2HVYB

Crystal structure of an h/aca box rnp from pyrococcus furiosus
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
74
structure length
74
Chain Sequence
MKRLGKVLHYAKQGFLIVRTNWVPSLNDRVVDKRLQFVGIVKDVFGPVKMPYVAIKPKVSNPEIYVGEVLYVDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H/ACA RNA
publication title Crystal structure of an H/ACA box ribonucleoprotein particle
pubmed doi rcsb
source organism Pyrococcus furiosus
molecule tags Isomerase/biosynthetic protein/rna
total genus 12
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF04410 Gar1 Gar1/Naf1 RNA binding region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.230 Mainly Beta Beta Barrel Thrombin, subunit H Probable tRNA pseudouridine synthase domain 2hvyB00
2RFKC 3MQKC 3U28C 3UAIC 2HVYB 2V3MA 2EY4C 2EQNA
chains in the Genus database with same CATH superfamily
3ZVCA 2SGQE 5LPRA 5EU8A 1BBRK 1YPLH 1O2NA 3RU4T 1O3IA 5JYIA 4D76A 3BTTE 1GDUA 1IQMA 1QB6A 3Q3KA 2FYQA 4NG9H 1T4VH 1GBLA 1G3DA 1J8AA 2WINI 4X8SH 2C8ZB 3R0FA 1EOLA 2VIDA 1SGDE 3RXLA 2Y81A 1GMCG 4XFQA 1UTJA 1IQNA 1OSSA 3BN9A 2PUXB 1JIRA 2JKHA 1MABB 1NU7B 1MZDA 4I8JA 1TAWA 4OS5A 3SJ9A 2Z9JA 1AU8A 1MBQA 1GI0A 1ELFA 5ESBA 1J16A 2PKAB 5EODA 4Z0KA 2TIOA 2SNWA 2THFB 4FUIA 3ZYEA 1O33A 3TNTA 1E79D 3AVZA 2G81E 2Y5FA 2KCPA 3GICB 1L1NA 2GCHG 2IJOB 3ZV9A 2BD3A 1ZHPA 4H6TA 1MU6B 3ESTA 1HGTH 2QY0B 2W26A 1MU8B 4B2BA 1ZPCA 1ARCA 1G2LA 3DFLA 4P00A 1AI8H 4NIYA 1O5GH 1C5MD 1E37B 2JETC 1QRWA 1BRAA 1LVMA 1TYNA 4UDWH 1PQ5A 5BRRE 2P94A 1H4WA 1GCTC 2WYJA 4ACBA 2CHAC 1AQ7A 1OX1A 1WTGH 3SUEA 4CHAC 3UQVA 5I25A 2RFKC 1QHRB 3ZIAD 4O03A 2A5KA 1GI9B 5JDUB 3E6PH 1O5AB 3RXSA 3KQ5A 2P59A 3M36A 1DWEH 3SU1A 2J38A 4Y7AA 4HI3A 3OEHD 5ESTE 1BRUP 2ZFRH 1DY9A 1O2GH 1XUIA 5LGOA 4BAHB 2ZCKP 3V0XA 4TY7A 3BTHE 2PR3A 1BMLA 5EXLA 2R2MB 4NIXA 1YPKH 3W95A 1FV9A 3MU8A 1HDTH 1YLCA 2O8UA 2Y5HA 1VITH 1UTNA 4R8TB 1C5RA 1FX0B 1EZXC 3BTEE 3A8BA 3U8OH 4D8NA 1U6QA 1E38B 3FANA 4CR9A 1Q2WA 2JDID 5EJ1A 2IPQX 4ZMAH 5I46H 3TGKE 1SI5H 1NBMD 1DWBH 2A7HA 1AFQC 1P01A 3HKIB 1UTKA 2W7UA 2YNBA 1AO5A 1OS8A 3DD2H 2OP9A 