3V0XA

Bovine trypsin variant x(tripleglu217phe227) in complex with small molecule inhibitor
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCVGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title Bovine trypsin variants X(tripleGlu217Phe227) in complexes with small molecule inhibitor
rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v0xA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v0xA02
2XWAA 2HNTF 4X8VH 1MKXK 1K9OE 2Q6DA 1IQKA 4NWLA 1GJBB 4B1TA 3H7OA 3QK1A 4O97A 1O32A 3V12A 4OS6A 1BCUH 1EX3A 5AHGH 4OGYA 3LONA 4WJG2 1O2TA 4YOIA 3JZ1B 1O2RA 2H9HA 4MPVA 3UPEA 8ESTE 3R3GB 3ZVCA 5JBAS 1CT4E 2RA3A 4D7FA 1TNJA 1Y5UT 1NRSH 3DT0H 1MBMA 3SORA 1AGJA 1ZMJA 2ZPQA 5GCHG 1ZHPA 3TJOA 1MZAA 2VB0A 2FI4E 3RXOA 2Z9IA 1ESBA 4RSPA 1TMUH 3SI3H 3MWIU 1SGRE 1H8DH 1N6YA 3P8GA 1GHBF 1AD8H 1PQ7A 1GHWH 1JIMA 7ESTE 4MNWA 4NIXA 2VNTA 1KY9A 4WXIA 5GWZA 3K6YA 1WSSH 1WQVH 3A7VA 4TY7A 1NY22 1C5SA 5EW2H 2OUAA 4H6SB 8KME2 3A84A 4Y7BA 1V2QT 1TONA 2AIPA 4IN2A 1MU8B 1RRKA 2R3UA 1E35B 2ZKSA 1C4U2 1ELAA 2VVUA 2C4FH 1QBVH 1PPGE 2FIRH 5FCRA 1OP0A 4JYTA 2BTCE 1C5XB 2LPRA 5HMAA 1LKAA 3ZV9A 1SI5H 5I46H 3EE0B 1BBRK 1FDPA 2XCNA 2R2WU 1AUTC 3SI4H 1PYTD 1FXYA 1IQEA 3I29A 5A8ZA 1DY8A 2Z6BD 2HVXA 1AVXA 4ZUHA 1Y3WA 3RXTA 5ABWA 3RXMA 1MTUA 1W10U 1XUGA 3U8OH 2G5NA 3D49H 1CA0B 3D62A 4ZXXH 2XYAA 2H5CA 1FY3A 3VGCC 4X1QU 2G4TA 3UNRA 1KXEA 2ZDKA 1RXPA 1UVTH 1Y5BT 4X2WA 1UO6A 3ELAH 3SHCH 1S6FA 4FUBA 2NWNA 4XBDA 1JIRA 4BANB 1ANEA 1C5NH 3P17H 5C5OA 3KQBA 2G55A 4MG3A 1LCYA 1W7GH 4BAQB 3PYHA 1CHOF 1V2KT 5GIBA 3ZYDA 1JWTA 2CMYA 1K1NA 1A61H 1K2I1 3A89A 3PTBA 1HGTH 4Y6DA 1GI5A 2EEKA 3QN7A 1FY8E 1EAXA 1P06A 3UNQA 1AKSA 3RU4D 1CU1A 1RGQA 2GX4A 4MVNA 2ZTYA 1O5AB 4O3UA 1ZRKA 2FDAA 1EP6A 1V2NT 2PKAB 1CA8B 3P8FA 4ISLA 1AQ7A 1DOJA 2NU2E 2HNTE 3ZZ3A 2WYJA 2BVSH 2OP9A 3KF2A 2FYRA 1OYTH 5T6DA 2CXVA 2BLVA 3AW0A 1O3OA 1HCGA 4IGDA 3MNCA 1MBQA 4O03A 5FBIA 1KXFA 2Q6FA 1THSH 1BTXA 3ITIA 3GCTG 2ILNA 1DE7H 1LQEA 3MMGA 4WMFA 5GCHF 3BG8A 4DJZB 4Y0YE 1KDQA 2GT7A 2GZ9A 2HWLB 1ZRBA 1NTPA 4KELA 1YPLH 1A3BH 1DPOA 1T4UH 2GMTB 2A5IA 1C5VA 1O5FH 1G2LA 1TYNA 1GJDB 1YCPM 1ZLRA 2FOAA 1BIOA 3ZZ5A 4CRGA 1BA8B 1TNKA 3MI4A 1T8MA 4H42U 1GJAB 1A3EH 1K22H 2ALVA 1CGHA 1V6DA 4X8UH 3TGKE 1EASA 1SGTA 3MU1A 2VH0A 1VGCB 3LGVA 4B74A 2Y81A 5A8YA 1EJAA 2ZQ1A 3LC5A 1FY5A 4BTTB 2FLBH 1UTLM 3PLBA 3A7ZA 1MU6B 2FPZA 3RMNH 1Y59T 3GOVB 1BZXE 1RS0A 4KTSA 4KP0A 1V2UT 1MKWK 4WF8A 1NS3A 1A0HB 1KTTB 1GHAG 1BHXB 1GHVH 2PR3A 3S0NA 2BVRH 1O2QA 1O2WA 3LH1A 4GLYA 2O8WA 4GUXA 1QJ1B 4FVBA 4A5TS 5A0BA 4NFEA 4IC6A 4NG9H 1W8BH 3ENSB 1GVLA 2ZPSA 2ZIQH 5AFYH 3LJJA 4CRCA 3B23B 1DUAA 3BSQA 4AFQA 3RXAA 1SOZA 3VXEH 4D76A 5F8TA 2P3UB 3E0PB 2ZG0H 4RKOB 2XWBI 1NRPH 3SNEA 4THNH 4U2WA 1MTNC 3QUMP 1MMJN 1ZMLA 4LXBH 1WU1A 4CHAC 2GKVE 4X0WU 4BOHA 1P2NA 2VWMA 3V13A 1C2GA 4NIYA 2AH4X 1SR5C 2AGGX 2BY8X 1YCPK 4IBLH 1LHGH 1H9HE 1GJ8B 1C5RA 2PLXA 3RMOH 1GBHA 1LHEH 4IS5A 2D1JA 4ABJA 1GG6B 1G3EA 1DY9A 3BTKE 1LVMA 1DITH 3MU0A 5ESTE 1ZSLA 2JH0D 2OBOA 4HI3A 3OYPA 2RA0A 1GDQA 4RKJB 5GDSH 1FLEE 1HV7A 1VCPA 2GCHG 4K1TA 1HRTH 3TJUA 3OX7U 1FY1A 2ZDAH 1BITA 4LZ4B 1H9IE 5E2PA 3TVJB 3UNSA 3GCTF 4K1SA 1JRTA 2ZTZA 3MYWA 3TNTA 1GI1A 1BTWA 2RDLA 1UK4A 3JZ2B 4B2AA 5SGAE 3ZZ9A 3O8CA 2FEQH 2AGIX 4CH8B 3ATMA 2V0BA 3KQDA 1WYKA 2STAE 1K1IA 4BAOB 3PLPA 1PQ8A 1C1MA 3SUDA 2ULLA 3A85A 2F91A 1CE5A 3OU0A 2WPHS 1ELDE 3QWCH 1P3CA 2QC2A 4AFZA 1AFEH 1XUFA 1OWJA 4YESB 1ABIH 3TK5A 2CN0H 1TX6A 1SHYA 3LDXH 1FJSA 3PMJA 4FXGH 2HPPH 5ETXA 3E6PH 3R0FA 1LHDH 3QTOH 1EP5A 1A2CH 4ISNA 1SGPE 2PUQH 2P95A 1OKXA 2W7UA 2Z7FE 2Y7ZA 2QY0B 1THRH 1XM1A 5ESBA 1AVGH 1DX5M 3K9XB 1UVUH 2AYWA 4DW2U 4I8KA 2R0LA 1CGJE 1UVOA 5E8EH 4YT7H 1S85A 1GBJA 1SQAA 5EQSA 2GT8A 1TWXB 1ZTLA 1LPZB 3A7WA 5DG6A 2XBWA 3U1JB 1GBTA 4FUEA 3T26A 2VJ1A 3QO6A 3MO3A 1MCVA 2H5DA 4VGCB 3QGJA 4MPUA 1YPEH 2FOGA 3HGPA 1HAPH 1AN1E 3E90B 1MTVA 1P11E 2AEIH 1HAYB 2BD8A 2QYIA 1ZSJA 3BIVH 2EC9H 4U30A 1Y8TA 3S9CA 1O2YA 4BAHB 4X2XA 1C4Y2 1RIWC 3A8DA 6CHAB 4Z6AH 4TYDA 3E0NB 2AS9A 3RXVA 5LPRA 1V2PT 2BX4A 3PO1B 2GD4B 1S81A 2C8ZB 5IDKA 3UWIA 3T28A 4ZAEA 1P2IA 2QXJA 7GCHG 1KIGH 1E34B 3F9EA 4FUCA 1FAXA 2OINA 1BMLA 2BMGB 1J14A 1JRSA 2ZCKP 4Y11E 1D3TB 2F9NA 3NZIA 3RXJA 4ABDA 2WUBA 2BHGA 3T25A 1QJ7B 4DVAU 2PUXB 4MDSA 3M5NA 2UWLA 1LPKB 3MO6A 1GL1A 3M7QA 1CT2E 5EOKA 1KXCA 5EGMA 3E1XB 3LOXA 1O2HA 3VPKA 2JH6D 1C5QA 3SQEE 2BQ6B 4AGKA 4SGAE 3HK6B 3TH4H 2PSYA 5L2YH 3LH3A 2R3YA 1KXDA 3SGBE 2FODA 3M7TA 3SUGA 3URDA 1G3DA 4I8LA 1ARBA 1W13U 2BLQA 2A7CA 2H1UA 1ETTH 3MHWU 1QRXA 2XW9A 4FVDA 2H9TH 1JMOH 3EA7A 3RLYH 1XUHA 3AAUA 4H6TA 4WXVA 5HM9A 1THPB 3V0XA 3KQEA 1ETSH 2JETB 1T8LA 1O3LA 5DP5A 4J2YB 5BRRE 1QBOA 1SGNE 1F5LA 2Z9KA 2R0KA 1P2JA 1EZQA 5FAHA 5FCKA 4WWYA 1ELCA 2QXGA 4CBNA 2XTTB 4BTIB 2QXHA 4JYUH 1UTNA 2M5TA 2HLCA 3BN9A 1G37A 1Q2WA 3A83A 1A4WH 1SQTA 2A2XH 4LK4A 4X8TH 2P59A 2G8TA 2GV7A 4ISOA 1AY6H 1WCZA 2H9EH 3SGQE 5FX5A 3ZVAA 4K2YA 2VIVA 1O3AA 6GCHG 1TBZH 6ESTA 1TGCA 4FUFA 3PWCA 1Z6JH 3MFJA 1FQ3A 2D2DA 4O9VA 1B5GH 4MPWA 1H4WA 1QBNA 3QZQA 1EJNA 1XUKA 1ACBE 3RXPA 