3V0XA

Bovine trypsin variant x(tripleglu217phe227) in complex with small molecule inhibitor
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCVGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Bovine trypsin variants X(tripleGlu217Phe227) in complexes with small molecule inhibitor
rcsb
source organism Bos taurus
total genus 50
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v0xA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v0xA02
5FBIA 4BOHA 1GCTB 2Z3CA 5CHAC 1OPHB 1W2KH 1KXFA 1LHEH 3ZYDA 3M3TA 1N6YA 1TABE 2P3FH 3M5OA 1V2RT 2FTMA 4NG9H 1W7XH 2ZC9H 2XCNA 2GDDA 1C2KA 3STIA 4R0IA 4B76A 7LPRA 2BDCA 1YPMH 2HGTH 5L6NH 1JIRA 1VCWA 2SGDE 1ZJKA 3RU4D 1NT1A 1W10U 2FOFA 4ABAA 1A5HA 1LO6A 1C5RA 2A2XH 4I8JA 2ZQ1A 1HJ9A 2OC0A 3JZ2B 4FUJA 3RMMH 3GY2A 2P3TB 2ZKSA 1UTOA 2CN0H 2H5CA 1MZAA 9ESTA 3SZNA 1KTTB 5AFYH 5FX6A 1E36B 5LGOA 2BVRH 5HXFA 3RC4A 1FY8E 4FU9A 3LGIA 5JYIA 1GDUA 2UUFB 2ZTYA 1MQ5A 1SC8U 1V2OT 2FOHA 2IN2A 2BVSH 3BEFB 1CHOF 1F5KU 3NXPA 1AVGH 1EAWA 2EEKA 1MBQA 3BTEE 4A1VA 3ZZBA 2ZQ2A 6LPRA 4GHQA 2P95A 3GY4A 1KXBA 3MHWU 4GCHF 4HTCH 1GL1A 1TOCB 4ASHA 2PUXB 2GKVE 3DFLA 1C2MA 3BG4C 1OP0A 3FZDA 3M5NA 1OWIA 1C2DA 4FUHA 4D7GA 5JB9S 2A1DB 2GCHF 1P02A 2G52A 1D9IA 4JZDH 3I78A 2XW9A 1CE5A 3EA8A 1TPAE 2P8OC 1C2IA 2FEQH 2AYWA 3ODFA 1MCVA 2VH0A 3EYDA 3URDA 1K1NA 4O03A 2THFB 2KAIA 2ZU5A 3F9GA 1OYTH 5C1YA 4CRCA 1CT4E 4RN6A 1Y3XA 1K1LA 2RA0A 4KGAA 5E0GA 1CVWH 2STAE 3QGNB 2ZPSA 1ANBA 4WMEA 2PSYA 4DG4A 2VJ1A 5JBAS 1C5PA 1ZGIA 1A7SA 1KYNA 1LVOA 4INHA 1TBRH 3F9EA 3E0NB 3T25A 4BAMB 1B7XB 1AB9B 3MH5A 3MNCA 1O39A 3BIVH 5EW1H 1BDAA 4Q80A 3P6ZB 3ZZ5A 1O2XA 2ZCKP 3KEEA 1SQOA 3SO3A 3KGPA 5HM2A 3VPKA 2AGEX 4J2YB 2ZPQA 2BY9X 4E05H 1TNLA 1BZXE 2QCYA 5ESTE 2PUQH 2BQ6B 1C5NH 1C4V2 3LGWA 1O3IA 3RU4E 3Q77A 3SN8A 4XOJA 2QA9E 5A8YA 2BD5A 3T29A 4ABJA 1HIAB 1ZOMA 1T4UH 3NK8A 2BY5X 1G36A 3TJNA 1GMHF 1K1IA 1ZGVA 1AU8A 2ZU3A 5DP8A 3RP2A 2BX3A 4VGCC 2AEIH 5C5NA 2GX4A 4A1XA 1O2YA 3UY9A 1H9LB 2IOTA 2EI6A 1CHOG 4AFUA 2AH4X 4X6NA 1O33A 2JH6D 2FOCA 2XC0A 1MTSA 4ISLA 1WTGH 3MU5A 2QN5T 2QF0A 1XX9A 2ODPA 1P01A 2C8YB 3C27B 1AUTC 4Y8ZA 3NUMA 2BDAA 2ZEBA 1O2HA 1HXEH 1J16A 3SI4H 4K1EA 3RU4T 2YNAA 1HAIH 4AFZA 2AIQA 3DFJA 2GCHG 2UWOA 1HGTH 1FI8A 1MMJN 2NU3E 2ZA5A 1IQEA 1NFUA 3UQOA 3ATIA 1O2IA 1IQNA 1ZSJA 2P3UB 3HGPA 1G37A 3IG6B 1CBWC 1FIWA 2A4QA 1PPEE 3TITA 1T8LA 1TPOA 4MLFB 4AGKA 2GVFA 1P04A 1GI7B 1RIWB 1MAXA 3KQCA 3LGTA 3SNDA 1GGDB 1GHXH 3MO9A 3BTME 1Z8JB 1N1LA 4YZUA 1TGBA 2BOKA 2C90B 1NRNH 3VGCC 1SL3A 2HRVA 1FIZA 3E6PH 3AAVA 2ZGXH 2AIPA 2GV7A 1EB2A 1QQUA 1O3HA 2H2ZA 3JZ1B 1HAVA 4A7IB 1W13U 3CS0A 2V35A 4MNWA 1N8OC 1O3AA 3RXLA 1O3KA 3GCHB 3BEIB 3Q3KA 1P0SH 1YC0A 2ZFFH 3SJIA 1VITH 1KLJH 1EJNA 2CJIA 3S0NA 2PKAA 3FZZA 1QA7A 3BTKE 1GDQA 3MNXA 2ZDLA 3LIWA 5C20A 1KIGH 1G3CA 2Q6GA 2ZFRH 1GHYH 4WMFA 2BDIA 2XYAA 4X1QU 4XFQA 1ELCA 5AF9H 1K21H 1EZUC 4FUBA 2ZFQH 2UUKB 1A1RA 1DS2E 4MPVA 1GPZA 3PMHB 1C9TA 2EI7A 1Q31A 2HNTF 2A7JA 2BDBA 1SLWB 1WQSA 1C1RA 5TJXA 4F49A 5ESBA 1A5GH 3R3GB 4KKDA 3IWMA 2OP9A 1TLDA 3RUOA 1GMHG 1SLUB 4D9QA 1XUGA 4X1PU 1GJ5H 2VWLA 1GJ9B 1S0RA 5FCKA 1OP2A 2I6SA 2CF9H 4O3UA 1Z6JH 1YLCA 1HIAA 2H1UA 3FANA 5FHTA 2PTCE 1ZSLA 3FP6E 1EX3A 1ZMNA 3RXRA 4INKA 1GWAA 5JBTA 1GBTA 3U98H 4XBDA 3UUZA 2Z94A 1QIXB 5CE1A 3T5FH 2DE8A 1LTOA 2F9PA 2VIDA 3HKIB 3E0PB 3SV7A 3RXJA 2NU0E 1FAXA 2XC5A 1NRRH 4CRAA 1OWDA 2G81E 4SGAE 2Q1JA 2A5AA 3F9FA 1P2OA 1EZSC 1H8IH 2J2UA 5BPEA 3ITIA 4GUXA 4ABGA 2XBXA 3A7YA 3HKJB 3UOUA 1HJAC 3G01A 4ZAEA 3BV9B 1HNEE 1JBUH 1MTUA 1TE0A 2IJOB 1MU6B 1TNHA 3PB1E 1L2EA 3PYHA 3UFAA 1OYQA 2EC9H 2W3IA 3QGJA 5CMXH 4NSYA 3NZIA 1OX1A 3E91A 3VB5A 1XMNB 1ZJDA 3RXCA 1PPZA 1TIOA 3MI4A 1A2CH 1DY9A 2ANMH 4GLYA 2JETB 3QLPH 5J4SA 1OWEA 1O5AB 1AY6H 3UTUH 5DG6A 2W7SA 4FUFA 4B74A 3P8FA 3GY5A 1YPHC 2FOEA 1WV7H 3MNSA 1DWEH 1O3JA 1GHBG 2FS9A 3PLBA 1ZHPA 1PYTD 1SFIA 2A5IA 3RMLH 2WYJA 3A85A 5LPRA 3KCGH 5L2YH 1HLTH 5L2ZH 4YO9A 4NIYA 2OQ5A 1C5UA 3E3TA 1FY5A 3RLWH 3A7ZA 4BAHB 1BITA 1MTWA 1CA0C 1P05A 1BBRE 4CHAB 1TMTH 4ZROA 1YKTA 2WPKS 1GG6B 3TJOA 1JWTA 4MVNA 2TGAA 3TK9A 2FX6A 2BOHB 1OWHA 3A83A 1DT2A 1FN8A 1GVZA 2BD8A 1JRTA 2ZP0H 3L6PA 2PW8H 1K1MA 2B7DH 5F8TA 1JRSA 4CRBA 1ZHRA 4ZHMU 4E7NA 4PROA 2ZF0H 1GBCA 2ZHDA 4HFPB 4Y0ZE 3S9CA 3EDXB 1EP5A 2ZCHP 5EQSA 1C5ZB 2ZHFH 2HPPH 1NU9A 4JYTA 1O5DH 5GCHF 4X1SU 3WY8A 2ODQA 2P16A 1NC6A 3A89A 1BTYA 1LMWB 4THNH 1W7GH 5AVDA 1V2QT 1WUNH 1QRZA 1LVYA 1QB1A 2ZWLH 3R0FA 2BQ7B 5E2PA 4UONA 5A8ZA 1GI8B 1L1JA 2PGQB 2ZU4A 3OYPA 1ETTH 7GCHF 3EA9A 3HGNA 3S7HB 4YOIA 2Z7FE 1O2JA 4JZ1A 2D1JA 2GDEH 2NU1E 4GHTA 4DURA 1QRXA 2ANKH 5E0JA 2FI4E 2FXRA 1SB1H 4DW2U 1E34B 1O2OA 1SQTA 1BTZA 1BMMH 1SGYE 1TX8A 1VGCC 1WQVH 1O2LA 4IW4E 3DA9B 6CHAC 3UQVA 3PV4A 4YT6H 1F5LA 1KXEA 1SGTA 2Z9GA 1YBWA 2A0QB 3KL6A 4Y7AA 5E2OA 1WSSH 4A5TS 1GBEA 3EQ0H 4HZHA 3S7KB 1BIOA 1HCGA 2BZAA 3NWUA 1XM1A 2WPHS 5JBBS 1BMLA 2ZECA 4UDWH 4Y0YE 1BTXA 2G8TA 2GP9B 1TALA 1RTKA 2OC7A 1ESBA 5C5OA 1IQKA 1NU7B 1ARBA 3SNCA 1GI2A 4I8LA 3RM2H 1ELBA 1O38A 1UCYE 4E7RG 2SNVA 3V13A 1SBWA 2OLGA 8ESTE 1LHFH 1KXAA 2GZ8A 