3SU2A 1L1GA 3SU5A 5JBAS 1JRTA 2P8OC 3SHCH 4XOJA 2L74A 5LPFA 1IQFA 3LC3A 3M35A 3A8AA 5AFYH 5C1UA 1MTVA 2BD9A 1TMTH 5JPMH 1A7SA 2R3YA 1YPHC 2GGVB 2PFEA 4CH2B 2UUYA 1JRSA 1V6DA 4IMZA 3E8LA 4MLFB 1TIOA 1C5LH 1OP0A 3MI4A 5B6OA 2W3IA 1PYTC 4ZHLU 1P8VC 1OWDA 1SL3A 1UO6A 1Y5UT 2GX4A 1CBWC 2CV3A 2ESTE 3PTBA 4ESTE 3SO3A 2Z9KA 1NS3A 1O3FA 1ZMNA 1FI8A 4ABFA 1E35B 1GGDB 1P3EA 1BJUA 1TONA 1SLVB 2AEIH 4ISIH 3VXFH 1EP5A 4NSVA 5EW2H 2P93A 5GWZA 4ABIA 1AVWA 1TGBA 3EGKH 1FXYA 4I8LA 3RU4D 1DDJA 3TH3H 1HAHH 2DUCA 2G55A 2J98A 2QCYA 2ZFTA 4X2YA 1GBAA 1LPKB 3NZIA 1ZPBA 1GPZA 3FZDA 5EJLA 3PV4A 5A2MH 4I31A 3AW0A 3Q76A 3UB0A 2OBOA 2ZCHP 5FHTA 3P92A 4NWLA 1CA0B 1EB1H 2ZDAH 4X8UH 5BPEA 1V2QT 4X6MA 1QFKH 5C0UA 4Y11E 1ZPZA 4IN2A 4K1EA 3LPRA 4E05H 1HJ8A 4KKDA 1F2SE 2FM2A 2IJD1 2QV1A 5FPSA 2FX6A 1O2YA 1DUAA 2F3CE 1SOZA 4HGCA 3SU0A 1XMNB 4K2YA 4TPIZ 1C1VH 2Y6TA 6CHAC 4A1VA 5FPYA 2F4LA 5CMXH 1UK4A 2KAIA 3FVFB 2FEQH 4WMDA 3RXCA 1V2MT 2UWPA 3TH2H 4BAOB 4TY6A 2WPLS 2PW8H 1LVBA 3OSYA 1F5KU 3LGYA 2ZECA 1UW7A 4GLYA 1WQSA 1C5XB 3RMNH 1OYQA 1XUHA 1FN8A 2XWAA 3MO9A 4OS6A 2HNTF 1K28D 1V2JT 2ZPRA 7KMEH 2SGFE 4JYUH 1J9CH 1PPZA 4B74A 1MMJN 3QDZB 1E1RD 3BEIB 2I6QA 3GYLB 2A7JA 1UCYE 3GOVB 1QL9A 3SGAE 1KIGH 1C1UH 1TLDA 2ANMH 1LHFH 3ZZBA 1G30B 2Q6DA 3PROA 4RT1A 2V3OH 3D23A 2G00A 3VPKA 1GMCF 3VB6A 3LIWA 1O3KA 1A4WH 4O3TA 2XTTB 2WZQA 1K2I1 2SNVA 1AWHB 1O3MA 3A84A 3RM2H 2K0QA 1TX8A 1W7GH 2J92A 1SQAA 1GHAG 4FUHA 4ABHA 1D4PB 1GJ5H 2G5VA 3M7UA 4X2WA 2BQWB 4XSKU 5PTPA 1ANDA 2VIQA 1P2IA 2GCHF 1HJAB 3PO1B 4JCNA 3MFJA 1EP6A 2C93B 3E16B 2H1UA 5L6NH 1SGYE 1EXFA 2GT7A 1E36B 2HOBA 4Y10E 1YBWA 2VVVA 1OXGA 3PM3A 3MYWA 3BSQA 4F55A 2J95A 2STBE 4JK6A 4Y76A 1UVTH 1O3AA 1P12E 3C1KA 2R9PA 4I86A 1OPHB 1O5EH 1AMHA 1GBHA 3GCNA 1K1MA 2GDDA 1GWAA 1GMHF 1AWFH 1TPSA 1EAUA 1EPTB 2ZNKH 2B8OH 2VB0A 1PFXC 1WOFA 1BCUH 2ANKH 2JH5D 5IK2D 1C9TA 4BTIB 1C1MA 1W2KH 2L6OA 2ZKSA 5DO4H 3PRDA 4JZEH 1C5QA 3TNSA 2ZHDA 2UWLA 3FP8E 4ZKOU 3FP7E 3VB4A 1G3CA 1P57B 2SGAA 3TJVA 3IWMA 1O5DH 1UTQA 1YKTA 1KXBA 2AS9A 4SGBE 2JH0D 5DP7A 5L30H 2A0QB 2WUBA 3F6UH 1XUJA 3BF6H 1TA6A 4X8VH 