3ATIA 2ASUB 4K60A 3BG4B 1RTLA 1YPHE 1LHCH 3UWJH 1QCPA 3BF6H 4NZQA 1MUEB 3M3SA 1NZQH 1TGBA 3ZZ4A 3OY6U 1O2PA 5E0HA 4ABHA 1RTKA 3GDUA 1D9IA 3SU6A 4JK5A 3RXUA 1E0FD 1O38A 4X2VA 2WUCA 2ANMH 3A82A 2QIQA 3S69A 3ZZ8A 2SGPE 1TPAE 1QA0A 2BYAX 2UUYA 3EAJA 1HAOH 2O8TA 4ZHMU 1N6XA 1FV9A 1D6RA 4AN7A 1KTSB 2CGAA 1FIZA 1YC0A 2V3OH 3UR9A 1TRNA 3HPTB 3O8RA 2ZDNA 4I8HA 2FLRH 3S9AA 2XBYA 2BDIA 3GY3A 1SC8U 1BTHH 1O2NA 1ZR0A 1GJ5H 2GCTC 3MO9A 2BX3A 2ZF0H 3P95A 4FUDA 3FANA 4AYVB 3TK9A 1QRWA 4UEHH 1C1VH 1FZZA 1QR3E 2BOHB 2IPHA 4IN1A 4YM9A 1O5BB 3PM3A 1GI3A 3GCNA 1BJVA 2A4QA 1GBCA 3KL6A 1C2LA 4U32A 1EAUA 1CHGA 1O3PB 2FZZA 2VGCB 3ZZDA 2F9OA 4R8TB 2ZO3H 1SHHB 3SV8A 4FU9A 3EQ0H 2HALA 1YLDA 1SGEE 5GXPA 1C2MA 3PMHB 4XBBA 1CBWC 1GBEA 4NZLA 2EI7A 2PSXA 2RCEA 1O5CB 2GTBA 1VITG 1S83A 1D4PB 2G5VA 1V2TT 3FFGA 2PFEA 1UHBA 1F0SA 2W3IA 2BDAA 3T29A 5T6FA 3FAOA 1UK2A 2SNWA 4A7IB 1W14U 1BMAA 2ZFSA 1KDQB 4YO9A 4YZUA 3TH3H 4GAWA 3O8BA 4D8NA 2Z3EA 2ZFRH 1GCDA 4AFUA 1O2VA 3BEUA 1C1SA 9LPRA 1RJXB 4ZKNU 1CVWH 5JYIA 4JZFH 1FAKH 1NRQH 1ZPZA 5HGGA 4NFFA 4X1SU 4K69A 1VCQA 6GCHF 3FZZA 4MNXA 1GDNA 3M3TA 1T8OA 2D8WA 1AU8A 4FUGA 2NU0E 3ZZCA 4Y8ZA 1A0LA 4JMYA 4E7NA 4XBCA 1YGCH 1O5GH 1VJAU 3BIUH 1SLXB 1MCTA 3GY5A 1TIOA 3BTTE 5T6GA 5F8XA 1UCYE 3A86A 2ZC9H 2FOMB 1ZGVA 2SGDE 3Q77A 2R2MB 4DIIH 2ZDVH 1EZUC 1A5IA 5LPEA 4JYVH 1HJAB 1F5RA 2ZU4A 5DP8A 1HLTH 1GBAA 1UCYH 1LPGB 5LPFA 5FHTA 3M37A 3RXKA 1HXFH 2ZHDA 2IN2A 1XXFA 1HDTH 2OD3B 1O3HA 2OXSA 4WMEA 1V2VT 4Y10E 1O37A 1QY6A 1O2OA 1A5HA 3A7XA 3Q76A 4ZKRU 4ZHLU 4UONA 1QB9A 1ZGIA 2SNVA 1EOLA 1GHZA 4UD9H 3MTYA 1AO5A 1EUFA 3PWBA 1TE0A 1O5EH 2H2ZA 5FX6A 1LO6A 5L30H 1DWEH 1C9PA 3UY9A 1HAGE 2ZPRA 1D3DB 5FXLA 3A80A 3HGNA 2YOLA 4YOGA 5C1UA 2ZU1A 2BB4A 1EOJA 2TBSA 1UTJA 1KLIH 4D9RA 2GDDA 2GGVB 1CA0C 3V7TA 1TMBH 3PMBB 5DP7A 1AB9B 3NUMA 2G00A 2GDEH 5EXNA 1BMNH 3RXDA 1VITF 1ZZZA 1MTSA 3RDZA 2A4RA 1EPTB 4UFGH 5DP9A 1P2MA 2HOBA 1HAIH 1J8AA 1SLVB 2V6NA 2ZQ2A 4D7GA 3GY6A 5A09A 4ZKOU 1P9UA 1UTQA 2XXLA 3KHVA 4Y76A 3GDSA 3V3MA 1E37B 2OCVB 1W11U 2ZI2H 3RXHA 1SGDE 3SNAA 1LVBA 3ZVDA 2V3HH 3M61U 2ANWA 1L1NA 2FMJA 1O36A 2FTMA 4Q7XA 1O3NA 3RXSA 4BXWA 4A6LA 1A1RA 3SOSA 1DT2A 2Z94A 1AIXH 2ZFTA 4ABEA 1GMCG 6LPRA 2ZZUH 1P05A 3GYLB 2ZGXH 3U8TH 3UIRA 3U98H 1N1LA 1T8NA 1A0JA 1TX8A 3SJ9A 1C2EA 1DWCH 3LKWA 3RM2H 1O3KA 1GI6A 1QL8A 1AI8H 5DK1A 2H6MA 4JCNA 1C5PA 3SHAH 2C3SA 3H5CB 5G4BA 4QT8C 4UFDH 3BTEE 1BTUA 2TPIZ 1YYY1 3BTDE 4WVPE 2BOKA 4INHA 4CR5A 1O39A 5A8XA 5J4QA 5L2ZH 4ABIA 4ZH8A 1TBQH 1MKXH 4X6OA 5GJ4B 1QTFA 3F68H 1C2DA 1NO9H 2EI8A 2A7JA 1ZJDA 2K1QA 1ZPCA 1V2WT 1CGIE 2UUJB 4ZROA 3UUZA 1XUIA 2PKAA 4Q7YA 2GMTC 3AW1A 5DPAA 1P0SH 4KGAA 5T3HA 4R0IA 2A4GA 3ATLA 3SJKA 1BRCE 3ODDA 2VWNA 1O3EA 2XBVA 4WMDA 1P3EA 2JKHA 2HPQH 3AASA 2AFQB 3FZDA 1FN6A 1G32B 1ORFA 1SQOA 2QXIA 4X1RU 2F9PA 4K1EA 4CR9A 1EB1H 2ZHWH 2BD3A 1P9SA 5HYOA 1K21H 1GBKA 1XKBC 1MH0A 1YPKH 3GCHB 2GZ8A 2Y7XA 1VGCC 1Z7KA 3I77A 4Y8YA 3PTNA 2VIOA 4XOJA 1MD7A 1G36A 1AZ8A 1Y3UA 5JB8S 2A31A 5K7RA 4MNYA 4O3TA 1LKBA 3LGWA 2C8YB 1BRAA 3GDVA 2UUFB 5IYTA 1K1JA 1NN6A 3AAVA 1P2QA 1QQUA 3CENA 1M9UA 1EXFA 1BBRE 4B71A 5FBEA 4H4FA 1IOEA 2OLGA 1KLTA 3T62A 3P8NA 1TRMA 2O8MA 4CBOA 1B0FA 3EGKH 5CHAB 3NPSA 3BV9B 4AG2A 4XFQA 2FS8A 3RXLA 1J17T 3DHKH 2ZHEH 2CHAB 4TY6A 1TGSZ 2ZGJA 2VIQA 1YKTA 1XKAC 1BBRH 4LOYH 1QB1A 1O3IA 3F9GA 4DIHH 2BDGA 4MLFB 4NA9H 3RLWH 2KAIB 1P57B 2JH5D 4A1VA 1C2HA 2W7SA 1O3DA 3W95A 3FVFB 3IITA 2ZFFH 3Q3KA 3GY8A 1GWAA 1HAVA 1ID5H 3SU1A 2A45B 3SV6A 3LC3A 4X8SH 5E0GA 2WPLS 3U1IB 1GBFA 2NU1E 3M7UA 1GCTB 3T2NA 1ZHRA 2O9QA 1O33A 1F7ZA 1GI9B 4GSOA 4INKA 2WV4A 4AB9A 1VITH 3SV7A 4MTBA 3A88A 1C1WH 3B8JA 1GHAF 1OP2A 1GMCF 1TNGA 4JZIA 1GGDB 2Y6TA 3G01A 1EQ9A 2ZFPH 1UVSH 1UTKA 2D26C 1F0UA 2ZU5A 4CREA 1P12E 2TGPZ 2B7DH 4AB8A 3GY4A 1O2JA 4ABAA 2BD9A 4NA7A 5DO4H 1SFQB 1N8OB 1GG6C 1Y3VA 4KKDA 1GI2A 1TGTA 5LGOA 3RC6A 2ZCHP 3SNBA 3L6PA 1VJ9U 1SFIA 1YBWA 1GI4A 4DURA 1L1GA 2RG3A 4RN6A 1O3BA 4OS4A 1C1RA 2HRVA 4FUIA 2QCYA 1NFYA 2WINI 2ZGBH 3VB5A 1TQ7B 1GPZA 4PROA 4NGAH 5HXFA 1YPGH 1W2KH 3SZNA 7KMEH 1UTOA 5JDUB 1YM0A 3BTFE 5HM2A 3SUFA 4FUJA 4ISHH 4B2CA 3A7YA 1ZSKA 3MH7A 4CRBA 2CV3A 4X6PA 3RP2A 1CSOE 1HAHH 2UUKB 1F0TA 3OY5U 1BB0B 1HIAB 2PKSB 4GCHG 2HNTC 1YP9A 2I6QA 1Q3XA 2P3FH 3SBKA 2ZHFH 3QZRA 2ZGCA 2FO9A 2PTNA 2OTVA 1BTYA 4I8JA 1G9IE 4NA8A 1AFQB 3NXPA 1A5GH 1W12U 1W0YH 4Z0KA 3DUXH 3VB4A 1ESTA 2GCHF 1WBGB 2FYQA 1OXGA 3SO3A 1O3MA 1K1PA 1IQJA 2XNIA 3RXRA 5C3NA 2FP7B 2PTCE 3SW2B 1UCYK 1HBTH 1LVYA 1W0ZU 1G30B 2PW8H 1HJ9A 4E7RG 3HKJB 1F2SE 3DFJA 3HATH 1FY4A 4NSVA 2QAAA 1NFUA 1O3JA 2BZ6H 2CJIA 2OQUA 2Z9GA 5EPYA 1MTWA 1DFPA 2OC1A 2VIPA 2LNCA 3ODFA 2FXRA 3H7TA 1O30A 3UR6A 2Y80A 1C2KA 1V2ST 2ZCLP 1C5WB 1NRRH 2W3KA 4K8BA 2F9UA 2AGEX 1DXPA 4VGCC 5JBCS 1GHBG 4DCDA 1BHXF 3LGYA 3E16B 4JZ1A 2BDYA 2Z9JA 1MKWH 2B0FA 2TGDA 2BVXH 1SLUB 3SV2H 5E0JA 5EODA 2ZA5A 3P6ZB 1QHRB 2XBXA 3M5OA 2FI5E 3Q00A 1DXWA 1V2LT 3MNXA 4YLQH 3IWMA 2P16A 4K5ZA 1AHTH 2XCFA 3S7HB 2EI6A 2VWLA 2BXUH 3RU4E 2GP9B 2QV1A 3TGJE 3VEQB 4OGXA 6CHAC 1PJPA 4BAMB 1TAWA 4INLA 4X6MA 3EDXB 3MH4A 