA 2A7JA 4I8KA 2J92A 2FODA 1PYTC 4RKOB 2F9UA 2ZEBA 3PO1B 1C2EA 1IQKA 1SVPA 5I25A 2WYJA 2ZHDA 5EXMA 2ASUB 5EG4A 1ZPBA 5IDKA 1BBRH 1ZSKA 1MQ6A 1C2IA 1ELBA 1ANBA 1NS3A 3MU4A 5C2ZA 4FUDA 1FUJA 1KLJH 4O9VA 4ABIA 4NIWA 3K2UA 1W0ZU 1MUEB 1ZR0A 1UCYK 1GMCF 1P03A 1AFQB 2AH4X 1BCUH 1SGFA 1C2LA 2NU0E 1GHZA 3DFLA 3MO9A 3MU8A 5TCCA 1K1OA 1JMOH 4U32A 1YKTA 3A8DA 4X1NU 2TGDA 2SGEE 3LH3A 1OP2A 4Z6AH 1IQFA 2P59A 3ZZCA 1C1MA 2FI5E 4HZHA 1ABJH 1XX9A 3GCNA 2NU2E 4YTAA 5L2YH 1F0UA 5J4QA 1HAIH 3RMLH 2BD7A 1DSUA 1T4VH 4O3TA 2ESTE 1GCTC 5CE1A 1E36B 3PLBA 3ZV9A 3PMBB 1B0FA 4FU7A 4FUJA 2KAIB 3RXPA 1O39A 3SGAE 4AG1A 3GDUA 4MTBA 2P94A 1O3AA 2HNTC 1V2ST 3ITIA 1FXYA 1Z8JB 4F49A 3OY5U 1EOJA 3CP7A 1TGBA 1CT0E 1SLWB 4X8UH 1GDQA 3SI3H 1GMCG 4MG3A 1LHEH 2F9PA 3ODDA 1UHBB 1Y3VA 4Y11E 2YNBA 1DITH 4XBDA 1P10A 2BZ6H 2VIOA 4ISHH 3RDZA 3ZVEA 1G9IE 3E0PB 4DIHH 2B7DH 3UWIA 4TPIZ 3VEQB 1PPGE 2SGQE 4DIIH 3PMJA 4AGKA 3TLOA 3QTOH 1QY6A 5PTPA 1L0ZA 3RXBA 1NRQH 1T8NA 1ELAA 4INLA 1SGDE 1ANDA 1YCPH 3M61U 5GXPA 5LH8A 3NXPA 1D4PB 1K1PA 3URCA 2A45B 1GDNA 1ZYOA 1BMMH 1YPHE 1AVGH 3ELAH 1ABIH 3H7OA 2STBE 2ZC9H 4ZHAA 1Z8GA 1C5RA 3LGYA 5F03A 1HFDA 4D9RA 1BJVA 1H8DH 3TGJE 3FAOA 2FOEA 1RFNA 4SGBE 1L4DA 3K9XB 3HATH 1SB1H 1HIAA 1WUNH 1M9UA 3D49H 2ZFPH 4CBOA 1MBMA 1V2LT 3BTDE 2F9OA 5EOKA 4BTTB 3QGNB 2BVRH 2NU1E 4CRGA 3RC6A 1Y3YA 5DP3A 3TK6A 1ANCA 3K6ZA 2W3IA 4X1QU 1N6YA 4CRCA 1O2SA 4OS6A 4Y7BA 1MKXH 1TRYA 2CJIA 2Z94A 1C1PA 2ZG0H 4UFGH 5LPEA 2OBQA 3UIRA 2H5CA 2PTCE 1C1VH 5DP9A 5L6NH 3SNDA 1VCWA 1KTTB 1VITF 1A5IA 2FTMA 1CHGA 3P8GA 3E0NB 2QC2A 1IQNA 4I33A 3FANA 4AOQA 3TJNA 1XKBC 1C5SA 1PQAA 4FXGH 4DOQA 4MQAA 1FAKH 1DT2A 2F83A 3EA7A 1KYNA 1QRZA 1OSSA 3UR9A 4MPUA 5DP5A 1SSXA 2VINA 2DE8A 5DGJA 1QGFA 1GCTB 1JWTA 2GD4B 2ZPRA 1TBQH 3A89A 3PLKA 1HJAC 3ZV8A 4FU9A 2H9HA 4X2XA 5L2ZH 3M3VA 1NRPH 3GDSA 3PROA 1S6FA 3DUXH 3ZZDA 1O3PB 1S0RA 1TGNA 1TE0A 4X8TH 1H9LB 1FJSA 3RXFA 4FUIA 2CN0H 1W0YH 4Q2KA 1P57B 1JRSA 3BEIB 3NZIA 1V2MT 1HAXB 4ZH8A 3U98H 4TY6A 1NC6A 1BB0B 1FPCH 3MH5A 3PYHA 3F9EA 1WSSH 3GYLB 4X2WA 3BG8A 2RA0A 1V3XA 1QA0A 1AD8H 5HYOA 2WPKS 1GWAA 1YP9A 2ZGCA 2G81E 4Z0KA 1FAXA 1DX5M 4WJG2 3SU5A 1H9IE 3LU9B 2ZPSA 4XFQA 2EC9H 1A3EH 5T3HA 4AN7A 1W10U 2ANWA 2IN2A 4H4FA 5DJ7A 2XYAA 3EA9A 4THNH 5ABWA 2D1JA 1EZQA 3SGBE 1SGPE 1OKXA 4ZXXH 1ESTA 1UTKA 3F6UH 4TWWA 5SGAE 1WYKA 2VWNA 3SU2A 2TBSA 4KTSA 1LHGH 1SLXB 3S9AA 2ODPA 7GCHF 4AZ2B 2BOHB 3OTJE 3UR6A 4B2CA 3T2NA 1U6QA 2C8WB 4MLFB 3UNSA 3UNRA 1K1JA 2FDAA 1IQJA 1TFXA 3BIUH 4Y71A 1A5HA 5EW2H 1ELTA 2HALA 2XC0A 1AKSB 2PV9B 2QXIA 2YOLA 3R0FA 3BTGE 1SHHB 1SQOA 6CHAB 4TWYA 3S0NA 1O5DH 2Q6DA 2O8WA 1TAWA 1GDUA 1GBMA 1BMNH 1O2QA 2A31A 3VFEA 3BTME 1C4U2 1O2TA 3RU4T 1FQ3A 5TJXA 4JYTA 2G5NA 1O3BA 1A3BH 3DA9B 3MI4A 2A7HA 1UVTH 1GG6B 2A2XH 2ZF0H 1V2RT 1FLEE 1LMWB 1DPOA 4BAKB 1ANEA 4X1PU 1QNJA 3STJA 1P11E 3BTWE 3RXKA 4K2YA 5HM9A 3LH1A 4JZDH 3LGIA 5A2MH 3P8FA 1N6XA 1LHCH 5T6FA 1TNKA 2THFB 4X6NA 1G3BA 1HJAB 7LPRA 5DK1A 7KMEH 5E2PA 2STAE 1LVMA 1K1IA 5F8XA 1O2JA 4LOYH 4K1TA 2SGDE 2AEIH 4JZIA 4ABEA 2BTCE 1K1LA 2FOHA 4AX9H 1V2TT 5FCRA 3V7TA 3UQOA 2ZU2A 1TX6A 1CVWH 1GCDA 3A83A 2PUQH 2ZPQA 2Z3DA 2G51A 2Y6TA 2ALPA 3GICB 5C67A 2GZ8A 2ALVA 4A6LA 2R3YA 1Y8TA 4UE7H 1AZZA 4E05H 1NROH 1BTZA 2Y5GA 1IQGA 3U1JB 1C5UA 2A5AA 1BUIA 3SUFA 1GPZA 2C8XB 1BTPA 1HV7A 1PFXC 5K7RA 1SLUB 1O2LA 3RXTA 2J94A 1MCVA 1PYTD 2VB0A 1AN1E 2VH0A 3S69A 1O2YA 2BLOA 1Y3UA 1C5ZB 1CT2E 5EPNA 4AG2A 2ZDLA 1J14A 1S5SA 1DANH 2Z9GA 1EOLA 2BY6X 4ZKRU 3MOCA 2PFEA 1GJAB 2H9TH 2Y7XA 3IG6B 1BIOA 3A85A 5C1YA 3RMOH 5C3NA 1D6WA 1C1QA 4BTIB 1G32B 4XOJA 2BDYA 3QO6A 4I8HA 4Y79A 5FPYA 3F68H 1O2VA 2ZFFH 1GBJA 2WPHS 3Q3XA 1GI3A 3E91A 1V2NT 5EQRA 1LVOA 3RXIA 5GCHF 1CSOE 2Z3CA 1Z7KA 3VB6A 3TPIZ 2QA9E 4LZ1H 1YPKH 2K1QA 2P16A 1O32A 2B5TB 1BQYA 1QA7A 2VIPA 1XUIA 3SUEA 3UOPA 4X6PA 2JH6D 3RXCA 4NA7A 2FOFA 3LONA 2IJOB 4YOGA 4FUCA 5JB9S 