2Z9IA 3ZVDA 4Z6AH 3P8NA 5H4IB 2VH6A 3ZZ9A 2A32A 1J17T 1P2NA 3RXRA 3T28A 1B0EA 3RXHA 5HXFA 4WWYA 1C2FA 3ZV8A 3WWFA 4NGAH 4PROA 4U30A 3P70B 4OS7A 1SLUB 1W0KD 3MU0A 1E34B 1ZSKA 1NZQH 5TJXA 2Z94A 1TB6H 3DA9B 1C4Y2 3U28C 2XBYA 4YLQH 1Y5AT 8ESTE 3LOXA 3TPIZ 1GJBB 1SGQE 3ATIA 3GCOA 2CJIA 3BTDE 5AVDA 4F49A 5C67A 1ETTH 2GJGA 3URDA 3AK5A 1DXWA 3BV9B 3JZ2B 1G2MA 2PSXA 2JIZD 1HB0B 3O8CA 3A7ZA 2G51A 1KXEA 2H9HA 4FUFA 3SUFA 2AIQA 3A7XA 2GCTB 1Y3UA 3F0OA 4WF8A 1TGNA 4Y0ZE 2AHME 4CRCA 4UFEH 2OC7A 1BMFD 3VB7A 1O2JA 3N7OA 1AZZA 2ILNA 1LHCH 4GUXA 2ZP0H 3ENSB 1AFQB 1NPMA 2EC9H 4LZ1H 1TNJA 3TLOA 1NFYA 1UTMA 2WPHS 3SNBA 5CDFE 1O3CA 1W8BH 2A2QH 5T3HA 3H7OA 4B6EA 3A85A 2ZHWH 2WPMS 4QT8C 2HRVA 3AAVA 3UFAA 2G8TA 2OXSA 4A7IB 2ODPA 1LVOA 1P09A 1GI1A 5IYTA 2C8WB 4DURA 4XBBA 2TGTA 1ZLRA 3GY2A 4K3JA 2EI6A 2TGDA 1SGFA 4NSYA 4Y79A 1O2XA 3U69H 1S84A 1TBRH 4ABBA 1GHBG 1YPEH 3ZZ6A 1Q31A 2SGPE 3EDXB 1GL1A 1OWEA 1WTHD 4Y6DA 1MTUA 1A5IA 5DP4A 1A61H 2VVUA 1YPJH 1LO6A 3NRLA 1MTNC 1H9IE 4I8KA 3RC4A 5CHAC 4FU8A 4MPUA 1HAVA 3OFND 3T26A 6ESTA 1GVLA 3SI3H 3TJOA 2ZI2H 2SGDE 2WPJS 2XW9A 2G52A 2R3UA 3I77A 2OCVB 3Q3YA 3ZZDA 5EXMA 3OE7D 3ZVGA 3P8GA 1JOUB 2BY6X 3MU5A 2QIQA 1NU9A 2GZ9A 3M5LA 1ELAA 1AY6H 4ABDA 5GDSH 1YY3A 1GJ8B 2Y7ZA 1V2VT 1THSH 1BTWA 1GMDG 2NU1E 5K0HA 1LHGH 3RXGA 2D8WA 3MOCA 4CBNA 1T8MA 2QC2A 1LKBA 1NTPA 3PTNA 1FY4A 4K5ZA 3PRBA 3E3TA 1NY22 4X6NA 1CHOF 4K69A 4TWYA 1IQJA 1HAYB 4FETA 1UHBA 2H6MA 4ISNA 1C2KA 3LH1A 1C1SA 1BMNH 2FTMA 4AOQA 2VIWA 1GHAF 1KXAA 2FXRA 1HBTH 4FUBA 3DUXH 1ETRH 4I32A 1OWHA 1QBOA 1W11U 3FN8A 3LDXH 6LPRA 3SU3A 2CK3D 1EB2A 1ZMJA 4AG1A 2FP7B 3ATWA 1FDPA 2F91A 2V3MA 1C5OH 3UOUA 4X1RU 2HLDD 1Z1JA 3A80A 3AASA 5DGJA 3SJ8A 2GTBA 1O35A 3CS0A 1UTPA 3QO6A 3RLYH 1C9PA 1MD7A 2OQUA 3G01A 4WMEA 2Z6BD 3A87A 1BB0B 1SGFG 2BD8A 1VCWA 2YNAA 1O2ZA 1SSXA 1BUIA 3MNBA 3TH4H 4DCDA 1FPHH 7GCHG 3PV2A 4H4FA 3STJA 2PP6A 1TPPA 1ESAA 4I8HA 3TK5A 2ZIQH 3BIUH 1KXDA 1RIWC 4UFDH 1QR3E 2A31A 3BTFE 3HK6B 1WU1A 2XNDD 2AFQB 4P02A 3RUOA 5GCHF 8GCHF 3A7VA 3F3BA 4X1QU 1A3BH 1WUNH 2O8WA 2WHXA 1F5RA 1KDQA 1O2SA 1SLWB 2YMSD 3CENA 