2HVYB

Crystal structure of an h/aca box rnp from pyrococcus furiosus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
74
structure length
74
Chain Sequence
MKRLGKVLHYAKQGFLIVRTNWVPSLNDRVVDKRLQFVGIVKDVFGPVKMPYVAIKPKVSNPEIYVGEVLYVDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase/biosynthetic protein/rna
molecule keywords H/ACA RNA
publication title Crystal structure of an H/ACA box ribonucleoprotein particle
pubmed doi rcsb
source organism Pyrococcus furiosus
total genus 12
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04410 Gar1 Gar1/Naf1 RNA binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.230 Mainly Beta Beta Barrel Thrombin, subunit H Probable tRNA pseudouridine synthase domain 2hvyB00
2EY4C 3U28C 2V3MA 2RFKC 3MQKC 2HVYB 3UAIC 2EQNA
chains in the Genus database with same CATH superfamily
1IHTH 1GBFA 2F9BH 1XUHA 3FOAA 3MQKC 3NPSA 2ZIQH 2PW8H 3LPRA 4ABHA 5L2YH 4JYVH 1FMGA 2FOEA 4SGBE 1BIOA 2R9PA 1H8DH 2D1JA 1C5QA 3FAOA 1GI8B 3SJ8A 2WSSD 2VNTA 1AWHB 3RXRA 2GDEH 2XBYA 1QB9A 2JH0D 1D6WA 2QCYA 3ATKA 1DLKB 3T28A 5EPNA 4CH2B 2PKSB 2ZDNA 4MPXA 1TOCB 1O2GH 2WV9A 1GDNA 2FOBA 4D7FA 3E8LA 3UB0A 5A09A 1RRKA 2O9QA 2ZHFH 2LP6A 3M35A 3VXEH 1BTHH 3TK9A 1XXFA 2J2UA 2GCTB 9ESTA 1ZGVA 2GMTB 4I8HA 1NC6A 1FV9A 1O30A 5C0TA 1BJUA 1O5AB 2P95A 3CS0A 4ZAEA 3M3SA 4LXBH 1H9HE 1UTKA 5C2ZA 3B9FH 3SI4H 1FY8E 1BMLA 1FX0B 1UTMA 3MOCA 3MO3A 1LHDH 1VGCB 1C1SA 5A8ZA 4YESB 4GPGA 1VCWA 3A8DA 4I33A 4DT4A 1UVPA 1OWDA 1YPLH 3K65B 4YT6H 2HNTC 3RXMA 3ATWA 2CF8H 5T3HA 3UQVA 1E35B 4IC6A 2SGPE 2UUJB 3STJA 4HG6A 4BXWA 5KECA 2Z6BD 4E06H 1BT7A 1DPOA 1LKAA 3BEFB 3SJOA 1DE7H 1GHXH 4WH8A 1O2RA 2HVYB 1XXDA 1AWFH 3EE7A 2W26A 1LHEH 3MYWA 3RXIA 2B0FA 1NN6A 1PYTC 1EJMA 1C5LH 4NA9H 5DP4A 3SGAE 5BRRE 1Z71A 4AC9A 4DJZB 1SGYE 5EJLA 3S9AA 4BTUB 1QB6A 3KQDA 4OM9A 1J14A 3PWBA 3A7TA 4K69A 2H1UA 3M5NA 1HAYB 4I31A 1XMNB 3EGKH 2VVUA 4MNXA 4K1TA 1GWAA 2O8WA 4MPVA 3ZZ8A 5B6LA 5C0UA 1O5CB 3P70B 1GVZA 4OS6A 2AMQA 3ODFA 3PRDA 4D8NA 4X1NU 5F53A 1YCPK 3TITA 4F48B 4Y71A 4BANB 3VB7A 4YXWD 3SU6A 3WW7A 5A0BA 4IGDA 1O5GH 2BX3A 2PLXA 2VWLA 1RGQA 1U6QA 4DURA 4ISOA 3LGYA 2KCYA 4O97A 2TGAA 2NU1E 1P06A 4ESTE 1QBNA 4CRFA 3RMOH 1G36A 3U9AH 2OC7A 1CA0B 1O33A 2PGQB 3RXSA 1JIMA 1MZAA 5F8ZA 1HJAC 2ZNKH 1C1MA 2BD7A 1TBQH 2QXGA 1C5VA 1J15A 1FAXA 1NM6A 2K0QA 2YMSB 3RLYH 2PSYA 5LPRA 5A2MH 3S9CA 1SLUB 2GV7A 3OFND 1O36A 1IQIA 2BDGA 3E91A 1TLDA 1NFYA 2ZGBH 4GCHF 1GJ4H 1O2QA 1D3TB 2A7HA 4FVDA 1ANDA 2BDYA 1GDQA 3K6ZA 2BDBA 1ELTA 1LVYA 2ZFTA 1E1QD 3VG8A 1C5NH 2BDHA 2BD4A 2HOBA 1O2VA 2Y5HA 1G2LA 1MTVA 5E0HA 1Z8JB 2J4IA 5E8EH 1XX9A 1C1RA 1WBGB 2W7UA 1C5PA 3M5OA 4ZKSU 1MU6B 4OS5A 1UTLM 1GBKA 2ZDVH 1SGIB 1TNLA 4R0IA 1EOLA 2Y81A 3GY5A 2ANWA 3DSPA 2IJD1 1CGHA 8GCHG 2F43B 1CHOF 3SHCH 1DY9A 3MNBA 1DICA 1AI8H 4BAOB 3P8FA 4FUDA 2ULLA 3ZZ5A 1EPTB 1T4VH 2VWNA 4X1SU 1TPSA 1F5RA 1GI1A 3GY2A 2WV4A 4CHAB 2SNVA 4KTCA 3RXEA 1P09A 1TB6H 3GCOA 1TRYA 5GWZA 3TJVA 2A4OA 2BOKA 1FNIA 3RM0H 1SGTA 1C4U2 2BVSH 3DFJA 1D9IA 1CT2E 1XKBC 1S6LA 4JMYA 1J9CH 1B5GH 5J4SA 4CRBA 5K7RA 1FY5A 1C2DA 4WF8A 5E0GA 1ZRBA 1XUKA 4Y8XA 3M5LA 3NRLA 3U69H 4OS1A 3RXOA 1BMNH 2RCEA 1LDTT 2OTVA 2TGDA 2CV3A 3W94A 1CGJE 3QTOH 4WMFA 2XYAA 3UPEA 3KQEA 2DE8A 3GCHB 1KYNA 3UWIA 2D8WA 1W3CA 1C5XB 1FY3A 1FUJA 3IG6B 1K1OA 1L1JA 3U1IB 1YPGH 1AHTH 1UO6A 5AF9H 1YCPH 4OS2A 1S83A 3QK1A 1EPTA 3TVJB 4X1PU 3Q00A 1KXDA 3TH3H 3HGPA 1P11E 1HAZB 4M7GA 1EKBB 1HBTH 4Q80A 3A7YA 4AFZA 3GDVA 2ZPRA 3A87A 2I6QA 4RI0A 1GBBA 1HAVA 2WPHS 5I25A 1GL0E 5EXNA 2OQUA 2BQ7B 2Q6DA 2ZPQA 2PUXB 3SHAH 2P3TB 5CMXH 1GHVH 3RXHA 1WV7H 5HYOA 3T2NA 1KXFA 1O3PB 1F0RA 3CNRA 4AYYB 3K2UA 1O0DH 4J2YB 1AE8H 1HYLA 4NZLA 2GKVE 3UNQA 5FL7D 1P04A 2ZU1A 3RXJA 3DSOA 5GCHG 2G5VA 1O2KA 3RLWH 3F1SB 1SOZA 1DWCH 3O8CA 1HJ8A 4ZKRU 1T7CA 2AMDA 3SNCA 1HAGE 1O35A 1TMTH 1CA8B 2A2XH 5DO4H 1NRRH 1P2IA 2Q6FA 1XUJA 1C1WH 4IC5A 3ZV8A 1Y3WA 4KTSA 2ZQ1A 1D4PB 2ZCLP 1CT4E 1BZXE 1ETRH 4AORA 3U8RH 1J8AA 2ZU5A 1SGQE 3QZQA 2H5DA 1C2EA 1ELGA 5EQSA 4XOJA 4CBNA 2HNTE 1L4DA 5IDKA 3A7ZA 4I8GA 4K2YA 2GCHG 2BDAA 4B73A 1L0ZA 2OINA 2ZDAH 1AU8A 1AMHA 2Z9LA 1KLIH 3BTKE 1TONA 2A4RA 2FXRA 2BVRH 2NU0E 4YOJA 1C4V2 3UIRA 1D3PB 2Y6TA 2ZKSA 2O8TA 3NK8A 4Q7ZA 2FI3E 4NSYA 5C1YA 2YNBA 1JXPA 3MU0A 1GCTB 2OC8A 1GMCF 1BRBE 3GCTG 1O5EH 3HKJB 3CENA 1T31A 2LPRA 1HAHH 3H5CB 1VITG 1KDQB 3ENSB 1C2GA 1DOJA 5EODA 1F5KU 1YLDA 2JIZD 3E16B 3VGCB 4ASUD 1W12U 1YPHC 1GBEA 3F2GA 1K1MA 1C5WB 4NZQA 2J94A 2CMYA 2OC1A 1G3BA 3MNXA 5FX5A 2A4QA 3SJKA 2FLRH 4FUBA 1CBWB 3P8GA 4YZUA 3OE7D 5T1VA 1GDUA 2VH6A 4TSFD 1UVSH 2BD9A 4K3JA 1K9OE 3EA8A 4INKA 4IN1A 4YOGA 1N8OB 2CXVA 2P93A 5HM9A 3V12A 4DCDA 3TPIZ 4B1TA 1SLWB 3A7VA 1GI3A 5AFZH 5LGOA 1ZSLA 2CJIA 1O3LA 1G37A 4J1YA 3WY8A 3D23A 1GI4A 1ZMJA 2Y7ZA 1BQYA 1W8BH 1FIZA 1J16A 2ZHWH 1C2MA 1YBWA 3RU4T 1OWHA 8GCHF 3GY6A 1K21H 1SMFE 2BY8X 3K9XB 1V2PT 3OEHD 1Z8RA 1SGRE 3UR9A 3RXQA 3BTDE 1OWEA 4X6OA 1NBMD 1P3EA 4AGJA 1KDQA 2G55A 4ISHH 1QQUA 5F8XA 3ZZ9A 1SSXA 2FO9A 2KCOA 3VXFH 1AN1E 2QN5T 1IQJA 1Y5BT 2R3UA 1GGDC 2VGCC 1LPGB 4JYUH 2ZU3A 1NZQH 2A7CA 4MTBA 1S84A 3S0NA 3BIUH 3BTME 1EAIA 1P9UA 2NU2E 3Q76A 3TGKE 2HRVA 1JIRA 3M36A 3MFJA 1QL9A 1G2MA 3LKWA 1C1UH 1O2NA 3K6YA 3FKSD 1P10A 1IOEA 3SNEA 4RT1A 5EPYA 1UVUH 4TWYA 4F49A 1HNEE 2CHAB 3QUMP 1V2OT 2AHME 3A7WA 4K1SA 4A1VA 2Z94A 1QHRB 1MABB 4MPUA 2NWNA 1F0TA 1E36B 1ZTLA 