1C1RA 1CA0C 1O5BB 1EASA 1EZXC 2F9VA 4X2YA 3AW1A 5DP6A 1GI5A 4MDSA 5JB8S 1TPPA 4AORA 3LC3A 4FUHA 3U69H 3LKWA 3TJVA 1UO6A 5C1UA 3P8OA 3KQCA 5AVDA 1XKAC 1C2KA 2XCFA 4KELA 1O2XA 3O8RA 1V2UT 2UWOA 5B6OA 3DHKH 2R2MB 1ELVA 1UTMA 1EZSC 2QF3A 4WH6A 1XUHA 3LOXA 3RMMH 2GT7A 3E3TA 2Y81A 1LTOA 1Z8IB 1S85A 5EGMA 2FXRA 5GCHG 2A4QA 1EAWA 2HPPH 2PSXA 1J9CH 4B74A 3QDZB 8GCHG 1OWDA 3QLPH 2Y5HA 4NA8A 1ZSJA 9ESTA 1MKXK 2VWLA 3GISB 1J8AA 2F9BH 3BG4C 5L30H 2BDGA 1YYY1 5J4SA 2DUCA 2FMJA 3KCGH 3LGVA 4GUXA 2TGAA 1SGRE 1SGIB 2VU8E 3RLYH 1Y5BT 2KAIA 4BTUB 4NZQA 4E7RG 3NWUA 1AGJA 2GMTC 3ATWA 4Y76A 2AMQA 2JH5D 5GJ4B 3VPKA 4ESTE 2TPIZ 4CBNA 1H8IH 5TCAA 2P3UB 2ZU4A 1ZHMA 2W3KA 4GCHG 1INCA 1P8VC 1EQ9A 1WV7H 2BVXH 3TK5A 2A5KA 3GY8A 1O38A 4BANB 3A80A 3I78A 2BZAA 2R9PA 4U30A 2ILNA 3RXMA 3SJOA 2PLXA 2AYWA 4U01A 1AO5A 3RXVA 4BOHA 1TABE 1HNEE 1P9SA 2BD4A 4JZEH 4BAMB 3T25A 4ZHMU 1FONA 1UVPA 3RM0H 2ZHEH 2YNAA 2BLWA 2F3CE 4K1SA 2WYGA 2VVCA 4Y6DA 1ZTLA 3RUOA 4IGDA 4YLQH 3ZZ5A 3SJIA 2BY7X 1DWBH 1F0TA 2VJ1A 1P2OA 3M35A 3D62A 4HTCH 3A8CA 1C5MD 2O9QA 1UCYE 3MNCA 1C1SA 1WQVH 3O8BA 3F9GA 1CA0B 1VJAU 2D8WA 5GIBA 1LPKB 1LPZB 2A4GA 2V3HH 4J1YA 1ZGVA 3LJJA 1LKAA 1IHTH 1MU6B 1SQAA 1GL0E 3B8JA 4DY7B 1DM4B 2ZHQH 4X8VH 1RGQA 4TY7A 1F2SE 1GJCB 1O31A 1XUKA 3DT0H 3RM2H 2BDBA 1F7ZA 4IMZA 2BQ6B 1MAYA 1T7CA 3LIWA 1ELEE 1BZXE 2CXVA 2AFQB 5DO4H 1QCPA 4YO9A 1YC0A 2PW8H 1WU1A 2V3OH 2J9NA 1WOFA 4Y0YE 4K69A 1AE5A 1HCGA 3AW0A 3NK8A 2AIPA 4AB8A 4ABAA 1FDPA 2OCVB 2GV6A 4KGAA 2D2DA 3E8LA 4LZ4B 3BG4B 5E0JA 4AGJA 1C5QA 2ANMH 2WV4A 4AYYB 1YPMH 2G5VA 3RU4D 3RXHA 1Z6EA 2VWOA 4I8LA 4XDEA 1PPEE 1TGSZ 3BSQA 3SUGA 2GMTB 2C93B 1GJ4H 2JETC 1LQEA 3TK9A 2ODQA 2BY9X 2J34A 2OC1A 4X6MA 3IWMA 1S83A 4IN1A 4K1EA 5FPSA 2ZGBH 4DG4A 3LJOA 1RJXB 3SJ9A 1XXDA 1HAVB 1ZPZA 3TJUA 3SJ8A 2HNTF 1PQ8A 1LPGB 1GJ8B 3MU5A 3E90B 3Q77A 4JYUH 2ZCLP 1LHFH 1BTHH 2FTLE 5ETXA 1GMDG 2A32A 1O0DH 4UEHH 3B23B 4NWLA 4OGYA 1C5LH 1GI9B 1QL8A 2SFAA 4B1TA 2B8OH 2GDEH 5E0HA 2EI7A 2RDLA 3SNBA 2XC4A 2RA3A 1YPJH 3M7QA 1IOEA 4X1SU 1DY9A 1IQEA 2HOBA 3TVJB 1NPMA 2HPQH 3WY8A 3UOUA 1P05A 3D65E 4Y8ZA 4JZFH 9LPRA 2QV1A 1YPHC 1K21H 1LVYA 1FMGA 4Y7AA 1OP8A 3FFGA 1AB9C 1V2QT 4WXVA 4WY3A 4JK5A 1SGNE 5BPEA 5GDSH 4UONA 1T8LA 1L2EA 2ZFQH 1ZTJA 2QAAA 1C5YB 1WQSA 8LPRA 1O3MA 1W7XH 3Q00A 1G36A 1LQDB 1GJBB 3GY6A 5DKMA 1RTFB 2QGRA 1VJ9U 1TONA 5FBIA 1C4V2 1D6RA 1ETSH 2HLCA 4ABHA 1XXFA 1AKSA 2PKSC 3SU1A 2VVVA 2TGTA 3ATKA 1FI8A 4CRBA 5BRRE 2QXJA 3S9CA 4NIYA 3A7XA 4ISIH 1T8OA 2AS9A 1W14U 1GJ9B
chains in the Genus database with same CATH superfamily
1RD3B 2JIZD 1C5WB 3SV6A 1BITA 2FM2A 4OS5A 3N7OA 4I8JA 4A1XA 1C1TA 1MZDA 2BDHA 2L6OA 3MFJA 2BY5X 2GT8A 2OLGA 1NU7B 1FPHH 1FY8E 4UDWH 2G8TA 4YOIA 2M2AA 1NO9H 4MPWA 1KXFA 1RRKA 1V2VT 4JYVH 3SNAA 1QB1A 3RXJA 4DCDA 2WUCA 1PPBH 1HAHH 2WPIS 4D7FA 1L1GA 1GGDC 1MAXA 1FN6A 3RXGA 1DUAA 2FS9A 2FOAA 2AERH 1BRCE 3MH4A 1IAUA 1GJ6A 8ESTE 2I6QA 3P95A 3EQ0H 3QZRA 1PJPA 1GJDB 2LP6A 4D7GA 1TGCA 2G4TA 1EATA 1SFQB 1ZMJA 3U9AH 3M5NA 1ZTKA 4INKA 1Z1IA 1O3FA 1ZHRA 2JETB 2VGCC 4KP0A 2A1DB 3Q3YA 4MNYA 2ZTZA 1TX8A 4KKDA 2P8OC 1A2CH 1J16A 1GI7B 3TNTA 4CRFA 2UUKB 2XBWA 3OU0A 1W0JD 1OXGA 2GDDA 3DSOA 3F9HA 4AYVB 1V2KT 4UD9H 2WPJS 1ARCA 4OGXA 2BD9A 2K8IA 1MKWK 3MU0A 2QN5T 1FY4A 1GBAA 1GI8B 3SZNA 1ORFA 3UFAA 4INHA 3QK1A 1KSNA 3OX7U 1TNJA 4UFEH 4YOJA 1DFPA 1WBGB 2GV7A 3I29A 5LPRA 2F43B 1YPGH 2SGAA 1AWFH 3SU3A 3URDA 2GP9B 3LGUA 2EY4C 3RU4E 1QQ4A 1UCYH 1MTUA 2J2UA 2Z9LA 1HAPH 2Y7ZA 1O2HA 1YWUA 3BTKE 1A7SA 3KNXA 1SQTA 2ZFRH 1ZOMA 1G3DA 1H8ED 1AB9B 3S9BA 2G00A 4Q7YA 1JIRA 3FZDA 3D23A 6ESTA 1DXWA 1EP6A 1QURH 1QB9A 3PTBA 1TLDA 1UK2A 3EYDA 3ODFA 1C5PA 2FX4A 2BD5A 1V2PT 2ZU3A 1PQ5A 5FHTA 1HB0B 3ATMA 1W7GH 2PHBA 3SJKA 2EQNA 1NFXA 3VXFH 2ANKH 1O35A 1YY3A 2HVYB 1O5AB 1NY22 1P3CA 4JCNA 4GVUA 3DD2H 1RTKA 2BB4A 4YXWD 2PKSB 3TITA 1LHDH 1YBWA 2QY0B 1O5FH 4GAWA 1ELDE 1Z6JH 