2HVYB

Crystal structure of an h/aca box rnp from pyrococcus furiosus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
74
structure length
74
Chain Sequence
b'MKRLGKVLHYAKQGFLIVRTNWVPSLNDRVVDKRLQFVGIVKDVFGPVKMPYVAIKPKVSNPEIYVGEVLYVDE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H/ACA RNA
publication title Crystal structure of an H/ACA box ribonucleoprotein particle
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/biosynthetic protein/rna
total genus 12
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04410 Gar1 Gar1/Naf1 RNA binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.230 Mainly Beta Beta Barrel Thrombin, subunit H Probable tRNA pseudouridine synthase domain 2hvyB00
2RFKC 2EY4C 3UAIC 2EQNA 2HVYB 2V3MA 3U28C 3MQKC
chains in the Genus database with same CATH superfamily
2XOKD 3U98H 5EPNA 4FU8A 3DUXH 1C5TA 2Y80A 3SV7A 1P02A 1O2IA 1SQRA 3M61U 1TFXA 2WYGA 2ZO3H 1O30A 2OINA 4X6NA 5F8XA 1SC8U 3VG8A 2UWPA 2AHME 1AO5A 5EW1H 4J1YA 5A8ZA 1P3EA 4B1TA 2ZTXA 1GJ5H 4GCHF 3V13A 2VWLA 1ZRBA 1TQ7B 2BXUH 2WSSD 3WY8A 1TPSA 2OBQA 1OWEA 2A5KA 1L1GA 3A7ZA 1HAZB 1C1NA 1P03A 5HM9A 1CT0E 3DD2H 2G4TA 2V35A 3PMAB 1MTWA 4RKJB 1ZTKA 1O3NA 2FS9A 6ESTA 3SV9A 1Y3VA 1ZLRA 3R0FA 1O36A 2PUQH 1ZTJA 1GHAG 3MO9A 4TY7A 3STIA 3BTDE 3OX7U 3BTEE 4Z1MD 5GIBA 1EPTC 2A5IA 3QGNB 4FXGH 1CBWB 2KCYA 5L2ZH 2VVVA 2BLQA 1TNGA 1G3DA 1W2KH 1EAWA 2ASUB 2BHGA 2OC7A 3M7QA 1EP6A 1ZSKA 5EJZA 2OD3B 3RXSA 1OYQA 1FY1A 2UUJB 3F2GA 4DOQA 5C1UA 1O2JA 1RD3B 2AGGX 2GCHF 1O2LA 2VBCA 3QK1A 2YMSB 3PLPA 3F2HA 2PKAA 3RP2A 4AGJA 2OQUA 2ZU3A 5TJXA 1EJNA 1BITA 4ZHLU 1FJSA 1FN8A 2KCOA 4UFDH 1C1VH 2FOGA 3L3TA 2ZA5A 3A81A 3PMBB 1NZQH 2FTMA 2G4UA 2J97A 4U32A 3UIRA 4X8VH 1UVOA 4WXVA 1DXWA 2BDIA 4NIWA 1PPGE 1MTNC 2XBVA 2QF3A 5JB8S 2GT7A 2ILNA 5F8ZA 3M5NA 2P3UB 1MUEB 3EAJA 1W10U 1O3HA 1O2VA 2Y81A 3GCNA 1CBWC 2VWOA 3MH7A 1K1LA 2O8TA 1ZOMA 4FU9A 2TGDA 3BTFE 2JH0D 1F5RA 2P95A 3AVZA 4A1VA 1RRKA 4LOYH 1XXFA 2VH6A 1W13U 3TK6A 2EY4C 1T8LA 4Z0KA 1HJAB 3C1KA 3DA9B 2YMSC 3ZVDA 1DLEA 4TWYA 2HWLB 4FUDA 2EC9H 3ZVCA 4DIHH 2CMYA 4PROA 1TX7A 1H9IE 1SHYA 3FP7E 2AIPA 3P70B 1PQ7A 1VCPA 2VWNA 3V0XA 1S82A 2IOTA 1GGDC 1TNIA 1BHXF 1BOQA 5EPYA 2A5AA 6GCHF 1Z6JH 2LP6A 3OFND 1AWHB 4ESTE 4YOGA 4CBNA 3PO1B 4OS6A 3HK3B 3NPSA 1V2QT 5F53A 3LJOA 3SU6A 3ZVAA 3RXLA 1AGJA 4ABFA 3FO8D 4UONA 3A88A 4YO9A 5LH8A 3ATLA 3H09A 1CGIE 4X8UH 2CXVA 4YM9A 5DN6D 1EKBB 2BDAA 2GTBA 2ZDLA 1FNIA 3VEQB 1TA2A 4LZ1H 2Q6GA 4UFEH 2YNAA 1AE8H 2QF4A 3GY6A 4NZQA 4XBDA 2ALVA 2PKSB 3PV2A 1MTSA 1RTLA 1C1UH 2STAE 1QZ8A 4NCYA 3MNCA 1UHBA 1YYY1 2Z94A 3HK6B 3UR9A 2AMPA 1G2MA 3FOAA 4YZUA 4IC6A 1IQLA 1O35A 2QIQA 2Z9IA 4UFGH 3FP6E 3TH3H 3WWBA 1KLIH 1IQNA 1LMWB 1S6FA 1G3EA 2ULLA 5DK1A 3UNSA 2CV3A 3D65E 1SGYE 1HV7A 4OS2A 5ESBA 4WWYA 2H9EH 4GHTA 3BIUH 1VJ9U 2W7UA 3LGTA 1MMJN 1B7XB 1C5OH 5T6FA 4OM9A 1YPEH 1D3PB 4JZFH 2Y7ZA 5DP6A 1EOJA 5FHTA 8GCHG 1GHAF 1PPZA 1B0FA 1BRAA 2VU8E 1MBMA 1N8OB 1FY3A 2C4FH 1YBWA 4IC5A 4MG3A 1H8DH 5TCCA 3DT0H 1C2DA 3O8BA 2ZDNA 1DM4B 3BG4B 5J4QA 4NIXA 4HTCH 2V3MA 2HALA 3UWIA 2TRMA 1BTXA 4WH6A 2J98A 1AKSA 3HGNA 1ABJH 4AG1A 3ENSB 1UW7A 2FOEA 4K1SA 1EJMA 1UHBB 3LOXA 3ITIA 1UK3A 4INHA 2W3IA 1EZQA 1VCQA 2STBE 1YPMH 3RXRA 1BJUA 3SW2B 3O8DA 1AI8H 1QTFA 1AN1E 1P2KA 1XUIA 4BXWA 2J38A 1XMNB 1W0ZU 2ZU5A 1Z8IB 2CGAA 2F9BH 4WY3A 1ELDE 3NUMA 3P8OA 3T26A 4QT8C 2TGAA 1HDTH 3K2UA 1SLWB 1O2GH 1AIXH 1UVUH 4NSYA 3U8TH 1WBGB 3RXBA 1KLTA 4WVPE 3TGIE 3SU4A 1NRSH 1GMCG 2ZU1A 4YXWD 2KCPA 5KEDA 3FZDA 1BMNH 3UNQA 3LPRA 2SGQE 1FPHH 2GCTB 1OWHA 1TABE 2WV4A 1O2KA 2J98B 2H1UA 1AKSB 4IS5A 1O31A 4K3JA 3MH5A 3F9GA 5C1XA 3JZ2B 5C67A 4DG4A 3AASA 1Z1IA 2ZFFH 4XDEA 1ZMLA 4K2YA 2P16A 3MWIU 3TJOA 1PPFE 3LGUA 1J8AA 4ASUD 1C4V2 1EASA 4TYDA 4E7RG 2PSXA 4B2BA 1ZYOA 2SGFE 1KXFA 2L74A 3MFJA 4BTTB 1C2IA 2F91A 1L1JA 1JWTA 2W7SA 1F0SA 4WF8A 5A8XA 1C1MA 3KCGH 1YGCH 1HAXB 2R3UA 1TGCA 2R0KA 4D9QA 1W7GH 4X2YA 5B6LA 2SGPE 1T8OA 5FL7D 4AOQA 1SMFE 3RC6A 3B8JA 4B73A 1C2JA 1JIRA 1GBJA 2ZHDA 5E8EH 2FI5E 2XC5A 2SGEE 5JBBS 4AFUA 2GZ9A 2ZU4A 1S0RA 2WPDD 3Q3XA 1O2RA 3RXGA 3SQHE 1LKBA 2EI7A 2A4OA 1W3CA 2FLRH 1SPJA 4I86A 1L0ZA 2OTVA 3RUOA 1QHRB 4K8BA 1HJ8A 4KGAA 2BVXH 2I6SA 1CT2E 1GCTB 3TPIZ 1EAUA 2R9PA 1LHFH 1GI4A 1KLJH 1XKAC 1GJBB 3MO6A 1LHDH 1LQDB 4CRDA 3LGIA 1WSSH 1RS0A 4Y8XA 2JJ1D 3LH1A 2F3CE 2ZPQA 1ANBA 3SZEA 2AGEX 2Q6DA 1F5KU 2G00A 3A83A 2EA3A 1A5IA 1V2TT 4D7GA 1C1RA 3ODDA 1FY5A 4ABAA 2ZECA 4X2VA 4YT6H 3ZZ8A 1MZAA 1THPB 1GI9B 4X1SU 2ZGXH 2IPQX 2QXJA 4R8TB 2ZI2H 1TALA 3EYDA 4DT7B 4Q7ZA 1SFIA 4I33A 4OS1A 4FVDA 1F0RA 4AFQA 4BNRA 3VB3A 3GDVA 1CQQA 4F55A 5FBIA 1H9LB 1WQSA 3NXPA 1SQAA 3RXJA 1AMHA 1E36B 2ZHEH 2F83A 1G37A 2D1JA 4NA8A 3O8CA 3DCLA 1LPGB 5BRRE 2NU4E 2Y5HA 2QV1A 1XX9A 5LPEA 1GHWH 2VINA 1FY8E 4ABEA 4I32A 1NPMA 1Z6EA 3RXKA 1RIWC 4XE4A 1IQFA 4JZ1A 3MOCA 1WUNH 3MH6A 1LHCH 1KY9A 2DUCA 2AH4X 2KAIA 3Q76A 1TB6H 3M7UA 4I8HA 4AYYB 5EQSA 3E6PH 5JBAS 2FOHA 1A0LA 1FLEE 2UWOA 2Z3CA 1GHZA 3A8DA 2AERH 3BTGE 1YLDA 2GKVE 4RN6A 3GCTF 3T2NA 4J2YB 3ATWA 1MABB 3PMHB 5I25A 1QL9A 4P02A 2ANWA 4BTUB 3RXEA 3LONA 2BZAA 1GMCF 2ZTZA 1EATA 2KM0A 1WU1A 1YPGH 4MNXA 3RDZA 3RLYH 1E35B 1MQ6A 1FX0B 3ZZ9A 3MI4A 2SFAA 4E05H 3FZZA 3A7YA 1EJAA 1U6QA 3KN2A 4B71A 1AFQC 2FEQH 1TNHA 4ZKRU 1MKXH 4H42U 5GCHF 1KSNA 5A0CA 5HYOA 3RXAA 5JBTA 1A5HA 3ZV9A 4BAQB 1OHHD 3LJJA 2A4QA 3D23A 1KYNA 1C4Y2 