3A82A 3HATH 5EPNA 4D7FA 1LQDB 1OXGA 4DY7B 1SGQE 4B1TA 1RTLA 2FOGA 3A8CA 2HOBA 1YPHE 1PQ8A 1QBOA 1ETSH 3M5MA 4XE4A 4CRGA 1QBNA 3UWIA 1NM6A 4H6TA 5FCRA 4IMZA 2QYIA 1C5MD 1IQGA 3RMNH 1EPTB 1MKWK 5FPSA 2A4RA 3M37A 4K8BA 4YOJA 4CBNA 1NS3A 5C2ZA 1GBDA 1C2LA 1B0FA 4OS1A 1C2JA 2GD4B 2OTVA 2PR3A 2O8WA 1C5WB 2Y81A 4OS6A 4F4OC 1O5EH 2GV6A 4UE7H 4YOGA 1QB6A 2F91A 1PPBH 1EATA 2GMTB 1A61H 1W0ZU 4B2AA 4DIHH 1JXPA 1L1NA 1LQEA 1QJ6B 1PQ5A 1WOFA 4AN7A 1P2IA 4ZKOU 2O8LA 1EQ9A 3H5CB 2J38A 1FLEE 5DP6A 2XBWA 2ZU2A 5GCHG 1YPKH 2TRMA 2ZFPH 2ESTE 4HGCA 3UNQA 3L3TA 1AQ7A 3NKKA 4RKJB 3W95A 1AZ8A 2GGVB 1SVPA 2XWAA 3B23B 1DWBH 2FI5E 1GCDA 1IAUA 1SMFE 1LHGH 1DPOA 1QL7A 1DDJA 3BTTE 1UJ1A 2AMPA 1BTWA 1CA8B 1P57B 4OGYA 4OS2A 7GCHG 3PLPA 4IGDA 1T4VH 4ZMAH 1HAZB 3FP7E 1DWDH 1THPB 1DXWA 1O2QA 5JPMH 4MPUA 2UWPA 1TQ0B 2AMQA 2HPQH 3GYMA 1THSH 5EXMA 5EQRA 2C8ZB 1INCA 1VR1H 3Q76A 5DP9A 4NIXA 2QY0B 2VWOA 3MO6A 1HBTH 1BCUH 3RXSA 5AHGH 2Z6BD 2FP7B 2ZDMA 1Y3UA 1G30B 2A32A 4B71A 3E1XB 3HK3B 1GI0A 2YNBA 4A92A 4UFGH 3ELAH 2BDHA 4X2XA 1AB9C 4I32A 1F0RA 1XUJA 1GBAA 2IPHA 1ZLRA 1ESTA 3EE0B 4ISHH 2PLXA 3GDUA 5J4QA 1HFDA 3SOSA 1NZQH 2J94A 4DJZB 1NFWA 1A3BH 4D9RA 2XXLA 3UPEA 3VB3A 1PPHE 1TPSA 1GBJA 1QGFA 3KQEA 2BM2A 1ESAA 1FNIA 4AG2A 1BMNH 1TGTA 1O36A 1T8MA 5T3HA 3RXBA 2FX4A 1LCYA 4Y71A 4FUDA 5HGGA 3BG8A 1LHDH 1KDQB 3V0XA 2Z9KA 2ZDVH 4CRFA 3BTHE 1ANDA 5T6FA 3RDZA 3TU7H 4WJG2 3RXKA 2ALVA 1GJDB 2P93A 3RXIA 1CGHA 1O34A 3FP8E 3GYLB 1EPTA 1BRBE 1C5OH 1GHZA 1T8OA 1UHBB 4K3JA 3B9FH 1T32A 4WXIA 1PFXC 4BAQB 5K7RA 2NWNA 1AZZA 1EASA 5F8XA 4AZ2B 3ZYEA 5LPEA 1DOJA 2OUAA 4ABDA 1C1UH 4K5ZA 1IQLA 4FUIA 3SU5A 1GHVH 1CU1A 1ELDE 4WWYA 4BTTB 2ZGBH 2ZPRA 5FPTA 1ZTLA 1BRAA 1H9HE 2ZO3H 3M35A 1UTMA 2C93B 1WCZA 2VGCB 3URCA 2OINA 1BBRK 1AUJA 2XRCA 3D49H 3ZZ3A 1O2RA 3LOXA 5CHAB 1TBZH 1GI4A 2SFAA 2FOMB 1RIWC 1GGDC 4KTUA 3A7WA 1V3XA 3C1KA 1BTPA 2LNCA 1SHHB 3A80A 1S5SA 1HYLA 1S85A 3ATMA 5A09A 1EAIA 2O8UA 1ZR0A 1YP9A 2FS8A 3ZZ8A 5GIBA 2R0LA 1PJPA 1NROH 5C3NA 2W7UA 2TGDA 1G3BA 5HM9A 4OS4A 3QO6A 3LKWA 2O9QA 5E0HA 3LDXH 1DWCH 4LOYH 3TH2H 5AFZH 3LH1A 1RXPA 1ABJH 4UFEH 1AD8H 5FBEA 2ZGCA 5DP7A 3U8TH 1PQ7A 1ELTA 3K65B 3SNAA 1P2KA 1DUEA 1UTNA 2JH0D 4ZKNU 1NY22 3O8BA 3AW1A 2TPIZ 3QN7A 3VB4A 4I8HA 4IN2A 1SGRE 1SGIB 1Y5BT 3M5LA 2FPZA 5LPFA 2BD4A 1K9OE 2C4FH 2Z9JA 1P9SA 3GICB 2AMDA 1YLDA 1GJCB 1ZTKA 3DHKH 1JOUB 2QXHA 4R8TB 5C1XA 3LGVA 4LZ1H 4YESB 2A2QH 2EA3A 1MCTA 2PWXA 3RM0H 4K2YA 3UNSA 4X2YA 2VH6A 3BF6H 2R3YA 2O8MA 3QUMP 4GAWA 1SGFG 3BG4B 8GCHF 1V2JT 2K1QA 3SGAE 1XKBC 4GVUA 3QDZB 4HI3A 4MG3A 3RXTA 1QURH 1NFYA 3Q00A 1UCYK 4NIVA 2DUCA 4X1NU 4YTAA 2G5VA 1QJ1B 2P8OB 1Y3WA 2VWMA 1WU1A 4FXGH 1EB1H 1G2LA 3U8OH 2OC8A 5EGMA 1SGEE 3S69A 3W94A 3UIRA 2DE9A 1GVKB 2FMJA 3SU0A 3HK6B 3QWCH 8KME2 5DK1A 3HPTB 1MU8B 2NU4E 2FOBA 1ANCA 2ZGJA 1C2EA 1C2HA 3U8RH 1O3GA 4AOQA 4NSVA 4XSKU 1O0DH 1HDTH 1IQFA 5GXPA 1GJBB 4X0WU 2PGBB 4J1YA 5GPIB 3RXAA 1F5RA 2HNTC 5F8ZA 1BRUP 2VNTA 3ZVCA 3ZVEA 4LZ4B 2H9HA 5DP3A 1C9PA 1O2PA 1K1JA 4K69A 2F9NA 1RGQA 3LC3A 3SNEA 3UNRA 3FAOA 2Y5HA 9LPRA 1C2GA 1XUHA 1GHBF 3TNTA 1UTJA 2F3CE 1GMDF 2CV3A 1W12U 2JETC 1MQ6A 2G00A 1G2MA 4H6SB 1GBMA 4MDSA 4B2BA 3K6ZA 3P17H 1QL8A 3MU4A 4BTIB 4B2CA 1FY3A 1V2WT 1TOMH 1O3FA 1SGFA 1C5LH 3PO1C 1HV7A 1J8AA 2C8XB 4AB9A 1YCPK 1A0LA 3A8DA 4FVDA 3DUXH 3MH4A 3PROA 2TGTA 3T26A 1UK2A 4JMYA 4UEHH 3ZZAA 1UVUH 2SGPE 4VGCB 2XC4A 1SQAA 1ZSKA 3P95A 2G4UA 1E38B 1DITH 1FMGA 1Z71A 3O8DA 4CHAC 4FUCA 1AFEH 3F6UH 4NWKA 5FPYA 1WAYB 6ESTA 1GBBA 1MTNC 2BY6X 2J34A 1Z8GA 1Z8RA 2ANYA 3O8RA 2BTCE 8GCHG 4ESTE 2HWLB 1TNKA 1HJ8A 2QIQA 3Q3YA 2BD2A 5I46H 5IYTA 1W0YH 5PTPA 1IQHA 4Y11E 1HAXB 1GI5A 2I6QA 5E8EH 2ZTXA 3M7TA 1QB9A 3SORA 2BLVA 2C3SA 2SGEE 4DIIH 4Z6AH 1F0SA 1CBWB 5F6MA 3PM3A 2V6NA 4AFSA 3F68H 1O3NA 1O3PB 1QHRB 1K1PA 1UMAH 4WMDA 2VIPA 1YPGH 4CRDA 2XWBI 3GCNA 2FLBH 4NIWA 3RXHA 1GI3A 2ZDNA 1EZQA 2G4TA 4ZUHA 5T6DA 3ZV8A 3LJJA 1K1OA 1BJUA 4X2VA 3TK5A 1TRYA 3MO3A 2J92A 2A4OA 3VGCB 2F9UA 2R9PA 2OBQA 1H4WA 1BQYA 1KLTA 1MD7A 1DVAH 4UFFH 1K2I1 1IQMA 5G4BA 3EGKH 3LT3A 3MNBA 3ZZ4A 1YGCH 4K8YA 2GZ7A 1WBGB 1FUJA 3SU4A 2ZCLP 1TGSZ 1KXCA 4AX9H 1DM4B 1YYY1 2VU8E 1DFPA 3SUGA 3B8JA 4JYVH 1ELEE 2HNTE 2PKSB 4U2WA 3TGKE 1ZMJA 5DJ7A 3RXFA 4KELA 1TGCA 2GTBA 1ELFA 3A84A 2SGAA 1GMDG 1HB0B 3TJVA 3SI3H 1LPGB 1PYTC 2FODA 1C1VH 1S0QA 4Y8XA 4GPGA 1DICA 1XUIA 1GJ8B 1Y3VA 3M3SA 3MH7A 5EW2H 3ATLA 3F1SB 1ELAA 3OSYA 4NA8A 2V3OH 1C4Y2 1IQIA 1E35B 2J95A 2WPIS 3H7OA 1IHSH 4ZXYH 4TWYA 1MKXK 4I8GA 1F2SE 2C8WB 2FYQA 4AYYB 2QXJA 1Y5UT 3RXPA 1DLKB 1IOEA 3BEUA 2VVVA 1UTKA 3AASA 3TH4H 1ELVA 2ZNKH 1YCPM 1JMOH 1E37B 3QTOH 4H42U 4B73A 3TLOA 1VITG 2R2MB 2BMGB 3GCTG 3VXFH 1THRH 2B5TB 4MQAA 3RXGA 2GCTC 1Z6EA 1BT7A 1YPJH 1SPJA 1KXDA 1RS0A 1JIMA 2H6MA 2OC1A 4AFQA 3RXQA 5A2MH 5EXLA 5DP4A 4TWWA 1Y3YA 2FOAA 2ZI2H 1AIXH 3DD2H 4JZEH 2OBOA 1FJSA 1G3EA 3LJOA 1QNJA 2F9BH 2Z3EA 3SJ9A 2WV5A 1D3DB 4YT7H 1EJMA 2JKHA 3RXDA 2Y6TA 3SUFA 5F03A 2CHAB 2ODYB 2QV1A 4X6OA 1NPMA 2FI3E 1GL0E 3V12A 3KNXA 3S9BA 1RJXB 4AORA 1ZMLA 2STBE 3N7OA 1XXFA 1ETRH 1FQ3A 2VIWA 2BDGA 2D2DA 4ZH8A 