1O36A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o36A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o36A02
1O0DH 3SN8A 2VIPA 1JWTA 5F8XA 1AI8H 1ZSLA 2TGDA 2ZGXH 1MCVA 2AMQA 1D9IA 1MBQA 3F6UH 3TH4H 1AB9B 1YM0A 1O2UA 1S6HA 3A7TA 1IHSH 1HBTH 2BX3A 4TWYA 4GHTA 4U32A 1EAIA 3TNTA 1E0FD 1WUNH 1EPTB 4NWKA 1ZRBA 2VVVA 1CGHA 1CE5A 1SQOA 1UTMA 2VWMA 4DIHH 3UIRA 2G55A 4B74A 3UNQA 4FUIA 4X8UH 3RXHA 3TPIZ 1AGJA 1W7XH 3ODDA 2UUJB 3VPKA 1VZQH 3ODFA 2GD4B 1CT4E 3ATLA 1RIWC 4I31A 3NK8A 1XX9A 1TWXB 3M3SA 4I8HA 1FDPA 2O9QA 3SHCH 4FUJA 3LGYA 1QJ6B 1B0EA 4Q2KA 3JZ2B 1DOJA 2BOKA 2ZNKH 4UFGH 1CSOE 3RXSA 1ZGVA 1H1BA 3QTVH 1IQNA 1ETSH 2VNTA 3U98H 1LTOA 4FUDA 1LHEH 2H6MA 4OS2A 2XC5A 3SV2H 1B5GH 2G5VA 1GCTC 1HCGA 1C1OA 5GWZA 4D7GA 4X8TH 1RRKA 4FXGH 3PTNA 4X6OA 3K6ZA 1Y5UT 4DCDA 2A31A 5HM9A 2H9TH 1UJ1A 2GZ9A 1LHFH 6GCHG 2ANWA 4DOQA 1FAXA 4X8VH 1WCZA 1V2OT 5DJ7A 2FS9A 4NA8A 1GG6B 3T25A 1KTSB 1GJ5H 2D2DA 5A2MH 2PKAA 2Z3CA 3GYLB 1O2XA 2P95A 1LQEA 1DY9A 3QZQA 2ZU3A 1GBTA 1LQDB 1F0RA 3H7OA 1D3DB 1YF4A 2C93B 3E91A 5FBEA 2AGGX 2TIOA 3RXDA 1ZPZA 2AERH 3MU1A 1O5GH 3O8DA 4AZ2B 1A1RA 2Y7ZA 1GL0E 1JIRA 5HMAA 1CHGA 1ELTA 1DY8A 3OX7U 1DE7H 2RCEA 2BQ6B 1AB9C 5DK1A 2NU4E 1EZUC 3M7UA 3V7TA 2XBWA 1MZDA 1ZSKA 1GMHG 1O2LA 1C5WB 4XBDA 2BD5A 1SLWB 3K9XB 1WOFA 4FUCA 2KAIA 1TALA 1C1RA 1N1LA 3SORA 1PPBH 3S7KB 4FUGA 3LGTA 3BTEE 2I6SA 1O3FA 3UQOA 1PPEE 2FOAA 1RFNA 2XTTB 3C27B 3TJUA 2XBYA 4OGYA 1FN8A 1MTUA 1TRYA 1K1PA 4GLYA 1ELAA 1KSNA 4ISHH 2HRVA 4DW2U 4MNVA 2FZZA 3RP2A 3MOCA 2PTNA 3PWBA 4HZHA 2XCFA 5GXPA 3A80A 3IG6B 4H4FA 2OC7A 5A09A 2XXLA 4E05H 3GCTG 3LDXH 1H8IH 1FQ3A 2XWBI 4KELA 5FPSA 1AD8H 5DKMA 1T8LA 1GBIA 1EASA 2D1JA 2WPJS 1Z6EA 5E0GA 3TK9A 4AG1A 4B76A 5TJXA 1YPGH 1EB1H 4NG9H 1CT0E 3VB5A 5EQSA 1C1PA 1GBKA 2P3TB 3PMHB 5E0JA 1TX6A 1G36A 1C5LH 1IQGA 3PB1E 4B2BA 4YLQH 1NT1A 1O2MA 1HJAB 2R3UA 1DM4B 4K1SA 1L4DA 1KXCA 5A0AE 1O37A 1SC8U 2UUFB 3UTUH 2VU8E 5DP3A 2BY9X 1OX1A 2CXVA 3UPEA 1MZAA 1GG6C 4D9RA 3EGKH 1ANEA 1C5PA 5LPEA 2YOLA 2ULLA 1HRTH 3ZVCA 3RXEA 2HPQH 3SUFA 3W94A 4YLUA 4WWYA 1J8AA 5LPRA 3BN9A 2O8UA 2QN5T 2A4GA 4MLFB 2CF9H 4TY7A 2W7SA 1G37A 1CGJE 3SQEE 1W0YH 3NPSA 4X6PA 1BJUA 2A5KA 2UWLA 4D8NA 6GCHF 1YPEH 3E6PH 1ZMJA 3PV4A 1N8OB 3M61U 1DLKB 1SGDE 4ISOA 4OS7A 3C1KA 3VB3A 1BBRH 5L30H 4IMQA 2Y7XA 1MTSA 3VXEH 1YLDA 1FONA 2EA3A 1SGNE 2B5TB 2J9NA 1GI2A 4JCNA 1TQ0B 3V13A 1QL7A 1EJMA 3P6ZB 1BCUH 1DXPA 4FUBA 3L33A 1SGTA 2ZDMA 1J9CH 2A45B 4MNWA 4BTTB 1TGTA 1GMHF 2ZF0H 2XNIA 2VWLA 1GHBG 3MU4A 1ZJDA 2C8ZB 3PTBA 3SQHE 1P57B 2ZQ2A 5T6FA 2G5NA 1O2KA 3SGAE 4Y7BA 2ZEBA 5AVDA 4IN1A 2B0FA 1Z71A 2ZPQA 3SI3H 1H9LB 1O2SA 2D26C 4JZEH 1WV7H 2AIQA 3AAVA 1TPPA 5TCCA 3ZZ7A 3H5CB 5AFYH 2NU0E 1KXFA 2H9HA 1UTLM 1F7ZA 1T31A 3MH4A 4GAWA 1C5XB 1BRBE 1MKWH 1GJ6A 2ZFSA 1XUIA 1HJAC 2JH0D 3FVFB 1NZQH 2ZGCA 4I8GA 1OWIA 3GCTF 1ARBA 1LO6A 2RDLA 2VB0A 2HNTC 1KLIH 1HAOH 4DVAU 8KME2 3D49H 1V3XA 3VFEA 5FPYA 3RXPA 2LPRA 4MVNA 4SGAE 2IOTA 1NU7B 1SSXA 2OC8A 4CR5A 4K8YA 2FTLE 2WPMS 4I33A 5BRRE 3VB7A 4AOQA 3FFGA 3FP7E 2M5TA 1Z8IB 1DSUA 4BAKB 4X1SU 1O3JA 3TGIE 5EGMA 5EODA 1WTGH 4BXWA 4IC6A 2XRCA 3A89A 4MNYA 3SUEA 4ZH8A 2ZIQH 5JB8S 2STBE 1IQMA 4CRFA 1TYNA 5DP8A 2EI7A 4XFQA 1N8OC 1A5IA 1K9OE 3Q76A 3QX5H 1HB0B 3WY8A 4FUHA 1ZTJA 3A8BA 4MQAA 4E06H 3ATWA 4X6MA 2Q6FA 3HK6B 1DT2A 1SGYE 4AFZA 1J17T 1JOUB 2EEKA 1GL1A 3M3VA 1C5NH 2V0BA 4HTCH 2ZP0H 4HFPB 1SHYA 1ZPCA 2G4TA 2AGEX 1GI7B 1OPHB 5FCRA 3U1JB 1O2QA 2QXIA 1O3HA 4AFQA 3BIUH 1UTNA 5IDKA 1G3CA 1MUEB 4YOIA 3BTTE 3L3TA 1JIMA 1NFWA 1ETTH 5A0CA 2IN2A 4D7FA 4MPWA 3V12A 1C1TA 1EOJA 3V0XA 4THNH 1IQIA 1TX7A 3D62A 3KCGH 3RDZA 4X2VA 1SGCA 1QURH 2BDGA 1VITG 1GHBF 1Z6JH 4H6SB 2A7CA 2DE8A 4CRCA 1FZZA 1C2HA 1O5BB 1TBZH 1TNGA 1AY6H 1UVUH 1XM1A 4NFEA 2SGQE 4NSYA 2ALVA 4MPXA 3T5FH 1ZZZA 2W3KA 5EW1H 4TY6A 2V35A 4JYVH 2PFEA 1NM6A 3BTFE 4K2YA 4K3JA 2BZAA 4Y7AA 2SGAA 2J4IA 5PTPA 1BTXA 1W14U 2CHAC 1RTFB 2Z9IA 3GY4A 1IAUA 2GV7A 1ELCA 1EP6A 3SU3A 1K1OA 1O2PA 2O8MA 4WMEA 3UWJH 2CJIA 2VJ1A 3KQEA 5E8EH 5GPIB 5G4BA 1S6FA 1S84A 3NUMA 5A8YA 1DPOA 1A7SA 4Y0ZE 1C2MA 1D3PB 3DT0H 3A7XA 4SGBE 1AE5A 1J14A 1XUFA 3MU8A 2GZ8A 4O9VA 5DP5A 3A7VA 1BTUA 3P92A 3PLPA 5ESTE 3STIA 2V3OH 3QGNB 3KIDU 1O2VA 2PUXB 3SO3A 4ZHLU 1RTKA 3RLWH 3QDZB 1TQ7B 4Y8ZA 5CE1A 2ZG0H 3VGCB 1TNLA 3SZNA 1O2RA 1TNIA 2THFB 1AKSB 3ZZBA 1H4WA 2F9NA 3RXUA 1GWAA 1BZXE 5JB9S 1UVOA 3UY9A 3U69H 2VVUA 5EXLA 4RKJB 2PTCE 1QGFA 2Y5GA 1HLTH 2PSXA 5FX6A 1SOTA 3GCOA 4O3TA 2TGAA 3E16B 1L1NA 2FX4A 3BEFB 4Y0YE 3M37A 2TPIZ 3OTJE 4OS6A 4XSKU 3ZVEA 5J4QA 2FS8A 1FIZA 2B8OH 2GX4A 3ITIA 4JYUH 1J16A 2SGFE 4FUFA 1NTPA 1GBFA 3SU1A 1Y3VA 4NIXA 2ZZUH 4NCYA 4A1VA 2AYWA 3ZVFA 2FWWA 1GVKB 1A46H 4K1TA 2BD9A 4NA7A 1ETRH 5FAHA 4JK5A 1C2GA 1O2OA 1P2NA 2G52A 4GSOA 1NY22 1KDQB 3A7YA 1QB1A 1W2KH 1NFUA 4KTUA 3DUXH 2FI5E 2A4OA 1P2IA 1GMCG 5JYIA 1DDJA 3M7QA 2R2WU 3RXQA 3SGBE 3GDVA 2SGDE 2W7UA 2QV1A 4GPGA 2BDCA 1C1UH 4MPUA 5F8TA 1QB6A 3FAOA 1W0ZU 1YPMH 1VITF 1QRXA 2ZFPH 3EAJA 2ZFFH 3KGPA 2G4UA 2QXJA 2SNVA 1G9IE 2XYAA 2BDYA 1PQ7A 3HPTB 