4GAWA 3A7VA 1UJ1A 1J15A 1D3DB 1SOTA 1ESAA 2KAIB 1F7ZA 3CNRA 3FAOA 2BDGA 2QE7D 2VH0A 1TGBA 1DANH 4Y8YA 1ESBA 1GJ6A 2BDCA 3SHAH 5T6DA 1ARBA 2BY8X 5E0HA 5HGGA 4MQAA 1E0FD 1UCYH 3P8GA 1GI0A 2ZFQH 1O5BB 2BY5X 1O2SA 2QN5T 2WPKS 2QY0B 5DJ7A 3AW0A 2GDDA 2BDYA 4Y6DA 5C20A 3P17H 2PTCE 3PWCA 1FUJA 2PTNA 1SGFA 4AORA 3K9XB 3TJNA 3KQ5A 1DWCH 2Z9LA 1SL3A 2ZZUH 1S83A 1IQIA 4K8YA 4CBOA 3ESTA 1NM6A 6CHAB 3I29A 1D3TB 3PB1E 3M5LA 3K6YA 3LC3A 2FI3E 5FX5A 2WHXA 1IQEA 1K2I1 3EQ0H 3GY2A 4KTUA 4WMEA 5AFZH 1SGRE 1O3FA 4X2WA 3TITA 1CHGA 2QAAA 4O97A 4ZCNA 5G4BA 1CHOF 2KX4A 1T32A 2UUYA 2ZFSA 5C17A 1LQEA 3IG6B 1AE5A 3TGJE 1EFRD 1GL0E 1ESTA 1E38B 1P05A 3DSGA 3B9FH 2XW9A 4FUEA 2ZDVH 4AYVB 1TBZH 2ALPA 2P93A 4ISHH 3A86A 1DE7H 2ESTE 3C27B 2C8ZB 4K5ZA 3HGPA 3KIDU 3Q77A 6GCHG 4Y7AA 3SNDA 4JYVH 2EI8A 2VIOA 1GBIA 3F9EA 3KQCA 1O2MA 1ZMJA 2EI6A 8ESTE 3QGJA 1W11U 5FAHA 7KMEH 4ZMAH 3GY5A 1DY8A 1O3IA 1G32B 1MKXK 3AW1A 5IDKA 3AK5A 1IAUA 2P59A 1EAIA 3IITA 3RMLH 1HIAA 1SGFG 1MH0A 3KQDA 1BTWA 2FESH 2FZZA 3CS0A 3N7DA 1V2NT 5DKMA 4LK4A 1GVZA 3QZRA 5ETXA 1GI5A 1K28D 1P2OA 2O8LA 1P10A 1YPKH 1HNEE 4X1NU 1WTGH 5EG4A 1JRTA 3ZV8A 3D62A 2CN0H 1P2IA 1A3EH 1NBME 1KMHB 2Y7XA 1UCYK 2J4IA 3RXHA 1FDPA 2CJIA 3BIVH 3PYHA 2Z9JA 3L6PA 4X0WU 1C1TA 1N6XA 1ZPBA 1BMLA 2P8OB 1MTVA 1O32A 3NKKA 3QUMP 3SU2A 1AB9C 2RG3A 2XNDD 3GDUA 1QBVH 1TRMA 2FI4E 1OP2A 1V2WT 2J92A 3SGQE 1SGEE 4CHAB 2PSYA 1QA7A 3A7TA 3S0NA 5I46H 1HIAB 1KXCA 1SGNE 2K1QA 4THNH 4TPIZ 3U1JB 2W6JD 1LVMA 1C1QA 2XWBI 1EZSC 3DSOA 2Y5FA 1SGQE 3E0NB 3MTYA 2XBXA 2WPIS 1ZHPA 2V6NA 3SU0A 1D6RA 1TGNA 1GHVH 1OKXA 3F9FA 1WXRA 1P2MA 3E3TA 1GJAB 1HUTH 1C5UA 1Z71A 4BAHB 1INCA 2XBWA 3TH2H 2QA9E 3U1IB 1LHEH 4ZXXH 3P8NA 3TNSA 3CS7A 4INLA 3SUGA 3FFGA 1GBEA 2HNTC 4K60A 4U2WA 2H5DA 1E1RD 4DCDA 4AC9A 3RC4A 5JDUB 1V6DA 1QRZA 7LPRA 4HFPB 2WPLS 1BMAA 2XWAA 4AFZA 4JK5A 2SGAA 1C2GA 4GLYA 4FOUC 1QFKH 2QYIA 1UVSH 1CGJE 2B5TB 2FOAA 2ZCKP 1UTLM 3PLKA 2GP9B 3BSQA 4GUXA 3RXOA 1C5QA 4GHQA 1EP5A 2A1DB 1V3XA 2L6OA 1XUHA 2FOMB 5EU8A 5T6GA 1F92A 1UK4A 1TNLA 1T4VH 1S81A 5HMAA 1BB0B 1ZZZA 1SGDE 2PKAB 1DSTA 3BTKE 1ZGIA 2J2UA 1EOLA 3TJUA 1GI3A 1Y5BT 2Q1JA 2ZIQH 4X8SH 4WMFA 2G5VA 2O8WA 4H6TA 4A5TS 3ZVGA 2OXSA 4Q63A 1DOJA 3EDXB 1SLUB 2GMTB 4AG2A 3MHWU 5T1VA 1EQ9A 2H9TH 5E2OA 4OGYA 4ZH8A 1IOEA 3TIUA 3MNXA 1IHSH 1SG8B 3SHCH 1T8NA 2IJOB 2W26A 4XFQA 1B0EA 2F9UA 3LT3A 1KDQA 1CA8B 2PW8H 2BD3A 4ISOA 2ZDAH 1JOUB 1ELGA 1TGTA 1GJDB 1MAXA 2AFQB 2FX4A 2J5UA 1QRWA 3NWUA 1NT1A 2GGVB 3SBKA 5GWZA 1P0SH 1HJAC 2Z6BD 2GX4A 4I8KA 4X1PU 5EJ1A 3P6ZB 1K1NA 2FLBH 2ZF0H 3OTJE 5GPIB 2SNVA 4ZKNU 2M2AA 4F48B 2A45B 1W0KD 2NU2E 4AB8A 1P8VC 3QTOH 1J17T 1UTQA 1T7CA 1GJ7B 1GDUA 4NWKA 4K69A 5AHGH 3VB6A 1NRQH 1O2HA 3QTVH 3ELAH 2BB4A 4H4FA 4MNVA 3G01A 3E91A 1P04A 2ZFRH 5FBEA 3PO1C 5LPRA 4GSOA 3ZYDA 4SGAE 1B5GH 1RTKA 4KELA 1T4UH 2D2DA 4X8TH 2HVXA 4XRNA 2AGIX 1W12U 1NBMD 1SVPA 4E06H 1DXPA 1FV9A 1KXAA 1QQUA 1KDQB 1VCWA 5A0BA 1O2PA 3UFAA 5F8TA 1GI7B 1ZHMA 2ANKH 1K22H 1X7AC 2PKSC 3ZZ5A 3UREA 1SSXA 1P12E 3A7WA 3OTPA 1QIXB 1YY3A 1BTPA 4CH8B 3F2FA 1O37A 2PWXA 3N7OA 1AVWA 3BTTE 1QR3E 2HNTF 1O2NA 3HPTB 4ACAA 1OWIA 1IQJA 5FX6A 1BMFD 1EXFA 4KP0A 4B6FA 3PWBA 2WV9A 5HIZA 1E34B 5GDSH 1LDTT 4TSFD 4Y11E 3TH4H 1C4U2 1ZSJA 2ZTYA 2PLXA 4YT7H 1NRRH 1K1OA 2VVUA 1TRNA 4I7YH 3OY5U 3GCTG 2BVRH 1GG6B 1O0DH 3KL6A 1BTYA 4K1TA 4GVUA 1N8OC 5FXLA 1K21H 2LNCA 1DITH 5DP8A 5JPMH 4YLUA 1YPHE 5ESTE 3T5FH 3BG4C 1PPHE 5C5OA 1O3OA 3BTHE 5FPSA 1C2KA 1GI2A 3E90B 5JB9S 1O2YA 4Y0YE 1K1MA 4SGBE 2ZCLP 5GCHG 1EX3A 5B6OA 5HM2A 4JYTA 1LCYA 1C9PA 1QJ1B 2ZPSA 3SU3A 1GBDA 1Q2WA 5EW2H 5LGOA 3OAAD 1KXBA 3TVJB 1P57B 2Z3EA 2BTCE 2WUCA 3AAUA 1GBBA 1V2LT 1DFPA 3A89A 1P01A 1H1BA 2HOBA 1V2RT 1EB2A 2VB0A 1G30B 3KQEA 4Y7BA 1ZR0A 2YOLA 2G8TA 3A8CA 2JIZD 1UTPA 1BBRH 1ZJDA 4JMYA 4OS5A 2WUBA 1AHTH 2EQNA 3GY3A 1V2OT 3STJA 3RMNH 1MKWH 3R3GB 1BBRE 1QQ4A 4D7FA 3U28C 1SGTA 1QRXA 2GCTC 1O3PB 4Q4LA 3SJ9A 2ZHWH 1C5NH 1O39A 2FM2A 1ORFA 2HRVA 4RT0A 4U01A 4AZ2B 1BUIA 1TRYA 1P06A 1A1RA 2ZPRA 3VFEA 2A7HA 4R0IA 4ZKOU 3EE0B 3OYPA 4D8NA 1NESE 1GBLA 2O8MA 3K6ZA 5IYTA 4MPXA 1BT7A 1ELVA 1GJ8B 1SKYE 1C1SA 5SGAE 1GMHF 1PQ8A 4IN2A 1CGHA 2OK5A 1S5SA 3CP7A 1HPGA 4MPUA 1Y3WA 4HZHA 1P9SA 1GWAA 1C5ZB 3GOVB 3SO3A 1XXDA 2ZCHP 3VGCB 3SV6A 1TBQH 1E79D 2WINI 1OOKB 1CHOG 1HAVA 3BG8A 2BY6X 2HPPH 1FZZA 1A46H 1T8MA 1RGQA 2GV6A 3HKIB 3IWMA 1Y5AT 3RC5A 1C2MA 4FU7A 1PQ5A 1A4WH 3SYJA 4XOJA 4BOHA 2ZGCA 1DT2A 1BTZA 4Y76A 1MZDA 2PP6A 4HI3A 2ZQ1A 3A8AA 1C1OA 3FKSD 3GDSA 2BD8A 1DUEA 3Q3KA 1VJAU 2JETB 1DY9A 1HAPH 1O5GH 4VGCB 1ACBE 1GCTC 4BXSA 3VB7A 5ABWA 3B23B 1BMMH 2V3OH 1TLDA 3PRBA 3P92A 3PLBA 1GI8B 4JZDH 1XVMA 1D4PB 4ZXYH 1MCTA 3S9CA 1ELAA 1TYNA 1Z8RA 3P8FA 1UVPA 2P3TB 1TPAE 2XC4A 3Q00A 1ABIH 3SN8A 1RTFB 2ANMH 3O8RA 3A8BA 5CE1A 2R2MB 3T29A 4A7IB 4TPYA 1HAVB 2H5CA 5E0JA 2ODPA 1HJ9A 2FOCA 2SGDE 2G52A 5J4SA 4UDWH 1V2ST 1NROH 2GZ7A 2AMDA 3U8RH 4FVBA 2OBOA 1A0HB 5K7RA 1C5LH 1G3BA 1VGCB 4ABDA 1SB1H 1LVBA 1BBRK 1QB1A 1Y3YA 4TWWA 1TNJA 1C5RA 1TMTH 1K0HA 2XBYA 1MKWK 1BQYA 1ELTA 2K8IA 3U9AH 2FOFA 3M3TA 1DLKB 2QCYA 2Z3DA 4TT3D 1G2LA 3LC5A 4YOJA 3URDA 3WWFA 4FUGA 1CA0B 1HXEH 1YKTA 2GZ8A 5JYIA 1ELEE 1HBTH 3QLPH 4DURA 5L30H 2G51A 3I78A 1F2SE 2OCVB 1S85A 1LO6A 2EEKA 3RLWH 3SU1A 5C94A 1ANEA 5L2YH 1UTOA 2BY7X 4ACBA 3A82A 2RFKC 3W95A 4TY6A 4CH2B 2D8WA 1AY6H 3AAVA 1O3AA 2B7DH 5HXFA 4B76A 4UD9H 4Q80A 3SV2H 