3V0XA

Bovine trypsin variant x(tripleglu217phe227) in complex with small molecule inhibitor
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
223
structure length
222
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSETYNNDIMLIKLKSAASLSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSFIITSNMFCVGYLEGGKDACQGDSGGPVVCSGKLQGIVSWGEGCAQKNKPGFYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bovine trypsin variants X(tripleGlu217Phe227) in complexes with small molecule inhibitor
rcsb
source organism Bos taurus
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 50
structure length 222
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-12-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v0xA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3v0xA02
3NK8A 4GCHF 5GDSH 3F9GA 1O33A 1GBIA 3MI4A 4FUIA 1HAVA 1KXBA 2Z3CA 1MUEB 5C20A 5F03A 3S9AA 4Y7BA 1NT1A 2O8TA 3VB5A 1GJAB 2CHAC 3KF2A 2CF8H 1QIXB 1TPSA 3ATWA 1XUHA 1GPZA 4IS5A 1EAXA 1NRSH 2BLOA 1SOTA 5A8YA 1SFIA 3H7TA 2GCHG 2ZP0H 1C5PA 3RXCA 1O3HA 1VCPA 3FZZA 4X8TH 1GMCG 4NIYA 1DFPA 1S6FA 1OYTH 3HKIB 2Q6GA 2F9UA 3TGJE 1P10A 2BM2A 1C1SA 2OC7A 3T26A 5EW1H 4NGAH 5L30H 1Y5UT 2VIPA 3MH5A 3RXGA 4DCDA 2TGPZ 4WH8A 4BAQB 1ANEA 2QY0B 3R0FA 1SVPA 1LMWB 1TGBA 2VWNA 3RLYH 1Y8TA 3SV8A 4ZKNU 4LZ4B 1HYLA 2BX3A 1YPHC 1P2QA 4ZAEA 3RXKA 2HPQH 1O3JA 1LHGH 1V2ST 2Z9LA 1WSSH 1YGCH 1NPMA 3T62A 4CBNA 4MPUA 1TYNA 4WJG2 4Q80A 1QRXA 2JH5D 1YPGH 1UMAH 1WAYB 4ZUHA 1AZZA 1YPLH 2JETB 3SBKA 4CRGA 1K21H 3RXMA 1J15A 2P59A 4CR5A 2ANMH 1TA2A 1W3CA 1FIWA 2R3UA 2ODQA 3V0XA 1E37B 2AMDA 3IWMA 2ALPA 1O2HA 4ABJA 1NS3A 4Y10E 1RXPA 4FU9A 1LVMA 4X2YA 3ZZCA 3QDZB 3RXFA 5H4IB 2P8OB 1TPOA 3KIDU 1GJCB 1HLTH 1ACBE 2R2WU 1BMAA 2C8YB 2B9LA 4K1SA 3GCHB 1O5FH 1QL8A 1EATA 1HBTH 4IC5A 2H1UA 4B1TA 1O3LA 3F9FA 2BQWB 1CGJE 1NROH 4NSYA 1H9IE 3MMGA 2Y7XA 2QXIA 1GGDC 1G30B 1KXDA 1GMDF 4KTUA 3ZZDA 1HAGE 2AMPA 3M3SA 2HRVA 3SU0A 1VZQH 1ANBA 1O3NA 1N6YA 4K1TA 3TNTA 3LC3A 1YC0A 5JPMH 4CHAB 4HTCH 2R2MB 1O5GH 1QFKH 4RSPA 1LQEA 3GY6A 3MYWA 2Q6DA 1TQ7B 3FP6E 3B23B 3L6PA 2ZCLP 4DOQA 1MTNC 1RS0A 1GBFA 1K1LA 4D9QA 2ZHWH 1OWEA 1XVOA 1ZR0A 1M9UA 3A8AA 1QGFA 4K8YA 2WPMS 3A86A 1DITH 3D23A 3PLPA 2AFQB 1TNKA 1ZLRA 5JBBS 2HNTC 2ANYA 2F91A 2HWLB 3BTQE 2VGCC 1YLDA 1T32A 3HK6B 2P3UB 3A7YA 3P95A 2OQ5A 3EA9A 1DLEA 1LTOA 2BLVA 2GKVE 4WY3A 1QL7A 2V35A 3U69H 1UK3A 5E0JA 1AFQC 1ETTH 3K65B 4OGYA 5I46H 4WWYA 1AE8H 3ENSB 4GVUA 4ABEA 3LDXH 2BDAA 1ZPBA 5C5OA 1FNIA 3ZZ3A 4AFQA 2OQUA 2BDCA 5TCCA 1G3BA 4Y7AA 1P05A 2ZNKH 1GI2A 1EQ9A 1S5SA 1GJ8B 3NCLA 3QLPH 3LGWA 5F8TA 5A0BA 1QTFA 4O3UA 4I8JA 2VINA 1E34B 1MQ6A 4Q7XA 1V3XA 1ZMLA 3RXVA 1QHRB 1K1JA 1BTZA 1YCPK 4JCNA 3RMOH 3MO9A 1OP0A 1BJVA 4I8HA 5EXLA 5K0HA 2ZFPH 1CQQA 3LT3A 3RXDA 3ZZBA 5JB8S 2XBWA 3MFJA 3SO3A 1G32B 5C1UA 1OOKB 1SHHB 2H9HA 1DANH 1PYTD 1D3DB 4ISOA 1KXEA 1L1NA 4Z6AH 2BQ6B 3QX5H 3MNXA 1GJ5H 3CS7A 4Y6DA 1NFWA 3FP7E 2BXTH 4KP0A 1FAKH 1MKWK 5DJ7A 3ATIA 1AN1E 3HATH 3B9FH 2A5KA 1AD8H 2AS9A 3RC5A 3BTDE 1UTOA 1C1TA 4LK4A 1C1RA 1MBQA 1O2WA 3ZZ5A 3MH7A 1V2TT 1SOZA 4MLFB 1F0RA 3QZRA 4MVNA 3ZYEA 3P8FA 1TNGA 1SHYA 1K9OE 1TRNA 4KKDA 2OD3B 3OY5U 5FX6A 3U8TH 1ZHMA 2B5TB 2ZFTA 4JK6A 2BDBA 1SQTA 1YCPM 1CA8B 2QN5T 1KTSB 1B7XB 1QL9A 1ID5H 5ESBA 4OGXA 1O2JA 1C4V2 4IN2A 1T4UH 4Y0YE 3UIRA 2ZWLH 3U8OH 1AFEH 1HJ9A 3NWUA 3B8JA 4JYUH 3TJNA 4K60A 1MCVA 1KY9A 4K3JA 1TX7A 3O8RA 4JZEH 4D76A 1P2MA 2FO9A 4AYVB 1HXEH 2BXUH 4ESTE 1TALA 1AUTC 1GHXH 1UTNA 2FS8A 2A7CA 1V2WT 2BVXH 3TIUA 3RXLA 1DWEH 1SGTA 2GT8A 2ZFRH 1FPHH 4BNRA 4A1TA 1CE5A 4OS2A 2BYAX 1E0FD 3SQEE 2WV4A 1MZDA 2Z9IA 5GXPA 1PQ8A 1F5KU 1EJNA 1GMHG 2A0QB 2ASUB 4FUCA 1O2LA 1DWDH 1THPB 2UWPA 3PM3A 2TPIZ 3FZDA 2Y7ZA 2B0FA 4X6PA 3V13A 2XW9A 3RXSA 1PQ7A 1Y59T 4BTUB 3LGTA 2G5NA 3U9AH 4YLQH 2GCTB 4DURA 3SU4A 1QBNA 5GJ4B 1A1RA 4MG3A 1O35A 1FZZA 3UQVA 2A4RA 4CH8B 3PLBA 1O3MA 5T6FA 5E2PA 3QTOH 4KELA 1A0JA 3LJJA 4LXBH 3MU0A 1G3CA 1KIGH 3BG4C 2AIPA 1TMBH 2CV3A 1ZHPA 1L4DA 6CHAC 1HGTH 3MNBA 3SNDA 3UWJH 1O2IA 3FVFB 3LGUA 1OWIA 2EI6A 4ABGA 4CREA 4ZKOU 5DK1A 1BRUP 2IOTA 1GDNA 3GDSA 4WMFA 2PV9B 1TNHA 2HGTH 1MD8A 2Z9GA 4I8GA 5DP4A 1GDQA 1U6QA 1TPAE 1O3CA 1N1LA 3RXPA 2ZU4A 2AGEX 1O2PA 1YPHE 1WOFA 1DXWA 1O3KA 1GJDB 1W14U 4FVBA 5EQQA 4NFEA 3ZVFA 2XTTB 1G37A 5JB9S 1SB1H 3V7TA 4IW4E 1DUEA 1Y3VA 6CHAB 1WU1A 2F9PA 4FXGH 1LPGB 3FAOA 4FUBA 1FV9A 2BX4A 1FY4A 1RTLA 8LPRA 3O8DA 8KME2 1NRQH 2PKSC 3KL6A 4R0IA 2ZZUH 3AAUA 4JZ1A 5DP3A 1LHDH 2SGAA 3A8CA 1NFXA 3ZZ6A 2I6QA 3SU2A 1L1JA 2J94A 1F5RA 4D7FA 5B6OA 4I31A 1HPGA 1W7GH 1UTQA 2FESH 3P8GA 4OS5A 1IOEA 3PO1C 1V2LT 2A7JA 4NFFA 1WBGB 5T6DA 1BTHH 5L2ZH 1CVWH 3LJOA 1K1IA 2ZDKA 3Q00A 1PPCE 3QTVH 1NTPA 2V0BA 1FXYA 3S9BA 1EJMA 3SW2B 2ZPRA 8GCHF 3OY6U 4NZLA 1O0DH 1V2JT 1GL1A 3P8OA 1O3BA 3ELAH 1SGPE 5F6MA 5FPYA 1C1OA 1O5DH 2ZPQA 1SPJA 5J4QA 3ZZ7A 1C5XB 1SLVB 2OXSA 3AW1A 2OTVA 1T8NA 1AVWA 1SC8U 4H6SB 1ZHRA 5EPNA 1CBWC 2O8WA 1G3EA 4HI3A 1XUJA 1O2NA 4I33A 3ZVAA 3TK9A 2GZ9A 1C2MA 1VCWA 4O03A 2A5IA 1G3DA 1PPBH 4XE4A 1CSOE 1UTMA 3LH1A 5J4SA 3SU5A 3SJ8A 1EPTA 1P2IA 2ZGCA 1HCGA 1EP5A 4TY6A 1AMHA 1GMHF 2VIVA 4H4FA 