3NPSA 1HJAB 2SGFE 1O2MA 2VIQA 2Y80A 3SJKA 1TAWA 1NFXA 4IC6A 3RC6A 1C1SA 1GVLA 2QAAA 3S9AA 4X8SH 1Q3XA 2OD3B 2A4GA 1ANEA 1GCTC 1SG8B 1TRNA 3A88A 1O32A 4ABHA 3OY5U 1K28D 2H9TH 3O8CA 4E06H 1P09A 2D26C 1TYNA 1QJ7B 2F9OA 2PTNA 1QCPA 1DLEA 4BNRA 1C1WH 1W11U 3MU0A 1D3TB 4IC5A 2XTTB 1SHYA 4JYUH 3KQBA 4Q7XA 1TGNA 3LGUA 1O31A 3ZVDA 2FLRH 3UR9A 1TX6A 3PTNA 1BHXB 3K6YA 3SGQE 4O97A 2XCFA 5DPAA 1CSOE 4QT8C 4D76A 2Z9LA 1ZPZA 4O9VA 3GCOA 1O5BB 5FX5A 3AW0A 3MTYA 5JBCS 2Z9IA 1OOKB 1A4WH 4XBBA 2ANWA 2BVXH 1SOTA 1TQ7B 1G9IE 2XBYA 2ALPA 1GBLA 1AHTH 2OXSA 1O2SA 1P10A 2FWWA 1Q2WA 1P06A 2A45B 1AKSB 1SSXA 1V2ST 2WPLS 4BXSA 3TGIE 1C1QA 5EQQA 4ZXXH 1AFQB 4IS5A 1QFKH 1C1PA 1OS8A 5T6GA 1CGIE 4ABFA 4DVAU 8LPRA 1ZHMA 1MAYA 1TFXA 2OQUA 1SLVB 3ZZDA 1BUIA 4NZLA 2F83A 1HAGE 3EAJA 4MPWA 1O2ZA 1UVPA 5EPYA 1HAOH 1LHCH 1MZDA 2BD3A 1OSSA 2YOLA 1C5SA 3ODDA 4K60A 4TPYA 1GMCG 2A7HA 4FVBA 2R3UA 2BB4A 2ZFTA 4NGAH 1FAKH 4JZFH 1HUTH 1ZPBA 1QA0A 1C1OA 1TB6H 1X7AC 1UK4A 3EA7A 4INLA 1DSUA 2LPRA 3SU2A 1V2LT 1DE7H 2VINA 4BXWA 2Y82A 3PTBA 1QQ4A 1C4U2 2FTLE 1O3BA 1S83A 1HAPH 3M36A 4X6MA 4X2WA 1Z1IA 1VGCB 1H1BA 1O5FH 4FUEA 2VB0A 5EXNA 6CHAB 2R0KA 1AWFH 1NESE 2W26A 3AVZA 2AS9A 4X8VH 2QF3A 1O2GH 1C1NA 2W5EA 5JB8S 1D3PB 1GDNA 2EI8A 1DX5M 1F0TA 1SGPE 5HMAA 3ZZ6A 4LK4A 3UR6A 4D8NA 2RCEA 3CENA 2TIOA 3OU0A 3P8OA 4NA9H 3SGBE 2A5KA 1PPFE 2V0BA 2FIRH 3KIDU 3ZVGA 3H7TA 2PV9B 3BTFE 3SNBA 3P8GA 4YLQH 3KF2A 2GT8A 2BY7X 2BLOA 3GDVA 1ZZZA 4Y8YA 2TBSA 5L30H 3SV9A 4TY6A 5B6OA 2QXIA 3LU9B 3BIUH 1FY1A 1LVBA 1BMAA 1FPCH 2ZZUH 4ISNA 3ZVAA 1DANH 1SFQB 3MU1A 2ULLA 1D6RA 5DGJA 2FO9A 1RFNA 2CXVA 3M61U 1G3DA 3OY6U 7KMEH 3ZVFA 1AGJA 1IHTH 1SOZA 1V2UT 1AI8H 2BZ6H 2XBVA 3RXVA 1Z7KA 1AKSA 3BTGE 4KTCA 1P3EA 3A86A 4AB8A 2ZIQH 3RXMA 2VIVA 1P2QA 4U30A 4TYDA 3GISB 4X8TH 1TA2A 2AGIX 3SHAH 3E90B 1ZPCA 1ZRKA 3NCLA 3FVFB 2H5DA 1A3EH 2BD7A 1MKWH 4Z0KA 1P2NA 2ILNA 3TPIZ 3ZZ9A 5EU8A 2H9EH 1MTVA 1HAVB 4ZHLU 1FZZA 1FONA 2TGPZ 5DO4H 1GJ6A 1UTLM 4ISIH 1MUEB 3P8NA 3GY7A 3QZRA 2PKAB 3P70B 2BY8X 4MPXA 2JH5D 2HLCA 2AGGX 2HALA 1ORFA 1SGDE 4KTSA 5GDSH 2BDYA 1BA8B 4CH8B 1W8BH 1BJVA 2BYAX 3GCHC 2ZHQH 1TPPA 1ELGA 3GY3A 1SLXB 2B9LA 4ZKRU 5GJ4B 2VWNA 1ZRBA 2Y7XA 4O3TA 3ZVBA 1V2TT 4I33A 3MWIU 2J4IA 3QX5H 1S84A 1VJAU 1XVMA 1FXYA 1MH0A 1T8NA 2FM2A 1VZQH 5K0HA 1KTSB 1Z8IB 3Q3XA 3U1IB 4A6LA 2BX4A 1ACBE 4CH2B 2A7CA 4ABIA 3SW2B 2ZGHA 3K2UA 1RRKA 2VVCA 3MYWA 1FN6A 1O3LA 4YM9A 1YF4A 3CS7A 3A7VA 1AVWA 3ESTA 1D4PB 3AAUA 1VCPA 5A0AE 2UUJB 4DGJA 1BB0B 1H9IE 1EZXC 4MNYA 1FY4A 4NFEA 1S82A 3ENSB 4ABEA 1UTQA 1PPGE 4FUGA 1BTHH 2ZHEH 3IITA 2PSXA 1KDQA 4WF8A 1V2VT 2M5TA 1T31A 2FESH 1YM0A 1LDTT 4LXBH 2QGRA 4ZHAA 5A0CA 3K9XB 4GCHG 1EAUA 4B75A 1CT2E 1PPCE 1L4DA 1UHBA 1HRTH 1J9CH 1O3DA 3MH6A 3U69H 6GCHF 1TONA 4RKOB 4K1TA 1P11E 5EODA 1G32B 4CR5A 5A8XA 1T7CA 3TJUA 4IBLH 4JZIA 1TX7A 1AWHB 2ZDKA 4Y76A 2QC2A 2BXUH 1K22H 1QL9A 1O37A 3LC5A 1KLIH 1Y8TA 3VFEA 3RXEA 4DOQA 1O3EA 1O3CA 3RLYH 1GHAF 3MFJA 3DT0H 5TCAA 1YPEH 4NWLA 2F9VA 2O8TA 3SV8A 2BQWB 2Q6FA 1LPZB 1CT0E 1P3CA 4CR9A 2HVXA 3LPRA 1CHGA 4DT7B 2PKSC 1AO5A 1P9UA 1S6HA 4Y79A 5TCCA 3ZZCA 3RXUA 1CQQA 1DSTA 5JDUB 1NO9H 1NRSH 1TMUH 2R2WU 3V3MA 5LH8A 1BBRH 4FU7A 1OKXA 2WYGA 1GHWH 4WVPE 3SBKA 2RG3A 4H4FA 2RDLA 1VITF 1B5GH 1O2WA 3LONA 3P92A 3FFGA 4MNVA 3TH3H 3GCTF 3U9AH 3VB6A 4WH6A 3T2NA 3MMGA 1B0EA 1O30A 1GBKA 1C1TA 1GJ7B 3MOCA 1GG6C 4ZKSU 1TRMA 2FDAA 1M9UA 5H4IB 1AMHA 3RC5A 3ATWA 1DY8A 3PMAB 1FDPA 1QBVH 3M7QA 2P59A 4KP0A 1A5IA 3BTDE 1AVXA 1S6FA 3D23A 4IMQA 4NFFA 3BTWE 1CO7E 3A8AA 4Y10E 1RTFB 5FXLA 1GJ4H 4MTBA 2UWLA 3D62A 1GBHA 3GY6A 1ARCA 1LKBA 4IN1A 3VXEH 2Y5GA 1D3QB 1HPGA 2WPMS 5C67A 1NRQH 1XUKA 1SGCA 1UO6A 2CMYA 1TBQH 4OGXA 2CHAC 2B8OH 1C1MA 1TA6A 1EOLA 3M7UA 6GCHG 5EG4A 1E0FD 4NCYA 1FV9A 3QK1A 1OWJA 4YLUA 1IQJA 2WV4A 3SU6A 1ID5H 4XBCA 1A0HB 1UTPA 1S81A 1DUAA 1W3CA 1NRPH 4RSPA 1OWKA 1F0UA 1EUFA 1N8OB 3A87A 1C5VA 2V3HH 4BTUB 2WUBA 5C1UA 2WUCA 3UOPA 2Q6DA 4UD9H 3BSQA 1GHAG 2ZHWH 4CREA 1UCYH 1ABIH 1EP6A 1TNJA 2SGQE 4GSOA 3F9HA 2CF8H 1O2VA 1H8DH 1EJAA 1O2NA 3KHVA 1EOJA 1XUFA 5A0BA 1C5XB 2BD9A 1XVOA 3PO1B 2PHBA 3A7XA 5I25A 1J14A 2PFEA 1MD8A 3U1JB 4OS7A 5BRRE 2Y7ZA 1WYKA 2RA3A 2A31A 1J15A 1P2MA 1P2JA 2OCVB 5DP5A 2ASUB 1Z1JA 2VIOA 3PLKA 3STJA 2ZG0H 5HYOA 4X8UH 1EPTC 1O5CB 2BLQA 1C5QA 1GI1A 1MBMA 4A1TA 4Q7YA 1LPKB 1AE8H 1XXDA 3SU3A 1KSNA 2GZ9A 1RD3B 1MTNB 1DXPA 1NN6A 1ZTJA 2GMTC 3SJOA 2ZDAH 1J17T 2VVUA 5FAHA 1O2TA 3T27A 3ATKA 1V2KT 5DKMA 1N6XA 1P03A 4MNXA 2D8WA 3L33A 2XNIA 1AFQC 3TGJE 1GMCF 1BHXF 4JCNA 1F92A 2FYRA 3TIUA 3GY8A 1YCPH 1AN1E 1UVSH 3LGYA 1UVTH 1P12E 3PMBB 4AYVB 3QZQA 2G5NA 1QR3E 3SHCH 4X6PA 1C5YB 1GJAB 1VCQA 1LKAA 2G55A 2GT7A 3I77A 3PWCA 1TNGA 4TPIZ 3UREA 4BANB 2FZZA 3SQHE 2QXGA 3UWJH 5ETXA 1HXFH 1WTHD 2UUYA 1V2MT 3MU8A 5IDKA 4WH8A 1LVMA 3A7TA 4AG1A 1O5GH 4SGBE 3SUDA 1D6WA 1EKBB 3LH3A 5GWZA 2P94A 1CGJE 1UK3A 2WPJS 2Y5FA 4I7YH 3A81A 3D65E 2W3KA 1UVOA 1AE5A 3ZV9A 1EAXA 4BAOB 1QTFA 1VJ9U 1TNIA 3SJ8A 1V6DA 2B0FA 3V7TA 2SNWA 1TMBH 4K1SA 4X1RU 4ISOA 1GBFA 1F7ZA 4NA7A 3RMOH 4M7GA 3I29A 4JK5A 3VEQB 1FPHH 1O3MA 2ZU1A 4JK6A 1U6QA 1OP8A 3SV6A 4WY3A 1KY9A 1EXFA 2WINI 4I31A 4UFDH 2J9NA 1C5TA 1O2KA 1BOQA 4CBOA 2BLWA 1V2NT 1CA0B 3RXOA 4Y7BA 4NZQA 4U01A 7ESTE 3SUEA 1GI6A 1W14U 4XDEA 1ZYOA 2BHGA 3BTQE 3KN2A 4I8KA 4Q7ZA 2ZTZA 5EOKA 5SGAE 2Z3DA 1L0ZA 1TWXB 3SQEE 3CP7A 2BXTH 1GBIA 1HAHH 2GCTB 3T28A 1L4ZA 1PQAA 1Y5AT 4ABBA 1O2UA 2NU2E 1A0JA 1O3OA 4DCDA 1SR5C 3OTJE 3TVJB 1SGNE 2AFQB 4U32A 1V2PT 3SU1A 4WXVA 1QRWA 1P8VC 3GOVB 1SI5H 2KAIB 3T62A 2G51A 3QTVH 1C2FA 3VB7A 3BN9A 4FU8A 3TNSA 1L1GA 1BRCE 2AERH 3SV2H 3E8LA 3ZZ7A 3PWBA 4OS5A 3GDSA 3A8BA 3OX7U 1A46H 2ZFSA 1MKXH 3PMJA 3M3VA 4AGJA 4Y6DA 1BTUA 3TK6A 5ABWA 3KQDA 3E16B 2VGCC 1HAYB 4TY7A 1YPLH 4BAKB 4Q2KA 1O35A 1NTPA 2CGAA 1XKAC 1Y59T 1GI9B 1QY6A