2PWXA 3BTQE 2ALPA 4YTAA 3SJIA 2ZGCA 1L4DA 2UWOA 5HIZA 1YCPK 1GJCB 3KN2A 1EX3A 5HMAA 4Y71A 2V7QD 1P03A 1QRZA 3LKWA 1ZHMA 1GG6C 4Z1MD 3JZ1B 1ACBE 1ID5H 1AKSA 3IITA 2XC0A 2ZWLH 2ZPSA 3UREA 4X0WU 1TQ0B 4A1TA 1AB9B 1ESTA 2PKSC 3QX5H 3A83A 4TYDA 1THPB 1QBVH 3KNXA 3H7TA 4DIHH 2BY5X 2IOTA 1QJ7B 1BJVA 1ELCA 2ZQ2A 4FUEA 1TRYA 2F9BH 4JYTA 2ULLA 2W6ID 4K8YA 1DM4B 3S9AA 2AGEX 3EA9A 3FO8D 3QWCH 1SGRE 1GI5A 1H8ED 4I7YH 1NESE 4WXVA 4MPWA 1A0LA 1HAPH 4NZQA 1O39A 1SHHB 1O3GA 3O8RA 5JB8S 2CF8H 4D9QA 5ABWA 5J4QA 1TRMA 1C1OA 1GHVH 1LHEH 1T8OA 2D2DA 3RXKA 1BTHH 4JZDH 1GBBA 5JB9S 3SNDA 1VITF 1K1LA 2XBWA 2Z3DA 2ZPQA 2GZ7A 1CT4E 3DHKH 3RXUA 1L0ZA 5A0CA 1F92A 1PQ7A 1UK2A 2A4QA 1S81A 2R0KA 4Q63A 2I6SA 2BY9X 1MKWK 2V35A 1BRCE 4ZROA 2ZU4A 4FU9A 3UWIA 2F43B 2BZ6H 1S83A 2PHBA 1TGCA 2BLVA 4Q80A 4UE7H 3OTJE 4TWWA 1VJAU 2P3TB 3BG4B 1GJ9B 2YMSB 4XRNA 1YCPH 1LDTT 2VH0A 3RXVA 3S0NA 5EPNA 3UNQA 5DP8A 2A1DB 2EQNA 1O2IA 3S69A 1GHBF 1AN1E 4YZUA 5L2ZH 2V6NA 1RRKA 4DW2U 2ZA5A 5HIYA 1TALA 2OLGA 4J2YB 1GI7B 1BBRH 1KTSB 5AF9H 3EQ0H 1ZOMA 2A4OA 3SV9A 1XKBC 1CGJE 4VGCC 2W5EA 5EQQA 2OQ5A 4KELA 4AZ2B 2GV7A 1E1QD 4FXGH 1C2DA 1P2MA 4MNVA 1CA8B 4D7FA 2BXTH 4XBCA 1SHYA 3RXQA 2F9OA 4TSFD 3KF2A 3ZZAA 1GMDF 3UWJH 1NM6A 2ALVA 3MNXA 1C5YB 3U8RH 3QUMP 4ISLA 2XXLA 1K1NA 1UVPA 2XOKD 4NFEA 3ZZ7A 1ELEE 5E2PA 1QB1A 2PLXA 3OEED 1XUKA 9LPRA 3F2GA 1S6FA 3NXPA 1N8OC 2OD3B 1MAYA 4YT7H 3F2HA 1DVAH 1ELVA 4BANB 1OWJA 2KCYA 2ZGHA 4JZIA 4Y8ZA 2HVXA 2Z9LA 5CE1A 1KLJH 1MKWH 1O5FH 1MCTA 2KX4A 2V0BA 1GBFA 2FPZA 3OYPA 2J2UA 2M5TA 4YOGA 1FAKH 3VGCC 9ESTA 3LT3A 3O8DA 2AMPA 1QBNA 3SORA 1G37A 4O97A 2VINA 1GJ7B 1GL0E 1Z6JH 2BD7A 3BIVH 1F0SA 1YPHE 2BX4A 3A89A 3KHVA 4KP0A 3LC5A 1D3QB 1EJAA 4RI0A 2KM0A 2VWMA 1HV7A 3TIUA 5JBCS 1YP9A 2CMYA 2FS9A 4XE4A 1WYKA 3SV7A 4ASUD 3E0NB 1K1OA 2BDAA 2VWLA 2QXGA 1TWXB 2ZU5A 3SV8A 2NU0E 3K2UA 2J5UA 4INHA 7GCHF 2ZGXH 3NWUA 4FVBA 1NRQH 3L33A 4E06H 4E7RG 3UNSA 1C4U2 1SKYE 2HALA 3RXFA 1ZSLA 5FBIA 1J14A 3GCHC 1TNLA 4A92A 1O36A 1Y3VA 2ZG0H 5A09A 2HWLB 1ZZZA 4AB8A 4YM9A 4ABJA 1SG8B 1ETSH 3I29A 2F9NA 5C1XA 1O3EA 4BXWA 2Z9GA 4WH6A 5FCKA 