1C5WB 1Z6EA 1ESAA 1J9CH 1C4U2 3M3TA 5FCKA 4JMYA 3PROA 1T31A 3MO3A 4UDWH 4FUHA 6GCHF 1YLCA 1C5VA 3BTTE 2C90B 2UUFB 4ZH8A 1BT7A 1OXGA 1FAXA 4F49A 2A31A 1DXPA 2PHBA 1BRAA 1LVYA 1TAWA 3PYHA 2P3FH 1BJUA 2PR3A 3P6ZB 3SJKA 5EPYA 1OP2A 2ILNA 2RCEA 1KDQB 1O2ZA 2ZF0H 1MTNB 3M5MA 4GUXA 2KAIB 2FOMB 1UVOA 2ODPA 4M7GA 4X8VH 5HM2A 1TMTH 1DT2A 3UR6A 1O2KA 4X2VA 4YM9A 1AY6H 3MHWU 2YNBA 1ESTA 2G51A 1HJAB 2P94A 3VGCB 1XM1A 3A80A 4FUFA 1QA7A 4E7RG 3SJ9A 2F83A 2I6SA 4MPWA 1FN8A 1O2VA 2F9VA 3V3MA 2AERH 1MTSA 1DY8A 4ISHH 1KYNA 1EOLA 2ULLA 4B76A 1C2LA 5DP6A 1IQJA 4YLUA 4ZMAH 1JIRA 3SUEA 3F9EA 2V3OH 2SFAA 1VCQA 3LONA 1HAZB 4ISNA 3M61U 2JH6D 1ZMJA 3P8NA 1K28D 3RXHA 1TNIA 1ETSH 1IQHA 1SQAA 3QGNB 1LPKB 1C1MA 2ZCKP 1NO9H 2OCVB 4XBDA 2R0LA 1G2LA 1G9IE 3TJOA 1MZAA 4XSKU 3L33A 5GCHF 4WMDA 1A5IA 1E38B 3RC6A 1TONA 1ZTKA 1YPJH 4MNXA 4UFEH 2ZTYA 1YP9A 4SGBE 1O2MA 4A1VA 2P95A 2C3SA 2V6NA 1B0EA 5JYIA 3TK5A 1MH0A 4I8LA 3O8CA 2HOBA 1OYQA 1P2JA 3RMMH 1C5YB 2CXVA 1EX3A 4X0WU 3BTGE 4MDSA 3BTWE 5GPIB 2ODYB 2BDGA 3ZV8A 2VH0A 5C5NA 1S84A 2BHGA 3CP7A 4JZFH 1HXFH 3E90B 4AB8A 4WMEA 2J4IA 1FPCH 1AWFH 1VR1H 3GCTF 4Y0ZE 4GPGA 4DIIH 7LPRA 3T28A 1VJ9U 1EPTB 3SNEA 2Q6FA 2R3YA 1ZRKA 2XC4A 2BZAA 3L3TA 1S0RA 3P70B 5C67A 2ZDAH 4A6LA 2ZDNA 1YPMH 4WH6A 3E1XB 1DE7H 2CN0H 2V3HH 4DVAU 4K5ZA 5CE1A 3RM2H 3GY5A 4NWKA 1LCYA 1DPOA 1LHCH 1THSH 3R3GB 1GBEA 2VIDA 4CRCA 1NC6A 2VVUA 1RTKA 1Y3YA 4NA8A 2W7SA 3K2UA 3TU7H 2PTNA 1XUKA 4DGJA 2FI4E 7GCHF 2B8OH 5EXMA 1ABIH 1QB9A 1XXDA 1BUIA 2FTMA 1W8BH 1A61H 5HMAA 1KDQA 4AN7A 1BB0B 1GI3A 3C27B 4FUDA 1GBMA 5HM9A 5EQRA 1TRMA 1GCDA 1ZTLA 3BTEE 3RC4A 1W0YH 1RGQA 4UFGH 1N8OB 1T4VH 3T5FH 2Y81A 1ORFA 1BBRH 1IAUA 1D4PB 1H4WA 1VJAU 5EXNA 2G5VA 1K22H 3MO6A 4LZ1H 3DD2H 3KQCA 1C5NH 3MU5A 4AG2A 3A87A 1EPTC 3NPSA 1P57B 1C5MD 2P3TB 4DG4A 1JXPA 3E0NB 3M3VA 5DP7A 3I78A 2FEQH 2PUQH 3SUDA 1IQEA 1KLJH 1O2TA 2J92A 4ABAA 2C8WB 2BDHA 1P8VC 1F5LA 4DY7B 2H5DA 3ZZ8A 1MKXK 2STAE 2YOLA 2SNVA 2GX4A 1NZQH 3GCNA 1MTWA 1ZSLA 1FLEE 2A2QH 3I29A 5HYOA 1ZMNA 3OX7U 5DP9A 1ETRH 3WY8A 3F6UH 2DE9A 3PWBA 5C3NA 3EDXB 3I77A 2HNTF 1P06A 1DUAA 1Z8JB 1T8OA 2FOEA 2P93A 1QJ1B 2THFB 3BTME 1GJ4H 3MU8A 4FU7A 1JMOH 1KSNA 4CRDA 5A8ZA 4Q7ZA 1ARBA 1HB0B 2AGGX 2XYAA 1KTTB 1QA0A 5G4BA 1D3TB 3SI3H 1GMDG 3GY8A 1BMLA 3ZV9A 4JYTA 3KN2A 1AKSB 2BD8A 2EI7A 4XOJA 1GI1A 2D2DA 1YKTA 2VIWA 1SGFA 2IN2A 4R8TB 4BAOB 2VVVA 4BTIB 3UTUH 1CU1A 4Z0KA 1Z7KA 4E05H 1O2UA 2UUKB 3P92A 2J34A 4Y79A 1L4ZA 1CHOF 8ESTE 1EZXC 2HNTE 2SGEE 1ZYOA 4FU8A 3PMJA 3TH4H 1XUFA 2A1DB 4NIWA 2ZDLA 3W95A 2J38A 1TFXA 3RU4E 4MNVA 2PSYA 2WPLS 3TGIE 2ZPSA 1VGCC 1TIOA 1C5ZB 1ABJH 1SG8B 2A7HA 4O9VA 1OSSA 3W94A 2Y6TA 1ZOMA 1C2JA 1GHAF 3KNXA 1LHFH 1TWXB 1TGSZ 3GCTG 1BTWA 3E0PB 2Y5GA 2BD3A 1NRNH 1OS8A 3Q76A 2Y5HA 2SGFE 1IQLA 5JBCS 1BBRE 2WYJA 5DGJA 3ITIA 4MPVA 2DE8A 1N8OC 4A1XA 1C9TA 1W11U 1W0ZU 1QR3E 3S69A 2O9QA 2ZEBA 4IC6A 1FMGA 1O32A 3AASA 2ZU2A 3M5OA 2H9TH 1RIWC 1ELBA 1FQ3A 1FUJA 1MCTA 1IQIA 1PPHE 1Z8GA 4ZXXH 3ZVBA 1AE5A 2FX4A 1NFYA 1BRCE 1MKWH 5E2OA 3ZVGA 2W7UA 1WTGH 1UHBA 4RKOB 1GWAA 4WXVA 1S82A 3PMHB 2QXJA 2Y80A 2FS9A 1BOQA 1IQGA 4UE7H 3TLOA 3VXEH 5ETXA 2G00A 2G8TA 3PLKA 4WF8A 4XFQA 4BOHA 1EB1H 2SGQE 4NWLA 1WQVH 2BMGB 1OPHB 1TBRH 1W12U 2OC0A 4WXIA 5EG4A 3JZ1B 5EGMA 3VGCC 2PUXB 1C1NA 1TGCA 1TX6A 1MD7A 4INHA 4E7NA 5E0GA 1UJ1A 1THRH 1V2PT 4X1NU 4JZIA 1XX9A 1GHWH 3RMLH 2RA3A 5LGOA 2PTCE 1GI9B 5L6NH 3BTFE 2QAAA 4BTTB 1DICA 3SNAA 2Z9JA 2ZCHP 1F0SA 3MOCA 4IMQA 1PQAA 4TPYA 1SGQE 3RP2A 1S0QA 1GBTA 1YPEH 2ZDMA 1WYKA 1C5SA 1V2MT 2XWBI 1AKSA 2QXGA 4IGDA 1VGCB 1VITH 2EI8A 4VGCB 2CGAA 1GCTB 2BDIA 2BY9X 3A7XA 3E91A 1V2OT 2A2XH 4OS7A 2BDYA 2CJIA 4TY7A 4AFZA 1D6RA 4BXWA 3M7TA 3RMNH 5HXFA 1XUIA 5E8EH 2YNAA 3ZZAA 2B7DH 3HK3B 3TITA 1O5AB 1HJ8A 1SGDE 4GLYA 4DJZB 1SQOA 2XRCA 3PTBA 2ZIQH 2C8XB 4GHTA 1Y5BT 4ZHLU 1RTFB 1GG6C 2PKAA 1O2OA 2ZFQH 1GBBA 7GCHG 4A7IB 3VXFH 2UWOA 1Z8RA 4Y8ZA 1HAHH 1BIOA 3SNBA 2GP9B 1OWDA 1HAOH 3Q3YA 1IHTH 2G55A 3C1KA 3QWCH 3EGKH 1KXCA 3D65E 3BEFB 1SGIB 1QRZA 1O3FA 5LPEA 4Q2KA 1EXFA 4DIHH 1ESBA 1GBKA 5DPAA 3UNRA 2XWAA 2D26C 5HGGA 1O38A 4AOQA 2BQ7B 1A0HB 3BTKE 2GD4B 1J17T 1ZGIA 2ZGXH 2Z6BD 1QCPA 3PV4A 4NA7A 3MU1A 4YOIA 4AYYB 4B2CA 1FY8E 4A5TS 8GCHG 2FOCA 3UPEA 1NESE 3ODDA 5CHAC 1ZPCA 3ZVEA 3E16B 4XDEA 2WPIS 4X2WA 2BY5X 4K2YA 5DG6A 2VNTA 4UFDH 4I32A 3A81A 4D7GA 3SGAE 1BDAA 3F68H 2DUCA 1GG6B 1Y3UA 1IHSH 1O3GA 2GT7A 2QA9E 2CF9H 2OC1A 4QT8C 2J95A 1MMJN 2NU3E 3DHKH 4CH2B 1Z1JA 1PPFE 2FOHA 2ZU1A 5AF9H 2J9NA 1FI8A 1YM0A 2WUBA 1XUGA 5JBTA 4DW2U 2SGDE 1P12E 1PPEE 4ABHA 1C1VH 1K1OA 1KXAA 2AIQA 4FUJA 3D62A 3RXRA 3LGVA 3KQEA 1G36A 2XBVA 1TBQH 3VPKA 5F8ZA 4CR9A 2A32A 3QK1A 1LKBA 1O5EH 1UTPA 1N6XA 2BOHB 2NU1E 1ELEE 1MTVA 3GY2A 3VFEA 3M36A 4B2BA 4YO9A 2QC2A 5FXLA 3VEQB 1JBUH 1Z6JH 4Q7YA 3BIUH 2UWLA 5DP8A 2SGPE 2VWOA 2A45B 5L2YH 4GAWA 4AX9H 1O2XA 1CHOG 1OWKA 1TBZH 1V2UT 3GY3A 1D3QB 2C8ZB 2FP7B 3TJUA 1O3IA 1C5QA 4HZHA 3RLWH 5GWZA 3PB1E 3MU4A 1J16A 1RFNA 1AO5A 1EAUA 1S81A 6ESTA 2W3IA 3KQBA 5EODA 3DA9B 1O3AA 2BVRH 1TA6A 3OTJE 4CRFA 3SV9A 3GYMA 3U98H 4K1EA 1SGYE 1EKBB 2ZHEH 1S83A 3A7VA 3HKJB 1ZSKA 1ELAA 5GIBA 1EAWA 