2YNAA 3RC4A 4ZKOU 3ITIA 4OGYA 2OXSA 3RXKA 1BTWA 4GSOA 3H09A 5ETXA 3LGIA 5DSFA 2H2ZA 1F2SE 1OYQA 5HXFA 1SGNE 2ZTYA 4NIYA 1BITA 2VJ1A 1ZSKA 4Y6DA 2BB4A 5FCRA 1OWKA 3A88A 1LQDB 1OS8A 4Y0YE 1NRNH 1PPCE 3PM3A 2HLDD 1E34B 5HMAA 2LELA 2W6ID 1BRUP 5TCCA 2THFB 1SR5C 3MNCA 2ZI2H 3M37A 2EI7A 5ESBA 2QY0B 2IOTA 3DSGA 3PLKA 1F7ZA 3ZZ6A 1NFXA 1C9TA 4YT7H 4WVPE 4PROA 4WMEA 1E37B 2V3MA 5C1XA 3QX5H 1SQTA 2NU4E 4MLFB 3SNAA 1LPKB 2FX6A 2ZCHP 1V2VT 3SOSA 3ODDA 5L6NH 2FTLE 1GBJA 3A7XA 4JYTA 1T8OA 1QCPA 2A7JA 3LGVA 3UWJH 2JH6D 5LPEA 1HCGA 3LGWA 3BSQA 1C1VH 1O3MA 1V2WT 1YYY1 2VIWA 4AG1A 3RXVA 2PKSC 1EAWA 2QA9E 3D62A 3KYFA 1Z6EA 2ZFQH 4IBLH 3RXUA 4IW4E 1LMWB 1DY8A 1GBLA 1O3FA 4GCHG 1MTWA 1F92A 2DUCA 3PROA 3FP7E 4R8TB 1QIXB 4GHTA 1PQ8A 3TK6A 2GCTC 2GMTC 1AB9B 3Q3XA 4NIWA 5AHGH 6LPRA 2A31A 4K8YA 4AGKA 1ABJH 3CP7A 4H4FA 1H8ED 4JZIA 1HV7A 1CE5A 1BTXA 2H6MA 1MD7A 2I6SA 1VGCC 3A8CA 1UK4A 4BTTB 1FI8A 3P6ZB 5DGJA 4DG4A 4ZXYH 1FPHH 3SU4A 2OK5A 1PQ5A 1E38B 2BLVA 3EDXB 2VWMA 4Q7YA 3ZZ4A 4AZ2B 1CHOG 3HGNA 1BMFD 1MUEB 1W0ZU 1AFEH 1EX3A 5GNDA 5DJ7A 1C5YB 2L74A 1PQAA 1F5LA 1A4WH 1TBZH 1V2KT 1GBTA 1P8VC 2FWWA 4E7RG 1TOMH 3OX7U 1V3XA 2XC5A 2A5AA 3SJIA 2JDID 1QBVH 1NPMA 2HALA 2M5TA 1VITH 3LOXA 1VITF 2BD3A 2B7DH 2BLWA 4ZCNA 1C2JA 2BY6X 2D26C 4I8JA 1QL7A 4MPWA 1TGBA 1TAWA 4FU7A 1DXWA 4FUIA 4UD9H 1P0SH 1E1RD 1LCYA 2WINI 1D6RA 4O03A 1C5MD 3LGTA 1SQOA 5GIBA 5TCAA 4XDEA 2ALPA 4NFFA 1NS3A 1E79D 2G51A 1PPFE 1OP0A 2BMGB 1Y5AT 3SUFA 1BHXB 1YM0A 2BYAX 2ZEBA 3A8BA 1GBCA 1G30B 2B8OH 1QA0A 1CA0C 1QJ7B 1SFQB 1NRPH 1YPHE 2ILNA 3KYGA 1O3OA 1THSH 3H7OA 3Q3YA 2IPHA 1BUIA 4CR5A 5JBCS 2YMSC 2FODA 1C5ZB 3RC5A 2KFWA 4JZ1A 4X2VA 4FUJA 2A5KA 3TK5A 1GI0A 1THRH 1H8HD 4XBDA 4X6PA 1SPJA 3UQOA 3ZZCA 2F9NA 1BBRE 3RDZA 2OCVB 2JJ2D 4WJG2 3T62A 4TY7A 2VBCA 5EGMA 3OSYA 1GVLA 3RMMH 5DP9A 3I29A 1P3CA 3N7DA 5HIYA 2HWLB 1SGPE 2KZ4A 5CDFE 1GHZA 1O2JA 1NROH 1PPBH 1TX8A 2BLQA 5C1UA 3F9GA 1ZPBA 4A6LA 1EASA 2ASUB 1GHWH 2GVFA 1Z1JA 2QXHA 1SGCA 1O5DH 1EXFA 4ABAA 5FPTA 1WUNH 3SQEE 4FOUC 5L2ZH 4F4OC 2SGDE 1O2XA 4I7YH 4RKJB 3RU4D 1TNHA 1UTJA 3SV2H 2UWOA 3ELAH 2ZFSA 1S6FA 3RC6A 1C1QA 2KM0A 3KNXA 1EPTC 2EI8A 1ARCA 3EQ0H 5CE1A 2YOLA 4BAHB 4CHAC 1O31A 4NIXA 1ZR0A 2GD4B 2QE7D 3MO9A 5CHAB 1O2HA 4X8UH 1BA8B 1O3CA 3RXGA 3UR6A 2W5EA 4HZHA 1DWDH 2AMPA 2EY4C 2J9NA 1C2KA 3KHVA 3WWFA 1XUIA 2FYQA 4ISLA 3S7HB 4TT3D 1P02A 1JWTA 2PWXA 4AFUA 4Q63A 1BRCE 1DT2A 1W0KD 3PV5A 2RDEA 1RTLA 1GMCG 4K60A 3BTHE 1JRSA 3PLPA 1K0HA 2ZDLA 1W11U 3KCGH 2GT7A 2XCNA 3GCHC 1GJ8B 3AW0A 1SQRA 2FOFA 3TLOA 6GCHG 1HIAB 2QIQA 1GI6A 3A86A 4X1QU 4AFSA 4FU9A 5EQRA 1CT0E 4CRDA 4LZ4B 2FP7B 3GOVB 3UNSA 4H42U 1EFRD 4Y76A 1V2NT 2PGBB 3E0PB 3SUDA 4YLQH 2XOKD 3SZEA 1EZQA 1NTPA 1HJ9A 3KEEA 3SU1A 4Q7XA 4O3UA 3ZV9A 4ISIH 1WOFA 2HVXA 2PTCE 1XM1A 1P05A 3V3MA 2RFKC 4GAWA 1SL3A 3STIA 1PPHE 2ODQA 1DWEH 2TGTA 1MKXK 2FOAA 4BNRA 3UAIC 3C1KA 1O2IA 3T5FH 1DITH 4K1EA 2G52A 4NFEA 1IQEA 5I46H 4IMQA 1TNIA 1NT1A 1MTSA 3MWIU 3PYHA 1A0LA 1GBMA 1OP2A 4JZEH 2IJOB 5C67A 1T32A 1KXAA 1VJ9U 1BBRK 1S5SA 4JZFH 3UOPA 2BDCA 3GYLB 2BZ6H 4NA7A 3UUZA 3ZYDA 1UJ1A 5FHTA 3M7UA 2SNWA 1HAIH 4OS7A 3F2FA 1GI2A 1HIAA 3F9FA 2XWBI 1O2OA 3BV9B 2A1DB 1D3QB 3NUMA 3TH2H 3E1XB 3DHKH 2PHBA 1A5IA 4E7NA 1YY3A 1LKBA 4THNH 1QURH 1RIWB 3BTWE 1ANBA 4X8TH 4Y8YA 3AAUA 1QBOA 5FAHA 4ABJA 4NGAH 1GHAG 1OOKB 4D9QA 2Z3EA 3P17H 1GBDA 1AGJA 1O2YA 1V2UT 1ZOMA 4X2YA 2J34A 1GBHA 3MHWU 3BG4B 2JH5D 1QB1A 4D76A 1A46H 1AFQB 3F0PA 4M9FA 4YLUA 3BG8A 3L3TA 1C2IA 1TPOA 3FFGA 4Z6AH 1O2ZA 1GCTC 1YPMH 4MDSA 5FPYA 4RT0A 4B74A 1W13U 1A1RA 2BQ6B 4Y10E 3ZVDA 1UTPA 3AW1A 4I86A 1ESTA 3RMLH 1WDIA 1ESBA 5F6MA 1OYTH 1INCA 1OXGA 3E3TA 5DP5A 3VGCC 1FXYA 2BTCE 3F3BA 2FS9A 2CK3D 2UUKB 1OHHD 1SOTA 4A1TA 4D7GA 2O8LA 1TMUH 1ID5H 1UW7A 3ESTA 2FYRA 2WPLS 1CBWC 4HFPB 3A84A 3RXPA 2VIOA 1KTSB 3BF6H 4NSVA 3QO6A 1G3CA 1G3EA 4JZDH 2WHXA 3BEUA 4A1XA 1N8OC 1TX7A 1NFWA 1UHBB 2J95A 4DIIH 1MD8A 1RTFB 2B5TB 1ESAA 4Y7AA 1FN6A 1O3NA 2P94A 2EQNA 3GDUA 1SLXB 1H4WA 2WYJA 3PV2A 1O32A 1QQ4A 1ELVA 2K1QA 1H9IE 4XRNA 4BAMB 1DSUA 1EJAA 3LONA 1ZHRA 4ZXXH 1EZUC 1RTKA 2VB0A 3PB1E 3OY6U 5LPFA 3MU1A 1B7XB 1IQMA 2ZTXA 3L33A 3GDSA 3ZZDA 3SGQE 1BTUA 3BTEE 3MU5A 1XVOA 5JDUB 2G5NA 4ZKNU 3QGJA 4WY3A 1MKXH 2BY7X 2QXIA 4Y0ZE 2VWOA 1TNGA 5GPIB 2OD3B 3ZZ3A 1SQAA 1GJ7B 2ZU2A 3M3TA 1Q31A 5C20A 3OTJE 5A8XA 1C2FA 3HK3B 2PP6A 1C5TA 3LC5A 1MTUA 1K1NA 1O3DA 3O8BA 1Z1IA 1FIWA 3SYJA 1BBRH 3S9BA 3D65E 1AKSB 2FESH 1EP6A 1DS2E 3LIWA 4XBBA 5ABWA 1UHBA 3A83A 5H4IB 1ZMLA 1MCVA 3ZYEA 2K8IA 2R0KA 1AVXA 2CHAC 1EQ9A 1MTNB 7LPRA 3QTVH 5KEDA 2BX4A 2ZO3H 1GG6B 4NWLA 4ZH8A 3UNRA 1V2ST 2C8YB 2AIQA 6GCHF 3RXCA 2V35A 2ZFRH 3PTBA 5C5OA 2STAE 1WU1A 3PV4A 4OS4A 1CO7E 2B9LA 2AIPA 1L2EA 1FQ3A 1W0YH 5E0JA 3SV8A 1P12E 1C5RA 2ZWLH 3LGUA 1UK3A 3S7KB 2C8WB 1TALA 3URDA 4U2WA 2WZQA 2ZGXH 1CQQA 5JYIA 4ABFA 3F9HA 3A85A 1KLTA 4QT8C 1QR3E 1O5FH 4UFEH 4JCNA 4ACBA 3R3GB 2GZ9A 3T26A 1O39A 1AKSA 5EXMA 4D9RA 1DM4B 2VIVA 3LJOA 1FAKH 1K1JA 4FUCA 2ZU4A 3FP8E 1ABIH 2OUAA 3KF2A 3ZVGA 4MG3A 1DX5M 3TGIE 5IYTA 1TPAE 1GMDF 1O3IA 3F6UH 3F2HA 4ZHLU 3Q3KA 2VVVA 2VH0A 3A80A 1Z8GA 3I77A 3EA7A 4ABDA 1IHSH 2C8ZB 1AB9C 4CH8B 2JETB 3D49H 1YP9A 1DWBH 1GMHG 3NXPA 1CSOE 1AUJA 3SW2B 2GZ7A 4FUFA 5FXLA 2ANYA 4U32A 1W0JD 3DD2H 5JBBS 1A2CH 1MAYA 4ZROA 3SNDA 1ZTKA 1ANCA 1CGIE 1GHAF 1MCTA 2F9VA 2FI5E 4JK5A 1LHFH 1JOUB 2ESTE 1K1LA 1NY22 2KCAA 