chains in the Genus database with same CATH superfamily
5FBIA 4BOHA 1GCTB 2Z3CA 5CHAC 1OPHB 1W2KH 1KXFA 1LHEH 3ZYDA 3M3TA 1N6YA 1TABE 2P3FH 3M5OA 1V2RT 2FTMA 4NG9H 1W7XH 2ZC9H 2XCNA 2OK5A 2GDDA 1C2KA 3STIA 4R0IA 3OTPA 4B76A 7LPRA 2BDCA 1YPMH 2HGTH 5L6NH 1JIRA 1VCWA 2SGDE 1ZJKA 1FX0B 3RU4D 1NT1A 1W10U 2FOFA 4ABAA 1A5HA 2JIZD 1LO6A 1C5RA 2A2XH 4I8JA 2ZQ1A 1HJ9A 2OC0A 3JZ2B 4FUJA 3RMMH 3GY2A 2P3TB 2ZKSA 1UTOA 2CN0H 2H5CA 1MZAA 9ESTA 3SZNA 1KTTB 5AFYH 5FX6A 1E36B 5LGOA 2BVRH 5HXFA 3RC4A 1FY8E 4FU9A 3LGIA 3OFND 5JYIA 1GDUA 2UUFB 2ZTYA 3F2HA 1MQ5A 1SC8U 1V2OT 2FOHA 2IN2A 2BVSH 3BEFB 1CHOF 1F5KU 3NXPA 1AVGH 1EAWA 2EEKA 1MBQA 3BTEE 4A1VA 3ZZBA 2ZQ2A 6LPRA 4GHQA 2P95A 3GY4A 1KXBA 3MHWU 4GCHF 4HTCH 3CNRA 1GL1A 1TOCB 4ASHA 3KYGA 2PUXB 2GKVE 1MABB 3DFLA 2WSSD 1C2MA 3BG4C 1OP0A 3FZDA 3M5NA 1OWIA 1C2DA 4FUHA 4D7GA 5JB9S 2A1DB 2GCHF 1P02A 2G52A 1D9IA 4JZDH 3I78A 1E1RD 2XW9A 1CE5A 3EA8A 3F2GA 1TPAE 2P8OC 1C2IA 2FEQH 2AYWA 3ODFA 1MCVA 2VH0A 3EYDA 3URDA 1K1NA 2W6ID 4O03A 2THFB 2M2AA 2KAIA 2ZU5A 3F9GA 1OYTH 5C1YA 4CRCA 1CT4E 4RN6A 1Y3XA 1K1LA 2RA0A 4KGAA 5E0GA 1CVWH 2STAE 3QGNB 2ZPSA 1ANBA 4WMEA 2PSYA 4DG4A 2VJ1A 5JBAS 1C5PA 1ZGIA 1A7SA 1KYNA 1LVOA 4INHA 1TBRH 3F9EA 3E0NB 2CK3D 3T25A 4BAMB 1B7XB 1AB9B 3MH5A 3MNCA 1O39A 3BIVH 5EW1H 1BDAA 4Q80A 3P6ZB 3ZZ5A 1O2XA 2ZCKP 3KEEA 1SQOA 3SO3A 3KGPA 5HM2A 3VPKA 2AGEX 4J2YB 2ZPQA 2BY9X 4E05H 1TNLA 1BZXE 3DSOA 2QCYA 5ESTE 2PUQH 2BQ6B 1C5NH 1C4V2 3LGWA 1O3IA 3RU4E 3Q77A 3SN8A 4XOJA 2QA9E 5A8YA 2BD5A 3T29A 4ABJA 1HIAB 1ZOMA 1T4UH 3NK8A 2BY5X 1G36A 3TJNA 1GMHF 1K1IA 1ZGVA 1AU8A 2ZU3A 5DP8A 3RP2A 2BX3A 4VGCC 2AEIH 5C5NA 2GX4A 4A1XA 1O2YA 3UY9A 1H9LB 2IOTA 2EI6A 1CHOG 4AFUA 2AH4X 4X6NA 1O33A 2JH6D 2FOCA 2XC0A 1MTSA 4ISLA 1WTGH 3MU5A 2QN5T 2QF0A 1XX9A 2ODPA 3DCLA 1P01A 2C8YB 3C27B 1AUTC 4Y8ZA 3NUMA 2BDAA 2ZEBA 1O2HA 1HXEH 1J16A 3SI4H 2J97A 4K1EA 3RU4T 4ZCNA 2YNAA 1HAIH 4AFZA 2AIQA 3DFJA 2GCHG 2UWOA 1HGTH 1FI8A 3W1EA 1MMJN 2NU3E 2ZA5A 1IQEA 1NFUA 3UQOA 3ATIA 1O2IA 1IQNA 1ZSJA 2P3UB 3HGPA 1G37A 3IG6B 1CBWC 1FIWA 2A4QA 1PPEE 3TITA 1T8LA 1TPOA 4MLFB 5KEDA 4AGKA 2GVFA 1P04A 1GI7B 1RIWB 1MAXA 3KQCA 3LGTA 3SNDA 1GGDB 1GHXH 3MO9A 3BTME 1Z8JB 1N1LA 4YZUA 1TGBA 2BOKA 2C90B 1NRNH 3VGCC 1SL3A 2HRVA 1FIZA 3E6PH 3AAVA 2ZGXH 2AIPA 2GV7A 1EB2A 1QQUA 1O3HA 2H2ZA 3JZ1B 1W0JD 1HAVA 4A7IB 1W13U 3CS0A 2V35A 2XNDD 4MNWA 1N8OC 1O3AA 3RXLA 1O3KA 3GCHB 3BEIB 3Q3KA 1P0SH 1YC0A 2ZFFH 3SJIA 2KCPA 1VITH 1KLJH 4RT0A 1EJNA 2CJIA 3S0NA 2PKAA 3FZZA 1QA7A 3BTKE 1GDQA 3MNXA 2ZDLA 3LIWA 5C20A 1KIGH 1G3CA 2Q6GA 2ZFRH 1GHYH 4WMFA 2BDIA 2XYAA 4X1QU 4XFQA 1ELCA 2JJ2D 5AF9H 3WWFA 1K21H 1EZUC 4FUBA 2ZFQH 4AC9A 2UUKB 1A1RA 1DS2E 4MPVA 1GPZA 3PMHB 1C9TA 2EI7A 1Q31A 2HNTF 2A7JA 2BDBA 1SLWB 1WQSA 1C1RA 5TJXA 4F49A 5ESBA 1A5GH 3R3GB 4KKDA 3IWMA 2IJD1 2OP9A 2V3MA 1TLDA 3RUOA 1GMHG 1SLUB 4D9QA 1XUGA 4X1PU 1GJ5H 2VWLA 1GJ9B 1S0RA 5FCKA 1OP2A 4TSFD 2I6SA 4RI0A 2CF9H 4O3UA 1Z6JH 1YLCA 1HIAA 2H1UA 3FANA 5FHTA 3MQKC 2PTCE 1ZSLA 3FP6E 1EX3A 1ZMNA 3RXRA 4INKA 2LELA 1GWAA 5JBTA 1GBTA 3U98H 4XBDA 3UUZA 2Z94A 1QIXB 5CE1A 3T5FH 2DE8A 1LTOA 2F9PA 2VIDA 3HKIB 3E0PB 3SV7A 3RXJA 2NU0E 1FAXA 2XC5A 1NRRH 4CRAA 1OWDA 2G81E 4SGAE 2Q1JA 2A5AA 3F9FA 1P2OA 1EZSC 1H8IH 2J2UA 5BPEA 2KR7A 3ITIA 4GUXA 4ABGA 2XBXA 3A7YA 3HKJB 3UOUA 1HJAC 3G01A 4ZAEA 4F55A 2XOKD 3BV9B 1HNEE 1JBUH 1MTUA 1TE0A 2IJOB 2RDEA 1MU6B 1TNHA 3PB1E 1L2EA 3PYHA 3UFAA 1OYQA 2EC9H 2W3IA 3QGJA 5CMXH 4FOUC 4NSYA 3NZIA 1OX1A 3E91A 3VB5A 1XMNB 1ZJDA 3RXCA 1PPZA 1TIOA 4ASUD 3MI4A 1A2CH 1DY9A 2ANMH 2KCOA 2JETB 4GLYA 3QLPH 5J4SA 1OWEA 1O5AB 1AY6H 3UTUH 5DG6A 2W7SA 4FUFA 4B74A 3P8FA 3GY5A 1YPHC 2FOEA 1WV7H 3MNSA 1DWEH 1O3JA 1GHBG 1E79D 2FS9A 3PLBA 1ZHPA 1PYTD 1SFIA 2A5IA 3FN8A 3RMLH 2WYJA 3A85A 5LPRA 3KCGH 1SQRA 5B6LA 1K0HA 5L2YH 1HLTH 5L2ZH 4YO9A 4NIYA 2OQ5A 1C5UA 3E3TA 1FY5A 3RLWH 3A7ZA 4BAHB 1BITA 1MTWA 1CA0C 1P05A 1BBRE 3H09A 4CHAB 1TMTH 4ZROA 1YKTA 4B6EA 2WPKS 1GG6B 3TJOA 1JWTA 4MVNA 2TGAA 3TK9A 2FX6A 2BOHB 1OWHA 3A83A 1DT2A 1FN8A 1GVZA 2BD8A 1JRTA 2ZP0H 3L6PA 2PW8H 1K1MA 2B7DH 5F8TA 4FETA 4M9FA 1JRSA 4CRBA 1ZHRA 4ZHMU 4E7NA 4PROA 5DSFA 2ZF0H 1GBCA 2ZHDA 4HFPB 4Y0ZE 3S9CA 3EDXB 1EP5A 2ZCHP 5EQSA 1C5ZB 2ZHFH 2HPPH 1NU9A 4JYTA 3DSGA 1O5DH 5GCHF 4X1SU 3WY8A 2ODQA 2P16A 1NC6A 3A89A 1BTYA 1LMWB 4THNH 1W7GH 5AVDA 1V2QT 1WUNH 1QRZA 1LVYA 1QB1A 2ZWLH 3R0FA 2BQ7B 