4ASHA 3CS0A 2BD7A 3K9XB 3M5NA 1Q31A 3RXUA 2AMQA 1WQSA 2FOFA 4B73A 2ZFFH 3HGNA 1TNJA 1TNLA 1HIAA 3QUMP 3BEUA 4HGCA 2F9BH 1GJ7B 2HLCA 3UWIA 1A0LA 1OP8A 3UOPA 1YCPH 2D8WA 2GVFA 4ZXYH 2GCHF 1JWTA 1IQMA 1UVPA 4K69A 2XNIA 1BHXB 1CT2E 1P9UA 2R9PA 4U2WA 2ZA5A 4XBBA 1CBWB 4MNWA 3UNSA 1GVKB 3GYLB 5CHAB 4ABBA 1JOUB 1GHBG 1UVTH 3MH4A 5LH8A 3UUZA 3PTNA 1ELDE 4ZHAA 1P3CA 2ZHQH 9ESTA 5IDKA 1IQNA 3DFJA 3UNQA 1BITA 4U01A 2BTCE 1CA0B 4BANB 2OBQA 2WPHS 2ALVA 3A7TA 3RXOA 5FAHA 1CA0C 4YESB 1JRTA 3K6YA 4NIVA 4Y71A 1DS2E 1CT0E 4UFFH 2TGAA 3NZIA 1D9IA 4X6OA 1TPPA 3JZ2B 2A4GA 1O3OA 1SLWB 1O37A 2O8LA 3ATLA 2OC8A 1O34A 2CMYA 1NN6A 1QBOA 3LGYA 1C5LH 1L0ZA 3LH3A 2XBXA 4O3TA 2HALA 2ZO3H 4BXSA 4ISIH 2XCFA 4B71A 2GDEH 1W2KH 1DSUA 1E35B 3BN9A 2FM2A 3TVJB 1SI5H 1DDJA 3HPTB 2FOGA 2RG3A 3RXIA 1O5BB 2GMTC 5CMXH 2GDDA 2BY8X 1UCYH 3QZQA 1V2KT 2Q1JA 1DVAH 4NSVA 4A92A 1Q2WA 4OS6A 3DT0H 3EQ0H 4BAMB 1BCUH 1O39A 5TCAA 2EC9H 4HFPB 1TE0A 2F9NA 4CHAC 1TX8A 2FI3E 1SL3A 1ZSJA 5IYTA 4B75A 2GTBA 4ISLA 1H9HE 5FPTA 1A5GH 3H7OA 3Q3KA 1SBWA 3A83A 3M5LA 3OYPA 3ZVDA 1Y5AT 1GMCF 1NU9A 1C9PA 2TBSA 7ESTE 1GHBF 3Q3XA 5F8XA 3A82A 2G81E 5TJXA 3SORA 2OINA 3FP8E 3RXJA 3A8BA 3RM0H 1W10U 4ABIA 4OS4A 4Y8XA 3GCHC 1WUNH 1GBAA 1GJBB 1K2I1 3RXEA 2ESTE 2IPHA 1ZJKA 1HFDA 3SJIA 3LKWA 3SJOA 5FHTA 3EAJA 1WTHD 2H6MA 2H5CA 2ZC9H 3PWCA 4I7YH 1TGNA 3A85A 4Y11E 2FODA 3P17H 1VITF 1GI7B 1NFUA 5BPEA 1PJPA 1W13U 1W7XH 1JIMA 4F4OC 3STJA 3DFLA 3A88A 5JDUB 2VGCB 1AB9C 4J2YB 4IN1A 1AGJA 3LIWA 2JETC 3UREA 1V2NT 4GCHG 1SSXA 4TYDA 3UQOA 3IG6B 1EOJA 1ZRBA 1ELGA 2QIQA 1QB1A 1HAVB 2FTLE 1BTYA 3LC5A 1LPZB 1WV7H 4O97A 3M7QA 4JYVH 1GI4A 3SV2H 1NY22 5AFYH 1QJ6B 5FCRA 3SQHE 3GCOA 1A2CH 2XCNA 5AFZH 1FDPA 4SGAE 5C1YA 1HAIH 2PKSB 1GVLA 1LO6A 2PSXA 1P2OA 2GZ7A 1O2GH 3NUMA 3MNCA 1UK4A 1INCA 1AQ7A 2TIOA 3KQDA 3KGPA 1TLDA 1GBDA 3G01A 2BB4A 2WYGA 2PLXA 2W26A 2XC5A 1F92A 2ZTXA 5K7RA 3BF6H 5ABWA 2VH6A 1S6HA 2QCYA 1YPKH 2ZU5A 3E6PH 3GDVA 4AFSA 1ELVA 4Y76A 1F2SE 4AZ2B 1AU8A 1TRYA 5A2MH 3BSQA 4AORA 1BZXE 1MBMA 1C1UH 4BAHB 1A4WH 1UO6A 3BG8A 3RXTA 1OWHA 2LPRA 2OLGA 1ARCA 3M7UA 3AW0A 2AH4X 3SGBE 4LOYH 2PWXA 1H8DH 1GHAG 1SGFG 3BEIB 4FVDA 2G52A 1C2EA 2NWNA 1SGCA 3BG4B 1C1WH 1BTPA 2TGDA 1DM4B 1TGTA 4KTCA 1LVOA 2K1QA 2OUAA 4INKA 3TH3H 5DO4H 3TPIZ 4NIXA 1GHZA 3RXAA 1GDUA 3SHCH 4AB9A 4X1SU 3KCGH 1SGNE 1O30A 1JRSA 4I8KA 1KLIH 1TQ0B 2OP9A 3KHVA 3O8BA 3ODFA 5A8XA 1K1MA 3S9CA 2RA0A 2FPZA 1BTUA 3CENA 3URCA 1OWJA 2FYQA 1Z8IB 3LU9B 4KTSA 1DY9A 2Y82A 3EE0B 4FUEA 5DP5A 2ZG0H 1V2RT 1AB9B 1OX1A 1DOJA 1SLUB 2FI5E 2PW8H 2WINI 3BTHE 1FN6A 3A89A 1P02A 3QO6A 4ZKSU 3EYDA 2BLQA 1GI5A 2ZHDA 1A7SA 4MPXA 1MQ5A 1UHBB 3D49H 1T8LA 2BD5A 1YBWA 4H6TA 4B74A 1HNEE 2G4TA 2JH0D 2ZHFH 1K1NA 3URDA 1O3DA 3S7HB 1Q3XA 4THNH 3T27A 3RDZA 1MAYA 1F0TA 3DUXH 4ABDA 1QNJA 3TJVA 3AVZA 1LKAA 1VITG 1LHEH 1TOCB 1GCTC 4ZHMU 4K8BA 2QXHA 1FY3A 1T8MA 1CT4E 1ELTA 1UTJA 2BLWA 1F0UA 2C4FH 4AFUA 2F9OA 1FONA 3UOUA 1SMFE 3AAVA 3KEEA 2CHAB 1P04A 2J2UA 3SV7A 2TGTA 3FANA 4X8SH 2QYIA 6LPRA 1QY6A 4NZQA 2FYRA 4YOJA 4X2XA 2BZ6H 1FY5A 1O36A 1ZGVA 3T29A 1HAPH 3NXPA 2JKHA 5T6GA 4NG9H 2O8MA 1P2KA 2ZGHA 2GV7A 3VB6A 1PYTC 4UEHH 3RU4T 1GVZA 5C2ZA 1HV7A 3MH6A 4J1YA 2ZECA 5ESTE 3SI4H 2FLBH 4ABFA 3UFAA 1C4Y2 1BQYA 4INLA 2BD2A 1GJ9B 1E36B 5EU8A 2PKAB 1ANDA 3VB3A 3QN7A 1O2YA 4PROA 1EZQA 5FX5A 2LNCA 2XC0A 3M37A 4YOGA 3BIVH 4B2AA 2FDAA 3ESTA 1WCZA 3BV9B 2WPJS 2ZQ1A 2W3KA 2A5AA 2Z9KA 5A09A 4X6NA 2A4QA 2GGVB 1HAYB 2VWMA 4UD9H 3VB7A 2P8OC 3PMBB 4E06H 4YTAA 3GDUA 1A46H 4GSOA 2FXRA 2ANKH 1TB6H 4X1RU 3SNCA 4X1PU 5GCHG 3ZYDA 1QQ4A 2FLRH 1UCYK 3GISB 1AVGH 1Z71A 2WPKS 1GHVH 1SFQB 1XMNB 4NCYA 1C1QA 1UCYE 3SHAH 3SN8A 2GMTB 4D9RA 5FBEA 3A84A 1L1GA 4MQAA 1BBRK 1AHTH 1AIXH 1UVSH 3A7WA 2GCTC 5BRRE 4CRBA 4RKJB 1FY1A 4ZKRU 3OSYA 1P2NA 2ZQ2A 3MNSA 2Y5FA 1ELCA 4NA9H 5EQSA 1O31A 1Y3WA 4U30A 1RD3B 1AFQB 1S85A 1DSTA 2Z3EA 1C2GA 4X8UH 4AG1A 2BD9A 2P16A 3PMAB 1H1BA 3S7KB 1D6WA 4JK5A 1CGIE 3U8RH 3ATKA 3SGQE 4IBLH 4Y8YA 3ATMA 1CGHA 1PPZA 4ZROA 1QJ7B 2SNWA 2AGIX 9LPRA 1XVMA 3RXBA 2BY6X 1C2FA 1NM6A 1B0FA 1KXFA 1L2EA 4U32A 2ZI2H 5I25A 1IQKA 2Z7FE 2QF0A 1C2KA 3A8DA 1SR5C 1TABE 1O2QA 1DWCH 5FPSA 4DT7B 1LVBA 3U1IB 2VJ1A 1J14A 1DLKB 2BOKA 1HDTH 2EA3A 2VVCA 1C5TA 2VIOA 1P11E 5AVDA 1MTUA 1XKAC 3T25A 3SUGA 1Z1IA 5DKMA 2FOAA 4AGJA 1O3PB 2UUYA 5EW2H 1HUTH 1GHYH 2RDLA 2Z3DA 2FZZA 3GY7A 5AHGH 3GICB 1GI8B 1BMNH 3EA8A 2HVXA 2VIQA 1AZ8A 3SOSA 4IMZA 1HRTH 3N7OA 5PTPA 3MTYA 4MNYA 2BY7X 4JZDH 4BAKB 3F9HA 2ZGJA 2VWLA 2UUJB 1A3BH 3GY4A 3MWIU 1LDTT 1O2SA 3STIA 1EAIA 1BRBE 3EA7A 2FX6A 1C5OH 4D8NA 1RRKA 2WUCA 1C2HA 1ZTJA 2NU0E 3GOVB 1SGRE 3NKKA 4TPIZ 1IQFA 2NU2E 1UTLM 2NU4E 4X6MA 1J8AA 4FUGA 1NRPH 2BVSH 1HIAB 3SU1A 1BTXA 4MTBA 4VGCC 4KGAA 1FJSA 1EASA 2H9EH 1ELFA 1DWBH 1EZSC 4YT7H 2GZ8A 2BD4A 1H9LB 4CBOA 3ZZ4A 1QURH 1CO7E 3FFGA 1P3EA 1K1PA 5FBIA 1TMUH 3K6ZA 4YZUA 2ZU3A 1PFXC 1T7CA 1V2QT 3UY9A 4XBCA 1A5HA 2OBOA 1ZZZA 3PO1B 2ZTZA 1GBJA 1QBVH 2IJOB 4OS1A 1AUJA 2AYWA 3H5CB 1KLTA 2QGRA 3UR9A 1O5CB 1C1PA 1C2DA 2XBYA 2H2ZA 1A3EH 2O8UA 1MU8B 1MAXA 1GBCA 1ZPZA 1P03A 2R0KA 1OKXA 2ZGBH 2Z94A 1GJ6A 5A0AE 1GGDB 1BA8B 3U1JB 