1IQIA 4JK6A 4XRNA 4Y8YA 1O2IA 1A0LA 1W3CA 4VGCC 2CV3A 4YM9A 1SGCA 2AGGX 2BDAA 1DVAH 2A4RA 3V0XA 1GHWH 2I6SA 4B75A 6GCHF 1ETTH 3MWIU 5GPIB 5DG6A 2Z7FE 4F48B 5AFZH 2PP6A 2V6NA 3ZZBA 3HKJB 1TNHA 4B71A 3ZZ4A 1BMFD 2H5DA 4DGJA 5B6LA 3RXUA 1DWEH 3N99A 3UNQA 4ABDA 4HG6A 2HLDD 4TYDA 1O3DA 2G4UA 2XBYA 1CGHA 1GGDB 4Y0ZE 3GS9A 3NKKA 1EPTC 1Y59T 4UFFH 3K6YA 1BRUP 3QN7A 4FVDA 3LPRA 3TH2H 1P01A 4R0IA 1C1NA 4FETA 3AK5A 1NRNH 1VKYA 1P2QA 3ESTA 3F9FA 1GI4A 1MQ5A 1BOQA 3MH7A 1TALA 1HXEH 3EA8A 1ACBE 1BBRK 2H9EH 4A7IB 2HRVA 4O03A 4RKJB 1A61H 3A7TA 1C1OA 1HPGA 4JMYA 1CU1A 2VGCB 4KTCA 1Q31A 1W11U 4B2BA 1SI5H 1TQ7B 2P8OB 4JZ1A 4LXBH 1K9OE 2FOMB 2BYAX 1QIXB 1P2JA 3KQEA 4UFDH 4AC9A 1W8BH 1HJ9A 4NZLA 1O3KA 1RIWC 2VIQA 6GCHG 1ELGA 3ATIA 4MNVA 2FOGA 2KZ4A 1BRBE 1HAOH 1GI1A 4OS7A 3QX5H 1EXFA 5EQSA 2FIRH 2FX6A 2FOCA 2IOTA 1J17T 1FY3A 1VITH 4H6SB 5A0BA 4ZXYH 2VVUA 4MPXA 3SQEE 2OC0A 1UTOA 2WHXA 3UY9A 1AQ7A 1NN6A 1FN8A 1MD8A 4MVNA 2PSYA 3QWCH 1ZMNA 3RC5A 1ZZZA 2FI3E 1BRAA 5I46H 1T8MA 2Y82A 2OC8A 4RSPA 2SNWA 5A0CA 5A8XA 2VWMA 1P2KA 1TBZH 3H7TA 3GCTG 1GJ7B 1SPJA 3MYWA 2OTVA 4B76A 1NM6A 1Q3XA 2TGPZ 2XRCA 2Z9JA 4P00A 1KXAA 2OUAA 2QYIA 1C1WH 3RXOA 1UJ1A 3KL6A 3M3TA 3T62A 4CR5A 1DLEA 1EJAA 1CBWC 1UTLM 1W2KH 4PROA 1P2IA 2FI4E 3E16B 2W5EA 2PR3A 3I77A 1UK4A 1T31A 3SU4A 4P02A 1GVKB 2BQ7B 1GBBA 1Z8RA 1Z71A 2FP7B 1A1RA 5ESBA 8GCHF 1JXPA 3LGTA 1O2NA 1P12E 2GCTC 1C9PA 2J38A 1VGCC 2NU3E 1YM0A 1D3TB 1V2WT 1KXDA 1FIWA 1IQLA 3A86A 4ZMAH 2WUBA 3E1XB 3OY6U 2CHAC 3GCHC 4IC6A 2Q6GA 4XD7D 5EU8A 1KXBA 4VGCB 3R3GB 1QBOA 1UW7A 2IPQX 1YCPK 3UUZA 3GY4A 4YZUA 5G4BA 2GX4A 3UPEA 1NZQH 1GBIA 1O3IA 2P3TB 1AI8H 2R2WU 3S7KB 2ZDNA 4CRDA 3AAUA 1VCPA 3UREA 2OQ5A 2ZP0H 4I32A 2K0QA 1X7AC 1S82A 3FO8D 2BXUH 1JBUH 3SHAH 1Y5AT 4BXWA 4I8GA 2Z9IA 4GCHF 3U8TH 8KME2 2WSSD 3UAIC 1FV9A 3LDXH 1L1NA 1EPTB 1T4UH 2O8MA 1AFQC 1VZQH 4OS2A 1C5TA 1E38B 4AFQA 2Q1JA 4NIXA 4A1TA 2PGBB 1YLCA 1AU8A 1N8OC 1QJ1B 3W94A 1LO6A 1UVOA 1S84A 1JRTA 1O3GA 1SQRA 1CT4E 2WPLS 1ZSLA 1O30A 1G30B 2ZDMA 3ZZ7A 2SNVA 2FYQA 1KLIH 1SOTA 4XBBA 4H42U 1P06A 2B9LA 2CMYA 5A8ZA 3KGPA 4E7NA 1NRSH 2ZFTA 3BF6H 3L6PA 1F92A 5DPAA 4ABFA 1EAIA 1TMBH 2Y5FA 1GI0A 1RIWB 1EX3A 1O2WA 1KLTA 1LVBA 2ZECA 2XC5A 4XSKU 1GBHA 3NUMA 4Y8XA 3MHWU 4NA9H 5F8TA 1TA2A 3BTHE 1GMHF 1GBDA 1ZJDA 1H4WA 2PTNA 3RLWH 2GZ7A 3F2GA 4BNRA 2H2ZA 1BT7A 1O33A 3EDXB 2FLBH 1C5VA 3BV9B 1E34B 3NCLA 4CH2B 1THRH 1LCYA 2EA3A 4FUFA 1CGJE 4GHTA 5A0AE 1G2MA 4NIVA 1C5NH 3GDVA 2F9NA 4FOUC 2AMDA 1BTYA 3PB1E 2P3FH 3G01A 3A8BA 5JBBS 2H1UA 1CGIE 1P2MA 3K65B 1NU9A 1G37A 4IN2A 3OEHD 3A84A 3T26A 4ISNA 2Z3EA 1HDTH 1TB6H 1ZJKA 1HAVA 1A0JA 4FUGA 1HGTH 4RT1A 2ZZUH 3Q3KA 2UUJB 3QGJA 1GBEA 2BDIA 1DXPA 1CBWB 3WWBA 2JKHA 3ZVCA 1F0RA 4WMEA 3SU6A 3CNRA 2BDCA 4AB9A 4OS4A 1QHRB 2OINA 5HM2A 4DT7B 1ESBA 1VGCB 3FP8E 4MNXA 1GMHG 1ZPCA 3VGCC 2ZDVH 2BD3A 2CHAB 1A0HB 1TPAE 1XUGA 1PPCE 1TBRH 2LNCA 3GY7A 4NSVA 3V13A 1ZLRA 2FYRA 3A7VA 5JDUB 1C2FA 1NFUA 5FX5A 3P6ZB 3UTUH 3GYMA 5C0UA 1NESE 3NPSA 4NCYA 4M7GA 4NGAH 3A88A 1QR3E 3SGQE 4AFZA 3MH6A 3RXAA 5CHAC 1C2DA 2G52A 2HVXA 3PV4A 4ZHLU 1W12U 1MH0A 2O8UA 4FUEA 2XNIA 4K5ZA 1THPB 1AE8H 3QUMP 5T6DA 1EB2A 2D26C 1TRNA 4R8TB 1EKBB 1SC8U 1ID5H 1IQMA 1GHAG 1S0QA 4YT6H 2VIDA 3HKIB 4B73A 2FOBA 4MNWA 1KXEA 1BJUA 1OWEA 1P9UA 3HGPA 2QCYA 1TNIA 1EAXA 2ZTYA 1GMDF 1O3NA 1N8OB 3UWJH 2QXHA 3SNCA 4FU8A 3GOVB 1TX7A 3SV9A 1RS0A 1UK3A 2BY8X 4ASUD 1SL3A 2HNTE 1C2HA 1OOKB 2BQWB 1PPZA 2ZTXA 1V6DA 1NTPA 1E0FD 1BDAA 1YPEH 3Q76A 3HPTB 1HJ8A 2L74A 4IW4E 1QBNA 3M5LA 4XE4A 1TPSA 2J4IA 2NU4E 3ATLA 2AIQA 3PTNA 2Y80A 3AAVA 2BVSH 5DP7A 1ELCA 1J15A 1O3CA 3EGKH 1O3HA 4KTUA 3SW2B 2OP9A 1CHOF 3P17H 3A7ZA 1L1JA 3TGKE 3DSGA 1EJNA 3ZYEA 1FY1A 2Q6FA 5GWZA 1TYNA 2GGVB 3N7DA 1Y3WA 5F6MA 2HWLB 1C1UH 2FLRH 3A8AA 1O34A 1MTSA 2XBXA 1E35B 3SNEA 5FBEA 1V2OT 2GZ9A 5JBTA 3A81A 2UUFB 1TPOA 1OHHD 2A7CA 1AVXA 2BM2A 3P70B 