4HTCH 2QV1A 8LPRA 2FOGA 5KGOA 1KLJH 2C4FH 1ZSJA 1AUTC 1Y5UT 2HLCA 1Y8TA 7ESTE 4X6MA 3KQ5A 3VB3A 1VCPA 3ZVAA 1ACBE 2F9PA 1CVWH 1SLVB 2Y82A 3FO8D 1W7XH 1YGCH 4B2AA 2CN0H 4UE7H 5EW1H 1FJSA 3VB5A 1YF4A 2C3SA 2AGGX 3URCA 2ZGCA 1QNJA 3KQCA 1ZGIA 4GHQA 2BQWB 1HRTH 4LK4A 3SUGA 1ELDE 5JBTA 2J98B 2FX4A 3PWCA 1F0UA 2ODYB 5EG4A 1L4ZA 2C90B 1FLEE 3LT3A 1ANEA 1BTYA 2F3CE 1O3EA 3PO1B 3A81A 1ORFA 1FONA 1A0JA 1MU8B 4X2XA 5C3NA 2FEQH 3C27B 3TJUA 1ELAA 2ZF0H 5F8TA 1WQSA 3ZVFA 1LPZB 2ALVA 2VVCA 3SV6A 5HGGA 3N7OA 1N1LA 1OWJA 1SB1H 2J97A 4MNYA 1NESE 3RXTA 2QC2A 2A45B 2G4TA 1PPZA 3GS9A 2FDAA 3T25A 1OPHB 1S0QA 1RJXB 1BMMH 2QGRA 5PTPA 4I8LA 4P00A 2AYWA 2P8OB 1C2LA 3RMNH 4CRAA 4X6NA 2P3FH 2A32A 4AYVB 5HM2A 4WH6A 3RXDA 2AGEX 3B8JA 1S6HA 1C4Y2 2KR7A 1GI9B 1TWXB 2GZ8A 5DG6A 3P92A 2A5IA 3MO6A 1BCUH 1AE5A 3SORA 1PQ7A 1WTGH 1UTQA 1UCYE 2H5CA 2ZECA 3QZRA 1EZSC 1TFXA 3ZIAD 3OY5U 1P2MA 3V7TA 1PYTD 3QWCH 1KTTB 3RXLA 3E6PH 3P95A 2A0QB 4AOQA 1YKTA 3LU9B 1H8IH 3VFEA 1FDPA 3FZZA 1ZRKA 4NG9H 1O38A 2W3IA 5K0HA 4AX9H 2OLGA 1GJBB 2AS9A 2BVXH 2ZHQH 1HXFH 1Z6JH 5CHBA 7KMEH 1FPCH 6CHAB 2Z3DA 1QGFA 4I32A 3ZVCA 3DCLA 1Y3YA 3ZZBA 1O3BA 2AFQB 1X7AC 1T4UH 4UDWH 1SGFG 2RG3A 1CU1A 2V3OH 5CHAC 2W3KA 4MNVA 3UOUA 4F55A 2FIRH 1HB0B 3GY8A 1IQGA 1QA7A 3SGBE 4IN2A 3H7TA 1T8NA 1TRNA 5F03A 1A7SA 1W14U 2J5UA 8KME2 2G00A 2GP9B 3V0XA 2ZZUH 3EYDA 1QRXA 2D2DA 2HPQH 3JZ2B 2KAIB 2HNTF 3O8RA 4DGJA 1AY6H 2W7SA 1ZMNA 5DP3A 1DANH 4DW2U 4X2WA 2Z9KA 1TNJA 2ZTZA 1MAXA 2XBWA 2QF0A 1JRTA 1RD3B 3NZIA 2ZDKA 2BM2A 3I78A 5G4BA 1KSNA 4GUXA 2PR3A 3SZNA 1AQ7A 1MKWK 1O5BB 4XD7D 1GL1A 1N6XA 1S81A 1A3EH 2KX4A 1O3JA 2ZA5A 3F68H 2R3YA 2XXLA 3SU3A 2QF5A 4O9VA 1VZQH 1ZYOA 1BMAA 1C1OA 3RXAA 1RFNA 5E2OA 4B71A 3SU2A 1E0FD 4YOIA 5FCKA 1TA6A 2O8UA 4LZ1H 5TJXA 2FPZA 2BOHB 4VGCB 3M7QA 3V13A 1JBUH 1GMHF 1HAXB 2BDIA 1QY6A 5FBIA 3OTPA 4Y8ZA 1DSTA 2Y5FA 3RXFA 3KIDU 1ZHMA 1GBIA 1ZZZA 3RUOA 5JB8S 2UUFB 2ZGHA 1IAUA 3RM2H 4U01A 1DLEA 2KAIA 3CS7A 2VU8E 4KTUA 1QTFA 1Y3VA 1EB1H 1XUFA 4YO9A 3QN7A 4RN6A 1K22H 5DN6D 2A2QH 4WXVA 4O3TA 4Y79A 5EXLA 1IQNA 1L1NA 4YTAA 1QRZA 1W2KH 1LHGH 1TNKA 2F9UA 1DUAA 1WQVH 4XSKU 2FMJA 1KY9A 3ATLA 4CRGA 1SGDE 4P02A 3P8OA 1UCYK 5JPMH 6ESTA 1O3GA 5DP6A 1A5GH 1PFXC 1RXPA 2WPDD 4IS5A 3VB6A 2OBOA 1ZLRA 3ZVEA 3SQHE 1PPEE 1Z8IB 2NU3E 3U8TH 1SKYE 1EUFA 1ELEE 4UEHH 1H9LB 1GI7B 5HIZA 4AB8A 4X1RU 1BRAA 2J92A 1K1PA 1RIWC 3R0FA 4AG2A 3MTYA 2TBSA 3SBKA 5EOKA 4UONA 3AK5A 4I8KA 2C93B 4RKOB 4TY6A 1Q2WA 1XKAC 4BAKB 2QF4A 2PTNA 3GICB 1K1IA 3PLBA 1SC8U 3HPTB 2ZFPH 2CGAA 3BG4C 2A4GA 1AFQC 3E0NB 2F4LA 2BZAA 4WWYA 2F9OA 1S82A 4DVAU 2WUCA 2GJGA 1C1PA 4FXGH 2UWLA 2WV5A 1ZTJA 1VR1H 3MNSA 1EAUA 3QDZB 5EQQA 5AVDA 2AGIX 1SGEE 2Z9IA 1WXRA 1MQ6A 1L1GA 1TQ7B 3HATH 4ISNA 4ZHAA 3IWMA 4XBCA 1MQ5A 1T8LA 3FN8A 4CREA 1OWIA 2GGVB 2VIQA 3UFAA 5DKMA 4DT7B 2GTBA 1O2MA 5GDSH 2UWPA 3BEIB 1MKWH 2GT8A 1O37A 1EJNA 5T6FA 2Z9JA 1ZPZA 1IQHA 3BTTE 1CHGA 4NWKA 1TRMA 2KCPA 1HDTH 5DP8A 1H1BA 4KP0A 1TE0A 1FY4A 4UFGH 4WMDA 4B75A 1TX6A 1O34A 1SG8B 4KKDA 1GMDG 3SI3H 3PTNA 1FY1A 2XWAA 3A82A 1GJ5H 2FI4E 1MH0A 3N99A 7GCHF 3N7EA 1V2LT 5SGAE 3W1EA 2STBE 3GY4A 1Q3XA 1AZZA 1UTNA 1QRWA 4H6SB 1C2HA 1BDAA 1D3DB 4UFDH 3DA9B 1M9UA 3TJOA 1KXEA 1PJPA 1W7GH 3EA9A 3E90B 4BXSA 1V2RT 1NBME 3LC3A 3U1JB 1GJAB 3PMJA 1O2PA 3FP6E 1HAVB 2VIDA 2GDDA 4B6FA 3BTFE 4Z1MD 3M7TA 1ZJDA 2WPKS 3TNTA 3LDXH 1YPKH 2Y5GA 1UCYH 3L6PA 2TPIZ 5J4QA 1MBMA 2CF9H 3FVFB 1MTNC 1IQFA 1NFUA 4TYDA 1EOJA 4A5TS 1KMHB 2AERH 1GG6C 1O2UA 4FVBA 1GJ9B 5EJZA 4SGAE 4TWWA 4NCYA 1NU9A 2SGQE 1ARBA 4K8BA 1GJCB 1TA2A 1HJAB 1AZ8A 2JKHA 5FX6A 1TGTA 1V2MT 3GY3A 1BJVA 1TGCA 4TPYA 4ZHMU 1W10U 3MH6A 1HAOH 2EA3A 2OC0A 2AEIH 2V6NA 1VJAU 1WYKA 2H9HA 3TNSA 1C9PA 2DE9A 4A92A 3KGPA 3WWBA 3EE0B 4UFFH 1EAXA 1O2WA 1KXBA 1C5OH 1P2QA 4LOYH 5DPAA 1O3KA 2FOMB 1A3BH 1UVTH 1TQ0B 3MH7A 1O3HA 1HPGA 1YLNA 1KXCA 1QJ6B 4WXIA 2XBVA 1O2LA 2XW9A 3LH3A 4YM9A 2VINA 2Y7XA 5C94A 1QJ1B 5DP7A 1MMJN 2ZDMA 4CRCA 3F0OA 2P3UB 4E05H 4FUEA 2IPQX 3OAAD 1WSSH 2J38A 5JBAS 3DT0H 2WPIS 2BY9X 4B2CA 1YCPM 1TIOA 1S85A 2XRCA 3LH1A 3P8NA 2QAAA 2GV6A 1A0HB 2TGPZ 4Y7BA 5T6GA 2BLOA 3BN9A 3SV7A 5C17A 1P01A 1AO5A 1B0EA 2L6OA 1ZJKA 1T8MA 3ZZ7A 2XC0A 2BD8A 1UMAH 2XNDD 3G01A 3GY7A 5IK2D 1IQKA 3BIVH 1GHBG 3OEED 2FOHA 1DUEA 3GYMA 2ZPSA 2LNCA 3SO3A 2JETC 1AVWA 2H9TH 1WAYB 1ELCA 9LPRA 3RP2A 2PUQH 3ATMA 1GVKB 2TRMA 1GBAA 2FTMA 2XCFA 1HFDA 5GJ4B 1HAPH 1GHYH 1O3AA 1N6YA 2QF3A 2EEKA 4IMZA 1OKXA 1P03A 2RA0A 2JJ1D 5EIYA 2G8TA 3MI4A 3F9EA 1KIGH 3OYPA 3ZZAA 2SGEE 1LVMA 2R2WU 1EP5A 4A7IB 1ELFA 4Y11E 2R0LA 2O8MA 2HGTH 1OX1A 4ABEA 4JK6A 1A61H 4K5ZA 1PPGE 2BD5A 1Y3XA 3S69A 3VEQB 4B76A 1LVBA 1NU7B 2PKAB 1OSSA 4ACAA 5E2PA 3PMBB 1RS0A 1WTHD 3FANA 1LQEA 1DVAH 1S0RA 3MU8A 2WPMS 1Y3UA 3KQBA 5FBEA 2P59A 2V3HH 8ESTE 3W95A 3OU0A 2PV9B 2WYGA 4KGAA 1QFKH 4DIHH 3JZ1B 4CR9A 1ZPCA 2ZQ2A 1C1TA 4BTIB 3SN8A 3PMHB 2RDLA 3EAJA 4ABGA 1TGSZ 3PO1C 1NO9H 2F91A 2H9EH 2BY5X 1GJDB 3QLPH 3SU5A 5JB9S 1YLCA 2SGAA 1BTPA 3IITA 2SFAA 1TMBH 2TIOA 2BD2A 4GVUA 3TJNA 2ZP0H 3ATIA 2Q6GA 4GLYA 2PKAA 1TABE 2WPJS 1B0FA 3BTGE 3NWUA 4OGXA 3M61U 2PSXA 4ABBA 5C5NA 3AASA 1BOQA 5EU8A 2BXUH 2FS8A 2P16A 3SUEA 1C1NA 2P8OC 3A8AA 3SJ9A 3B23B 1JMOH 2ANKH 1QZ8A 3TIUA 4NA8A 1GJ6A 3SV9A 1Y59T 1XUGA 2EC9H 1SVPA 1VCQA 2ZGJA 3MMGA 1THPB 1SHYA 3NKKA 2G4UA 2ODPA 1MBQA 3O8DA 2F83A 1TGNA 4MVNA 5BPEA 4TPIZ 1TYNA 4B2BA 3U28C 1OP8A 1SGFA 