3OU0A 2C93B 2W5EA 1SGEE 1PPGE 1PQ5A 1EZUC 4CRAA 3E8LA 4RN6A 1GBHA 1EB2A 2ANWA 2HPPH 1UVUH 3IITA 1C2IA 2PGQB 5LPFA 3LOXA 1P9SA 3VB4A 1B5GH 1D3PB 1EJAA 1P0SH 1RIWB 1V2VT 2FMJA 1AWHB 2AEIH 1GBLA 2EEKA 3SU6A 3M35A 4X1QU 1FIZA 5EOKA 1V6DA 2ZFSA 4AGKA 1YF4A 7KMEH 3ZVCA 4H42U 2XXLA 1MU6B 2GV6A 1ANCA 1EUFA 1QRWA 2F3CE 1H8IH 2FWWA 5C1XA 1GI6A 1NU7B 2ZKSA 3SV6A 1C5RA 1XKBC 2G4UA 2ZDVH 3HGPA 4GHQA 3TH2H 3S0NA 1TOMH 2STBE 3ZZ9A 4TWYA 3E3TA 1QB6A 1HAXB 1RJXB 3V12A 1UK2A 5E0HA 1UTKA 1MKXH 2WV5A 3A7ZA 3LGIA 3LPRA 2A4OA 2VB0A 1C5UA 2PFEA 1BMMH 1GL0E 1P09A 1XXFA 1O2RA 1F7ZA 5LPRA 4UONA 1NRRH 2D1JA 1HJAC 1G2MA 3RXQA 3SZNA 6GCHG 3QGJA 1Y3XA 5T3HA 1AI8H 1LQDB 5JBAS 5A0CA 1CHGA 2TRMA 3TK6A 3TGKE 2QF3A 3F1SB 3RU4D 1ZJDA 1QQUA 1O3EA 2M5TA 1X7AC 5SGAE 4TWWA 1AVXA 3T2NA 3RUOA 2FOBA 1P01A 4YT6H 2QV1A 1DX5M 1BHXF 3SU3A 3Q77A 3TNSA 1GI0A 4WVPE 1EP6A 1SLXB 2KAIA 2FIRH 2PGBB 1YYY1 3SUFA 2VU8E
chains in the Genus database with same CATH superfamily
3NK8A 3N99A 4GCHF 5GDSH 3F9GA 1O33A 1GBIA 2OK5A 3MI4A 4FUIA 1HAVA 1KXBA 4F48B 2Z3CA 1MUEB 5C20A 4TSFD 5F03A 3S9AA 4Y7BA 1NT1A 2O8TA 3VB5A 1GJAB 2CHAC 3KF2A 2CF8H 1QIXB 1TPSA 3ATWA 1XUHA 1GPZA 4IS5A 2YMSC 1EAXA 1NRSH 2BLOA 1SOTA 5A8YA 1SFIA 3H7TA 2GCHG 2ZP0H 1C5PA 3RXCA 1O3HA 1VCPA 3FZZA 4X8TH 1GMCG 4NIYA 1DFPA 1S6FA 1OYTH 3HKIB 2Q6GA 2F9UA 3TGJE 1P10A 2BM2A 1C1SA 2KZ4A 2OC7A 3T26A 5EW1H 4NGAH 5L30H 1Y5UT 2VIPA 3MH5A 3RXGA 4DCDA 2TGPZ 4WH8A 4BAQB 1ANEA 2QY0B 3R0FA 1SVPA 1LMWB 1TGBA 2VWNA 3RLYH 1Y8TA 3SV8A 4ZKNU 4LZ4B 1HYLA 2BX3A 1YPHC 1P2QA 4ZAEA 3RXKA 2HPQH 1O3JA 1LHGH 1V2ST 2Z9LA 4Z1MD 1WSSH 1YGCH 1NPMA 3T62A 4CBNA 4MPUA 1FX0B 1TYNA 1KMHB 4WJG2 4Q80A 1QRXA 2JH5D 1YPGH 1UMAH 1WAYB 4ZUHA 1AZZA 2JJ2D 1YPLH 2JETB 3SBKA 1VKYA 4CRGA 1K21H 3RXMA 1J15A 2P59A 4CR5A 2ANMH 1TA2A 1W3CA 1FIWA 2R3UA 2ODQA 3V0XA 1E37B 2AMDA 3IWMA 2ALPA 1O2HA 4ABJA 1NS3A 4Y10E 3OFND 1RXPA 4FU9A 1LVMA 4X2YA 3ZZCA 3QDZB 3PV2A 3RXFA 5H4IB 2P8OB 1TPOA 3KIDU 1GJCB 1HLTH 1ACBE 2R2WU 1BMAA 2C8YB 2B9LA 4K1SA 3GCHB 4Q63A 1O5FH 1QL8A 1EATA 1HBTH 4IC5A 2H1UA 4B1TA 1O3LA 2V3MA 3F9FA 2BQWB 1CGJE 1NROH 5KEDA 4NSYA 1H9IE 3MMGA 2Y7XA 2QXIA 1GGDC 1G30B 1KXDA 1GMDF 4KTUA 3WW7A 3ZZDA 1HAGE 2AMPA 3M3SA 2HRVA 3SU0A 1VZQH 1ANBA 1O3NA 1N6YA 4K1TA 3TNTA 3LC3A 1YC0A 5JPMH 4CHAB 4HTCH 2R2MB 3KYFA 1O5GH 1QFKH 4RSPA 1LQEA 3GY6A 3FO8D 3MYWA 2Q6DA 1TQ7B 3FP6E 3B23B 3L6PA 2KCPA 2ZCLP 4DOQA 1MTNC 1RS0A 1GBFA 1K1LA 4D9QA 2ZHWH 1OWEA 1XVOA 3UAIC 1ZR0A 1M9UA 3A8AA 1QGFA 4K8YA 2WPMS 3A86A 1DITH 3D23A 3PLPA 2AFQB 1TNKA 1ZLRA 5JBBS 2HNTC 2ANYA 2F91A 2HWLB 3BTQE 2VGCC 1YLDA 1T32A 3HK6B 2P3UB 3A7YA 3P95A 3KYGA 2OQ5A 3PRDA 3EA9A 1DLEA 1LTOA 2BLVA 2GKVE 4WY3A 1QL7A 4ASUD 2V35A 3U69H 1UK3A 5E0JA 3DCLA 1AFQC 1E1RD 1ETTH 3K65B 4OGYA 5I46H 4WWYA 1AE8H 3ENSB 4GVUA 4ABEA 3LDXH 2BDAA 1ZPBA 5C5OA 1FNIA 4ACBA 3UB0A 3ZZ3A 4AFQA 2OQUA 2BDCA 5TCCA 1G3BA 4Y7AA 1W0JD 1P05A 2ZNKH 1GI2A 1EQ9A 1S5SA 1GJ8B 3NCLA 3QLPH 3LGWA 5F8TA 5A0BA 1QTFA 4O3UA 4I8JA 2VINA 1E34B 1MQ6A 4Q7XA 2IPQX 1V3XA 1ZMLA 3RXVA 1QHRB 1K1JA 1BTZA 1YCPK 4JCNA 3RMOH 3MO9A 1OP0A 1BJVA 4I8HA 5EXLA 5K0HA 2ZFPH 1CQQA 3LT3A 3RXDA 3ZZBA 5JB8S 2XBWA 2QF4A 3FOAA 3MFJA 1G32B 3SO3A 5C1UA 1YY3A 1OOKB 1SHHB 2H9HA 1DANH 1PYTD 1D3DB 4ISOA 1KXEA 1EFRD 1L1NA 4Z6AH 2W6JD 2BQ6B 3QX5H 3MNXA 1GJ5H 3CS7A 4Y6DA 1NFWA 3FP7E 2BXTH 1SQRA 4KP0A 1FAKH 4OM9A 1MKWK 5DJ7A 3ATIA 1AN1E 3HATH 3H09A 3B9FH 2A5KA 1AD8H 3VG8A 2AS9A 3RC5A 3BTDE 1UTOA 1C1TA 4LK4A 1C1RA 1MBQA 1O2WA 2VBCA 3ZZ5A 3MH7A 1V2TT 1SOZA 4MLFB 1F0RA 3QZRA 4MVNA 3ZYEA 3P8FA 2JDID 1TNGA 1SHYA 1K9OE 1TRNA 4KKDA 2OD3B 3OY5U 5FX6A 3U8TH 1ZHMA 2B5TB 2ZFTA 4JK6A 2BDBA 1SQTA 1YCPM 1CA8B 2QN5T 1KTSB 1B7XB 1QL9A 1ID5H 4B6FA 3OAAD 5ESBA 4OGXA 1O2JA 1C4V2 4IN2A 1T4UH 4Y0YE 3UIRA 2ZWLH 3U8OH 1AFEH 1HJ9A 3NWUA 3B8JA 4JYUH 3TJNA 4K60A 1MCVA 1KY9A 4K3JA 1TX7A 3O8RA 4JZEH 5KGOA 2RDEA 4D76A 1P2MA 2FO9A 4AYVB 1HXEH 2LP6A 2BXUH 4ESTE 1TALA 1AUTC 1GHXH 1UTNA 2FS8A 3W1EA 2A7CA 1V2WT 2BVXH 3TIUA 3RXLA 1DWEH 1SGTA 2GT8A 2ZFRH 2QF5A 1FPHH 4BNRA 4A1TA 1CE5A 4OS2A 2BYAX 1E0FD 3SQEE 2WV4A 1MZDA 2Z9IA 5GXPA 1PQ8A 1F5KU 1EJNA 1GMHG 2A0QB 2ASUB 4FUCA 1O2LA 1DWDH 1THPB 2UWPA 3PM3A 2TPIZ 3FZDA 2Y7ZA 2B0FA 4X6PA 3V13A 2XW9A 3RXSA 1PQ7A 1Y59T 4BTUB 3LGTA 2G5NA 3U9AH 4YLQH 2GCTB 4DURA 3SU4A 1QBNA 5GJ4B 1A1RA 4MG3A 1O35A 1FZZA 3UQVA 2A4RA 4CH8B 3PLBA 2PP6A 1O3MA 5T6FA 5E2PA 3QTOH 3PV5A 4KELA 1A0JA 3LJJA 4LXBH 3MU0A 1G3CA 1KIGH 3BG4C 2AIPA 1TMBH 2CV3A 1ZHPA 1L4DA 6CHAC 1HGTH 3MNBA 3SNDA 3UWJH 1O2IA 2WHXA 3FVFB 3LGUA 4XRNA 1OWIA 2EI6A 4ABGA 4CREA 1K0HA 4ZKOU 2J98A 5DK1A 1BRUP 2IOTA 1GDNA 3GDSA 4WMFA 2PV9B 1TNHA 2HGTH 1MD8A 1WDIA 2Z9GA 4I8GA 5DP4A 1GDQA 1U6QA 1TPAE 1O3CA 2L6OA 1N1LA 2J5UA 3RXPA 2ZU4A 2AGEX 1O2PA 1YPHE 1WOFA 1DXWA 1O3KA 1GJDB 1W14U 4FVBA 5EQQA 4NFEA 3ZVFA 2XTTB 1G37A 5JB9S 1SB1H 3V7TA 4IW4E 1DUEA 1Y3VA 6CHAB 1WU1A 1COWD 2F9PA 4FXGH 1LPGB 3FAOA 4FUBA 1FV9A 2BX4A 1FY4A 1RTLA 8LPRA 3O8DA 8KME2 1NRQH 2PKSC 3KL6A 4R0IA 2ZZUH 3AAUA 4JZ1A 5DP3A 1LHDH 2SGAA 3A8CA 1NFXA 3ZZ6A 2I6QA 3SU2A 1L1JA 2J94A 1F5RA 4D7FA 5B6OA 4I31A 1HPGA 1W7GH 1UTQA 2FESH 3P8GA 4OS5A 4RT0A 