2WV9A 1SR5C 2PUQH 2QYIA 4JZFH 3QTVH 2KR7A 1HIAB 2ZTXA 1DT2A 2BQ7B 4H6SB 2ZTYA 3ODFA 6GCHG 5E0HA 2WSSD 4LXBH 4GHTA 4ACAA 3U8TH 4M9FA 1XM1A 3EAJA 2WPIS 1COWD 3UQOA 1SGTA 2P95A 4Y7BA 1SGIB 2XCNA 1FLEE 1T4UH 1GVKB 2FOBA 3CNRA 4B6FA 1ZSJA 3OY5U 4DGJA 3D62A 1GJDB 2D1JA 3SOSA 4A5TS 4ZAEA 3SBKA 1MCVA 2VGCB 1VR1H 4OM9A 3F1SB 2BD4A 1IQIA 1C5ZB 1TBZH 4AC9A 1YWUA 4U01A 3BTWE 1W13U 1H9LB 4NCYA 1WXRA 4AGJA 3RXPA 2Q6GA 3UOPA 1UMAH 1VGCB 1FQ3A 5G4BA 5FAHA 1EATA 4BTUB 5DN6D 2ZDNA 4Q7YA 4R0IA 3FOAA 3PYHA 1OKXA 3PMJA 1TGSZ 1O2HA 1O32A 2TGPZ 5EPYA 5C20A 1SQRA 2J4IA 2A5AA 1HYLA 1D9IA 3SW2B 1ELDE 2Q1JA 2F83A 1IQHA 2RG3A 3U1JB 1MQ6A 2NU4E 4U32A 4O3UA 2FOEA 3NPSA 1TX7A 4TT3D 1W0YH 3OTPA 1GBCA 3M37A 3C27B 2FI5E 1O31A 1QA7A 1ELBA 2BVXH 2FOGA 2ZFFH 2GD4B 3MU4A 1EUFA 2FTLE 2A45B 4BAMB 3UAIC 2PKAA 2FI3E 2QF4A 2ZGJA 4K1SA 1GI2A 3SUGA 1C2LA 5FXLA 3SYJA 1WV7H 3MO6A 1AD8H 3LGIA 4CRDA 4WJG2 1B0FA 1O3BA 2ZEBA 1ZRBA 3ZVAA 1S0QA 1DX5M 3ELAH 1NFWA 1C4V2 4DJZB 5T6GA 4ABAA 1P2OA 2GT8A 4NWKA 1THRH 4UONA 4WY3A 4YLUA 1FY3A 1HCGA 3UPEA 3RXBA 2ANWA 1KLTA 2K8IA 1PYTD 4WMFA 1ABJH 2V3HH 3RXTA 1W0ZU 5C17A 1UVSH 4MDSA 5T1VA 5A8XA 2QE7D 3BEFB 3CS7A 3S7HB 1F0TA 4SGAE 1CHGA 1TABE 2CN0H 1EASA 2JETB 3HATH 2TGAA 1ZGIA 3F9HA 1GBDA 2FLBH 4E7NA 4RN6A 5LPEA 4AN7A 4YOIA 5HYOA 1BBRE 1GCTB 1YPGH 1QY6A 2CHAB 2Z3CA 1OHHD 1SFIA 4CHAB 3QK1A 3TJUA 4X2VA 4WXIA 4NFFA 1ANBA 3GY7A 1A2CH 2QF5A 2HGTH 1IHTH 2OC8A 1AE5A 2LP6A 4OS1A 1ANEA 2BLOA 3SZEA 2FZZA 3MH4A 1UVUH 1QL8A 3ATKA 5C5NA 5JBBS 2VWNA 3E90B 3AAUA 4AFSA 3SGQE 3BTME 2H5CA 4O9VA 4ASHA 1SPJA 1HXFH 4YXWD 5LH8A 1Q3XA 3PLPA 2BLWA 3M3TA 3W94A 4CRBA 5EXNA 1HFDA 5FL7D 2J34A 2IN2A 4IGDA 1C5WB 1RTLA 3M3VA 2PGBB 2Y7XA 1LPGB 3DCLA 4K60A 3UIRA 1SGEE 3S9BA 1TFXA 2AMDA 1H8HD 2ODQA 2BM2A 1GBJA 3FP6E 3V3MA 1ORFA 2FOHA 1GJ4H 3QGJA 4CR5A 5CHBA 1YM0A 2BDIA 2P8OB 3RC5A 1JBUH 3SQEE 5FPTA 1O3LA 1TOCB 3RMMH 1TNKA 1S6HA 1N8OB 1IOEA 2NWNA 2P3UB 1SGCA 1C5NH 2C8YB 2ZHQH 1FIWA 1O37A 1BDAA 3L6PA 1FY1A 5B6LA 1P9UA 4IS5A 1SFQB 2LELA 3UR9A 3A7TA 2R0LA 2HPPH 1CBWB 1TPOA 2LPRA 1A46H 3ZYDA 4BAKB 1HPGA 4UFFH 1V2OT 2FOMB 1BTUA 