1O36A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o36A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o36A02
1X7AC 3CS7A 2B9LA 1YPEH 4YT6H 2PSXA 2BMGB 2KAIB 2ZA5A 1P09A 1UTQA 1EAUA 3DFJA 5A2MH 3Q00A 2R2WU 4KP0A 1LPGB 1UTJA 3UOPA 3HKIB 2A7JA 2Z6BD 1XXFA 4I8KA 1SR5C 1HAVB 2BQ6B 4I32A 2Q6GA 1RIWB 3SV6A 3GCTG 1UVTH 2IJOB 8ESTE 2ZHQH 1KSNA 1C5QA 1EOJA 2A32A 1AY6H 3OU0A 4O3UA 1FY4A 1G2LA 1LPKB 5E2OA 2QXGA 1OOKB 1ELGA 5GWZA 1EAXA 3SUGA 1T7CA 3DUXH 4AB9A 3H5CB 5FAHA 5EGMA 1G9IE 2V0BA 1IHTH 3U1IB 3BF6H 2GT8A 2CHAC 1D9IA 1HV7A 2GKVE 2GT7A 5ESTE 1PPCE 1ZOMA 4JZ1A 2G5VA 4DOQA 2BD3A 3VPKA 3QWCH 1W12U 2PKAA 5F03A 3GOVB 1S0RA 3HATH 2THFB 1GI5A 5A0CA 4ABBA 5T6FA 1V2VT 1MU6B 3A86A 1OP8A 3CENA 1QJ6B 3PM3A 4MNXA 3KEEA 3STJA 4WWYA 3BEUA 3SHCH 3VXEH 1FV9A 1MTNC 1K21H 1C2IA 1K1NA 1FZZA 2ZIQH 1EZQA 2GZ7A 2VIPA 2QV1A 1A5GH 3H7OA 4BANB 1Y3YA 1XKAC 1V2PT 1QB6A 1C5PA 1KIGH 3IITA 2FDAA 1PPBH 1AB9B 4TYDA 1K9OE 1BQYA 1GJBB 2Y81A 2ZFFH 4FUGA 1MMJN 4FUJA 3ZVBA 2VB0A 2J34A 1O2LA 5DP7A 1LHFH 1DOJA 3M7TA 3RM2H 4MPXA 2WV4A 4NA8A 1VCPA 1A3EH 3PV4A 4CH2B 1ZR0A 2UWOA 1CA0C 2PSYA 1EZUC 1LQEA 4FU8A 3P8GA 2VIDA 1EB2A 1JWTA 4WMDA 3ZVFA 4R0IA 3RU4T 3QX5H 1BMLA 1B5GH 1FN6A 3V0XA 4Q7ZA 1BRCE 1C1NA 1FAXA 4AGKA 3URCA 1NO9H 2QF0A 4U01A 1TQ0B 2I6QA 3M5OA 1AFQB 1BTHH 1YC0A 2JETC 4AB8A 3K6YA 1QNJA 4AFZA 4UFFH 1UTLM 2IN2A 2ZFPH 1TNKA 1G2MA 4K1SA 4X1QU 2BX4A 4YT7H 2NU2E 1GMHG 1ZPZA 1DFPA 2HNTE 4BAQB 5E2PA 2H5DA 3TJNA 4OS1A 2BX3A 1GBFA 2FM2A 2BD2A 1LQDB 5FX5A 1CE5A 1BBRK 3NUMA 5LGOA 4JYVH 3PMJA 1TPPA 1UHBA 1HAZB 3R0FA 1FXYA 2A5AA 1IQGA 2UUFB 2XTTB 3Q3XA 4BAHB 1BT7A 2ODYB 4A1TA 2R9PA 1QHRB 1TQ7B 4X6NA 2CF9H 2BLVA 2TGPZ 3MH7A 1Y3XA 1N6YA 4IS5A 1FAKH 2QXHA 2PKSB 2SGDE 1C2FA 2TBSA 1P0SH 2W3IA 1T8LA 2FO9A 1Z1JA 4CRCA 1KXCA 2AS9A 5C1XA 1MBQA 1AB9C 2FLBH 1F2SE 5A8YA 2V3HH 1TBZH 1SHYA 1GDUA 3T29A 5C5NA 8GCHF 2ZGBH 2FOMB 2BXUH 1NU9A 1PQ7A 4H6SB 5L2ZH 4INKA 1OSSA 1VGCB 2KAIA 4MPVA 1NROH 1W13U 1S6HA 4NZQA 3DD2H 1WV7H 1TMBH 1AWFH 4XBCA 1GBIA 1MD8A 1QBVH 1O3MA 2SFAA 1O5AB 2EI7A 2CGAA 3TITA 3PWCA 4CRDA 1YLCA 1ZHPA 1KLJH 4YTAA 2NU1E 1AKSA 3UFAA 1ARBA 4X8VH 1O2MA 2BY9X 1ELEE 3MYWA 3MU4A 2H9TH 5AF9H 1O31A 2ZCLP 3GCOA 3SJ9A 4NSYA 2PTNA 1UO6A 1OWHA 2VU8E 4GCHF 4ZKNU 2WUCA 1GHVH 1OWIA 3BTHE 4K60A 3BTEE 2HGTH 2R3YA 2PUXB 4X2VA 2CXVA 1XVMA 1TRMA 2OC7A 6ESTA 1GBDA 2OINA 1C5LH 3BTFE 1FN8A 4F4OC 4OS6A 2P3UB 3A83A 4U32A 5L30H 4QT8C 1WU1A 3M5LA 1RIWC 2F83A 3EGKH 2A1DB 3S69A 1BTWA 1UCYH 3V12A 1GG6B 1V2UT 1ZLRA 1YCPM 2QCYA 3ZZ6A 1PYTD 1QBOA 1EAWA 1C2JA 1O2SA 3TH3H 1SGDE 1C1OA 3TJOA 1ZTLA 2WUBA 3S7KB 3UNSA 2OQUA 4X1SU 1SPJA 3W95A 1T8OA 1H9HE 1ELCA 2OXSA 1Y3WA 4NWLA 4YOIA 4ABJA 2FOAA 2B8OH 1PYTC 1C1UH 1TBQH 3M37A 3OTJE 4DCDA 4WVPE 5EW2H 1AE8H 3E91A 4ABDA 1HCGA 1UTMA 1GMDG 1NZQH 4X2XA 2P59A 1BMAA 2H5CA 1GJ5H 2HLCA 2AGIX 5C20A 1EOLA 1LMWB 1P2QA 3MH4A 1GJ7B 4H6TA 4OS7A 1YBWA 2Z9KA 3S7HB 1ZRBA 2AERH 2Y7ZA 1C5MD 1OWKA 1GI0A 1QY6A 1EP5A 1MZAA 2UWLA 4TWWA 3MNXA 2G4TA 5LH8A 1K1OA 3BTQE 1S84A 1PFXC 1YP9A 2CN0H 2ZP0H 4IMQA 5GJ4B 4TWYA 1BOQA 1OWJA 1CGJE 2BY7X 3UR6A 3D49H 1P12E 3ZZ5A 1SLUB 2PHBA 2WINI 4XE4A 3MO3A 5E0HA 3ELAH 4XBDA 3FANA 2F9VA 2BD8A 1C2LA 1YCPH 3SNDA 4XBBA 1C5OH 2Z9LA 2VVCA 5FBIA 3PB1E 5GDSH 3BTDE 1MKXK 2ODQA 1C4U2 4U30A 1HBTH 2RG3A 1K1IA 1VCQA 2ZU2A 1V2JT 1TOCB 1MH0A 1VGCC 1O30A 2SGFE 1HAIH 7ESTE 5FHTA 2CJIA 2GMTB 3A7ZA 5GCHF 4F49A 3EDXB 1A0HB 2ZHFH 1GHAF 1P2KA 4CREA 1O3EA 3U69H 1GJAB 1TMUH 3F9GA 1O0DH 5FX6A 1T4VH 3URDA 2PFEA 7LPRA 1NFXA 5FBEA 2SGEE 1GDNA 3SNCA 4E7NA 5IDKA 2VWLA 1SFQB 1D6RA 2JKHA 1QBNA 3LKWA 1RTLA 3BIVH 3E0PB 4Y10E 3TGJE 1OWDA 5EPNA 2QXJA 1MCTA 1SI5H 1PQ5A 2W3KA 3AW0A 3TU7H 3I29A 2A7HA 3MOCA 2Z9IA 1TNGA 2VWOA 4FUBA 4DIIH 1FJSA 1IQJA 1PPZA 1BIOA 4IC6A 3GDUA 4RSPA 3P17H 5HM2A 5C5OA 2F9PA 5T6GA 2UUYA 2OLGA 2ZF0H 4Y6DA 3RXIA 3S9BA 1AN1E 4Y79A 2GMTC 4KTCA 1QL7A 1O3HA 2ZGJA 3M35A 3ODFA 5FXLA 4D8NA 1GMHF 1EP6A 4CR9A 1C1SA 1NRQH 3NXPA 1GI9B 3PLBA 3A87A 1YKTA 2WPHS 3SJOA 2H9HA 1RRKA 3LH1A 1XKBC 5F8ZA 1C1TA 2AMQA 1AU8A 1KXFA 3VB6A 2D1JA 3RXSA 1UTPA 2ZCHP 4GLYA 1O5DH 3FAOA 3SV9A 2YNBA 1BRAA 4AFUA 2GZ9A 4CRAA 3PTBA 2Y6TA 3SU2A 4TY7A 5AHGH 1AKSB 4MDSA 1CA0B 3F1SB 2H6MA 1GHBF 5F6MA 4X2WA 2G55A 1V2TT 2H9EH 1THSH 1RFNA 1B0FA 1EX3A 4JYTA 3O8RA 1O2ZA 2BLQA 1G37A 1LHDH 1MKWK 1HYLA 1H4WA 2ZHWH 3OY6U 2ZDLA 1CU1A 2B0FA 2XWAA 1TWXB 1W10U 4AYYB 5JBBS 3RXTA 3KQBA 3P8OA 3F6UH 3RC5A 5JBAS 2XC4A 1XUHA 2HWLB 4ZXYH 1VJ9U 3SUFA 2ZU4A 3BG4C 5EXMA 1T32A 2GCTB 1O3AA 5CMXH 5JYIA 3QTVH 3SHAH 3PWBA 3O8BA 1DWDH 3TJUA 2FOFA 4ISOA 1BDAA 1Z8GA 4NFFA 1BITA 3P92A 1HXEH 1NPMA 1KDQA 3RXJA 1GJDB 4Y0YE 4X0WU 2ZZUH 1LVMA 1GHYH 1F7ZA 2QGRA 4BXWA 4Y8YA 8LPRA 1MCVA 4UEHH 1O35A 3KNXA 3M3VA 4FUFA 4ZHAA 1BBRH 1BTXA 3T62A 1S85A 1UTNA 3Q3YA 3ZYEA 2FXRA 3ATLA 1QR3E 4XDEA 3O8DA 1O3FA 4JYUH 3BIUH 2FPZA 1GMCF 2ZGCA 1O2IA 2P95A 1MKWH 2WPKS 2ANYA 2O9QA 3LT3A 5T3HA 3EAJA 1DT2A 1H1BA 1IHSH 2Z94A 3MU8A 2BVXH 1SFIA 2OBQA 3AAUA 1HAPH 2A5IA 1V2RT 1MTVA 4UE7H 3D23A 2FMJA 3LU9B 3PMHB 1WOFA 2PGQB 4MVNA 