1IOEA 3PO1C 1V2LT 2A7JA 4NFFA 4RI0A 1WBGB 5T6DA 1BTHH 5L2ZH 1CVWH 3LJOA 1K1IA 2ZDKA 3Q00A 1PPCE 2EQNA 3QTVH 1NTPA 2V0BA 1FXYA 3S9BA 1EJMA 3SW2B 2ZPRA 8GCHF 3FN8A 3OY6U 4NZLA 1O0DH 1V2JT 1GL1A 3P8OA 1O3BA 3ELAH 1SGPE 5F6MA 5FPYA 1C1OA 1O5DH 4Q4LA 2ZPQA 1SPJA 5J4QA 3ZZ7A 1C5XB 1SLVB 2OXSA 3AW1A 5C94A 2OTVA 1T8NA 1AVWA 3N7EA 1SC8U 4H6SB 1ZHRA 5EPNA 1CBWC 2O8WA 4FOUC 1G3EA 4HI3A 1XUJA 1O2NA 4I33A 3ZVAA 3TK9A 2GZ9A 1C2MA 1VCWA 4AC9A 2KCAA 4O03A 2A5IA 1G3DA 1PPBH 4XE4A 1CSOE 1UTMA 3LH1A 5J4SA 3SU5A 3SJ8A 1EPTA 1P2IA 2ZGCA 1HCGA 1EP5A 2YMSB 5GNDA 4TY6A 1AMHA 1GMHF 2VIVA 4H4FA 1C5WB 1Z6EA 2F4LA 1ESAA 1J9CH 1C4U2 3M3TA 5FCKA 4JMYA 2IJD1 3PROA 1T31A 3MO3A 4UDWH 4FUHA 6GCHF 1YLCA 1C5VA 3BTTE 2C90B 2UUFB 4ZH8A 1BT7A 1OXGA 1FAXA 4F49A 2A31A 1DXPA 2PHBA 1BRAA 1LVYA 1TAWA 3PYHA 2P3FH 1BJUA 2PR3A 3P6ZB 3SJKA 5EPYA 1OP2A 2ILNA 2RCEA 1KDQB 1O2ZA 2ZF0H 1MTNB 3M5MA 4GUXA 2KAIB 2FOMB 1UVOA 2ODPA 4M7GA 4X8VH 5HM2A 1TMTH 1DT2A 3UR6A 1O2KA 4X2VA 4YM9A 1AY6H 3MHWU 2YNBA 1ESTA 2G51A 1HJAB 2P94A 3VGCB 1XM1A 3A80A 4FUFA 1QA7A 4E7RG 3SJ9A 2F83A 2I6SA 4MPWA 1FN8A 1O2VA 2F9VA 3V3MA 2AERH 1MTSA 1DY8A 4ISHH 1KYNA 1EOLA 2ULLA 4B76A 1C2LA 5DP6A 1IQJA 4YLUA 4ZMAH 1JIRA 3SUEA 3F9EA 1NBME 2V3OH 2SFAA 1VCQA 3LONA 1HAZB 4ISNA 3M61U 2JH6D 1ZMJA 3P8NA 1K28D 3RXHA 1TNIA 1ETSH 1IQHA 1SQAA 3QGNB 1LPKB 1C1MA 2ZCKP 1NO9H 2OCVB 4XBDA 2R0LA 1G2LA 1G9IE 3TJOA 1MZAA 4XSKU 3L33A 5GCHF 2KX4A 4WMDA 1A5IA 1E38B 3RC6A 1TONA 1ZTKA 1YPJH 2WSSD 5CDFE 4MNXA 4UFEH 2JIZD 2ZTYA 1YP9A 4SGBE 1O2MA 4A1VA 2P95A 2C3SA 2V6NA 1B0EA 5JYIA 3TK5A 1MH0A 4I8LA 3O8CA 2HOBA 1OYQA 1P2JA 3RMMH 1C5YB 2CXVA 1EX3A 4X0WU 3BTGE 4MDSA 3BTWE 5GPIB 2ODYB 2BDGA 3ZV8A 5F53A 1SKYE 2VH0A 5C5NA 1S84A 2BHGA 3CP7A 3GS9A 4JZFH 1HXFH 3E90B 4AB8A 3MQKC 4WMEA 2J4IA 1FPCH 2RFKC 1AWFH 1VR1H 3GCTF 4Y0ZE 4GPGA 4DIIH 7LPRA 3T28A 1VJ9U 2V7QD 1EPTB 3SNEA 2Q6FA 2R3YA 1ZRKA 2XC4A 2KCOA 2BZAA 3L3TA 1S0RA 3P70B 5C67A 2ZDAH 4A6LA 2ZDNA 1YPMH 4WH6A 3E1XB 1DE7H 2CN0H 2V3HH 4DVAU 4K5ZA 5CE1A 3RM2H 3GY5A 4NWKA 1LCYA 1DPOA 1LHCH 1THSH 2WV9A 1GBEA 2VIDA 3R3GB 4CRCA 1NC6A 2VVUA 1RTKA 1Y3YA 4NA8A 2W7SA 3K2UA 3TU7H 2PTNA 1XUKA 4DGJA 3SZEA 2FI4E 7GCHF 2B8OH 5EXMA 1ABIH 1QB9A 1XXDA 2AHME 1BUIA 2FTMA 1W8BH 1A61H 5HMAA 1KDQA 4AN7A 1BB0B 1GI3A 3C27B 4FETA 4FUDA 1GBMA 5HM9A 5EQRA 1TRMA 1GCDA 1ZTLA 3BTEE 5FL7D 3RC4A 1W0YH 1RGQA 4UFGH 1N8OB 1T4VH 3T5FH 2Y81A 1ORFA 1BBRH 1IAUA 1D4PB 1H4WA 5T1VA 1VJAU 5EXNA 2G5VA 1K22H 3MO6A 4LZ1H 3DD2H 3KQCA 1C5NH 3MU5A 4TT3D 5CHBA 3A87A 3KQ5A 1EPTC 4AG2A 3NPSA 1P57B 1C5MD 2P3TB 4DG4A 1JXPA 3E0NB 3M3VA 5DP7A 3I78A 2FEQH 2PUQH 3SUDA 1IQEA 1KLJH 1O2TA 2J92A 4ABAA 2C8WB 2BDHA 1P8VC 1F5LA 4DY7B 2H5DA 3ZZ8A 1MKXK 2STAE 2YOLA 2SNVA 2GX4A 1NZQH 3GCNA 1MTWA 1ZSLA 1W0KD 2M2AA 1FLEE 2A2QH 3I29A 5HYOA 1ZMNA 3OX7U 5DP9A 1ETRH 3WY8A 3F6UH 2DE9A 3PWBA 2L74A 5C3NA 3EDXB 3I77A 3F3BA 2HNTF 1P06A 1DUAA 1Z8JB 1T8OA 2FOEA 2P93A 2LELA 1QJ1B 2THFB 3BTME 1GJ4H 3MU8A 4FU7A 1JMOH 1KSNA 4CRDA 5A8ZA 4Q7ZA 5DSFA 1ARBA 1HB0B 2AGGX 2XYAA 1KTTB 1QA0A 5G4BA 1D3TB 3SI3H 1GMDG 3GY8A 1BMLA 3ZV9A 4JYTA 3KN2A 1AKSB 2BD8A 2EI7A 4XOJA 1GI1A 2D2DA 1YKTA 3U28C 2VIWA 1SGFA 2IN2A 4R8TB 4BAOB 2VVVA 4BTIB 3UTUH 1CU1A 4Z0KA 1Z7KA 4E05H 1O2UA 2UUKB 3OEHD 3P92A 2J34A 4Y79A 1L4ZA 1CHOF 8ESTE 1EZXC 2HNTE 2SGEE 1ZYOA 4FU8A 3PMJA 3TH4H 1XUFA 2A1DB 4NIWA 2ZDLA 3W95A 2J38A 1TFXA 3RU4E 4MNVA 2PSYA 2WPLS 3TGIE 2ZPSA 1VGCC 1TIOA 1C5ZB 1ABJH 1SG8B 2A7HA 4O9VA 1OSSA 3W94A 2Y6TA 1ZOMA 1C2JA 1GHAF 3KNXA 1LHFH 1TWXB 1TGSZ 3GCTG 1BTWA 3E0PB 2Y5GA 2BD3A 1NRNH 1OS8A 3Q76A 2Y5HA 2SGFE 1IQLA 5JBCS 1BBRE 2WYJA 5DGJA 3ITIA 4MPVA 2DE8A 1N8OC 4A1XA 1C9TA 1W11U 5C0TA 1W0ZU 1QR3E 3S69A 2O9QA 2ZEBA 4IC6A 1FMGA 1O32A 3AASA 2ZU2A 3M5OA 4B6EA 2H9TH 1RIWC 1ELBA 1FQ3A 1FUJA 1MCTA 1IQIA 1PPHE 1Z8GA 4ZXXH 2XOKD 3ZVBA 4ACAA 1AE5A 2FX4A 3OEED 1NFYA 1BRCE 1MKWH 5E2OA 3ZVGA 2W7UA 1WTGH 1UHBA 4RKOB 1GWAA 4WXVA 1S82A 3PMHB 2QXJA 2Y80A 2FS9A 1BOQA 1IQGA 2WPDD 4UE7H 3TLOA 3VXEH 5ETXA 2G00A 2G8TA 3PLKA 4WF8A 4XFQA 4BOHA 3F0OA 1EB1H 2SGQE 4NWLA 1WQVH 2BMGB 1OPHB 1TBRH 1W12U 2OC0A 4WXIA 5EG4A 3JZ1B 2CK3D 5EGMA 2PUXB 3VGCC 1C1NA 1TGCA 2J97A 1TX6A 1MD7A 4INHA 4E7NA 5E0GA 1UJ1A 1THRH 1V2PT 4X1NU 4JZIA 1XX9A 1GHWH 3RMLH 2RA3A 5LGOA 2PTCE 1GI9B 5L6NH 3BTFE 2QAAA 4BTTB 1DICA 3SNAA 2Z9JA 2ZCHP 1F0SA 3MOCA 4IMQA 1PQAA 4TPYA 1SGQE 3RP2A 1S0QA 1GBTA 1YPEH 2ZDMA 1WYKA 1C5SA 1V2MT 2XWBI 1AKSA 2QXGA 4IGDA 1VGCB 1VITH 2EI8A 4VGCB 2CGAA 1GCTB 2BDIA 2BY9X 3A7XA 3E91A 1V2OT 2A2XH 4OS7A 2BDYA 2CJIA 4TY7A 4AFZA 1D6RA 4BXWA 3M7TA 3RMNH 1E1QD 5HXFA 1UW7A 1XUIA 2YNAA 5E8EH 3ZZAA 2B7DH 3HK3B 2GJGA 3TITA 1O5AB 1HJ8A 1SGDE 4GLYA 4DJZB 1SQOA 2XRCA 3PTBA 2ZIQH 2C8XB 4GHTA 1Y5BT 4ZHLU 1RTFB 1GG6C 2PKAA 3ZIAD 1O2OA 2ZFQH 1GBBA 7GCHG 4A7IB 3VXFH 2UWOA 1Z8RA 4Y8ZA 4ZCNA 1HAHH 1BIOA 3SNBA 2GP9B 1OWDA 1HAOH 3Q3YA 1IHTH 2G55A 2KR7A 3C1KA 3QWCH 3EGKH 1KXCA 3D65E 3BEFB 1SGIB 1QRZA 1O3FA 5LPEA 4Q2KA 1EXFA 4DIHH 1ESBA 1GBKA 5DPAA 3UNRA 2XWAA 2D26C 3WWBA 5KECA 5HGGA 1O38A 4AOQA 2BQ7B 1A0HB 3BTKE 2GD4B 1J17T 1YWUA 1ZGIA 2ZGXH 2Z6BD 1QCPA 3PV4A 4NA7A 3MU1A 4YOIA 4AYYB 4B2CA 1FY8E 4A5TS 