1E1RD 1AZ8A 2V35A 4ZKSU 2ZGJA 3QZQA 4YT7H 1SGFG 2ZCHP 1BMAA 5EODA 3OYPA 2PKAA 1A4WH 5H4IB 2O8LA 4BXSA 2ZWLH 3VG8A 5FAHA 5E0GA 3BTQE 2J5UA 2A5IA 3TNSA 2QXGA 2KM0A 3RXLA 2ZHFH 3T27A 2BOKA 4NFFA 2C3SA 3RMNH 2OQUA 4WF8A 1TQ0B 2ZO3H 3RXDA 2BMGB 5ESTE 1GHYH 4ABBA 1YCPM 5EXNA 2UUYA 2ZU5A 3VGCB 2RFKC 1VR1H 2XXLA 3T5FH 3L33A 1F5KU 1DWDH 2FZZA 1CHOG 2GTBA 5C5OA 3PWBA 4K60A 2QF0A 3ZZ8A 1SG8B 1OYQA 1DS2E 4RN6A 1K22H 4GSOA 1ZRBA 3KEEA 1D3PB 2ZGHA 4IBLH 2UWPA 1KDQA 3SV2H 1EB1H 4A5TS 2OXSA 2ZDKA 5CHAB 1SGTA 5C0TA 3MTYA 1GBFA 6CHAC 1CE5A 4BAQB 4X1RU 1O2RA 2ZNKH 3DCLA 3FP7E 3O8DA 3U8OH 1OS8A 2A2QH 3V3MA 1GBLA 2ZFSA 1CQQA 4CH8B 1JIMA 4HFPB 2VNTA 4FVBA 5C20A 1HBTH 5AHGH 4E06H 1S6HA 1ZMLA 4B2AA 1O5CB 2XBVA 3F1SB 1O3EA 1FX0B 3W95A 1DLKB 1GG6C 1UVSH 1AMHA 4GPGA 1H9HE 4YLUA 1S6LA 2QF5A 5AF9H 1P2NA 3P8NA 5FX6A 3UQVA 1PPHE 1G3EA 4BAHB 3SUDA 1AWHB 5KEDA 4BAOB 3U8RH 1UTPA 1CA8B 1MCTA 2QIQA 4ASHA 2R0LA 5C1XA 4D76A 2VIWA 2V0BA 4ZKOU 1XUFA 4QT8C 3HGNA 5KECA 5EPYA 4K3JA 2CF9H 1TOCB 1D9IA 2GKVE 2FWWA 1DWCH 5HKKD 1S81A 5C17A 3KIDU 1E37B 1DDJA 4TT3D 4WMDA 2JJ2D 1GI6A 3GY5A 1W0KD 2IPHA 1ELFA 3A87A 3SORA 1D3DB 3M5OA 1SR5C 1SLVB 1OYTH 4Q7XA 1ESAA 1MU8B 1TRMA 1VITG 1BHXF 5F53A 2XWAA 2PKAB 1MMJN 1EZUC 3T28A 4ISOA 1DICA 1B0EA 1PQ7A 3LC5A 2ZHWH 5JYIA 1DY8A 1O2KA 4ISLA 1BTXA 1OWIA 3TGIE 3AASA 1MTWA 2CF8H 1HRTH 3RXEA 1OWKA 1LDTT 1O2GH 3BEFB 1XMNB 2HGTH 1ZGIA 2WV9A 2A4OA 1TNLA 2XCNA 7ESTE 2EI8A 1GI2A 1OP0A 4CHAC 1N1LA 1FZZA 5EXLA 3FP6E 1HIAB 4DURA 5C94A 2A0QB 1QQUA 1SGQE 5T6GA 1IQHA 1KXCA 4OM9A 1C9TA 2P95A 2BXTH 1E79D 3GY2A 2ZA5A 4WH8A 4WMFA 1KDQB 1FIZA 3H5CB 3VB4A 1F5LA 1XVMA 3QTVH 1YPLH 1SGYE 4WWYA 2ZU1A 1AIXH 3RC4A 1Z1JA 4K8BA 4X8SH 4X0WU 3KYGA 5DN6D 1O5EH 5E8EH 5CMXH 2M5TA 1XVOA 3C27B 1SFIA 4ZUHA 3KQBA 3TH3H 1NFWA 1UVUH 3SQHE 2SGFE 1AY6H 1ZRKA 3VXEH 5DP8A 3FOAA 1O2PA 5HGGA 3O8CA 1BMLA 1E1QD 1THSH 5A8YA 1XM1A 4ABJA 2FEQH 3SU0A 3ZVAA 1KTSB 4Q4LA 3M37A 1FNIA 1UMAH 1L4ZA 1XUJA 4O97A 3TU7H 2TRMA 2Z9KA 3M7TA 3EE7A 1WCZA 1QTFA 1P04A 2AGEX 3T29A 4ZROA 2YMSC 3U1IB 3F0OA 1QRXA 3E6PH 4WXIA 1YF4A 5JBCS 2BLQA 3EE0B 1QBVH 2BD2A 3RP2A 3M5MA 3SV7A 1YLDA 2NWNA 3M3SA 4I86A 2W26A 1C2JA 5LPFA 1GJ5H 1JOUB 1SHYA 1O2MA 7GCHG 1BHXB 1HYLA 1BBRE 3DFJA 1QFKH 2J95A 4D8NA 3GCOA 3IITA 6LPRA 5EW1H 3GCTF 2XTTB 4CRAA 1O36A 3F2HA 2XOKD 4NSYA 1C4Y2 2C4FH 1B5GH 1MTNC 1SMFE 3KHVA 5HMAA 4A1VA 5DP4A 3VB7A 1GBKA 2ODYB 3HK6B 1EPTA 1SBWA 1GHVH 1MZAA 4IMQA 1MD7A 3BTEE 1LKBA 1P3EA 1A46H 2ZQ1A 1Y3XA 3SV8A 4A92A 5E2OA 3SOSA 2Z6BD 3BIVH 2ZGXH 4NWKA 2PGQB 3FZZA 4DJZB 2WINI 4SGAE 1NRRH 1WXRA 1Q2WA 1NFYA 5IYTA 1AUJA 5C5NA 1NT1A 1SKYE 2EEKA 4X2VA 3TH4H 1DSTA 1QRWA 3MU1A 1F0SA 3V12A 1TWXB 1C2MA 3DSPA 1MBQA 3RXQA 2JH0D 3NRLA 4U2WA 4YESB 1O3OA 3EAJA 1O3JA 1CO7E 1T32A 2FESH 1GHXH 2C8ZB 2R0KA 3A82A 1K1NA 4NG9H 1EUFA 3ZZ6A 1WTHD 5HXFA 4Q7ZA 1GHBF 2XWBI 4CHAB 2FO9A 1O2UA 1AHTH 3JZ2B 3SHCH 2XW9A 1DOJA 4DW2U 1TOMH 3ZVGA 1EFRD 1K2I1 3KF2A 2ZIQH 3ZVFA 2ZCKP 2C90B 1P0SH 1WTGH 4CREA 3ZVDA 5F8ZA 3M7UA 3VB3A 3BTTE 1DE7H 1O2OA 3PV2A 3BTFE 4Y10E 1AFEH 1G3CA 1GVLA 1BA8B 1QJ7B 2GCHF 4IS5A 1P02A 1YGCH 4IC5A 1ARBA 2CGAA 2ULLA 3FVFB 1UTJA 5IK2D 2VH6A 2SGPE 1QL7A 4ZAEA 3LT3A 3SI4H 3PLPA 1SOZA 1QL9A 3B9FH 3HK3B 3PO1C 1BTUA 1RTLA 1V2JT 3A7YA 1GHBG 2BHGA 4I7YH 3MO6A 4CR9A 1KIGH 2YMSB 5JBAS 2TIOA 3P92A 2LPRA 4WVPE 1HAYB 3M36A 4Q80A 3MNXA 3CENA 2G55A 1GBCA 1RXPA 3OSYA 4DT4A 1EP5A 2EI6A 5A09A 5LGOA 2PUXB 1P09A 1HAZB 2C8YB 3ZVBA 4MPVA 2P93A 1C5OH 1O3LA 2W7SA 4GHQA 1TMTH 1O37A 3MMGA 3KN2A 4XBCA 3TJOA 1IHSH 4HGCA 4X6OA 4DVAU 4K8YA 3ZZ3A 1MKWH 4LK4A 1F5RA 1DUEA 2O8TA 3STIA 3GY3A 1GBTA 3SO3A 2BD8A 3ZYDA 4D9QA 3C1KA 1MTNB 2ZQ2A 3RXRA 2OC7A 2UWLA 1TNGA 1PPFE 2GCHG 2GVFA 2ZI2H 3L3TA 5EQQA 3BN9A 4TPYA 1TGTA 1K28D 4GLYA 2RG3A 2ZKSA 1FY5A 3KQDA 5FCKA 3RXSA 2AMPA 3LGWA 5K0HA 3MNBA 2J97A 3ZIAD 2FPZA 2WV5A 1O2ZA 4J2YB 5FXLA 1A5GH 1TA6A 4FUBA 1BTWA 