1U6QA 3ZZ9A 4A7IB 4ABGA 1ESTA 2XBVA 1THRH 4FXGH 1GWAA 4CRFA 1J8AA 1C4Y2 4INHA 4NFEA 1QQ4A 5B6OA 5A0AE 4I8JA 2BQ7B 2PTCE 3GY4A 3P8NA 1HDTH 2XRCA 5GXPA 2EI6A 1SSXA 2BQWB 3M3TA 4NIWA 3GDVA 3BV9B 1VITF 1OP2A 1NFUA 1TPSA 4NIXA 3RXDA 1H9IE 1O3IA 1GBMA 5EQSA 1TE0A 3ENSB 2A0QB 3R3GB 4WXIA 1NU7B 3SV7A 1VJAU 4Y8ZA 4JZFH 4JZDH 3ZYDA 1S0QA 4I8LA 1BTYA 1O5GH 1P04A 1CA8B 1C1MA 1K22H 2P16A 1YPMH 3HGNA 1EJNA 1W7XH 3QZQA 4OGYA 1LKAA 3A81A 1TLDA 1GVZA 1O2QA 2ALVA 4AG2A 2CMYA 4ZKSU 3ZZ3A 1CGIE 3VXFH 1BJUA 3FFGA 2R0KA 5LPFA 2XC0A 2AEIH 3H7TA 1LTOA 4DGJA 4WMFA 1INCA 1F92A 4OGXA 3C27B 4A1VA 1GL1A 3E1XB 4CH8B 1NS3A 2WPMS 4WXVA 1Z8JB 4E7RG 2C90B 4AYVB 1BTZA 2WYGA 1AO5A 2OBOA 1C2GA 2VNTA 1BB0B 1C5TA 1O39A 4AX9H 3RUOA 3DA9B 1YLDA 3ZV9A 2FOHA 3LGUA 1IQKA 1W3CA 3RMMH 3T26A 1MD7A 2C3SA 3E3TA 3SO3A 1GBCA 4Q7XA 2DUCA 4HGCA 2BY8X 1TNLA 1M9UA 2HPQH 4GPGA 3QUMP 3LC3A 4B75A 1SVPA 4KTUA 1XUFA 2BZ6H 1XMNB 4FUDA 4O3TA 4Y8XA 3VFEA 6CHAB 1D3PB 3QN7A 1XUIA 1O34A 3RMOH 2ZHDA 2FYQA 1W2KH 1GJ4H 3E6PH 5BRRE 3ZZBA 4MLFB 2ZTYA 1KYNA 3MH6A 1AUJA 1RXPA 3SU6A 4MNWA 3GCHC 1HXFH 2I6SA 3GDSA 1QJ1B 3RLYH 1ELFA 1DM4B 1QRXA 3SJ8A 5K7RA 2BDGA 1WBGB 1FUJA 1KLTA 1AUTC 1A61H 3E16B 3ZVAA 3SOSA 2SGAA 2ZTZA 2PKSC 1TPAE 4UONA 1LHEH 3SJKA 4CRBA 5A09A 1ELVA 2WPJS 3RU4E 1QIXB 1TX8A 3RP2A 4FU9A 2Y82A 1ESAA 2G00A 3MNSA 1SGYE 1DUEA 1V2KT 4YESB 1P2JA 5F8XA 1NY22 1C2DA 2XNIA 2XYAA 1EZSC 1GHBG 2FZZA 2VJ1A 3SGQE 1KTTB 3RDZA 1MQ6A 2BLWA 1XM1A 1AIXH 5EQRA 2ODPA 1P9UA 1UHBB 2GTBA 1SQAA 3MU0A 1T31A 1PJPA 1SHHB 1W8BH 1SGQE 3FP8E 3SJIA 2VGCC 1MAXA 1N8OB 3PROA 4UFDH 1EPTC 3MU1A 2ZKSA 1YPGH 1FY3A 3B23B 4X1NU 2GCHF 2JH6D 4ISNA 4ABHA 1GHAG 3M7QA 1WYKA 1G3DA 1AFQC 3U8OH 9LPRA 3G01A 1OYTH 1T4UH 1YPHE 1DY9A 2HNTF 1RJXB 4Y71A 1ZRKA 3Q77A 5HXFA 1FDPA 2FOEA 2B7DH 5DKMA 4ZAEA 2G8TA 1IQEA 5DP5A 3A7WA 4ZXXH 1O3PB 1P11E 1C5NH 1DLEA 2BHGA 3V7TA 1TGNA 3GY5A 4JMYA 2AIQA 1WUNH 1HJAB 4O97A 2ZFSA 1TAWA 5JPMH 1UMAH 4DT7B 2ZGXH 5IYTA 4ZUHA 2GCTC 2TPIZ 5C2ZA 1VR1H 2Y7XA 4THNH 1BCUH 4RN6A 4B73A 3C1KA 4DURA 2BXTH 1AHTH 1L2EA 1JRTA 2GDEH 1SLXB 1C2HA 3MO6A 1AVWA 3FP7E 4BAMB 1EPTA 1ZGIA 2VINA 4K8YA 2TGAA 1C5XB 2ZDMA 1RTFB 3KL6A 1O2RA 1DUAA 3A84A 4K1TA 4YLQH 1AGJA 1N6XA 2BDYA 2O8MA 1S83A 2STBE 3CS0A 3T28A 1LHGH 2BD4A 3QK1A 4NSVA 4J1YA 4Y76A 1O2JA 1EATA 1WSSH 1A46H 4AFSA 3RXHA 3NKKA 1YM0A 2D2DA 2OC8A 5ETXA 2GX4A 2GP9B 1JRSA 1TPOA 2A45B 4FVDA 1AD8H 3RMLH 4X2YA 1SGIB 1MTWA 1ACBE 3T2NA 5EW1H 1J17T 3A7TA 4WY3A 2F9NA 1NC6A 4B1TA 3FZDA 1GI6A 4I8GA 1A0JA 3KCGH 3BTWE 2J9NA 1V2OT 2EI8A 4OS4A 1KDQB 1Q2WA 1YPJH 3RXAA 3MNBA 1CVWH 5HMAA 3LONA 2ZU1A 3SN8A 4NCYA 2FOCA 5LPEA 3VB7A 3B8JA 4ZMAH 2BY5X 1RGQA 5JB9S 1WTGH 4D7GA 3I78A 3EQ0H 3W94A 2ZFRH 3SV8A 4X8SH 2J95A 1SGFG 1C5VA 1O2OA 1EASA 2D26C 1C5SA 1XVOA 3SW2B 1O3LA 1Y3UA 4ISIH 1J15A 4WF8A 1HFDA 1A5HA 1SGNE 5EOKA 2TRMA 2V35A 3FVFB 1QJ7B 1O2VA 1QA0A 3PO1B 1HB0B 3U8RH 3V3MA 3IG6B 2ZG0H 6GCHG 3TJVA 1P01A 5A8XA 2OQ5A 1PPHE 1WQSA 5EXNA 1AZ8A 2OP9A 1BHXF 4GHQA 4ABIA 4ZKRU 1F0UA 3SGBE 3A85A 1O2NA 4DIHH 3U9AH 1GVKB 2G81E 4CBOA 2QA9E 2A4OA 3MU5A 3QTOH 1MTUA 1OS8A 4B76A 4KELA 3GY2A 1O3NA 2ANMH 2Q1JA 2BDBA 1GL0E 2ILNA 4CR5A 3S9CA 4D9RA 2BD9A 1FPCH 1GJ6A 3RXQA 1P02A 3U98H 1Y3VA 2VVUA 1ZJKA 3A80A 4XSKU 2UUKB 3ITIA 2ZFTA 1ZTKA 2A4RA 1UCYE 2NU0E 4HTCH 2BDIA 1O3JA 5EU8A 5L2YH 4YLUA 1MTNB 4GUXA 4WH8A 1TRYA 2G52A 5J4SA 4CRGA 1AVXA 1ABIH 1HJAC 1QURH 4NA9H 3LGWA 1A4WH 2JETB 4MTBA 3FP6E 1L1GA 5ABWA 2OCVB 1SLWB 1ZJDA 1YPKH 2PW8H 3SUEA 2YOLA 1EAIA 3CP7A 3SNBA 1ANDA 1C1PA 1HUTH 1TNHA 2PUQH 2O8LA 2W5EA 2XWBI 2WV5A 2WYJA 1ANEA 4FUHA 1YYY1 2BY6X 1OP0A 3VB3A 2Y80A 2FODA 4UDWH 3K9XB 1H9LB 1ARCA 2VVVA 1QTFA 1V3XA 2TGTA 2PR3A 1EXFA 3S0NA 2B5TB 1UCYK 1NTPA 1Y5AT 1G3BA 4OS5A 3A7VA 2Y5GA 1GI4A 3RXUA 2G5NA 4YOGA 3ESTA 2SNWA 1CSOE 5I46H 2AMDA 3MWIU 2XW9A 1DVAH 1O36A 3LOXA 1SGRE 2BM2A 5JBCS 3A89A 1DWCH 1KXDA 1THPB 1QB9A 5DP8A 2Y5HA 3SU1A 2GGVB 5BPEA 2QXIA 1LDTT 1K2I1 1G32B 2PKAB 2ZPSA 3GCTF 2J2UA 2FTMA 1GBJA 4IN1A 3RXLA 4I31A 2FESH 3E8LA 3RXEA 5SGAE 3SI4H 2LPRA 1KLIH 2SGPE 1PPEE 1H8DH 1A5IA 2ZWLH 4K5ZA 1MAYA 2QY0B 4IGDA 4ZKOU 2J4IA 1C2EA 2FI3E 1ETRH 2XCFA 1V2LT 2FS9A 1W0YH 3A7YA 6LPRA 4LZ4B 1Z6JH 1Q31A 4GCHG 1HAXB 4MPUA 3UQOA 1GJCB 1CHOG 1TX6A 2ZQ1A 1GVLA 1WAYB 4AG1A 2FTLE 2GVFA 2BTCE 1BMMH 1P8VC 1KY9A 1E0FD 5DO4H 3P95A 3QGNB 4BAKB 1GHWH 3ZZAA 2NU4E 1G36A 1V2MT 5F8TA 1KTSB 1ABJH 2GZ8A 2FI5E 1E36B 2QIQA 3S9AA 1OXGA 3PLKA 1NFYA 1FI8A 1W14U 1H8IH 1IQLA 1W0ZU 1Z7KA 4WMEA 5I25A 1NRPH 2C8WB 5HGGA 4PROA 3LDXH 2O8WA 2OC0A 1IQHA 1DE7H 3NCLA 5JBTA 1GBAA 3ZVCA 2FYRA 3TH2H 2WPLS 3ZZ4A 4E06H 2A5KA 4E05H 3EA7A 3Q76A 4AOQA 1O3DA 2F9OA 1CT2E 2VGCB 5E8EH 1GJ8B 1O5BB 1HAOH 3JZ1B 2FS8A 1T8MA 3UOUA 1P03A 4GVUA 3TH4H 1P05A 2JH0D 3NK8A 1TX7A 1TGSZ 1WQVH 5DP6A 1B7XB 4D9QA 4FUCA 1GG6C 2W7UA 1C4V2 4XFQA 2ZGHA 1A0LA 2P8OC 1GBEA 2J92A 1SLVB 1EB1H 3A82A 3F68H 4ISLA 4MPWA 1UVSH 3MO9A 1S81A 3RLWH 2Z9JA 5DP3A 5E0JA 3KQDA 2A2XH 3SGAE 3L3TA 1ESBA 2D8WA 3M61U 1P2OA 5EODA 1BRBE 1ZSKA 1C5UA 1Y59T 1V2NT 3UWJH 2GCHG 4A1XA 2A7CA 