3PO1C 3UFAA 1IQFA 1DWBH 3M35A 1GL0E 3TJVA 4B75A 3GYMA 3E3TA 1HJ8A 3K6ZA 1GBBA 3ZV8A 4HTCH 3W94A 2EA3A 1X7AC 1C4V2 1ESAA 1QQ4A 1GJ4H 1O2IA 4ASHA 4CRFA 5JBTA 5H4IB 2F83A 3BTME 3L33A 5C20A 3BTQE 2OBQA 3LJOA 3S9BA 1P2KA 2FOFA 2WYGA 5A0AE 1MAYA 1S0QA 1UTPA 3ZZBA 1EAWA 3MH5A 3OTJE 2PWXA 3FP7E 5DP6A 1ARCA 1TRYA 1E38B 2I6SA 4FU8A 2BDHA 5FPTA 2BQWB 3SNCA 1OYQA 5C1XA 1SOTA 3HKIB 1A46H 3SU4A 5C5NA 2OC8A 1O0DH 1UVPA 3PV4A 7GCHF 4X6NA 1DUEA 3TPIZ 1Z8GA 2A0QB 4OS2A 5EG4A 2AMPA 1P8VC 1HXEH 1TA6A 4BAKB 1XMNB 2J92A 2YNBA 1G3CA 1QL7A 5AVDA 3UQOA 2XC0A 3T27A 2JETC 1SB1H 1QJ6B 4I8GA 4AYYB 2OC7A 3MNSA 3UREA 2W5EA 2HGTH 1G2MA 1ZYOA 3VGCB 1Q31A 2DE9A 4TWWA 4ZHAA 8GCHG 5L6NH 4A92A 1UK3A 1V2JT 2VH6A 1INCA 3BTHE 1AKSB 1VZQH 4A1TA 3GISB 4Y0ZE 2J2UA 3VB6A 2BY9X 3RXBA 1TX7A 1WTHD 1SGFG 4HGCA 3NKKA 4BXSA 1OP8A 3QDZB 2VVCA 1C2JA 3VFEA 3GICB 2ZDMA 4MNVA 4YTAA 3RXEA 1DVAH 1ETRH 2FI3E 3LGUA 1GI7B 1SGFA 2FOCA 1HPGA 1AUJA 2O8LA 2BM2A 1SPJA 3BG4C 3QLPH 4LZ1H 1TFXA 1TOCB 1GI0A 1AWHB 1DDJA 1QIXB 1ZHMA 1UMAH 1GBLA 3EA8A 2A5KA 1XVOA 4ESTE 2G4UA 4I7YH 1Z8IB 1K1OA 3LIWA 1NU9A 1OX1A 2ZP0H 4B73A 3STJA 1F0RA 1SMFE 1O5DH 1QURH 3VB7A 1HUTH 1B0EA 4IMZA 1YF4A 5EQRA 3ATWA 1ZMNA 1GBIA 4CRAA 4X1NU 3A81A 3E91A 3BEFB 1BQYA 1JBUH 1RFNA 1AE8H 3WY8A 1P02A 1GJ6A 4F49A 2FOHA 2BD5A 1FIWA 3RXQA 2NU4E 3TLOA 5AF9H 1PQ5A 1TABE 1UJ1A 3C27B 1YPJH 4K3JA 2XC4A 1EKBB 1O31A 4X1PU 3UOPA 2SGAA 1C2FA 1GBMA 4KTCA 1XXDA 1FUJA 2F9VA 1ELTA 1C5TA 2OC0A 2ZFQH 3Q3XA 3TU7H 1GMHG 3O8DA 1LMWB 1K1LA 1C5UA 3STIA 2WPMS 4E06H 3B9FH 1O2MA 2VGCC 5EQQA 2J95A 4CRDA 1H8IH 3OSYA 1LDTT 4A1XA 3C1KA 1O2UA 2SGFE 3BEIB 2BY7X 3RXGA 1T4VH 4B76A 5DGJA 5J4SA 1QL9A 1IHTH 3GY2A 3M36A 3EYDA 1OSSA 3NWUA 2G81E 4FU7A 1QRZA 1S82A 2BY5X 2B5TB 1C9TA 1PYTC 5JPMH 1E36B 1NC6A 1P01A 3M5MA 1BRUP 1KYNA 1SGYE 3AVZA 4OS7A 3LPRA 4WH6A 2G51A 2Z3DA 4Y7AA 4Y79A 2FOBA 1GHYH 1QA7A 1ZTJA 2BZAA 2WPIS 1EZSC 5PTPA 3P92A 2A2QH 3ZVBA 1NRNH 1MAXA 3LT3A 3UTUH 3UOUA 8GCHF 2FTLE 1WTGH 1IQLA 2GV6A 2ZDLA 1VR1H 2BD4A 3ZVEA 4Q2KA 4X2YA 3BTWE 3RXFA 2BD2A 2PGQB 3D65E 2AMQA 1HNEE 2BDBA 2Z9LA 3Q3YA 3SQHE 4KTUA 5I25A 1PQAA 2ODPA 5CE1A 4AOQA 1TB6H 2PGBB 1ANCA 2P3TB 1AE5A 3T5FH 1BMMH 3F1SB 9ESTA 3DA9B 1BRBE 2P93A 1MTNB 2R9PA 4AFSA 1ELBA 5EXMA 4AG1A 1C1TA 4SGBE 4UFEH 1KSNA 3EA9A 4CHAB 1QB6A 1K28D 2A1DB 2AMDA 2VVVA 2WPJS 2ZWLH 2QA9E 2A4OA 3TNSA 1FNIA 1Z8JB 1FMGA 4OS1A 3TITA 1SBWA 1HJAC 1OWKA 1L4DA 3E8LA 4NIVA 1C5MD 2QGRA 4E05H 1Y3XA 5DP4A 1GMDG 5C2ZA 1TNLA 4TWYA 3VB3A 5FPSA 3K2UA 1A7SA 5K0HA 1KXAA 1NM6A 1P04A 1J9CH 1HFDA 2O8UA 1P2OA 1QFKH 2ANKH 1C5YB 2YNAA 1K1MA 5EW1H 1C2IA 1YPHC 1Z1JA 4YT6H 1IQMA 1TPPA 3KIDU 5A2MH 4JZDH 1SGQE 1TQ0B 1HAVB 2FWWA 1ANDA 4ZKSU 2C93B 3P70B 2ESTE 1ZOMA 4I32A 3ZZ6A 4D9QA 4YLUA 3LGTA 3SV9A 3DD2H 2B8OH 1OPHB 4DT7B 2FS9A 1GMHF 4GVUA 4HFPB 1Z1IA 4YOJA 1GDUA 4ABFA 4GHTA 4MQAA 1NFXA 4WH8A 1TLDA 2Q6GA 1C1PA 1ELVA 3URCA 1SGIB 1PPZA 4DGJA 2IJOB 1PFXC 1S5SA 7LPRA 2TRMA 1SGCA 4BNRA 1AB9C 1FPCH 5DP3A 4AGJA 1TOMH 3SGAE 4UE7H 1C5OH 3IG6B 3SU0A 1EPTC 3CP7A 1TNIA 1C1NA 1MQ6A 1MD8A 1PPCE 2G52A 2ZGHA 2C90B 3SJIA 2VWOA 1O35A 3CS7A 3MOCA 1GVKB 1D3QB 1LTOA 2GVFA 1Z6EA 4ISIH 3D23A 2CF9H 3ESTA 4Y8XA 3ZVFA 1HAZB 1QNJA 2BLOA 2BY6X 3MU4A 5B6OA 2J9NA 1D3PB 3F6UH 1DSUA 1NT1A 1AZZA 1PPEE 4DG4A 2Y82A 4F4OC 5A0CA 2BQ7B 1UTMA 1EPTA 4Y71A 1V2RT 2VIDA 3SU2A 3A8CA 1YLCA 1SG8B 1TPSA 1OWEA 4ZMAH 3SU5A 1EZXC 1L1JA 1U6QA 4ZXYH 2A32A 1WV7H 2STBE 4XSKU 3SUEA 4NCYA 1XUJA 4I31A 1RIWB 2UWOA 1GBDA 1KXBA 1QGFA 1P10A 3BTGE 3VXFH 3RMLH 4Q7ZA 1TMTH 3UQVA 3KQCA 2AIQA 3MU5A 1O2LA 3RM0H 2THFB 2ZTXA 1NU7B 1SLWB 1C1OA 1NESE 1VCWA 2ZNKH 3PROA 1WQSA 1S0RA 3RU4T 3SNDA 1IHSH 1L2EA 1GMDF 1SVPA 1PPFE 1S84A 4FUHA 4BTUB 2SFAA 1F92A 5TCCA 3TK6A 1O2SA 1JXPA 2DE8A 5AFZH 3N7OA 3RXCA 4ABBA 3GCHC 5DJ7A 3SJOA 1DWDH 4AORA 1OOKB 4WY3A 3SJ8A 2SGQE 2VINA 2BXTH 1SSXA 1Y3YA 2F9BH 1IQIA 1BOQA 1P03A 5C67A 1OS8A 3KCGH 1TPOA 3A87A 1HYLA 1TNHA 1DM4B 1H1BA 1OWDA 4XE4A 3ZZ7A 4M7GA 1P09A 4UFFH 1OWHA 2FM2A 1J16A 1PPBH 1EAIA 3KNXA 1DS2E 1C5LH 1TA2A 2AERH 1F5KU 5LH8A 1RTFB 3A8AA 1T7CA 3A7TA 3HK3B 1L0ZA 2Z3CA 5CHAC 3L3TA 3ZVGA 2ZU2A 2C8WB 3NK8A 3M3VA 3PLKA 2CHAC 2XRCA 3P8OA 4GPGA 1T31A 4Q80A 4K8YA 3RMMH 1ZTKA 2QN5T 3KGPA 5F03A 4U01A 4I33A 2Y5HA 3F9FA 4AX9H 3SN8A 1GJCB 2FX6A 2Y5FA 1BDAA 2VU8E 5E2OA 1ELFA 3FP6E 4ABGA 1H9LB 4J1YA 3QGNB 1S6HA 3ATKA 4TPYA 1RD3B 1GJ7B 2J94A 3RC5A 1V3XA 3GY7A 1ZJKA 1EJMA 3A8BA 1GCTC 4NSYA 4XDEA 1O3FA 3QX5H 5TCAA 1L4ZA 1EB2A 2WV5A 4NIWA 5JB9S 3PB1E 1NROH 4TPIZ 1SL3A 3TIUA 1ANBA 1OWIA 1Z71A 1JOUB 3U8RH 1GGDC 3LU9B 1AWFH 4B2BA 4NWKA 3RC4A 1LQDB 3QTVH 2J4IA 3TJNA 3M5LA 3U9AH 1WUNH 1NPMA 2WPKS 1KLJH 4GHQA 1CO7E 2KAIA 1O34A 3DFLA 4OS5A 2ODQA 2P8OB 3MNBA 1N8OC 1C1UH 2PV9B 4DOQA 4UDWH 5TJXA 2FOEA 2B9LA 2TGAA 3FP8E 1TGNA 4JZEH 5GPIB 5F8ZA 4AZ2B 3S7KB 3ZYEA 2SGEE 2J34A 1DLKB 1FPHH 1HB0B 3TH2H 2J38A 3GCOA 2C8XB 1BUIA 3ZZAA 3KN2A 1EATA 1IQNA 1GHXH 5DKMA 1O2GH 2GCTB 1IQGA 2A5AA 1O3CA 1TBRH 1CT0E 1FONA 5EU8A 2NU3E 5CMXH 1DLEA 5FPYA 1V2OT 1NFWA 3RXIA 2PKSC 4JK6A 1G3BA 3F9HA 1UHBB 2OQ5A 4DY7B 1GJ9B 1YPMH 3PMAB 2ODYB 3SU3A 2XC5A 1C5ZB 2CF8H 2ANYA 1IQHA 1XX9A 1FI8A 4IMQA 2QF3A 4IC5A 5JBBS 1CQQA 1ZPBA 1XVMA 1FN8A 1AFQC 5EPNA 1MZDA 1BTZA 1O2ZA 1ELGA 2FX4A 1B7XB 1O3GA 1D6WA 2Y5GA 2ZHQH 3I78A 3K65B 3LGIA 1MQ5A 1DSTA 1CBWB 1W3CA 2TGTA 1AMHA 1BJUA 3TGIE 1T32A 2FESH 1WOFA 2IOTA 5BPEA 4MPXA 2TIOA 2W26A 1YCPH 3KEEA 8LPRA 1HIAA 2Q1JA 2BD7A 2PHBA 1Z8RA 5C1YA 1Y5AT 3MH6A 4HZHA 2BLWA 1ELEE 1J15A 1LVOA 1O2XA 1V2MT 2ZEBA 2V35A 5F6MA 1ABJH 1W7XH 3NCLA 1GI8B 1O2KA 1IAUA 2GZ7A 4GCHF 1BTPA 3U69H 4CH2B 1AVWA 2VIWA 2ZU3A 1CHOG 3RUOA 1BT7A 1HAXB 2P94A 2ALPA 5EXLA 1PPHE 2P8OC 2UWPA 2F3CE 3MU8A 4IW4E 2A7HA 1LHFH 1DANH 1C1QA 2DUCA 1DICA 2BDCA 1WAYB 2ZECA 3CS0A 1GVZA 1TALA 2QF0A