6LPRA 5F03A 1BMAA 2AMPA 3KN2A 1DUAA 4JZDH 4Z0KA 2A32A 5HYOA 4NA9H 1AHTH 1HAIH 2OQUA 4Y6DA 3LH1A 3M5OA 3D65E 1C2JA 1ZPBA 4KGAA 2OD3B 1TABE 3IITA 3MH6A 4KKDA 3SI4H 3ZZDA 2ZFQH 3VGCC 1UVSH 3ELAH 1Y8TA 1Y59T 3QZRA 4YO9A 4YM9A 2J92A 1A0LA 1BRUP 1P01A 1QQUA 1TMUH 4M7GA 4MNXA 1SGFG 2BQ7B 1CVWH 3EQ0H 3R0FA 3A86A 1K21H 2FO9A 1AWHB 1BHXF 1EUFA 2P16A 1O3LA 5JBTA 1T4VH 2ZDVH 2ZU4A 2ZTZA 5GJ4B 1O3AA 5T6DA 2C8XB 3VEQB 3MH7A 4BNRA 1FIWA 4JZIA 1T7CA 5L2YH 1O3CA 1P0SH 1VITH 1K1JA 5HM2A 3LC5A 5AHGH 1UCYK 3MU5A 4B73A 2G8TA 3V3MA 1MKXK 3R3GB 5A0BA 1FY8E 2OBOA 5ABWA 3TIUA 5C1YA 2F9UA 4OS5A 1W12U 3LU9B 2BY6X 1YPHE 1CO7E 4U30A 1RGQA 3KQCA 3MNXA 2DUCA 3DA9B 1YLCA 3O8CA 4BXSA 1ZSJA 2HGTH 1ZOMA 5FBIA 2F3CE 4K8BA 4CRAA 1HUTH 1KYNA 3GY5A 1FV9A 1EQ9A 3SU2A 4JMYA 2H5DA 2ESTE 1GI9B 1DITH 2F83A 2Z9LA 1O3NA 1O5AB 1WAYB 5DP7A 3SBKA 4JZFH 1NC6A 4H42U 4ABGA 1G3BA 1ELVA 2QGRA 1OWKA 1VGCB 3A7ZA 1V2KT 4E7NA 2QIQA 4MTBA 1PQ5A 1YPJH 2ZDNA 1C5OH 1KXEA 1EX3A 1O3PB 3S0NA 4BANB 3BTGE 1TLDA 3LOXA 3A87A 1O2GH 1Z1IA 3E0PB 2UWPA 1GMCF 3ZZCA 4UFFH 5DO4H 1SI5H 2R0LA 3K2UA 5CHAB 1YGCH 2W3IA 1LHGH 2GTBA 2ZDKA 2ZFTA 3HK3B 1O36A 4X1PU 4AFUA 3UQVA 4LZ4B 1EAUA 2GCHG 1T4UH 5B6OA 4UFDH 1DWDH 1SGFA 1U6QA 2GMTC 2VIOA 4D9QA 2BB4A 1ZHMA 2BDHA 3TNSA 2BVSH 4ZXYH 3T28A 2XBVA 1K22H 1AUTC 2VIWA 2CF8H 1GMDG 3AAUA 4IBLH 4OS4A 2FYRA 2Q6GA 3LH3A 3I29A 2ZTYA 1HAHH 1N6XA 4LZ1H 3U8OH 1XXDA 1GDQA 3AASA 1C1SA 1OWJA 1W8BH 1JMOH 3P8NA 3A8AA 1NN6A 4CBNA 4JK6A 1UO6A 5T6GA 1HAXB 3BG4B 4RSPA 3CENA 1J15A 1B7XB 2H5CA 1F5RA 1S82A 2WYJA 2HNTE 5EXMA 4FVDA 1ARCA 3ZV8A 1BRCE 1MCTA 3F9HA 1UVTH 4FVBA 4IGDA 1UTOA 2ZHEH 2FEQH 1QBOA 4A92A 1FY3A 3BG8A 5EPYA 4ZKRU 3PYHA 5FX5A 4H6TA 1V2MT 1GDUA 1KXAA 1F5LA 1EPTA 3ENSB 3EA8A 1AU8A 3LT3A 4X6NA 1Z8JB 1GVZA 2Y5HA 4HI3A 1C9PA 1GHWH 2R0KA 4UFEH 2SGEE 4Q80A 1HAGE 1GPZA 2QC2A 4GVUA 1O2JA 7LPRA 1NROH 1VGCC 2HOBA 3OU0A 1JRSA 1HJ9A 2OQ5A 4F4OC 1ZGIA 3B9FH 4ABJA 4DJZB 2ZHFH 1NRPH 1XKBC 2ZHQH 3URDA 2O8WA 3RMLH 2XBXA 3M7TA 1A4WH 1IQFA 4NIWA 2Z3EA 1HPGA 1ELGA 1DWCH 1KTTB 5CHAC 3LJJA 3QK1A 4PROA 2B9LA 1O39A 3MNBA 4INKA 1P10A 2WPLS 3STJA 3LJOA 2TRMA 1C1NA 3RU4T 1ZR0A 2A4RA 3A81A 3UR6A 2FM2A 1BTWA 1GBAA 4BOHA 2WUCA 2AFQB 3PM3A 4A5TS 1FJSA 3T27A 1S83A 1D6WA 4XOJA 1YC0A 1O3EA 1BITA 2EI8A 1K1NA 2BXUH 1TNKA 1UMAH 3DFLA 3UWIA 1AFQC 3RXAA 1DICA 1UTPA 4CBOA 1FPHH 2H1UA 3SV6A 3QN7A 5EXNA 3RXOA 7ESTE 2ZHWH 5DGJA 1BMNH 1HGTH 1K1MA 2F9BH 2G00A 1HAPH 2GDEH 1VCQA 2JKHA 4ZROA 3MFJA 1P9SA 1P03A 2GCHF 3PLBA 3EDXB 1UHBB 3RXMA 3TGJE 1CA0B 2FESH 1E34B 2BQWB 1GBDA 1IQKA 3PMAB 2ZGBH 3BG4C 1Z1JA 1YCPH 1GJ9B 1G2MA 2NU2E 4Y79A 4ZKNU 1D6RA 3MH5A 3NKKA 5ESBA 3SNBA 1FI8A 1GMDF 3LGUA 4LXBH 1O2ZA 3TK5A 3QUMP 1GHZA 2FI4E 2V3HH 1MAXA 3M36A 5AFZH 1EAWA 2C8YB 2PGQB 2QY0B 3PMJA 1LHDH 2FOCA 3SU4A 3FANA 3D23A 1QBNA 4X8SH 4I8KA 3ATIA 3CS0A 4ABDA 4Z6AH 5L2ZH 1FY4A 1O3OA 4NGAH 1W3CA 3KQBA 5HGGA 4Y8YA 4ABFA 2J95A 3ESTA 3E3TA 1HJ8A 3NWUA 1OWEA 1LVOA 1S85A 2BY7X 2ZTXA 4B2CA 3Q3KA 1TBRH 3SJIA 4ZUHA 1BJVA 1W7GH 2XW9A 4ZHAA 3BSQA 1SLVB 1HIAB 2BXTH 1O5EH 7GCHG 1N6YA 3FZDA 3RXGA 5TCAA 1BT7A 3SW2B 1SFQB 3MI4A 1PPZA 2A7HA 1C1QA 2CHAB 3ZYEA 2Q6DA 3RXIA 1GBEA 5C3NA 1JXPA 1TGBA 3LKWA 1EZQA 5EQRA 2ZGHA 1W11U 2BLOA 3A7WA 1LPGB 2VH6A 2A1DB 5C1XA 4FU8A 1O5CB 1JBUH 1XUKA 1ZHPA 3TVJB 1BTHH 1L0ZA 2C90B 3VXFH 1AFEH 4IS5A 5EW2H 2XCNA 3F9GA 1QR3E 4DY7B 1OP2A 3PMBB 1ZLRA 2CGAA 2Y82A 1IQEA 3BTDE 1GI5A 1V2RT 3RM0H 3H7TA 2ZQ1A 3RXVA 2ZKSA 5JDUB 4DIIH 2RA0A 2BY8X 1EJAA 3MHWU 2BLWA 2J38A 5A8ZA 2OCVB 1Y3XA 3TH2H 3F1SB 3LIWA 1SG8B 2OXSA 1CA0C 5DP6A 1Y5BT 1M9UA 3F9FA 3GCHB 2HALA 4GHQA 4XBCA 3CP7A 4WXVA 1V2VT 3KEEA 3M5MA 4WH8A 1AE8H 3MNSA 1P2JA 1TE0A 5K7RA 4A1XA 1P9UA 1GHAG 1GJAB 4AGJA 4CR9A 1FY1A 2P8OB 1SGRE 3OYPA 1BIOA 2ODPA 2SGPE 1A0HB 1SBWA 3GOVB 1TPOA 3ZVAA 2RA3A 4X2WA 1AUJA 2WPHS 1QCPA 1RD3B 2HNTF 2J34A 1QTFA 1UCYE 1TRNA 2HWLB 3UOPA 1H9IE 4AFSA 1QA7A 1TNJA 3SU6A 1Y3YA 1Q31A 3TH3H 1MD7A 1TPSA 2VWOA 3P8GA 4JYTA 4O3UA 2F9PA 3PO1C 5FPTA 3AW1A 2OP9A 1NRRH 1XKAC 3SNEA 4AG2A 1ZRKA 1QHRB 1C5RA 3SNCA 1DWBH 3RXJA 1TNHA 1QNJA 1LVYA 1QQ4A 3RC6A 3GY6A 3U8RH 1WTHD 1TB6H 1P05A 2F9VA 3OY6U 2BVRH 4LOYH 1THSH 2Y5FA 3UNRA 3A85A 1NRQH 1WQSA 1NESE 1XUGA 2VINA 3MMGA 3GY8A 1V2JT 4ZHMU 4TWWA 1A0JA 3HKIB 1T32A 4FU7A 1P12E 1L4ZA 8ESTE 2D8WA 7GCHF 3QLPH 2BD7A 2BDAA 3ATKA 4AGKA 2R2MB 5C1UA 1QY6A 3GY7A 1SGPE 4YZUA 1OSSA 3RXRA 2FTMA 1BRAA 1LHCH 2K1QA 1O5DH 1ANDA 4CRBA 1F92A 3GICB 4DGJA 1GVLA 1SL3A 2BLQA 2FPZA 1BMLA 2GDDA 5C67A 1SHHB 4U01A 4R0IA 2BD4A 1TBQH 1YKTA 1GDNA 5E2OA 4WH6A 6CHAB 4CHAB 3GCHC 2FOBA 1UK2A 3EYDA 3GY3A 2AGIX 1HAVA 1VCWA 1YCPM 4IMZA 2ZC9H 4K1EA 2XC0A 2ANKH 5E0HA 2F91A 1DX5M 1NS3A 2O8TA 2PGBB 1NFYA 4X1NU 1C5ZB 2SFAA 1O3KA 2NU3E 1P2QA 3RUOA 2PKAB 2P8OC 1XVMA 1SGIB 2IPHA 3UFAA 1CQQA 1FN6A 1ACBE 3SUGA 3SU5A 2H2ZA 2Z9JA 1MH0A 1BA8B 4BAHB 4CREA 4WMDA 2O8LA 4DURA 3K6YA 5EPNA 4MG3A 2YNBA 1C4U2 1IHTH 4YT7H 2BX4A 4ABHA 3EE0B 4BTUB 3QTOH 3RLYH 1ZHRA 2AMDA 3BTME 4HGCA 1GHAF 1BDAA 2OC1A 1KY9A 1V2UT 1NFXA 2R3YA 3UREA 2KAIB 5JPMH 1C2LA 