4TSFD 2F91A 1GVZA 1UTQA 4AFUA 1OPHB 1OX1A 1OWHA 1AUTC 2QF4A 4HI3A 1HAGE 4NFEA 1C5XB 3PMHB 3PM3A 3OFND 1GL1A 4ABGA 1MTVA 2OD3B 4H6TA 1EAUA 3PMAB 1ETRH 5AFYH 1HUTH 3MO3A 1C2GA 3ENSB 1QB6A 2FS8A 2PWXA 2ZDAH 3ZZAA 4AFSA 2OBOA 1K1MA 2JJ1D 3OAAD 3ZZ9A 1B7XB 1OWJA 2BX4A 3S7HB 3VB5A 3BEUA 1WDIA 5FPTA 4ZKNU 1UTNA 1UHBA 1O5GH 1HLTH 2W7UA 3SBKA 1D3QB 3A7WA 1GHAF 2RCEA 3SN8A 2BX3A 2BLVA 2WPMS 3N7EA 1G2LA 2DE9A 3U28C 3CS0A 4I31A 1EJMA 1H1BA 1TMUH 3MNSA 3AVZA 1QJ6B 4O3UA 1Y5UT 2GCTB 2KCPA 3CS7A 3TIUA 1HXFH 2AGIX 4OS1A 1SGEE 1ZHPA 2R3UA 2ANYA 2VIVA 4F4OC 5JPMH 1VCQA 1W13U 3GCHB 1KY9A 2H6MA 1WAYB 1AVWA 3JZ1B 2B0FA 3PWCA 1TIOA 2A7JA 4I8KA 2J92A 2FODA 1PYTC 4RKOB 2F9UA 2ZEBA 3PO1B 1C2EA 1IQKA 1SVPA 5I25A 2WYJA 2ZHDA 5EXMA 2ASUB 5EG4A 1ZPBA 5IDKA 1BBRH 1ZSKA 3WW7A 1MQ6A 1C2IA 1ELBA 1ANBA 1NS3A 3MU4A 5C2ZA 2KX4A 4FUDA 1FUJA 1KLJH 4O9VA 4ABIA 4NIWA 3K2UA 1W0ZU 1MUEB 1ZR0A 1UCYK 1GMCF 1P03A 1AFQB 2AH4X 2OK5A 1BCUH 1SGFA 1C2LA 2NU0E 1GHZA 3DFLA 3MO9A 3MU8A 5TCCA 1K1OA 1JMOH 4U32A 1YKTA 3A8DA 4X1NU 1YLNA 2SGEE 2TGDA 3LH3A 1OP2A 4Z6AH 1IQFA 2P59A 3ZZCA 1C1MA 2FI5E 4HZHA 1ABJH 1XX9A 3GCNA 2NU2E 4YTAA 5L2YH 1F0UA 5J4QA 1HAIH 4B6FA 3RMLH 2BD7A 1DSUA 1T4VH 4O3TA 2ESTE 1GCTC 5CE1A 1E36B 3W1EA 3PLBA 3ZV9A 5EJLA 2KCYA 3PMBB 1B0FA 4FU7A 4FUJA 2KAIB 3RXPA 1O39A 3SGAE 4AG1A 3GDUA 4MTBA 2P94A 1O3AA 2HNTC 1V2ST 3ITIA 1FXYA 1Z8JB 4F49A 3OY5U 1EOJA 3CP7A 1TGBA 1CT0E 1SLWB 4X8UH 1GDQA 3SI3H 1GMCG 4MG3A 1LHEH 2F9PA 3ODDA 1UHBB 1Y3VA 4Y11E 2YNBA 1DITH 4XBDA 1P10A 2BZ6H 2VIOA 4ISHH 3RDZA 3ZVEA 1G9IE 3E0PB 4DIHH 2B7DH 3UWIA 3PV5A 4TPIZ 3VEQB 1PPGE 2SGQE 4DIIH 3PMJA 4AGKA 3TLOA 3F2FA 1QY6A 3QTOH 1L0ZA 5PTPA 3RXBA 1NRQH 1T8NA 1ELAA 4INLA 1SGDE 1ANDA 1YCPH 3M61U 5GXPA 5LH8A 2XNDD 3NXPA 1D4PB 5T1VA 1K1PA 3URCA 5DSFA 2A45B 1GDNA 1ZYOA 1BMMH 1YPHE 1AVGH 3ELAH 1ABIH 3H7OA 2STBE 2ZC9H 4ZHAA 1Z8GA 1C5RA 3LGYA 5F03A 1HFDA 4D9RA 1BJVA 1H8DH 3TGJE 2YMSD 3FAOA 2FOEA 1RFNA 4SGBE 1L4DA 3K9XB 3HATH 1H8HD 1SB1H 1HIAA 1WUNH 1M9UA 3D49H 2ZFPH 4CBOA 1MBMA 1V2LT 3BTDE 4ACBA 2F9OA 5EOKA 4BTTB 3QGNB 1K0HA 2BVRH 2NU1E 4CRGA 3RC6A 1Y3YA 5DP3A 3TK6A 1ANCA 3K6ZA 2W3IA 4X1QU 1N6YA 4CRCA 1O2SA 4OS6A 4Y7BA 1MKXH 1TRYA 2CJIA 2Z94A 1C1PA 2ZG0H 4UFGH 5LPEA 2OBQA 3UIRA 2H5CA 2PTCE 1C1VH 5DP9A 5L6NH 3SNDA 1VCWA 1KTTB 1VITF 1A5IA 2FTMA 1CHGA 3P8GA 3E0NB 2QC2A 1IQNA 4I33A 3FANA 4AOQA 3TJNA 1XKBC 1C5SA 1PQAA 4FXGH 4DOQA 4MQAA 2KCOA 1FAKH 1DT2A 2F83A 3EA7A 1KYNA 1QRZA 1OSSA 3UR9A 4MPUA 5DP5A 1SSXA 1KMHB 2VINA 2DE8A 5DGJA 1QGFA 1GCTB 1JWTA 2GD4B 2ZPRA 1TBQH 3A89A 3PLKA 1HJAC 3ZV8A 4FU9A 2H9HA 4X2XA 5L2ZH 2KCAA 2CK3D 3M3VA 1NRPH 3GDSA 3PROA 1S6FA 3DUXH 2VBCA 3ZZDA 1O3PB 1S0RA 1TGNA 1TE0A 4X8TH 1H9LB 1FJSA 3RXFA 4FUIA 2CN0H 1W0YH 4Q2KA 1P57B 1JRSA 3BEIB 1NBMD 3NZIA 1V2MT 1HAXB 4ZH8A 3U98H 4TY6A 1NC6A 1BB0B 1FPCH 3MH5A 3PYHA 3F9EA 1WSSH 3GYLB 4X2WA 3BG8A 2RA0A 1V3XA 1QA0A 1AD8H 5HYOA 3OEED 2WPKS 3UB0A 1GWAA 1YP9A 4Z1MD 2JDID 2G81E 2ZGCA 4Z0KA 1FAXA 1DX5M 4WJG2 3SU5A 1H9IE 3LU9B 2ZPSA 4XFQA 2EC9H 1A3EH 5T3HA 4AN7A 1W10U 2ANWA 2LELA 2IN2A 4H4FA 5DJ7A 2XYAA 3EA9A 4THNH 5ABWA 2W6JD 2D1JA 1EZQA 3SGBE 1SGPE 1OKXA 4ZXXH 1ESTA 1UTKA 3F6UH 4TWWA 5SGAE 1WYKA 2VWNA 3SU2A 2TBSA 4KTSA 1LHGH 1SLXB 3S9AA 2ODPA 7GCHF 4AZ2B 2BOHB 3OTJE 3UR6A 4B2CA 3T2NA 1U6QA 2C8WB 4MLFB 3UNSA 3UNRA 1K1JA 2FDAA 5CHBA 1IQJA 1TFXA 3BIUH 4Y71A 1A5HA 5EW2H 1ELTA 2HALA 2XC0A 1AKSB 2PV9B 2QXIA 2YOLA 3R0FA 3BTGE 1SHHB 4RI0A 1SQOA 6CHAB 4TWYA 3S0NA 1O5DH 2Q6DA 2O8WA 3SZEA 1TAWA 1GDUA 2WZQA 1GBMA 1BMNH 1O2QA 2A31A 3VFEA 3BTME 1C4U2 1O2TA 3RU4T 1FQ3A 5TJXA 4JYTA 2G5NA 1O3BA 1A3BH 3DA9B 3MI4A 2A7HA 1UVTH 1GG6B 2A2XH 2ZF0H 1V2RT 1FLEE 1LMWB 2J98A 5HIYA 1DPOA 4M9FA 4BAKB 1ANEA 4X1PU 1QNJA 3STJA 1P11E 3BTWE 3RXKA 4K2YA 5HM9A 3LH1A 4JZDH 3LGIA 5A2MH 3P8FA 1N6XA 1LHCH 5T6FA 1TNKA 2THFB 4X6NA 1G3BA 1HJAB 7LPRA 5DK1A 7KMEH 5E2PA 2STAE 1LVMA 1K1IA 5F8XA 