chains in the Genus database with same CATH superfamily
2XWAA 2HNTF 4X8VH 1MKXK 1K9OE 2Q6DA 1IQKA 4NWLA 1GJBB 3MQKC 4B1TA 3H7OA 3QK1A 4O97A 1O32A 3V12A 4OS6A 1BCUH 1EX3A 5AHGH 4OGYA 3LONA 4WJG2 1O2TA 4YOIA 3JZ1B 1O2RA 2H9HA 4MPVA 3UPEA 8ESTE 3R3GB 3ZVCA 5JBAS 1CT4E 2RA3A 4D7FA 1TNJA 1Y5UT 1NRSH 3DT0H 1MBMA 3SORA 1AGJA 1ZMJA 2ZPQA 5GCHG 1ZHPA 3TJOA 1MZAA 2VB0A 2FI4E 3RXOA 2Z9IA 1ESBA 4RSPA 1TMUH 3SI3H 3MWIU 3WWBA 1SGRE 1H8DH 1N6YA 3P8GA 1GHBF 1AD8H 1PQ7A 1GHWH 1JIMA 7ESTE 4MNWA 4NIXA 2VNTA 1KY9A 4WXIA 1NBMD 5GWZA 3K6YA 5CDFE 1WSSH 1WQVH 3A7VA 4TY7A 1NY22 1C5SA 5EW2H 2OUAA 4H6SB 8KME2 3A84A 4Y7BA 1V2QT 1TONA 2AIPA 4IN2A 1MU8B 5KEDA 1RRKA 2R3UA 1E35B 2ZKSA 1C4U2 1ELAA 2VVUA 2C4FH 1QBVH 1PPGE 2FIRH 5FCRA 1OP0A 4JYTA 2BTCE 1C5XB 2LPRA 5HMAA 1LKAA 3ZV9A 1SI5H 5I46H 3EE0B 1BBRK 1FDPA 2XCNA 2R2WU 1AUTC 3SI4H 1PYTD 1FXYA 1IQEA 3I29A 5A8ZA 1DY8A 2Z6BD 2HVXA 1AVXA 4ZUHA 1Y3WA 3RXTA 5ABWA 3RXMA 1MTUA 1W10U 1XUGA 3U8OH 2G5NA 3D49H 1CA0B 3D62A 1WDIA 4ZXXH 2XYAA 2H5CA 1FY3A 3VGCC 4X1QU 2G4TA 3UNRA 1KXEA 2ZDKA 1RXPA 3FKSD 1UVTH 1Y5BT 4X2WA 1UO6A 4Z1MD 3ELAH 3SHCH 1S6FA 4FUBA 2NWNA 4XBDA 1JIRA 4BANB 1E1QD 1ANEA 1C5NH 3P17H 5C5OA 3KQBA 2G55A 4MG3A 1LCYA 1W7GH 4BAQB 3PYHA 1CHOF 1V2KT 5GIBA 3ZYDA 1JWTA 2CMYA 1K1NA 1A61H 1K2I1 3A89A 3PTBA 4F55A 1HGTH 2JIZD 4Y6DA 1GI5A 2EEKA 3QN7A 1FY8E 1EAXA 1P06A 2L74A 3UNQA 1AKSA 3RU4D 1CU1A 1RGQA 2GX4A 4MVNA 2ZTYA 1COWD 1O5AB 4O3UA 1ZRKA 2FDAA 1EP6A 1V2NT 2PKAB 1CA8B 3P8FA 4ISLA 1AQ7A 1DOJA 2NU2E 2HNTE 3ZZ3A 2WYJA 2BVSH 2OP9A 3F2HA 3KF2A 2FYRA 1OYTH 5T6DA 4P00A 5T1VA 2CXVA 2BLVA 2K0QA 1O3OA 3AW0A 1HCGA 4IGDA 3MNCA 5KECA 1MBQA 4O03A 2HLDD 5FBIA 1KXFA 2Q6FA 1BMFD 1THSH 1BTXA 1SQRA 3ITIA 3GCTG 2ILNA 1DE7H 1LQEA 3MMGA 2V7QD 4WMFA 5GCHF 3BG8A 4DJZB 4Y0YE 1KDQA 2GT7A 2GZ9A 2HWLB 1ZRBA 1NTPA 4KELA 1YPLH 1A3BH 1DPOA 1T4UH 2GMTB 2A5IA 1C5VA 1O5FH 1VKYA 1G2LA 1TYNA 1GJDB 1YCPM 1ZLRA 2FOAA 1BIOA 3ZZ5A 4CRGA 1BA8B 1TNKA 3MI4A 1T8MA 4H42U 1GJAB 1A3EH 1K22H 2ALVA 1CGHA 1V6DA 4X8UH 3TGKE 1EASA 1SGTA 3MU1A 2VH0A 1VGCB 3LGVA 4B74A 2Y81A 3DSPA 5A8YA 1EJAA 2ZQ1A 3LC5A 1FY5A 4BTTB 2FLBH 1UTLM 3PLBA 3A7ZA 1MU6B 2FPZA 3RMNH 1Y59T 3GOVB 1BZXE 1RS0A 4KTSA 4KP0A 1V2UT 1MKWK 4WF8A 1NS3A 1A0HB 1KTTB 2QF4A 1GHAG 4Q4LA 1BHXB 1GHVH 2PR3A 2OK5A 4F48B 3S0NA 2BVRH 1O2QA 1O2WA 3LH1A 4GLYA 2O8WA 4GUXA 1QJ1B 4FVBA 3N7EA 4A5TS 5A0BA 4NFEA 1QZ8A 2JJ2D 4IC6A 4NG9H 5HIYA 1W8BH 3ENSB 1GVLA 2ZPSA 2ZIQH 5AFYH 3LJJA 4CRCA 3B23B 1DUAA 3BSQA 1S6LA 4AFQA 3RXAA 1SOZA 3VXEH 4D76A 5F8TA 2P3UB 3E0PB 2ZG0H 4RKOB 2XWBI 1NRPH 3SNEA 4THNH 4U2WA 1MTNC 5EIYA 3OEHD 3QUMP 1MMJN 1ZMLA 4LXBH 1WU1A 4CHAC 5HKKD 2GKVE 4X0WU 4BOHA 1P2NA 2VWMA 3V13A 1C2GA 4NIYA 2AH4X 1SR5C 2AGGX 2BY8X 1YCPK 4IBLH 1LHGH 1H9HE 1GJ8B 1C5RA 2PLXA 2LP6A 3RMOH 1GBHA 1LHEH 4IS5A 2D1JA 4ABJA 1GG6B 1G3EA 1DY9A 3BTKE 1LVMA 1DITH 3MU0A 5ESTE 1ZSLA 2JH0D 2OBOA 4HI3A 3OYPA 2RA0A 1GDQA 4RKJB 5GDSH 1FLEE 1HV7A 1VCPA 2GCHG 4K1TA 1HRTH 3TJUA 3OX7U 1FY1A 2ZDAH 1BITA 4LZ4B 1H9IE 5E2PA 3TVJB 3UNSA 1K0HA 3GCTF 3N99A 4K1SA 1JRTA 2ZTZA 3MYWA 4RT1A 3TNTA 1GI1A 1BTWA 2RDLA 1UK4A 3JZ2B 4B2AA 5SGAE 3ZZ9A 3O8CA 2FEQH 3VG8A 2AGIX 4CH8B 3ATMA 3UB0A 2V0BA 3KQDA 1WYKA 2STAE 1K1IA 4BAOB 3PLPA 1PQ8A 1C1MA 3SUDA 2EY4C 2ULLA 3A85A 2F91A 1CE5A 3OU0A 2WPHS 1ELDE 3QWCH 1P3CA 2QC2A 4AFZA 2KZ4A 1AFEH 1XUFA 1OWJA 4YESB 1ABIH 3TK5A 2CN0H 1TX6A 1SHYA 3LDXH 1FJSA 3PMJA 4FXGH 2HPPH 5ETXA 3E6PH 3R0FA 1LHDH 2F4LA 3QTOH 1EP5A 1A2CH 4ISNA 1SGPE 2PUQH 2P95A 1OKXA 2W7UA 2Z7FE 2Y7ZA 2QY0B 2QE7D 1THRH 1XM1A 5ESBA 1AVGH 1DX5M 3K9XB 1UVUH 2AYWA 4DW2U 3KYGA 4I8KA 3OAAD 2R0LA 1CGJE 1UVOA 5E8EH 4YT7H 1S85A 1GBJA 1SQAA 5EQSA 2GT8A 1TWXB 1ZTLA 1LPZB 3A7WA 5DG6A 2XBWA 3U1JB 1GBTA 4FUEA 2L6OA 3T26A 2VJ1A 3QO6A 2WSSD 3MO3A 1MCVA 2H5DA 4VGCB 3QGJA 4MPUA 1YPEH 4I86A 2FOGA 3HGPA 1HAPH 1AN1E 3E90B 1MTVA 1P11E 2AEIH 1HAYB 2BD8A 2QYIA 1ZSJA 3PV5A 5FL7D 3BIVH 2EC9H 4U30A 1Y8TA 3S9CA 1O2YA 4BAHB 4X2XA 1C4Y2 1RIWC 3A8DA 6CHAB 4Z6AH 4TYDA 5IK2D 3E0NB 2AS9A 3RXVA 5LPRA 1V2PT 2BX4A 3PO1B 2GD4B 1S81A 2C8ZB 5IDKA 3UWIA 3T28A 4ZAEA 1P2IA 2QXJA 1OHHD 7GCHG 1KIGH 1E34B 3F9EA 4FUCA 1FAXA 2OINA 1BMLA 2BMGB 1J14A 1JRSA 2ZCKP 4Y11E 1D3TB 2F9NA 4B6FA 3NZIA 3RXJA 4ABDA 2WUBA 2BHGA 3T25A 1QJ7B 4DVAU 2PUXB 3EE7A 4MDSA 3M5NA 2UWLA 1LPKB 3MO6A 1GL1A 3M7QA 1CT2E 5EOKA 1KXCA 5EGMA 3E1XB 3LOXA 1O2HA 3VPKA 2JH6D 1C5QA 3SQEE 2BQ6B 4AGKA 4SGAE 