4BTIB 2QGRA 3TU7H 4JZEH 1JRSA 4X1RU 4XBCA 3GCOA 1HAGE 1HAYB 4DVAU 3SORA 2Y5GA 3LIWA 4ZHAA 5F6MA 4B2AA 1BTUA 2VWMA 4D76A 1A5GH 1G36A 1TE0A 1G9IE 7ESTE 2FTLE 3PV4A 4B74A 3E16B 1FXYA 2A4GA 3KF2A 3I77A 1XUGA 1O3GA 2BVSH 1C2EA 2K0QA 1WQVH 5GJ4B 1CO7E 3SUFA 1GBFA 3UWJH 1BIOA 4ABGA 1AUJA 2CHAB 4AGKA 1UTJA 3D49H 1JXPA 4X2XA 1QGFA 4ABHA 1ELBA 2BOKA 3BEFB 3FVFB 8LPRA 3BF6H 3UAIC 5CHAB 2ZGJA 4IN1A 3PTBA 4IW4E 4ZKSU 2FMJA 3TK9A 1G3CA 1YPJH 3H7TA 1N6YA 1O2WA 2BDHA 4I8JA 4CR9A 3KNXA 4X6MA 3OY6U 1H9HE 1A0JA 2QXIA 2FODA 2YNBA 2ZHQH 3SUDA 3BN9A 1EPTA 1Y5UT 1GJ9B 1C5SA 1A7SA 2VJ1A 5DP4A 3ZZ7A 1H8ED 3TK5A 4LZ4B 1P2NA 1KTSB 1P3CA 4Y8ZA 1LVOA 1Z8GA 4UFFH 4Y0ZE 1PPEE 6CHAC 3BTME 5CMXH 4MPVA 1O3LA 2JDID 1ELFA 3MU4A 1MD7A 1YLCA 2PGQB 1QCPA 5EXMA 1BZXE 1SLVB 4BAMB 2F9OA 2P3FH 3UPEA 1QBNA 3CENA 1SI5H 1AUTC 1UMAH 2OLGA 1CU1A 2DE8A 2C3SA 1O3CA 4F49A 3SJ8A 3FP8E 5EODA 1SHHB 2KCAA 1DX5M 1S0QA 3SNCA 3SJKA 5CHAC 4KKDA 1FAXA 2QF0A 5GXPA 4ZAEA 3URCA 3A7XA 3JZ1B 4E7NA 1NRNH 3S7KB 2KFWA 3RXVA 1LPKB 1FQ3A 3BEIB 5EQRA 4GPGA 2HPQH 1N1LA 1EPTB 1VKYA 2BD5A 1F0UA 1K9OE 1XKBC 1ZJKA 1O5DH 1HAHH 2W5EA 2BLWA 1DWDH 5DP9A 5AVDA 2CK3D 1BCUH 4ISLA 5A09A 1Q3XA 1OPHB 3F1SB 1THRH 1GI1A 3RXQA 3W94A 1ZPCA 1QJ7B 1J14A 2ZWLH 2PV9B 5DP3A 1ZRKA 2BZ6H 3L33A 2H6MA 4Z6AH 2GDEH 4H6SB 1OWJA 1W7XH 4DY7B 1VITH 4NSVA 1W0YH 1TX6A 3FN8A 1TMUH 4MTBA 2WYJA 2XCFA 2JH5D 3DHKH 2XC0A 3FANA 9LPRA 4HGCA 1Q31A 2BX4A 1MTNB 1CE5A 5A2MH 1TWXB 2H2ZA 1WCZA 1DDJA 1O3KA 1DWBH 3PM3A 3QO6A 2B9LA 1PPBH 1CVWH 3RXCA 4IBLH 4U30A 2Z7FE 1UK2A 2RA0A 3A85A 3H5CB 1BDAA 4F4OC 5KECA 1L4DA 1O3EA 3HATH 3P95A 2FWWA 1A3BH 1O34A 3N7EA 2BDBA 1HXFH 2C8XB 1F0TA 1LVYA 3EA9A 1HAIH 2ZC9H 1D6WA 3GY4A 1RXPA 2P8OC 4O03A 2FX6A 2GJGA 4K1EA 1S6HA 2H9HA 2BD2A 2NU0E 2ODYB 4ZHMU 1OXGA 2TPIZ 1K1PA 3RMMH 4Y71A 2ZFTA 4DT4A 2PR3A 1NY22 2UUFB 4CHAC 2PFEA 1NU7B 1Z1JA 1GCDA 3GY8A 4FUFA 4IMZA 2HLCA 2A31A 1BRCE 4I8LA 1GGDB 2Z9GA 1BTHH 5DO4H 2G81E 4DIIH 3MQKC 4CRAA 2HLDD 3PRDA 1FIZA 2THFB 5IK2D 2BD9A 1GBKA 2G5NA 3EA7A 1ID5H 3UQVA 3F68H 1HFDA 2A7JA 3LGWA 2JH6D 2ZNKH 4XD7D 1P09A 2R3YA 3UOPA 4WH8A 4CR5A 3GS9A 3DSPA 2C8YB 1LPZB 1PQAA 2FPZA 2WPHS 1K1IA 1YCPH 2YMSD 4Y10E 4AB9A 4CREA 4M7GA 1OSSA 1WDIA 3E8LA 1MU6B 3OU0A 4FUBA 4A1TA 2O9QA 3M36A 1TAWA 4DJZB 1FAKH 1C5MD 3S9AA 3ZZDA 4ABIA 2OC0A 1SOZA 1AZZA 1BRUP 3MH4A 3MMGA 2PUXB 3M7TA 3TJVA 2FO9A 1XUJA 5EXNA 1TPOA 2W3KA 1THSH 1S6LA 3UB0A 2BLOA 3PV5A 3TNTA 1YM0A 1AVGH 2FYQA 5EGMA 3SZNA 1AZ8A 2DE9A 2HGTH 4CRGA 3SQEE 1J9CH 1O3BA 2AMQA 3SU5A 3RMOH 1C5VA 2G55A 5AF9H 1O2XA 4FETA 3OEED 2QC2A 3K65B 4OGXA 3E1XB 3HKJB 5DPAA 1GMHG 2C90B 1M9UA 3SOSA 1P9UA 4RKOB 1ZTLA 5HIYA 1GHBG 5GNDA 1C5WB 1H8HD 4JYUH 2BM2A 1GBTA 2GMTC 1ANDA 4OS4A 3OE7D 1GVLA 2RA3A 4X6PA 1KTTB 2TIOA 3RU4T 3UNRA 3SNEA 2BLVA 2FP7B 3RXFA 4A6LA 1OYTH 2TGPZ 4DW2U 4IGDA 2VGCB 4Q7YA 3EGKH 1DSUA 1MD8A 3BEUA 1HAOH 2XRCA 4B2CA 3UOUA 1VITG 3VXFH 1AWFH 1C5PA 1E1QD 1O38A 1SBWA 5E2PA 3ZYEA 3H7OA 6LPRA 3RXIA 1AQ7A 1KXDA 5C2ZA 3OEHD 1QL8A 2XCNA 1V2JT 1EAXA 2NU1E 3KYFA 3T27A 4NZLA 3QDZB 1QB9A 3MU0A 2P94A 2BXTH 1V2MT 1Y8TA 2FXRA 1HRTH 2GD4B 1GHYH 3ZZBA 1YLNA 3RXMA 5F03A 4HG6A 3RM2H 4JK6A 3T28A 1L1NA 5EIYA 5KGOA 3S9BA 2VVCA 3NZIA 3ODFA 3ATKA 4MLFB 1BRBE 4ISNA 3F3BA 5EJLA 3VPKA 3MO3A 1GJCB 1MAYA 1EUFA 1FONA 1C2FA 4KTSA 3ZZCA 1OWDA 3E0PB 2RDLA 5FPTA 1DWEH 2VGCC 3V7TA 1YCPK 4B75A 2ODQA 3S7HB 1H8IH 2B0FA 3KGPA 4KTCA 4WXIA 1BA8B 2ZQ2A 4LXBH 3UUZA 1UTMA 2OUAA 4A1XA 4DGJA 4M9FA 7GCHG 1GL1A 3M35A 2SNWA 4MNWA 3SI4H 4YESB 4FUIA 4P00A 3ZIAD 1NFWA 4NA7A 2F9VA 1O33A 4BAOB 5DG6A 1ZMNA 2TBSA 1OP0A 2TGTA 3NRLA 4D9RA 5DP7A 3BV9B 2M5TA 3KQBA 5EQQA 3VB5A 2ZFPH 3RXDA 1OX1A 4NFFA 4NIYA 2J94A 2BX3A 2IJD1 3LKWA 3U69H 2AIQA 1FN6A 3MU5A 2VIVA 1WV7H 3ZZ6A 4Q2KA 4IMQA 8KME2 1LTOA 5L6NH 2OP9A 1LHGH 3GYMA 3LH3A 1O3DA 1AFEH 1NFXA 2UUKB 1GG6C 1GJ4H 4X6OA 1QBOA 2A2XH 1IHTH 3QX5H 1AU8A 1GPZA 3KYGA 1SGIB 3T62A 2BQ7B 1UTNA 1QL7A 3NK8A 3UR6A 2IN2A 3TGKE 2ZGHA 2A0QB 3UQOA 2FDAA 9ESTA 1QURH 2BYAX 4NG9H 5EXLA 1UVTH 4ABJA 2ANYA 1V2VT 3ZZ3A 1QB6A 3GY7A 2Y82A 1WYKA 1O3MA 3LDXH 1BJVA 4NWLA 1GMDG 1SFQB 1SGPE 4RT1A 5DSFA 1GHBF 4OS7A 5PTPA 4JZIA 4O3UA 1W14U 5K0HA 3ZZ4A 2PGBB 1QJ6B 4Y79A 1YP9A 1SLXB 1MCVA 1O3JA 5FCKA 1YC0A 2VIPA 1C5YB 3F6UH 1V2PT 3SJOA 3RU4E 3NCLA 1SQOA 2GVFA 5E0GA 1RFNA 3M3VA 4MPWA 1RIWB 5DGJA 3ZVFA 1O5CB 2ZG0H 2C93B 2C8WB 2ZGBH 4UE7H 1HGTH 2RDEA 3A84A 1V2UT 3N99A 3PTNA 4ZROA 3SNAA 4O3TA 3Q3YA 1T31A 1QNJA 3ATIA 1JMOH 4I31A 1VITF 1DVAH 3DFLA 3MU8A 1UO6A 4JCNA 1C2LA 3ZZAA 5C3NA 3U8OH 2B8OH 1ELCA 2V7QD 2BQWB 3F0PA 4AX9H 4YLQH 2LELA 1A61H 1NC6A 1ETRH 1W0JD 1HCGA 8GCHF 1COWD 1MTUA 2PHBA 1Y3XA 2J9NA 4BAKB 4BANB 4CRFA 1DICA 3DFJA 4A92A 1H4WA 4NA9H 2JKHA 3LU9B 1IQHA 2F43B 3EA8A 1XUKA 1ZPZA 1XVOA 1IQGA 3BTWE 1KXEA 3SV8A 3VGCC 1PJPA 3V12A 5T3HA 1TOMH 2R2WU 2V0BA 1IQMA 3M5MA 1MBQA 1NRPH 2BD4A 1YF4A 1AFQB 1YCPM 3QZQA 1UTKA 2OQ5A 3SI3H 3F0OA 5C5NA 1OP8A 3SJIA 1O5AB 1ANCA 4WJG2 1RJXB 4NGAH 4X1QU 1C1PA 1TONA 2FYRA 3EE7A 1NFYA 3BTQE 1ETTH 2CF8H 3M37A 1HYLA 2XNIA 1NS3A 3M3SA 1O2UA 3ZVEA 5A8YA 1MU8B 1GBHA 1C2HA 1W8BH 1TQ0B 2ZHFH 4MVNA 7GCHF 2WV5A 2JETC 1FIWA 1O5FH 2A32A 3PROA 3RM0H 4ASHA 4VGCC 1HB0B 1WAYB 1NO9H 1VZQH 1P2QA 4Q7XA 1YWUA 1D3QB 2IPHA 3KHVA 5HKKD 2WZQA 1EZXC 2ZKSA 5CHBA 3UTUH 1TIOA 2BD7A 3ATMA 5JBCS 4WMDA 2ZDKA 1FI8A 2Z9KA 1TX8A 1TOCB 1EZUC 4GCHG 1J16A 4XSKU 4YOIA 1OS8A 1V2KT 