1O2JA 4LOYH 4K1TA 2SGDE 2AEIH 4JZIA 4ABEA 2BTCE 1K1LA 2FOHA 4AX9H 1MABB 1V2TT 5FCRA 3V7TA 3UQOA 2ZU2A 1TX6A 1CVWH 1GCDA 3A83A 2PUQH 2ZPQA 2Z3DA 2G51A 2Y6TA 2ALPA 3GICB 5C67A 2GZ8A 2ALVA 4A6LA 2R3YA 1Y8TA 3WWFA 4UE7H 1AZZA 4E05H 1NROH 1BTZA 2Y5GA 1IQGA 3U1JB 1C5UA 2A5AA 1BUIA 3SUFA 1GPZA 2C8XB 1BTPA 1HV7A 1PFXC 4B6EA 5K7RA 1SLUB 1O2LA 3RXTA 2J94A 1MCVA 1PYTD 2VB0A 1AN1E 2VH0A 3S69A 1O2YA 2BLOA 1Y3UA 1C5ZB 1CT2E 5EPNA 4AG2A 2ZDLA 1J14A 1S5SA 1NBME 1DANH 2Z9GA 1EOLA 2BY6X 3OTPA 4ZKRU 3MOCA 2PFEA 1GJAB 2H9TH 2Y7XA 3IG6B 1BIOA 3A85A 5C1YA 3RMOH 5C3NA 1D6WA 1C1QA 4BTIB 1G32B 4XOJA 2BDYA 3QO6A 4I8HA 4Y79A 5FPYA 3F68H 1O2VA 2ZFFH 1GBJA 2WPHS 3Q3XA 1GI3A 3E91A 1V2NT 5EQRA 1LVOA 3RXIA 5GCHF 1CSOE 2Z3CA 1Z7KA 3VB6A 4ZCNA 3TPIZ 2QA9E 2J98B 4LZ1H 1YPKH 2K1QA 2P16A 1O32A 2B5TB 1BQYA 1QA7A 2VIPA 1XUIA 3SUEA 3UOPA 4X6PA 2JH6D 3RXCA 4NA7A 2FOFA 3LONA 2IJOB 4YOGA 4FUCA 5JB9S 1C1RA 1CA0C 1O5BB 1EASA 1EZXC 2F9VA 4X2YA 3AW1A 5DP6A 3H09A 1GI5A 4MDSA 5JB8S 1TPPA 4AORA 3LC3A 4FUHA 2QE7D 3LKWA 3U69H 3TJVA 1UO6A 5C1UA 3P8OA 3KQCA 5AVDA 1XKAC 1C2KA 2XCFA 2F4LA 4KELA 1O2XA 3O8RA 1V2UT 5EIYA 2UWOA 5B6OA 3DHKH 2IJD1 2R2MB 1ELVA 1UTMA 1EZSC 2QF3A 4WH6A 1XUHA 5FL7D 3LOXA 3RMMH 2GT7A 3E3TA 2Y81A 1LTOA 1Z8IB 1S85A 5EGMA 2FXRA 5GCHG 2A4QA 2GJGA 1EAWA 2HPPH 3KQ5A 2PSXA 1J9CH 4B74A 5HIZA 3QDZB 8GCHG 1OWDA 3QLPH 2Y5HA 4NA8A 3FKSD 1ZSJA 9ESTA 1MKXK 2VWLA 3GISB 1J8AA 2F9BH 3BG4C 5L30H 2BDGA 1YYY1 5J4SA 2DUCA 2FMJA 3KCGH 3LGVA 4GUXA 2TGAA 1SGRE 1SGIB 2VU8E 3RLYH 1Y5BT 2KAIA 4BTUB 4NZQA 2V7QD 4E7RG 3NWUA 1AGJA 2GMTC 3ATWA 4Y76A 2AMQA 2JH5D 5GJ4B 3VPKA 4ESTE 2TPIZ 4CBNA 1H8IH 2W6ID 2AHME 5TCAA 2P3UB 2ZU4A 1ZHMA 2W3KA 4GCHG 3PRBA 1INCA 1P8VC 1EQ9A 1WV7H 2BVXH 3TK5A 2A5KA 3GY8A 1O38A 4BANB 3A80A 3I78A 1COWD 2BZAA 2R9PA 4U30A 2ILNA 3RXMA 3SJOA 2PLXA 5CDFE 2AYWA 4U01A 1AO5A 3RXVA 4BOHA 2RDEA 1TABE 1HNEE 1P9SA 2BD4A 4RT0A 4JZEH 4BAMB 3T25A 4ZHMU 1FONA 1UVPA 3RM0H 2ZHEH 2YNAA 2BLWA 3FN8A 2F3CE 4K1SA 2WYGA 2VVCA 4Y6DA 1ZTLA 3RUOA 4IGDA 4YLQH 3ZZ5A 3SJIA 2BY7X 1DWBH 1F0TA 2VJ1A 1P2OA 3M35A 3D62A 4HTCH 3A8CA 1C5MD 2O9QA 1UCYE 3MNCA 1C1SA 1WQVH 3O8BA 3F9GA 1CA0B 1VJAU 2D8WA 5EJZA 5GIBA 1LPKB 1LPZB 2A4GA 2V3HH 4J1YA 1ZGVA 3LJJA 1LKAA 1IHTH 1MU6B 3MQKC 1QZ8A 1SQAA 1GL0E 3B8JA 4F55A 4DY7B 1DM4B 2ZHQH 4X8VH 1RGQA 4TY7A 1F2SE 1GJCB 1O31A 1XUKA 3DT0H 3KYFA 3RM2H 2BDBA 1F7ZA 4IMZA 2BQ6B 1MAYA 1T7CA 3LIWA 1ELEE 1BZXE 2CXVA 2AFQB 5DO4H 1QCPA 4YO9A 1YC0A 2PW8H 1WU1A 2V3OH 2J9NA 1WOFA 4Y0YE 4K69A 1AE5A 1HCGA 3AW0A 3NK8A 2AIPA 4Q63A 4AB8A 4ABAA 1FDPA 2OCVB 2GV6A 3F0PA 4ACAA 4KGAA 2D2DA 3E8LA 4LZ4B 3BG4B 5E0JA 4AGJA 1C5QA 2ANMH 2KFWA 2WV4A 4AYYB 1YPMH 2G5VA 3RU4D 3RXHA 1Z6EA 2VWOA 4I8LA 4XDEA 1PPEE 1TGSZ 3BSQA 3SUGA 2GMTB 2C93B 1GJ4H 2JETC 1LQEA 3TK9A 2BY9X 2ODQA 2J34A 2OC1A 4X6MA 5EJ1A 3IWMA 1S83A 4IN1A 4K1EA 5FPSA 2ZGBH 4DG4A 3LJOA 1RJXB 3SJ9A 1XXDA 1HAVB 1ZPZA 3TJUA 3SJ8A 2HNTF 1PQ8A 1LPGB 1GJ8B 3MU5A 3E90B 3Q77A 4JYUH 2ZCLP 1LHFH 1BTHH 2FTLE 5ETXA 2KR7A 1GMDG 2A32A 1O0DH 4UEHH 3B23B 4NWLA 4OGYA 1C5LH 1GI9B 1QL8A 2SFAA 4B1TA 2B8OH 2GDEH 5E0HA 2EI7A 2RDLA 3SYJA 3SNBA 2XC4A 2RA3A 1YPJH 3M7QA 1IOEA 4X1SU 1DY9A 1IQEA 2HOBA 3TVJB 1NPMA 2HPQH 3WY8A 3UOUA 1P05A 3D65E 4Y8ZA 4JZFH 9LPRA 2QV1A 1YPHC 1K21H 1LVYA 1FMGA 4Y7AA 1OP8A 3FFGA 3OE7D 1AB9C 1V2QT 2WPDD 4WXVA 4WY3A 4JK5A 1SGNE 5BPEA 5GDSH 4UONA 1T8LA 1L2EA 2ZFQH 3PRDA 1ZTJA 2QAAA 1C5YB 1WQSA 8LPRA 3F3BA 1O3MA 1W7XH 3Q00A 1G36A 1LQDB 1GJBB 3GY6A 2V3MA 5DKMA 1RTFB 2QGRA 1VJ9U 1TONA 5FBIA 1C4V2 1D6RA 1ETSH 2HLCA 4ABHA 1XXFA 1AKSA 5GNDA 2PKSC 3SU1A 2VVVA 2TGTA 3ATKA 1FI8A 4CRBA 5BRRE 2QXJA 3S9CA 5KGOA 4NIYA 3A7XA 4ISIH 1T8OA 2AS9A 1W14U 1GJ9B
chains in the Genus database with same CATH topology