2K0QA 8GCHG 2FOCA 3UPEA 1NESE 3F0PA 3ODDA 5CHAC 1ZPCA 3ZVEA 3E16B 4XDEA 2WPIS 4X2WA 2BY5X 4K2YA 5DG6A 2VNTA 4UFDH 4I32A 2HLDD 3A81A 4D7GA 3SGAE 1BDAA 3F68H 2DUCA 1GG6B 1Y3UA 1IHSH 1O3GA 2GT7A 2QA9E 2CF9H 2OC1A 4QT8C 2J95A 1MMJN 2NU3E 3DHKH 4CH2B 1Z1JA 1PPFE 2FOHA 2ZU1A 5AF9H 2J9NA 1FI8A 1YM0A 2WUBA 1XUGA 5JBTA 4DW2U 2SGDE 1P12E 1PPEE 4ABHA 1C1VH 1K1OA 1KXAA 2AIQA 4FUJA 3D62A 3RXRA 3LGVA 3KQEA 1G36A 2XBVA 1TBQH 3VPKA 5F8ZA 4CR9A 2A32A 3QK1A 1LKBA 1O5EH 1UTPA 1N6XA 2BOHB 2NU1E 1ELEE 1MTVA 3GY2A 3VFEA 3M36A 4B2BA 4YO9A 2QC2A 5FXLA 3VEQB 1JBUH 1Z6JH 4Q7YA 3BIUH 4M9FA 2UWLA 5DP8A 2SGPE 2VWOA 2A45B 5L2YH 4GAWA 4AX9H 1O2XA 1CHOG 1OWKA 1TBZH 1V2UT 3GY3A 1D3QB 2C8ZB 2FP7B 3TJUA 1O3IA 1C5QA 4HZHA 3RLWH 5GWZA 3PB1E 3MU4A 1J16A 1RFNA 1AO5A 1EAUA 1S81A 3DSPA 5DN6D 6ESTA 2W3IA 3KQBA 5EODA 2EY4C 3DA9B 1O3AA 2BVRH 1TA6A 3OTJE 4CRFA 3SV9A 3GYMA 3U98H 4K1EA 1SGYE 1EKBB 2ZHEH 1S83A 3A7VA 3HKJB 1ZSKA 1ELAA 5GIBA 1EAWA 4ASHA 3CS0A 2BD7A 3K9XB 3M5NA 1Q31A 3RXUA 2AMQA 1WQSA 2FOFA 4B73A 3CNRA 2ZFFH 3HGNA 1TNJA 1TNLA 1HIAA 3QUMP 3BEUA 4HGCA 2F9BH 1BMFD 1GJ7B 2HLCA 3UWIA 1A0LA 1OP8A 3UOPA 1YCPH 2D8WA 2GVFA 4ZXYH 2GCHF 1JWTA 1IQMA 1UVPA 4K69A 2XNIA 1BHXB 1CT2E 1P9UA 2R9PA 4U2WA 2ZA5A 4XBBA 1CBWB 4MNWA 3UNSA 1GVKB 2KFWA 3GYLB 5CHAB 4ABBA 1JOUB 1GHBG 1UVTH 3MH4A 5LH8A 3UUZA 3PTNA 4P02A 1ELDE 4ZHAA 1P3CA 2ZHQH 9ESTA 5IDKA 1IQNA 3DFJA 3UNQA 1BITA 4U01A 2BTCE 1CA0B 4BANB 2OBQA 2WPHS 2ALVA 3A7TA 3RXOA 5FAHA 1CA0C 4YESB 1JRTA 3K6YA 4NIVA 4Y71A 1DS2E 1CT0E 4UFFH 2TGAA 3NZIA 1D9IA 4F55A 4X6OA 1TPPA 3JZ2B 2A4GA 1O3OA 1SLWB 1O37A 3PRBA 2O8LA 3ATLA 2OC8A 1O34A 2CMYA 5B6LA 1NN6A 1QBOA 3LGYA 1C5LH 1L0ZA 3LH3A 2XBXA 4O3TA 2HALA 2ZO3H 3FKSD 4BXSA 4ISIH 2XCFA 4B71A 2GDEH 1W2KH 1DSUA 1E35B 3BN9A 2FM2A 3TVJB 1SI5H 1DDJA 3HPTB 2FOGA 2HVYB 2RG3A 3RXIA 1O5BB 2GMTC 5CMXH 2GDDA 2BY8X 1UCYH 3QZQA 5HKKD 1V2KT 2Q1JA 1DVAH 4NSVA 4A92A 1Q2WA 4OS6A 3DT0H 3EQ0H 4BAMB 1BCUH 1O39A 5TCAA 4XD7D 2EC9H 4HFPB 1TE0A 2F9NA 4CHAC 1TX8A 2FI3E 1SL3A 1ZSJA 5IYTA 4B75A 2GTBA 4ISLA 1H9HE 5FPTA 1A5GH 3H7OA 3Q3KA 1SBWA 3A83A 3M5LA 3OYPA 3ZVDA 1Y5AT 1GMCF 1NU9A 4I86A 1C9PA 2TBSA 7ESTE 5HIYA 1GHBF 3Q3XA 5F8XA 3A82A 2G81E 5TJXA 3SORA 2OINA 3FP8E 3RXJA 3A8BA 3RM0H 1W10U 4ABIA 4OS4A 4Y8XA 3GCHC 1WUNH 1GBAA 1GJBB 1K2I1 3RXEA 2ESTE 2IPHA 1ZJKA 1HFDA 3SJIA 3LKWA 3SJOA 5FHTA 3EAJA 1WTHD 2H6MA 2H5CA 2ZC9H 3PWCA 4I7YH 1TGNA 3A85A 4Y11E 2FODA 3P17H 1VITF 1GI7B 1NFUA 5BPEA 1PJPA 1W13U 1W7XH 1JIMA 4F4OC 3DSOA 3STJA 3DFLA 3A88A 5JDUB 1S6LA 2VGCB 1AB9C 4J2YB 5IK2D 4IN1A 1AGJA 3LIWA 2JETC 3UREA 1V2NT 4GCHG 1SSXA 3F2FA 2YMSD 4TYDA 3UQOA 3IG6B 1EOJA 1ZRBA 1ELGA 2QIQA 1QB1A 1HAVB 2FTLE 1BTYA 3LC5A 1LPZB 1WV7H 4O97A 3M7QA 4JYVH 1GI4A 3SV2H 1NY22 5AFYH 1QJ6B 5FCRA 3SQHE 3AK5A 3GCOA 1A2CH 2XCNA 5AFZH 1FDPA 4SGAE 5C1YA 1HAIH 2PKSB 1GVLA 1LO6A 2PSXA 1P2OA 2GZ7A 1O2GH 3NUMA 3MNCA 1UK4A 1INCA 1AQ7A 2TIOA 3KQDA 3KGPA 1TLDA 1GBDA 3G01A 2BB4A 2WYGA 2PLXA 2W26A 2XC5A 1F92A 2ZTXA 5K7RA 3BF6H 5ABWA 2VH6A 1S6HA 2QCYA 1YPKH 2ZU5A 3E6PH 3GDVA 4AFSA 1ELVA 4Y76A 1F2SE 4AZ2B 1AU8A 1TRYA 5A2MH 3BSQA 4AORA 1BZXE 1MBMA 1C1UH 4BAHB 1A4WH 1QZ8A 1UO6A 3BG8A 3RXTA 1OWHA 2KCYA 2LPRA 3F2HA 2OLGA 3SYJA 1ARCA 3M7UA 3AW0A 2AH4X 3SGBE 4LOYH 2PWXA 1H8DH 1GHAG 1SGFG 5EJ1A 3BEIB 4FVDA 4HG6A 2G52A 1C2EA 2NWNA 1SGCA 3BG4B 1C1WH 1BTPA 2TGDA 1DM4B 1TGTA 4KTCA 1LVOA 2K1QA 2OUAA 4INKA 3TH3H 5DO4H 3TPIZ 4NIXA 1GHZA 1MABB 3RXAA 1GDUA 3SHCH 4AB9A 4X1SU 3KCGH 1SGNE 1O30A 1JRSA 4I8KA 1OHHD 1KLIH 1TQ0B 2OP9A 3KHVA 3O8BA 3ODFA 5A8XA 1K1MA 3S9CA 2RA0A 2FPZA 1BTUA 3CENA 3URCA 1OWJA 2FYQA 1Z8IB 3LU9B 4KTSA 1DY9A 2Y82A 3EE0B 4FUEA 5DP5A 2ZG0H 1V2RT 1AB9B 1OX1A 1DOJA 1SLUB 2XNDD 2FI5E 2PW8H 2WINI 3BTHE 4P00A 1NBMD 1FN6A 3A89A 1P02A 3QO6A 4ZKSU 3EYDA 2BLQA 1GI5A 2ZHDA 5C17A 1A7SA 4MPXA 1MQ5A 1UHBB 3D49H 1T8LA 2BD5A 1YBWA 4H6TA 4B74A 1HNEE 2G4TA 1H8ED 2JH0D 2ZHFH 1K1NA 3URDA 1O3DA 3S7HB 1Q3XA 4THNH 3T27A 3RDZA 1MAYA 1F0TA 3DUXH 4ABDA 1QNJA 3TJVA 3AVZA 1LKAA 1VITG 1LHEH 5EIYA 1TOCB 1GCTC 4ZHMU 4K8BA 2QXHA 1FY3A 1T8MA 1CT4E 1ELTA 1UTJA 2BLWA 1F0UA 2C4FH 4AFUA 4DT4A 2KM0A 2F9OA 1FONA 3UOUA 1SMFE 3AAVA 3KEEA 2CHAB 3WWFA 1P04A 2J2UA 3SV7A 2TGTA 3FANA 4X8SH 2QYIA 6LPRA 1QY6A 4NZQA 1H8HD 2FYRA 2QE7D 3OE7D 4YOJA 4X2XA 2BZ6H 1FY5A 1O36A 1ZGVA 3T29A 1HAPH 3NXPA 2JKHA 5T6GA 4NG9H 2O8MA 1P2KA 2ZGHA 2GV7A 2JJ1D 3VB6A 1PYTC 4UEHH 3RU4T 1GVZA 5C2ZA 1HV7A 3MH6A 4J1YA 2ZECA 5ESTE 3SI4H 2FLBH 4ABFA 5C0UA 3UFAA 1C4Y2 1BQYA 4INLA 2BD2A 1GJ9B 1E36B 5EU8A 2PKAB 1ANDA 3VB3A 3QN7A 1O2YA 4PROA 1EZQA 5FX5A 2LNCA 2XC0A 3M37A 4YOGA 3BIVH 5HIZA 4B2AA 2FDAA 3ESTA 1WCZA 3BV9B 2WPJS 2ZQ1A 2W3KA 2A5AA 4YXWD 2Z9KA 5A09A 4X6NA 2A4QA 2GGVB 1HAYB 2VWMA 4UD9H 3VB7A 2P8OC 3PMBB 4E06H 4YTAA 1E79D 3GDUA 1A46H 4GSOA 2FXRA 2ANKH 1TB6H 4X1RU 3SNCA 4X1PU 5GCHG 3ZYDA 1QQ4A 2FLRH 1UCYK 3GISB 1AVGH 1Z71A 2WPKS 1GHVH 1SFQB 1XMNB 4NCYA 1C1QA 1UCYE 3SHAH 3SN8A 2GMTB 4D9RA 5FBEA 3A84A 1L1GA 4MQAA 2F43B 1BBRK 1AHTH 1AIXH 1UVSH 3A7WA 2GCTC 5BRRE 4CRBA 4RKJB 1FY1A 3NRLA 4ZKRU 3OSYA 1P2NA 2ZQ2A 3MNSA 2Y5FA 1ELCA 4NA9H 5EQSA 1O31A 1Y3WA 4U30A 1RD3B 1AFQB 1S85A 1DSTA 