4KP0A 1NPMA 4KTSA 3Q3XA 3RMOH 1UK3A 2GCTC 2OINA 1EAXA 1WU1A 2QCYA 3ZZ5A 2FOGA 1L2EA 1S0QA 2FDAA 1ELFA 2V6NA 3TGKE 1PFXC 1PJPA 3T26A 3SV9A 1RTLA 2PHBA 3FZZA 2QAAA 2UUYA 4WJG2 4YOJA 1LKBA 1AZZA 2F9OA 1P02A 1C1MA 2BDIA 2NU1E 1SQTA 1TAWA 2P59A 2ANMH 1Z8RA 1ID5H 1L1GA 5LGOA 1E35B 2FYQA 2R9PA 3GCNA 1KIGH 1C5YB 1MQ6A 2FLBH 1KXDA 2RG3A 1F0TA 2WV5A 1Z7KA 1C5UA 1B0FA 4A6LA 2GMTB 3RXFA 3TITA 2Z94A 1P2MA 1QL8A 1EXFA 1GI8B 2FXRA 1GJBB 5GIBA 6CHAC 4TYDA 4CHAC 1SVPA 3DHKH 3ZZ6A 1GBMA 4B75A 1SFIA 2BD8A 1GBCA 1E36B 1QA0A 2ZO3H 3G01A 4ESTE 2IJOB 3HGNA 1LVMA 3RU4D 4ASHA 5FCKA 3OY5U 4ZMAH 2YNAA 3I78A 2OLGA 3RXKA 4TPYA 3ZZ4A 1UTKA 1O2IA 1SMFE 1GBHA 1XUHA 7KMEH 2WPIS 4IC5A 2WPKS 1GGDB 4F49A 5DG6A 1QB9A 1NRSH 2GVFA 9ESTA 1DANH 1EATA 3TK6A 1SPJA 1OKXA 3AW0A 5FHTA 2P3FH 2FMJA 2PW8H 4UONA 2BLVA 2EI6A 4JZ1A 4VGCB 5CMXH 3SV8A 5K0HA 3URCA 1PPCE 3VB4A 2PR3A 1XXFA 2OBQA 1C9TA 1YP9A 1BTPA 1LVBA 3BV9B 1TGNA 1O35A 2A2XH 1V2NT 2JH5D 3ZV9A 2Y81A 3NXPA 2J94A 2FOEA 4WMFA 1SLXB 1HV7A 1AKSA 3SUDA 1P2OA 3BTHE 4J1YA 1MU8B 4X0WU 1LKAA 1C5SA 5DPAA 4K60A 2CN0H 1LMWB 1EOLA 3EA7A 5ETXA 1CGIE 1QL9A 1C2IA 4NZLA 3MO6A 2UWOA 4XBBA 8LPRA 1FPCH 4Y11E 2VWNA 2ZI2H 2FODA 4NWLA 3BF6H 4BAOB 1TX8A 3E8LA 3SNAA 1BTZA 3LPRA 3P70B 3P17H 1AWFH 2ASUB 4OGXA 1V2PT 3RMMH 1KXBA 2HPPH 2FP7B 1PYTC 3U8TH 3LGVA 3Q00A 1S5SA 3ZVDA 4X1RU 1KDQA 4B71A 1AFQB 1C4Y2 1K28D 1YPKH 4AX9H 4INHA 4RKOB 2ZHDA 3S9AA 5AF9H 1K2I1 1QJ1B 2SNWA 1ABIH 2JH6D 3PLKA 3MO9A 1OOKB 1EPTC 4NIVA 1S0RA 1Z8GA 3PROA 1TMBH 1UCYH 4Y76A 2UUKB 1MKXH 1Q2WA 1EP5A 2ZCLP 1C4V2 4DG4A 9LPRA 2ANYA 3LC3A 5GDSH 1BBRK 1T8NA 2BDBA 2QYIA 1TGSZ 4NZQA 1GGDC 3BTQE 3E0NB 4X1QU 1P11E 2PSYA 4XDEA 1TGCA 1C5TA 1ZYOA 2STAE 2ZU2A 4MDSA 2ZDAH 1O33A 2GV6A 1AN1E 1G32B 1ZTKA 3ZZ9A 4VGCC 2FIRH 4NSVA 1BTYA 1S81A 2GGVB 1ANCA 1C5MD 4MPVA 1V6DA 3QO6A 1RXPA 4YOGA 5FXLA 2ODQA 2W26A 1DLEA 1GJDB 5C2ZA 1K1IA 2ZU5A 3RMNH 3ZZ8A 1RS0A 2ODYB 1GBBA 3MYWA 4NFFA 1YCPK 3SU0A 5DP4A 3OSYA 3TJVA 3T29A 3SOSA 4AB8A 4Y8XA 1ANBA 1Y3WA 3PWCA 1T8OA 2W5EA 2BY5X 2BZ6H 3MNCA 1DUEA 1F0SA 2GZ7A 3S9BA 1SGQE 3NCLA 1VCPA 1BOQA 3P95A 1V2LT 4Q7ZA 8GCHG 2OUAA 1JRTA 1MKWK 1GI6A 1A5GH 2QXGA 1YPHC 2QF3A 1K1LA 3M5LA 2ZU1A 1GJ7B 1XUJA 1IOEA 4WF8A 2QXHA 1VR1H 1O2NA 2VIQA 1Y5AT 4A1TA 1ZTLA 3RU4E 1O34A 3RXLA 3RXBA 1C2FA 1IQJA 3BTKE 3HGPA 2NWNA 2ZDLA 1TPAE 1BUIA 4CRGA 4ISIH 3UNSA 3IWMA 1ZMNA 5C5NA 2DE9A 1V2WT 3RM2H 2VVCA 3Q77A 2PV9B 5EQQA 3S9CA 4B2AA 3AVZA 4X2YA 1KLJH 2ZCHP 1QRWA 3F68H 1THRH 1THPB 3M3TA 1CHOG 1UTJA 2A2QH 1HFDA 1OYQA 2CMYA 3A88A 1TRMA 1DVAH 2PWXA 4BTIB 4UD9H 1KLTA 2Z7FE 3Q3YA 2BVXH 2EC9H 2OTVA 4UEHH 2PKSB 4I8JA 1P3CA 1P09A 1HXEH 1NO9H 4KTCA 4D76A 3BEUA 2GP9B 4FU9A 1O2WA 3RXCA 1AZ8A 5L6NH 3T2NA 1A5HA 5EU8A 1MQ5A 3TLOA 1GHVH 1PQ8A 2XWAA 2BTCE 3B8JA 1GHYH 4Q7XA 3UOUA 1F2SE 2JETB 1HDTH 1D3QB 1DS2E 2B7DH 1SLUB 1LCYA 2BOHB 1NRNH 4GCHG 3QGJA 4E7RG 4K5ZA 4ABAA 1P04A 4LK4A 1GBLA 4ZKSU 3TU7H 4J2YB 4YESB 1O5FH 2QF0A 1E37B 2C8WB 2VIDA 1OWHA 1DXWA 1V2ST 1NU9A 1W13U 1A2CH 1VJ9U 2HVXA 5JBAS 1W10U 1HXFH 3PO1B 3LONA 3TJNA 4BAQB 1MTNB 2WINI 1CA8B 3BTWE 2AIPA 1EKBB 4BAMB 4A7IB 1TFXA 3ZVGA 3A8CA 1O3GA 2P93A 4ABBA 3GDSA 4I8LA 5C5OA 1HAYB 2P94A 5GCHG 3UUZA 2ZFRH 2PLXA 3BIVH 1E38B 1GBJA 1CT2E 2C3SA 2WUBA 4CH8B 3HKJB 5IYTA 1QFKH 1HAVB 2FOHA 2VIVA 3ZVBA 4I7YH 3B23B 4CH2B 1GI1A 3A8DA 4UE7H 2ZECA 2GT7A 1H8DH 1P8VC 8GCHF 2BD2A 4IW4E 1Q3XA 4WY3A 3ZZ3A 1FUJA 1ELBA 1SOZA 1AMHA 5T3HA 1P3EA 3W95A 5F6MA 4ZKOU 2ILNA 3SV7A 4OS1A 1CU1A 1BMMH 1MMJN 1PYTD 3FP6E 1WSSH 1WBGB 3KF2A 5DP9A 2Y6TA 1D4PB 1A3BH 1DFPA 2GKVE 1O30A 2AH4X 2TGTA 2WV4A 4O97A 4X2XA 3T62A 4AYYB 4INLA 1OP0A 1AVWA 3DD2H 3K65B 2PKSC 2G51A 1QJ7B 1TA2A 1O3IA 4Y71A 4QT8C 4IN2A 5E2PA 2ZWLH 3SHAH 3SJOA 1MBMA 3KL6A 3KHVA 3KNXA 4AB9A 1SQAA 2BMGB 2Q1JA 1CHOF 1IQLA 2TBSA 5I25A 1X7AC 1O2HA 1UK4A 2JETC 1FMGA 1BHXB 4GUXA 5LPFA 1C5QA 1CBWB 3QWCH 5HXFA 1D3TB 1H9HE 1OS8A 4ISLA 1ZMLA 2FI3E 2ZCKP 4YT6H 3SJ9A 1TMTH 2Y80A 4O03A 1ELEE 2VGCB 3LGIA 2AEIH 3O8BA 1L1JA 1GI3A 1C1WH 4UDWH 2ALPA 2BHGA 3A82A 3UR9A 1FXYA 1MTNC 1YPLH 4ZAEA 1O3DA 3L6PA 3TJOA 1XVOA 1RJXB 1A3EH 1HAZB 1TOCB 1F5KU 1YBWA 1GJCB 1G30B 1UHBA 4GCHF 3P8OA 2GCTB 2QA9E 1C2DA 2PUQH 2A5AA 1FY5A 1LDTT 2BYAX 3NZIA 4ABIA 1Y3UA 1DSTA 3KQDA 4AN7A 6ESTA 2BD3A 3MWIU 5JBCS 1FNIA 1TONA 1PPFE 1QRZA 3MO3A 1G3EA 2ZPSA 3P8FA 1FLEE 1C1VH 5BPEA 3M5NA 1OP8A 1V2TT 3ZYDA 2G81E 4I32A 1G2LA 1FAKH 1C2KA 1AVXA 4NIYA 1PPGE 5GCHF 1MTVA 1ELDE 4ISNA 1GHXH 2FOFA 3DFJA 3RC4A 2ZGJA 3EA9A 1INCA 1AIXH 1ESAA 1ESBA 2TGPZ 4FUEA 2FX6A 1HIAA 2OC0A 1F0UA 5JBBS 1LPZB 3LGWA 1PPHE 3U9AH 1PQAA 2LNCA 4TPIZ 1UTQA 1C5VA 1AQ7A 1GI4A 1TA6A 2FLRH 2Z3DA 1ORFA 1BB0B 3M35A 4R8TB 1GJ4H 4WXIA 1BQYA 1O32A 3SJ8A 1YYY1 1EJNA 3MU0A 1V2QT 3GISB 3N7OA 1P06A 2Z6BD 5H4IB 1RIWB 3HATH 1ZJKA 1XMNB 3E90B 1CBWC 2A7JA 5EG4A 1BBRE 4ZXXH 1OXGA 1QBVH 1UVPA 2P3UB 1HNEE 1OWDA 2BM2A 3GY2A 2A0QB 5A8XA 3BEIB 3MTYA 4AORA 1OYTH 4XE4A 1TIOA 4RN6A 2VGCC 1A61H 4AYVB 2VH0A 1O3BA 1AVGH 3RC5A 1WYKA 4CRDA 5F8ZA 4B1TA 2H9EH 3O8RA 4DT7B 2C4FH 2WYGA 1T8MA 3S7HB 1EZXC 3GYMA 4Y10E 3SJKA 1O31A 3I77A 1G3DA 3F9EA 1GI0A 1GCDA 1HYLA 2A4QA 3S69A 1GCTB 5LH8A 1VJAU 4YTAA 5SGAE 4K69A 2HLCA 2AS9A 2J2UA 3JZ1B 1O2TA 2FOMB 2ZA5A 1MD8A 2CV3A 1WQVH 3GDUA 2I6QA 3ZZAA 1ABJH 1P2KA 1IQHA 1ESTA 1MU6B 4ABEA 3E1XB 1EB2A 1C2EA 2XC4A 2A5IA 3SNDA 3RXTA 1O3MA 1EZSC 1LPKB 3VB6A 1O2YA 3FP8E 2ZPRA 1MAYA 1O38A 1SGEE 2Z9KA 1AO5A 2GT8A 5C20A 1GJ8B 1SR5C 1QIXB 4WVPE 3SGQE 5J4SA 5I46H 1DWEH 3ATMA 5EOKA 1MTWA 4Q7YA 1SB1H 3A84A 3A83A 3CS7A 4U2WA 2Z9GA 1TOMH 3U1IB