3P6ZB 4SGBE 3A7XA 3RXGA 4GSOA 1QL8A 1OYQA 1E38B 1K28D 4Q2KA 1QL9A 3K65B 1TABE 2BOKA 1NT1A 1EZXC 1L1NA 4DJZB 4X6MA 1UK3A 2Z3EA 3ZZCA 2TGDA 1A1RA 1C1RA 3ATKA 3OSYA 2F9UA 1SOTA 8GCHG 1FONA 3RC6A 2DE8A 4A5TS 1CT4E 1TOMH 3QZRA 5ESBA 4M7GA 1GI8B 4LOYH 5AFYH 1P57B 3KQCA 3RXOA 1D3TB 4FVBA 1FNIA 4GHTA 4X6OA 2Y5FA 1HLTH 4ABAA 4Q80A 2BB4A 3MH5A 1C5RA 1P3EA 3RMNH 1NFWA 1O5FH 1OX1A 3O8CA 2F91A 3L33A 3AASA 2RA0A 2ZC9H 3BG4B 3SUDA 1AFEH 3PMAB 1OKXA 3TGIE 2A31A 3MTYA 4B71A 2ZDVH 1LHCH 5DP4A 1AQ7A 1C9PA 3M5NA 2BD5A 3EE0B 4O9VA 5EXLA 2ALPA 3UNQA 1TFXA 1F5LA 1RS0A 2FEQH 3KF2A 3LH3A 2WPIS 4D7FA 1C9TA 1TBRH 2H2ZA 3VGCB 1QGFA 5C1UA 4ZROA 3ATWA 4IC5A 1HAYB 3A8DA 3OX7U 1P06A 3QDZB 3GYMA 1MZDA 5FCRA 3T27A 1YPHC 1GMCG 2ASUB 2RA3A 3A8CA 3A8BA 2PGBB 3SU0A 2HVXA 1YCPK 1L4ZA 2VIVA 2XBWA 2W7SA 1ANCA 1P10A 1MKXH 1ELAA 1MTSA 1OPHB 3BTME 2BZAA 4X1RU 1O33A 1O38A 1AWHB 1PPFE 3BG8A 2OD3B 4RKOB 2JH5D 2FX6A 1FQ3A 3GYLB 4ASHA 1F0RA 2J94A 2XBXA 1O2HA 1J9CH 1S6FA 1K1MA 2EEKA 1FMGA 3N7OA 1HJ9A 3IWMA 1CBWB 3F9FA 2XBYA 1K1JA 1KXBA 4MG3A 3UQVA 1G3CA 3T25A 1F0SA 1ZHMA 2HALA 2BYAX 2O8TA 1JIRA 5FPTA 2FOBA 3KQEA 3LC5A 4LZ1H 4B2AA 4NIYA 1TA6A 1DWBH 1FLEE 4Y7BA 4A6LA 1PQAA 3ZV8A 2Z9GA 2CV3A 3ATIA 3BEFB 4NGAH 5PTPA 1O3GA 1G3EA 1NRRH 6GCHF 1YF4A 1NRSH 1JMOH 3LGVA 1IAUA 5C1YA 2AMPA 1SGTA 3HGPA 3OYPA 1QA7A 1P3CA 1O3OA 3HKJB 4B2BA 1QRZA 2H1UA 3RXKA 3UUZA 3SU5A 3P70B 3GY7A 1O3BA 1LCYA 1O3KA 3RM0H 3SI3H 2ZPQA 3BN9A 1GI3A 1HIAA 1C1WH 1GGDB 2J38A 4ZH8A 4WJG2 2RCEA 2C8XB 4YO9A 1GDQA 2OTVA 4BOHA 5FPYA 1A7SA 4BAOB 1ORFA 1GI7B 1AVGH 2QF3A 1MUEB 1QCPA 4BTTB 1DX5M 2C93B 5EG4A 1F5KU 1GJ9B 1RD3B 1TNJA 4UD9H 1BRUP 3DFLA 4MNYA 1LVBA 1GCTB 3AW1A 4BTIB 4B74A 3K2UA 4JK5A 4VGCB 1O37A 2ZDNA 2A2QH 5FPSA 1XXDA 3I77A 1Y5UT 1BJVA 1UTOA 3SORA 4H4FA 1KXEA 3MI4A 3JZ2B 5DG6A 1TGBA 3SV2H 1BBRE 1QB1A 4DY7B 2VIOA 1FPHH 5L6NH 3M3SA 1BMNH 3ZZ7A 2Q6DA 2V6NA 2ZEBA 5TCCA 1GBHA 4JCNA 3KHVA 3ZVDA 3M5MA 3SQEE 1K1PA 2OC1A 2ULLA 2R0LA 1F0TA 1UTKA 3GY8A 4IW4E 4CHAC 2LNCA 2IOTA 5DJ7A 4BXSA 3ZZ8A 4Q7YA 1O5EH 1E34B 1LVOA 1SGFA 1TRNA 1QQUA 2W26A 1OWEA 2ZECA 1ETSH 3UIRA 3GCHB 4HI3A 3EA8A 2GD4B 4AZ2B 4WH6A 1S5SA 5A8ZA 1SGCA 3ZZDA 3LIWA 1P2MA 4U2WA 1CO7E 2QC2A 1GCDA 1GHXH 1C5WB 3U1JB 1K1LA 2R3UA 2ZDAH 1O2UA 1C2MA 1ZHRA 2NWNA 2XCNA 2ZO3H 1O2WA 3RXCA 3A8AA 3LGTA 2AGEX 4DVAU 4O03A 1V2ST 1O2XA 1AMHA 4YZUA 5C3NA 4CBNA 1GI2A 1O2KA 2ANWA 2R2MB 3GY3A 2ZHEH 4RKJB 1C2KA 1DITH 4HZHA 2P94A 3TNTA 2EA3A 3RXMA 2ZU5A 1HAGE 3SNEA 3AVZA 2O8UA 3UTUH 1IQMA 2VIWA 4K2YA 4LK4A 3HK6B 1P2NA 1HPGA 1ID5H 3KGPA 3ODDA 2FOGA 2HNTC 1XX9A 1BTUA 3L6PA 4SGAE 1GBKA 2G51A 4MQAA 4ZHLU 2AH4X 5C67A 3F9HA 2QN5T 2HOBA 3LGYA 1SOZA 1L4DA 3B9FH 1VITH 1XUJA 3PYHA 2VH0A 2HPPH 1NM6A 1TALA 5LPRA 3BTTE 1UVPA 2ZCKP 1GBTA 1P9SA 2P3TB 3RC4A 4TPIZ 3DT0H 4K69A 3Q3KA 1NESE 1EKBB 3VB5A 2F3CE 1UK4A 4XOJA 3RXPA 3LGIA 3NWUA 1RTKA 4Z0KA 4I33A 1O2YA 1S82A 1DPOA 5T6DA 2ZNKH 2M5TA 4NA7A 5DK1A 5DGJA 4I7YH 5GIBA 3M36A 2XXLA 2Z7FE 4DG4A 1D4PB 1GMDF 1TYNA 3MMGA 4LXBH 4R8TB 1EJMA 1TB6H 2PLXA 1LVYA 2P8OB 4GAWA 2UUJB 1WTHD 1VITG 1T8NA 2ZFQH 4K8BA 3TGKE 3BEIB 1GBLA 5GCHG 1ZMNA 1MQ5A 1C5ZB 2BD7A 1FY5A 3TK6A 4NG9H 3P8FA 1ZSLA 1QRWA 5EQQA 1GPZA 1ZMJA 2G4UA 2ZQ2A 4JK6A 4KTSA 1ZSJA 2DE9A 1FIZA 3EYDA 2P3FH 1BTPA 4Y7AA 2AIPA 1ZMLA 4NIVA 4KGAA 1N1LA 1LKBA 2FX4A 2F9BH 1EUFA 1IQNA 1CQQA 1C1QA 2C8ZB 2FI4E 2VWNA 1UK2A 5HM9A 1CHGA 1IQIA 1DY8A 2TIOA 1YGCH 1HJ8A 5TJXA 3ZVEA 3NPSA 1O2GH 1FY1A 4KKDA 5FCKA 1P2IA 3WY8A 2FIRH 1ELDE 1DSTA 4BNRA 4ZHMU 4BTUB 4I8HA 1V6DA 4CHAB 1L0ZA 5GPIB 4IMZA 1O5CB 1TONA 2VH6A 1LPZB 1Z71A 1J14A 1FIWA 1BHXB 1UVOA 3ATMA 3OY5U 4K3JA 3K6ZA 3MNCA 5CHAB 3BSQA 1BA8B 2XC5A 1E37B 1DANH 3PMBB 4H42U 1GBBA 3QO6A 3UR9A 3E0NB 4Y0ZE 1AE5A 7GCHG 1O2PA 1SGEE 5AVDA 2ZI2H 2BLOA 1V2WT 3BTGE 5DPAA 4AN7A 1TNIA 1UJ1A 1AZZA 1QFKH 2BOHB 1SG8B 4VGCC 1A2CH 1F5RA 1ZGVA 5CE1A 3E90B 2NU3E 1XUGA 4IN2A 3UREA 3RXFA 2UWPA 3LPRA 4A92A 1UVUH 3FZZA 1SB1H 3SBKA 3SU3A 3TNSA 4DW2U 3TK9A 1GI1A 3PO1C 5TCAA 4FUEA 4MNVA 1DICA 3AAVA 1VZQH 1EQ9A 3QGJA 1SC8U 4TY6A 2RDLA 3VB4A 3GICB 1Y8TA 1DXPA 1TA2A 2EC9H 1VCWA 2GV6A 2C8YB 1ELTA 1SGPE 1ZZZA 3UY9A 4D76A 1Z6EA 2BVRH 1ETTH 1ANBA 1J16A 1BZXE 4X8UH 3GY6A 2IPHA 5AFZH 2BDCA 5H4IB 1JXPA 2PV9B 1CHOF 4J2YB 4OS2A 3SQHE 2GDDA 4NWKA 1TMTH 1CBWC 4FU7A 2C4FH 3UNRA 3LJOA 2Q6FA 3KN2A 4X6PA 3UPEA 4AFQA 3DHKH 3LJJA 4X1PU 4ESTE 1HIAB 2ESTE 1SBWA 5K0HA 3U8TH 3TLOA 4K1EA 2BVSH 3TK5A 3RXVA 3M7UA 1NN6A 4HFPB 1W7GH 1EPTB 1HNEE 1N8OC 2A4QA 1NRNH 3SNAA 4TPYA 8KME2 5JDUB 1D3QB 4Z6AH 1D3DB 2FWWA 1TGCA 1ZYOA 1WCZA 2QYIA 1MU8B 3VGCC 2HRVA 3STIA 2FP7B 1Y5BT 2K1QA 1D6WA 4ISHH 1O2TA 3SZNA 2SGQE 3SU4A 3MHWU 1CT0E 4AORA 2ZPRA 2SNVA 3MFJA 2BDAA 4X8TH 2BDHA 1V2QT 3NZIA 3V13A 3F9EA 3VEQB 2OUAA 1CGHA 1DS2E 1O32A 5JB8S 3A88A 4UFGH 7GCHF 1FY8E 5HYOA 3RU4D 1DWEH 3TVJB 5J4QA 1HAHH 1MBMA 1HAVA 5G4BA 1A3BH 3KIDU 1O3CA 1XUKA 4JZIA 3EA9A 2ZTXA 1ZPCA 1TIOA 1GCTC 1KXAA 5DP9A 4AGJA 1ELBA 5EPYA 1SL3A 3UWIA 2ZU3A 1TGTA 4INLA 1BUIA 1JOUB 1W11U 2VWMA 1GHZA 1EJAA 1Z8IB 4FUIA 6CHAC 3GISB 4UFEH 2ZDKA 2P93A 3TIUA 4JZEH 4Y11E 4B2CA 2VIQA 1PQ8A 2YNAA 1E35B 2GV7A 1JIMA 1SQTA 1PPGE 1Z8RA 2CHAB 1G30B 1JBUH 5CHAC 3BTKE 7KMEH 1SMFE 1GGDC 4ABFA 1DSUA 3HK3B 3HPTB 3T5FH 1DDJA 2V3OH 3RXBA 1DXWA 1C1VH 1AI8H 3D65E 2Z3DA 2STAE 1B0EA 3ZVGA 5E0GA 1HGTH 1SQOA 3PLPA 3D62A 1C5YB 2Z3CA 2CF8H 4YM9A 2AFQB 2A4GA 1IOEA 2PWXA 5A0BA 9ESTA 1YPLH 3TPIZ 1Z1IA 4ABEA 3RXRA 1Q3XA 3GCNA 2FLRH 1L1JA 1HRTH 4NZLA 1LO6A 1DLKB 1ZPBA 3PTNA 2AYWA 4IBLH 4YOJA 2QAAA 1IQFA 1ZTJA 2AGGX 3QLPH 2ANKH