2Z3EA 1C2GA 4X8UH 4AG1A 2BD9A 2P16A 3PMAB 1H1BA 3S7KB 1D6WA 3N7DA 4JK5A 1CGIE 3U8RH 3ATKA 5EJLA 3SGQE 4IBLH 4Y8YA 3ATMA 1CGHA 1PPZA 4ZROA 1QJ7B 3DSGA 2SNWA 2AGIX 9LPRA 1XVMA 3RXBA 2BY6X 1C2FA 1NM6A 1B0FA 1WXRA 1KXFA 1L2EA 4U32A 2ZI2H 5I25A 1IQKA 2Z7FE 2QF0A 1C2KA 3A8DA 1SR5C 1TABE 1O2QA 1DWCH 5FPSA 4DT7B 1LVBA 3U1IB 2VJ1A 1J14A 1DLKB 2BOKA 1HDTH 2EA3A 2VVCA 1C5TA 2VIOA 1P11E 5AVDA 1MTUA 1XKAC 3T25A 3SUGA 1Z1IA 5DKMA 2FOAA 4AGJA 1O3PB 2UUYA 5EW2H 1HUTH 1GHYH 2RDLA 2K8IA 2Z3DA 2FZZA 3GY7A 5AHGH 3OTPA 3GICB 1GI8B 1BMNH 3EA8A 2HVXA 2VIQA 1AZ8A 3SOSA 4IMZA 1HRTH 3N7OA 5PTPA 3MTYA 4MNYA 2BY7X 4JZDH 4BAKB 3F9HA 2ZGJA 2VWLA 2UUJB 1A3BH 3GY4A 3MWIU 1LDTT 1O2SA 3STIA 1EAIA 1BRBE 2W6ID 3EA7A 2FX6A 1C5OH 4D8NA 1RRKA 2WUCA 1C2HA 1ZTJA 2NU0E 3GOVB 1SGRE 3NKKA 4TPIZ 1IQFA 2NU2E 1UTLM 2NU4E 4X6MA 1J8AA 4FUGA 1NRPH 2BVSH 1HIAB 2J98B 3SU1A 1BTXA 4MTBA 4VGCC 4KGAA 1FJSA 1EASA 2H9EH 1ELFA 1DWBH 1EZSC 4YT7H 2GZ8A 2BD4A 1H9LB 4CBOA 3ZZ4A 1QURH 1CO7E 3FFGA 1P3EA 1K1PA 5FBIA 1TMUH 3K6ZA 4YZUA 2ZU3A 1PFXC 1T7CA 1V2QT 3UY9A 4XBCA 1A5HA 2OBOA 1ZZZA 3PO1B 2ZTZA 1GBJA 1QBVH 2IJOB 4OS1A 1AUJA 2AYWA 3H5CB 1KLTA 2QGRA 3UR9A 1O5CB 1C1PA 1C2DA 2XBYA 2H2ZA 1A3EH 2O8UA 1MU8B 1MAXA 4RT1A 1GBCA 1ZPZA 1P03A 2R0KA 1OKXA 2ZGBH 2Z94A 1GJ6A 5A0AE 1GGDB 1BA8B 3U1JB 3OU0A 2C93B 2W5EA 1SGEE 1PPGE 1PQ5A 1EZUC 4CRAA 3E8LA 4RN6A 1GBHA 1EB2A 2ANWA 2HPPH 1UVUH 3IITA 1C2IA 2PGQB 5LPFA 3LOXA 1P9SA 3VB4A 1B5GH 1D3PB 1EJAA 1P0SH 1RIWB 1V2VT 2FMJA 1AWHB 3F2GA 2AEIH 1YLNA 1GBLA 2EEKA 3SU6A 3M35A 4X1QU 1FIZA 5EOKA 1V6DA 2ZFSA 4AGKA 1YF4A 7KMEH 3ZVCA 4H42U 2XXLA 1MU6B 2GV6A 3EE7A 1ANCA 1EUFA 1QRWA 2F3CE 1H8IH 2FWWA 5C1XA 1GI6A 1NU7B 2ZKSA 3SV6A 5EJZA 1C5RA 1XKBC 2G4UA 2ZDVH 3HGPA 4GHQA 3TH2H 3S0NA 1TOMH 2STBE 3ZZ9A 4TWYA 3E3TA 1QB6A 1HAXB 1RJXB 3V12A 1UK2A 5E0HA 2WZQA 1UTKA 1MKXH 2WV5A 3A7ZA 3LGIA 3LPRA 2A4OA 2VB0A 1C5UA 2PFEA 1BMMH 1GL0E 1P09A 1XXFA 1O2RA 1F7ZA 5LPRA 4UONA 1NRRH 2D1JA 1HJAC 1G2MA 3RXQA 3SZNA 6GCHG 3QGJA 1Y3XA 5T3HA 1AI8H 1LQDB 5JBAS 5A0CA 1CHGA 2TRMA 3TK6A 3TGKE 2QF3A 3F1SB 3RU4D 1ZJDA 1QQUA 1O3EA 2M5TA 1X7AC 5SGAE 4TWWA 1AVXA 3T2NA 3RUOA 2FOBA 1P01A 4YT6H 2QV1A 1DX5M 1BHXF 3SU3A 3Q77A 3TNSA 1GI0A 4WVPE 1EP6A 1SLXB 2KAIA 2FIRH 2PGBB 1YYY1 3SUFA 2VU8E
chains in the Genus database with same CATH topology
3NK8A 4GCHF 5GDSH 3F9GA 1O33A 1GBIA 3MI4A 4FUIA 1HAVA 1KXBA 2Z3CA 1MUEB 5C20A 5F03A 3S9AA 4Y7BA 1NT1A 2O8TA 3VB5A 1GJAB 2CHAC 3KF2A 2CF8H 1QIXB 1TPSA 3ATWA 1XUHA 1GPZA 4IS5A 1EAXA 1NRSH 2BLOA 1SOTA 5A8YA 1SFIA 3H7TA 2GCHG 2ZP0H 1C5PA 3RXCA 1O3HA 1VCPA 3FZZA 4X8TH 1GMCG 4NIYA 1DFPA 1S6FA 1OYTH 3HKIB 2Q6GA 2F9UA 3TGJE 1P10A 2BM2A 1C1SA 2OC7A 3T26A 5EW1H 4NGAH 5L30H 1Y5UT 2VIPA 3MH5A 3RXGA 4DCDA 2TGPZ 4WH8A 4BAQB 1ANEA 2QY0B 3R0FA 1SVPA 1LMWB 1TGBA 2VWNA 3RLYH 1Y8TA 3SV8A 4ZKNU 4LZ4B 1HYLA 2BX3A 1YPHC 1P2QA 4ZAEA 3RXKA 2HPQH 1O3JA 1LHGH 1V2ST 2Z9LA 1WSSH 1YGCH 1NPMA 3T62A 4CBNA 4MPUA 1TYNA 4WJG2 4Q80A 1QRXA 2JH5D 1YPGH 1UMAH 1WAYB 4ZUHA 1AZZA 1YPLH 2JETB 3SBKA 4CRGA 1K21H 3RXMA 1J15A 2P59A 4CR5A 2ANMH 1TA2A 1W3CA 1FIWA 2R3UA 2ODQA 3V0XA 1E37B 2AMDA 3IWMA 2ALPA 1O2HA 4ABJA 1NS3A 4Y10E 1RXPA 4FU9A 1LVMA 4X2YA 3ZZCA 3QDZB 3RXFA 5H4IB 2P8OB 1TPOA 3KIDU 1GJCB 1HLTH 1ACBE 2R2WU 1BMAA 2C8YB 2B9LA 4K1SA 3GCHB 1O5FH 1QL8A 1EATA 1HBTH 4IC5A 2H1UA 4B1TA 1O3LA 3F9FA 2BQWB 1CGJE 1NROH 4NSYA 1H9IE 3MMGA 2Y7XA 2QXIA 1GGDC 1G30B 1KXDA 1GMDF 4KTUA 3ZZDA 1HAGE 2AMPA 3M3SA 2HRVA 3SU0A 1VZQH 1ANBA 1O3NA 1N6YA 4K1TA 3TNTA 3LC3A 1YC0A 5JPMH 4CHAB 4HTCH 2R2MB 1O5GH 1QFKH 4RSPA 1LQEA 3GY6A 3MYWA 2Q6DA 1TQ7B 3FP6E 3B23B 3L6PA 2ZCLP 4DOQA 1MTNC 1RS0A 1GBFA 1K1LA 4D9QA 2ZHWH 1OWEA 1XVOA 1ZR0A 1M9UA 3A8AA 1QGFA 4K8YA 2WPMS 3A86A 1DITH 3D23A 3PLPA 2AFQB 1TNKA 1ZLRA 5JBBS 2HNTC 2ANYA 2F91A 2HWLB 3BTQE 2VGCC 1YLDA 1T32A 3HK6B 2P3UB 3A7YA 3P95A 2OQ5A 3EA9A 1DLEA 1LTOA 2BLVA 2GKVE 4WY3A 1QL7A 2V35A 3U69H 1UK3A 5E0JA 1AFQC 1ETTH 3K65B 4OGYA 5I46H 4WWYA 1AE8H 3ENSB 4GVUA 4ABEA 3LDXH 2BDAA 1ZPBA 5C5OA 1FNIA 3ZZ3A 4AFQA 2OQUA 2BDCA 5TCCA 1G3BA 4Y7AA 1P05A 2ZNKH 1GI2A 1EQ9A 1S5SA 1GJ8B 3NCLA 3QLPH 3LGWA 5F8TA 5A0BA 1QTFA 4O3UA 4I8JA 2VINA 1E34B 1MQ6A 4Q7XA 1V3XA 1ZMLA 3RXVA 1QHRB 1K1JA 1BTZA 1YCPK 4JCNA 3RMOH 3MO9A 1OP0A 1BJVA 4I8HA 5EXLA 5K0HA 2ZFPH 1CQQA 3LT3A 3RXDA 3ZZBA 5JB8S 2XBWA 3MFJA 3SO3A 1G32B 5C1UA 1OOKB 1SHHB 2H9HA 1DANH 1PYTD 1D3DB 4ISOA 1KXEA 1L1NA 4Z6AH 2BQ6B 3QX5H 3MNXA 1GJ5H 3CS7A 4Y6DA 1NFWA 3FP7E 2BXTH 4KP0A 1FAKH 1MKWK 5DJ7A 3ATIA 1AN1E 3HATH 3B9FH 2A5KA 1AD8H 2AS9A 3RC5A 3BTDE 1UTOA 1C1TA 4LK4A 1C1RA 1MBQA 1O2WA 3ZZ5A 3MH7A 1V2TT 1SOZA 4MLFB 1F0RA 3QZRA 4MVNA 3ZYEA 3P8FA 1TNGA 1SHYA 1K9OE 1TRNA 4KKDA 2OD3B 3OY5U 5FX6A 3U8TH 1ZHMA 2B5TB 2ZFTA 4JK6A 2BDBA 1SQTA 1YCPM 1CA8B 2QN5T 1KTSB 1B7XB 1QL9A 1ID5H 5ESBA 4OGXA 1O2JA 1C4V2 4IN2A 1T4UH 4Y0YE 3UIRA 2ZWLH 3U8OH 1AFEH 1HJ9A 3NWUA 3B8JA 4JYUH 3TJNA 4K60A 1MCVA 1KY9A 4K3JA 1TX7A 3O8RA 4JZEH 4D76A 1P2MA 2FO9A 4AYVB 1HXEH 2BXUH 4ESTE 1TALA 1AUTC 1GHXH 1UTNA 2FS8A 2A7CA 1V2WT 2BVXH 3TIUA 3RXLA 1DWEH 1SGTA 2GT8A 2ZFRH 1FPHH 4BNRA 4A1TA 1CE5A 4OS2A 2BYAX 1E0FD 3SQEE 2WV4A 1MZDA 2Z9IA 