chains in the Genus database with same CATH superfamily
1O0DH 3SN8A 2VIPA 1JWTA 5F8XA 1AI8H 1ZSLA 2TGDA 2ZGXH 1MCVA 2AMQA 1D9IA 1MBQA 3F6UH 3TH4H 1AB9B 1YM0A 1O2UA 1S6HA 3A7TA 1IHSH 1HBTH 2BX3A 4TWYA 2F4LA 4GHTA 4U32A 1EAIA 3TNTA 1E0FD 1WUNH 1EPTB 4NWKA 1ZRBA 2VVVA 1CGHA 1CE5A 1SQOA 1UTMA 2VWMA 4DIHH 3UIRA 2G55A 4B74A 3UNQA 4FUIA 4X8UH 3ZIAD 3RXHA 3TPIZ 1AGJA 1W7XH 3ODDA 2UUJB 3VPKA 1VZQH 3ODFA 2GD4B 1CT4E 3ATLA 1RIWC 4I31A 3NK8A 1XX9A 1TWXB 3M3SA 4I8HA 1FDPA 2O9QA 3SHCH 4FUJA 3LGYA 1QJ6B 1B0EA 4Q2KA 3JZ2B 1DOJA 2BOKA 2ZNKH 4UFGH 1CSOE 3RXSA 1ZGVA 1H1BA 3QTVH 1IQNA 1ETSH 2VNTA 3U98H 1LTOA 1H8ED 4FUDA 1LHEH 2H6MA 3H09A 3MQKC 4OS2A 2XC5A 3SV2H 1B5GH 2G5VA 1GCTC 1HCGA 1C1OA 5GWZA 4D7GA 4X8TH 1RRKA 4FXGH 3PTNA 4X6OA 3K6ZA 1Y5UT 4DCDA 3U28C 2A31A 5HM9A 2H9TH 1UJ1A 2GZ9A 1LHFH 6GCHG 2ANWA 4DOQA 1FAXA 4X8VH 1WCZA 1V2OT 5DJ7A 2FS9A 4NA8A 1GG6B 3T25A 1KTSB 1GJ5H 2D2DA 2JJ2D 5A2MH 2PKAA 2Z3CA 3GYLB 1O2XA 2P95A 1LQEA 1DY9A 3QZQA 2ZU3A 1GBTA 1LQDB 1F0RA 3H7OA 4TSFD 1D3DB 1YF4A 2C93B 3E91A 5FBEA 2AGGX 2TIOA 3RXDA 1ZPZA 2AERH 3MU1A 1O5GH 3O8DA 4AZ2B 1A1RA 2Y7ZA 1GL0E 1JIRA 5HMAA 1CHGA 1ELTA 1DY8A 3OX7U 1H8HD 1DE7H 2RCEA 2BQ6B 1AB9C 4RI0A 5DK1A 2NU4E 5HKKD 1EZUC 3M7UA 3V7TA 2XBWA 1MZDA 1ZSKA 1GMHG 1O2LA 2W6ID 1C5WB 4XBDA 2BD5A 1SLWB 3K9XB 1WOFA 2PP6A 4FUCA 2KAIA 1TALA 1C1RA 1N1LA 3SORA 1PPBH 3S7KB 4FUGA 3LGTA 3BTEE 3UAIC 2I6SA 1O3FA 3UQOA 1PPEE 2FOAA 1RFNA 2XTTB 3C27B 2KCPA 3TJUA 2XBYA 4OGYA 1FN8A 3PV5A 1MTUA 1TRYA 1K1PA 2F43B 4GLYA 1ELAA 1KSNA 4ISHH 2HRVA 4DW2U 4MNVA 2FZZA 3RP2A 3MOCA 2PTNA 3PWBA 4HZHA 2XCFA 5GXPA 5T1VA 3A80A 3IG6B 4H4FA 2OC7A 4OM9A 2JDID 5A09A 2XXLA 4E05H 3GCTG 3LDXH 1H8IH 1FQ3A 2XWBI 4KELA 5FPSA 1AD8H 5DKMA 1T8LA 1GBIA 1EASA 2D1JA 2WPJS 1Z6EA 5E0GA 3TK9A 4AG1A 4B76A 5TJXA 1YPGH 1EB1H 4NG9H 1CT0E 3VB5A 5EQSA 1C1PA 1GBKA 2P3TB 3PMHB 5E0JA 1TX6A 1G36A 1C5LH 1IQGA 3PB1E 4B2BA 4YLQH 1NT1A 1O2MA 1HJAB 2R3UA 1DM4B 4K1SA 1L4DA 1KXCA 5A0AE 1O37A 1SC8U 2UUFB 3UTUH 2VU8E 5DP3A 2BY9X 1OX1A 2CXVA 3UPEA 1MZAA 1GG6C 4D9RA 3EGKH 1ANEA 1C5PA 5LPEA 2YOLA 2ULLA 1HRTH 3ZVCA 3RXEA 2HPQH 3SUFA 3W94A 4YLUA 4WWYA 1J8AA 5LPRA 3BN9A 2O8UA 2QN5T 2A4GA 4MLFB 2CF9H 4TY7A 2W7SA 1G37A 1CGJE 3SQEE 4Z1MD 1W0YH 3OFND 3N99A 3NPSA 4X6PA 1BJUA 2A5KA 2UWLA 4D8NA 6GCHF 1YPEH 3E6PH 1ZMJA 3PV4A 2XNDD 1N8OB 3M61U 1DLKB 1SGDE 4ISOA 4OS7A 3C1KA 3VB3A 1BBRH 5L30H 5CHBA 4IMQA 2Y7XA 1MTSA 3VXEH 1YLDA 1FONA 2EA3A 1SGNE 2B5TB 2J9NA 1GI2A 4JCNA 1TQ0B 3V13A 1QL7A 1EJMA 3P6ZB 1BCUH 1DXPA 4FUBA 3L33A 3DSPA 1SGTA 2ZDMA 1J9CH 2A45B 4MNWA 4BTTB 1TGTA 1GMHF 2ZF0H 2XNIA 2VWLA 1GHBG 3MU4A 1ZJDA 2C8ZB 3PTBA 3SQHE 1P57B 2ZQ2A 5T6FA 2G5NA 1BMFD 1O2KA 3SGAE 4Y7BA 2ZEBA 5AVDA 4IN1A 2B0FA 1Z71A 2ZPQA 3SI3H 1H9LB 1O2SA 2D26C 1E1QD 4JZEH 1WV7H 2AIQA 3SZEA 3AAVA 1TPPA 5TCCA 3ZZ7A 2CK3D 3H5CB 5AFYH 2NU0E 1KXFA 2H9HA 1UTLM 1F7ZA 1T31A 3MH4A 4GAWA 1C5XB 3WWFA 1BRBE 1MKWH 1GJ6A 4ZCNA 2ZFSA 1XUIA 2IPQX 1HJAC 2JH0D 3FVFB 1NZQH 2ZGCA 4I8GA 1OWIA 3GCTF 1ARBA 1LO6A 2RDLA 1OHHD 2VB0A 2HNTC 1KLIH 1HAOH 4DVAU 8KME2 3D49H 1V3XA 3VFEA 5FPYA 3RXPA 2LPRA 4MVNA 4SGAE 2IOTA 1NU7B 1SSXA 4ASUD 2OC8A 4CR5A 4K8YA 2FTLE 2WPMS 4I33A 5BRRE 3VB7A 5C0TA 4AOQA 3FFGA 3FP7E 2M5TA 1Z8IB 1DSUA 4BAKB 4X1SU 1O3JA 3TGIE 5EGMA 5EODA 2W6JD 1WTGH 4BXWA 4IC6A 2XRCA 3A89A 4MNYA 3SUEA 4ZH8A 2ZIQH 5JB8S 2STBE 1IQMA 4CRFA 1TYNA 5DP8A 2EI7A 4XFQA 1N8OC 1A5IA 1K9OE 2J98A 3Q76A 3QX5H 1HB0B 3WY8A 4FUHA 1ZTJA 3A8BA 4MQAA 4E06H 3ATWA 4X6MA 2Q6FA 3HK6B 1DT2A 1SGYE 4AFZA 1J17T 1JOUB 2EEKA 1GL1A 3M3VA 1C5NH 2V0BA 4HTCH 2ZP0H 4HFPB 2JIZD 1SHYA 1ZPCA 2G4TA 2AGEX 1GI7B 1OPHB 2GJGA 2KZ4A 5FCRA 3U1JB 1O2QA 2QXIA 1O3HA 4AFQA 3BIUH 1UTNA 5IDKA 2KX4A 1G3CA 1MUEB 4YOIA 3BTTE 3L3TA 1JIMA 1NFWA 2KCAA 1ETTH 5A0CA 2IN2A 4D7FA 4MPWA 3V12A 1C1TA 1EOJA 3V0XA 4THNH 1IQIA 1TX7A 3D62A 3KCGH 3RDZA 4X2VA 1SGCA 1QURH 2BDGA 1VITG 4B6EA 1GHBF 5C0UA 1Z6JH 4H6SB 2A7CA 3DSGA 2DE8A 4CRCA 1FZZA 1C2HA 1O5BB 1TBZH 1TNGA 1AY6H 1UVUH 1XM1A 4NFEA 2SGQE 3F0OA 4NSYA 2ALVA 4MPXA 3T5FH 1ZZZA 2W3KA 5EW1H 5KGOA 4TY6A 2V35A 4JYVH 2PFEA 1NM6A 3BTFE 4K2YA 4K3JA 2BZAA 4Y7AA 2SGAA 2J4IA 5PTPA 1BTXA 1W14U 2CHAC 1RTFB 2Z9IA 3GY4A 1IAUA 2GV7A 1FX0B 1ELCA 1EP6A 3SU3A 1K1OA 1O2PA 2O8MA 4WMEA 3UWJH 2CJIA 2VJ1A 3EE7A 3KQEA 5E8EH 5GPIB 5G4BA 1S6FA 1S84A 3NUMA 5A8YA 1DPOA 1A7SA 4Y0ZE 1C2MA 1D3PB 3DT0H 3A7XA 4SGBE 1AE5A 1J14A 1XUFA 3MU8A 2GZ8A 4O9VA 5DP5A 3A7VA 1BTUA 3P92A 3PLPA 5ESTE 1MABB 3STIA 2V3OH 3QGNB 3KIDU 1O2VA 1YLNA 2PUXB 3SO3A 4ZHLU 1RTKA 3F2FA 3RLWH 3QDZB 1TQ7B 4Y8ZA 5CE1A 2ZG0H 