3HK6B 3TH4H 2PSYA 5L2YH 3LH3A 2R3YA 1KXDA 3SGBE 2FODA 3M7TA 3SUGA 3URDA 1G3DA 4I8LA 1ARBA 2J98B 1W13U 2BLQA 2A7CA 2H1UA 1ETTH 3MHWU 1QRXA 2XW9A 4FVDA 2H9TH 1JMOH 3EA7A 3RLYH 1XUHA 3AAUA 4H6TA 4WXVA 5HM9A 1THPB 3V0XA 3KQEA 1ETSH 3SYJA 2JETB 1T8LA 1O3LA 4RT0A 5DP5A 4J2YB 5BRRE 1E79D 1QBOA 1SGNE 1F5LA 2Z9KA 5EJLA 2R0KA 1P2JA 1EZQA 5FAHA 5FCKA 4WWYA 1ELCA 2QXGA 4CBNA 2XTTB 4BTIB 2QXHA 4JYUH 1UTNA 2M5TA 2HLCA 3BN9A 1G37A 1Q2WA 3A83A 1A4WH 1SQTA 2A2XH 4LK4A 4X8TH 2P59A 2G8TA 2GV7A 4ISOA 1AY6H 1WCZA 2H9EH 3SGQE 5FX5A 3ZVAA 4K2YA 2VIVA 1O3AA 6GCHG 1TBZH 6ESTA 1TGCA 4FUFA 3PWCA 1Z6JH 3MFJA 4B6EA 1FQ3A 2D2DA 4O9VA 1B5GH 4MPWA 1H4WA 1QBNA 3QZQA 1EJNA 4TT3D 1XUKA 1ACBE 3RXPA 3ATIA 2ASUB 4K60A 3BG4B 1RTLA 1YPHE 1LHCH 3UWJH 1QCPA 3BF6H 4NZQA 1MUEB 3M3SA 1NZQH 1TGBA 3ZZ4A 3OY6U 1O2PA 5E0HA 4ABHA 1RTKA 3GDUA 1D9IA 3SU6A 4JK5A 3RXUA 1E0FD 1O38A 4X2VA 2WUCA 2ANMH 3A82A 2QIQA 3S69A 3ZZ8A 2SGPE 1TPAE 1QA0A 2BYAX 2UUYA 3EAJA 1HAOH 2O8TA 4ZHMU 1N6XA 1FV9A 1D6RA 3PV2A 1KTSB 2CGAA 1FIZA 4AN7A 1YC0A 2V3OH 3UR9A 1TRNA 3HPTB 3O8RA 2ZDNA 2RDEA 4I8HA 2FLRH 3S9AA 2XBYA 2BDIA 3GY3A 1SC8U 1BTHH 1O2NA 1ZR0A 1GJ5H 2GCTC 3MO9A 2BX3A 2ZF0H 3P95A 4FUDA 3FANA 4AYVB 3TK9A 1QRWA 4UEHH 1SKYE 1C1VH 1FZZA 1QR3E 2BOHB 2IPHA 4IN1A 4YM9A 1O5BB 3PM3A 1GI3A 3GCNA 1BJVA 2A4QA 1GBCA 3KL6A 1C2LA 4U32A 1EAUA 1CHGA 1O3PB 2FZZA 2VGCB 3ZZDA 2F9OA 4R8TB 2ZO3H 1SHHB 3SV8A 4FU9A 3EQ0H 2HALA 1YLDA 1SGEE 5GXPA 1C2MA 3PMHB 4XBBA 1CBWC 1GBEA 4NZLA 2J5UA 2EI7A 2PSXA 2RCEA 1O5CB 2GTBA 1VITG 1S83A 1D4PB 2G5VA 1V2TT 3AK5A 3FFGA 2PFEA 1UHBA 1F0SA 2W3IA 2BDAA 3T29A 5T6FA 3FAOA 1UK2A 2SNWA 4A7IB 1W14U 1BMAA 2ZFSA 1KDQB 4YO9A 4YZUA 3TH3H 4GAWA 3O8BA 4D8NA 2Z3EA 2ZFRH 1GCDA 4AFUA 1O2VA 3BEUA 1C1SA 9LPRA 1RJXB 4ZKNU 3F3BA 1CVWH 5JYIA 4JZFH 1FAKH 1NRQH 1ZPZA 5HGGA 4NFFA 4X1SU 4K69A 1VCQA 6GCHF 3FZZA 4MNXA 1GDNA 3M3TA 1T8OA 2D8WA 1AU8A 4FUGA 3DSGA 2NU0E 3ZZCA 4Y8ZA 1A0LA 4JMYA 4E7NA 4XBCA 1YGCH 1O5GH 1VJAU 3BIUH 1SLXB 1MCTA 3GY5A 1TIOA 3BTTE 5T6GA 5F8XA 1UCYE 3A86A 2ZC9H 2FOMB 1ZGVA 2SGDE 3Q77A 2R2MB 4DIIH 2ZDVH 1EZUC 5F53A 1A5IA 5LPEA 4JYVH 1HJAB 1F5RA 2ZU4A 5DP8A 2EQNA 1HLTH 1GBAA 1UCYH 1LPGB 5LPFA 5FHTA 3M37A 3RXKA 1HXFH 2ZHDA 2IN2A 1XXFA 1HDTH 2OD3B 1O3HA 2OXSA 4WMEA 1V2VT 4Y10E 1O37A 1QY6A 1O2OA 1A5HA 3A7XA 3Q76A 4ZKRU 4ZHLU 4UONA 1QB9A 1ZGIA 2SNVA 1EOLA 1GHZA 4UD9H 3MTYA 1AO5A 1EUFA 2F43B 3PWBA 1TE0A 1O5EH 2H2ZA 5FX6A 1LO6A 5L30H 1DWEH 1C9PA 2KX4A 3UY9A 1HAGE 2ZPRA 1D3DB 5FXLA 3A80A 3HGNA 2YOLA 4YOGA 5C1UA 2ZU1A 2BB4A 1EOJA 2TBSA 1UTJA 2J97A 1KLIH 4D9RA 2GDDA 2GGVB 1CA0C 3NRLA 3V7TA 1TMBH 3PMBB 5DP7A 1AB9B 3NUMA 2G00A 2GDEH 5EXNA 1BMNH 3RXDA 1VITF 4ASUD 1ZZZA 1MTSA 3RDZA 2A4RA 1EPTB 4UFGH 5DP9A 1P2MA 2HOBA 1HAIH 1J8AA 1SLVB 2KCOA 2V6NA 2ZQ2A 4D7GA 3GY6A 5A09A 4ZKOU 1P9UA 1UTQA 2XXLA 3KHVA 4Y76A 3GDSA 3V3MA 1E37B 2OCVB 1W11U 2ZI2H 3RXHA 1SGDE 3SNAA 1LVBA 3ZVDA 2V3HH 3M61U 2ANWA 1L1NA 2XOKD 2FMJA 1O36A 2FTMA 4Q7XA 1O3NA 3RXSA 4BXWA 4A6LA 1A1RA 3SOSA 1DT2A 2Z94A 1AIXH 2ZFTA 4ABEA 1GMCG 6LPRA 2ZZUH 1P05A 3GYLB 2ZGXH 3U8TH 3UIRA 3U98H 1N1LA 1T8NA 1A0JA 1TX8A 3SJ9A 1C2EA 1DWCH 3LKWA 3W1EA 3RM2H 1O3KA 1GI6A 1QL8A 1AI8H 5DK1A 2H6MA 4JCNA 1C5PA 3SHAH 2C3SA 3H5CB 5G4BA 4QT8C 4UFDH 3BTEE 1BTUA 2TPIZ 1YYY1 3BTDE 4WVPE 2BOKA 4INHA 4CR5A 1O39A 5A8XA 3FOAA 2QF5A 5J4QA 5L2ZH 4ABIA 5EJZA 4ZH8A 1TBQH 1MKXH 4X6OA 5GJ4B 1QTFA 3F68H 1C2DA 1NO9H 2EI8A 2A7JA 1ZJDA 2K1QA 1ZPCA 1V2WT 1CGIE 2UUJB 4ZROA 3UUZA 1XUIA 2PKAA 2KR7A 4Q7YA 2GMTC 3AW1A 5DPAA 1P0SH 4KGAA 5T3HA 1H8ED 4R0IA 2A4GA 3ATLA 3SJKA 1BRCE 3ODDA 2GJGA 2VWNA 1O3EA 2XBVA 4WMDA 1P3EA 2JKHA 2HPQH 3AASA 2AFQB 3FZDA 1FN6A 1G32B 1ORFA 1SQOA 2QXIA 4X1RU 2F9PA 4K1EA 4CR9A 1EB1H 2ZHWH 2BD3A 1P9SA 3SZEA 5HYOA 1K21H 1GBKA 1XKBC 1MH0A 1YPKH 3GCHB 2GZ8A 2Y7XA 1VGCC 2M2AA 1Z7KA 3I77A 4Y8YA 3PTNA 2VIOA 4XOJA 1MD7A 1G36A 1AZ8A 1Y3UA 5JB8S 2A31A 5K7RA 4MNYA 4O3TA 1LKBA 3LGWA 2C8YB 1BRAA 3GDVA 2UUFB 5IYTA 1K1JA 1NN6A 3AAVA 1P2QA 1QQUA 3CENA 1M9UA 1EXFA 1BBRE 4B71A 2K8IA 5FBEA 4H4FA 1IOEA 2OLGA 1KLTA 3T62A 3P8NA 1TRMA 2O8MA 4CBOA 2LELA 1B0FA 3EGKH 5CHAB 3NPSA 3BV9B 4AG2A 4XFQA 2FS8A 3RXLA 1J17T 3DHKH 2ZHEH 2CHAB 4TY6A 1TGSZ 2ZGJA 2VIQA 1YKTA 1XKAC 1BBRH 4LOYH 1QB1A 1O3IA 3F9GA 4DIHH 2BDGA 4MLFB 4NA9H 3RLWH 2KAIB 1P57B 2JH5D 4A1VA 1C2HA 2W7SA 1O3DA 3W95A 3FVFB 3IITA 2ZFFH 3Q3KA 3GY8A 1GWAA 1HAVA 1ID5H 3SU1A 2A45B 3SV6A 3LC3A 4X8SH 5E0GA 2WPLS 3U1IB 1GBFA 2NU1E 3M7UA 1GCTB 3T2NA 1ZHRA 2O9QA 1O33A 1F7ZA 1GI9B 4GSOA 2YMSB 4INKA 2WV4A 3H09A 4AB9A 1YWUA 1VITH 3SV7A 4MTBA 4XD7D 3A88A 1C1WH 2XNDD 3B8JA 1GHAF 1OP2A 1GMCF 1TNGA 4JZIA 1GGDB 2Y6TA 3G01A 1EQ9A 2ZFPH 1UVSH 1UTKA 2D26C 1F0UA 2ZU5A 4CREA 1P12E 2TGPZ 2B7DH 4AB8A 3GY4A 1O2JA 4ABAA 2BD9A 4NA7A 5DO4H 1SFQB 1N8OB 1GG6C 1Y3VA 4KKDA 1GI2A 1TGTA 2WV9A 5LGOA 3RC6A 2ZCHP 3SNBA 3L6PA 1VJ9U 1SFIA 1YBWA 1GI4A 4DURA 1L1GA 2RG3A 4RN6A 1O3BA 3U28C 4OS4A 1C1RA 2HRVA 4FUIA 2QCYA 1NFYA 2WINI 2ZGBH 3VB5A 1TQ7B 1GPZA 4PROA 4NGAH 5HXFA 1YPGH 1W2KH 3SZNA 7KMEH 1UTOA 5JDUB 1YM0A 3BTFE 5HM2A 1NBME 3SUFA 4FUJA 4ISHH 4B2CA 3A7YA 1ZSKA 3MH7A 