3AAVA 2VIPA 1GI5A 1GCDA 1TPPA 4XFQA 1P2KA 1UTOA 3BTQE 1GPZA 1LO6A 5LH8A 3KL6A 1UVOA 1BHXF 1C5SA 3Q77A 2BXTH 4Q2KA 4FUGA 4X0WU 4H6TA 5GXPA 1UK2A 3UY9A 1YC0A 1V6DA 1TBRH 5A0CA 1HUTH 3MH4A 1V2TT 3GCNA 4INLA 3VB4A 6CHAC 3UTUH 1P57B 4B6EA 1G32B 4INHA 3DFLA 4Q4LA 4CBOA 5FPSA 2UUYA 2FM2A 5A0AE 1V2QT 2Z3CA 3RU4E 1DFPA 4AFQA 1NRSH 2AH4X 4ZUHA 1SFIA 1J17T 1O2TA 4FUHA 2OBQA 1DDJA 2Z9GA 3ZVBA 1YPEH 3TH4H 2XBXA 1BTZA 2IN2A 4KELA 2FLBH 2OQ5A 1FZZA 1AVGH 2Z7FE 2C8XB 3T29A 1DXPA 1YPJH 1ETSH 2V7QD 3PRBA 1WCZA 4U30A 2YMSD 2GX4A 2RA3A 3U8OH 3RXBA 1HGTH 4BAQB 1LVOA 2ZFFH 2SGFE 3HKIB 1EATA 5L30H 1ETTH 1QL8A 1SBWA 3HK6B 3UREA 4HI3A 3T27A 5T6DA 5DK1A 3U98H 2FZZA 3MH5A 4X8SH 2QXJA 1P2JA 4ZMAH 2W6JD 3M3VA 3FZDA 1K2I1 1NRQH 1IQLA 5GCHF 3TU7H 4DY7B 4MNWA 2XC4A 1EZXC 2QYIA 2XTTB 3QGNB 1GHBF 4FETA 4Z0KA 2OP9A 4VGCC 5ESTE 2J98A 2G81E 3AVZA 4FU8A 1V2JT 3A89A 1O2SA 1GGDB 2VGCB 3PMAB 1EB2A 3LJJA 2ZCKP 4ASHA 2M2AA 1LHCH 4BOHA 4NIVA 1F0SA 5EW2H 1AD8H 2ANMH 2PFEA 2ZHDA 4MQAA 1LTOA 2Q1JA 5AFYH 2ZC9H 1MZDA 1ELBA 2V0BA 3SNBA 1HLTH 5A8YA 3MU4A 1G3DA 1VKYA 7GCHG 5EJ1A 5HKKD 2GCHF 1P2NA 1P9SA 1XVMA 2ZHEH 1P2OA 1BB0B 1A5HA 1SI5H 2FOCA 3NCLA 4DOQA 4HGCA 2BHGA 2EI6A 4AB9A 1SHHB 2R2MB 1K28D 1C5UA 5B6OA 2HPPH 3GISB 3GCTF 4ABIA 4XE4A 3KN2A 3VPKA 3SU0A 4X8VH 1AIXH 1COWD 2WUBA 2ZG0H 2XNIA 1FN8A 1YWUA 1G9IE 4AN7A 4RSPA 1Z7KA 3M5MA 1ZHPA 1HXEH 2Y80A 3TGJE 3DUXH
chains in the Genus database with same CATH topology
2EY4C 3U28C 2V3MA 2RFKC 3MQKC 2HVYB 3UAIC 2EQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EY4 C;  3U28 C;  2V3M A;  2RFK C;  3MQK C;  2HVY B;  3UAI C;  2EQN A; 
#chains in the Genus database with same CATH topology
 1IHT H;  1GBF A;  2F9B H;  1XUH A;  3FOA A;  3MQK C;  3NPS A;  2ZIQ H;  2PW8 H;  3LPR A;  4ABH A;  5L2Y H;  4JYV H;  1FMG A;  2FOE A;  4SGB E;  1BIO A;  2R9P A;  1H8D H;  2D1J A;  1C5Q A;  3FAO A;  1GI8 B;  3SJ8 A;  2WSS D;  2VNT A;  1AWH B;  3RXR A;  2GDE H;  2XBY A;  1QB9 A;  2JH0 D;  1D6W A;  2QCY A;  3ATK A;  1DLK B;  3T28 A;  5EPN A;  4CH2 B;  2PKS B;  2ZDN A;  4MPX A;  1TOC B;  1O2G H;  2WV9 A;  1GDN A;  2FOB A;  4D7F A;  3E8L A;  3UB0 A;  5A09 A;  1RRK A;  2O9Q A;  2ZHF H;  2LP6 A;  3M35 A;  3VXE H;  1BTH H;  3TK9 A;  1XXF A;  2J2U A;  2GCT B;  9EST A;  1ZGV A;  2GMT B;  4I8H A;  1NC6 A;  1FV9 A;  1O30 A;  5C0T A;  1BJU A;  1O5A B;  2P95 A;  3CS0 A;  4ZAE A;  3M3S A;  4LXB H;  1H9H E;  1UTK A;  5C2Z A;  3B9F H;  3SI4 H;  1FY8 E;  1BML A;  1FX0 B;  1UTM A;  3MOC A;  3MO3 A;  1LHD H;  1VGC B;  1C1S A;  5A8Z A;  4YES B;  4GPG A;  1VCW A;  3A8D A;  4I33 A;  4DT4 A;  1UVP A;  1OWD A;  1YPL H;  3K65 B;  4YT6 H;  2HNT C;  3RXM A;  3ATW A;  2CF8 H;  5T3H A;  3UQV A;  1E35 B;  4IC6 A;  2SGP E;  2UUJ B;  3STJ A;  4HG6 A;  4BXW A;  5KEC A;  2Z6B D;  4E06 H;  1BT7 A;  1DPO A;  1LKA A;  3BEF B;  3SJO A;  1DE7 H;  1GHX H;  4WH8 A;  1O2R A;  2HVY B;  1XXD A;  1AWF H;  3EE7 A;  2W26 A;  1LHE H;  3MYW A;  3RXI A;  2B0F A;  1NN6 A;  1PYT C;  1EJM A;  1C5L H;  4NA9 H;  5DP4 A;  3SGA E;  5BRR E;  1Z71 A;  4AC9 A;  4DJZ B;  1SGY E;  5EJL A;  3S9A A;  4BTU B;  1QB6 A;  3KQD A;  4OM9 A;  1J14 A;  3PWB A;  3A7T A;  4K69 A;  2H1U A;  3M5N A;  1HAY B;  4I31 A;  1XMN B;  3EGK H;  2VVU A;  4MNX A;  4K1T A;  1GWA A;  2O8W A;  4MPV A;  3ZZ8 A;  5B6L A;  5C0U A;  1O5C B;  3P70 B;  1GVZ A;  4OS6 A;  2AMQ A;  3ODF A;  3PRD A;  4D8N A;  4X1N U;  5F53 A;  1YCP K;  3TIT A;  4F48 B;  4Y71 A;  4BAN B;  3VB7 A;  4YXW D;  3SU6 A;  3WW7 A;  5A0B A;  4IGD A;  1O5G H;  2BX3 A;  2PLX A;  2VWL A;  1RGQ A;  1U6Q A;  4DUR A;  4ISO A;  3LGY A;  2KCY A;  4O97 A;  2TGA A;  2NU1 E;  1P06 A;  4EST E;  1QBN A;  4CRF A;  3RMO H;  1G36 A;  3U9A H;  2OC7 A;  1CA0 B;  1O33 A;  2PGQ B;  3RXS A;  1JIM A;  1MZA A;  5F8Z A;  1HJA C;  2ZNK H;  1C1M A;  2BD7 A;  1TBQ H;  2QXG A;  1C5V A;  1J15 A;  1FAX A;  1NM6 A;  2K0Q A;  2YMS B;  3RLY H;  2PSY A;  5LPR A;  5A2M H;  3S9C A;  1SLU B;  2GV7 A;  3OFN D;  1O36 A;  1IQI A;  2BDG A;  3E91 A;  1TLD A;  1NFY A;  2ZGB H;  4GCH F;  1GJ4 H;  1O2Q A;  1D3T B;  2A7H A;  4FVD A;  1AND A;  2BDY A;  1GDQ A;  3K6Z A;  2BDB A;  1ELT A;  1LVY A;  2ZFT A;  1E1Q D;  3VG8 A;  1C5N H;  2BDH A;  2BD4 A;  2HOB A;  1O2V A;  2Y5H A;  1G2L A;  1MTV A;  5E0H A;  1Z8J B;  2J4I A;  5E8E H;  1XX9 A;  1C1R A;  1WBG B;  2W7U A;  1C5P A;  3M5O A;  4ZKS U;  1MU6 B;  4OS5 A;  1UTL M;  1GBK A;  2ZDV H;  1SGI B;  1TNL A;  4R0I A;  1EOL A;  2Y81 A;  3GY5 A;  2ANW A;  3DSP A;  2IJD 1;  1CGH A;  8GCH G;  2F43 B;  1CHO F;  3SHC H;  1DY9 A;  3MNB A;  1DIC A;  1AI8 H;  4BAO B;  3P8F A;  4FUD A;  2ULL A;  3ZZ5 A;  1EPT B;  1T4V H;  2VWN A;  4X1S U;  1TPS A;  1F5R A;  1GI1 A;  3GY2 A;  2WV4 A;  4CHA B;  2SNV A;  4KTC A;  3RXE A;  1P09 A;  1TB6 H;  3GCO A;  1TRY A;  5GWZ A;  3TJV A;  2A4O A;  2BOK A;  1FNI A;  3RM0 H;  1SGT A;  1C4U 2;  2BVS H;  3DFJ A;  1D9I A;  1CT2 E;  1XKB C;  1S6L A;  4JMY A;  1J9C H;  1B5G H;  5J4S A;  4CRB A;  5K7R A;  1FY5 A;  1C2D A;  4WF8 A;  5E0G A;  1ZRB A;  1XUK A;  4Y8X A;  3M5L A;  3NRL A;  3U69 H;  4OS1 A;  3RXO A;  1BMN H;  2RCE A;  1LDT T;  2OTV A;  2TGD A;  2CV3 A;  3W94 A;  1CGJ E;  3QTO H;  4WMF A;  2XYA A;  3UPE A;  3KQE A;  2DE8 A;  3GCH B;  1KYN A;  3UWI A;  2D8W A;  1W3C A;  1C5X B;  1FY3 A;  1FUJ A;  3IG6 B;  1K1O A;  1L1J