1TNKA 2O8UA 1NU9A 1YPHC 4NIVA 1DS2E 1L2EA 1Z8JB 1TA6A 2VIQA 2J95A 1SR5C 4CRBA 3MNBA 4ABBA 5C0UA 2GV7A 2BQ6B 3QN7A 2UWLA 2F4LA 1AD8H 1P11E 1ARCA 1O2TA 3LGYA 1TMBH 2HVYB 3GYLB 4AFSA 2NU3E 1QA0A 1A2CH 2Y6TA 1LKAA 5FCRA 1JIMA 1GVKB 2VIWA 2WPJS 1GDNA 1YPLH 1VGCC 2V3HH 3T25A 1CT4E 4NFEA 2XYAA 5BPEA 1ZSLA 4I8GA 4MNYA 2BOHB 4CRCA 1S84A 2XTTB 3RXPA 2AS9A 3ZVBA 1XM1A 1TBRH 1NN6A 3S69A 2ZDMA 2A2QH 1GBAA 2W6ID 2GCHG 1KIGH 2FIRH 1ZHRA 2HNTE 1CA0C 2BY9X 1HLTH 2F9NA 5LPFA 2J34A 1OWKA 1DPOA 3MU1A 1ETSH 2OC8A 2VIDA 1VR1H 1UCYE 1P2JA 3PMJA 3W1EA 4UEHH 2A7CA 2RCEA 5C0TA 3WW7A 1GMDF 2LPRA 1XUFA 1O2QA 4XBBA 2ZP0H 2BMGB 1K1JA 2I6QA 2JJ2D 4B6EA 1C5XB 4INKA 1E37B 5TCAA 4FUCA 3SUEA 2AEIH 2QXGA 4ISIH 3RXTA 3VXEH 3QWCH 1ZGVA 5C1YA 4AN7A 3RXUA 2KZ4A 1AVXA 3SNBA 4RI0A 1F5LA 5H4IB 3GCHB 3M5OA 3GISB 3SGBE 3TLOA 1SGCA 1D9IA 3F9HA 3LGVA 4YTAA 3V3MA 1GBCA 1PFXC 1O2OA 2OC1A 2FOBA 1BHXB 3A87A 2WPMS 1O2ZA 1QY6A 1FY4A 4MDSA 1NTPA 1L4ZA 5DP5A 3RU4D 5FPYA 1O5EH 2ZEBA 1GHXH 2GT8A 2ZU2A 5EOKA 1TPPA 1Z7KA 1CSOE 2A4RA 5CDFE 4FUHA 1JBUH 2VNTA 2D26C 3KEEA 2KR7A 1GBMA 1FPCH 1TGSZ 2F9PA 1WTHD 2CHAC 2QXHA 3MYWA 3SGAE 1C9TA 2XXLA 3A80A 3GICB 4O9VA 1FMGA 1GI6A 1GDQA 2QF5A 2AYWA 1SQTA 3OSYA 2CF9H 1NFUA 4FUJA 1WOFA 1DUAA 1PYTD 2NWNA 2Q6FA 4RSPA 4ZUHA 1IQKA 3MNSA 1PYTC 5AFYH 1EB1H 1MQ5A 5A0AE 1Y3UA 3UY9A 1Y59T 2FS8A 1C1WH 3GCHC 1AB9B 2R0LA 3VB4A 1PPCE
chains in the Genus database with same CATH topology
2RFKC 2EY4C 3UAIC 2EQNA 2HVYB 2V3MA 3U28C 3MQKC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RFK C;  2EY4 C;  3UAI C;  2EQN A;  2HVY B;  2V3M A;  3U28 C;  3MQK C; 
#chains in the Genus database with same CATH topology
 2XOK D;  3U98 H;  5EPN A;  4FU8 A;  3DUX H;  1C5T A;  2Y80 A;  3SV7 A;  1P02 A;  1O2I A;  1SQR A;  3M61 U;  1TFX A;  2WYG A;  2ZO3 H;  1O30 A;  2OIN A;  4X6N A;  5F8X A;  1SC8 U;  3VG8 A;  2UWP A;  2AHM E;  1AO5 A;  5EW1 H;  4J1Y A;  5A8Z A;  1P3E A;  4B1T A;  2ZTX A;  1GJ5 H;  4GCH F;  3V13 A;  2VWL A;  1ZRB A;  1TQ7 B;  2BXU H;  2WSS D;  3WY8 A;  1TPS A;  2OBQ A;  1OWE A;  2A5K A;  1L1G A;  3A7Z A;  1HAZ B;  1C1N A;  1P03 A;  5HM9 A;  1CT0 E;  3DD2 H;  2G4T A;  2V35 A;  3PMA B;  1MTW A;  4RKJ B;  1ZTK A;  1O3N A;  2FS9 A;  6EST A;  3SV9 A;  1Y3V A;  1ZLR A;  3R0F A;  1O36 A;  2PUQ H;  1ZTJ A;  1GHA G;  3MO9 A;  4TY7 A;  3STI A;  3BTD E;  3OX7 U;  3BTE E;  4Z1M D;  5GIB A;  1EPT C;  2A5I A;  3QGN B;  4FXG H;  1CBW B;  2KCY A;  5L2Z H;  2VVV A;  2BLQ A;  1TNG A;  1G3D A;  1W2K H;  1EAW A;  2ASU B;  2BHG A;  2OC7 A;  3M7Q A;  1EP6 A;  1ZSK A;  5EJZ A;  2OD3 B;  3RXS A;  1OYQ A;  1FY1 A;  2UUJ B;  3F2G A;  4DOQ A;  5C1U A;  1O2J A;  1RD3 B;  2AGG X;  2GCH F;  1O2L A;  2VBC A;  3QK1 A;  2YMS B;  3PLP A;  3F2H A;  2PKA A;  3RP2 A;  4AGJ A;  2OQU A;  2ZU3 A;  5TJX A;  1EJN A;  1BIT A;  4ZHL U;  1FJS A;  1FN8 A;  2KCO A;  4UFD H;  1C1V H;  2FOG A;  3L3T A;  2ZA5 A;  3A81 A;  3PMB B;  1NZQ H;  2FTM A;  2G4U A;  2J97 A;  4U32 A;  3UIR A;  4X8V H;  1UVO A;  4WXV A;  1DXW A;  2BDI A;  4NIW A;  1PPG E;  1MTN C;  2XBV A;  2QF3 A;  5JB8 S;  2GT7 A;  2ILN A;  5F8Z A;  3M5N A;  2P3U B;  1MUE B;  3EAJ A;  1W10 U;  1O3H A;  1O2V A;  2Y81 A;  3GCN A;  1CBW C;  2VWO A;  3MH7 A;  1K1L A;  2O8T A;  1ZOM A;  4FU9 A;  2TGD A;  3BTF E;  2JH0 D;  1F5R A;  2P95 A;  3AVZ A;  4A1V A;  1RRK A;  4LOY H;  1XXF A;  2VH6 A;  1W13 U;  3TK6 A;  2EY4 C;  1T8L A;  4Z0K A;  1HJA B;  3C1K A;  3DA9 B;  2YMS C;  3ZVD A;  1DLE A;  4TWY A;  2HWL B;  4FUD A;  2EC9 H;  3ZVC A;  4DIH H;  2CMY A;  4PRO A;  1TX7 A;  1H9I E;  1SHY A;  3FP7 E;  2AIP A;  3P70 B;  1PQ7 A;  1VCP A;  2VWN A;  3V0X A;  1S82 A;  2IOT A;  1GGD C;  1TNI A;  1BHX F;  1BOQ A;  5EPY A;  2A5A A;  6GCH F;  1Z6J H;  2LP6 A;  3OFN D;  1AWH B;  4EST E;  4YOG A;  4CBN A;  3PO1 B;  4OS6 A;  3HK3 B;  3NPS A;  1V2Q T;  5F53 A;  3LJO A;  3SU6 A;  3ZVA A;  3RXL A;  1AGJ A;  4ABF A;  3FO8 D;  4UON A;  3A88 A;  4YO9 A;  5LH8 A;  3ATL A;  3H09 A;  1CGI E;  4X8U H;  2CXV A;  4YM9 A;  5DN6 D;  1EKB B;  2BDA A;  2GTB A;  2ZDL A;  1FNI A;  3VEQ B;  1TA2 A;  4LZ1 H;  2Q6G A;  4UFE H;  2YNA A;  1AE8 H;  2QF4 A;  3GY6 A;  4NZQ A;  4XBD A;  2ALV A;  2PKS B;  3PV2 A;  1MTS A;  1RTL A;  1C1U H;  2STA E;  1QZ8 A;  4NCY A;  3MNC A;  1UHB A;  1YYY 1;  2Z94 A;  3HK6 B;  3UR9 A;  2AMP A;  1G2M A;  3FOA A;  4YZU A;  4IC6 A;  1IQL A;  1O35 A;  2QIQ A;  2Z9I A;  4UFG H;  3FP6 E;  3TH3 H;  3WWB A;  1KLI H;  1IQN A;  1LMW B;  1S6F A;  1G3E A;  2ULL A;  5DK1 A;  3UNS A;  2CV3 A;  3D65 E;  1SGY E;  1HV7 A;  4OS2 A;  5ESB A;  4WWY A;  2H9E H;  4GHT A;  3BIU H;  1VJ9 U;  2W7U A;  3LGT A;  1MMJ N;  1B7X B;  1C5O H;  5T6F A;  4OM9 A;  1YPE H;  1D3P B;  4JZF H;  2Y7Z A;  5DP6 A;  1EOJ A;  5FHT A;  8GCH G;  1GHA F;  1PPZ A;  1B0F A;  1BRA A;  2VU8 E;  1MBM A;  1N8O B;  1FY3 A;  2C4F H;  1YBW A;  4IC5 A;  4MG3 A;  1H8D H;  5TCC A;  3DT0 H;  1C2D A;  3O8B A;  2ZDN A;  1DM4 B;  3BG4 B;  5J4Q A;  4NIX A;  4HTC H;  2V3M A;  2HAL A;  3UWI A;  2TRM A;  1BTX A;  4WH6 A;  2J98 A;  1AKS A;  3HGN A;  1ABJ H;  4AG1 A;  3ENS B;  1UW7 A;  2FOE A;  4K1S A;  1EJM A;  1UHB B;  3LOX A;  3ITI A;  1UK3 A;  4INH A;  2W3I A;  1EZQ A;  1VCQ A;  2STB E;  1YPM H;  3RXR A;  1BJU A;  3SW2 B;  3O8D A;  1AI8 H;  1QTF A;  1AN1 E;  1P2K A;  1XUI A;  4BXW A;  2J38 A;  1XMN