4CRBA 2CV3A 4X6PA 3RP2A 1CSOE 1HAHH 2UUKB 1F0TA 3OY5U 1BB0B 1HIAB 2WPDD 2PKSB 4GCHG 2HNTC 1YP9A 2I6QA 1Q3XA 2P3FH 3SBKA 1EFRD 2ZHFH 3QZRA 3FN8A 2ZGCA 1H8HD 2FO9A 2PTNA 2OTVA 1BTYA 4I8JA 1G9IE 4NA8A 1AFQB 3NXPA 1A5GH 1W12U 2V3MA 1W0YH 4Z0KA 3DUXH 3VB4A 1ESTA 2GCHF 1WBGB 2FYQA 1OXGA 3SO3A 1O3MA 1K1PA 1IQJA 2XNIA 3RXRA 5C3NA 2FP7B 2PTCE 3SW2B 1UCYK 1HBTH 1LVYA 5C0UA 1W0ZU 1G30B 2PW8H 1HJ9A 3PRDA 3HKJB 1F2SE 4E7RG 3DFJA 3HATH 1FY4A 1MABB 4NSVA 2QAAA 1NFUA 1O3JA 2BZ6H 2CJIA 2OQUA 2Z9GA 5EPYA 1MTWA 1DFPA 2OC1A 2VIPA 2LNCA 3ODFA 2FXRA 3H7TA 1O30A 3UR6A 2Y80A 1C2KA 1V2ST 2ZCLP 1C5WB 1NRRH 2W3KA 4K8BA 2F9UA 2AGEX 1DXPA 4VGCC 5JBCS 1GHBG 4DCDA 1BHXF 3LGYA 3E16B 4JZ1A 2BDYA 2Z9JA 1MKWH 2B0FA 2TGDA 2BVXH 1SLUB 3SV2H 5E0JA 5EODA 2ZA5A 3P6ZB 4Q63A 1QHRB 2XBXA 3M5OA 2FI5E 3Q00A 1DXWA 1V2LT 3MNXA 4YLQH 3IWMA 2P16A 4K5ZA 1AHTH 2XCFA 4HG6A 3S7HB 2EI6A 2VWLA 2BXUH 3RU4E 4ZCNA 2GP9B 2QV1A 3TGJE 3VEQB 4OGXA 6CHAC 1PJPA 4BAMB 1TAWA 4INLA 4X6MA 3EDXB 3MH4A 3PO1C 3UFAA 1IQFA 1DWBH 3M35A 1GL0E 3TJVA 4B75A 3GYMA 3E3TA 1HJ8A 3K6ZA 1GBBA 3ZV8A 4HTCH 3W94A 2EA3A 1X7AC 1C4V2 1ESAA 1QQ4A 1GJ4H 1O2IA 4ASHA 4CRFA 5JBTA 5H4IB 2F83A 3BTME 3L33A 5C20A 3BTQE 2OBQA 3LJOA 3S9BA 1KMHB 1P2KA 2FOFA 2WYGA 5A0AE 1MAYA 1S0QA 1UTPA 3ZZBA 1EAWA 3MH5A 3OTJE 2PWXA 3FP7E 5DP6A 1ARCA 1TRYA 1E38B 2I6SA 4FU8A 2BDHA 5FPTA 2BQWB 3SNCA 1OYQA 5C1XA 1SOTA 3HKIB 1A46H 3SU4A 5C5NA 2OC8A 1O0DH 1UVPA 3PV4A 7GCHF 4X6NA 1DUEA 3FO8D 3TPIZ 1Z8GA 2A0QB 4OS2A 5EG4A 2AMPA 1P8VC 1HXEH 1TA6A 4BAKB 1XMNB 2J92A 2YNBA 3OFND 1G3CA 1QL7A 5AVDA 3UQOA 2XC0A 3T27A 2JETC 1SB1H 1QJ6B 4I8GA 4AYYB 2OC7A 3MNSA 3UREA 2W5EA 2HGTH 1G2MA 1ZYOA 3VGCB 1Q31A 2DE9A 4TWWA 4ZHAA 8GCHG 5L6NH 4A92A 1UK3A 1V2JT 2VH6A 1INCA 3BTHE 1AKSB 1VZQH 4A1TA 4M9FA 3GISB 4Y0ZE 2J98A 2J2UA 3VB6A 2BY9X 3RXBA 1TX7A 1WTHD 1SGFG 4HGCA 3NKKA 4BXSA 2JJ1D 1OP8A 3QDZB 2VVCA 1C2JA 3VFEA 3GICB 2ZDMA 4MNVA 4YTAA 3RXEA 1DVAH 1ETRH 2W6JD 2HVYB 2FI3E 3LGUA 4YXWD 1GI7B 1SGFA 2FOCA 5C94A 1HPGA 1AUJA 2O8LA 5C17A 3UAIC 2BM2A 1SPJA 3BG4C 3QLPH 4LZ1H 1TFXA 1TOCB 1GI0A 1AWHB 1DDJA 1QIXB 1ZHMA 1UMAH 1GBLA 3EA8A 2A5KA 1XVOA 4ESTE 2G4UA 4I7YH 1Z8IB 1K1OA 3LIWA 1NU9A 1OX1A 2ZP0H 4B73A 3STJA 1F0RA 1SMFE 2KCAA 1O5DH 1QURH 3VB7A 1HUTH 1B0EA 4IMZA 5DSFA 1YF4A 5EQRA 3ATWA 1ZMNA 1GBIA 4CRAA 4X1NU 3A81A 3E91A 3BEFB 1BQYA 1JBUH 1RFNA 1AE8H 3WY8A 1P02A 1GJ6A 4F49A 2FOHA 2BD5A 1FIWA 3RXQA 2NU4E 3TLOA 5AF9H 1PQ5A 1TABE 1UJ1A 3C27B 1YPJH 4K3JA 2XC4A 1EKBB 1O31A 4X1PU 3UOPA 2SGAA 1C2FA 1GBMA 4KTCA 1XXDA 1FUJA 2F9VA 1ELTA 1C5TA 2OC0A 2ZFQH 3Q3XA 3TU7H 1GMHG 3O8DA 1LMWB 1K1LA 1C5UA 3STIA 2WPMS 4E06H 3B9FH 1O2MA 2VGCC 5EQQA 2J95A 4CRDA 1H8IH 3OSYA 1LDTT 4A1XA 3C1KA 1O2UA 2SGFE 3BEIB 2BY7X 5KGOA 3RXGA 1T4VH 4B76A 5DGJA 5J4SA 1QL9A 1IHTH 3GY2A 3M36A 3WW7A 3EYDA 1OSSA 3NWUA 2G81E 4FU7A 1QRZA 1S82A 5GNDA 2BY5X 2B5TB 1C9TA 1PYTC 5JPMH 1E36B 1NC6A 1P01A 3M5MA 1BRUP 1KYNA 1SGYE 1FX0B 3AVZA 4OS7A 3LPRA 2KFWA 4WH6A 2G51A 2Z3DA 4Y7AA 4Y79A 2FOBA 1GHYH 1QA7A 1ZTJA 2BZAA 2WPIS 1EZSC 5PTPA 3P92A 2A2QH 3ZVBA 4P02A 1NRNH 1MAXA 3LT3A 3UTUH 3UOUA 8GCHF 2FTLE 1WTGH 1IQLA 2GV6A 2ZDLA 1VR1H 2BD4A 3ZVEA 4Q2KA 4X2YA 3BTWE 3RXFA 2BD2A 2PGQB 3D65E 2AMQA 1HNEE 2BDBA 2Z9LA 3Q3YA 3SQHE 4KTUA 5I25A 1PQAA 2ODPA 5CE1A 4AC9A 4AOQA 1TB6H 2PGBB 1W0KD 1ANCA 2P3TB 1AE5A 3T5FH 1BMMH 2IPQX 3F1SB 9ESTA 3DA9B 1BRBE 2P93A 1MTNB 2R9PA 4AFSA 1ELBA 3F0PA 5EXMA 4AG1A 1C1TA 2KCYA 4SGBE 1KSNA 3EA9A 4UFEH 1QB6A 1K28D 2A1DB 4CHAB 1YY3A 2AMDA 4FETA 5C0TA 2VVVA 2WPJS 2ZWLH 2QA9E 2A4OA 3TNSA 1FNIA 1Z8JB 1FMGA 4OS1A 3TITA 1SBWA 1HJAC 1OWKA 1L4DA 3E8LA 2AHME 4NIVA 1C5MD 2QGRA 4E05H 1Y3XA 5DP4A 3OE7D 1GMDG 5C2ZA 1TNLA 4TWYA 3VB3A 5EJ1A 5FPSA 3K2UA 1A7SA 5K0HA 1KXAA 1NM6A 1P04A 1J9CH 1HFDA 1P2OA 2O8UA 1QFKH 2ANKH 1C5YB 2YNAA 1K1MA 5EW1H 1C2IA 1YPHC 1Z1JA 4YT6H 1IQMA 1TPPA 3KIDU 5A2MH 4JZDH 1SGQE 1TQ0B 1HAVB 2FWWA 1ANDA 4ZKSU 2C93B 3P70B 3DSOA 2ESTE 1ZOMA 4I32A 3ZZ6A 4D9QA 4YLUA 3LGTA 3SV9A 3DD2H 2B8OH 1OPHB 4DT7B 2FS9A 1GMHF 4GVUA 4HFPB 1Z1IA 3N7DA 4YOJA 1GDUA 4ABFA 4GHTA 4MQAA 1NFXA 4WH8A 1TLDA 2Q6GA 1C1PA 1ELVA 3URCA 4XRNA 1SGIB 1PPZA 4DGJA 2IJOB 1PFXC 1S5SA 7LPRA 2TRMA 1SGCA 2JDID 4BNRA 4ACBA 1AB9C 1FPCH 5DP3A 4AGJA 1TOMH 3SGAE 4UE7H 1C5OH 3IG6B 3SU0A 1EPTC 3CP7A 1TNIA 1C1NA 1MQ6A 1MD8A 1PPCE 2G52A 2ZGHA 4RI0A 2C90B 3SJIA 2VWOA 1O35A 3CS7A 3MOCA 1GVKB 1D3QB 1LTOA 2GVFA 1Z6EA 4ISIH 3D23A 2CF9H 3ESTA 4Y8XA 3ZVFA 1HAZB 1QNJA 2BLOA 2BY6X 3MU4A 5B6OA 2J9NA 1D3PB 3F6UH 1DSUA 1NT1A 1AZZA 3GS9A 1PPEE 4DT4A 4DG4A 2Y82A 4F4OC 5A0CA 2BQ7B 1UTMA 2WZQA 1EPTA 3CNRA 4Y71A 1V2RT 2IJD1 2VIDA 3SU2A 3A8CA 1YLCA 1SG8B 1TPSA 1OWEA 2PP6A 4ZMAH 3SU5A 1EZXC 1L1JA 1U6QA 4ZXYH 2A32A 1WV7H 2STBE 4XSKU 3SUEA 4NCYA 1WXRA 1XUJA 4I31A 1RIWB 2UWOA 1GBDA 1KXBA 1QGFA 1P10A 3BTGE 3VXFH 3RMLH 4Q7ZA 1TMTH 2KCPA 3UQVA 3KQCA 2AIQA 3MU5A 1O2LA 3RM0H 2THFB 2ZTXA 1NU7B 4ACAA 1SLWB 1C1OA 1NESE 1VCWA 2ZNKH 3PROA 1WQSA 1S0RA 3RU4T 3SNDA 1IHSH 1L2EA 1GMDF 1SVPA 1PPFE 1S84A 4FUHA 4BTUB 2SFAA 1F92A 5TCCA 3DCLA 3TK6A 1O2SA 1JXPA 2DE8A 1YLNA 3F2FA 3N7OA 5AFZH 3RXCA 