chains in the Genus database with same CATH superfamily
1X7AC 3CS7A 2B9LA 1YPEH 2WHXA 4YT6H 2PSXA 2BMGB 2KAIB 2ZA5A 1P09A 1UTQA 1EAUA 3DFJA 5A2MH 3Q00A 3UAIC 2R2WU 4KP0A 1LPGB 1UTJA 3UOPA 3HKIB 2A7JA 2Z6BD 1XXFA 4I8KA 1SR5C 1HAVB 2BQ6B 4I32A 2Q6GA 1RIWB 3SV6A 3GCTG 1UVTH 4F48B 2IJOB 2RDEA 8ESTE 2ZHQH 1KSNA 1C5QA 1EOJA 2A32A 1AY6H 3OU0A 4O3UA 1FY4A 1G2LA 1LPKB 5E2OA 2QXGA 1KMHB 1OOKB 1ELGA 2J5UA 5GWZA 1EAXA 3SUGA 1T7CA 3DUXH 4AB9A 3H5CB 5FAHA 5EGMA 4ZCNA 1G9IE 2V0BA 1IHTH 3U1IB 3BF6H 2GT8A 2CHAC 1D9IA 1HV7A 2GKVE 2GT7A 5ESTE 1PPCE 1ZOMA 4RT1A 4JZ1A 2G5VA 4DOQA 2BD3A 3VPKA 3QWCH 1W12U 2PKAA 5F03A 3GOVB 1S0RA 3HATH 2THFB 1GI5A 5A0CA 4ABBA 5T6FA 1V2VT 1MU6B 3A86A 1OP8A 3CENA 1QJ6B 3PM3A 4MNXA 3KEEA 3STJA 4WWYA 3BEUA 3SHCH 3VXEH 1FV9A 1MTNC 1K21H 1C2IA 3AK5A 1K1NA 1FZZA 2ZIQH 2PP6A 2RFKC 1EZQA 2GZ7A 2VIPA 2QV1A 1A5GH 3H7OA 4BANB 1Y3YA 1XKAC 1V2PT 1QB6A 1C5PA 1KIGH 3IITA 2FDAA 1PPBH 1AB9B 4TYDA 1K9OE 1BQYA 1GJBB 2Y81A 2ZFFH 4FUGA 1MMJN 4FUJA 3ZVBA 2VB0A 2J34A 1O2LA 2W6JD 5DP7A 1LHFH 1DOJA 3M7TA 3RM2H 1WDIA 4MPXA 2WV4A 4NA8A 1VCPA 1A3EH 3PV4A 4ASUD 4CH2B 1ZR0A 2UWOA 1CA0C 2PSYA 1EZUC 1LQEA 4FU8A 3P8GA 2VIDA 1EB2A 1JWTA 4WMDA 3ZVFA 4R0IA 3RU4T 3QX5H 1BMLA 2KCPA 1B5GH 1FN6A 3V0XA 4Q7ZA 1BRCE 1C1NA 1FAXA 4AGKA 3URCA 1NO9H 2QF0A 4U01A 1TQ0B 2I6QA 3M5OA 1AFQB 1BTHH 1YC0A 4XRNA 2JETC 4AB8A 3K6YA 1QNJA 4AFZA 4UFFH 1UTLM 2IN2A 2ZFPH 1TNKA 1G2MA 4K1SA 4X1QU 2BX4A 4YT7H 2NU2E 1GMHG 1ZPZA 1DFPA 1UW7A 2HNTE 4BAQB 5E2PA 2H5DA 3TJNA 4OS1A 2BX3A 1GBFA 2FM2A 2BD2A 2L74A 1LQDB 5FX5A 1CE5A 1BBRK 3NUMA 5LGOA 4JYVH 3PMJA 1TPPA 1UHBA 1HAZB 3R0FA 1FXYA 2A5AA 1IQGA 2UUFB 2XTTB 3Q3XA 4BAHB 1BT7A 2ODYB 4A1TA 2R9PA 1QHRB 1TQ7B 4X6NA 2CF9H 2BLVA 2TGPZ 3MH7A 1Y3XA 1N6YA 4IS5A 1FAKH 2QXHA 2PKSB 2SGDE 1C2FA 2TBSA 1P0SH 1T8LA 2W3IA 2FO9A 1Z1JA 4CRCA 1KXCA 2AS9A 5HIZA 1YWUA 5C1XA 4Q63A 1MBQA 1AB9C 2FLBH 1F2SE 5A8YA 2V3HH 1TBZH 1SHYA 1GDUA 3T29A 5C5NA 8GCHF 2ZGBH 2FOMB 3DCLA 2BXUH 1BMFD 1NU9A 1PQ7A 4H6SB 5L2ZH 4INKA 1OSSA 1VGCB 2KAIA 4MPVA 3DSOA 1NROH 1W13U 1S6HA 4NZQA 3DD2H 1WV7H 1TMBH 1AWFH 4XBCA 1GBIA 1MD8A 1QBVH 1O3MA 2SFAA 1O5AB 2EI7A 2CGAA 3TITA 3PWCA 4CRDA 1YLCA 1ZHPA 2KCAA 1KLJH 4YTAA 2NU1E 1AKSA 3UFAA 1ARBA 4X8VH 1O2MA 2BY9X 1ELEE 3MYWA 3MU4A 2H9TH 3N99A 5AF9H 1O31A 2ZCLP 3GCOA 5DSFA 3SJ9A 4NSYA 2PTNA 1UO6A 1OWHA 2VU8E 3EE7A 4GCHF 4ZKNU 2WUCA 1GHVH 1W0JD 1OWIA 3BTHE 4K60A 3BTEE 2HGTH 2R3YA 2PUXB 4X2VA 2CXVA 2KM0A 2JJ2D 1XVMA 1TRMA 2OC7A 6ESTA 1GBDA 2OINA 1C5LH 3N7DA 3BTFE 1FN8A 4F4OC 4OS6A 2P3UB 3A83A 4U32A 5L30H 1NBME 4QT8C 1WU1A 3M5LA 1RIWC 2F83A 3EGKH 2A1DB 3S69A 1BTWA 1UCYH 3V12A 3UB0A 1GG6B 1V2UT 1ZLRA 4TSFD 1YCPM 2QCYA 3ZZ6A 1PYTD 1QBOA 1EAWA 1C2JA 1QZ8A 1O2SA 3TH3H 1SGDE 1C1OA 3TJOA 1ZTLA 2WUBA 3S7KB 3UNSA 2OQUA 4X1SU 1SPJA 3W95A 1T8OA 1H9HE 1ELCA 2OXSA 1Y3WA 4NWLA 4YOIA 4ABJA 2FOAA 2B8OH 1PYTC 2F4LA 1C1UH 1TBQH 3M37A 3OTJE 4DCDA 4WVPE 5EW2H 1AE8H 3E91A 4ABDA 1HCGA 1UTMA 1GMDG 1NZQH 4X2XA 2P59A 1BMAA 2H5CA 1GJ5H 2HLCA 2AGIX 5C20A 1EOLA 1LMWB 1P2QA 3MH4A 1GJ7B 4H6TA 4OS7A 1EFRD 1YBWA 2Z9KA 3S7HB 1ZRBA 2AERH 2Y7ZA 1C5MD 1OWKA 1GI0A 1QY6A 1EP5A 1MZAA 2UWLA 4TWWA 3MNXA 2G4TA 5LH8A 1K1OA 3BTQE 1S84A 1PFXC 1YP9A 2CN0H 2ZP0H 4IMQA 5GJ4B 4TWYA 1BOQA 1OWJA 1CGJE 2BY7X 3UR6A 3D49H 1P12E 3ZZ5A 1SLUB 2PHBA 2WINI 4XE4A 3MO3A 5E0HA 3ELAH 4XBDA 3OAAD 3FANA 2F9VA 2BD8A 1C2LA 1YCPH 3SNDA 4XBBA 1C5OH 2CK3D 2Z9LA 2VVCA 5FBIA 3PB1E 5GDSH 3BTDE 1MKXK 2ODQA 1C4U2 4U30A 1HBTH 2RG3A 1K1IA 1VCQA 2ZU2A 1V2JT 1TOCB 1MH0A 3U28C 1VGCC 1O30A 2SGFE 1HAIH 7ESTE 5FHTA 2CJIA 2GMTB 3A7ZA 5GCHF 4F49A 3EDXB 1A0HB 2ZHFH 1GHAF 1P2KA 4CREA 1O3EA 3U69H 1GJAB 1TMUH 3F9GA 1O0DH 5FX6A 3CNRA 1T4VH 1E1QD 3URDA 2PFEA 7LPRA 1NFXA 5FBEA 2SGEE 1GDNA 3SNCA 4E7NA 5IDKA 2VWLA 1SFQB 1D6RA 2JKHA 1QBNA 3LKWA 1RTLA 3BIVH 3E0PB 4Y10E 3TGJE 1OWDA 5KGOA 5EPNA 2QXJA 1MCTA 1SI5H 1PQ5A 2W3KA 3AW0A 3TU7H 3I29A 2A7HA 3MOCA 2Z9IA 1TNGA 2VWOA 4FUBA 4DIIH 1FJSA 1IQJA 1PPZA 1BIOA 4IC6A 3GDUA 4RSPA 3P17H 5HM2A 5C5OA 2F9PA 5T6GA 2UUYA 2OLGA 2ZF0H 4Y6DA 3RXIA 3S9BA 1AN1E 4Y79A 2GMTC 4KTCA 1QL7A 1O3HA 2ZGJA 3M35A 3ODFA 5FXLA 4D8NA 1GMHF 1EP6A 3DSPA 1C1SA 4CR9A 1NRQH 3NXPA 1GI9B 3PLBA 3A87A 1YKTA 2WPHS 3SJOA 2H9HA 1RRKA 3LH1A 1XKBC 5F8ZA 1C1TA 2AMQA 1AU8A 1KXFA 4B6FA 3VB6A 2D1JA 3RXSA 1UTPA 2ZCHP 4GLYA 1O5DH 3FAOA 3SV9A 2YNBA 1BRAA 4AFUA 2GZ9A 4CRAA 3PTBA 2Y6TA 3SU2A 4TY7A 5AHGH 1AKSB 4MDSA 1CA0B 3F1SB 2H6MA 1GHBF 5F6MA 4X2WA 2G55A 1V2TT 2H9EH 1THSH 1RFNA 1B0FA 1EX3A 4JYTA 2XNDD 3O8RA 1O2ZA 2BLQA 1G37A 1LHDH 1MKWK 1HYLA 