3SJOA 4F4OC 1C5UA 1WAYB 1ZTJA 2FS8A 2ZFPH 2ZDMA 6GCHF 4GCHG 1NFUA 1LCYA 2P16A 3SGBE 2ZC9H 4IC6A 3A86A 5KEDA 4ISOA 3B9FH 3RXEA 2RA0A 4KTUA 2WV5A 5T6FA 2W3KA 1LTOA 2ZFQH 1O2PA 2H9TH 4TPYA 3IG6B 2VBCA 1RTFB 4HFPB 1QJ6B 1C5SA 1DSTA 2VWOA 3E1XB 1W10U 2VIPA 4AFQA 1DLKB 4IW4E 3M3SA 4AGKA 5F8TA 1PQ8A 2OUAA 1JXPA 2C4FH 5A8YA 4ZXYH 1C1NA 1GGDC 3ZZ4A 3QZRA 1FJSA 4DT4A 1DXPA 4RKOB 5C3NA 5E8EH 1QQ4A 2Z7FE 3LU9B 4JK5A 3RXIA 1OWIA 3U1IB 1AGJA 3GISB 4BAQB 1MKXK 2AYWA 2BD2A 2ODYB 4AFUA 2C3SA 3NKKA 6CHAB 4F48B 1UCYK 1O2RA 4AORA 2G4UA 1GBEA 1ZJDA 3MH5A 1CT0E 4UEHH 2JJ2D 2OBQA 1P2KA 3QGNB 3S7KB 1CA0C 1KXCA 1DICA 1ARBA 1EAWA 1H9HE 1QURH 5DPAA 2J98B 4UD9H 2AH4X 5TCCA 1FY8E 2QF0A 1YLNA 3SV2H 3UNRA 1C1RA 1ANCA 4DT7B 3A8CA 1PPFE 1SC8U 1SB1H 2EI7A 1FY5A 1S82A 1ZMLA 3SN8A 1QGFA 1EZUC 2BY8X 2VJ1A 1N1LA 2QF3A 3P8FA 2BOKA 1Z7KA 4CRFA 3STIA 1FIZA 1RXPA 2VU8E 2ZO3H 1GI3A 3RXMA 1DY8A 4U2WA 3SI4H 2RDEA 1GBIA 1P02A 3QZQA 3WY8A 5GXPA 1G3EA 2BHGA 3MWIU 3RP2A 2NU2E 2BVSH 4MTBA 3RXAA 4GSOA 1TMBH 4RT0A 2J9NA 3M61U 2KAIB 2QXIA 3E0PB 5F8ZA 3SQHE 1A3EH 4FVDA 3VB5A 3ZZCA 1AVXA 1RJXB 5DSFA 1TA2A 1TQ7B 3BTGE 5F8XA 3ODDA 2HNTC 4ISHH 4Y8XA 1D6WA 2XNIA 3QN7A 5AHGH 1N6XA 4MPXA 3K6ZA 1W3CA 1BMAA 4INKA 2O8TA 1NRPH 7ESTE 5F03A 1MKXH 2F9PA 1SVPA 1DFPA 1EPTA 5EW1H 1MTSA 4FUDA 3MO3A 1PPEE 3GS9A 1KY9A 5DP5A 4X1PU 2A4RA 1FMGA 5C0TA 1XVMA 1PPBH 4IN1A 1BITA 5HKKD 5GIBA 1Z1IA 1W14U 1HJAC 3PO1C 1MAXA 2BD5A 1IAUA 2F9VA 5J4SA 2BDYA 1O38A 4XD7D 3LGUA 1MZAA 2WYGA 1O2VA 4YOJA 4B76A 1BTPA 2DE9A 4Q2KA 4RSPA 2OK5A 2GMTC 3M5NA 1A0HB 3KYGA 4AX9H 2ZU2A 2RCEA 2DE8A 1BTXA 3URCA 2G5NA 2OINA 2ZZUH 1HAOH 3TK6A 5AFZH 1EPTC 1VJ9U 3RDZA 1VCQA 3LJJA 3TGJE 3F9EA 4IBLH 1DOJA 4NIVA 1YGCH 4DOQA 3VB3A 1YYY1 1JWTA 1V2TT 1NC6A 1HXEH 3HKJB 3EA8A 3PMHB 2TPIZ 4BOHA 1ABIH 3ATLA 3K6YA 1BA8B 3MH6A 4GAWA 1C5VA 2ZHFH 3N7DA 1EZSC 1Y3YA 1NFXA 1AUJA 3NUMA 1GDNA 2AIPA 1XX9A 1FPCH 5EQRA 1K1JA 1GDQA 2GZ8A 2BOHB 4H42U 1BT7A 1CT2E 4M7GA 1ELGA 3P95A 4K8BA 1C1QA 1ZGVA 2UUKB 2Y82A 1FZZA 1MTWA 3MTYA 4LOYH 1Z8IB 4CRAA 2HVYB 3UY9A 1INCA 1MD8A 1SQOA 1V2KT 3CP7A 4I8GA 4J1YA 5C5OA 