A;  3U1I B;  1YPG H;  1AHT H;  1UO6 A;  5AF9 H;  1YCP H;  4OS2 A;  1S83 A;  3QK1 A;  1EPT A;  3TVJ B;  4X1P U;  3Q00 A;  1KXD A;  3TH3 H;  3HGP A;  1P11 E;  1HAZ B;  4M7G A;  1EKB B;  1HBT H;  4Q80 A;  3A7Y A;  4AFZ A;  3GDV A;  2ZPR A;  3A87 A;  2I6Q A;  4RI0 A;  1GBB A;  1HAV A;  2WPH S;  5I25 A;  1GL0 E;  5EXN A;  2OQU A;  2BQ7 B;  2Q6D A;  2ZPQ A;  2PUX B;  3SHA H;  2P3T B;  5CMX H;  1GHV H;  3RXH A;  1WV7 H;  5HYO A;  3T2N A;  1KXF A;  1O3P B;  1F0R A;  3CNR A;  4AYY B;  3K2U A;  1O0D H;  4J2Y B;  1AE8 H;  1HYL A;  4NZL A;  2GKV E;  3UNQ A;  5FL7 D;  1P04 A;  2ZU1 A;  3RXJ A;  3DSO A;  5GCH G;  2G5V A;  1O2K A;  3RLW H;  3F1S B;  1SOZ A;  1DWC H;  3O8C A;  1HJ8 A;  4ZKR U;  1T7C A;  2AMD A;  3SNC A;  1HAG E;  1O35 A;  1TMT H;  1CA8 B;  2A2X H;  5DO4 H;  1NRR H;  1P2I A;  2Q6F A;  1XUJ A;  1C1W H;  4IC5 A;  3ZV8 A;  1Y3W A;  4KTS A;  2ZQ1 A;  1D4P B;  2ZCL P;  1CT4 E;  1BZX E;  1ETR H;  4AOR A;  3U8R H;  1J8A A;  2ZU5 A;  1SGQ E;  3QZQ A;  2H5D A;  1C2E A;  1ELG A;  5EQS A;  4XOJ A;  4CBN A;  2HNT E;  1L4D A;  5IDK A;  3A7Z A;  4I8G A;  4K2Y A;  2GCH G;  2BDA A;  4B73 A;  1L0Z A;  2OIN A;  2ZDA H;  1AU8 A;  1AMH A;  2Z9L A;  1KLI H;  3BTK E;  1TON A;  2A4R A;  2FXR A;  2BVR H;  2NU0 E;  4YOJ A;  1C4V 2;  3UIR A;  1D3P B;  2Y6T A;  2ZKS A;  2O8T A;  3NK8 A;  4Q7Z A;  2FI3 E;  4NSY A;  5C1Y A;  2YNB A;  1JXP A;  3MU0 A;  1GCT B;  2OC8 A;  1GMC F;  1BRB E;  3GCT G;  1O5E H;  3HKJ B;  3CEN A;  1T31 A;  2LPR A;  1HAH H;  3H5C B;  1VIT G;  1KDQ B;  3ENS B;  1C2G A;  1DOJ A;  5EOD A;  1F5K U;  1YLD A;  2JIZ D;  3E16 B;  3VGC B;  4ASU D;  1W12 U;  1YPH C;  1GBE A;  3F2G A;  1K1M A;  1C5W B;  4NZQ A;  2J94 A;  2CMY A;  2OC1 A;  1G3B A;  3MNX A;  5FX5 A;  2A4Q A;  3SJK A;  2FLR H;  4FUB A;  1CBW B;  3P8G A;  4YZU A;  3OE7 D;  5T1V A;  1GDU A;  2VH6 A;  4TSF D;  1UVS H;  2BD9 A;  4K3J A;  1K9O E;  3EA8 A;  4INK A;  4IN1 A;  4YOG A;  1N8O B;  2CXV A;  2P93 A;  5HM9 A;  3V12 A;  4DCD A;  3TPI Z;  4B1T A;  1SLW B;  3A7V A;  1GI3 A;  5AFZ H;  5LGO A;  1ZSL A;  2CJI A;  1O3L A;  1G37 A;  4J1Y A;  3WY8 A;  3D23 A;  1GI4 A;  1ZMJ A;  2Y7Z A;  1BQY A;  1W8B H;  1FIZ A;  1J16 A;  2ZHW H;  1C2M A;  1YBW A;  3RU4 T;  1OWH A;  8GCH F;  3GY6 A;  1K21 H;  1SMF E;  2BY8 X;  3K9X B;  1V2P T;  3OEH D;  1Z8R A;  1SGR E;  3UR9 A;  3RXQ A;  3BTD E;  1OWE A;  4X6O A;  1NBM D;  1P3E A;  4AGJ A;  1KDQ A;  2G55 A;  4ISH H;  1QQU A;  5F8X A;  3ZZ9 A;  1SSX A;  2FO9 A;  2KCO A;  3VXF H;  1AN1 E;  2QN5 T;  1IQJ A;  1Y5B T;  2R3U A;  1GGD C;  2VGC C;  1LPG B;  4JYU H;  2ZU3 A;  1NZQ H;  2A7C A;  4MTB A;  1S84 A;  3S0N A;  3BIU H;  3BTM E;  1EAI A;  1P9U A;  2NU2 E;  3Q76 A;  3TGK E;  2HRV A;  1JIR A;  3M36 A;  3MFJ A;  1QL9 A;  1G2M A;  3LKW A;  1C1U H;  1O2N A;  3K6Y A;  3FKS D;  1P10 A;  1IOE A;  3SNE A;  4RT1 A;  5EPY A;  1UVU H;  4TWY A;  4F49 A;  1HNE E;  2CHA B;  3QUM P;  1V2O T;  2AHM E;  3A7W A;  4K1S A;  4A1V A;  2Z94 A;  1QHR B;  1MAB B;  4MPU A;  2NWN A;  1F0T A;  1E36 B;  1ZTL A;  2YNA A;  3RC4 A;  4ZKO U;  3ITI A;  4OGY A;  2OXS A;  3RXK A;  1BTW A;  4GSO A;  3H09 A;  5ETX A;  3LGI A;  5DSF A;  2H2Z A;  1F2S E;  1OYQ A;  5HXF A;  1SGN E;  2ZTY A;  4NIY A;  1BIT A;  2VJ1 A;  1ZSK A;  4Y6D A;  2BB4 A;  5FCR A;  1OWK A;  3A88 A;  1LQD B;  1OS8 A;  4Y0Y E;  1NRN H;  1PPC E;  3PM3 A;  2HLD D;  1E34 B;  5HMA A;  2LEL A;  2W6I D;  1BRU P;  5TCC A;  2THF B;  1SR5 C;  3MNC A;  2ZI2 H;  3M37 A;  2EI7 A;  5ESB A;  2QY0 B;  2IOT A;  3DSG A;  3PLK A;  1F7Z A;  3ZZ6 A;  1NFX A;  1C9T A;  4YT7 H;  4WVP E;  4PRO A;  4WME A;  1E37 B;  2V3M A;  5C1X A;  3QX5 H;  1SQT A;  2NU4 E;  4MLF B;  3SNA A;  1LPK B;  2FX6 A;  2ZCH P;  1V2V T;  3SOS A;  3ODD A;  5L6N H;  2FTL E;  1GBJ A;  3A7X A;  4JYT A;  1T8O A;  1QCP A;  2A7J A;  3LGV A;  3UWJ H;  2JH6 D;  5LPE A;  1HCG A;  3LGW A;  3BSQ A;  1C1V H;  1O3M A;  1V2W T;  1YYY 1;  2VIW A;  4AG1 A;  3RXV A;  2PKS C;  1EAW A;  2QA9 E;  3D62 A;  3KYF A;  1Z6E A;  2ZFQ H;  4IBL H;  3RXU A;  4IW4 E;  1LMW B;  1DY8 A;  1GBL A;  1O3F A;  4GCH G;  1MTW A;  1F92 A;  2DUC A;  3PRO A;  3FP7 E;  4R8T B;  1QIX B;  4GHT A;  1PQ8 A;  3TK6 A;  2GCT C;  2GMT C;  1AB9 B;  3Q3X A;  4NIW A;  5AHG H;  6LPR A;  2A31 A;  4K8Y A;  4AGK A;  1ABJ H;  3CP7 A;  4H4F A;  1H8E D;  4JZI A;  1HV7 A;  1CE5 A;  1BTX A;  2H6M A;  1MD7 A;  2I6S A;  1VGC C;  3A8C A;  1UK4 A;  4BTT B;  1FI8 A;  3P6Z B;  5DGJ A;  4DG4 A;  4ZXY H;  1FPH H;  3SU4 A;  2OK5 A;  1PQ5 A;  1E38 B;  2BLV A;  3EDX B;  2VWM A;  4Q7Y A;  3ZZ4 A;  4AZ2 B;  1CHO G;  3HGN A;  1BMF D;  1MUE B;  1W0Z U;  1AFE H;  1EX3 A;  5GND A;  5DJ7 A;  1C5Y B;  2L74 A;  1PQA A;  1F5L A;  1A4W H;  1TBZ H;  1V2K T;  1GBT A;  1P8V C;  2FWW A;  4E7R G;  1TOM H;  3OX7 U;  1V3X A;  2XC5 A;  2A5A A;  3SJI A;  2JDI D;  1QBV H;  1NPM A;  2HAL A;  2M5T A;  1VIT H;  3LOX A;  1VIT F;  2BD3 A;  2B7D H;  2BLW A;  4ZCN A;  1C2J A;  2BY6 X;  2D26 C;  4I8J A;  1QL7 A;  4MPW A;  1TGB A;  1TAW A;  4FU7 A;  1DXW A;  4FUI A;  4UD9 H;  1P0S H;  1E1R D;  1LCY A;  2WIN I;  1D6R A;  4O03 A;  1C5M D;  3LGT A;  1SQO A;  5GIB A;  5TCA A;  4XDE A;  2ALP A;  4NFF A;  1NS3 A;  1E79 D;  2G51 A;  1PPF E;  1OP0 A;  2BMG B;  1Y5A T;  3SUF A;  1BHX B;  1YM0 A;  2BYA X;  2ZEB A;  3A8B A;  1GBC A;  1G30 B;  2B8O H;  