5E2PA 4UONA 5A8ZA 1GI8B 1L1JA 2PGQB 2ZU4A 3OYPA 1ETTH 7GCHF 3EA9A 3HGNA 3S7HB 4YOIA 2Z7FE 1O2JA 4JZ1A 2D1JA 2GDEH 2NU1E 4GHTA 4DURA 1QRXA 2ANKH 5E0JA 2FI4E 2FXRA 1SB1H 4DW2U 1E34B 1O2OA 1SQTA 1BTZA 4I86A 1BMMH 1SGYE 1TX8A 1VGCC 1WQVH 1O2LA 4IW4E 3DA9B 6CHAC 3UQVA 3PV4A 4YT6H 1F5LA 1WXRA 1KXEA 1SGTA 2Z9GA 1YBWA 2A0QB 2J98B 3KL6A 4Y7AA 5E2OA 5HKKD 1WSSH 4A5TS 1GBEA 3EQ0H 4HZHA 3S7KB 1BIOA 1HCGA 2BZAA 3NWUA 1XM1A 2WPHS 5JBBS 1BMLA 2ZECA 4UDWH 4Y0YE 1BTXA 2G8TA 2GP9B 1TALA 1RTKA 2OC7A 3FO8D 1ESBA 5C5OA 1IQKA 1NU7B 1ARBA 3SNCA 1GI2A 4I8LA 3RM2H 1ELBA 1O38A 1UCYE 4E7RG 2SNVA 3V13A 1SBWA 2OLGA 8ESTE 1LHFH 1KXAA 2GZ8A 3A82A 3HATH 5EPNA 4D7FA 1LQDB 1OXGA 4DY7B 1SGQE 4B1TA 1RTLA 2FOGA 3A8CA 2HOBA 1YPHE 1PQ8A 1QBOA 1ETSH 3M5MA 4XE4A 4CRGA 1QBNA 3UWIA 1NM6A 4H6TA 5FCRA 4IMZA 2QYIA 1C5MD 2KZ4A 4DT4A 1IQGA 3RMNH 1EPTB 1MKWK 5FPSA 2A4RA 3M37A 4K8BA 4YOJA 4CBNA 1NS3A 5C2ZA 1GBDA 1C2LA 1B0FA 4OS1A 1C2JA 2GD4B 2OTVA 2PR3A 2O8WA 1C5WB 2Y81A 4OS6A 4F4OC 1O5EH 2GV6A 4UE7H 4YOGA 1QB6A 2F91A 1PPBH 1EATA 2GMTB 1A61H 1W0ZU 4B2AA 4B6FA 4DIHH 1JXPA 1L1NA 1LQEA 1QJ6B 1PQ5A 1WOFA 4AN7A 1P2IA 4ZKOU 2O8LA 1EQ9A 3H5CB 2J38A 1FLEE 5DP6A 2XBWA 2ZU2A 5GCHG 1YPKH 2TRMA 2ZFPH 2ESTE 4HGCA 3UNQA 3L3TA 1AQ7A 3NKKA 4RKJB 3W95A 1AZ8A 2GGVB 1SVPA 2XWAA 3B23B 1DWBH 2FI5E 1GCDA 1IAUA 1SMFE 1LHGH 1DPOA 1QL7A 1DDJA 3BTTE 1UJ1A 2AMPA 1BTWA 1CA8B 1P57B 1NBME 4OGYA 4OS2A 3PLPA 7GCHG 4IGDA 1T4VH 4ZMAH 1HAZB 3FP7E 1DWDH 1THPB 1DXWA 1O2QA 5JPMH 4MPUA 2UWPA 5HIYA 1TQ0B 2AMQA 2HPQH 3GYMA 1THSH 5EXMA 5EQRA 2C8ZB 2KFWA 1INCA 1VR1H 3Q76A 5DP9A 4NIXA 2QY0B 2VWOA 3F2FA 3MO6A 1HBTH 1BCUH 3RXSA 5AHGH 2Z6BD 2FP7B 2ZDMA 1Y3UA 1WDIA 1G30B 2A32A 4B71A 3E1XB 3HK3B 1GI0A 2YNBA 3FOAA 4A92A 1YLNA 4UFGH 5EJ1A 3ELAH 2BDHA 4X2XA 1AB9C 4I32A 1F0RA 1XUJA 1GBAA 2JJ1D 2IPHA 2J98A 1ZLRA 1ESTA 3EE0B 4ISHH 2PLXA 3GDUA 5J4QA 1HFDA 3SOSA 1NZQH 2J94A 4DJZB 1NFWA 1A3BH 4D9RA 2XXLA 3UPEA 3VB3A 1PPHE 1TPSA 1GBJA 1QGFA 3KQEA 2BM2A 1ESAA 1FNIA 4AG2A 3OEED 1BMNH 1TGTA 1O36A 4HG6A 1T8MA 5T3HA 3RXBA 2FX4A 1LCYA 4Y71A 4FUDA 5HGGA 3BG8A 1LHDH 1KDQB 3V0XA 2Z9KA 2ZDVH 4CRFA 3BTHE 1ANDA 5T6FA 3RDZA 3TU7H 4WJG2 3RXKA 2ALVA 1GJDB 2P93A 3RXIA 1CGHA 1O34A 3FP8E 3GYLB 1EPTA 1BRBE 1C5OH 1GHZA 1T8OA 1UHBB 4K3JA 3B9FH 1T32A 1COWD 4WXIA 1PFXC 4BAQB 5K7RA 2NWNA 1AZZA 1EASA 5F8XA 4AZ2B 3ZYEA 3KYFA 5LPEA 1DOJA 2OUAA 4ABDA 5DN6D 1C1UH 2L74A 4K5ZA 1IQLA 4FUIA 3SU5A 1GHVH 1CU1A 1ELDE 4WWYA 4BTTB 2ZGBH 2ZPRA 5FPTA 1ZTLA 1BRAA 1H9HE 2ZO3H 3M35A 1UTMA 2C93B 1WCZA 2VGCB 3URCA 2OINA 4YXWD 1BBRK 1AUJA 2XRCA 3D49H 3ZZ3A 1O2RA 3LOXA 5CHAB 1TBZH 1GI4A 2SFAA 2FOMB 1VKYA 1RIWC 1GGDC 2RFKC 4KTUA 3A7WA 1V3XA 3C1KA 1BTPA 2LNCA 1SHHB 3A80A 1S5SA 1HYLA 1S85A 3ATMA 5A09A 1EAIA 2O8UA 1ZR0A 2F43B 1YP9A 2FS8A 3ZZ8A 5GIBA 2R0LA 1PJPA 1NROH 5C3NA 2W7UA 2TGDA 1G3BA 5HM9A 4OS4A 3QO6A 3LKWA 2O9QA 5E0HA 3LDXH 1DWCH 4LOYH 3TH2H 5AFZH 3LH1A 1RXPA 3ZIAD 1ABJH 4UFEH 1AD8H 5FBEA 2ZGCA 5DP7A 3U8TH 3UAIC 1PQ7A 1ELTA 3K65B 3SNAA 1P2KA 1DUEA 1UTNA 2JH0D 4ZKNU 1NY22 3O8BA 2F4LA 2TPIZ 3AW1A 3QN7A 3VB4A 4I8HA 4IN2A 1SGRE 1SGIB 1Y5BT 3M5LA 2FPZA 5LPFA 2BD4A 1K9OE 2C4FH 2Z9JA 1P9SA 3GICB 2AMDA 1YLDA 1GJCB 1ZTKA 3DHKH 1JOUB 2QXHA 4R8TB 5C1XA 3LGVA 4LZ1H 4YESB 2A2QH 2EA3A 2AHME 1MCTA 2PWXA 3RM0H 4K2YA 3UNSA 4X2YA 2VH6A 3BF6H 2R3YA 2O8MA 3QUMP 4GAWA 5FL7D 1SGFG 3BG4B 8GCHF 1V2JT 2K1QA 3SGAE 1XKBC 4GVUA 3QDZB 4HI3A 4MG3A 3RXTA 1QURH 1NFYA 3N7DA 3Q00A 1UCYK 4NIVA 2DUCA 4X1NU 4YTAA 2G5VA 1QJ1B 2P8OB 1Y3WA 2VWMA 1WU1A 4FXGH 1EB1H 1G2LA 3U8OH 2OC8A 5EGMA 1SGEE 3S69A 3W94A 3UIRA 2DE9A 1GVKB 2FMJA 3SU0A 3HK6B 3QWCH 8KME2 5DK1A 3HPTB 1MU8B 2NU4E 2FOBA 1ANCA 2ZGJA 1C2EA 1C2HA 3U8RH 1O3GA 4AOQA 4NSVA 4XSKU 1O0DH 1HDTH 1IQFA 5GXPA 1GJBB 4X0WU 2PGBB 4J1YA 2EQNA 5GPIB 3RXAA 1F5RA 2HNTC 5F8ZA 1BRUP 2VNTA 3ZVCA 3ZVEA 4LZ4B 2H9HA 5DP3A 1C9PA 1O2PA 1K1JA 4K69A 2F9NA 1RGQA 3LC3A 3SNEA 3UNRA 3FAOA 2Y5HA 9LPRA 1C2GA 1XUHA 1GHBF 3TNTA 1UTJA 2F3CE 1GMDF 2CV3A 1W12U 2JETC 1MQ6A 2G00A 1G2MA 4H6SB 1GBMA 4MDSA 4B2BA 3K6ZA 2V7QD 3P17H 1QL8A 3MU4A 4BTIB 4B2CA 1FY3A 1V2WT 2K0QA 2GJGA 1TOMH 1H8HD 1O3FA 1SGFA 1C5LH 3PO1C 1HV7A 1E1QD 1J8AA 2C8XB 4XRNA 4AB9A 1YCPK 1A0LA 3A8DA 4FVDA 3DUXH 3MH4A 3PROA 2TGTA 3T26A 1UK2A 4JMYA 4UEHH 3ZZAA 1UVUH 2SGPE 4VGCB 2XC4A 1SQAA 1ZSKA 3P95A 2G4UA 1E38B 1DITH 1FMGA 3OEHD 1Z71A 3O8DA 4CHAC 4FUCA 1AFEH 3F6UH 4NWKA 5FPYA 1WAYB 6ESTA 2W6JD 1GBBA 1MTNC 2BY6X 2J34A 1Z8GA 1Z8RA 2ANYA 3O8RA 2BTCE 8GCHG 4ESTE 2HWLB 1TNKA 1HJ8A 2QF5A 2QIQA 2BD2A 3Q3YA 5I46H 5IYTA 1W0YH 5PTPA 1IQHA 4Y11E 1HAXB 1GI5A 2I6QA 5E8EH 2ZTXA 3M7TA 1QB9A 3OE7D 3SORA 2BLVA 2C3SA 2SGEE 4DIIH 4Z6AH 1F0SA 1CBWB 5F6MA 3PM3A 2V6NA 4AFSA 3F68H 1O3NA 1O3PB 1QHRB 1K1PA 1UMAH 4WMDA 2VIPA 1YPGH 4CRDA 2XWBI 3GCNA 2FLBH 4NIWA 3RXHA 1GI3A 2ZDNA 1EZQA 2G4TA 4ZUHA 5T6DA 3ZV8A 3LJJA 3U28C 1K1OA 1BJUA 4X2VA 3TK5A 1TRYA 3MO3A 2J92A 2A4OA 3VGCB 2F9UA 2R9PA 2OBQA 1H4WA 1BQYA 1KLTA 1MD7A 1DVAH 1S6LA 4UFFH 1K2I1 1IQMA 5G4BA 3EGKH 3LT3A 3MNBA 3ZZ4A 1YGCH 4K8YA 2GZ7A 1WBGB 1FUJA 3SU4A 2ZCLP 1TGSZ 1KXCA 4AX9H 1DM4B 1YYY1 2VU8E 1DFPA 