1H4WA 2ZHWH 3OY6U 2ZDLA 1CU1A 2B0FA 2XWAA 1TWXB 1W10U 4AYYB 5JBBS 3RXTA 2EY4C 3KQBA 3P8OA 3F6UH 3RC5A 3FOAA 5JBAS 2XC4A 1XUHA 2HWLB 5GNDA 1VJ9U 4ZXYH 3SUFA 5HIYA 2JIZD 2ZU4A 3BG4C 5EXMA 1T32A 2GCTB 1O3AA 5CMXH 5JYIA 3QTVH 3SHAH 3PWBA 3O8BA 2XOKD 1DWDH 3TJUA 2FOFA 4ISOA 1BDAA 2J98B 1Z8GA 4NFFA 1BITA 3P92A 1HXEH 1MABB 1NPMA 3DSGA 1KDQA 3RXJA 1GJDB 4Y0YE 4X0WU 2ZZUH 1LVMA 1GHYH 1F7ZA 2QGRA 4BXWA 4Y8YA 8LPRA 1MCVA 4UEHH 1O35A 3KNXA 3M3VA 4FUFA 4ZHAA 1BBRH 1BTXA 3T62A 1S85A 1UTNA 3Q3YA 3ZYEA 2FXRA 3ATLA 1QR3E 4XDEA 3O8DA 1O3FA 4JYUH 3BIUH 2FPZA 1GMCF 2ZGCA 1O2IA 2P95A 1MKWH 2WPKS 2ANYA 2O9QA 3LT3A 3OTPA 5T3HA 3EAJA 1DT2A 1H1BA 1IHSH 2Z94A 3MU8A 2BVXH 1SFIA 2OBQA 3AAUA 1HAPH 2A5IA 1V2RT 1MTVA 4UE7H 4M9FA 3D23A 2FMJA 3LU9B 3PMHB 1WOFA 2PGQB 4MVNA 1U6QA 3ZZ9A 4A7IB 4ABGA 1ESTA 5IK2D 2XBVA 1THRH 4FXGH 1GWAA 4CRFA 1J8AA 1C4Y2 4INHA 4NFEA 1QQ4A 3WWBA 5B6OA 5A0AE 4I8JA 2BQ7B 2PTCE 3GY4A 3P8NA 1HDTH 2K0QA 2XRCA 5GXPA 2EI6A 4XD7D 1SSXA 2BQWB 3M3TA 4NIWA 3GDVA 3BV9B 1VITF 1OP2A 1NFUA 1TPSA 4NIXA 3RXDA 1H9IE 1O3IA 1GBMA 5EQSA 1TE0A 3ENSB 2A0QB 3R3GB 4WXIA 1NU7B 3SV7A 1VJAU 4Y8ZA 4JZFH 4JZDH 3ZYDA 1S0QA 4I8LA 1BTYA 1O5GH 1P04A 1CA8B 1C1MA 1K22H 2P16A 1YPMH 3HGNA 1EJNA 1W7XH 3QZQA 4OGYA 1LKAA 3A81A 4RI0A 1TLDA 1GVZA 1O2QA 2ALVA 4AG2A 2CMYA 4ZKSU 3ZZ3A 1CGIE 2KX4A 5EJLA 3VXFH 1BJUA 3FFGA 2R0KA 5LPFA 2XC0A 2AEIH 3H7TA 1LTOA 4DGJA 4WMFA 1INCA 1F92A 4OGXA 3C27B 4P00A 4A1VA 1GL1A 3E1XB 4CH8B 1NS3A 2WPMS 4WXVA 1Z8JB 4E7RG 2C90B 4AYVB 1BTZA 1AO5A 2OBOA 2WYGA 2QE7D 1C2GA 2VNTA 1BB0B 1C5TA 1O39A 4AX9H 3RUOA 3DA9B 1YLDA 3ZV9A 2FOHA 3LGUA 1IQKA 1W3CA 3RMMH 3T26A 1MD7A 2C3SA 3E3TA 3SO3A 1GBCA 4Q7XA 2DUCA 4HGCA 2BY8X 1TNLA 1M9UA 2HPQH 4GPGA 3QUMP 3LC3A 4B75A 1SVPA 4KTUA 1XUFA 2BZ6H 1XMNB 4FUDA 4O3TA 4Y8XA 3VFEA 6CHAB 1D3PB 3QN7A 1XUIA 1O34A 2KZ4A 3RMOH 2ZHDA 2FYQA 1W2KH 1GJ4H 3E6PH 5BRRE 1K0HA 3ZZBA 4MLFB 2ZTYA 1KYNA 3MH6A 1AUJA 1RXPA 3SU6A 4MNWA 3GCHC 1HXFH 2I6SA 3GDSA 1QJ1B 3RLYH 1ELFA 1DM4B 1QRXA 3SJ8A 5K7RA 2BDGA 5FL7D 1S6LA 1WBGB 1FUJA 1KLTA 1AUTC 1A61H 3E16B 3ZVAA 3SOSA 2SGAA 2ZTZA 2PKSC 1TPAE 4UONA 1LHEH 3SJKA 4CRBA 5A09A 1ELVA 2WPJS 3RU4E 1QIXB 1TX8A 3RP2A 4FU9A 2Y82A 1ESAA 2G00A 3MNSA 1SGYE 1DUEA 1V2KT 4YESB 1P2JA 5F8XA 1NY22 1C2DA 2XNIA 2XYAA 1EZSC 1GHBG 2FZZA 2VJ1A 3SGQE 1KTTB 3RDZA 1MQ6A 2BLWA 1XM1A 1AIXH 5EQRA 2ODPA 1P9UA 1UHBB 2GTBA 1SQAA 3MU0A 1T31A 1PJPA 1SHHB 1W8BH 1SGQE 3FP8E 3SJIA 1MAXA 1N8OB 2VGCC 3PROA 4UFDH 1EPTC 3MU1A 2ZKSA 1YPGH 1FY3A 3B23B 4X1NU 2KCOA 2GCHF 2JH6D 3GS9A 1GHAG 3M7QA 4ISNA 1WYKA 1G3DA 4ABHA 1AFQC 3U8OH 9LPRA 3G01A 1OYTH 1T4UH 1YPHE 1DY9A 2HNTF 1RJXB 4Y71A 1ZRKA 3Q77A 5HXFA 1FDPA 2FOEA 2B7DH 5DKMA 4ZAEA 2G8TA 1IQEA 5DP5A 3A7WA 4ZXXH 1O3PB 1P11E 1C5NH 1DLEA 2BHGA 3V7TA 1TGNA 2L6OA 3GY5A 4JMYA 2AIQA 1WUNH 1HJAB 4O97A 2ZFSA 1TAWA 3F2HA 5JPMH 1UMAH 4DT7B 2ZGXH 5IYTA 4ZUHA 2GCTC 2TPIZ 3F0PA 5C2ZA 1VR1H 2Y7XA 4THNH 1BCUH 4RN6A 4B73A 3C1KA 3OEHD 3FKSD 2BXTH 4DURA 1AHTH 1L2EA 1JRTA 2GDEH 1SLXB 1C2HA 3MO6A 1AVWA 3FP7E 4BAMB 1EPTA 1ZGIA 2VINA 4K8YA 5F53A 2M2AA 2TGAA 1C5XB 2ZDMA 1RTFB 3KL6A 1O2RA 1DUAA 3A84A 4K1TA 4YLQH 1AGJA 1N6XA 2BDYA 2O8MA 1S83A 3WWFA 2STBE 3CS0A 3T28A 1LHGH 2BD4A 3QK1A 4NSVA 4J1YA 4Y76A 1O2JA 1EATA 1WSSH 1A46H 4AFSA 3RXHA 3NKKA 1YM0A 2D2DA 2OC8A 5ETXA 2GX4A 2GP9B 1JRSA 1TPOA 2A45B 4FVDA 1AD8H 3OE7D 3RMLH 4X2YA 1SGIB 1MTWA 1ACBE 3T2NA 3SYJA 5KEDA 5EW1H 1J17T 3A7TA 4WY3A 2F9NA 1NC6A 4B1TA 3FZDA 1GI6A 4I8GA 1A0JA 3KCGH 3BTWE 2J9NA 1V2OT 2EI8A 4OS4A 1KDQB 1Q2WA 1YPJH 3RXAA 3MNBA 1CVWH 5HMAA 3LONA 2ZU1A 3SN8A 4NCYA 2FOCA 5LPEA 1E79D 3VB7A 3B8JA 4ZMAH 2BY5X 1RGQA 5JB9S 1WTGH 4D7GA 3MQKC 3I78A 3EQ0H 3W94A 2ZFRH 3SV8A 1SQRA 4X8SH 2J95A 1SGFG 1C5VA 1O2OA 1EASA 2D26C 1C5SA 1XVOA 3SW2B 1O3LA 1Y3UA 2WSSD 4ISIH 1J15A 4WF8A 1HFDA 1A5HA 1SGNE 5EOKA 2TRMA 2V35A 3FVFB 5KECA 1QJ7B 1O2VA 3PRDA 2JDID 1QA0A 3PO1B 1HB0B 3U8RH 3V3MA 3IG6B 2ZG0H 6GCHG 3TJVA 1P01A 5A8XA 2OQ5A 1PPHE 1WQSA 5EXNA 1AZ8A 2OP9A 1BHXF 4GHQA 4ABIA 4ZKRU 3FO8D 1F0UA 3SGBE 3A85A 1O2NA 4DIHH 3U9AH 1GVKB 2G81E 4CBOA 2QA9E 2A4OA 3MU5A 3QTOH 1MTUA 1OS8A 4B76A 4KELA 3GY2A 2QF5A 1O3NA 2ANMH 2Q1JA 2BDBA 1GL0E 2ILNA 4CR5A 3S9CA 4D9RA 2F43B 2BD9A 1FPCH 1GJ6A 3RXQA 1P02A 3U98H 1Y3VA 2VVUA 1ZJKA 3A80A 4XSKU 2UUKB 3ITIA 2V3MA 2ZFTA 1ZTKA 2A4RA 1UCYE 2NU0E 4HTCH 2BDIA 1O3JA 5EU8A 2V7QD 5L2YH 4YLUA 1MTNB 1YLNA 4GUXA 4WH8A 1TRYA 4F55A 2G52A 1H8ED 5J4SA 4CRGA 1AVXA 1ABIH 1HJAC 1QURH 4NA9H 3LGWA 1A4WH 2JETB 4MTBA 3FP6E 1L1GA 5C17A 5ABWA 2OCVB 1SKYE 1SLWB 1ZJDA 1YPKH 2PW8H 3SUEA 4OM9A 2YOLA 1EAIA 3CP7A 3SNBA 1ANDA 1C1PA 1HUTH 1TNHA 2PUQH 2O8LA 2W5EA 2XWBI 2WV5A 2WYJA 1ANEA 3WW7A 4FUHA 1YYY1 2BY6X 1OP0A 3VB3A 2Y80A 2FODA 4UDWH 3K9XB 1H9LB 1ARCA 2VVVA 1QTFA 1V3XA 2TGTA 2PR3A 1EXFA 3S0NA 2B5TB 1UCYK 1NTPA 1Y5AT 1G3BA 4OS5A 3A7VA 2Y5GA 1GI4A 3RXUA 2G5NA 4YOGA 3ESTA 2SNWA 1CSOE 5I46H 2AMDA 3MWIU 2XW9A 1DVAH 1O36A 3LOXA 1SGRE 2BM2A 5JBCS 3A89A 1DWCH 1KXDA 1THPB 1QB9A 3H09A 5DP8A 2Y5HA 3SU1A 2GGVB 5BPEA 2QXIA 1LDTT 1K2I1 5CHBA 1G32B 2PKAB 