1QA0 A;  1CA0 C;  1QJ7 B;  1SFQ B;  1NRP H;  1YPH E;  2ILN A;  3KYG A;  1O3O A;  1THS H;  3H7O A;  3Q3Y A;  2IPH A;  1BUI A;  4CR5 A;  5JBC S;  2YMS C;  2FOD A;  1C5Z B;  3RC5 A;  2KFW A;  4JZ1 A;  4X2V A;  4FUJ A;  2A5K A;  3TK5 A;  1GI0 A;  1THR H;  1H8H D;  4XBD A;  4X6P A;  1SPJ A;  3UQO A;  3ZZC A;  2F9N A;  1BBR E;  3RDZ A;  2OCV B;  2JJ2 D;  4WJG 2;  3T62 A;  4TY7 A;  2VBC A;  5EGM A;  3OSY A;  1GVL A;  3RMM H;  5DP9 A;  3I29 A;  1P3C A;  3N7D A;  5HIY A;  2HWL B;  1SGP E;  2KZ4 A;  5CDF E;  1GHZ A;  1O2J A;  1NRO H;  1PPB H;  1TX8 A;  2BLQ A;  5C1U A;  3F9G A;  1ZPB A;  4A6L A;  1EAS A;  2ASU B;  1GHW H;  2GVF A;  1Z1J A;  2QXH A;  1SGC A;  1O5D H;  1EXF A;  4ABA A;  5FPT A;  1WUN H;  3SQE E;  4FOU C;  5L2Z H;  4F4O C;  2SGD E;  1O2X A;  4I7Y H;  4RKJ B;  3RU4 D;  1TNH A;  1UTJ A;  3SV2 H;  2UWO A;  3ELA H;  2ZFS A;  1S6F A;  3RC6 A;  1C1Q A;  2KM0 A;  3KNX A;  1EPT C;  2EI8 A;  1ARC A;  3EQ0 H;  5CE1 A;  2YOL A;  4BAH B;  4CHA C;  1O31 A;  4NIX A;  1ZR0 A;  2GD4 B;  2QE7 D;  3MO9 A;  5CHA B;  1O2H A;  4X8U H;  1BA8 B;  1O3C A;  3RXG A;  3UR6 A;  2W5E A;  4HZH A;  1DWD H;  2AMP A;  2EY4 C;  2J9N A;  1C2K A;  3KHV A;  3WWF A;  1XUI A;  2FYQ A;  4ISL A;  3S7H B;  4TT3 D;  1P02 A;  1JWT A;  2PWX A;  4AFU A;  4Q63 A;  1BRC E;  1DT2 A;  1W0K D;  3PV5 A;  2RDE A;  1RTL A;  1GMC G;  4K60 A;  3BTH E;  1JRS A;  3PLP A;  1K0H A;  2ZDL A;  1W11 U;  3KCG H;  2GT7 A;  2XCN A;  3GCH C;  1GJ8 B;  3AW0 A;  1SQR A;  2FOF A;  3TLO A;  6GCH G;  1HIA B;  2QIQ A;  1GI6 A;  3A86 A;  4X1Q U;  4AFS A;  4FU9 A;  5EQR A;  1CT0 E;  4CRD A;  4LZ4 B;  2FP7 B;  3GOV B;  3UNS A;  4H42 U;  1EFR D;  4Y76 A;  1V2N T;  2PGB B;  3E0P B;  3SUD A;  4YLQ H;  2XOK D;  3SZE A;  1EZQ A;  1NTP A;  1HJ9 A;  3KEE A;  3SU1 A;  4Q7X A;  4O3U A;  3ZV9 A;  4ISI H;  1WOF A;  2HVX A;  2PTC E;  1XM1 A;  1P05 A;  3V3M A;  2RFK C;  4GAW A;  1SL3 A;  3STI A;  1PPH E;  2ODQ A;  1DWE H;  2TGT A;  1MKX K;  2FOA A;  4BNR A;  3UAI C;  3C1K A;  1O2I A;  3T5F H;  1DIT H;  4K1E A;  2G52 A;  4NFE A;  1IQE A;  5I46 H;  4IMQ A;  1TNI A;  1NT1 A;  1MTS A;  3MWI U;  3PYH A;  1A0L A;  1GBM A;  1OP2 A;  4JZE H;  2IJO B;  5C67 A;  1T32 A;  1KXA A;  1VJ9 U;  1BBR K;  1S5S A;  4JZF H;  3UOP A;  2BDC A;  3GYL B;  2BZ6 H;  4NA7 A;  3UUZ A;  3ZYD A;  1UJ1 A;  5FHT A;  3M7U A;  2SNW A;  1HAI H;  4OS7 A;  3F2F A;  1GI2 A;  1HIA A;  3F9F A;  2XWB I;  1O2O A;  3BV9 B;  2A1D B;  1D3Q B;  3NUM A;  3TH2 H;  3E1X B;  3DHK H;  2PHB A;  1A5I A;  4E7N A;  1YY3 A;  1LKB A;  4THN H;  1QUR H;  1RIW B;  3BTW E;  1ANB A;  4X8T H;  4Y8Y A;  3AAU A;  1QBO A;  5FAH A;  4ABJ A;  4NGA H;  1GHA G;  1OOK B;  4D9Q A;  2Z3E A;  3P17 H;  1GBD A;  1AGJ A;  1O2Y A;  1V2U T;  1ZOM A;  4X2Y A;  2J34 A;  1GBH A;  3MHW U;  3BG4 B;  2JH5 D;  1QB1 A;  4D76 A;  1A46 H;  1AFQ B;  3F0P A;  4M9F A;  4YLU A;  3BG8 A;  3L3T A;  1C2I A;  1TPO A;  3FFG A;  4Z6A H;  1O2Z A;  1GCT C;  1YPM H;  4MDS A;  5FPY A;  4RT0 A;  4B74 A;  1W13 U;  1A1R A;  2BQ6 B;  4Y10 E;  3ZVD A;  1UTP A;  3AW1 A;  4I86 A;  1EST A;  3RML H;  1WDI A;  1ESB A;  5F6M A;  1OYT H;  1INC A;  1OXG A;  3E3T A;  5DP5 A;  3VGC C;  1FXY A;  2BTC E;  3F3B A;  2FS9 A;  2CK3 D;  2UUK B;  1OHH D;  1SOT A;  4A1T A;  4D7G A;  2O8L A;  1TMU H;  1ID5 H;  1UW7 A;  3EST A;  2FYR A;  2WPL S;  1CBW C;  4HFP B;  3A84 A;  3RXP A;  2VIO A;  1KTS B;  3BF6 H;  4NSV A;  3QO6 A;  1G3C A;  1G3E A;  4JZD H;  2WHX A;  3BEU A;  4A1X A;  1N8O C;  1TX7 A;  1NFW A;  1UHB B;  2J95 A;  4DII H;  1MD8 A;  1RTF B;  2B5T B;  1ESA A;  4Y7A A;  1FN6 A;  1O3N A;  2P94 A;  2EQN A;  3GDU A;  1SLX B;  1H4W A;  2WYJ A;  3PV2 A;  1O32 A;  1QQ4 A;  1ELV A;  2K1Q A;  1H9I E;  4XRN A;  4BAM B;  1DSU A;  1EJA A;  3LON A;  1ZHR A;  4ZXX H;  1EZU C;  1RTK A;  2VB0 A;  3PB1 E;  3OY6 U;  5LPF A;  3MU1 A;  1B7X B;  1IQM A;  2ZTX A;  3L33 A;  3GDS A;  3ZZD A;  3SGQ E;  1BTU A;  3BTE E;  3MU5 A;  1XVO A;  5JDU B;  2G5N A;  4ZKN U;  3QGJ A;  4WY3 A;  1MKX H;  2BY7 X;  2QXI A;  4Y0Z E;  2VWO A;  1TNG A;  5GPI B;  2OD3 B;  3ZZ3 A;  1SQA A;  1GJ7 B;  2ZU2 A;  3M3T A;  1Q31 A;  5C20 A;  3OTJ E;  5A8X A;  1C2F A;  3HK3 B;  2PP6 A;  1C5T A;  3LC5 A;  1MTU A;  1K1N A;  1O3D A;  3O8B A;  1Z1I A;  1FIW A;  3SYJ A;  1BBR H;  3S9B A;  3D65 E;  1AKS B;  2FES H;  1EP6 A;  1DS2 E;  3LIW A;  4XBB A;  5ABW A;  1UHB A;  3A83 A;  5H4I B;  1ZML A;  1MCV A;  3ZYE A;  2K8I A;  2R0K A;  1AVX A;  2CHA C;  1EQ9 A;  1MTN B;  7LPR A;  3QTV H;  5KED A;  2BX4 A;  2ZO3 H;  1GG6 B;  4NWL A;  4ZH8 A;  3UNR A;  1V2S T;  2C8Y B;  2AIQ A;  6GCH F;  3RXC A;  2V35 A;  2ZFR H;  3PTB A;  5C5O A;  2STA E;  1WU1 A;  3PV4 A;  4OS4 A;  1CO7 E;  2B9L A;  2AIP A;  1L2E A;  1FQ3 A;  1W0Y H;  5E0J A;  3SV8 A;  1P12 E;  1C5R A;  2ZWL H;  3LGU A;  1UK3 A;  3S7K B;  2C8W B;  1TAL A;  3URD A;  4U2W A;  2WZQ A;  2ZGX H;  1CQQ A;  5JYI A;  4ABF A;  3F9H A;  3A85 A;  1KLT A;  4QT8 C;  1QR3 E;  1O5F H;  4UFE H;  4JCN A;  4ACB A;  3R3G B;  2GZ9 A;  3T26 A;  1O39 A;  1AKS A;  5EXM A;  4D9R A;  1DM4 B;  2VIV A;  3LJO A;  1FAK H;  1K1J A;  4FUC A;  2ZU4 A;  3FP8 E;  1ABI H;  2OUA A;  3KF2 A;  3ZVG A;  4MG3 A;  1DX5 M;  3TGI E;  5IYT A;  1TPA E;  1GMD F;  1O3I A;  3F6U H;  3F2H A;  4ZHL U;  3Q3K A;  2VVV A;  2VH0 A;  3A80 A;  1Z8G A;  3I77 A;  3EA7 