5GXPA 1PQ8A 1F5KU 1EJNA 1GMHG 2A0QB 2ASUB 4FUCA 1O2LA 1DWDH 1THPB 2UWPA 3PM3A 2TPIZ 3FZDA 2Y7ZA 2B0FA 4X6PA 3V13A 2XW9A 3RXSA 1PQ7A 1Y59T 4BTUB 3LGTA 2G5NA 3U9AH 4YLQH 2GCTB 4DURA 3SU4A 1QBNA 5GJ4B 1A1RA 4MG3A 1O35A 1FZZA 3UQVA 2A4RA 4CH8B 3PLBA 1O3MA 5T6FA 5E2PA 3QTOH 4KELA 1A0JA 3LJJA 4LXBH 3MU0A 1G3CA 1KIGH 3BG4C 2AIPA 1TMBH 2CV3A 1ZHPA 1L4DA 6CHAC 1HGTH 3MNBA 3SNDA 3UWJH 1O2IA 3FVFB 3LGUA 1OWIA 2EI6A 4ABGA 4CREA 4ZKOU 5DK1A 1BRUP 2IOTA 1GDNA 3GDSA 4WMFA 2PV9B 1TNHA 2HGTH 1MD8A 2Z9GA 4I8GA 5DP4A 1GDQA 1U6QA 1TPAE 1O3CA 1N1LA 3RXPA 2ZU4A 2AGEX 1O2PA 1YPHE 1WOFA 1DXWA 1O3KA 1GJDB 1W14U 4FVBA 5EQQA 4NFEA 3ZVFA 2XTTB 1G37A 5JB9S 1SB1H 3V7TA 4IW4E 1DUEA 1Y3VA 6CHAB 1WU1A 2F9PA 4FXGH 1LPGB 3FAOA 4FUBA 1FV9A 2BX4A 1FY4A 1RTLA 8LPRA 3O8DA 8KME2 1NRQH 2PKSC 3KL6A 4R0IA 2ZZUH 3AAUA 4JZ1A 5DP3A 1LHDH 2SGAA 3A8CA 1NFXA 3ZZ6A 2I6QA 3SU2A 1L1JA 2J94A 1F5RA 4D7FA 5B6OA 4I31A 1HPGA 1W7GH 1UTQA 2FESH 3P8GA 4OS5A 1IOEA 3PO1C 1V2LT 2A7JA 4NFFA 1WBGB 5T6DA 1BTHH 5L2ZH 1CVWH 3LJOA 1K1IA 2ZDKA 3Q00A 1PPCE 3QTVH 1NTPA 2V0BA 1FXYA 3S9BA 1EJMA 3SW2B 2ZPRA 8GCHF 3OY6U 4NZLA 1O0DH 1V2JT 1GL1A 3P8OA 1O3BA 3ELAH 1SGPE 5F6MA 5FPYA 1C1OA 1O5DH 2ZPQA 1SPJA 5J4QA 3ZZ7A 1C5XB 1SLVB 2OXSA 3AW1A 2OTVA 1T8NA 1AVWA 1SC8U 4H6SB 1ZHRA 5EPNA 1CBWC 2O8WA 1G3EA 4HI3A 1XUJA 1O2NA 4I33A 3ZVAA 3TK9A 2GZ9A 1C2MA 1VCWA 4O03A 2A5IA 1G3DA 1PPBH 4XE4A 1CSOE 1UTMA 3LH1A 5J4SA 3SU5A 3SJ8A 1EPTA 1P2IA 2ZGCA 1HCGA 1EP5A 4TY6A 1AMHA 1GMHF 2VIVA 4H4FA 1C5WB 1Z6EA 1ESAA 1J9CH 1C4U2 3M3TA 5FCKA 4JMYA 3PROA 1T31A 3MO3A 4UDWH 4FUHA 6GCHF 1YLCA 1C5VA 3BTTE 2C90B 2UUFB 4ZH8A 1BT7A 1OXGA 1FAXA 4F49A 2A31A 1DXPA 2PHBA 1BRAA 1LVYA 1TAWA 3PYHA 2P3FH 1BJUA 2PR3A 3P6ZB 3SJKA 5EPYA 1OP2A 2ILNA 2RCEA 1KDQB 1O2ZA 2ZF0H 1MTNB 3M5MA 4GUXA 2KAIB 2FOMB 1UVOA 2ODPA 4M7GA 4X8VH 5HM2A 1TMTH 1DT2A 3UR6A 1O2KA 4X2VA 4YM9A 1AY6H 3MHWU 2YNBA 1ESTA 2G51A 1HJAB 2P94A 3VGCB 1XM1A 3A80A 4FUFA 1QA7A 4E7RG 3SJ9A 2F83A 2I6SA 4MPWA 1FN8A 1O2VA 2F9VA 3V3MA 2AERH 1MTSA 1DY8A 4ISHH 1KYNA 1EOLA 2ULLA 4B76A 1C2LA 5DP6A 1IQJA 4YLUA 4ZMAH 1JIRA 3SUEA 3F9EA 2V3OH 2SFAA 1VCQA 3LONA 1HAZB 4ISNA 3M61U 2JH6D 1ZMJA 3P8NA 1K28D 3RXHA 1TNIA 1ETSH 1IQHA 1SQAA 3QGNB 1LPKB 1C1MA 2ZCKP 1NO9H 2OCVB 4XBDA 2R0LA 1G2LA 1G9IE 3TJOA 1MZAA 4XSKU 3L33A 5GCHF 4WMDA 1A5IA 1E38B 3RC6A 1TONA 1ZTKA 1YPJH 4MNXA 4UFEH 2ZTYA 1YP9A 4SGBE 1O2MA 4A1VA 2P95A 2C3SA 2V6NA 1B0EA 5JYIA 3TK5A 1MH0A 4I8LA 3O8CA 2HOBA 1OYQA 1P2JA 3RMMH 1C5YB 2CXVA 1EX3A 4X0WU 3BTGE 4MDSA 3BTWE 5GPIB 2ODYB 2BDGA 3ZV8A 2VH0A 5C5NA 1S84A 2BHGA 3CP7A 4JZFH 1HXFH 3E90B 4AB8A 4WMEA 2J4IA 1FPCH 1AWFH 1VR1H 3GCTF 4Y0ZE 4GPGA 4DIIH 7LPRA 3T28A 1VJ9U 1EPTB 3SNEA 2Q6FA 2R3YA 1ZRKA 2XC4A 2BZAA 3L3TA 1S0RA 3P70B 5C67A 2ZDAH 4A6LA 2ZDNA 1YPMH 4WH6A 3E1XB 1DE7H 2CN0H 2V3HH 4DVAU 4K5ZA 5CE1A 3RM2H 3GY5A 4NWKA 1LCYA 1DPOA 1LHCH 1THSH 3R3GB 1GBEA 2VIDA 4CRCA 1NC6A 2VVUA 1RTKA 1Y3YA 4NA8A 2W7SA 3K2UA 3TU7H 2PTNA 1XUKA 4DGJA 2FI4E 7GCHF 2B8OH 5EXMA 1ABIH 1QB9A 1XXDA 1BUIA 2FTMA 1W8BH 1A61H 5HMAA 1KDQA 4AN7A 1BB0B 1GI3A 3C27B 4FUDA 1GBMA 5HM9A 5EQRA 1TRMA 1GCDA 1ZTLA 3BTEE 3RC4A 1W0YH 1RGQA 4UFGH 1N8OB 1T4VH 3T5FH 2Y81A 1ORFA 1BBRH 1IAUA 1D4PB 1H4WA 1VJAU 5EXNA 2G5VA 1K22H 3MO6A 4LZ1H 3DD2H 3KQCA 1C5NH 3MU5A 4AG2A 3A87A 1EPTC 3NPSA 1P57B 1C5MD 2P3TB 4DG4A 1JXPA 3E0NB 3M3VA 5DP7A 3I78A 2FEQH 2PUQH 3SUDA 1IQEA 1KLJH 1O2TA 2J92A 4ABAA 2C8WB 2BDHA 1P8VC 1F5LA 4DY7B 2H5DA 3ZZ8A 1MKXK 2STAE 2YOLA 2SNVA 2GX4A 1NZQH 3GCNA 1MTWA 1ZSLA 1FLEE 2A2QH 3I29A 5HYOA 1ZMNA 3OX7U 5DP9A 1ETRH 3WY8A 3F6UH 2DE9A 3PWBA 5C3NA 3EDXB 3I77A 2HNTF 1P06A 1DUAA 1Z8JB 1T8OA 2FOEA 2P93A 1QJ1B 2THFB 3BTME 1GJ4H 3MU8A 4FU7A 1JMOH 1KSNA 4CRDA 5A8ZA 4Q7ZA 1ARBA 1HB0B 2AGGX 2XYAA 1KTTB 1QA0A 5G4BA 1D3TB 3SI3H 1GMDG 3GY8A 1BMLA 3ZV9A 4JYTA 3KN2A 1AKSB 2BD8A 2EI7A 4XOJA 1GI1A 2D2DA 1YKTA 2VIWA 1SGFA 2IN2A 4R8TB 4BAOB 2VVVA 4BTIB 3UTUH 1CU1A 4Z0KA 1Z7KA 4E05H 1O2UA 2UUKB 3P92A 2J34A 4Y79A 1L4ZA 1CHOF 8ESTE 1EZXC 2HNTE 2SGEE 1ZYOA 4FU8A 3PMJA 3TH4H 1XUFA 2A1DB 4NIWA 2ZDLA 3W95A 2J38A 1TFXA 3RU4E 4MNVA 2PSYA 2WPLS 3TGIE 2ZPSA 1VGCC 1TIOA 1C5ZB 1ABJH 1SG8B 2A7HA 4O9VA 1OSSA 3W94A 2Y6TA 1ZOMA 1C2JA 1GHAF 3KNXA 1LHFH 1TWXB 1TGSZ 3GCTG 1BTWA 3E0PB 2Y5GA 2BD3A 1NRNH 1OS8A 3Q76A 2Y5HA 2SGFE 1IQLA 5JBCS 1BBRE 2WYJA 5DGJA 3ITIA 4MPVA 2DE8A 1N8OC 4A1XA 1C9TA 1W11U 1W0ZU 1QR3E 3S69A 2O9QA 2ZEBA 4IC6A 1FMGA 1O32A 3AASA 2ZU2A 3M5OA 2H9TH 1RIWC 1ELBA 1FQ3A 1FUJA 1MCTA 1IQIA 1PPHE 1Z8GA 4ZXXH 3ZVBA 1AE5A 2FX4A 1NFYA 1BRCE 1MKWH 5E2OA 3ZVGA 2W7UA 1WTGH 1UHBA 4RKOB 1GWAA 4WXVA 1S82A 3PMHB 2QXJA 2Y80A 2FS9A 1BOQA 1IQGA 4UE7H 3TLOA 3VXEH 5ETXA 2G00A 2G8TA 3PLKA 4WF8A 4XFQA 4BOHA 1EB1H 2SGQE 4NWLA 1WQVH 2BMGB 1OPHB 1TBRH 1W12U 2OC0A 4WXIA 5EG4A 3JZ1B 5EGMA 3VGCC 2PUXB 1C1NA 1TGCA 1TX6A 1MD7A 4INHA 4E7NA 5E0GA 1UJ1A 1THRH 1V2PT 4X1NU 4JZIA 1XX9A 1GHWH 3RMLH 2RA3A 5LGOA 2PTCE 1GI9B 5L6NH 3BTFE 2QAAA 4BTTB 1DICA 3SNAA 2Z9JA 2ZCHP 1F0SA 3MOCA 4IMQA 1PQAA 4TPYA 1SGQE 3RP2A 1S0QA 1GBTA 1YPEH 2ZDMA 1WYKA 1C5SA 1V2MT 2XWBI 1AKSA 2QXGA 4IGDA 1VGCB 1VITH 2EI8A 4VGCB 2CGAA 1GCTB 2BDIA 2BY9X 3A7XA 3E91A <