B;  1W0Z U;  2ZU5 A;  1Z8I B;  2CGA A;  2F9B H;  4WY3 A;  1ELD E;  3NUM A;  3P8O A;  3T26 A;  4QT8 C;  2TGA A;  1HDT H;  3K2U A;  1SLW B;  1O2G H;  1AIX H;  1UVU H;  4NSY A;  3U8T H;  1WBG B;  3RXB A;  1KLT A;  4WVP E;  3TGI E;  3SU4 A;  1NRS H;  1GMC G;  2ZU1 A;  4YXW D;  2KCP A;  5KED A;  3FZD A;  1BMN H;  3UNQ A;  3LPR A;  2SGQ E;  1FPH H;  2GCT B;  1OWH A;  1TAB E;  2WV4 A;  1O2K A;  2J98 B;  2H1U A;  1AKS B;  4IS5 A;  1O31 A;  4K3J A;  3MH5 A;  3F9G A;  5C1X A;  3JZ2 B;  5C67 A;  4DG4 A;  3AAS A;  1Z1I A;  2ZFF H;  4XDE A;  1ZML A;  4K2Y A;  2P16 A;  3MWI U;  3TJO A;  1PPF E;  3LGU A;  1J8A A;  4ASU D;  1C4V 2;  1EAS A;  4TYD A;  4E7R G;  2PSX A;  4B2B A;  1ZYO A;  2SGF E;  1KXF A;  2L74 A;  3MFJ A;  4BTT B;  1C2I A;  2F91 A;  1L1J A;  1JWT A;  2W7S A;  1F0S A;  4WF8 A;  5A8X A;  1C1M A;  3KCG H;  1YGC H;  1HAX B;  2R3U A;  1TGC A;  2R0K A;  4D9Q A;  1W7G H;  4X2Y A;  5B6L A;  2SGP E;  1T8O A;  5FL7 D;  4AOQ A;  1SMF E;  3RC6 A;  3B8J A;  4B73 A;  1C2J A;  1JIR A;  1GBJ A;  2ZHD A;  5E8E H;  2FI5 E;  2XC5 A;  2SGE E;  5JBB S;  4AFU A;  2GZ9 A;  2ZU4 A;  1S0R A;  2WPD D;  3Q3X A;  1O2R A;  3RXG A;  3SQH E;  1LKB A;  2EI7 A;  2A4O A;  1W3C A;  2FLR H;  1SPJ A;  4I86 A;  1L0Z A;  2OTV A;  3RUO A;  1QHR B;  4K8B A;  1HJ8 A;  4KGA A;  2BVX H;  2I6S A;  1CT2 E;  1GCT B;  3TPI Z;  1EAU A;  2R9P A;  1LHF H;  1GI4 A;  1KLJ H;  1XKA C;  1GJB B;  3MO6 A;  1LHD H;  1LQD B;  4CRD A;  3LGI A;  1WSS H;  1RS0 A;  4Y8X A;  2JJ1 D;  3LH1 A;  2F3C E;  2ZPQ A;  1ANB A;  3SZE A;  2AGE X;  2Q6D A;  1F5K U;  2G00 A;  3A83 A;  2EA3 A;  1A5I A;  1V2T T;  4D7G A;  1C1R A;  3ODD A;  1FY5 A;  4ABA A;  2ZEC A;  4X2V A;  4YT6 H;  3ZZ8 A;  1MZA A;  1THP B;  1GI9 B;  4X1S U;  2ZGX H;  2IPQ X;  2QXJ A;  4R8T B;  2ZI2 H;  1TAL A;  3EYD A;  4DT7 B;  4Q7Z A;  1SFI A;  4I33 A;  4OS1 A;  4FVD A;  1F0R A;  4AFQ A;  4BNR A;  3VB3 A;  3GDV A;  1CQQ A;  4F55 A;  5FBI A;  1H9L B;  1WQS A;  3NXP A;  1SQA A;  3RXJ A;  1AMH A;  1E36 B;  2ZHE H;  2F83 A;  1G37 A;  2D1J A;  4NA8 A;  3O8C A;  3DCL A;  1LPG B;  5BRR E;  2NU4 E;  2Y5H A;  2QV1 A;  1XX9 A;  5LPE A;  1GHW H;  2VIN A;  1FY8 E;  4ABE A;  4I32 A;  1NPM A;  1Z6E A;  3RXK A;  1RIW C;  4XE4 A;  1IQF A;  4JZ1 A;  3MOC A;  1WUN H;  3MH6 A;  1LHC H;  1KY9 A;  2DUC A;  2AH4 X;  2KAI A;  3Q76 A;  1TB6 H;  3M7U A;  4I8H A;  4AYY B;  5EQS A;  3E6P H;  5JBA S;  2FOH A;  1A0L A;  1FLE E;  2UWO A;  2Z3C A;  1GHZ A;  3A8D A;  2AER H;  3BTG E;  1YLD A;  2GKV E;  4RN6 A;  3GCT F;  3T2N A;  4J2Y B;  3ATW A;  1MAB B;  3PMH B;  5I25 A;  1QL9 A;  4P02 A;  2ANW A;  4BTU B;  3RXE A;  3LON A;  2BZA A;  1GMC F;  2ZTZ A;  1EAT A;  2KM0 A;  1WU1 A;  1YPG H;  4MNX A;  3RDZ A;  3RLY H;  1E35 B;  1MQ6 A;  1FX0 B;  3ZZ9 A;  3MI4 A;  2SFA A;  4E05 H;  3FZZ A;  3A7Y A;  1EJA A;  1U6Q A;  3KN2 A;  4B71 A;  1AFQ C;  2FEQ H;  1TNH A;  4ZKR U;  1MKX H;  4H42 U;  5GCH F;  1KSN A;  5A0C A;  5HYO A;  3RXA A;  5JBT A;  1A5H A;  3ZV9 A;  4BAQ B;  1OHH D;  3LJJ A;  2A4Q A;  3D23 A;  1KYN A;  1C4Y 2;  4GAW A;  3A7V A;  1UJ1 A;  1J15 A;  1D3D B;  1SOT A;  1ESA A;  2KAI B;  1F7Z A;  3CNR A;  3FAO A;  2BDG A;  2QE7 D;  2VH0 A;  1TGB A;  1DAN H;  4Y8Y A;  1ESB A;  1GJ6 A;  2BDC A;  3SHA H;  5T6D A;  1ARB A;  2BY8 X;  5E0H A;  5HGG A;  4MQA A;  1E0F D;  1UCY H;  3P8G A;  1GI0 A;  2ZFQ H;  1O5B B;  2BY5 X;  1O2S A;  2QN5 T;  2WPK S;  2QY0 B;  5DJ7 A;  3AW0 A;  2GDD A;  2BDY A;  4Y6D A;  5C20 A;  3P17 H;  2PTC E;  3PWC A;  1FUJ A;  2PTN A;  1SGF A;  4AOR A;  3K9X B;  3TJN A;  3KQ5 A;  1DWC H;  2Z9L A;  1SL3 A;  2ZZU H;  1S83 A;  1IQI A;  4K8Y A;  4CBO A;  3EST A;  1NM6 A;  6CHA B;  3I29 A;  1D3T B;  3PB1 E;  3M5L A;  3K6Y A;  3LC3 A;  2FI3 E;  5FX5 A;  2WHX A;  1IQE A;  1K2I 1;  3EQ0 H;  3GY2 A;  4KTU A;  4WME A;  5AFZ H;  1SGR E;  1O3F A;  4X2W A;  3TIT A;  1CHG A;  2QAA A;  4O97 A;  4ZCN A;  5G4B A;  1CHO F;  2KX4 A;  1T32 A;  2UUY A;  2ZFS A;  5C17 A;  1LQE A;  3IG6 B;  1AE5 A;  3TGJ E;  1EFR D;  1GL0 E;  1EST A;  1E38 B;  1P05 A;  3DSG A;  3B9F H;  2XW9 A;  4FUE A;  2ZDV H;  4AYV B;  1TBZ H;  2ALP A;  2P93 A;  4ISH H;  3A86 A;  1DE7 H;  2EST E;  3C27 B;  2C8Z B;  4K5Z A;  3HGP A;  3KID U;  3Q77 A;  6GCH G;  4Y7A A;  3SND A;  4JYV H;  2EI8 A;  2VIO A;  1GBI A;  3F9E A;  3KQC A;  1O2M A;  1ZMJ A;  2EI6 A;  8EST E;  3QGJ A;  1W11 U;  5FAH A;  7KME H;  4ZMA H;  3GY5 A;  1DY8 A;  1O3I A;  1G32 B;  1MKX K;  3AW1 A;  5IDK A;  3AK5 A;  1IAU A;  2P59 A;  1EAI A;  3IIT A;  3RML H;  1HIA A;  1SGF G;  1MH0 A;  3KQD A;  1BTW A;  2FES H;  2FZZ A;  3CS0 A;  3N7D A;  1V2N T;  5DKM A;  4LK4 A;  1GVZ A;  3QZR A;  5ETX A;  1GI5 A;  1K28 D;  1P2O A;  2O8L A;  1P10 A;  1YPK H;  1HNE E;  4X1N U;  1WTG H;  5EG4 A;  1JRT A;  3ZV8 A;  3D62 A;  2CN0 H;  1P2I A;  1A3E H;  1NBM E;  1KMH B;  2Y7X A;  1UCY K;  2J4I A;  3RXH A;  1FDP A;  2CJI A;  3BIV H;  3PYH A;  2Z9J A;  3L6P A;  4X0W U;  1C1T A;  1N6X A;  1ZPB A;  1BML A;  2P8O B;  1MTV A;  1O32 A;  3NKK A;  3QUM P;  3SU2 A;  1AB9 C;  2RG3 A;  2XND D;  3GDU A;  1QBV H;  1TRM A;  2FI4 E;  1OP2 A;  1V2W T;  2J92 A;  3SGQ E;  1SGE E;  4CHA B;  2PSY A;  1QA7 A;  3A7T A;  3S0N A;  5I46 H;  1HIA B;  1KXC A;  1SGN E;  2K1Q A;  4THN H;  4TPI Z;  3U1J B;  2W6J D;  1LVM A;  1C1Q A;  2XWB I;  1EZS C;  3DSO A;  