3LGVA 4I33A 3OU0A 1AVGH 1JIMA 1J15A 2BB4A 4GCHF 1V2UT 3AW1A 5DK1A 1C2JA 1YLDA 4MNYA 1MQ5A 1V2ST 3QLPH 1GMHG 1AFEH 3PWCA 1JMOH 1T8NA 3EE0B 1C2MA 3NK8A 3ZVBA 2W6JD 1DWDH 3WWBA 4JZ1A 1O2OA 4ZKSU 1XKAC 1TX6A 2C90B 2FODA 2M2AA 1BRBE 1NN6A 1GBKA 3U98H 5C1YA 5DKMA 1BHXF 1DS2E 7LPRA 2JJ1D 1O0DH 1P10A 1BTZA 2B0FA 4MQAA 5DP6A 3GY3A 3SNCA 1HAIH 1L2EA 3V13A 3RMLH 3E91A 3A7WA 1X7AC 1F0UA 2R2WU 1WBGB 1BHXB 1K21H 1G32B 3UR6A 5GPIB 1XXFA 1O3DA 2FO9A 1TNIA 2GCTC 1CE5A 4BTTB 3P17H 5E2OA 5FX5A 4X6PA 1Z6EA 5KECA 1BIOA 1KLIH 1PJPA 5L2YH 2Z3EA 3LH3A 1SBWA 1K22H 2QXJA 1ZJKA 1MH0A 4XDEA 2XBXA 2XC5A 1GJ6A 1W0JD 2XCFA 5E0JA 4Q4LA 2ZGBH 4OGXA 5FCRA 2QA9E 3BG8A 1DPOA 2B7DH 1F5LA 1MTNB 4DY7B 1TNHA 5EQSA 1TBQH 2BXUH 5CHAB 3Q77A 2WPKS 2BYAX 5E0GA 1C2HA 3A7YA 1O3HA 3DSPA 3T25A 4GPGA 4FU7A 4NIWA 3HK3B 5ETXA 3ZZ8A 1GVZA 3RMOH 2XRCA 1TNGA 2FYRA 1OP8A 1ZR0A 5GNDA 1SQTA 2TRMA 5FX6A 3DSOA 3R3GB 1RD3B 2FOFA 2FWWA 1NRSH 4UFGH 1DANH 4ZHMU 3ATMA 3KQCA 1P11E 3LGWA 1WCZA 1OWKA 3UUZA 2GVFA 4HG6A 1T8LA 4ZUHA 2XYAA 1RFNA 1S5SA 5EOKA 2C8XB 1C5PA 4ZXXH 3V7TA 1VCPA 3RXDA 1TPAE 2PTCE 4YO9A 1HNEE 1MBMA 2WPDD 1F0RA 1A1RA 1C2IA 1QA0A 4B73A 1HAVB 2VIVA 5EJZA 1DE7H 1OP2A 3F68H 2F9UA 1ELTA 5F6MA 1P9SA 4LK4A 1Y5BT 1CSOE 1W12U 1GBTA 1O3PB 1S85A 5HGGA 1O34A 1ZRKA 2QAAA 3OAAD 1KMHB 1O2WA 4GVUA 3VXEH 1DLEA 4XBDA 4BXSA 1P0SH 1O3JA 4ZHAA 3S9CA 1AUTC 1BMMH 2XWBI 3VFEA 5HM2A 1VZQH 4WVPE 2Q6FA 3GDUA 2UUJB 2FMJA 4Q7ZA 3M7QA 1VKYA 3GDVA 1HUTH 1O5CB 5T6DA 1V2LT 4A1XA 3O8BA 1KSNA 1UHBB 2STAE 3SJKA 1Y3WA 1GCDA 1DUEA 1SLXB 3GY4A 3PMBB 1TE0A 4JMYA 1P2QA 3KYFA 2GKVE 1UVOA 1RIWB 2AGIX 1CU1A 2CXVA 3PLBA 1D3PB 1EAIA 2AGGX 1G9IE 5EIYA 1DWCH 4OGYA 4B71A 1L1JA 1NRNH 1K1IA 4GHQA 1L4ZA 3MMGA 3PB1E 3KQBA 1IHSH 2BZAA 1NROH 3TGIE 4MNWA 3H5CB 3N99A 1PQAA 4BNRA 1EFRD 1EZQA 1V2PT 3K65B 1QB9A 4B1TA 1CHOG 1GG6B 2HLCA 2WV4A 2RA3A 3LGTA 2J97A 2HPQH 3MNSA 1PPGE 1QTFA 4AFZA 2ZCLP 2PKSB 3P6ZB 2BDCA 2VVCA 2G4TA 3D65E 1OYTH 1YPMH 1ZTKA 1Z8RA 1CVWH 3B23B 2ZDVH 1P06A 3FFGA 4B2AA 2JH6D 1C5TA 1Z8GA 4MVNA 1QCPA 1ZHRA 4WH8A 1CGHA 1A5HA 3T27A 1AE8H 1N6YA 3TJNA 3EYDA 1ZYOA 4DG4A 