4ABBA 3GCHC 5DJ7A 3SJOA 1DWDH 4AORA 1OOKB 5CHBA 4WY3A 3SJ8A 2SGQE 4OM9A 2VINA 2BXTH 1SSXA 1Y3YA 2F9BH 1IQIA 1BOQA 1P03A 5C67A 1OS8A 3KCGH 1TPOA 3PRBA 3A87A 1HYLA 1TNHA 1DM4B 3KYFA 1H1BA 1OWDA 4XE4A 4FOUC 3ZZ7A 4M7GA 1P09A 2YMSD 4UFFH 1OWHA 2FM2A 1J16A 1PPBH 1EAIA 3KNXA 1DS2E 1C5LH 1TA2A 2AERH 1F5KU 5LH8A 1RTFB 3A8AA 1T7CA 3A7TA 3HK3B 1L0ZA 2Z3CA 5CHAC 3L3TA 3ZVGA 2ZU2A 2C8WB 3NK8A 3M3VA 3PLKA 2CHAC 2XRCA 3P8OA 5DN6D 4GPGA 1T31A 2VBCA 4Q80A 4K8YA 3RMMH 1ZTKA 2QN5T 3KGPA 3F0OA 4U01A 5F03A 4I33A 2Y5HA 3F9FA 4AX9H 3SN8A 1GJCB 2FX6A 2Y5FA 1BDAA 2VU8E 5E2OA 1ELFA 3FP6E 4ABGA 1H9LB 4J1YA 3QGNB 1S6HA 3ATKA 4TPYA 1RD3B 1GJ7B 2J94A 3RC5A 1V3XA 3GY7A 1ZJKA 1W0JD 1EJMA 3A8BA 1GCTC 4NSYA 4XDEA 1O3FA 3QX5H 5TCAA 1L4ZA 1EB2A 2WV5A 2YMSC 4NIWA 5JB9S 2CK3D 3PB1E 1NROH 4TPIZ 1SL3A 3TIUA 1ANBA 1OWIA 1Z71A 1JOUB 3U8RH 1GGDC 3LU9B 1AWFH 4B2BA 4NWKA 3RC4A 1LQDB 3QTVH 2J4IA 3TJNA 3M5LA 3U9AH 1WUNH 1NPMA 2WPKS 1KLJH 4GHQA 1CO7E 2KAIA 1O34A 3DFLA 4OS5A 2ODQA 2P8OB 3F2GA 1N8OC 3MNBA 1C1UH 2PV9B 4DOQA 4UDWH 5TJXA 2FOEA 2B9LA 2TGAA 3FP8E 1TGNA 4JZEH 5GPIB 5F8ZA 1UW7A 4AZ2B 3S7KB 3ZYEA 2SGEE 2J34A 1DLKB 1FPHH 1HB0B 3TH2H 2J38A 3GCOA 2C8XB 4TSFD 1BUIA 3ZZAA 3KN2A 1EATA 1IQNA 1GHXH 5DKMA 1O2GH 2GCTB 1IQGA 2A5AA 1O3CA 1TBRH 1CT0E 1FONA 5EU8A 2NU3E 3KQ5A 5CMXH 1DLEA 5FPYA 1V2OT 1NFWA 3RXIA 3OTPA 2PKSC 4JK6A 1G3BA 5HIZA 3F9HA 1UHBB 2RFKC 2OQ5A 4DY7B 1GJ9B 1YPMH 3PMAB 2ODYB 3SU3A 2XC5A 1C5ZB 2CF8H 2ANYA 1IQHA 1XX9A 1FI8A 4IMQA 2QF3A 4IC5A 5JBBS 1CQQA 1ZPBA 1XVMA 1FN8A 1AFQC 3OEED 5EPNA 1MZDA 1BTZA 1O2ZA 1ELGA 2FX4A 3WWFA 1B7XB 1O3GA 2WHXA 1D6WA 2Y5GA 2ZHQH 3I78A 3K65B 3LGIA 1MQ5A 1DSTA 1CBWB 1W3CA 2TGTA 1AMHA 1BJUA 3TGIE 1T32A 2FESH 1WOFA 2IOTA 5BPEA 2KM0A 4MPXA 2TIOA 2W26A 1YCPH 3KEEA 8LPRA 1HIAA 2Q1JA 2BD7A 2PHBA 1E1RD 1Z8RA 5C1YA 1Y5AT 2W6ID 3MH6A 4HZHA 2BLWA 1ELEE 1J15A 1LVOA 1O2XA 3ZIAD 1V2MT 2ZEBA 2V35A 5F6MA 1ABJH 1W7XH 3NCLA 1GI8B 1O2KA 1IAUA 2GZ7A 4GCHF 5B6LA 1BTPA 3U69H 4CH2B 1AVWA 2VIWA 2ZU3A 1CHOG 3RUOA 1BT7A 1HAXB 2P94A 2ALPA 5EXLA 1PPHE 2P8OC 2UWPA 2F3CE 3MU8A 4IW4E 2A7HA 1LHFH 1DANH 1C1QA 2DUCA 1DICA 2BDCA 1WAYB 2ZECA 3CS0A 1GVZA 1TALA 2QF0A
chains in the Genus database with same CATH topology
2XWAA 2HNTF 4X8VH 1MKXK 1K9OE 2Q6DA 1IQKA 4NWLA 1GJBB 4B1TA 3H7OA 3QK1A 4O97A 1O32A 3V12A 4OS6A 1BCUH 1EX3A 5AHGH 4OGYA 3LONA 4WJG2 1O2TA 4YOIA 3JZ1B 1O2RA 2H9HA 4MPVA 3UPEA 8ESTE 3R3GB 3ZVCA 5JBAS 1CT4E 2RA3A 4D7FA 1TNJA 1Y5UT 1NRSH 3DT0H 1MBMA 3SORA 1AGJA 1ZMJA 2ZPQA 5GCHG 1ZHPA 3TJOA 1MZAA 2VB0A 2FI4E 3RXOA 2Z9IA 1ESBA 4RSPA 1TMUH 3SI3H 3MWIU 1SGRE 1H8DH 1N6YA 3P8GA 1GHBF 1AD8H 1PQ7A 1GHWH 1JIMA 7ESTE 4MNWA 4NIXA 2VNTA 1KY9A 4WXIA 5GWZA 3K6YA 1WSSH 1WQVH 3A7VA 4TY7A 1NY22 1C5SA 5EW2H 2OUAA 4H6SB 8KME2 3A84A 4Y7BA 1V2QT 1TONA 2AIPA 4IN2A 1MU8B 1RRKA 2R3UA 1E35B 2ZKSA 1C4U2 1ELAA 2VVUA 2C4FH 1QBVH 1PPGE 2FIRH 5FCRA 1OP0A 4JYTA 2BTCE 1C5XB 2LPRA 5HMAA 1LKAA 3ZV9A 1SI5H 5I46H 3EE0B 1BBRK 1FDPA 2XCNA 2R2WU 1AUTC 3SI4H 1PYTD 1FXYA 1IQEA 3I29A 5A8ZA 1DY8A 2Z6BD 2HVXA 1AVXA 4ZUHA 1Y3WA 3RXTA 5ABWA 3RXMA 1MTUA 1W10U 1XUGA 3U8OH 2G5NA 3D49H 1CA0B 3D62A 4ZXXH 2XYAA 2H5CA 1FY3A 3VGCC 4X1QU 2G4TA 3UNRA 1KXEA 2ZDKA 1RXPA 1UVTH 1Y5BT 4X2WA 1UO6A 3ELAH 3SHCH 1S6FA 4FUBA 2NWNA 4XBDA 1JIRA 4BANB 1ANEA 1C5NH 3P17H 5C5OA 3KQBA 2G55A 4MG3A 1LCYA 1W7GH 4BAQB 3PYHA 1CHOF 1V2KT 5GIBA 3ZYDA 1JWTA 2CMYA 1K1NA 1A61H 1K2I1 3A89A 3PTBA 1HGTH 4Y6DA 1GI5A 2EEKA 3QN7A 1FY8E 1EAXA 1P06A 3UNQA 1AKSA 3RU4D 1CU1A 1RGQA 2GX4A 4MVNA 2ZTYA 1O5AB 4O3UA 1ZRKA 2FDAA 1EP6A 1V2NT 2PKAB 1CA8B 3P8FA 4ISLA 1AQ7A 1DOJA 2NU2E 2HNTE 3ZZ3A 2WYJA 2BVSH 2OP9A 3KF2A 2FYRA 1OYTH 5T6DA 2CXVA 2BLVA 3AW0A 1O3OA 1HCGA 4IGDA 3MNCA 1MBQA 4O03A 5FBIA 1KXFA 2Q6FA 1THSH 1BTXA 3ITIA 3GCTG 2ILNA 1DE7H 1LQEA 3MMGA 4WMFA 5GCHF 3BG8A 4DJZB 4Y0YE 1KDQA 2GT7A 2GZ9A 2HWLB 1ZRBA 1NTPA 4KELA 1YPLH 1A3BH 1DPOA 1T4UH 2GMTB 2A5IA 1C5VA 1O5FH 1G2LA 1TYNA 1GJDB 1YCPM 1ZLRA 2FOAA 1BIOA 3ZZ5A 4CRGA 1BA8B 1TNKA 3MI4A 1T8MA 4H42U 1GJAB 1A3EH 1K22H 2ALVA 1CGHA 1V6DA 4X8UH 3TGKE 1EASA 1SGTA 3MU1A 2VH0A 1VGCB 3LGVA 4B74A 2Y81A 5A8YA 1EJAA 2ZQ1A 3LC5A 1FY5A 4BTTB 2FLBH 1UTLM 3PLBA 3A7ZA 1MU6B 2FPZA 3RMNH 1Y59T 3GOVB 1BZXE 1RS0A 4KTSA 4KP0A 1V2UT 1MKWK 4WF8A 1NS3A 1A0HB 1KTTB 1GHAG 1BHXB 1GHVH 2PR3A 3S0NA 2BVRH 1O2QA 1O2WA 3LH1A 4GLYA 2O8WA 4GUXA 1QJ1B 4FVBA 4A5TS 5A0BA 4NFEA 4IC6A 4NG9H 1W8BH 3ENSB 1GVLA 2ZPSA 2ZIQH 5AFYH 3LJJA 4CRCA 3B23B 1DUAA 3BSQA 4AFQA 3RXAA 1SOZA 3VXEH 4D76A 5F8TA 2P3UB 3E0PB 2ZG0H 4RKOB 2XWBI 1NRPH 3SNEA 4THNH 4U2WA 1MTNC 3QUMP 1MMJN 1ZMLA 4LXBH 1WU1A 4CHAC 2GKVE 4X0WU 4BOHA 1P2NA 2VWMA 3V13A 1C2GA 4NIYA 2AH4X 1SR5C 2AGGX 2BY8X 1YCPK 4IBLH 1LHGH 1H9HE 1GJ8B 1C5RA 2PLXA 3RMOH 1GBHA 1LHEH 4IS5A 2D1JA 4ABJA 1GG6B 1G3EA 1DY9A 3BTKE 1LVMA 1DITH 3MU0A 5ESTE 1ZSLA 2JH0D 2OBOA 4HI3A 3OYPA 2RA0A 1GDQA 4RKJB 5GDSH 1FLEE 1HV7A 1VCPA 2GCHG 4K1TA 1HRTH 3TJUA 3OX7U 1FY1A 2ZDAH 1BITA 4LZ4B 1H9IE 5E2PA 3TVJB 3UNSA 3GCTF 4K1SA 1JRTA 2ZTZA 3MYWA 3TNTA 1GI1A 1BTWA 2RDLA 1UK4A 3JZ2B 4B2AA 5SGAE 3ZZ9A 3O8CA 2FEQH 2AGIX 4CH8B 3ATMA 