1RD3B 1C5WB 3SV6A 1BITA 2FM2A 4OS5A 3N7OA 4I8JA 4A1XA 1C1TA 1MZDA 2BDHA 3MFJA 2BY5X 2GT8A 2OLGA 1NU7B 1FPHH 1FY8E 4UDWH 2G8TA 4YOIA 1NO9H 4MPWA 1KXFA 1RRKA 1V2VT 4JYVH 3SNAA 1QB1A 3RXJA 4DCDA 2WUCA 1PPBH 1HAHH 2WPIS 4D7FA 1L1GA 1GGDC 1MAXA 1FN6A 3RXGA 1DUAA 2FS9A 2FOAA 2AERH 1BRCE 3MH4A 1IAUA 1GJ6A 8ESTE 2I6QA 3P95A 3EQ0H 3QZRA 1PJPA 1GJDB 4D7GA 1TGCA 2G4TA 1EATA 1SFQB 1ZMJA 3U9AH 3M5NA 1ZTKA 4INKA 1Z1IA 1O3FA 1ZHRA 2JETB 2VGCC 4KP0A 2A1DB 3Q3YA 4MNYA 2ZTZA 1TX8A 4KKDA 2P8OC 1A2CH 1J16A 1GI7B 3TNTA 4CRFA 2UUKB 2XBWA 3OU0A 1OXGA 2GDDA 3F9HA 4AYVB 1V2KT 4UD9H 2WPJS 1ARCA 4OGXA 2BD9A 3MU0A 1MKWK 2QN5T 1FY4A 1GBAA 1GI8B 3SZNA 1ORFA 3UFAA 4INHA 3QK1A 1KSNA 3OX7U 1TNJA 4UFEH 4YOJA 1DFPA 1WBGB 2GV7A 3I29A 5LPRA 1YPGH 2SGAA 1AWFH 3SU3A 3URDA 2GP9B 3LGUA 3RU4E 1QQ4A 1UCYH 1MTUA 2J2UA 2Z9LA 1HAPH 2Y7ZA 1O2HA 3BTKE 1A7SA 3KNXA 1SQTA 2ZFRH 1ZOMA 1G3DA 1AB9B 3S9BA 2G00A 4Q7YA 1JIRA 3FZDA 3D23A 6ESTA 1DXWA 1EP6A 1QURH 1QB9A 3PTBA 1TLDA 1UK2A 3EYDA 3ODFA 1C5PA 2FX4A 2BD5A 1V2PT 2ZU3A 1PQ5A 5FHTA 1HB0B 3ATMA 1W7GH 2PHBA 3SJKA 1NFXA 3VXFH 2ANKH 1O35A 1O5AB 1NY22 1P3CA 4JCNA 4GVUA 3DD2H 1RTKA 2BB4A 2PKSB 3TITA 1LHDH 1YBWA 2QY0B 1O5FH 4GAWA 1ELDE 1Z6JH 1IQIA 4JK6A 4Y8YA 1O2IA 1A0LA 1W3CA 4VGCC 2CV3A 4YM9A 1SGCA 2AGGX 2BDAA 1DVAH 2A4RA 3V0XA 1GHWH 2I6SA 4B75A 6GCHF 1ETTH 3MWIU 5GPIB 5DG6A 2Z7FE 5AFZH 2V6NA 3ZZBA 3HKJB 1TNHA 4B71A 3ZZ4A 2H5DA 4DGJA 3RXUA 1DWEH 3UNQA 4ABDA 4TYDA 1O3DA 2G4UA 2XBYA 1CGHA 1GGDB 4Y0ZE 3NKKA 1EPTC 1Y59T 4UFFH 3K6YA 1BRUP 3QN7A 4FVDA 3LPRA 3TH2H 1P01A 4R0IA 1C1NA 1NRNH 1P2QA 3ESTA 3F9FA 1GI4A 1MQ5A 1BOQA 3MH7A 1TALA 1HXEH 3EA8A 1ACBE 1BBRK 2H9EH 4A7IB 2HRVA 4O03A 4RKJB 1A61H 3A7TA 1C1OA 1HPGA 4JMYA 1CU1A 2VGCB 4KTCA 1Q31A 1W11U 4B2BA 1SI5H 1TQ7B 2P8OB 4JZ1A 4LXBH 1K9OE 2FOMB 2BYAX 1QIXB 1P2JA 3KQEA 4UFDH 1W8BH 1HJ9A 4NZLA 1O3KA 1RIWC 2VIQA 6GCHG 1ELGA 3ATIA 4MNVA 2FOGA 1BRBE 1HAOH 1GI1A 4OS7A 3QX5H 1EXFA 5EQSA 2FIRH 2FX6A 2FOCA 2IOTA 1J17T 1FY3A 1VITH 4H6SB 5A0BA 4ZXYH 2VVUA 4MPXA 3SQEE 2OC0A 1UTOA 3UY9A 1AQ7A 1NN6A 1FN8A 1MD8A 4MVNA 2PSYA 3QWCH 1ZMNA 3RC5A 1ZZZA 2FI3E 1BRAA 5I46H 1T8MA 2Y82A 2OC8A 4RSPA 2SNWA 5A0CA 5A8XA 2VWMA 1P2KA 1TBZH 3H7TA 3GCTG 1GJ7B 1SPJA 3MYWA 2OTVA 4B76A 1NM6A 1Q3XA 2TGPZ 2XRCA 2Z9JA 1KXAA 2OUAA 2QYIA 1C1WH 3RXOA 1UJ1A 3KL6A 3M3TA 3T62A 4CR5A 1DLEA 1EJAA 1CBWC 1UTLM 1W2KH 4PROA 1P2IA 2FI4E 3E16B 2W5EA 2PR3A 3I77A 1UK4A 1T31A 3SU4A 1GVKB 2BQ7B 1GBBA 1Z8RA 1Z71A 2FP7B 1A1RA 5ESBA 8GCHF 1JXPA 3LGTA 1O2NA 1P12E 2GCTC 1C9PA 2J38A 2NU3E 1VGCC 1YM0A 1D3TB 1V2WT 1KXDA 1FIWA 1IQLA 3A86A 4ZMAH 2WUBA 3E1XB 3OY6U 2CHAC 3GCHC 4IC6A 2Q6GA 5EU8A 1KXBA 4VGCB 3R3GB 1QBOA 1YCPK 3UUZA 3GY4A 4YZUA 5G4BA 2GX4A 3UPEA 1NZQH 1GBIA 1O3IA 2P3TB 1AI8H 2R2WU 3S7KB 2ZDNA 4CRDA 3AAUA 1VCPA 3UREA 2OQ5A 2ZP0H 4I32A 1X7AC 1S82A 2BXUH 1JBUH 3SHAH 1Y5AT 4BXWA 4I8GA 2Z9IA 4GCHF 3U8TH 8KME2 1FV9A 3LDXH 1L1NA 1EPTB 1T4UH 2O8MA 1AFQC 1VZQH 4OS2A 1C5TA 1E38B 4AFQA 2Q1JA 4NIXA 4A1TA 2PGBB 1YLCA 1AU8A 1N8OC 1QJ1B 3W94A 1LO6A 1UVOA 1S84A 1JRTA 1O3GA 1CT4E 2WPLS 1ZSLA 1O30A 1G30B 2ZDMA 3ZZ7A 2SNVA 2FYQA 1KLIH 1SOTA 4XBBA 4H42U 1P06A 2B9LA 2CMYA 5A8ZA 3KGPA 4E7NA 1NRSH 2ZFTA 3BF6H 3L6PA 1F92A 5DPAA 4ABFA 1EAIA 1TMBH 2Y5FA 1GI0A 1RIWB 1EX3A 1O2WA 1KLTA 1LVBA 2ZECA 2XC5A 4XSKU 1GBHA 3NUMA 4Y8XA 3MHWU 4NA9H 5F8TA 1TA2A 3BTHE 1GMHF 1GBDA 1ZJDA 1H4WA 2PTNA 3RLWH 2GZ7A 4BNRA 2H2ZA 1BT7A 1O33A 3EDXB 2FLBH 1C5VA 3BV9B 1E34B 3NCLA 4CH2B 1THRH 1LCYA 2EA3A 4FUFA 1CGJE 4GHTA 5A0AE 1G2MA 4NIVA 1C5NH 3GDVA 2F9NA 2AMDA 1BTYA 3PB1E 2P3FH 3G01A 3A8BA 5JBBS 2H1UA 1CGIE 1P2MA 3K65B 1NU9A 1G37A 4IN2A 3A84A 3T26A 4ISNA 2Z3EA 1HDTH 1TB6H 1ZJKA 1HAVA 1A0JA 4FUGA 1HGTH 2ZZUH 3Q3KA 2UUJB 3QGJA 1GBEA 2BDIA 1DXPA 1CBWB 2JKHA 3ZVCA 1F0RA 4WMEA 3SU6A 2BDCA 4AB9A 4OS4A 1QHRB 2OINA 5HM2A 4DT7B 1ESBA 1VGCB 3FP8E 4MNXA 1GMHG 1ZPCA 3VGCC 2ZDVH 2BD3A 2CHAB 1A0HB 1TPAE 1XUGA 1PPCE 1TBRH 2LNCA 3GY7A 4NSVA 3V13A 1ZLRA 2FYRA 3A7VA 5JDUB 1C2FA 1NFUA 5FX5A 3P6ZB 3UTUH 3GYMA 1NESE 3NPSA 4NCYA 4M7GA 4NGAH 