2Y5F A;  1SGQ E;  3E0N B;  3MTY A;  2XBX A;  2WPI S;  1ZHP A;  2V6N A;  3SU0 A;  1D6R A;  1TGN A;  1GHV H;  1OKX A;  3F9F A;  1WXR A;  1P2M A;  3E3T A;  1GJA B;  1HUT H;  1C5U A;  1Z71 A;  4BAH B;  1INC A;  2XBW A;  3TH2 H;  2QA9 E;  3U1I B;  1LHE H;  4ZXX H;  3P8N A;  3TNS A;  3CS7 A;  4INL A;  3SUG A;  3FFG A;  1GBE A;  2HNT C;  4K60 A;  4U2W A;  2H5D A;  1E1R D;  4DCD A;  4AC9 A;  3RC4 A;  5JDU B;  1V6D A;  1QRZ A;  7LPR A;  4HFP B;  2WPL S;  1BMA A;  2XWA A;  4AFZ A;  4JK5 A;  2SGA A;  1C2G A;  4GLY A;  4FOU C;  1QFK H;  2QYI A;  1UVS H;  1CGJ E;  2B5T B;  2FOA A;  2ZCK P;  1UTL M;  3PLK A;  2GP9 B;  3BSQ A;  4GUX A;  3RXO A;  1C5Q A;  4GHQ A;  1EP5 A;  2A1D B;  1V3X A;  2L6O A;  1XUH A;  2FOM B;  5EU8 A;  5T6G A;  1F92 A;  1UK4 A;  1TNL A;  1T4V H;  1S81 A;  5HMA A;  1BB0 B;  1ZZZ A;  1SGD E;  2PKA B;  1DST A;  3BTK E;  1ZGI A;  2J2U A;  1EOL A;  3TJU A;  1GI3 A;  1Y5B T;  2Q1J A;  2ZIQ H;  4X8S H;  4WMF A;  2G5V A;  2O8W A;  4H6T A;  4A5T S;  3ZVG A;  2OXS A;  4Q63 A;  1DOJ A;  3EDX B;  1SLU B;  2GMT B;  4AG2 A;  3MHW U;  5T1V A;  1EQ9 A;  2H9T H;  5E2O A;  4OGY A;  4ZH8 A;  1IOE A;  3TIU A;  3MNX A;  1IHS H;  1SG8 B;  3SHC H;  1T8N A;  2IJO B;  2W26 A;  4XFQ A;  1B0E A;  2F9U A;  3LT3 A;  1KDQ A;  1CA8 B;  2PW8 H;  2BD3 A;  4ISO A;  2ZDA H;  1JOU B;  1ELG A;  1TGT A;  1GJD B;  1MAX A;  2AFQ B;  2FX4 A;  2J5U A;  1QRW A;  3NWU A;  1NT1 A;  2GGV B;  3SBK A;  5GWZ A;  1P0S H;  1HJA C;  2Z6B D;  2GX4 A;  4I8K A;  4X1P U;  5EJ1 A;  3P6Z B;  1K1N A;  2FLB H;  2ZF0 H;  3OTJ E;  5GPI B;  2SNV A;  4ZKN U;  2M2A A;  4F48 B;  2A45 B;  1W0K D;  2NU2 E;  4AB8 A;  1P8V C;  3QTO H;  1J17 T;  1UTQ A;  1T7C A;  1GJ7 B;  1GDU A;  4NWK A;  4K69 A;  5AHG H;  3VB6 A;  1NRQ H;  1O2H A;  3QTV H;  3ELA H;  2BB4 A;  4H4F A;  4MNV A;  3G01 A;  3E91 A;  1P04 A;  2ZFR H;  5FBE A;  3PO1 C;  5LPR A;  4GSO A;  3ZYD A;  4SGA E;  1B5G H;  1RTK A;  4KEL A;  1T4U H;  2D2D A;  4X8T H;  2HVX A;  4XRN A;  2AGI X;  1W12 U;  1NBM D;  1SVP A;  4E06 H;  1DXP A;  1FV9 A;  1KXA A;  1QQU A;  1KDQ B;  1VCW A;  5A0B A;  1O2P A;  3UFA A;  5F8T A;  1GI7 B;  1ZHM A;  2ANK H;  1K22 H;  1X7A C;  2PKS C;  3ZZ5 A;  3URE A;  1SSX A;  1P12 E;  3A7W A;  3OTP A;  1QIX B;  1YY3 A;  1BTP A;  4CH8 B;  3F2F A;  1O37 A;  2PWX A;  3N7O A;  1AVW A;  3BTT E;  1QR3 E;  2HNT F;  1O2N A;  3HPT B;  4ACA A;  1OWI A;  1IQJ A;  5FX6 A;  1BMF D;  1EXF A;  4KP0 A;  4B6F A;  3PWB A;  2WV9 A;  5HIZ A;  1E34 B;  5GDS H;  1LDT T;  4TSF D;  4Y11 E;  3TH4 H;  1C4U 2;  1ZSJ A;  2ZTY A;  2PLX A;  4YT7 H;  1NRR H;  1K1O A;  2VVU A;  1TRN A;  4I7Y H;  3OY5 U;  3GCT G;  2BVR H;  1GG6 B;  1O0D H;  3KL6 A;  1BTY A;  4K1T A;  4GVU A;  1N8O C;  5FXL A;  1K21 H;  2LNC A;  1DIT H;  5DP8 A;  5JPM H;  4YLU A;  1YPH E;  5EST E;  3T5F H;  3BG4 C;  1PPH E;  5C5O A;  1O3O A;  3BTH E;  5FPS A;  1C2K A;  1GI2 A;  3E90 B;  5JB9 S;  1O2Y A;  4Y0Y E;  1K1M A;  4SGB E;  2ZCL P;  5GCH G;  1EX3 A;  5B6O A;  5HM2 A;  4JYT A;  1LCY A;  1C9P A;  1QJ1 B;  2ZPS A;  3SU3 A;  1GBD A;  1Q2W A;  5EW2 H;  5LGO A;  3OAA D;  1KXB A;  3TVJ B;  1P57 B;  2Z3E A;  2BTC E;  2WUC A;  3AAU A;  1GBB A;  1V2L T;  1DFP A;  3A89 A;  1P01 A;  1H1B A;  2HOB A;  1V2R T;  1EB2 A;  2VB0 A;  1G30 B;  3KQE A;  4Y7B A;  1ZR0 A;  2YOL A;  2G8T A;  3A8C A;  2JIZ D;  1UTP A;  1BBR H;  1ZJD A;  4JMY A;  4OS5 A;  2WUB A;  1AHT H;  2EQN A;  3GY3 A;  1V2O T;  3STJ A;  3RMN H;  1MKW H;  3R3G B;  1BBR E;  1QQ4 A;  4D7F A;  3U28 C;  1SGT A;  1QRX A;  2GCT C;  1O3P B;  4Q4L A;  3SJ9 A;  2ZHW H;  1C5N H;  1O39 A;  2FM2 A;  1ORF A;  2HRV A;  4RT0 A;  4U01 A;  4AZ2 B;  1BUI A;  1TRY A;  1P06 A;  1A1R A;  2ZPR A;  3VFE A;  2A7H A;  4R0I A;  4ZKO U;  3EE0 B;  3OYP A;  4D8N A;  1NES E;  1GBL A;  2O8M A;  3K6Z A;  5IYT A;  4MPX A;  1BT7 A;  1ELV A;  1GJ8 B;  1SKY E;  1C1S A;  5SGA E;  1GMH F;  1PQ8 A;  4IN2 A;  1CGH A;  2OK5 A;  1S5S A;  3CP7 A;  1HPG A;  4MPU A;  1Y3W A;  4HZH A;  1P9S A;  1GWA A;  1C5Z B;  3GOV B;  3SO3 A;  1XXD A;  2ZCH P;  3VGC B;  3SV6 A;  1TBQ H;  1E79 D;  2WIN I;  1OOK B;  1CHO G;  1HAV A;  3BG8 A;  2BY6 X;  2HPP H;  1FZZ A;  1A46 H;  1T8M A;  1RGQ A;  2GV6 A;  3HKI B;  3IWM A;  1Y5A T;  3RC5 A;  1C2M A;  4FU7 A;  1PQ5 A;  1A4W H;  3SYJ A;  4XOJ A;  4BOH A;  2ZGC A;  1DT2 A;  1BTZ A;  4Y76 A;  1MZD A;  2PP6 A;  4HI3 A;  2ZQ1 A;  3A8A A;  1C1O A;  3FKS D;  3GDS A;  2BD8 A;  1DUE A;  3Q3K A;  1VJA U;  2JET B;  1DY9 A;  1HAP H;  1O5G H;  4VGC B;  1ACB E;  1GCT C;  4BXS A;  3VB7 A;  5ABW A;  3B23 B;  1BMM H;  2V3O H;  1TLD A;  3PRB A;  3P92 A;  3PLB A;  1GI8 B;  4JZD H;  1XVM A;  1D4P B;  4ZXY H;  1MCT A;  3S9C A;  1ELA A;  1TYN A;  1Z8R A;  3P8F A;  1UVP A;  2P3T B;  1TPA E;  2XC4 A;  3Q00 A;  1ABI H;  3SN8 A;  1RTF B;  2ANM H;  3O8R A;  3A8B A;  5CE1 A;  2R2M B;  3T29 A;  4A7I B;  4TPY A;  1HAV B;  2H5C A;  5E0J A;  2ODP A;  1HJ9 A;  2FOC A;  2SGD E;  2G52 A;  5J4S A;  4UDW H;  1V2S T;  1NRO H;  2GZ7 A;  2AMD A;  3U8R H;  4FVB A;  2OBO A;  1A0H B;  5K7R A;  1C5L H;  1G3B A;  1VGC B;  4ABD A;  1SB1 H;  1LVB A;  1BBR K;  1QB1 A;  1Y3Y A;  4TWW A;  1TNJ A;  1C5R A;  1TMT H;  1K0H A;  2XBY A;  1MKW K;  1BQY A;  1ELT A;  2K8I A;  3U9A H;  2FOF A;  3M3T A;  1DLK B;  2QCY A;  2Z3D A;  4TT3 D;  1G2L A;  3LC5 A;  4YOJ A;  