3VGCB 1TNLA 3SZNA 1O2RA 1TNIA 2THFB 1AKSB 3ZZBA 1H4WA 2F9NA 3RXUA 1GWAA 1BZXE 5JB9S 1UVOA 3UY9A 3U69H 2VVUA 5EXLA 4RKJB 2PTCE 1QGFA 2Y5GA 1HLTH 2KR7A 2PSXA 5FX6A 1SOTA 3GCOA 4O3TA 2TGAA 3E16B 1L1NA 2FX4A 3BEFB 4Y0YE 3M37A 2TPIZ 3OTJE 4OS6A 4XSKU 3ZVEA 5J4QA 2FS8A 1FIZA 2B8OH 2GX4A 3ITIA 4JYUH 1J16A 2SGFE 4FUFA 1NTPA 1GBFA 3SU1A 1Y3VA 4NIXA 2ZZUH 4NCYA 4A1VA 2AYWA 3ZVFA 2HLDD 2FWWA 1GVKB 1A46H 4K1TA 2BD9A 4NA7A 1ETRH 5FAHA 4JK5A 1C2GA 1O2OA 1P2NA 2G52A 4GSOA 1NY22 1KDQB 3A7YA 1QB1A 1W2KH 1NFUA 4KTUA 3DUXH 2FI5E 2A4OA 1P2IA 4P02A 1GMCG 5JYIA 1DDJA 3M7QA 2R2WU 3RXQA 3SGBE 3GDVA 2SGDE 2W7UA 2QV1A 4GPGA 2BDCA 1C1UH 4MPUA 5EJLA 5F8TA 1QB6A 3FAOA 1W0ZU 1YPMH 1QZ8A 1VITF 1QRXA 2ZFPH 3EAJA 2ZFFH 3KGPA 2G4UA 2QXJA 2SNVA 1G9IE 2XYAA 2BDYA 1PQ7A 3HPTB 6LPRA 5F03A 1BMAA 2AMPA 3KN2A 1DUAA 4JZDH 4Z0KA 2A32A 5HYOA 4NA9H 1AHTH 1HAIH 2OQUA 4Y6DA 3LH1A 3M5OA 3D65E 1C2JA 1ZPBA 4KGAA 5HIYA 2OD3B 1TABE 3IITA 3MH6A 4KKDA 3SI4H 4I86A 3ZZDA 2ZFQH 3VGCC 1UVSH 3ELAH 1Y8TA 1Y59T 3QZRA 4YO9A 4YM9A 1COWD 2J92A 1A0LA 1BRUP 1P01A 1QQUA 1TMUH 4M7GA 4MNXA 1SGFG 2BQ7B 1CVWH 3EQ0H 3R0FA 3A86A 1K21H 2FO9A 1AWHB 1BHXF 1E1RD 1EUFA 2P16A 1O3LA 5JBTA 3PRBA 1T4VH 2ZDVH 3SYJA 2ZU4A 2ZTZA 5GJ4B 1O3AA 5T6DA 2C8XB 3VEQB 3MH7A 4BNRA 1FIWA 4JZIA 1T7CA 5L2YH 1O3CA 1P0SH 3F0PA 1VITH 1K1JA 5HM2A 3LC5A 5AHGH 1UCYK 3MU5A 4B73A 2G8TA 3V3MA 1MKXK 3R3GB 5A0BA 1FY8E 2OBOA 5ABWA 3TIUA 5C1YA 2F9UA 4OS5A 1W12U 3LU9B 2BY6X 1YPHE 1CO7E 4U30A 4HG6A 1RGQA 3KQCA 3MNXA 2DUCA 3DA9B 1YLCA 3O8CA 4BXSA 1ZSJA 2HGTH 1ZOMA 5FBIA 2F3CE 4K8BA 4Q4LA 4CRAA 1HUTH 1KYNA 3GY5A 1FV9A 1EQ9A 3SU2A 4JMYA 2H5DA 2ESTE 1GI9B 1DITH 2F83A 2Z9LA 1O3NA 1O5AB 1WAYB 2J5UA 5DP7A 3SBKA 4JZFH 1NC6A 4H42U 4ABGA 1G3BA 1ELVA 2QGRA 3OTPA 1OWKA 1VGCB 3A7ZA 1V2KT 5DN6D 4E7NA 2QIQA 4MTBA 1PQ5A 1YPJH 2ZDNA 1C5OH 1KXEA 1EX3A 1O3PB 3S0NA 4BANB 3BTGE 1TLDA 3LOXA 4F48B 3A87A 1O2GH 1Z1IA 3E0PB 2UWPA 1GMCF 3ZZCA 4UFFH 5DO4H 1SI5H 2R0LA 4B6FA 3K2UA 5CHAB 1YGCH 2W3IA 1LHGH 4ACBA 2GTBA 2ZDKA 3N7EA 2ZFTA 3HK3B 1O36A 4X1PU 4AFUA 3UQVA 4LZ4B 1EAUA 2GCHG 1T4UH 5B6OA 4UFDH 1DWDH 3VG8A 1SGFA 1U6QA 2GMTC 2VIOA 2KCYA 5EIYA 3FOAA 4D9QA 2BB4A 1ZHMA 2BDHA 2RFKC 3TNSA 2BVSH 4ZXYH 3T28A 2XBVA 1K22H 1AUTC 2VIWA 2CF8H 1GMDG 3AAUA 4IBLH 4OS4A 2FYRA 2Q6GA 3LH3A 3I29A 2ZTYA 1HAHH 1N6XA 4LZ1H 3U8OH 1XXDA 1GDQA 3AASA 1C1SA 1OWJA 1W8BH 1JMOH 3P8NA 3A8AA 1NN6A 4CBNA 4JK6A 1UO6A 5T6GA 1HAXB 3BG4B 4RSPA 3CENA 1EFRD 1J15A 1B7XB 2H5CA 1F5RA 2K8IA 1S82A 2WYJA 2HNTE 5EXMA 4FVDA 1ARCA 3ZV8A 1BRCE 1MCTA 3F9HA 1UVTH 4FVBA 4IGDA 1UTOA 2ZHEH 2FEQH 1QBOA 4A92A 1FY3A 3BG8A 5EPYA 4ZKRU 3PYHA 5FX5A 4H6TA 1V2MT 1GDUA 1KXAA 1F5LA 1EPTA 3ENSB 3EA8A 1AU8A 3LT3A 4X6NA 1Z8JB 1GVZA 2Y5HA 4HI3A 1C9PA 1GHWH 2R0KA 4UFEH 2SGEE 4Q80A 1HAGE 5KEDA 1GPZA 2KFWA 2QC2A 3FKSD 1O2JA 4GVUA 7LPRA 1NROH 1VGCC 2HOBA 3OU0A 1JRSA 1HJ9A 2OQ5A 4F4OC 3PV2A 1ZGIA 3B9FH 4ABJA 4DJZB 2WZQA 1NRPH 1XKBC 2ZHFH 2ZHQH 3URDA 2O8WA 3RMLH 2XBXA 3M7TA 1A4WH 1IQFA 4NIWA 2Z3EA 1HPGA 1ELGA 1DWCH 1KTTB 5CHAC 3LJJA 3QK1A 4PROA 2B9LA 1O39A 3MNBA 4INKA 1P10A 2WPLS 3STJA 3LJOA 2TRMA 1C1NA 3RU4T 1ZR0A 2A4RA 3A81A 3UR6A 2FM2A 1BTWA 1GBAA 4BOHA 2WUCA 2AFQB 3PM3A 4A5TS 1FJSA 3T27A 1S83A 1D6WA 4XOJA 1YC0A 1O3EA 1BITA 2EI8A 1K1NA 2BXUH 1TNKA 1UMAH 3DFLA 3UWIA 1AFQC 3RXAA 1DICA 1UTPA 4CBOA 1FPHH 2H1UA 3SV6A 3QN7A 2L6OA 5EXNA 3RXOA 7ESTE 2ZHWH 5DGJA 1BMNH 1HGTH 1K1MA 2F9BH 2G00A 1HAPH 2GDEH 1VCQA 2JKHA 4ZROA 3MFJA 1P9SA 1P03A 3AK5A 2GCHF 3PLBA 3EDXB 1UHBB 3RXMA 3TGJE 1CA0B 2FESH 1E34B 4DT4A 2BQWB 1GBDA 1IQKA 3PMAB 2ZGBH 3BG4C 1Z1JA 1YCPH 1GJ9B 1G2MA 2NU2E 2KCOA 4Y79A 3WW7A 4ZKNU 1D6RA 1WDIA 3MH5A 3NKKA 5ESBA 3SNBA 1FI8A 1GMDF 3LGUA 4LXBH 1O2ZA 3TK5A 3QUMP 1VKYA 1GHZA 2FI4E 2V3HH 1MAXA 3M36A 5AFZH 1EAWA 2C8YB 2PGQB 2QY0B 3PMJA 1LHDH 2FOCA 3SU4A 3FANA 3D23A 1QBNA 4X8SH 4I8KA 3ATIA 3CS0A 4ABDA 4Z6AH 5L2ZH 1FY4A 1O3OA 4NGAH 1W3CA 3KQBA 5HGGA 4Y8YA 4ABFA 2J95A 3ESTA 3E3TA 1HJ8A 3NWUA 1OWEA 4P00A 1LVOA 1S85A 2BY7X 2ZTXA 4B2CA 3Q3KA 1TBRH 3SJIA 4ZUHA 1BJVA 2RDEA 1W7GH 2XW9A 4ZHAA 3BSQA 1SLVB 1HIAB 2BXTH 1O5EH 7GCHG 1N6YA 3FZDA 1E79D 3RXGA 5TCAA 1BT7A 3SW2B 1SFQB 3MI4A 1PPZA 2A7HA 1C1QA 2CHAB 3ZYEA 2Q6DA 3RXIA 1GBEA 5C3NA 1JXPA 1TGBA 3LKWA 1EZQA 5EQRA 2ZGHA 1W11U 2BLOA 3A7WA 1LPGB 2VH6A 2A1DB 5C1XA 4FU8A 4Q63A 1O5CB 1JBUH 1XUKA 1ZHPA 3TVJB 3OAAD 1BTHH 1L0ZA 2C90B 3VXFH 1AFEH 4IS5A 5EW2H 2XCNA 3F9GA 1SQRA 1QR3E 4DY7B 1OP2A 3PMBB 1ZLRA 2CGAA 2Y82A 1IQEA 3KQ5A 1WXRA 3BTDE 1GI5A 1V2RT 3RM0H 3H7TA 1NBMD 2ZQ1A 3RXVA 2ZKSA 5JDUB 4DIIH 2RA0A 2BY8X 1EJAA 3MHWU 2BLWA 2J38A 5A8ZA 2OCVB 1Y3XA 3TH2H 3F1SB 3LIWA 1SG8B 2OXSA 1CA0C 5DP6A 1Y5BT 1M9UA 3F9FA 3GCHB 2HALA 4GHQA 4XBCA 3CP7A 4WXVA 1V2VT 3KEEA 3M5MA 4XD7D 4WH8A 1AE8H 3MNSA 4YXWD 1P2JA 1TE0A 5K7RA 4A1XA 1P9UA 1GHAG 1GJAB 4AGJA 4CR9A 1FY1A 2P8OB 1SGRE 3OYPA 1W0JD 1BIOA 2ODPA 2SGPE 1A0HB 1SBWA 3GOVB 1TPOA 3ZVAA 2RA3A 4X2WA 1AUJA 2WPHS 5CDFE 1QCPA 1RD3B 2HNTF 2J34A 1QTFA 1UCYE 2K0QA 1TRNA 2HWLB 3UOPA 1H9IE 4AFSA 1QA7A 1TNJA 3SU6A 1Y3YA 1Q31A 3TH3H 1MD7A 