3SUGA 3B8JA 4JYVH 1ELEE 2HNTE 2PKSB 4U2WA 3TGKE 1ZMJA 5DJ7A 3RXFA 5F53A 4KELA 1TGCA 2GTBA 1ELFA 3A84A 2SGAA 1GMDG 1HB0B 3TJVA 3SI3H 1LPGB 1PYTC 2FODA 1C1VH 1S0QA 4Y8XA 4GPGA 1DICA 1XUIA 1GJ8B 1Y3VA 3M3SA 3MH7A 5EW2H 3ATLA 3F1SB 1ELAA 3OSYA 4NA8A 4RT1A 5C0TA 2V3OH 1C4Y2 1IQIA 1E35B 2J95A 2WPIS 3H7OA 1IHSH 4ZXYH 4TWYA 1MKXK 4I8GA 1F2SE 2C8WB 2FYQA 4AYYB 2QXJA 1Y5UT 3RXPA 1DLKB 1IOEA 3BEUA 2KX4A 2VVVA 1UTKA 3AASA 3TH4H 1ELVA 2ZNKH 1YCPM 1JMOH 1E37B 3QTOH 4H42U 4B73A 3TLOA 1VITG 2R2MB 2EY4C 3F3BA 2BMGB 3GCTG 3VXFH 1THRH 2B5TB 4MQAA 3RXGA 2GCTC 1Z6EA 1BT7A 1YPJH 1SPJA 1KXDA 1RS0A 1JIMA 2H6MA 2OC1A 3PRBA 4AFQA 3RXQA 5A2MH 5EXLA 5DP4A 4TWWA 1Y3YA 2FOAA 2ZI2H 1AIXH 3DD2H 4JZEH 2OBOA 1FJSA 1G3EA 3LJOA 1QNJA 2F9BH 2Z3EA 3SJ9A 2WV5A 5EJZA 1D3DB 4YT7H 1EJMA 2JKHA 3RXDA 2Y6TA 3SUFA 5F03A 2CHAB 2ODYB 2QV1A 4X6OA 1NPMA 2FI3E 1GL0E 3V12A 3KNXA 3S9BA 1RJXB 4AORA 1ZMLA 2STBE 3N7OA 1XXFA 1ETRH 1FQ3A 2VIWA 1OHHD 3NRLA 2BDGA 2D2DA 4ZH8A 3NPSA 1HJAB 2SGFE 1O2MA 2VIQA 2Y80A 3SJKA 1TAWA 1NFXA 3N7EA 4IC6A 3RC6A 1C1SA 1GVLA 2QAAA 3S9AA 4X8SH 1Q3XA 2OD3B 2A4GA 1ANEA 1GCTC 1SG8B 1TRNA 3A88A 1O32A 4ABHA 3OY5U 1K28D 2H9TH 3O8CA 4E06H 1P09A 2D26C 1TYNA 1QJ7B 2F9OA 2PTNA 1QCPA 5CDFE 1DLEA 4BNRA 1C1WH 1W11U 3MU0A 1D3TB 4IC5A 3PV2A 2XTTB 1SHYA 4JYUH 3KQBA 4Q7XA 5C0UA 1KMHB 1TGNA 3LGUA 1O31A 3ZVDA 2FLRH 3UR9A 1TX6A 3PTNA 1BHXB 3K6YA 3SGQE 4O97A 2XCFA 5DPAA 1CSOE 4QT8C 4D76A 2Z9LA 1ZPZA 4O9VA 3GCOA 1O5BB 5FX5A 3AW0A 3MTYA 5JBCS 2Z9IA 1OOKB 1A4WH 4XBBA 2ANWA 2BVXH 1SOTA 5EJLA 1TQ7B 1G9IE 2XBYA 2ALPA 1GBLA 1AHTH 2OXSA 1O2SA 1P10A 2FWWA 1Q2WA 1P06A 2A45B 1AKSB 1SSXA 1V2ST 2WPLS 4BXSA 3N99A 3TGIE 1C1QA 5EQQA 3WWBA 4ZXXH 1AFQB 4IS5A 1QFKH 1C1PA 3UB0A 1OS8A 5T6GA 1CGIE 4ABFA 4DVAU 8LPRA 1ZHMA 1MAYA 1TFXA 2OQUA 1SLVB 3ZZDA 3F0PA 1BUIA 4NZLA 2F83A 1HAGE 3EAJA 4MPWA 1O2ZA 1UVPA 5EPYA 1HAOH 1LHCH 1MZDA 2BD3A 1OSSA 2YOLA 1C5SA 3ODDA 4K60A 4TPYA 1GMCG 2A7HA 4FVBA 2R3UA 2BB4A 2ZFTA 4NGAH 1FAKH 4JZFH 1HUTH 1ZPBA 1QA0A 1C1OA 3KQ5A 1TB6H 1X7AC 1UK4A 3EA7A 4INLA 4TT3D 1DSUA 2LPRA 3SU2A 1V2LT 1DE7H 2VINA 4BXWA 2Y82A 3PTBA 1QQ4A 1C4U2 2FTLE 1O3BA 1S83A 1HAPH 3M36A 4X6MA 4X2WA 1Z1IA 1VGCB 1H1BA 1O5FH 4FUEA 2VB0A 5EXNA 6CHAB 2R0KA 1AWFH 1NESE 2W26A 3AVZA 2AS9A 4X8VH 2QF3A 1O2GH 1C1NA 5GNDA 2W5EA 5JB8S 1D3PB 1GDNA 3GS9A 2EI8A 1DX5M 5C94A 1F0TA 1SGPE 5HMAA 3ZZ6A 4LK4A 3UR6A 4D8NA 2RCEA 3CENA 2TIOA 3OU0A 3P8OA 4NA9H 3SGBE 2A5KA 1PPFE 3PV5A 2V0BA 2WV9A 2FIRH 3KIDU 3OAAD 3ZVGA 3H7TA 2PV9B 3BTFE 1BMFD 3SNBA 3P8GA 4YLQH 3KF2A 2GT8A 2BY7X 2BLOA 3GDVA 1ZZZA 4Y8YA 2TBSA 5L30H 3SV9A 4TY6A 5B6OA 2QXIA 3LU9B 3BIUH 1FY1A 1LVBA 1BMAA 1FPCH 2ZZUH 4ISNA 3ZVAA 1DANH 2YMSB 1SFQB 3MU1A 2ULLA 1D6RA 5DGJA 2FO9A 1RFNA 2CXVA 3M61U 1G3DA 3OY6U 7KMEH 3ZVFA 1AGJA 1IHTH 1SOZA 1V2UT 1AI8H 2BZ6H 2XBVA 3RXVA 4OM9A 2VBCA 1Z7KA 1AKSA 3BTGE 4KTCA 1P3EA 3A86A 5T1VA 4AB8A 2ZIQH 3RXMA 2VIVA 1P2QA 4U30A 4TYDA 3GISB 4X8TH 1TA2A 2AGIX 3SHAH 3E90B 1ZPCA 1ZRKA 3NCLA 3FVFB 2H5DA 1A3EH 2BD7A 1MKWH 4Z0KA 1P2NA 2ILNA 3TPIZ 3ZZ9A 5EU8A 2H9EH 1MTVA 1HAVB 1EFRD 4ZHLU 1FZZA 1FONA 2TGPZ 5DO4H 3AK5A 1GJ6A 1UTLM 4ISIH 1MUEB 3P8NA 3GY7A 3QZRA 2PKAB 3P70B 2BY8X 4MPXA 2JH5D 2HLCA 2AGGX 2HALA 1ORFA 1SGDE 4KTSA 5GDSH 2BDYA 1BA8B 4CH8B 1W8BH 1BJVA 2BYAX 3GCHC 2ZHQH 1W0KD 1TPPA 1ELGA 3GY3A 1SLXB 2B9LA 4ZKRU 2IPQX 5GJ4B 2VWNA 1ZRBA 2Y7XA 4O3TA 3ZVBA 1V2TT 4I33A 3MWIU 3EE7A 2J4IA 3QX5H 1S84A 1VJAU 1XVMA 1FXYA 1MH0A 1T8NA 2FM2A 1VZQH 5K0HA 1KTSB 1Z8IB 3Q3XA 3U1IB 4A6LA 2BX4A 1ACBE 4CH2B 2A7CA 4ABIA 5C17A 3SW2B 2ZGHA 3K2UA 3VG8A 1RRKA 2VVCA 3MYWA 1FN6A 1O3LA 2WPDD 4YM9A 1YF4A 3CS7A 3A7VA 1H8ED 1AVWA 2J5UA 3ESTA 3WW7A 1D4PB 3AAUA 1VCPA 5A0AE 2UUJB 4DGJA 2KM0A 1BB0B 1H9IE 1EZXC 4MNYA 1FY4A 4NFEA 1S82A 3ENSB 4ABEA 1UTQA 1PPGE 4FUGA 1BTHH 2ZHEH 3IITA 2PSXA 1KDQA 4WF8A 1V2VT 2M5TA 1T31A 2FESH 1YM0A 1LDTT 4LXBH 2QGRA 4ZHAA 5A0CA 3K9XB 4GCHG 1EAUA 4B75A 1CT2E 1PPCE 1L4DA 1UHBA 1HRTH 1J9CH 3PRDA 1O3DA 3MH6A 4XD7D 3U69H 6GCHF 1TONA 4RKOB 4K1TA 1P11E 5EODA 1G32B 4CR5A 5A8XA 1T7CA 3TJUA 4IBLH 3SZEA 4JZIA 3DSPA 5KECA 1TX7A 1AWHB 2ZDKA 1QZ8A 4Y76A 2QC2A 2BXUH 1K22H 1QL9A 1O37A 3LC5A 1KLIH 1Y8TA 2WZQA 3VFEA 3RXEA 4DOQA 1O3EA 1O3CA 3RLYH 1GHAF 3MFJA 2K8IA 3DT0H 5TCAA 1YPEH 4NWLA 2F9VA 2O8TA 3SV8A 2BQWB 2Q6FA 2JDID 1LPZB 1CT0E 1P3CA 4CR9A 2HVXA 2HLDD 3LPRA 1CHGA 4DT7B 2PKSC 1AO5A 1P9UA 1S6HA 4Y79A 5TCCA 3ZZCA 3RXUA 1CQQA 1DSTA 5JDUB 1NO9H 1NRSH 1TMUH 2R2WU 3V3MA 5LH8A 1BBRH 4FU7A 1OKXA 2WYGA 1GHWH 4WVPE 3SBKA 2RG3A 4H4FA 2RDLA 1VITF 1B5GH 1O2WA 3LONA 3P92A 3FFGA 4MNVA 3TH3H 3GCTF 3U9AH 3VB6A 4WH6A 3T2NA 3MMGA 1B0EA 1O30A 1GBKA 1C1TA 1GJ7B 3MOCA 1GG6C 4ZKSU 1TRMA 5KGOA 2FDAA 1M9UA 5H4IB 1AMHA 3RC5A 3ATWA 1DY8A 3PMAB 1FDPA 1QBVH 3M7QA 2P59A 4KP0A 1A5IA 3BTDE 1AVXA 1S6FA 3D23A 4IMQA 4NFFA 3BTWE 1CO7E 3A8AA 4Y10E 1RTFB 5FXLA 1GJ4H 4MTBA 2UWLA 1YWUA 3D62A 1GBHA 3GY6A 1ARCA 1LKBA 4IN1A 3VXEH 2Y5GA 1D3QB 1HPGA 2WPMS 5C67A 1NRQH 1XUKA 1SGCA 1UO6A 2CMYA 1TBQH 4OGXA 2CHAC 2B8OH 1C1MA 1TA6A 1EOLA 3M7UA 6GCHG 5EG4A 1E0FD 4NCYA 1FV9A 2WHXA 3QK1A 1OWJA 4YLUA 1IQJA 2WV4A 