A;  4ABD A;  1IHS H;  2C8Z B;  1AB9 C;  4CH8 B;  2JET B;  3D49 H;  1YP9 A;  1DWB H;  1GMH G;  3NXP A;  1CSO E;  1AUJ A;  3SW2 B;  2GZ7 A;  4FUF A;  5FXL A;  2ANY A;  4U32 A;  1W0J D;  3DD2 H;  5JBB S;  1A2C H;  1MAY A;  4ZRO A;  3SND A;  1ZTK A;  1ANC A;  1CGI E;  1GHA F;  1MCT A;  2F9V A;  2FI5 E;  4JK5 A;  1LHF H;  1JOU B;  2EST E;  1K1L A;  1NY2 2;  2KCA A;  4HTC H;  2QV1 A;  8LPR A;  2FOG A;  5KGO A;  1KLJ H;  2C4F H;  1ZSJ A;  1AUT C;  1Y5U T;  2HLC A;  1Y8T A;  7EST E;  4X6M A;  3KQ5 A;  3VB3 A;  1VCP A;  3ZVA A;  1ACB E;  2F9P A;  1CVW H;  1SLV B;  2Y82 A;  3FO8 D;  1W7X H;  1YGC H;  4B2A A;  2CN0 H;  4UE7 H;  5EW1 H;  1FJS A;  3VB5 A;  1YF4 A;  2C3S A;  2AGG X;  3URC A;  2ZGC A;  1QNJ A;  3KQC A;  1ZGI A;  4GHQ A;  2BQW B;  1HRT H;  4LK4 A;  3SUG A;  1ELD E;  5JBT A;  2J98 B;  2FX4 A;  3PWC A;  1F0U A;  2ODY B;  5EG4 A;  1L4Z A;  2C90 B;  1FLE E;  3LT3 A;  1ANE A;  1BTY A;  2F3C E;  1O3E A;  3PO1 B;  3A81 A;  1ORF A;  1FON A;  1A0J A;  1MU8 B;  4X2X A;  5C3N A;  2FEQ H;  3C27 B;  3TJU A;  1ELA A;  2ZF0 H;  5F8T A;  1WQS A;  3ZVF A;  1LPZ B;  2ALV A;  2VVC A;  3SV6 A;  5HGG A;  3N7O A;  1N1L A;  1OWJ A;  1SB1 H;  2J97 A;  4MNY A;  1NES E;  3RXT A;  2QC2 A;  2A45 B;  2G4T A;  1PPZ A;  3GS9 A;  2FDA A;  3T25 A;  1OPH B;  1S0Q A;  1RJX B;  1BMM H;  2QGR A;  5PTP A;  4I8L A;  4P00 A;  2AYW A;  2P8O B;  1C2L A;  3RMN H;  4CRA A;  4X6N A;  2P3F H;  2A32 A;  4AYV B;  5HM2 A;  4WH6 A;  3RXD A;  2AGE X;  3B8J A;  1S6H A;  1C4Y 2;  2KR7 A;  1GI9 B;  1TWX B;  2GZ8 A;  5DG6 A;  3P92 A;  2A5I A;  3MO6 A;  1BCU H;  1AE5 A;  3SOR A;  1PQ7 A;  1WTG H;  1UTQ A;  1UCY E;  2H5C A;  2ZEC A;  3QZR A;  1EZS C;  1TFX A;  3ZIA D;  3OY5 U;  1P2M A;  3V7T A;  1PYT D;  3QWC H;  1KTT B;  3RXL A;  3E6P H;  3P95 A;  2A0Q B;  4AOQ A;  1YKT A;  3LU9 B;  1H8I H;  3VFE A;  1FDP A;  3FZZ A;  1ZRK A;  4NG9 H;  1O38 A;  2W3I A;  5K0H A;  4AX9 H;  2OLG A;  1GJB B;  2AS9 A;  2BVX H;  2ZHQ H;  1HXF H;  1Z6J H;  5CHB A;  7KME H;  1FPC H;  6CHA B;  2Z3D A;  1QGF A;  4I32 A;  3ZVC A;  3DCL A;  1Y3Y A;  3ZZB A;  1O3B A;  2AFQ B;  1X7A C;  1T4U H;  4UDW H;  1SGF G;  2RG3 A;  1CU1 A;  2V3O H;  5CHA C;  2W3K A;  4MNV A;  3UOU A;  4F55 A;  2FIR H;  1HB0 B;  3GY8 A;  1IQG A;  1QA7 A;  3SGB E;  4IN2 A;  3H7T A;  1T8N A;  1TRN A;  5F03 A;  1A7S A;  1W14 U;  2J5U A;  8KME 2;  2G00 A;  2GP9 B;  3V0X A;  2ZZU H;  3EYD A;  1QRX A;  2D2D A;  2HPQ H;  3JZ2 B;  2KAI B;  2HNT F;  3O8R A;  4DGJ A;  1AY6 H;  2W7S A;  1ZMN A;  5DP3 A;  1DAN H;  4DW2 U;  4X2W A;  2Z9K A;  1TNJ A;  2ZTZ A;  1MAX A;  2XBW A;  2QF0 A;  1JRT A;  1RD3 B;  3NZI A;  2ZDK A;  2BM2 A;  3I78 A;  5G4B A;  1KSN A;  4GUX A;  2PR3 A;  3SZN A;  1AQ7 A;  1MKW K;  1O5B B;  4XD7 D;  1GL1 A;  1N6X A;  1S81 A;  1A3E H;  2KX4 A;  1O3J A;  2ZA5 A;  3F68 H;  2R3Y A;  2XXL A;  3SU3 A;  2QF5 A;  4O9V A;  1VZQ H;  1ZYO A;  1BMA A;  1C1O A;  3RXA A;  1RFN A;  5E2O A;  4B71 A;  3SU2 A;  1E0F D;  4YOI A;  5FCK A;  1TA6 A;  2O8U A;  4LZ1 H;  5TJX A;  2FPZ A;  2BOH B;  4VGC B;  3M7Q A;  3V13 A;  1JBU H;  1GMH F;  1HAX B;  2BDI A;  1QY6 A;  5FBI A;  3OTP A;  4Y8Z A;  1DST A;  2Y5F A;  3RXF A;  3KID U;  1ZHM A;  1GBI A;  1ZZZ A;  3RUO A;  5JB8 S;  2UUF B;  2ZGH A;  1IAU A;  3RM2 H;  4U01 A;  1DLE A;  2KAI A;  3CS7 A;  2VU8 E;  4KTU A;  1QTF A;  1Y3V A;  1EB1 H;  1XUF A;  4YO9 A;  3QN7 A;  4RN6 A;  1K22 H;  5DN6 D;  2A2Q H;  4WXV A;  4O3T A;  4Y79 A;  5EXL A;  1IQN A;  1L1N A;  4YTA A;  1QRZ A;  1W2K H;  1LHG H;  1TNK A;  2F9U A;  1DUA A;  1WQV H;  4XSK U;  2FMJ A;  1KY9 A;  3ATL A;  4CRG A;  1SGD E;  4P02 A;  3P8O A;  1UCY K;  5JPM H;  6EST A;  1O3G A;  5DP6 A;  1A5G H;  1PFX C;  1RXP A;  2WPD D;  4IS5 A;  3VB6 A;  2OBO A;  1ZLR A;  3ZVE A;  3SQH E;  1PPE E;  1Z8I B;  2NU3 E;  3U8T H;  1SKY E;  1EUF A;  1ELE E;  4UEH H;  1H9L B;  1GI7 B;  5HIZ A;  4AB8 A;  4X1R U;  1BRA A;  2J92 A;  1K1P A;  1RIW C;  3R0F A;  4AG2 A;  3MTY A;  2TBS A;  3SBK A;  5EOK A;  4UON A;  3AK5 A;  4I8K A;  2C93 B;  4RKO B;  4TY6 A;  1Q2W A;  1XKA C;  4BAK B;  2QF4 A;  2PTN A;  3GIC B;  1K1I A;  3PLB A;  1SC8 U;  3HPT B;  2ZFP H;  2CGA A;  3BG4 C;  2A4G A;  1AFQ C;  3E0N B;  2F4L A;  2BZA A;  4WWY A;  2F9O A;  1S82 A;  4DVA U;  2WUC A;  2GJG A;  1C1P A;  4FXG H;  2UWL A;  2WV5 A;  1ZTJ A;  1VR1 H;  3MNS A;  1EAU A;  3QDZ B;  5EQQ A;  5AVD A;  2AGI X;  1SGE E;  2Z9I A;  1WXR A;  1MQ6 A;  1L1G A;  1TQ7 B;  3HAT H;  4ISN A;  4ZHA A;  3IWM A;  4XBC A;  1MQ5 A;  1T8L A;  3FN8 A;  4CRE A;  1OWI A;  2GGV B;  2VIQ A;  3UFA A;  5DKM A;  4DT7 B;  2GTB A;  1O2M A;  5GDS H;  2UWP A;  3BEI B;  1MKW H;  2GT8 A;  1O37 A;  1EJN A;  5T6F A;  2Z9J A;  1ZPZ A;  1IQH A;  3BTT E;  1CHG A;  4NWK A;  1TRM A;  2KCP A;  1HDT H;  5DP8 A;  1H1B A;  4KP0 A;  1TE0 A;  1FY4 A;  4UFG H;  4WMD A;  4B75 A;  1TX6 A;  1O34 A;  1SG8 B;  4KKD A;  1GMD G;  3SI3 H;  3PTN A;  1FY1 A;  2XWA A;  3A82 A;  1GJ5 H;  2FI4 E;  1MH0 A;  3N99 A;  7GCH F;  3N7E A;  1V2L T;  5SGA E;  3W1E A;  2STB E;  3GY4 A;  1Q3X A;  1AZZ A;  1UTN A;  1QRW A;  4H6S B;  1C2H A;  1BDA A;  1D3D B;  4UFD H;  3DA9 B;  1M9U A;  3TJO A;  1KXE A;  1PJP A;  1W7G H;  3EA9 A;  3E90 B;  4BXS A;  1V2R T;  1NBM E;  3LC3 A;  3U1J B;  1GJA B;  3PMJ A;  1O2P A;  3FP6 E;  1HAV B;  2VID A;  2GDD A;  4B6F A;  