2ZPSA 3GCTF 2J2UA 3SZEA 2FTMA 1GBJA 3PV2A 2VBCA 4IN1A 4P02A 3RXLA 4I31A 2FESH 3E8LA 3RXEA 5SGAE 3SI4H 2LPRA 1KLIH 2SGPE 1PPEE 1H8DH 1A5IA 2ZWLH 4K5ZA 1MAYA 2QY0B 4IGDA 4ZKOU 2J4IA 1C2EA 3OFND 2FI3E 1ETRH 2XCFA 1V2LT 2FS9A 1W0YH 3A7YA 6LPRA 4LZ4B 1Z6JH 1Q31A 4GCHG 1HAXB 4MPUA 3UQOA 4Z1MD 1GJCB 1CHOG 1TX6A 2ZQ1A 1GVLA 1WAYB 4AG1A 2FTLE 2GVFA 2JJ1D 2BTCE 1BMMH 1P8VC 1KY9A 2WV9A 1E0FD 5DO4H 3P95A 3QGNB 4BAKB 1GHWH 3ZZAA 2NU4E 1G36A 1V2MT 5F8TA 1KTSB 1ABJH 2GZ8A 2FI5E 1E36B 2QIQA 3S9AA 1OXGA 3PLKA 1NFYA 1FI8A 1W14U 1H8IH 1IQLA 1W0ZU 1Z7KA 4WMEA 5I25A 1NRPH 2C8WB 5HGGA 4PROA 3LDXH 2O8WA 2OC0A 1IQHA 1DE7H 3NCLA 5JBTA 2KCYA 1GBAA 3ZVCA 2FYRA 3TH2H 2WPLS 3ZZ4A 4E06H 2A5KA 4E05H 3EA7A 3PRBA 3Q76A 4AOQA 1O3DA 2F9OA 1CT2E 2VGCB 5E8EH 1GJ8B 1O5BB 1HAOH 3JZ1B 2FS8A 3VG8A 1T8MA 3UOUA 1P03A 4GVUA 3TH4H 1P05A 2JH0D 3NK8A 1WQVH 1TGSZ 1TX7A 5DP6A 1B7XB 4D9QA 2K8IA 4FUCA 1GG6C 2W7UA 1C4V2 4XFQA 2ZGHA 1A0LA 2P8OC 1GBEA 2J92A 4AC9A 1SLVB 1EB1H 3A82A 3F68H 4ISLA 4MPWA 1UVSH 3MO9A 1S81A 3RLWH 2Z9JA 1E1RD 5DP3A 5E0JA 3KQDA 2A2XH 3SGAE 3L3TA 1ESBA 2D8WA 3M61U 1YY3A 1P2OA 5EODA 1BRBE 1ZSKA 1C5UA 1Y59T 1V2NT 3UWJH 2GCHG 4FOUC 4A1XA 2A7CA 3P6ZB 4SGBE 3A7XA 3RXGA 4GSOA 1QL8A 1OYQA 1E38B 1K28D 4Q2KA 2YMSD 1QL9A 3K65B 1TABE 2BOKA 1NT1A 1EZXC 1L1NA 1NBMD 4DJZB 4X6MA 1UK3A 2Z3EA 3ZZCA 2TGDA 1A1RA 1C1RA 3ATKA 3OSYA 2F9UA 1SOTA 8GCHG 1FONA 3RC6A 2DE8A 4A5TS 1CT4E 1TOMH 3QZRA 5ESBA 5EJZA 4M7GA 1GI8B 4LOYH 5AFYH 1P57B 3KQCA 4ACBA 5EJ1A 3RXOA 1D3TB 4FVBA 1FNIA 4GHTA 4X6OA 2Y5FA 1HLTH 4ABAA 4DT4A 4Q80A 2BB4A 3MH5A 1C5RA 1P3EA 3RMNH 1NFWA 1O5FH 1OX1A 3O8CA 2F91A 3L33A 3AASA 2RA0A 2ZC9H 3BG4B 3SUDA 1AFEH 3PMAB 1OKXA 3TGIE 2A31A 3MTYA 4B71A 2ZDVH 1LHCH 2LELA 5DP4A 1AQ7A 2HLDD 1C9PA 3M5NA 2BD5A 3EE0B 4O9VA 4TT3D 5EXLA 3W1EA 2ALPA 3UNQA 1TFXA 1F5LA 1RS0A 2FEQH 3KF2A 3LH3A 2WPIS 4D7FA 1C9TA 1TBRH 1WXRA 2H2ZA 3VGCB 1QGFA 5C1UA 4ZROA 3ATWA 4IC5A 1HAYB 3A8DA 2EQNA 3OX7U 1P06A 3QDZB 3GYMA 1MZDA 5FCRA 3T27A 1YPHC 1GMCG 2ASUB 2RA3A 3A8CA 3A8BA 2PGBB 3SU0A 2HVXA 1YCPK 4ACAA 1L4ZA 2VIVA 2XBWA 2W7SA 1ANCA 1P10A 1MKXH 1ELAA 1MTSA 1OPHB 3BTME 2BZAA 4X1RU 1O33A 1O38A 1AWHB 3KYGA 1PPFE 3BG8A 2OD3B 4RKOB 2JH5D 2FX6A 1FQ3A 3GYLB 4ASHA 1F0RA 4I86A 2J94A 2XBXA 1O2HA 1J9CH 1S6FA 1K1MA 2EEKA 1FMGA 3N7OA 1HJ9A 3IWMA 1CBWB 3F9FA 2XBYA 1K1JA 1KXBA 4MG3A 3UQVA 1G3CA 3T25A 1F0SA 1ZHMA 2HALA 2BYAX 2O8TA 1JIRA 5FPTA 2FOBA 3KQEA 3LC5A 4LZ1H 4B2AA 4NIYA 1TA6A 1DWBH 1FLEE 4Y7BA 4A6LA 1PQAA 3ZV8A 2Z9GA 2CV3A 3ATIA 3BEFB 4NGAH 5PTPA 1O3GA 1G3EA 1NRRH 6GCHF 1YF4A 1NRSH 1JMOH 3LGVA 1IAUA 5C1YA 2AMPA 1SGTA 3HGPA 3OYPA 1QA7A 1P3CA 1O3OA 3HKJB 4B2BA 1QRZA 2H1UA 3NRLA 3RXKA 3UUZA 3SU5A 3P70B 3GY7A 1O3BA 4Q4LA 1LCYA 1O3KA 3RM0H 3SI3H 2ZPQA 3BN9A 2KFWA 1GI3A 1HIAA 1C1WH 1GGDB 2J38A 4ZH8A 4WJG2 2RCEA 2C8XB 2KR7A 4B6EA 4YO9A 1GDQA 2OTVA 4BOHA 5FPYA 1A7SA 3F3BA 2YMSC 4BAOB 1ORFA 1GI7B 1AVGH 2QF3A 1MUEB 1QCPA 4BTTB 1DX5M 2C93B 5EG4A 3KYFA 1F5KU 1GJ9B 1RD3B 1TNJA 4UD9H 1BRUP 3DFLA 4MNYA 1LVBA 1GCTB 3AW1A 4BTIB 4B74A 3K2UA 4JK5A 4VGCB 5B6LA 1O37A 2ZDNA 2A2QH 5FPSA 1XXDA 3I77A 1Y5UT 1BJVA 1UTOA 3SORA 4HG6A 4H4FA 1KXEA 3MI4A 3JZ2B 5DG6A 1TGBA 3SV2H 1BBRE 1OHHD 5C0UA 1QB1A 4DY7B 2VIOA 1FPHH 1FX0B 5L6NH 3M3SA 1BMNH 3ZZ7A 2Q6DA 2V6NA 2ZEBA 5TCCA 1GBHA 4JCNA 3KHVA 3ZVDA 3M5MA 3SQEE 1K1PA 2OC1A 2ULLA 2R0LA 1F0TA 1UTKA 3GY8A 4IW4E 4CHAC 2LNCA 3F0OA 2IOTA 5DJ7A 4BXSA 3ZZ8A 4Q7YA 1O5EH 1E34B 3PV5A 1LVOA 1SGFA 1TRNA 1QQUA 2W26A 1OWEA 2ZECA 1ETSH 3UIRA 3GCHB 4HI3A 3EA8A 2GD4B 4AZ2B 4WH6A 1S5SA 5A8ZA 1SGCA 3ZZDA 3LIWA 1P2MA 4U2WA 1CO7E 2QC2A 1GCDA 1GHXH 1C5WB 3U1JB 1K1LA 2R3UA 2ZDAH 1O2UA 1C2MA 1ZHRA 2NWNA 2XCNA 2ZO3H 1O2WA 3RXCA 3A8AA 3LGTA 2AGEX 4DVAU 4O03A 1V2ST 1O2XA 1AMHA 4YZUA 5C3NA 4CBNA 1GI2A 1W0KD 1O2KA 2ANWA 2R2MB 3GY3A 2ZHEH 4RKJB 1C2KA 2IJD1 1DITH 4HZHA 2P94A 3TNTA 2EA3A 3RXMA 2ZU5A 1HAGE 3SNEA 3AVZA 2O8UA 3UTUH 1IQMA 3F2FA 2VIWA 4K2YA 4LK4A 5DN6D 3HK6B 1P2NA 1HPGA 1ID5H 3KGPA 3ODDA 2FOGA 2HNTC 1XX9A 2GJGA 1BTUA 3L6PA 4SGAE 1GBKA 5HKKD 2G51A 4MQAA 4ZHLU 2AH4X 5C67A 3F9HA 2QN5T 2HOBA 3LGYA 1SOZA 1L4DA 3B9FH 1VITH 1XUJA 3PYHA 2VH0A 2HPPH 2OK5A 1NM6A 1TALA 5LPRA 3BTTE 1UVPA 2ZCKP 1GBTA 3KQ5A 1P9SA 2P3TB 3RC4A 4TPIZ 3DT0H 4K69A 3Q3KA 1NESE 1EKBB 3VB5A 2F3CE 1UK4A 4XOJA 3RXPA 3LGIA 3NWUA 1COWD 1RTKA 4Z0KA 4I33A 1O2YA 1S82A 1DPOA 5T6DA 2ZNKH 2M5TA 4NA7A 5DK1A 5DGJA 4I7YH 5GIBA 3M36A 2XXLA 2Z7FE 4DG4A 3OEED 1D4PB 1GMDF 1TYNA 3MMGA 4LXBH 4R8TB 1EJMA 1TB6H 2PLXA 1LVYA 2P8OB 2WPDD 4GAWA 2UUJB 1WTHD 1VITG 1T8NA 2ZFQH 4FETA 4K8BA 3TGKE 3BEIB 2AHME 1GBLA 5GCHG 1ZMNA 1MQ5A 1C5ZB 2BD7A 1FY5A 3TK6A 4NG9H 2J98A 3P8FA 1ZSLA 1QRWA 5EQQA 1GPZA 5CDFE 1ZMJA 2G4UA 2ZQ2A 4JK6A 4KTSA 1ZSJA 2DE9A 1FIZA 3EYDA 2P3FH 1BTPA 4Y7AA 2AIPA 1ZMLA 4NIVA 4KGAA 1N1LA 1LKBA 2FX4A 3ZIAD 2F9BH 1EUFA 1IQNA 1CQQA 1C1QA 2C8ZB 2FI4E 2VWNA 1UK2A 5HM9A 1CHGA 1IQIA 1DY8A 2TIOA 1YGCH 5EIYA 1HJ8A 5TJXA 3ZVEA 3NPSA 1O2GH 1FY1A 4KKDA 5FCKA 1P2IA 3WY8A 2FIRH 1ELDE 1DSTA 4BNRA 4ZHMU 4BTUB 4I8HA 1V6DA 4CHAB 1L0ZA 5GPIB 4IMZA 