3URD A;  3WWF A;  4FUG A;  1CA0 B;  1HXE H;  1YKT A;  2GZ8 A;  5JYI A;  1ELE E;  1HBT H;  3QLP H;  4DUR A;  5L30 H;  2G51 A;  3I78 A;  1F2S E;  2OCV B;  1S85 A;  1LO6 A;  2EEK A;  3RLW H;  3SU1 A;  5C94 A;  1ANE A;  5L2Y H;  1UTO A;  2BY7 X;  4ACB A;  3A82 A;  2RFK C;  3W95 A;  4TY6 A;  4CH2 B;  2D8W A;  1AY6 H;  3AAV A;  1O3A A;  2B7D H;  5HXF A;  4B76 A;  4UD9 H;  4Q80 A;  3SV2 H;  4BTI B;  2QGR A;  3TU7 H;  4JZE H;  1JRS A;  4X1R U;  4XBC A;  3GCO A;  1HAG E;  1HAY B;  4DVA U;  3SOR A;  2Y5G A;  3LIW A;  4ZHA A;  5F6M A;  4B2A A;  1BTU A;  2VWM A;  4D76 A;  1A5G H;  1G36 A;  1TE0 A;  1G9I E;  7EST E;  2FTL E;  3PV4 A;  4B74 A;  3E16 B;  1FXY A;  2A4G A;  3KF2 A;  3I77 A;  1XUG A;  1O3G A;  2BVS H;  1C2E A;  2K0Q A;  1WQV H;  5GJ4 B;  1CO7 E;  3SUF A;  1GBF A;  3UWJ H;  1BIO A;  4ABG A;  1AUJ A;  2CHA B;  4AGK A;  1UTJ A;  3D49 H;  1JXP A;  4X2X A;  1QGF A;  4ABH A;  1ELB A;  2BOK A;  3BEF B;  3FVF B;  8LPR A;  3BF6 H;  3UAI C;  5CHA B;  2ZGJ A;  4IN1 A;  3PTB A;  4IW4 E;  4ZKS U;  2FMJ A;  3TK9 A;  1G3C A;  1YPJ H;  3H7T A;  1N6Y A;  1O2W A;  2BDH A;  4I8J A;  4CR9 A;  3KNX A;  4X6M A;  3OY6 U;  1H9H E;  1A0J A;  2QXI A;  2FOD A;  2YNB A;  2ZHQ H;  3SUD A;  3BN9 A;  1EPT A;  1Y5U T;  1GJ9 B;  1C5S A;  1A7S A;  2VJ1 A;  5DP4 A;  3ZZ7 A;  1H8E D;  3TK5 A;  4LZ4 B;  1P2N A;  1KTS B;  1P3C A;  4Y8Z A;  1LVO A;  1Z8G A;  4UFF H;  4Y0Z E;  1PPE E;  6CHA C;  3BTM E;  5CMX H;  4MPV A;  1O3L A;  2JDI D;  1ELF A;  3MU4 A;  1MD7 A;  1YLC A;  2PGQ B;  1QCP A;  5EXM A;  1BZX E;  1SLV B;  4BAM B;  2F9O A;  2P3F H;  3UPE A;  1QBN A;  3CEN A;  1SI5 H;  1AUT C;  1UMA H;  2OLG A;  1CU1 A;  2DE8 A;  2C3S A;  1O3C A;  4F49 A;  3SJ8 A;  3FP8 E;  5EOD A;  1SHH B;  2KCA A;  1DX5 M;  1S0Q A;  3SNC A;  3SJK A;  5CHA C;  4KKD A;  1FAX A;  2QF0 A;  5GXP A;  4ZAE A;  3URC A;  3A7X A;  3JZ1 B;  4E7N A;  1NRN H;  3S7K B;  2KFW A;  3RXV A;  1LPK B;  1FQ3 A;  3BEI B;  5EQR A;  4GPG A;  2HPQ H;  1N1L A;  1EPT B;  1VKY A;  2BD5 A;  1F0U A;  1K9O E;  1XKB C;  1ZJK A;  1O5D H;  1HAH H;  2W5E A;  2BLW A;  1DWD H;  5DP9 A;  5AVD A;  2CK3 D;  1BCU H;  4ISL A;  5A09 A;  1Q3X A;  1OPH B;  3F1S B;  1THR H;  1GI1 A;  3RXQ A;  3W94 A;  1ZPC A;  1QJ7 B;  1J14 A;  2ZWL H;  2PV9 B;  5DP3 A;  1ZRK A;  2BZ6 H;  3L33 A;  2H6M A;  4Z6A H;  2GDE H;  4H6S B;  1OWJ A;  1W7X H;  4DY7 B;  1VIT H;  4NSV A;  1W0Y H;  1TX6 A;  3FN8 A;  1TMU H;  4MTB A;  2WYJ A;  2XCF A;  2JH5 D;  3DHK H;  2XC0 A;  3FAN A;  9LPR A;  4HGC A;  1Q31 A;  2BX4 A;  1MTN B;  1CE5 A;  5A2M H;  1TWX B;  2H2Z A;  1WCZ A;  1DDJ A;  1O3K A;  1DWB H;  3PM3 A;  3QO6 A;  2B9L A;  1PPB H;  1CVW H;  3RXC A;  4IBL H;  4U30 A;  2Z7F E;  1UK2 A;  2RA0 A;  3A85 A;  3H5C B;  1BDA A;  4F4O C;  5KEC A;  1L4D A;  1O3E A;  3HAT H;  3P95 A;  2FWW A;  1A3B H;  1O34 A;  3N7E A;  2BDB A;  1HXF H;  2C8X B;  1F0T A;  1LVY A;  3EA9 A;  1HAI H;  2ZC9 H;  1D6W A;  3GY4 A;  1RXP A;  2P8O C;  4O03 A;  2FX6 A;  2GJG A;  4K1E A;  1S6H A;  2H9H A;  2BD2 A;  2NU0 E;  2ODY B;  4ZHM U;  1OXG A;  2TPI Z;  1K1P A;  3RMM H;  4Y71 A;  2ZFT A;  4DT4 A;  2PR3 A;  1NY2 2;  2UUF B;  4CHA C;  2PFE A;  1NU7 B;  1Z1J A;  1GCD A;  3GY8 A;  4FUF A;  4IMZ A;  2HLC A;  2A31 A;  1BRC E;  4I8L A;  1GGD B;  2Z9G A;  1BTH H;  5DO4 H;  2G81 E;  4DII H;  3MQK C;  4CRA A;  2HLD D;  3PRD A;  1FIZ A;  2THF B;  5IK2 D;  2BD9 A;  1GBK A;  2G5N A;  3EA7 A;  1ID5 H;  3UQV A;  3F68 H;  1HFD A;  2A7J A;  3LGW A;  2JH6 D;  2ZNK H;  4XD7 D;  1P09 A;  2R3Y A;  3UOP A;  4WH8 A;  4CR5 A;  3GS9 A;  3DSP A;  2C8Y B;  1LPZ B;  1PQA A;  2FPZ A;  2WPH S;  1K1I A;  1YCP H;  2YMS D;  4Y10 E;  4AB9 A;  4CRE A;  4M7G A;  1OSS A;  1WDI A;  3E8L A;  1MU6 B;  3OU0 A;  4FUB A;  4A1T A;  2O9Q A;  3M36 A;  1TAW A;  4DJZ B;  1FAK H;  1C5M D;  3S9A A;  3ZZD A;  4ABI A;  2OC0 A;  1SOZ A;  1AZZ A;  1BRU P;  3MH4 A;  3MMG A;  2PUX B;  3M7T A;  3TJV A;  2FO9 A;  1XUJ A;  5EXN A;  1TPO A;  2W3K A;  1THS H;  1S6L A;  3UB0 A;  2BLO A;  3PV5 A;  3TNT A;  1YM0 A;  1AVG H;  2FYQ A;  5EGM A;  3SZN A;  1AZ8 A;  2DE9 A;  2HGT H;  4CRG A;  3SQE E;  1J9C H;  1O3B A;  2AMQ A;  3SU5 A;  3RMO H;  1C5V A;  2G55 A;  5AF9 H;  1O2X A;  4FET A;  3OEE D;  2QC2 A;  3K65 B;  4OGX A;  3E1X B;  3HKJ B;  5DPA A;  1GMH G;  2C90 B;  1M9U A;  3SOS A;  1P9U A;  4RKO B;  1ZTL A;  5HIY A;  1GHB G;  5GND A;  1C5W B;  1H8H D;  4JYU H;  2BM2 A;  1GBT A;  2GMT C;  1AND A;  4OS4 A;  3OE7 D;  1GVL A;  2RA3 A;  4X6P A;  1KTT B;  2TIO A;  3RU4 T;  3UNR A;  3SNE A;  2BLV A;  2FP7 B;  3RXF A;  4A6L A;  1OYT H;  2TGP Z;  4DW2 U;  4IGD A;  2VGC B;  4Q7Y A;  3EGK H;  1DSU A;  1MD8 A;  3BEU A;  1HAO H;  2XRC A;  4B2C A;  3UOU A;  1VIT G;  3VXF H;  1AWF H;  1C5P A;  1E1Q D;  1O38 A;  1SBW A;  5E2P A;  3ZYE A;  3H7O A;  6LPR A;  3RXI A;  1AQ7 A;  1KXD A;  5C2Z A;  3OEH D;  1QL8 A;  2XCN A;  1V2J T;  1EAX A;  2NU1 E;  3KYF A;  3T27 A;  4NZL A;  3QDZ B;  1QB9 A;  3MU0 A;  2P94 A;  2BXT H;  1V2M T;  1Y8T A;  2FXR A;  1HRT H;  2GD4 B;  1GHY H;  3ZZB A;  1YLN A;  3RXM A;  5F03 A;  4HG6 A;  3RM2 H;  4JK6 A;  3T28 A;  1L1N A;  5EIY A;  5KGO A;  3S9B A;  2VVC A;  3NZI A;  3ODF A;  3ATK A;  4MLF B;  1BRB E;  4ISN A;  3F3B A;  5EJL A;  3VPK A;  3MO3 A;  1GJC B;  1MAY A;  1EUF A;  1FON A;  1C2F A;  4KTS A;  3ZZC A;  1OWD