3BTF E;  4Z1M D;  3M7T A;  1ZJD A;  2WPK S;  3TNT A;  3LDX H;  1YPK H;  2Y5G A;  1UCY H;  3L6P A;  2TPI Z;  5J4Q A;  1MBM A;  2CF9 H;  3FVF B;  1MTN C;  1IQF A;  1NFU A;  4TYD A;  1EOJ A;  4A5T S;  1KMH B;  2AER H;  1GG6 C;  1O2U A;  4FVB A;  1GJ9 B;  5EJZ A;  4SGA E;  4TWW A;  4NCY A;  1NU9 A;  2SGQ E;  1ARB A;  4K8B A;  1GJC B;  1TA2 A;  1HJA B;  1AZ8 A;  2JKH A;  5FX6 A;  1TGT A;  1V2M T;  3GY3 A;  1BJV A;  1TGC A;  4TPY A;  4ZHM U;  1W10 U;  3MH6 A;  1HAO H;  2EA3 A;  2OC0 A;  2AEI H;  2V6N A;  1VJA U;  1WYK A;  2H9H A;  3TNS A;  1C9P A;  2DE9 A;  4A92 A;  3KGP A;  3WWB A;  3EE0 B;  4UFF H;  1EAX A;  1O2W A;  1KXB A;  1C5O H;  1P2Q A;  4LOY H;  5DPA A;  1O3K A;  2FOM B;  1A3B H;  1UVT H;  1TQ0 B;  3MH7 A;  1O3H A;  1HPG A;  1YLN A;  1KXC A;  1QJ6 B;  4WXI A;  2XBV A;  1O2L A;  2XW9 A;  3LH3 A;  4YM9 A;  2VIN A;  2Y7X A;  5C94 A;  1QJ1 B;  5DP7 A;  1MMJ N;  2ZDM A;  4CRC A;  3F0O A;  2P3U B;  4E05 H;  4FUE A;  2IPQ X;  3OAA D;  1WSS H;  2J38 A;  5JBA S;  3DT0 H;  2WPI S;  2BY9 X;  4B2C A;  1YCP M;  1TIO A;  1S85 A;  2XRC A;  3LH1 A;  3P8N A;  2QAA A;  2GV6 A;  1A0H B;  2TGP Z;  4Y7B A;  5T6G A;  2BLO A;  3BN9 A;  3SV7 A;  5C17 A;  1P01 A;  1AO5 A;  1B0E A;  2L6O A;  1ZJK A;  1T8M A;  3ZZ7 A;  2XC0 A;  2BD8 A;  1UMA H;  2XND D;  3G01 A;  3GY7 A;  5IK2 D;  1IQK A;  3BIV H;  1GHB G;  3OEE D;  2FOH A;  1DUE A;  3GYM A;  2ZPS A;  2LNC A;  3SO3 A;  2JET C;  1AVW A;  2H9T H;  1WAY B;  1ELC A;  9LPR A;  3RP2 A;  2PUQ H;  3ATM A;  1GVK B;  2TRM A;  1GBA A;  2FTM A;  2XCF A;  1HFD A;  5GJ4 B;  1HAP H;  1GHY H;  1O3A A;  1N6Y A;  2QF3 A;  2EEK A;  4IMZ A;  1OKX A;  1P03 A;  2RA0 A;  2JJ1 D;  5EIY A;  2G8T A;  3MI4 A;  3F9E A;  1KIG H;  3OYP A;  3ZZA A;  2SGE E;  1LVM A;  2R2W U;  1EP5 A;  4A7I B;  1ELF A;  4Y11 E;  2R0L A;  2O8M A;  2HGT H;  1OX1 A;  4ABE A;  4JK6 A;  1A61 H;  4K5Z A;  1PPG E;  2BD5 A;  1Y3X A;  3S69 A;  3VEQ B;  4B76 A;  1LVB A;  1NU7 B;  2PKA B;  1OSS A;  4ACA A;  5E2P A;  3PMB B;  1RS0 A;  1WTH D;  3FAN A;  1LQE A;  1DVA H;  1S0R A;  3MU8 A;  2WPM S;  1Y3U A;  3KQB A;  5FBE A;  2P59 A;  2V3H H;  8EST E;  3W95 A;  3OU0 A;  2PV9 B;  2WYG A;  4KGA A;  1QFK H;  4DIH H;  3JZ1 B;  4CR9 A;  1ZPC A;  2ZQ2 A;  1C1T A;  4BTI B;  3SN8 A;  3PMH B;  2RDL A;  3EAJ A;  4ABG A;  1TGS Z;  3PO1 C;  1NO9 H;  2F91 A;  2H9E H;  2BY5 X;  1GJD B;  3QLP H;  3SU5 A;  5JB9 S;  1YLC A;  2SGA A;  1BTP A;  3IIT A;  2SFA A;  1TMB H;  2TIO A;  2BD2 A;  4GVU A;  3TJN A;  2ZP0 H;  3ATI A;  2Q6G A;  4GLY A;  2PKA A;  1TAB E;  2WPJ S;  1B0F A;  3BTG E;  3NWU A;  4OGX A;  3M61 U;  2PSX A;  4ABB A;  5C5N A;  3AAS A;  1BOQ A;  5EU8 A;  2BXU H;  2FS8 A;  2P16 A;  3SUE A;  1C1N A;  2P8O C;  3A8A A;  3SJ9 A;  3B23 B;  1JMO H;  2ANK H;  1QZ8 A;  3TIU A;  4NA8 A;  1GJ6 A;  3SV9 A;  1Y59 T;  1XUG A;  2EC9 H;  1SVP A;  1VCQ A;  2ZGJ A;  3MMG A;  1THP B;  1SHY A;  3NKK A;  2G4U A;  2ODP A;  1MBQ A;  3O8D A;  2F83 A;  1TGN A;  4MVN A;  5BPE A;  4TPI Z;  1TYN A;  4B2B A;  3U28 C;  1OP8 A;  1SGF A;  3AAV A;  2VIP A;  1GI5 A;  1GCD A;  1TPP A;  4XFQ A;  1P2K A;  1UTO A;  3BTQ E;  1GPZ A;  1LO6 A;  5LH8 A;  3KL6 A;  1UVO A;  1BHX F;  1C5S A;  3Q77 A;  2BXT H;  4Q2K A;  4FUG A;  4X0W U;  4H6T A;  5GXP A;  1UK2 A;  3UY9 A;  1YC0 A;  1V6D A;  1TBR H;  5A0C A;  1HUT H;  3MH4 A;  1V2T T;  3GCN A;  4INL A;  3VB4 A;  6CHA C;  3UTU H;  1P57 B;  4B6E A;  1G32 B;  4INH A;  3DFL A;  4Q4L A;  4CBO A;  5FPS A;  2UUY A;  2FM2 A;  5A0A E;  1V2Q T;  2Z3C A;  3RU4 E;  1DFP A;  4AFQ A;  1NRS H;  2AH4 X;  4ZUH A;  1SFI A;  1J17 T;  1O2T A;  4FUH A;  2OBQ A;  1DDJ A;  2Z9G A;  3ZVB A;  1YPE H;  3TH4 H;  2XBX A;  1BTZ A;  2IN2 A;  4KEL A;  2FLB H;  2OQ5 A;  1FZZ A;  1AVG H;  2Z7F E;  2C8X B;  3T29 A;  1DXP A;  1YPJ H;  1ETS H;  2V7Q D;  3PRB A;  1WCZ A;  4U30 A;  2YMS D;  2GX4 A;  2RA3 A;  3U8O H;  3RXB A;  1HGT H;  4BAQ B;  1LVO A;  2ZFF H;  2SGF E;  3HKI B;  1EAT A;  5L30 H;  1ETT H;  1QL8 A;  1SBW A;  3HK6 B;  3URE A;  4HI3 A;  3T27 A;  5T6D A;  5DK1 A;  3U98 H;  2FZZ A;  3MH5 A;  4X8S H;  2QXJ A;  1P2J A;  4ZMA H;  2W6J D;  3M3V A;  3FZD A;  1K2I 1;  1NRQ H;  1IQL A;  5GCH F;  3TU7 H;  4DY7 B;  4MNW A;  2XC4 A;  1EZX C;  2QYI A;  2XTT B;  3QGN B;  1GHB F;  4FET A;  4Z0K A;  2OP9 A;  4VGC C;  5EST E;  2J98 A;  2G81 E;  3AVZ A;  4FU8 A;  1V2J T;  3A89 A;  1O2S A;  1GGD B;  2VGC B;  3PMA B;  1EB2 A;  3LJJ A;  2ZCK P;  4ASH A;  2M2A A;  1LHC H;  4BOH A;  4NIV A;  1F0S A;  5EW2 H;  1AD8 H;  2ANM H;  2PFE A;  2ZHD A;  4MQA A;  1LTO A;  2Q1J A;  5AFY H;  2ZC9 H;  1MZD A;  1ELB A;  2V0B A;  3SNB A;  1HLT H;  5A8Y A;  3MU4 A;  1G3D A;  1VKY A;  7GCH G;  5EJ1 A;  5HKK D;  2GCH F;  1P2N A;  1P9S A;  1XVM A;  2ZHE H;  1P2O A;  1BB0 B;  1A5H A;  1SI5 H;  2FOC A;  3NCL A;  4DOQ A;  4HGC A;  2BHG A;  2EI6 A;  4AB9 A;  1SHH B;  2R2M B;  1K28 D;  1C5U A;  5B6O A;  2HPP H;  3GIS B;  3GCT F;  4ABI A;  4XE4 A;  3KN2 A;  3VPK A;  3SU0 A;  4X8V H;  1AIX H;  1COW D;  2WUB A;  2ZG0 H;  2XNI A;  1FN8 A;  1YWU A;  1G9I E;  4AN7 A;  4RSP A;  1Z7K A;  3M5M A;  1ZHP A;  1HXE H;  2Y80 A;  3TGJ E;  3DUX H; 
#chains in the Genus database with same CATH homology
 2EY4 C;  3U28 C;  2V3M A;  2RFK C;  3MQK C;  2HVY B;  3UAI C;  2EQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...