1TPSA 2VWOA 3P8GA 4JYTA 4O3UA 2F9PA 3PO1C 5FPTA 3AW1A 2OP9A 1NRRH 1XKAC 3SNEA 4AG2A 1ZRKA 1QHRB 1C5RA 3SNCA 1DWBH 3RXJA 1TNHA 1QNJA 1LVYA 1QQ4A 3RC6A 3KYGA 3GY6A 3U8RH 1WTHD 1TB6H 1P05A 2F9VA 3OY6U 2BVRH 4LOYH 1THSH 2Y5FA 2YMSB 3UNRA 3A85A 1NRQH 1WQSA 1NESE 1XUGA 2VINA 3MMGA 3GY8A 2WV9A 1V2JT 4ZHMU 4TWWA 1A0JA 3HKIB 1T32A 4FU7A 1P12E 1L4ZA 8ESTE 2D8WA 7GCHF 3QLPH 2BD7A 2BDAA 3ATKA 4AGKA 2R2MB 5C1UA 1QY6A 3GY7A 1SGPE 4YZUA 1OSSA 3RXRA 2FTMA 1BRAA 1LHCH 2K1QA 1O5DH 1ANDA 4CRBA 1F92A 5C17A 3GICB 4DGJA 1GVLA 1SL3A 2BLQA 1YWUA 2FPZA 1BMLA 2GDDA 5C67A 1SHHB 4U01A 4R0IA 2BD4A 1TBQH 1YKTA 1GDNA 2WPDD 5E2OA 4WH6A 6CHAB 4CHAB 3GCHC 2FOBA 1UK2A 3EYDA 3GY3A 2AGIX 1HAVA 1VCWA 2V7QD 1YCPM 4IMZA 2ZC9H 4K1EA 2XC0A 2ANKH 5E0HA 2F91A 1DX5M 1NS3A 2O8TA 2PGBB 1NFYA 3W1EA 4X1NU 1C5ZB 2SFAA 1O3KA 2NU3E 1P2QA 3RUOA 2PKAB 2P8OC 1XVMA 1SGIB 2IPHA 3UFAA 2QF4A 4M9FA 1CQQA 1FN6A 3N7DA 1ACBE 3SUGA 3SU5A 2H2ZA 2Z9JA 3DCLA 1MH0A 1BA8B 2KM0A 4BAHB 4CREA 4WMDA 2O8LA 4DURA 3K6YA 5EPNA 4MG3A 2YNBA 1C4U2 5F53A 1IHTH 4YT7H 2BX4A 4ABHA 3EE0B 4BTUB 3QTOH 3RLYH 1ZHRA 5EJZA 2AMDA 3BTME 4HGCA 1GHAF 1BDAA 1KY9A 1V2UT 2OC1A 1NFXA 2WHXA 2R3YA 3UREA 2KAIB 5JPMH 1C2LA 4KP0A 1NPMA 4KTSA 3Q3XA 3RMOH 1NBME 1UK3A 2GCTC 2OINA 1EAXA 1WU1A 2QCYA 3ZZ5A 2FOGA 1L2EA 1S0QA 2FDAA 1ELFA 2V6NA 3KYFA 3TGKE 1PFXC 2YMSC 1PJPA 3T26A 3SV9A 1RTLA 2PHBA 3FZZA 2EY4C 2QAAA 2UUYA 4WJG2 4YOJA 1LKBA 1AZZA 2F9OA 1P02A 1C1MA 2BDIA 2NU1E 1SQTA 1TAWA 2P59A 2ANMH 1Z8RA 1ID5H 1L1GA 5LGOA 4AC9A 1E35B 2FYQA 2R9PA 3GCNA 1KIGH 3NRLA 1C5YB 1MQ6A 2FLBH 1KXDA 2RG3A 1F0TA 4RT1A 2WV5A 1Z7KA 1C5UA 1B0FA 4A6LA 2GMTB 3RXFA 3TITA 2Z94A 3OE7D 1P2MA 1QL8A 1EXFA 1GI8B 2FXRA 1GJBB 5GIBA 6CHAC 4TYDA 4CHAC 1SVPA 3DHKH 3ZZ6A 1GBMA 4B75A 1SFIA 2BD8A 1GBCA 1E36B 1QA0A 2ZO3H 3G01A 4ESTE 2IJOB 3HGNA 1LVMA 3RU4D 4ASHA 5FCKA 3OY5U 4ZMAH 2YNAA 1SKYE 3I78A 2OLGA 3RXKA 4TPYA 3ZZ4A 1UTKA 1O2IA 1SMFE 1GBHA 1XUHA 7KMEH 1S6LA 2WPIS 2WPKS 1GGDB 3OEHD 4F49A 4IC5A 5DG6A 1QB9A 1NRSH 2GVFA 9ESTA 1DANH 1EATA 3TK6A 1SPJA 1OKXA 3AW0A 5FHTA 2P3FH 2FMJA 2PW8H 4UONA 2BLVA 2EI6A 4JZ1A 4VGCB 5CMXH 3SV8A 5K0HA 3URCA 1PPCE 3VB4A 2PR3A 1XXFA 2OBQA 1C9TA 1YP9A 1BTPA 1LVBA 3BV9B 1TGNA 1O35A 2A2XH 1V2NT 2JH5D 4FOUC 3ZV9A 2Y81A 3NXPA 2J94A 2FOEA 4WMFA 1SLXB 1HV7A 1AKSA 3SUDA 1P2OA 3BTHE 4J1YA 1MU8B 4X0WU 1LKAA 1C5SA 5DPAA 4K60A 2CN0H 1LMWB 1EOLA 3EA7A 5ETXA 1CGIE 1QL9A 1C2IA 4NZLA 3MO6A 2UWOA 4XBBA 8LPRA 1FPCH 4Y11E 2VWNA 2ZI2H 2FODA 4NWLA 3BF6H 4BAOB 1TX8A 2QE7D 3E8LA 3SNAA 2WSSD 1BTZA 3LPRA 3P70B 3P17H 1AWFH 2ASUB 4OGXA 1V2PT 3RMMH 1KXBA 2HPPH 2FP7B 1PYTC 3U8TH 3LGVA 3Q00A 1S5SA 3ZVDA 5EJ1A 4X1RU 1KDQA 4B71A 1AFQB 1C4Y2 1K28D 2J97A 1YPKH 4AX9H 2IJD1 4INHA 4RKOB 2ZHDA 3S9AA 5AF9H 1K2I1 1QJ1B 2SNWA 1ABIH 2JH6D 3DSOA 3PLKA 3MO9A 1OOKB 1EPTC 4NIVA 1S0RA 1Z8GA 3PROA 1TMBH 1UCYH 4Y76A 2UUKB 1MKXH 3OEED 1Q2WA 1EP5A 2ZCLP 1C4V2 4DG4A 9LPRA 2ANYA 3LC3A 5GDSH 1BBRK 1T8NA 2BDBA 2QYIA 1TGSZ 4NZQA 1GGDC 3BTQE 5C94A 3E0NB 4X1QU 1P11E 2PSYA 4XDEA 1TGCA 1C5TA 1ZYOA 2STAE 2ZU2A 4MDSA 2ZDAH 1O33A 2GV6A 1AN1E 1G32B 1ZTKA 3ZZ9A 4VGCC 2FIRH 4NSVA 1BTYA 1S81A 2GGVB 1ANCA 1C5MD 4MPVA 1V6DA 3QO6A 1RXPA 4YOGA 5FXLA 2ODQA 2W26A 1DLEA 1GJDB 5C2ZA 1K1IA 2ZU5A 3RMNH 2J98B 2LP6A 3ZZ8A 1RS0A 2ODYB 3CNRA 1GBBA 3MYWA 4NFFA 1YCPK 3SU0A 3GS9A 5DP4A 3OSYA 3TJVA 3T29A 3SOSA 4AB8A 4Y8XA 1ANBA 1Y3WA 3PWCA 1T8OA 2W5EA 4FETA 4XRNA 2BY5X 2BZ6H 3MNCA 1DUEA 1F0SA 2GZ7A 3S9BA 1SGQE 3NCLA 1VCPA 1BOQA 3P95A 1V2LT 4Q7ZA 8GCHG 2OUAA 1JRTA 1MKWK 1GI6A 1A5GH 2QXGA 1YPHC 2QF3A 1K1LA 3M5LA 2ZU1A 1GJ7B 1XUJA 1IOEA 4WF8A 2QXHA 1VR1H 1O2NA 2VIQA 1Y5AT 4A1TA 1ZTLA 3RU4E 1O34A 3RXLA 3RXBA 1C2FA 2LELA 1IQJA 3BTKE 3HGPA 2NWNA 2ZDLA 1TPAE 2YMSD 1BUIA 4CRGA 4ISIH 3UNSA 3IWMA 1ZMNA 5C5NA 2DE9A 1YY3A 1V2WT 3RM2H 2VVCA 3Q77A 2PV9B 5EQQA 3S9CA 4B2AA 2M2AA 3AVZA 4X2YA 1KLJH 2ZCHP 1QRWA 3F3BA 1THRH 1THPB 3F68H 3M3TA 4TT3D 1CHOG 1UTJA 2A2QH 1HFDA 1K0HA 1OYQA 2CMYA 3A88A 5HIZA 1TRMA 1DVAH 2PWXA 4BTIB 4UD9H 1KLTA 2Z7FE 3Q3YA 2BVXH 2EC9H 2OTVA 4UEHH 2PKSB 4I8JA 1P3CA 1P09A 1HXEH 1NO9H 4KTCA 4D76A 3BEUA 2GP9B 4FU9A 1O2WA 3RXCA 2JJ1D 1AZ8A 5L6NH 3T2NA 1A5HA 5EU8A 1MQ5A 3TLOA 1GHVH 1PQ8A 2XWAA 2BTCE 3B8JA 1GHYH 4Q7XA 3UOUA 1F2SE 2JETB 1HDTH 1D3QB 1DS2E 2B7DH 1SLUB 1LCYA 2BOHB 1NRNH 4GCHG 3QGJA 4E7RG 4K5ZA 4ABAA 1P04A 4LK4A 1GBLA 4ZKSU 3TU7H 3F2HA 4J2YB 4YESB 1O5FH 2QF0A 1E37B 2C8WB 2VIDA 2OK5A 1OWHA 1DXWA 2HVYB 1V2ST 1NU9A 1W13U 1A2CH 1VJ9U 2HVXA 5JBAS 1W10U 1HXFH 3PO1B 3LONA 3TJNA 4BAQB 1MTNB 2WINI 1CA8B 3BTWE 2AIPA 1EKBB 4BAMB 4A7IB 1TFXA 3ZVGA 3A8CA 1O3GA 2P93A 4ABBA 3GDSA 4I8LA 5C5OA 1HAYB 2P94A 5FL7D 5GCHG 3UUZA 2ZFRH 2PLXA 3BIVH 1E38B 1GBJA 1CT2E 2C3SA 2WUBA 4CH8B 3HKJB 5IYTA 1QFKH 4RT0A 1HAVB 2FOHA 2VIVA 3ZVBA 4I7YH 3B23B 2L74A 4CH2B 1GI1A 3A8DA 4UE7H 2ZECA 2GT7A 1H8DH 1P8VC 8GCHF 2BD2A 4IW4E 1Q3XA 4WY3A 3ZZ3A 1FUJA 1ELBA 1SOZA 1AMHA 2VBCA 5T3HA 1P3EA 3W95A 5F6MA 4ZKOU 2ILNA 3SV7A 4OS1A 1CU1A 1BMMH 1MMJN 1PYTD 3FP6E 1WSSH 1WBGB 3KF2A 5DP9A 2Y6TA 1D4PB 1A3BH 1DFPA 2GKVE 1O30A 