3SU6A 1ID5H 4XBCA 1A0HB 2HVYB 1UTPA 1S81A 1DUAA 1W3CA 1NRPH 4RSPA 1OWKA 1F0UA 1EUFA 1N8OB 3A87A 4ACBA 1C5VA 2V3HH 4Q63A 4BTUB 2WUBA 5C1UA 2WUCA 3UOPA 2Q6DA 4UD9H 3BSQA 1GHAG 2ZHWH 4CREA 1UCYH 1ABIH 5EIYA 1EP6A 1TNJA 2SGQE 4GSOA 3F9HA 2CF8H 1O2VA 1H8DH 1EJAA 1O2NA 3KHVA 1EOJA 1XUFA 5A0BA 1C5XB 2BD9A 1XVOA 3PO1B 2PHBA 3A7XA 5I25A 1J14A 2PFEA 1MD8A 3U1JB 4OS7A 5BRRE 2Y7ZA 1WYKA 2RA3A 2A31A 1J15A 1P2MA 1P2JA 2OCVB 5DP5A 2ASUB 1Z1JA 2PP6A 2LP6A 4P02A 2VIOA 3PLKA 3STJA 2ZG0H 5HYOA 4X8UH 1EPTC 1O5CB 2BLQA 1C5QA 1GI1A 1MBMA 4A1TA 4Q7YA 1LPKB 1AE8H 1XXDA 3SU3A 1KSNA 2GZ9A 1RD3B 1MTNB 1DXPA 1NN6A 1ZTJA 2GMTC 3SJOA 2ZDAH 1J17T 2VVUA 5FAHA 1O2TA 3FKSD 3T27A 3ATKA 1V2KT 5DKMA 1N6XA 1P03A 4MNXA 2D8WA 3L33A 2XNIA 1AFQC 3TGJE 1GMCF 1BHXF 4JCNA 4F48B 1F92A 2FYRA 3TIUA 3GY8A 1YCPH 1AN1E 1UVSH 3LGYA 1UVTH 1P12E 3PMBB 4AYVB 1NBMD 3QZQA 2G5NA 1QR3E 3SHCH 4X6PA 1C5YB 1GJAB 1VCQA 1LKAA 2G55A 2GT7A 3I77A 3PWCA 1TNGA 4TPIZ 3UREA 4BANB 1SKYE 2FZZA 3SQHE 2QF4A 2QXGA 5ETXA 3UWJH 1HXFH 1WTHD 2UUYA 1V2MT 3MU8A 5IDKA 4WH8A 1LVMA 3A7TA 4AG1A 1O5GH 4SGBE 3SUDA 1D6WA 1EKBB 3SYJA 3LH3A 2KCYA 2QE7D 2P94A 5GWZA 1CGJE 1UW7A 5CHBA 1UK3A 2WPJS 2Y5FA 4I7YH 3A81A 3D65E 2W3KA 1UVOA 1AE5A 3ZV9A 1EAXA 4Z1MD 4BAOB 1QTFA 1VJ9U 1TNIA 3SJ8A 1V6DA 2B0FA 3V7TA 2SNWA 1TMBH 4K1SA 4X1RU 4ISOA 1GBFA 1F7ZA 2L6OA 4NA7A 3F0OA 3RMOH 4M7GA 3I29A 4JK5A 3VEQB 1FPHH 1O3MA 2ZU1A 4JK6A 1U6QA 1OP8A 3SV6A 4WY3A 1KY9A 1EXFA 2WINI 4I31A 4UFDH 2J9NA 1C5TA 1O2KA 1BOQA 4CBOA 2BLWA 1V2NT 1CA0B 3RXOA 4Y7BA 4NZQA 4U01A 7ESTE 3SUEA 1GI6A 1W14U 4XDEA 1ZYOA 2BHGA 3BTQE 4Q4LA 3KN2A 4I8KA 4Q7ZA 2ZTZA 5EOKA 5SGAE 2Z3DA 1L0ZA 1TWXB 3SQEE 4P00A 3CP7A 2BXTH 1GBIA 1HAHH 2GCTB 3T28A 1L4ZA 1PQAA 1Y5AT 4ABBA 1O2UA 1YY3A 2NU2E 1A0JA 1O3OA 2YMSD 4DCDA 1SR5C 3OTJE 4ACAA 3TVJB 2YMSC 1SGNE 2AFQB 4U32A 1V2PT 3SU1A 2KCAA 4WXVA 1QRWA 1P8VC 3GOVB 1SI5H 2KAIB 3T62A 2G51A 3QTVH 1C2FA 3VB7A 3BN9A 4FU8A 3TNSA 1L1GA 1BRCE 2AERH 3SV2H 3E8LA 3ZZ7A 3PWBA 4OS5A 3GDSA 3A8BA 3OX7U 5HIZA 1A46H 2ZFSA 1MKXH 3PMJA 3M3VA 4AGJA 4Y6DA 1BTUA 3TK6A 5ABWA 3KQDA 3E16B 2VGCC 1HAYB 5IK2D 4TY7A 1YPLH 4BAKB 4Q2KA 1O35A 1NTPA 2CGAA 1XKAC 1Y59T 1GI9B 1QY6A
chains in the Genus database with same CATH topology
5FBIA 4BOHA 1GCTB 2Z3CA 5CHAC 1OPHB 1W2KH 1KXFA 1LHEH 3ZYDA 3M3TA 1N6YA 1TABE 2P3FH 3M5OA 1V2RT 2FTMA 4NG9H 1W7XH 2ZC9H 2XCNA 2GDDA 1C2KA 3STIA 4R0IA 4B76A 7LPRA 2BDCA 1YPMH 2HGTH 5L6NH 1JIRA 1VCWA 2SGDE 1ZJKA 3RU4D 1NT1A 1W10U 2FOFA 4ABAA 1A5HA 1LO6A 1C5RA 2A2XH 4I8JA 2ZQ1A 1HJ9A 2OC0A 3JZ2B 4FUJA 3RMMH 3GY2A 2P3TB 2ZKSA 1UTOA 2CN0H 2H5CA 1MZAA 9ESTA 3SZNA 1KTTB 5AFYH 5FX6A 1E36B 5LGOA 2BVRH 5HXFA 3RC4A 1FY8E 4FU9A 3LGIA 5JYIA 1GDUA 2UUFB 2ZTYA 1MQ5A 1SC8U 1V2OT 2FOHA 2IN2A 2BVSH 3BEFB 1CHOF 1F5KU 3NXPA 1AVGH 1EAWA 2EEKA 1MBQA 3BTEE 4A1VA 3ZZBA 2ZQ2A 6LPRA 4GHQA 2P95A 3GY4A 1KXBA 3MHWU 4GCHF 4HTCH 1GL1A 1TOCB 4ASHA 2PUXB 2GKVE 3DFLA 1C2MA 3BG4C 1OP0A 3FZDA 3M5NA 1OWIA 1C2DA 4FUHA 4D7GA 5JB9S 2A1DB 2GCHF 1P02A 2G52A 1D9IA 4JZDH 3I78A 2XW9A 1CE5A 3EA8A 1TPAE 2P8OC 1C2IA 2FEQH 2AYWA 3ODFA 1MCVA 2VH0A 3EYDA 3URDA 1K1NA 4O03A 2THFB 2KAIA 2ZU5A 3F9GA 1OYTH 5C1YA 4CRCA 1CT4E 4RN6A 1Y3XA 1K1LA 2RA0A 4KGAA 5E0GA 1CVWH 2STAE 3QGNB 2ZPSA 1ANBA 4WMEA 2PSYA 4DG4A 2VJ1A 5JBAS 1C5PA 1ZGIA 1A7SA 1KYNA 1LVOA 4INHA 1TBRH 3F9EA 3E0NB 3T25A 4BAMB 1B7XB 1AB9B 3MH5A 3MNCA 1O39A 3BIVH 5EW1H 1BDAA 4Q80A 3P6ZB 3ZZ5A 1O2XA 2ZCKP 3KEEA 1SQOA 3SO3A 3KGPA 5HM2A 3VPKA 2AGEX 4J2YB 2ZPQA 2BY9X 4E05H 1TNLA 1BZXE 2QCYA 5ESTE 2PUQH 2BQ6B 1C5NH 1C4V2 3LGWA 1O3IA 3RU4E 3Q77A 3SN8A 4XOJA 2QA9E 5A8YA 2BD5A 3T29A 4ABJA 1HIAB 1ZOMA 1T4UH 3NK8A 2BY5X 1G36A 3TJNA 1GMHF 1K1IA 1ZGVA 1AU8A 2ZU3A 5DP8A 3RP2A 2BX3A 4VGCC 2AEIH 5C5NA 2GX4A 4A1XA 1O2YA 3UY9A 1H9LB 2IOTA 2EI6A 1CHOG 4AFUA 2AH4X 4X6NA 1O33A 2JH6D 2FOCA 2XC0A 1MTSA 4ISLA 1WTGH 3MU5A 2QN5T 2QF0A 1XX9A 2ODPA 1P01A 2C8YB 3C27B 1AUTC 4Y8ZA 3NUMA 2BDAA 2ZEBA 1O2HA 1HXEH 1J16A 3SI4H 4K1EA 3RU4T 2YNAA 1HAIH 4AFZA 2AIQA 3DFJA 2GCHG 2UWOA 1HGTH 1FI8A 1MMJN 2NU3E 2ZA5A 1IQEA 1NFUA 3UQOA 3ATIA 1O2IA 1IQNA 1ZSJA 2P3UB 3HGPA 1G37A 3IG6B 1CBWC 1FIWA 2A4QA 1PPEE 3TITA 1T8LA 1TPOA 4MLFB 4AGKA 2GVFA 1P04A 1GI7B 1RIWB 1MAXA 3KQCA 3LGTA 3SNDA 1GGDB 1GHXH 3MO9A 3BTME 1Z8JB 1N1LA 4YZUA 1TGBA 2BOKA 2C90B 1NRNH 3VGCC 1SL3A 2HRVA 1FIZA 3E6PH 3AAVA 2ZGXH 2AIPA 2GV7A 1EB2A 1QQUA 1O3HA 2H2ZA 3JZ1B 1HAVA 4A7IB 1W13U 3CS0A 2V35A 4MNWA 1N8OC 1O3AA 3RXLA 1O3KA 3GCHB 3BEIB 3Q3KA 1P0SH 1YC0A 2ZFFH 3SJIA 1VITH 1KLJH 1EJNA 2CJIA 3S0NA 2PKAA 3FZZA 1QA7A 3BTKE 1GDQA 3MNXA 2ZDLA 3LIWA 5C20A 1KIGH 1G3CA 2Q6GA 2ZFRH 1GHYH 4WMFA 2BDIA 2XYAA 4X1QU 4XFQA 1ELCA 5AF9H 1K21H 1EZUC 4FUBA 2ZFQH 2UUKB 1A1RA 1DS2E 4MPVA 1GPZA 3PMHB 1C9TA 2EI7A 1Q31A 2HNTF 2A7JA 2BDBA 1SLWB 1WQSA 1C1RA 5TJXA 4F49A 5ESBA 1A5GH 3R3GB 4KKDA 3IWMA 2OP9A 1TLDA 3RUOA 1GMHG 1SLUB 4D9QA 1XUGA 4X1PU 1GJ5H 2VWLA 1GJ9B 1S0RA 5FCKA 1OP2A 2I6SA 2CF9H 4O3UA 1Z6JH 1YLCA 1HIAA 2H1UA 3FANA 5FHTA 2PTCE 1ZSLA 3FP6E 1EX3A 1ZMNA 3RXRA 4INKA 1GWAA 5JBTA 1GBTA 3U98H 4XBDA 3UUZA 2Z94A 1QIXB 5CE1A 3T5FH 2DE8A 1LTOA 2F9PA 