1O5CB 1TONA 2VH6A 1LPZB 1Z71A 1J14A 1FIWA 1BHXB 1H8HD 1UVOA 3ATMA 3OY5U 4K3JA 3K6ZA 3MNCA 5CHAB 3BSQA 1BA8B 2XC5A 1E37B 1DANH 3PMBB 4H42U 1GBBA 3QO6A 3UR9A 3E0NB 4Y0ZE 1AE5A 7GCHG 1O2PA 1SGEE 5AVDA 2ZI2H 2BLOA 1V2WT 3BTGE 5DPAA 4AN7A 1TNIA 1UJ1A 1AZZA 1QFKH 2BOHB 1SG8B 4VGCC 1A2CH 1F5RA 1ZGVA 5CE1A 3E90B 2NU3E 1XUGA 4IN2A 3UREA 3RXFA 2UWPA 3LPRA 4A92A 1UVUH 3FZZA 1SB1H 3SBKA 3SU3A 3TNSA 4DW2U 3TK9A 1GI1A 3PO1C 5TCAA 4FUEA 4MNVA 1DICA 3AAVA 1VZQH 1EQ9A 3QGJA 5T1VA 1SC8U 4TY6A 2RDLA 3VB4A 3GICB 1Y8TA 1DXPA 1TA2A 2EC9H 1VCWA 2GV6A 2C8YB 1ELTA 1SGPE 1ZZZA 3UY9A 4D76A 1Z6EA 2BVRH 1ETTH 1ANBA 1J16A 2WZQA 1BZXE 4X8UH 3GY6A 4YXWD 2IPHA 5AFZH 2BDCA 5H4IB 1JXPA 2PV9B 1CHOF 4J2YB 4OS2A 3SQHE 2GDDA 4NWKA 1TMTH 1CBWC 4FU7A 2C4FH 3UNRA 3LJOA 2Q6FA 3KN2A 4X6PA 3UPEA 4AFQA 3DHKH 3LJJA 4X1PU 4ESTE 1HIAB 2ESTE 1SBWA 5K0HA 3U8TH 3TLOA 4K1EA 2BVSH 3TK5A 3RXVA 3M7UA 1NN6A 4HFPB 1W7GH 1EPTB 1HNEE 1N8OC 2A4QA 2LP6A 1NRNH 3SNAA 4TPYA 8KME2 5JDUB 1D3QB 4Z6AH 1D3DB 2FWWA 1TGCA 2W6ID 1ZYOA 1WCZA 5C94A 2QYIA 1MU8B 3VGCC 2HRVA 3STIA 2FP7B 1Y5BT 2K1QA 1D6WA 2IPQX 4ISHH 1O2TA 3SZNA 2SGQE 3SU4A 3MHWU 2QF4A 1CT0E 4AORA 2ZPRA 2SNVA 1VKYA 3N7EA 3MFJA 2BDAA 4X8TH 2BDHA 1V2QT 3NZIA 3V13A 3F9EA 3VEQB 2OUAA 1CGHA 1DS2E 1O32A 2YMSB 5JB8S 3A88A 4UFGH 7GCHF 2HVYB 1FY8E 5HYOA 3RU4D 1DWEH 3TVJB 5J4QA 1HAHH 1MBMA 1HAVA 5G4BA 1A3BH 3KIDU 1O3CA 1XUKA 4JZIA 3EA9A 2ZTXA 1ZPCA 5C0TA 1TIOA 1GCTC 1KXAA 5DP9A 4AGJA 1ELBA 5EPYA 1SL3A 3UWIA 2ZU3A 1TGTA 4INLA 1BUIA 1JOUB 1W11U 3F2GA 2VWMA 2J97A 1GHZA 1EJAA 1Z8IB 4FUIA 6CHAC 3GISB 4UFEH 2ZDKA 2P93A 3TIUA 4JZEH 4Y11E 4B2CA 2VIQA 1PQ8A 2YNAA 1E35B 2GV7A 4RT0A 1JIMA 1SQTA 1PPGE 1Z8RA 2CHAB 1G30B 1JBUH 5CHAC 3BTKE 7KMEH 1SMFE 1GGDC 4ABFA 1DSUA 3HK3B 3HPTB 3T5FH 1DDJA 2V3OH 3RXBA 1DXWA 1C1VH 1AI8H 3FN8A 3D65E 2Z3DA 2STAE 1B0EA 3ZVGA 5E0GA 1HGTH 1SQOA 3PLPA 3D62A 1C5YB 2Z3CA 2CF8H 4YM9A 2AFQB 2A4GA 1IOEA 2PWXA 5A0BA 9ESTA 1YPLH 3TPIZ 1Z1IA 4ABEA 3RXRA 1Q3XA 3GCNA 2FLRH 1L1JA 1HRTH 4NZLA 1LO6A 1DLKB 1ZPBA 3PTNA 2AYWA 4IBLH 4YOJA 2QAAA 1IQFA 1ZTJA 2AGGX 3QLPH 2ANKH
chains in the Genus database with same CATH topology
1X7AC 3CS7A 2B9LA 1YPEH 4YT6H 2PSXA 2BMGB 2KAIB 2ZA5A 1P09A 1UTQA 1EAUA 3DFJA 5A2MH 3Q00A 2R2WU 4KP0A 1LPGB 1UTJA 3UOPA 3HKIB 2A7JA 2Z6BD 1XXFA 4I8KA 1SR5C 1HAVB 2BQ6B 4I32A 2Q6GA 1RIWB 3SV6A 3GCTG 1UVTH 2IJOB 8ESTE 2ZHQH 1KSNA 1C5QA 1EOJA 2A32A 1AY6H 3OU0A 4O3UA 1FY4A 1G2LA 1LPKB 5E2OA 2QXGA 1OOKB 1ELGA 5GWZA 1EAXA 3SUGA 1T7CA 3DUXH 4AB9A 3H5CB 5FAHA 5EGMA 1G9IE 2V0BA 1IHTH 3U1IB 3BF6H 2GT8A 2CHAC 1D9IA 1HV7A 2GKVE 2GT7A 5ESTE 1PPCE 1ZOMA 4JZ1A 2G5VA 4DOQA 2BD3A 3VPKA 3QWCH 1W12U 2PKAA 5F03A 3GOVB 1S0RA 3HATH 2THFB 1GI5A 5A0CA 4ABBA 5T6FA 1V2VT 1MU6B 3A86A 1OP8A 3CENA 1QJ6B 3PM3A 4MNXA 3KEEA 3STJA 4WWYA 3BEUA 3SHCH 3VXEH 1FV9A 1MTNC 1K21H 1C2IA 1K1NA 1FZZA 2ZIQH 1EZQA 2GZ7A 2VIPA 2QV1A 1A5GH 3H7OA 4BANB 1Y3YA 1XKAC 1V2PT 1QB6A 1C5PA 1KIGH 3IITA 2FDAA 1PPBH 1AB9B 4TYDA 1K9OE 1BQYA 1GJBB 2Y81A 2ZFFH 4FUGA 1MMJN 4FUJA 3ZVBA 2VB0A 2J34A 1O2LA 5DP7A 1LHFH 1DOJA 3M7TA 3RM2H 4MPXA 2WV4A 4NA8A 1VCPA 1A3EH 3PV4A 4CH2B 1ZR0A 2UWOA 1CA0C 2PSYA 1EZUC 1LQEA 4FU8A 3P8GA 2VIDA 1EB2A 1JWTA 4WMDA 3ZVFA 4R0IA 3RU4T 3QX5H 1BMLA 1B5GH 1FN6A 3V0XA 4Q7ZA 1BRCE 1C1NA 1FAXA 4AGKA 3URCA 1NO9H 2QF0A 4U01A 1TQ0B 2I6QA 3M5OA 1AFQB 1BTHH 1YC0A 2JETC 4AB8A 3K6YA 1QNJA 4AFZA 4UFFH 1UTLM 2IN2A 2ZFPH 1TNKA 1G2MA 4K1SA 4X1QU 2BX4A 4YT7H 2NU2E 1GMHG 1ZPZA 1DFPA 2HNTE 4BAQB 5E2PA 2H5DA 3TJNA 4OS1A 2BX3A 1GBFA 2FM2A 2BD2A 1LQDB 5FX5A 1CE5A 1BBRK 3NUMA 5LGOA 4JYVH 3PMJA 1TPPA 1UHBA 1HAZB 3R0FA 1FXYA 2A5AA 1IQGA 2UUFB 2XTTB 3Q3XA 4BAHB 1BT7A 2ODYB 4A1TA 2R9PA 1QHRB 1TQ7B 4X6NA 2CF9H 2BLVA 2TGPZ 3MH7A 1Y3XA 1N6YA 4IS5A 1FAKH 2QXHA 2PKSB 2SGDE 1C2FA 2TBSA 1P0SH 2W3IA 1T8LA 2FO9A 1Z1JA 4CRCA 1KXCA 2AS9A 5C1XA 1MBQA 1AB9C 2FLBH 1F2SE 5A8YA 2V3HH 1TBZH 1SHYA 1GDUA 3T29A 5C5NA 8GCHF 2ZGBH 2FOMB 2BXUH 1NU9A 1PQ7A 4H6SB 5L2ZH 4INKA 1OSSA 1VGCB 2KAIA 4MPVA 1NROH 1W13U 1S6HA 4NZQA 3DD2H 1WV7H 1TMBH 1AWFH 4XBCA 1GBIA 1MD8A 1QBVH 1O3MA 2SFAA 1O5AB 2EI7A 2CGAA 3TITA 3PWCA 4CRDA 1YLCA 1ZHPA 1KLJH 4YTAA 2NU1E 1AKSA 3UFAA 1ARBA 4X8VH 1O2MA 2BY9X 1ELEE 3MYWA 3MU4A 2H9TH 5AF9H 1O31A 2ZCLP 3GCOA 3SJ9A 4NSYA 2PTNA 1UO6A 1OWHA 2VU8E 4GCHF 4ZKNU 2WUCA 1GHVH 1OWIA 3BTHE 4K60A 3BTEE 2HGTH 2R3YA 2PUXB 4X2VA 2CXVA 1XVMA 1TRMA 2OC7A 6ESTA 1GBDA 2OINA 1C5LH 3BTFE 1FN8A 4F4OC 4OS6A 2P3UB 3A83A 4U32A 5L30H 4QT8C 1WU1A 3M5LA 1RIWC 2F83A 3EGKH 2A1DB 3S69A 1BTWA 1UCYH 3V12A 1GG6B 1V2UT 1ZLRA 1YCPM 2QCYA 3ZZ6A 1PYTD 1QBOA 1EAWA 1C2JA 1O2SA 3TH3H 1SGDE 1C1OA 3TJOA 1ZTLA 2WUBA 3S7KB 3UNSA 2OQUA 4X1SU 1SPJA 3W95A 1T8OA 1H9HE 1ELCA 2OXSA 1Y3WA 4NWLA 4YOIA 4ABJA 2FOAA 2B8OH 1PYTC 1C1UH 1TBQH 3M37A 3OTJE 4DCDA 4WVPE 5EW2H 1AE8H 3E91A 4ABDA 1HCGA 1UTMA 1GMDG 1NZQH 4X2XA 2P59A 1BMAA 2H5CA 1GJ5H 2HLCA 2AGIX 5C20A 1EOLA 1LMWB 1P2QA 3MH4A 1GJ7B 4H6TA 4OS7A 1YBWA 2Z9KA 3S7HB 1ZRBA 2AERH 2Y7ZA 1C5MD 1OWKA 1GI0A 1QY6A 1EP5A 1MZAA 2UWLA 4TWWA 3MNXA 2G4TA 5LH8A 1K1OA 3BTQE 