2AH4X 2TGTA 2WV4A 4O97A 4X2XA 3T62A 4AYYB 4INLA 1OP0A 1AVWA 3DD2H 3K65B 2PKSC 2G51A 1QJ7B 1TA2A 1O3IA 4Y71A 5KECA 4QT8C 4IN2A 5E2PA 2ZWLH 3SHAH 3PRDA 3SJOA 1MBMA 3KL6A 3KHVA 3KNXA 4AB9A 1SQAA 2BMGB 2Q1JA 1CHOF 1IQLA 2TBSA 5I25A 1X7AC 1O2HA 1UK4A 2JETC 1FMGA 1BHXB 4GUXA 5LPFA 1C5QA 1CBWB 3QWCH 5HXFA 1D3TB 1H9HE 1OS8A 4ISLA 1ZMLA 2FI3E 2ZCKP 4YT6H 3SJ9A 1TMTH 2Y80A 4O03A 1ELEE 2VGCB 3LGIA 2AEIH 3O8BA 1L1JA 1GI3A 1C1WH 4UDWH 2ALPA 2BHGA 3A82A 3UR9A 1FXYA 3FN8A 1MTNC 1YPLH 4ZAEA 1O3DA 3L6PA 3TJOA 1XVOA 1RJXB 1A3EH 1HAZB 1TOCB 1F5KU 1YBWA 1KMHB 1GJCB 1G30B 1UHBA 4GCHF 3P8OA 2GCTB 2QA9E 1C2DA 2PUQH 2XOKD 2A5AA 1FY5A 1LDTT 2BYAX 3NZIA 4ABIA 3WWBA 3F2GA 1Y3UA 5GNDA 1DSTA 3KQDA 4AN7A 6ESTA 2BD3A 3MWIU 5JBCS 1FNIA 1TONA 1PPFE 1QRZA 3MO3A 1G3EA 2ZPSA 3P8FA 1UW7A 1FLEE 1C1VH 5BPEA 3M5NA 1OP8A 1V2TT 2EQNA 2G81E 3ZYDA 4I32A 1G2LA 1FAKH 1C2KA 1AVXA 4NIYA 1PPGE 3FO8D 5GCHF 1MTVA 1ELDE 4ISNA 1GHXH 2FOFA 2AHME 3DFJA 3RC4A 2ZGJA 3EA9A 1INCA 1AIXH 1ESAA 1ESBA 2TGPZ 4FUEA 2FX6A 1HIAA 2OC0A 1F0UA 5JBBS 1LPZB 3LGWA 1PPHE 3U9AH 1PQAA 2LNCA 4TPIZ 1UTQA 1C5VA 1AQ7A 1GI4A 1TA6A 2FLRH 2Z3DA 1ORFA 1BB0B 1W0KD 3M35A 4R8TB 1GJ4H 4WXIA 1BQYA 1O32A 5DSFA 3SJ8A 1YYY1 1EJNA 3MU0A 1V2QT 3GISB 3N7OA 1P06A 2Z6BD 5H4IB 1RIWB 3HATH 1ZJKA 1XMNB 3E90B 1CBWC 2A7JA 5EG4A 1BBRE 4ZXXH 1OXGA 1QBVH 1UVPA 2P3UB 1HNEE 1OWDA 2BM2A 3GY2A 2A0QB 5A8XA 3BEIB 3MTYA 4AORA 1OYTH 4XE4A 1TIOA 4RN6A 2VGCC 1A61H 3UB0A 4AYVB 2VH0A 1O3BA 1AVGH 2V3MA 3RC5A 1WYKA 4CRDA 5F8ZA 4B1TA 2H9EH 3O8RA 4DT7B 2C4FH 2WYGA 1T8MA 3S7HB 1EZXC 3GYMA 4Y10E 3SJKA 1O31A 3I77A 1G3DA 3F9EA 4ACAA 1GI0A 1GCDA 1HYLA 2A4QA 3S69A 1GCTB 5LH8A 1VJAU 4YTAA 5SGAE 4K69A 2HLCA 2AS9A 2J2UA 3JZ1B 1O2TA 2FOMB 2ZA5A 1MD8A 2CV3A 1WQVH 3GDUA 2QF5A 2I6QA 3ZZAA 1ABJH 1P2KA 1IQHA 1ESTA 1MU6B 4ABEA 5B6LA 3E1XB 1EB2A 1C2EA 2XC4A 2A5IA 3SNDA 3RXTA 1O3MA 1EZSC 1LPKB 3VB6A 1O2YA 3FP8E 2ZPRA 1MAYA 1O38A 1SGEE 2Z9KA 1AO5A 2GT8A 5C20A 1GJ8B 1SR5C 5IK2D 1QIXB 4WVPE 3SGQE 5J4SA 5I46H 1DWEH 3ATMA 5EOKA 1MTWA 4Q7YA 1SB1H 3A84A 3A83A 4F55A 3CS7A 4U2WA 2Z9GA 1TOMH 3U1IB
chains in the Genus database with same CATH topology
1O0DH 3SN8A 2VIPA 1JWTA 5F8XA 1AI8H 1ZSLA 2TGDA 2ZGXH 1MCVA 2AMQA 1D9IA 1MBQA 3F6UH 3TH4H 1AB9B 1YM0A 1O2UA 1S6HA 3A7TA 1IHSH 1HBTH 2BX3A 4TWYA 4GHTA 4U32A 1EAIA 3TNTA 1E0FD 1WUNH 1EPTB 4NWKA 1ZRBA 2VVVA 1CGHA 1CE5A 1SQOA 1UTMA 2VWMA 4DIHH 3UIRA 2G55A 4B74A 3UNQA 4FUIA 4X8UH 3RXHA 3TPIZ 1AGJA 1W7XH 3ODDA 2UUJB 3VPKA 1VZQH 3ODFA 2GD4B 1CT4E 3ATLA 1RIWC 4I31A 3NK8A 1XX9A 1TWXB 3M3SA 4I8HA 1FDPA 2O9QA 3SHCH 4FUJA 3LGYA 1QJ6B 1B0EA 4Q2KA 3JZ2B 1DOJA 2BOKA 2ZNKH 4UFGH 1CSOE 3RXSA 1ZGVA 1H1BA 3QTVH 1IQNA 1ETSH 2VNTA 3U98H 1LTOA 4FUDA 1LHEH 2H6MA 4OS2A 2XC5A 3SV2H 1B5GH 2G5VA 1GCTC 1HCGA 1C1OA 5GWZA 4D7GA 4X8TH 1RRKA 4FXGH 3PTNA 4X6OA 3K6ZA 1Y5UT 4DCDA 2A31A 5HM9A 2H9TH 1UJ1A 2GZ9A 1LHFH 6GCHG 2ANWA 4DOQA 1FAXA 4X8VH 1WCZA 1V2OT 5DJ7A 2FS9A 4NA8A 1GG6B 3T25A 1KTSB 1GJ5H 2D2DA 5A2MH 2PKAA 2Z3CA 3GYLB 1O2XA 2P95A 1LQEA 1DY9A 3QZQA 2ZU3A 1GBTA 1LQDB 1F0RA 3H7OA 1D3DB 1YF4A 2C93B 3E91A 5FBEA 2AGGX 2TIOA 3RXDA 1ZPZA 2AERH 3MU1A 1O5GH 3O8DA 4AZ2B 1A1RA 2Y7ZA 1GL0E 1JIRA 5HMAA 1CHGA 1ELTA 1DY8A 3OX7U 1DE7H 2RCEA 2BQ6B 1AB9C 5DK1A 2NU4E 1EZUC 3M7UA 3V7TA 2XBWA 1MZDA 1ZSKA 1GMHG 1O2LA 1C5WB 4XBDA 2BD5A 1SLWB 3K9XB 1WOFA 4FUCA 2KAIA 1TALA 1C1RA 1N1LA 3SORA 1PPBH 3S7KB 4FUGA 3LGTA 3BTEE 2I6SA 1O3FA 3UQOA 1PPEE 2FOAA 1RFNA 2XTTB 3C27B 3TJUA 2XBYA 4OGYA 1FN8A 1MTUA 1TRYA 1K1PA 4GLYA 1ELAA 1KSNA 4ISHH 2HRVA 4DW2U 4MNVA 2FZZA 3RP2A 3MOCA 2PTNA 3PWBA 4HZHA 2XCFA 5GXPA 3A80A 3IG6B 4H4FA 2OC7A 5A09A 2XXLA 4E05H 3GCTG 3LDXH 1H8IH 1FQ3A 2XWBI 4KELA 5FPSA 1AD8H 5DKMA 1T8LA 1GBIA 1EASA 2D1JA 2WPJS 1Z6EA 5E0GA 3TK9A 4AG1A 4B76A 5TJXA 1YPGH 1EB1H 4NG9H 1CT0E 3VB5A 5EQSA 1C1PA 1GBKA 2P3TB 3PMHB 5E0JA 1TX6A 1G36A 1C5LH 1IQGA 3PB1E 4B2BA 4YLQH 1NT1A 1O2MA 1HJAB 2R3UA 1DM4B 4K1SA 1L4DA 1KXCA 5A0AE 1O37A 1SC8U 2UUFB 3UTUH 2VU8E 5DP3A 2BY9X 1OX1A 2CXVA 3UPEA 1MZAA 1GG6C 4D9RA 3EGKH 1ANEA 1C5PA 5LPEA 2YOLA 2ULLA 1HRTH 3ZVCA 3RXEA 2HPQH 3SUFA 3W94A 4YLUA 4WWYA 1J8AA 5LPRA 3BN9A 2O8UA 2QN5T 2A4GA 4MLFB 2CF9H 4TY7A 2W7SA 1G37A 1CGJE 3SQEE 1W0YH 3NPSA 4X6PA 1BJUA 2A5KA 2UWLA 4D8NA 6GCHF 1YPEH 3E6PH 1ZMJA 3PV4A 1N8OB 3M61U 1DLKB 1SGDE 4ISOA 4OS7A 3C1KA 3VB3A 1BBRH 5L30H 4IMQA 2Y7XA 1MTSA 3VXEH 1YLDA 1FONA 2EA3A 1SGNE 2B5TB 2J9NA 1GI2A 4JCNA 1TQ0B 3V13A 1QL7A 1EJMA 3P6ZB 1BCUH 1DXPA 4FUBA 3L33A 1SGTA 2ZDMA 1J9CH 2A45B 4MNWA 4BTTB 1TGTA 1GMHF 2ZF0H 2XNIA 2VWLA 1GHBG 3MU4A 1ZJDA 2C8ZB 3PTBA 3SQHE 1P57B 2ZQ2A 5T6FA 2G5NA 1O2KA 3SGAE 4Y7BA 2ZEBA 5AVDA 4IN1A 2B0FA 1Z71A 2ZPQA 3SI3H 1H9LB 1O2SA 2D26C 4JZEH 1WV7H 2AIQA 3AAVA 1TPPA 5TCCA 3ZZ7A 3H5CB 5AFYH 2NU0E 1KXFA 2H9HA 1UTLM 1F7ZA 1T31A 3MH4A 4GAWA 1C5XB 1BRBE 1MKWH 1GJ6A 2ZFSA 1XUIA 1HJAC 2JH0D 3FVFB 1NZQH 2ZGCA 4I8GA 1OWIA 3GCTF 1ARBA 1LO6A 2RDLA 2VB0A 2HNTC 1KLIH 1HAOH 4DVAU 8KME2 3D49H 1V3XA 3VFEA 5FPYA 3RXPA 2LPRA 4MVNA 4SGAE 2IOTA 1NU7B 1SSXA 2OC8A 4CR5A 4K8YA 2FTLE 2WPMS 4I33A 