2V0BA 3KQDA 1WYKA 2STAE 1K1IA 4BAOB 3PLPA 1PQ8A 1C1MA 3SUDA 2ULLA 3A85A 2F91A 1CE5A 3OU0A 2WPHS 1ELDE 3QWCH 1P3CA 2QC2A 4AFZA 1AFEH 1XUFA 1OWJA 4YESB 1ABIH 3TK5A 2CN0H 1TX6A 1SHYA 3LDXH 1FJSA 3PMJA 4FXGH 2HPPH 5ETXA 3E6PH 3R0FA 1LHDH 3QTOH 1EP5A 1A2CH 4ISNA 1SGPE 2PUQH 2P95A 1OKXA 2W7UA 2Z7FE 2Y7ZA 2QY0B 1THRH 1XM1A 5ESBA 1AVGH 1DX5M 3K9XB 1UVUH 2AYWA 4DW2U 4I8KA 2R0LA 1CGJE 1UVOA 5E8EH 4YT7H 1S85A 1GBJA 1SQAA 5EQSA 2GT8A 1TWXB 1ZTLA 1LPZB 3A7WA 5DG6A 2XBWA 3U1JB 1GBTA 4FUEA 3T26A 2VJ1A 3QO6A 3MO3A 1MCVA 2H5DA 4VGCB 3QGJA 4MPUA 1YPEH 2FOGA 3HGPA 1HAPH 1AN1E 3E90B 1MTVA 1P11E 2AEIH 1HAYB 2BD8A 2QYIA 1ZSJA 3BIVH 2EC9H 4U30A 1Y8TA 3S9CA 1O2YA 4BAHB 4X2XA 1C4Y2 1RIWC 3A8DA 6CHAB 4Z6AH 4TYDA 3E0NB 2AS9A 3RXVA 5LPRA 1V2PT 2BX4A 3PO1B 2GD4B 1S81A 2C8ZB 5IDKA 3UWIA 3T28A 4ZAEA 1P2IA 2QXJA 7GCHG 1KIGH 1E34B 3F9EA 4FUCA 1FAXA 2OINA 1BMLA 2BMGB 1J14A 1JRSA 2ZCKP 4Y11E 1D3TB 2F9NA 3NZIA 3RXJA 4ABDA 2WUBA 2BHGA 3T25A 1QJ7B 4DVAU 2PUXB 4MDSA 3M5NA 2UWLA 1LPKB 3MO6A 1GL1A 3M7QA 1CT2E 5EOKA 1KXCA 5EGMA 3E1XB 3LOXA 1O2HA 3VPKA 2JH6D 1C5QA 3SQEE 2BQ6B 4AGKA 4SGAE 3HK6B 3TH4H 2PSYA 5L2YH 3LH3A 2R3YA 1KXDA 3SGBE 2FODA 3M7TA 3SUGA 3URDA 1G3DA 4I8LA 1ARBA 1W13U 2BLQA 2A7CA 2H1UA 1ETTH 3MHWU 1QRXA 2XW9A 4FVDA 2H9TH 1JMOH 3EA7A 3RLYH 1XUHA 3AAUA 4H6TA 4WXVA 5HM9A 1THPB 3V0XA 3KQEA 1ETSH 2JETB 1T8LA 1O3LA 5DP5A 4J2YB 5BRRE 1QBOA 1SGNE 1F5LA 2Z9KA 2R0KA 1P2JA 1EZQA 5FAHA 5FCKA 4WWYA 1ELCA 2QXGA 4CBNA 2XTTB 4BTIB 2QXHA 4JYUH 1UTNA 2M5TA 2HLCA 3BN9A 1G37A 1Q2WA 3A83A 1A4WH 1SQTA 2A2XH 4LK4A 4X8TH 2P59A 2G8TA 2GV7A 4ISOA 1AY6H 1WCZA 2H9EH 3SGQE 5FX5A 3ZVAA 4K2YA 2VIVA 1O3AA 6GCHG 1TBZH 6ESTA 1TGCA 4FUFA 3PWCA 1Z6JH 3MFJA 1FQ3A 2D2DA 4O9VA 1B5GH 4MPWA 1H4WA 1QBNA 3QZQA 1EJNA 1XUKA 1ACBE 3RXPA 3ATIA 2ASUB 4K60A 3BG4B 1RTLA 1YPHE 1LHCH 3UWJH 1QCPA 3BF6H 4NZQA 1MUEB 3M3SA 1NZQH 1TGBA 3ZZ4A 3OY6U 1O2PA 5E0HA 4ABHA 1RTKA 3GDUA 1D9IA 3SU6A 4JK5A 3RXUA 1E0FD 1O38A 4X2VA 2WUCA 2ANMH 3A82A 2QIQA 3S69A 3ZZ8A 2SGPE 1TPAE 1QA0A 2BYAX 2UUYA 3EAJA 1HAOH 2O8TA 4ZHMU 1N6XA 1FV9A 1D6RA 4AN7A 1KTSB 2CGAA 1FIZA 1YC0A 2V3OH 3UR9A 1TRNA 3HPTB 3O8RA 2ZDNA 4I8HA 2FLRH 3S9AA 2XBYA 2BDIA 3GY3A 1SC8U 1BTHH 1O2NA 1ZR0A 1GJ5H 2GCTC 3MO9A 2BX3A 2ZF0H 3P95A 4FUDA 3FANA 4AYVB 3TK9A 1QRWA 4UEHH 1C1VH 1FZZA 1QR3E 2BOHB 2IPHA 4IN1A 4YM9A 1O5BB 3PM3A 1GI3A 3GCNA 1BJVA 2A4QA 1GBCA 3KL6A 1C2LA 4U32A 1EAUA 1CHGA 1O3PB 2FZZA 2VGCB 3ZZDA 2F9OA 4R8TB 2ZO3H 1SHHB 3SV8A 4FU9A 3EQ0H 2HALA 1YLDA 1SGEE 5GXPA 1C2MA 3PMHB 4XBBA 1CBWC 1GBEA 4NZLA 2EI7A 2PSXA 2RCEA 1O5CB 2GTBA 1VITG 1S83A 1D4PB 2G5VA 1V2TT 3FFGA 2PFEA 1UHBA 1F0SA 2W3IA 2BDAA 3T29A 5T6FA 3FAOA 1UK2A 2SNWA 4A7IB 1W14U 1BMAA 2ZFSA 1KDQB 4YO9A 4YZUA 3TH3H 4GAWA 3O8BA 4D8NA 2Z3EA 2ZFRH 1GCDA 4AFUA 1O2VA 3BEUA 1C1SA 9LPRA 1RJXB 4ZKNU 1CVWH 5JYIA 4JZFH 1FAKH 1NRQH 1ZPZA 5HGGA 4NFFA 4X1SU 4K69A 1VCQA 6GCHF 3FZZA 4MNXA 1GDNA 3M3TA 1T8OA 2D8WA 1AU8A 4FUGA 2NU0E 3ZZCA 4Y8ZA 1A0LA 4JMYA 4E7NA 4XBCA 1YGCH 1O5GH 1VJAU 3BIUH 1SLXB 1MCTA 3GY5A 1TIOA 3BTTE 5T6GA 5F8XA 1UCYE 3A86A 2ZC9H 2FOMB 1ZGVA 2SGDE 3Q77A 2R2MB 4DIIH 2ZDVH 1EZUC 1A5IA 5LPEA 4JYVH 1HJAB 1F5RA 2ZU4A 5DP8A 1HLTH 1GBAA 1UCYH 1LPGB 5LPFA 5FHTA 3M37A 3RXKA 1HXFH 2ZHDA 2IN2A 1XXFA 1HDTH 2OD3B 1O3HA 2OXSA 4WMEA 1V2VT 4Y10E 1O37A 1QY6A 1O2OA 1A5HA 3A7XA 3Q76A 4ZKRU 4ZHLU 4UONA 1QB9A 1ZGIA 2SNVA 1EOLA 1GHZA 4UD9H 3MTYA 1AO5A 1EUFA 3PWBA 1TE0A 1O5EH 2H2ZA 5FX6A 1LO6A 5L30H 1DWEH 1C9PA 3UY9A 1HAGE 2ZPRA 1D3DB 5FXLA 3A80A 3HGNA 2YOLA 4YOGA 5C1UA 2ZU1A 2BB4A 1EOJA 2TBSA 1UTJA 1KLIH 4D9RA 2GDDA 2GGVB 1CA0C 3V7TA 1TMBH 3PMBB 5DP7A 1AB9B 3NUMA 2G00A 2GDEH 5EXNA 1BMNH 3RXDA 1VITF 1ZZZA 1MTSA 3RDZA 2A4RA 1EPTB 4UFGH 5DP9A 1P2MA 2HOBA 1HAIH 1J8AA 1SLVB 2V6NA 2ZQ2A 4D7GA 3GY6A 5A09A 4ZKOU 1P9UA 1UTQA 2XXLA 3KHVA 4Y76A 3GDSA 3V3MA 1E37B 2OCVB 1W11U 2ZI2H 3RXHA 1SGDE 3SNAA 1LVBA 3ZVDA 2V3HH 3M61U 2ANWA 1L1NA 2FMJA 1O36A 2FTMA 4Q7XA 1O3NA 3RXSA 4BXWA 4A6LA 1A1RA 3SOSA 1DT2A 2Z94A 1AIXH 2ZFTA 4ABEA 1GMCG 6LPRA 2ZZUH 1P05A 3GYLB 2ZGXH 3U8TH 3UIRA 3U98H 1N1LA 1T8NA 1A0JA 1TX8A 3SJ9A 1C2EA 1DWCH 3LKWA 3RM2H 1O3KA 1GI6A 1QL8A 1AI8H 5DK1A 2H6MA 4JCNA 1C5PA 3SHAH 2C3SA 3H5CB 5G4BA 4QT8C 4UFDH 3BTEE 1BTUA 2TPIZ 1YYY1 3BTDE 4WVPE 2BOKA 4INHA 4CR5A 1O39A 5A8XA 5J4QA 5L2ZH 4ABIA 4ZH8A 1TBQH 1MKXH 4X6OA 5GJ4B 1QTFA 3F68H 1C2DA 1NO9H 2EI8A 2A7JA 1ZJDA 2K1QA 1ZPCA 1V2WT 1CGIE 2UUJB 4ZROA 3UUZA 1XUIA 2PKAA 4Q7YA 2GMTC 3AW1A 5DPAA 1P0SH 4KGAA 5T3HA 4R0IA 2A4GA 3ATLA 3SJKA 1BRCE 3ODDA 2VWNA 1O3EA 2XBVA 4WMDA 1P3EA 2JKHA 2HPQH 3AASA 2AFQB 3FZDA 1FN6A 1G32B 1ORFA 1SQOA 2QXIA 4X1RU 2F9PA 4K1EA 4CR9A 1EB1H 2ZHWH 2BD3A 1P9SA 5HYOA 1K21H 1GBKA 1XKBC 1MH0A 1YPKH 3GCHB 2GZ8A 2Y7XA 1VGCC 1Z7KA 3I77A 4Y8YA 3PTNA 2VIOA 4XOJA 1MD7A 1G36A 1AZ8A 1Y3UA 5JB8S 2A31A 5K7RA 4MNYA 4O3TA 1LKBA 3LGWA 2C8YB 1BRAA 3GDVA 2UUFB 5IYTA 1K1JA 1NN6A 3AAVA 1P2QA 1QQUA 3CENA 1M9UA 1EXFA 1BBRE 4B71A 5FBEA 4H4FA 1IOEA 2OLGA 1KLTA 3T62A 3P8NA 1TRMA 2O8MA 4CBOA 1B0FA 3EGKH 5CHAB 3NPSA 3BV9B 4AG2A 4XFQA 2FS8A 3RXLA 1J17T 3DHKH 2ZHEH 2CHAB 4TY6A 1TGSZ