A;  3E0P B;  2RDL A;  5FPT A;  1DWE H;  2VGC C;  3V7T A;  1YCP K;  4B75 A;  2ODQ A;  3S7H B;  1H8I H;  2B0F A;  3KGP A;  4KTC A;  4WXI A;  1BA8 B;  2ZQ2 A;  4LXB H;  3UUZ A;  1UTM A;  2OUA A;  4A1X A;  4DGJ A;  4M9F A;  7GCH G;  1GL1 A;  3M35 A;  2SNW A;  4MNW A;  3SI4 H;  4YES B;  4FUI A;  4P00 A;  3ZIA D;  1NFW A;  4NA7 A;  2F9V A;  1O33 A;  4BAO B;  5DG6 A;  1ZMN A;  2TBS A;  1OP0 A;  2TGT A;  3NRL A;  4D9R A;  5DP7 A;  3BV9 B;  2M5T A;  3KQB A;  5EQQ A;  3VB5 A;  2ZFP H;  3RXD A;  1OX1 A;  4NFF A;  4NIY A;  2J94 A;  2BX3 A;  2IJD 1;  3LKW A;  3U69 H;  2AIQ A;  1FN6 A;  3MU5 A;  2VIV A;  1WV7 H;  3ZZ6 A;  4Q2K A;  4IMQ A;  8KME 2;  1LTO A;  5L6N H;  2OP9 A;  1LHG H;  3GYM A;  3LH3 A;  1O3D A;  1AFE H;  1NFX A;  2UUK B;  1GG6 C;  1GJ4 H;  4X6O A;  1QBO A;  2A2X H;  1IHT H;  3QX5 H;  1AU8 A;  1GPZ A;  3KYG A;  1SGI B;  3T62 A;  2BQ7 B;  1UTN A;  1QL7 A;  3NK8 A;  3UR6 A;  2IN2 A;  3TGK E;  2ZGH A;  2A0Q B;  3UQO A;  2FDA A;  9EST A;  1QUR H;  2BYA X;  4NG9 H;  5EXL A;  1UVT H;  4ABJ A;  2ANY A;  1V2V T;  3ZZ3 A;  1QB6 A;  3GY7 A;  2Y82 A;  1WYK A;  1O3M A;  3LDX H;  1BJV A;  4NWL A;  1GMD G;  1SFQ B;  1SGP E;  4RT1 A;  5DSF A;  1GHB F;  4OS7 A;  5PTP A;  4JZI A;  4O3U A;  1W14 U;  5K0H A;  3ZZ4 A;  2PGB B;  1QJ6 B;  4Y79 A;  1YP9 A;  1SLX B;  1MCV A;  1O3J A;  5FCK A;  1YC0 A;  2VIP A;  1C5Y B;  3F6U H;  1V2P T;  3SJO A;  3RU4 E;  3NCL A;  1SQO A;  2GVF A;  5E0G A;  1RFN A;  3M3V A;  4MPW A;  1RIW B;  5DGJ A;  3ZVF A;  1O5C B;  2ZG0 H;  2C93 B;  2C8W B;  2ZGB H;  4UE7 H;  1HGT H;  2RDE A;  3A84 A;  1V2U T;  3N99 A;  3PTN A;  4ZRO A;  3SNA A;  4O3T A;  3Q3Y A;  1T31 A;  1QNJ A;  3ATI A;  1JMO H;  4I31 A;  1VIT F;  1DVA H;  3DFL A;  3MU8 A;  1UO6 A;  4JCN A;  1C2L A;  3ZZA A;  5C3N A;  3U8O H;  2B8O H;  1ELC A;  2V7Q D;  2BQW B;  3F0P A;  4AX9 H;  4YLQ H;  2LEL A;  1A61 H;  1NC6 A;  1ETR H;  1W0J D;  1HCG A;  8GCH F;  1COW D;  1MTU A;  2PHB A;  1Y3X A;  2J9N A;  4BAK B;  4BAN B;  4CRF A;  1DIC A;  3DFJ A;  4A92 A;  1H4W A;  4NA9 H;  2JKH A;  3LU9 B;  1IQH A;  2F43 B;  3EA8 A;  1XUK A;  1ZPZ A;  1XVO A;  1IQG A;  3BTW E;  1KXE A;  3SV8 A;  3VGC C;  1PJP A;  3V12 A;  5T3H A;  1TOM H;  2R2W U;  2V0B A;  1IQM A;  3M5M A;  1MBQ A;  1NRP H;  2BD4 A;  1YF4 A;  1AFQ B;  1YCP M;  3QZQ A;  1UTK A;  2OQ5 A;  3SI3 H;  3F0O A;  5C5N A;  1OP8 A;  3SJI A;  1O5A B;  1ANC A;  4WJG 2;  1RJX B;  4NGA H;  4X1Q U;  1C1P A;  1TON A;  2FYR A;  3EE7 A;  1NFY A;  3BTQ E;  1ETT H;  2CF8 H;  3M37 A;  1HYL A;  2XNI A;  1NS3 A;  3M3S A;  1O2U A;  3ZVE A;  5A8Y A;  1MU8 B;  1GBH A;  1C2H A;  1W8B H;  1TQ0 B;  2ZHF H;  4MVN A;  7GCH F;  2WV5 A;  2JET C;  1FIW A;  1O5F H;  2A32 A;  3PRO A;  3RM0 H;  4ASH A;  4VGC C;  1HB0 B;  1WAY B;  1NO9 H;  1VZQ H;  1P2Q A;  4Q7X A;  1YWU A;  1D3Q B;  2IPH A;  3KHV A;  5HKK D;  2WZQ A;  1EZX C;  2ZKS A;  5CHB A;  3UTU H;  1TIO A;  2BD7 A;  3ATM A;  5JBC S;  4WMD A;  2ZDK A;  1FI8 A;  2Z9K A;  1TX8 A;  1TOC B;  1EZU C;  4GCH G;  1J16 A;  4XSK U;  4YOI A;  1OS8 A;  1V2K T;  1TNK A;  2O8U A;  1NU9 A;  1YPH C;  4NIV A;  1DS2 E;  1L2E A;  1Z8J B;  1TA6 A;  2VIQ A;  2J95 A;  1SR5 C;  4CRB A;  3MNB A;  4ABB A;  5C0U A;  2GV7 A;  2BQ6 B;  3QN7 A;  2UWL A;  2F4L A;  1AD8 H;  1P11 E;  1ARC A;  1O2T A;  3LGY A;  1TMB H;  2HVY B;  3GYL B;  4AFS A;  2NU3 E;  1QA0 A;  1A2C H;  2Y6T A;  1LKA A;  5FCR A;  1JIM A;  1GVK B;  2VIW A;  2WPJ S;  1GDN A;  1YPL H;  1VGC C;  2V3H H;  3T25 A;  1CT4 E;  4NFE A;  2XYA A;  5BPE A;  1ZSL A;  4I8G A;  4MNY A;  2BOH B;  4CRC A;  1S84 A;  2XTT B;  3RXP A;  2AS9 A;  3ZVB A;  1XM1 A;  1TBR H;  1NN6 A;  3S69 A;  2ZDM A;  2A2Q H;  1GBA A;  2W6I D;  2GCH G;  1KIG H;  2FIR H;  1ZHR A;  2HNT E;  1CA0 C;  2BY9 X;  1HLT H;  2F9N A;  5LPF A;  2J34 A;  1OWK A;  1DPO A;  3MU1 A;  1ETS H;  2OC8 A;  2VID A;  1VR1 H;  1UCY E;  1P2J A;  3PMJ A;  3W1E A;  4UEH H;  2A7C A;  2RCE A;  5C0T A;  3WW7 A;  1GMD F;  2LPR A;  1XUF A;  1O2Q A;  4XBB A;  2ZP0 H;  2BMG B;  1K1J A;  2I6Q A;  2JJ2 D;  4B6E A;  1C5X B;  4INK A;  1E37 B;  5TCA A;  4FUC A;  3SUE A;  2AEI H;  2QXG A;  4ISI H;  3RXT A;  3VXE H;  3QWC H;  1ZGV A;  5C1Y A;  4AN7 A;  3RXU A;  2KZ4 A;  1AVX A;  3SNB A;  4RI0 A;  1F5L A;  5H4I B;  3GCH B;  3M5O A;  3GIS B;  3SGB E;  3TLO A;  1SGC A;  1D9I A;  3F9H A;  3LGV A;  4YTA A;  3V3M A;  1GBC A;  1PFX C;  1O2O A;  2OC1 A;  2FOB A;  1BHX B;  3A87 A;  2WPM S;  1O2Z A;  1QY6 A;  1FY4 A;  4MDS A;  1NTP A;  1L4Z A;  5DP5 A;  3RU4 D;  5FPY A;  1O5E H;  2ZEB A;  1GHX H;  2GT8 A;  2ZU2 A;  5EOK A;  1TPP A;  1Z7K A;  1CSO E;  2A4R A;  5CDF E;  4FUH A;  1JBU H;  2VNT A;  2D26 C;  3KEE A;  2KR7 A;  1GBM A;  1FPC H;  1TGS Z;  2F9P A;  1WTH D;  2CHA C;  2QXH A;  3MYW A;  3SGA E;  1C9T A;  2XXL A;  3A80 A;  3GIC B;  4O9V A;  1FMG A;  1GI6 A;  1GDQ A;  2QF5 A;  2AYW A;  1SQT A;  3OSY A;  2CF9 H;  1NFU A;  4FUJ A;  1WOF A;  1DUA A;  1PYT D;  2NWN A;  2Q6F A;  4RSP A;  4ZUH A;  1IQK A;  3MNS A;  1PYT C;  5AFY H;  1EB1 H;  1MQ5 A;  5A0A E;  1Y3U A;  3UY9 A;  1Y59 T;  2FS8 A;  1C1W H;  3GCH C;  1AB9 B;  2R0L A;  3VB4 A;  1PPC E; 
#chains in the Genus database with same CATH homology
 2RFK C;  2EY4 C;  3UAI C;  2EQN A;  2HVY B;  2V3M A;  3U28 C;  3MQK C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...