5BRRE 3VB7A 4AOQA 3FFGA 3FP7E 2M5TA 1Z8IB 1DSUA 4BAKB 4X1SU 1O3JA 3TGIE 5EGMA 5EODA 1WTGH 4BXWA 4IC6A 2XRCA 3A89A 4MNYA 3SUEA 4ZH8A 2ZIQH 5JB8S 2STBE 1IQMA 4CRFA 1TYNA 5DP8A 2EI7A 4XFQA 1N8OC 1A5IA 1K9OE 3Q76A 3QX5H 1HB0B 3WY8A 4FUHA 1ZTJA 3A8BA 4MQAA 4E06H 3ATWA 4X6MA 2Q6FA 3HK6B 1DT2A 1SGYE 4AFZA 1J17T 1JOUB 2EEKA 1GL1A 3M3VA 1C5NH 2V0BA 4HTCH 2ZP0H 4HFPB 1SHYA 1ZPCA 2G4TA 2AGEX 1GI7B 1OPHB 5FCRA 3U1JB 1O2QA 2QXIA 1O3HA 4AFQA 3BIUH 1UTNA 5IDKA 1G3CA 1MUEB 4YOIA 3BTTE 3L3TA 1JIMA 1NFWA 1ETTH 5A0CA 2IN2A 4D7FA 4MPWA 3V12A 1C1TA 1EOJA 3V0XA 4THNH 1IQIA 1TX7A 3D62A 3KCGH 3RDZA 4X2VA 1SGCA 1QURH 2BDGA 1VITG 1GHBF 1Z6JH 4H6SB 2A7CA 2DE8A 4CRCA 1FZZA 1C2HA 1O5BB 1TBZH 1TNGA 1AY6H 1UVUH 1XM1A 4NFEA 2SGQE 4NSYA 2ALVA 4MPXA 3T5FH 1ZZZA 2W3KA 5EW1H 4TY6A 2V35A 4JYVH 2PFEA 1NM6A 3BTFE 4K2YA 4K3JA 2BZAA 4Y7AA 2SGAA 2J4IA 5PTPA 1BTXA 1W14U 2CHAC 1RTFB 2Z9IA 3GY4A 1IAUA 2GV7A 1ELCA 1EP6A 3SU3A 1K1OA 1O2PA 2O8MA 4WMEA 3UWJH 2CJIA 2VJ1A 3KQEA 5E8EH 5GPIB 5G4BA 1S6FA 1S84A 3NUMA 5A8YA 1DPOA 1A7SA 4Y0ZE 1C2MA 1D3PB 3DT0H 3A7XA 4SGBE 1AE5A 1J14A 1XUFA 3MU8A 2GZ8A 4O9VA 5DP5A 3A7VA 1BTUA 3P92A 3PLPA 5ESTE 3STIA 2V3OH 3QGNB 3KIDU 1O2VA 2PUXB 3SO3A 4ZHLU 1RTKA 3RLWH 3QDZB 1TQ7B 4Y8ZA 5CE1A 2ZG0H 3VGCB 1TNLA 3SZNA 1O2RA 1TNIA 2THFB 1AKSB 3ZZBA 1H4WA 2F9NA 3RXUA 1GWAA 1BZXE 5JB9S 1UVOA 3UY9A 3U69H 2VVUA 5EXLA 4RKJB 2PTCE 1QGFA 2Y5GA 1HLTH 2PSXA 5FX6A 1SOTA 3GCOA 4O3TA 2TGAA 3E16B 1L1NA 2FX4A 3BEFB 4Y0YE 3M37A 2TPIZ 3OTJE 4OS6A 4XSKU 3ZVEA 5J4QA 2FS8A 1FIZA 2B8OH 2GX4A 3ITIA 4JYUH 1J16A 2SGFE 4FUFA 1NTPA 1GBFA 3SU1A 1Y3VA 4NIXA 2ZZUH 4NCYA 4A1VA 2AYWA 3ZVFA 2FWWA 1GVKB 1A46H 4K1TA 2BD9A 4NA7A 1ETRH 5FAHA 4JK5A 1C2GA 1O2OA 1P2NA 2G52A 4GSOA 1NY22 1KDQB 3A7YA 1QB1A 1W2KH 1NFUA 4KTUA 3DUXH 2FI5E 2A4OA 1P2IA 1GMCG 5JYIA 1DDJA 3M7QA 2R2WU 3RXQA 3SGBE 3GDVA 2SGDE 2W7UA 2QV1A 4GPGA 2BDCA 1C1UH 4MPUA 5F8TA 1QB6A 3FAOA 1W0ZU 1YPMH 1VITF 1QRXA 2ZFPH 3EAJA 2ZFFH 3KGPA 2G4UA 2QXJA 2SNVA 1G9IE 2XYAA 2BDYA 1PQ7A 3HPTB 6LPRA 5F03A 1BMAA 2AMPA 3KN2A 1DUAA 4JZDH 4Z0KA 2A32A 5HYOA 4NA9H 1AHTH 1HAIH 2OQUA 4Y6DA 3LH1A 3M5OA 3D65E 1C2JA 1ZPBA 4KGAA 2OD3B 1TABE 3IITA 3MH6A 4KKDA 3SI4H 3ZZDA 2ZFQH 3VGCC 1UVSH 3ELAH 1Y8TA 1Y59T 3QZRA 4YO9A 4YM9A 2J92A 1A0LA 1BRUP 1P01A 1QQUA 1TMUH 4M7GA 4MNXA 1SGFG 2BQ7B 1CVWH 3EQ0H 3R0FA 3A86A 1K21H 2FO9A 1AWHB 1BHXF 1EUFA 2P16A 1O3LA 5JBTA 1T4VH 2ZDVH 2ZU4A 2ZTZA 5GJ4B 1O3AA 5T6DA 2C8XB 3VEQB 3MH7A 4BNRA 1FIWA 4JZIA 1T7CA 5L2YH 1O3CA 1P0SH 1VITH 1K1JA 5HM2A 3LC5A 5AHGH 1UCYK 3MU5A 4B73A 2G8TA 3V3MA 1MKXK 3R3GB 5A0BA 1FY8E 2OBOA 5ABWA 3TIUA 5C1YA 2F9UA 4OS5A 1W12U 3LU9B 2BY6X 1YPHE 1CO7E 4U30A 1RGQA 3KQCA 3MNXA 2DUCA 3DA9B 1YLCA 3O8CA 4BXSA 1ZSJA 2HGTH 1ZOMA 5FBIA 2F3CE 4K8BA 4CRAA 1HUTH 1KYNA 3GY5A 1FV9A 1EQ9A 3SU2A 4JMYA 2H5DA 2ESTE 1GI9B 1DITH 2F83A 2Z9LA 1O3NA 1O5AB 1WAYB 5DP7A 3SBKA 4JZFH 1NC6A 4H42U 4ABGA 1G3BA 1ELVA 2QGRA 1OWKA 1VGCB 3A7ZA 1V2KT 4E7NA 2QIQA 4MTBA 1PQ5A 1YPJH 2ZDNA 1C5OH 1KXEA 1EX3A 1O3PB 3S0NA 4BANB 3BTGE 1TLDA 3LOXA 3A87A 1O2GH 1Z1IA 3E0PB 2UWPA 1GMCF 3ZZCA 4UFFH 5DO4H 1SI5H 2R0LA 3K2UA 5CHAB 1YGCH 2W3IA 1LHGH 2GTBA 2ZDKA 2ZFTA 3HK3B 1O36A 4X1PU 4AFUA 3UQVA 4LZ4B 1EAUA 2GCHG 1T4UH 5B6OA 4UFDH 1DWDH 1SGFA 1U6QA 2GMTC 2VIOA 4D9QA 2BB4A 1ZHMA 2BDHA 3TNSA 2BVSH 4ZXYH 3T28A 2XBVA 1K22H 1AUTC 2VIWA 2CF8H 1GMDG 3AAUA 4IBLH 4OS4A 2FYRA 2Q6GA 3LH3A 3I29A 2ZTYA 1HAHH 1N6XA 4LZ1H 3U8OH 1XXDA 1GDQA 3AASA 1C1SA 1OWJA 1W8BH 1JMOH 3P8NA 3A8AA 1NN6A 4CBNA 4JK6A 1UO6A 5T6GA 1HAXB 3BG4B 4RSPA 3CENA 1J15A 1B7XB 2H5CA 1F5RA 1S82A 2WYJA 2HNTE 5EXMA 4FVDA 1ARCA 3ZV8A 1BRCE 1MCTA 3F9HA 1UVTH 4FVBA 4IGDA 1UTOA 2ZHEH 2FEQH 1QBOA 4A92A 1FY3A 3BG8A 5EPYA 4ZKRU 3PYHA 5FX5A 4H6TA 1V2MT 1GDUA 1KXAA 1F5LA 1EPTA 3ENSB 3EA8A 1AU8A 3LT3A 4X6NA 1Z8JB 1GVZA 2Y5HA 4HI3A 1C9PA 1GHWH 2R0KA 4UFEH 2SGEE 4Q80A 1HAGE 1GPZA 2QC2A 4GVUA 1O2JA 7LPRA 1NROH 1VGCC 2HOBA 3OU0A 1JRSA 1HJ9A 2OQ5A 4F4OC 1ZGIA 3B9FH 4ABJA 4DJZB 2ZHFH 1NRPH 1XKBC 2ZHQH 3URDA 2O8WA 3RMLH 2XBXA 3M7TA 1A4WH 1IQFA 4NIWA 2Z3EA 1HPGA 1ELGA 1DWCH 1KTTB 5CHAC 3LJJA 3QK1A 4PROA 2B9LA 1O39A 3MNBA 4INKA 1P10A 2WPLS 3STJA 3LJOA 2TRMA 1C1NA 3RU4T 1ZR0A 2A4RA 3A81A 3UR6A 2FM2A 1BTWA 1GBAA 4BOHA 2WUCA 2AFQB 3PM3A 4A5TS 1FJSA 3T27A 1S83A 1D6WA 4XOJA 1YC0A 1O3EA 1BITA 2EI8A 1K1NA 2BXUH 1TNKA 1UMAH 3DFLA 3UWIA 1AFQC 3RXAA 1DICA 1UTPA 4CBOA 1FPHH 2H1UA 3SV6A 3QN7A 5EXNA 3RXOA 7ESTE 2ZHWH 5DGJA 1BMNH 1HGTH 1K1MA 2F9BH 2G00A 1HAPH 2GDEH 1VCQA 2JKHA 4ZROA 3MFJA 1P9SA 1P03A 2GCHF 3PLBA 3EDXB 1UHBB 3RXMA 3TGJE 1CA0B 2FESH 1E34B 2BQWB 1GBDA 1IQKA 3PMAB 2ZGBH 3BG4C 1Z1JA 1YCPH 1GJ9B 1G2MA 2NU2E 4Y79A 4ZKNU 1D6RA 3MH5A 3NKKA 5ESBA 3SNBA 1FI8A 1GMDF 3LGUA 4LXBH 1O2ZA 3TK5A 3QUMP 1GHZA 2FI4E 2V3HH 1MAXA 3M36A 5AFZH 1EAWA 2C8YB 2PGQB 2QY0B 3PMJA 1LHDH 2FOCA 3SU4A 3FANA 3D23A 1QBNA 4X8SH 4I8KA 3ATIA 3CS0A 4ABDA 4Z6AH 5L2ZH 1FY4A 1O3OA 4NGAH 1W3CA 3KQBA 5HGGA 4Y8YA 4ABFA 2J95A 3ESTA 3E3TA 1HJ8A 3NWUA 1OWEA 1LVOA 1S85A 2BY7X 2ZTXA 4B2CA 3Q3KA 1TBRH 3SJIA 4ZUHA 1BJVA 1W7GH