1S84A 1PFXC 1YP9A 2CN0H 2ZP0H 4IMQA 5GJ4B 4TWYA 1BOQA 1OWJA 1CGJE 2BY7X 3UR6A 3D49H 1P12E 3ZZ5A 1SLUB 2PHBA 2WINI 4XE4A 3MO3A 5E0HA 3ELAH 4XBDA 3FANA 2F9VA 2BD8A 1C2LA 1YCPH 3SNDA 4XBBA 1C5OH 2Z9LA 2VVCA 5FBIA 3PB1E 5GDSH 3BTDE 1MKXK 2ODQA 1C4U2 4U30A 1HBTH 2RG3A 1K1IA 1VCQA 2ZU2A 1V2JT 1TOCB 1MH0A 1VGCC 1O30A 2SGFE 1HAIH 7ESTE 5FHTA 2CJIA 2GMTB 3A7ZA 5GCHF 4F49A 3EDXB 1A0HB 2ZHFH 1GHAF 1P2KA 4CREA 1O3EA 3U69H 1GJAB 1TMUH 3F9GA 1O0DH 5FX6A 1T4VH 3URDA 2PFEA 7LPRA 1NFXA 5FBEA 2SGEE 1GDNA 3SNCA 4E7NA 5IDKA 2VWLA 1SFQB 1D6RA 2JKHA 1QBNA 3LKWA 1RTLA 3BIVH 3E0PB 4Y10E 3TGJE 1OWDA 5EPNA 2QXJA 1MCTA 1SI5H 1PQ5A 2W3KA 3AW0A 3TU7H 3I29A 2A7HA 3MOCA 2Z9IA 1TNGA 2VWOA 4FUBA 4DIIH 1FJSA 1IQJA 1PPZA 1BIOA 4IC6A 3GDUA 4RSPA 3P17H 5HM2A 5C5OA 2F9PA 5T6GA 2UUYA 2OLGA 2ZF0H 4Y6DA 3RXIA 3S9BA 1AN1E 4Y79A 2GMTC 4KTCA 1QL7A 1O3HA 2ZGJA 3M35A 3ODFA 5FXLA 4D8NA 1GMHF 1EP6A 4CR9A 1C1SA 1NRQH 3NXPA 1GI9B 3PLBA 3A87A 1YKTA 2WPHS 3SJOA 2H9HA 1RRKA 3LH1A 1XKBC 5F8ZA 1C1TA 2AMQA 1AU8A 1KXFA 3VB6A 2D1JA 3RXSA 1UTPA 2ZCHP 4GLYA 1O5DH 3FAOA 3SV9A 2YNBA 1BRAA 4AFUA 2GZ9A 4CRAA 3PTBA 2Y6TA 3SU2A 4TY7A 5AHGH 1AKSB 4MDSA 1CA0B 3F1SB 2H6MA 1GHBF 5F6MA 4X2WA 2G55A 1V2TT 2H9EH 1THSH 1RFNA 1B0FA 1EX3A 4JYTA 3O8RA 1O2ZA 2BLQA 1G37A 1LHDH 1MKWK 1HYLA 1H4WA 2ZHWH 3OY6U 2ZDLA 1CU1A 2B0FA 2XWAA 1TWXB 1W10U 4AYYB 5JBBS 3RXTA 3KQBA 3P8OA 3F6UH 3RC5A 5JBAS 2XC4A 1XUHA 2HWLB 4ZXYH 1VJ9U 3SUFA 2ZU4A 3BG4C 5EXMA 1T32A 2GCTB 1O3AA 5CMXH 5JYIA 3QTVH 3SHAH 3PWBA 3O8BA 1DWDH 3TJUA 2FOFA 4ISOA 1BDAA 1Z8GA 4NFFA 1BITA 3P92A 1HXEH 1NPMA 1KDQA 3RXJA 1GJDB 4Y0YE 4X0WU 2ZZUH 1LVMA 1GHYH 1F7ZA 2QGRA 4BXWA 4Y8YA 8LPRA 1MCVA 4UEHH 1O35A 3KNXA 3M3VA 4FUFA 4ZHAA 1BBRH 1BTXA 3T62A 1S85A 1UTNA 3Q3YA 3ZYEA 2FXRA 3ATLA 1QR3E 4XDEA 3O8DA 1O3FA 4JYUH 3BIUH 2FPZA 1GMCF 2ZGCA 1O2IA 2P95A 1MKWH 2WPKS 2ANYA 2O9QA 3LT3A 5T3HA 3EAJA 1DT2A 1H1BA 1IHSH 2Z94A 3MU8A 2BVXH 1SFIA 2OBQA 3AAUA 1HAPH 2A5IA 1V2RT 1MTVA 4UE7H 3D23A 2FMJA 3LU9B 3PMHB 1WOFA 2PGQB 4MVNA 1U6QA 3ZZ9A 4A7IB 4ABGA 1ESTA 2XBVA 1THRH 4FXGH 1GWAA 4CRFA 1J8AA 1C4Y2 4INHA 4NFEA 1QQ4A 5B6OA 5A0AE 4I8JA 2BQ7B 2PTCE 3GY4A 3P8NA 1HDTH 2XRCA 5GXPA 2EI6A 1SSXA 2BQWB 3M3TA 4NIWA 3GDVA 3BV9B 1VITF 1OP2A 1NFUA 1TPSA 4NIXA 3RXDA 1H9IE 1O3IA 1GBMA 5EQSA 1TE0A 3ENSB 2A0QB 3R3GB 4WXIA 1NU7B 3SV7A 1VJAU 4Y8ZA 4JZFH 4JZDH 3ZYDA 1S0QA 4I8LA 1BTYA 1O5GH 1P04A 1CA8B 1C1MA 1K22H 2P16A 1YPMH 3HGNA 1EJNA 1W7XH 3QZQA 4OGYA 1LKAA 3A81A 1TLDA 1GVZA 1O2QA 2ALVA 4AG2A 2CMYA 4ZKSU 3ZZ3A 1CGIE 3VXFH 1BJUA 3FFGA 2R0KA 5LPFA 2XC0A 2AEIH 3H7TA 1LTOA 4DGJA 4WMFA 1INCA 1F92A 4OGXA 3C27B 4A1VA 1GL1A 3E1XB 4CH8B 1NS3A 2WPMS 4WXVA 1Z8JB 4E7RG 2C90B 4AYVB 1BTZA 2WYGA 1AO5A 2OBOA 1C2GA 2VNTA 1BB0B 1C5TA 1O39A 4AX9H 3RUOA 3DA9B 1YLDA 3ZV9A 2FOHA 3LGUA 1IQKA 1W3CA 3RMMH 3T26A 1MD7A 2C3SA 3E3TA 3SO3A 1GBCA 4Q7XA 2DUCA 4HGCA 2BY8X 1TNLA 1M9UA 2HPQH 4GPGA 3QUMP 3LC3A 4B75A 1SVPA 4KTUA 1XUFA 2BZ6H 1XMNB 4FUDA 4O3TA 4Y8XA 3VFEA 6CHAB 1D3PB 3QN7A 1XUIA 1O34A 3RMOH 2ZHDA 2FYQA 1W2KH 1GJ4H 3E6PH 5BRRE 3ZZBA 4MLFB 2ZTYA 1KYNA 3MH6A 1AUJA 1RXPA 3SU6A 4MNWA 3GCHC 1HXFH 2I6SA 3GDSA 1QJ1B 3RLYH 1ELFA 1DM4B 1QRXA 3SJ8A 5K7RA 2BDGA 1WBGB 1FUJA 1KLTA 1AUTC 1A61H 3E16B 3ZVAA 3SOSA 2SGAA 2ZTZA 2PKSC 1TPAE 4UONA 1LHEH 3SJKA 4CRBA 5A09A 1ELVA 2WPJS 3RU4E 1QIXB 1TX8A 3RP2A 4FU9A 2Y82A 1ESAA 2G00A 3MNSA 1SGYE 1DUEA 1V2KT 4YESB 1P2JA 5F8XA 1NY22 1C2DA 2XNIA 2XYAA 1EZSC 1GHBG 2FZZA 2VJ1A 3SGQE 1KTTB 3RDZA 1MQ6A 2BLWA 1XM1A 1AIXH 5EQRA 2ODPA 1P9UA 1UHBB 2GTBA 1SQAA 3MU0A 1T31A 1PJPA 1SHHB 1W8BH 1SGQE 3FP8E 3SJIA 2VGCC 1MAXA 1N8OB 3PROA 4UFDH 1EPTC 3MU1A 2ZKSA 1YPGH 1FY3A 3B23B 4X1NU 2GCHF 2JH6D 4ISNA 4ABHA 1GHAG 3M7QA 1WYKA 1G3DA 1AFQC 3U8OH 9LPRA 3G01A 1OYTH 1T4UH 1YPHE 1DY9A 2HNTF 1RJXB 4Y71A 1ZRKA 3Q77A 5HXFA 1FDPA 2FOEA 2B7DH 5DKMA 4ZAEA 2G8TA 1IQEA 5DP5A 3A7WA 4ZXXH 1O3PB 1P11E 1C5NH 1DLEA 2BHGA 3V7TA 1TGNA 3GY5A 4JMYA 2AIQA 1WUNH 1HJAB 4O97A 2ZFSA 1TAWA 5JPMH 1UMAH 4DT7B 2ZGXH 5IYTA 4ZUHA 2GCTC 2TPIZ 5C2ZA 1VR1H 2Y7XA 4THNH 1BCUH 4RN6A 4B73A 3C1KA 4DURA 2BXTH 1AHTH 1L2EA 1JRTA 2GDEH 1SLXB 1C2HA 3MO6A 1AVWA 3FP7E 4BAMB 1EPTA 1ZGIA 2VINA 4K8YA 2TGAA 1C5XB 2ZDMA 1RTFB 3KL6A 1O2RA 1DUAA 3A84A 4K1TA 4YLQH 1AGJA 1N6XA 2BDYA 2O8MA 1S83A 2STBE 3CS0A 3T28A 1LHGH 2BD4A 3QK1A 4NSVA 4J1YA 4Y76A 1O2JA 1EATA 1WSSH 1A46H 4AFSA 3RXHA 3NKKA 1YM0A 2D2DA 2OC8A 5ETXA 2GX4A 2GP9B 1JRSA 1TPOA 2A45B 4FVDA 1AD8H 3RMLH 4X2YA 1SGIB 1MTWA 1ACBE 3T2NA 5EW1H 1J17T 3A7TA 4WY3A 2F9NA 1NC6A 4B1TA 3FZDA 1GI6A 4I8GA 1A0JA 3KCGH 3BTWE 2J9NA 1V2OT 2EI8A 4OS4A 1KDQB 1Q2WA 1YPJH 3RXAA 3MNBA 1CVWH 5HMAA 3LONA 2ZU1A 3SN8A 4NCYA 2FOCA 5LPEA 3VB7A 3B8JA 4ZMAH 2BY5X 1RGQA 5JB9S 1WTGH 4D7GA 3I78A 3EQ0H 3W94A 2ZFRH 3SV8A 4X8SH 2J95A 1SGFG 1C5VA 1O2OA 1EASA 2D26C 1C5SA 1XVOA 3SW2B 1O3LA 1Y3UA 4ISIH 1J15A 4WF8A 1HFDA 1A5HA 1SGNE 5EOKA 2TRMA 2V35A 3FVFB 1QJ7B 1O2VA 1QA0A 3PO1B 1HB0B 3U8RH 3V3MA 3IG6B 2ZG0H 6GCHG 3TJVA 1P01A 5A8XA 2OQ5A 1PPHE 1WQSA 5EXNA 1AZ8A 2OP9A 1BHXF 4GHQA 4ABIA 4ZKRU 1F0UA 3SGBE