2VIDA 3HKIB 3E0PB 3SV7A 3RXJA 2NU0E 1FAXA 2XC5A 1NRRH 4CRAA 1OWDA 2G81E 4SGAE 2Q1JA 2A5AA 3F9FA 1P2OA 1EZSC 1H8IH 2J2UA 5BPEA 3ITIA 4GUXA 4ABGA 2XBXA 3A7YA 3HKJB 3UOUA 1HJAC 3G01A 4ZAEA 3BV9B 1HNEE 1JBUH 1MTUA 1TE0A 2IJOB 1MU6B 1TNHA 3PB1E 1L2EA 3PYHA 3UFAA 1OYQA 2EC9H 2W3IA 3QGJA 5CMXH 4NSYA 3NZIA 1OX1A 3E91A 3VB5A 1XMNB 1ZJDA 3RXCA 1PPZA 1TIOA 3MI4A 1A2CH 1DY9A 2ANMH 4GLYA 2JETB 3QLPH 5J4SA 1OWEA 1O5AB 1AY6H 3UTUH 5DG6A 2W7SA 4FUFA 4B74A 3P8FA 3GY5A 1YPHC 2FOEA 1WV7H 3MNSA 1DWEH 1O3JA 1GHBG 2FS9A 3PLBA 1ZHPA 1PYTD 1SFIA 2A5IA 3RMLH 2WYJA 3A85A 5LPRA 3KCGH 5L2YH 1HLTH 5L2ZH 4YO9A 4NIYA 2OQ5A 1C5UA 3E3TA 1FY5A 3RLWH 3A7ZA 4BAHB 1BITA 1MTWA 1CA0C 1P05A 1BBRE 4CHAB 1TMTH 4ZROA 1YKTA 2WPKS 1GG6B 3TJOA 1JWTA 4MVNA 2TGAA 3TK9A 2FX6A 2BOHB 1OWHA 3A83A 1DT2A 1FN8A 1GVZA 2BD8A 1JRTA 2ZP0H 3L6PA 2PW8H 1K1MA 2B7DH 5F8TA 1JRSA 4CRBA 1ZHRA 4ZHMU 4E7NA 4PROA 2ZF0H 1GBCA 2ZHDA 4HFPB 4Y0ZE 3S9CA 3EDXB 1EP5A 2ZCHP 5EQSA 1C5ZB 2ZHFH 2HPPH 1NU9A 4JYTA 1O5DH 5GCHF 4X1SU 3WY8A 2ODQA 2P16A 1NC6A 3A89A 1BTYA 1LMWB 4THNH 1W7GH 5AVDA 1V2QT 1WUNH 1QRZA 1LVYA 1QB1A 2ZWLH 3R0FA 2BQ7B 5E2PA 4UONA 5A8ZA 1GI8B 1L1JA 2PGQB 2ZU4A 3OYPA 1ETTH 7GCHF 3EA9A 3HGNA 3S7HB 4YOIA 2Z7FE 1O2JA 4JZ1A 2D1JA 2GDEH 2NU1E 4GHTA 4DURA 1QRXA 2ANKH 5E0JA 2FI4E 2FXRA 1SB1H 4DW2U 1E34B 1O2OA 1SQTA 1BTZA 1BMMH 1SGYE 1TX8A 1VGCC 1WQVH 1O2LA 4IW4E 3DA9B 6CHAC 3UQVA 3PV4A 4YT6H 1F5LA 1KXEA 1SGTA 2Z9GA 1YBWA 2A0QB 3KL6A 4Y7AA 5E2OA 1WSSH 4A5TS 1GBEA 3EQ0H 4HZHA 3S7KB 1BIOA 1HCGA 2BZAA 3NWUA 1XM1A 2WPHS 5JBBS 1BMLA 2ZECA 4UDWH 4Y0YE 1BTXA 2G8TA 2GP9B 1TALA 1RTKA 2OC7A 1ESBA 5C5OA 1IQKA 1NU7B 1ARBA 3SNCA 1GI2A 4I8LA 3RM2H 1ELBA 1O38A 1UCYE 4E7RG 2SNVA 3V13A 1SBWA 2OLGA 8ESTE 1LHFH 1KXAA 2GZ8A 3A82A 3HATH 5EPNA 4D7FA 1LQDB 1OXGA 4DY7B 1SGQE 4B1TA 1RTLA 2FOGA 3A8CA 2HOBA 1YPHE 1PQ8A 1QBOA 1ETSH 3M5MA 4XE4A 4CRGA 1QBNA 3UWIA 1NM6A 4H6TA 5FCRA 4IMZA 2QYIA 1C5MD 1IQGA 3RMNH 1EPTB 1MKWK 5FPSA 2A4RA 3M37A 4K8BA 4YOJA 4CBNA 1NS3A 5C2ZA 1GBDA 1C2LA 1B0FA 4OS1A 1C2JA 2GD4B 2OTVA 2PR3A 2O8WA 1C5WB 2Y81A 4OS6A 4F4OC 1O5EH 2GV6A 4UE7H 4YOGA 1QB6A 2F91A 1PPBH 1EATA 2GMTB 1A61H 1W0ZU 4B2AA 4DIHH 1JXPA 1L1NA 1LQEA 1QJ6B 1PQ5A 1WOFA 4AN7A 1P2IA 4ZKOU 2O8LA 1EQ9A 3H5CB 2J38A 1FLEE 5DP6A 2XBWA 2ZU2A 5GCHG 1YPKH 2TRMA 2ZFPH 2ESTE 4HGCA 3UNQA 3L3TA 1AQ7A 3NKKA 4RKJB 3W95A 1AZ8A 2GGVB 1SVPA 2XWAA 3B23B 1DWBH 2FI5E 1GCDA 1IAUA 1SMFE 1LHGH 1DPOA 1QL7A 1DDJA 3BTTE 1UJ1A 2AMPA 1BTWA 1CA8B 1P57B 4OGYA 4OS2A 7GCHG 3PLPA 4IGDA 1T4VH 4ZMAH 1HAZB 3FP7E 1DWDH 1THPB 1DXWA 1O2QA 5JPMH 4MPUA 2UWPA 1TQ0B 2AMQA 2HPQH 3GYMA 1THSH 5EXMA 5EQRA 2C8ZB 1INCA 1VR1H 3Q76A 5DP9A 4NIXA 2QY0B 2VWOA 3MO6A 1HBTH 1BCUH 3RXSA 5AHGH 2Z6BD 2FP7B 2ZDMA 1Y3UA 1G30B 2A32A 4B71A 3E1XB 3HK3B 1GI0A 2YNBA 4A92A 4UFGH 3ELAH 2BDHA 4X2XA 1AB9C 4I32A 1F0RA 1XUJA 1GBAA 2IPHA 1ZLRA 1ESTA 3EE0B 4ISHH 2PLXA 3GDUA 5J4QA 1HFDA 3SOSA 1NZQH 2J94A 4DJZB 1NFWA 1A3BH 4D9RA 2XXLA 3UPEA 3VB3A 1PPHE 1TPSA 1GBJA 1QGFA 3KQEA 2BM2A 1ESAA 1FNIA 4AG2A 1BMNH 1TGTA 1O36A 1T8MA 5T3HA 3RXBA 2FX4A 1LCYA 4Y71A 4FUDA 5HGGA 3BG8A 1LHDH 1KDQB 3V0XA 2Z9KA 2ZDVH 4CRFA 3BTHE 1ANDA 5T6FA 3RDZA 3TU7H 4WJG2 3RXKA 2ALVA 1GJDB 2P93A 3RXIA 1CGHA 1O34A 3FP8E 3GYLB 1EPTA 1BRBE 1C5OH 1GHZA 1T8OA 1UHBB 4K3JA 3B9FH 1T32A 4WXIA 1PFXC 4BAQB 5K7RA 2NWNA 1AZZA 1EASA 5F8XA 4AZ2B 3ZYEA 5LPEA 1DOJA 2OUAA 4ABDA 1C1UH 4K5ZA 1IQLA 4FUIA 3SU5A 1GHVH 1CU1A 1ELDE 4WWYA 4BTTB 2ZGBH 2ZPRA 5FPTA 1ZTLA 1BRAA 1H9HE 2ZO3H 3M35A 1UTMA 2C93B 1WCZA 2VGCB 3URCA 2OINA 1BBRK 1AUJA 2XRCA 3D49H 3ZZ3A 1O2RA 3LOXA 5CHAB 1TBZH 1GI4A 2SFAA 2FOMB 1RIWC 1GGDC 4KTUA 3A7WA 1V3XA 3C1KA 1BTPA 2LNCA 1SHHB 3A80A 1S5SA 1HYLA 1S85A 3ATMA 5A09A 1EAIA 2O8UA 1ZR0A 1YP9A 2FS8A 3ZZ8A 5GIBA 2R0LA 1PJPA 1NROH 5C3NA 2W7UA 2TGDA 1G3BA 5HM9A 4OS4A 3QO6A 3LKWA 2O9QA 5E0HA 3LDXH 1DWCH 4LOYH 3TH2H 5AFZH 3LH1A 1RXPA 1ABJH 4UFEH 1AD8H 5FBEA 2ZGCA 5DP7A 3U8TH 1PQ7A 1ELTA 3K65B 3SNAA 1P2KA 1DUEA 1UTNA 2JH0D 4ZKNU 1NY22 3O8BA 3AW1A 2TPIZ 3QN7A 3VB4A 4I8HA 4IN2A 1SGRE 1SGIB 1Y5BT 3M5LA 2FPZA 5LPFA 2BD4A 1K9OE 2C4FH 2Z9JA 1P9SA 3GICB 2AMDA 1YLDA 1GJCB 1ZTKA 3DHKH 1JOUB 2QXHA 4R8TB 5C1XA 3LGVA 4LZ1H 4YESB 2A2QH 2EA3A 1MCTA 2PWXA 3RM0H 4K2YA 3UNSA 4X2YA 2VH6A 3BF6H 2R3YA 2O8MA 3QUMP 4GAWA 1SGFG 3BG4B 8GCHF 1V2JT 2K1QA 3SGAE 1XKBC 4GVUA 3QDZB 4HI3A 4MG3A 3RXTA 1QURH 1NFYA 3Q00A 1UCYK 4NIVA 2DUCA 4X1NU 4YTAA 2G5VA 1QJ1B 2P8OB 1Y3WA 2VWMA 1WU1A 4FXGH 1EB1H 1G2LA 3U8OH 2OC8A 5EGMA 1SGEE 3S69A 3W94A 3UIRA 2DE9A 1GVKB 2FMJA 3SU0A 3HK6B 3QWCH 8KME2 5DK1A 3HPTB 1MU8B 2NU4E 2FOBA 1ANCA 2ZGJA 1C2EA 1C2HA 3U8RH 1O3GA 4AOQA 4NSVA 4XSKU 1O0DH 1HDTH 1IQFA 5GXPA 1GJBB 4X0WU 2PGBB 4J1YA 5GPIB 3RXAA 1F5RA 2HNTC 5F8ZA 1BRUP 2VNTA 3ZVCA 3ZVEA 4LZ4B 2H9HA 5DP3A 1C9PA 1O2PA 1K1JA 4K69A 2F9NA 1RGQA 3LC3A 3SNEA 3UNRA 3FAOA 2Y5HA 9LPRA 1C2GA 1XUHA 1GHBF 3TNTA 1UTJA 2F3CE 1GMDF 2CV3A 1W12U 2JETC 1MQ6A 2G00A 1G2MA 4H6SB 1GBMA 4MDSA 4B2BA 3K6ZA 3P17H 1QL8A 3MU4A 4BTIB 4B2CA 1FY3A 1V2WT 1TOMH 1O3FA 1SGFA 1C5LH 3PO1C 1HV7A 1J8AA 2C8XB 4AB9A 1YCPK 1A0LA 3A8DA 4FVDA 3DUXH 3MH4A