3A88A 1QR3E 3SGQE 4AFZA 3MH6A 3RXAA 5CHAC 1C2DA 2G52A 2HVXA 3PV4A 4ZHLU 1W12U 1MH0A 2O8UA 4FUEA 2XNIA 4K5ZA 1THPB 1AE8H 3QUMP 5T6DA 1EB2A 2D26C 1TRNA 4R8TB 1EKBB 1SC8U 1ID5H 1IQMA 1GHAG 1S0QA 4YT6H 2VIDA 3HKIB 4B73A 2FOBA 4MNWA 1KXEA 1BJUA 1OWEA 1P9UA 3HGPA 2QCYA 1TNIA 1EAXA 2ZTYA 1GMDF 1O3NA 1N8OB 3UWJH 2QXHA 3SNCA 4FU8A 3GOVB 1TX7A 3SV9A 1RS0A 1UK3A 2BY8X 1SL3A 2HNTE 1C2HA 1OOKB 2BQWB 1PPZA 2ZTXA 1V6DA 1NTPA 1E0FD 1BDAA 1YPEH 3Q76A 3HPTB 1HJ8A 4IW4E 1QBNA 3M5LA 4XE4A 1TPSA 2J4IA 2NU4E 3ATLA 2AIQA 3PTNA 2Y80A 3AAVA 2BVSH 5DP7A 1ELCA 1J15A 1O3CA 3EGKH 1O3HA 4KTUA 3SW2B 2OP9A 1CHOF 3P17H 3A7ZA 1L1JA 3TGKE 1EJNA 3ZYEA 1FY1A 2Q6FA 5GWZA 1TYNA 2GGVB 5F6MA 1Y3WA 2HWLB 1C1UH 2FLRH 3A8AA 1O34A 1MTSA 2XBXA 1E35B 3SNEA 5FBEA 1V2OT 2GZ9A 5JBTA 3A81A 2UUFB 1TPOA 2A7CA 1AVXA 2BM2A 3P70B 1AZ8A 2V35A 4ZKSU 2ZGJA 3QZQA 4YT7H 1SGFG 2ZCHP 1BMAA 5EODA 3OYPA 2PKAA 1A4WH 5H4IB 2O8LA 4BXSA 2ZWLH 5FAHA 5E0GA 3BTQE 2A5IA 3TNSA 2QXGA 3RXLA 2ZHFH 3T27A 2BOKA 4NFFA 2C3SA 3RMNH 2OQUA 4WF8A 1TQ0B 2ZO3H 3RXDA 2BMGB 5ESTE 1GHYH 4ABBA 1YCPM 5EXNA 2UUYA 2ZU5A 3VGCB 1VR1H 2XXLA 3T5FH 3L33A 1F5KU 1DWDH 2FZZA 1CHOG 2GTBA 5C5OA 3PWBA 4K60A 2QF0A 3ZZ8A 1SG8B 1OYQA 1DS2E 4RN6A 1K22H 4GSOA 1ZRBA 3KEEA 1D3PB 2ZGHA 4IBLH 2UWPA 1KDQA 3SV2H 1EB1H 4A5TS 2OXSA 2ZDKA 5CHAB 1SGTA 3MTYA 1GBFA 6CHAC 1CE5A 4BAQB 4X1RU 1O2RA 2ZNKH 3FP7E 3O8DA 3U8OH 1OS8A 2A2QH 3V3MA 1GBLA 2ZFSA 1CQQA 4CH8B 1JIMA 4HFPB 2VNTA 4FVBA 5C20A 1HBTH 5AHGH 4E06H 1S6HA 1ZMLA 4B2AA 1O5CB 2XBVA 3F1SB 1O3EA 3W95A 1DLKB 1GG6C 1UVSH 1AMHA 4GPGA 1H9HE 4YLUA 5AF9H 1P2NA 3P8NA 5FX6A 3UQVA 1PPHE 1G3EA 4BAHB 3SUDA 1AWHB 4BAOB 3U8RH 1UTPA 1CA8B 1MCTA 2QIQA 4ASHA 2R0LA 5C1XA 4D76A 2VIWA 2V0BA 4ZKOU 1XUFA 4QT8C 3HGNA 5EPYA 4K3JA 2CF9H 1TOCB 1D9IA 2GKVE 2FWWA 1DWCH 1S81A 3KIDU 1E37B 1DDJA 4WMDA 1GI6A 3GY5A 2IPHA 1ELFA 3A87A 3SORA 1D3DB 3M5OA 1SR5C 1SLVB 1OYTH 4Q7XA 1ESAA 1MU8B 1TRMA 1VITG 1BHXF 2XWAA 2PKAB 1MMJN 1EZUC 3T28A 4ISOA 1DICA 1B0EA 1PQ7A 3LC5A 2ZHWH 5JYIA 1DY8A 1O2KA 4ISLA 1BTXA 1OWIA 3TGIE 3AASA 1MTWA 2CF8H 1HRTH 3RXEA 1OWKA 1LDTT 1O2GH 3BEFB 1XMNB 2HGTH 1ZGIA 2A4OA 1TNLA 2XCNA 7ESTE 2EI8A 1GI2A 1OP0A 4CHAC 1N1LA 1FZZA 5EXLA 3FP6E 1HIAB 4DURA 2A0QB 1QQUA 1SGQE 5T6GA 1IQHA 1KXCA 1C9TA 2P95A 2BXTH 3GY2A 2ZA5A 4WH8A 4WMFA 1KDQB 1FIZA 3H5CB 3VB4A 1F5LA 1XVMA 3QTVH 1YPLH 1SGYE 4WWYA 2ZU1A 1AIXH 3RC4A 1Z1JA 4K8BA 4X8SH 4X0WU 1O5EH 5E8EH 5CMXH 2M5TA 1XVOA 3C27B 1SFIA 4ZUHA 3KQBA 3TH3H 1NFWA 1UVUH 3SQHE 2SGFE 1AY6H 1ZRKA 3VXEH 5DP8A 5HGGA 1O2PA 3O8CA 1BMLA 1THSH 5A8YA 1XM1A 4ABJA 2FEQH 3SU0A 3ZVAA 1KTSB 3M37A 1FNIA 1UMAH 1L4ZA 1XUJA 4O97A 3TU7H 2TRMA 2Z9KA 3M7TA 1WCZA 1QTFA 1P04A 2AGEX 3T29A 4ZROA 3U1IB 1QRXA 3E6PH 4WXIA 1YF4A 5JBCS 2BLQA 3EE0B 1QBVH 2BD2A 3RP2A 3M5MA 3SV7A 1YLDA 2NWNA 3M3SA 2W26A 1C2JA 5LPFA 1GJ5H 1JOUB 1SHYA 1O2MA 7GCHG 1BHXB 1HYLA 1BBRE 3DFJA 1QFKH 2J95A 4D8NA 3GCOA 3IITA 6LPRA 5EW1H 3GCTF 2XTTB 4CRAA 1O36A 4NSYA 1C4Y2 2C4FH 1B5GH 1MTNC 1SMFE 3KHVA 5HMAA 4A1VA 5DP4A 3VB7A 1GBKA 2ODYB 3HK6B 1EPTA 1SBWA 1GHVH 1MZAA 4IMQA 1MD7A 3BTEE 1LKBA 1P3EA 1A46H 2ZQ1A 1Y3XA 3SV8A 4A92A 5E2OA 3SOSA 2Z6BD 3BIVH 2ZGXH 4NWKA 2PGQB 3FZZA 4DJZB 2WINI 4SGAE 1NRRH 1Q2WA 1NFYA 5IYTA 1AUJA 5C5NA 1NT1A 2EEKA 4X2VA 3TH4H 1DSTA 1QRWA 3MU1A 1F0SA 3V12A 1TWXB 1C2MA 1MBQA 3RXQA 2JH0D 4U2WA 4YESB 1O3OA 3EAJA 1O3JA 1CO7E 1T32A 2FESH 1GHXH 2C8ZB 2R0KA 3A82A 1K1NA 4NG9H 1EUFA 3ZZ6A 1WTHD 5HXFA 4Q7ZA 1GHBF 2XWBI 4CHAB 2FO9A 1O2UA 1AHTH 3JZ2B 3SHCH 2XW9A 1DOJA 4DW2U 1TOMH 3ZVGA 1K2I1 3KF2A 2ZIQH 3ZVFA 2ZCKP 2C90B 1P0SH 1WTGH 4CREA 3ZVDA 5F8ZA 3M7UA 3VB3A 3BTTE 1DE7H 1O2OA 3BTFE 4Y10E 1AFEH 1G3CA 1GVLA 1BA8B 1QJ7B 2GCHF 4IS5A 1P02A 1YGCH 4IC5A 1ARBA 2CGAA 2ULLA 3FVFB 1UTJA 2VH6A 2SGPE 1QL7A 4ZAEA 3LT3A 3SI4H 3PLPA 1SOZA 1QL9A 3B9FH 3HK3B 3PO1C 1BTUA 1RTLA 1V2JT 3A7YA 1GHBG 2BHGA 4I7YH 3MO6A 4CR9A 1KIGH 5JBAS 2TIOA 3P92A