1QNJA 8LPRA 1UTOA 2WUCA 2FX4A 2EA3A 2Y80A 4KTCA 1KDQB 3OY6U 2GMTB 1KYNA 1O3NA 5C2ZA 2W7SA 1IQLA 1AB9C 1SMFE 1FNIA 3DSGA 1D3DB 1EJMA 2XBVA 3QTOH 1F7ZA 4ABGA 2BLQA 2PV9B 1P05A 2EI8A 3PMAB 4ZH8A 1AKSB 3TITA 3GCTG 1PPHE 4FOUC 3TVJB 1WDIA 4LZ4B 1C1PA 1NO9H 1GJAB 4CBOA 1GHZA 3FAOA 1O2QA 1T31A 2H9EH 2A7CA 5A0AE 4KTSA 1T32A 1FONA 2ZQ1A 3RXOA 2QN5T 8GCHG 2ZFSA 5GCHG 2FESH 4AYVB 3ZZ3A 3DT0H 1WSSH 1GHYH 1CO7E 4X8TH 5SGAE 2KCOA 4X6OA 3EE7A 4INLA 5GJ4B 5C94A 4B75A 1YF4A 3ZVFA 4NA9H 3RXJA 3TK9A 1ZTLA 2EY4C 1LKAA 2O9QA 2PTNA 2BMGB 2CGAA 1O2KA 3A82A 4DVAU 3BEUA 3KL6A 3KQEA 2FDAA 2BY7X 1GI6A 3M5MA 3T29A 3VG8A 1TRNA 2GV6A 4VGCB 1YCPM 4MG3A 1S0RA 2BDGA 3MNCA 3BG4C 1CQQA 2YMSC 1LQEA 1H8IH 2O8LA 1Y8TA 3LJOA 1LQDB 1SGNE 1OOKB 3N7EA 3PWBA 3FZZA 3ZVEA 3F2FA 2J94A 4IC5A 3UTUH 1GHXH 1H8DH 1V2WT 2FI4E 1HAGE 5A0BA 2GDEH 3KQDA 3F9FA 3RLWH 1P2JA 1TMUH 1FAXA 3SHAH 3KGPA 4JYVH 1C1TA 2A2XH 1UTLM 1VITG 3F9GA 4ZKRU 4ABEA 5EG4A 1IQKA 3KCGH 1B7XB 2VIOA 1O5BB 2BDHA 1K0HA 1TOMH 5EGMA 3ZZ5A 5A8ZA 5JBTA 2ZDLA 1NRRH 3MH7A 3PLKA 5DP3A 2FLRH 2O8MA 3BTKE 2BVRH 2RDLA 4MNXA 4YT6H 3T62A 3VGCB 1W7XH 4CH8B 1WQVH 2VNTA 1KXFA 1LVYA 1SOTA 4X2XA 1XUGA 2TBSA 1O3OA 1G36A 3GY8A 4B2CA 3SNAA 1YC0A 1FUJA 1IQGA 1LHDH 2UUFB 2P3FH 4K1TA 1V2RT 2NU3E 4D9RA 3P8OA 1A0JA 1O2TA 2FIRH 1GI4A 1RS0A 5DP9A 1FN6A 2FOCA 2SGEE 4Y0YE 1TGTA 4HZHA 3B8JA 4ZCNA 2BX3A 5TCAA 5FBEA 1BOQA 1NT1A 3RC6A 2ZF0H 2ZTZA 1LMWB 1Z8JB 4FUJA 3GDSA 1P3CA 2OTVA 3U9AH 3SNEA 2QGRA 1M9UA 4A6LA 2B9LA 1O2UA 1MUEB 1C1WH 3GCHB 1HLTH 5K7RA 1PPCE 1HAZB 3TU7H 1P04A 1HIAA 5DJ7A 1AHTH 3F0PA 4X1NU 3HPTB 1S6LA 1B5GH 3T5FH 2KFWA 1C2GA 5DG6A 3SZNA 3GY5A 1EJNA 3Q3XA 1ESBA 3SUDA 3MQKC 2H2ZA 3SU4A 4FUCA 3M5OA 3MHWU 2GP9B 1BTYA 3ITIA 3EA7A 1V2NT 2AERH 1DITH 2QXHA 3OX7U 1QRXA 1GI8B 4YESB 5KGOA 3VEQB 1EKBB 1V3XA 1O2LA 4NZLA 2KZ4A 2A5IA 1D3TB 1XXDA 2ZDKA 4MPVA 3SV6A 1K9OE 2PGQB 4RKJB 3RM0H 3NCLA 3V12A 3GYMA 1O2MA 1SGPE 1Y3XA 4KGAA 3A81A 3L3TA 2LNCA 1GHWH 4DIIH 1HRTH 1QQUA 2K1QA 2OC0A 4CRGA 1QZ8A 3DFJA 1UK3A 5HM9A 1LPZB 1QIXB 3KEEA 1EOJA 2AMQA 3M7TA 1Y59T 2XC4A 1KTTB 2ZU1A 2BQ6B 1IQEA 3Q00A 2H5DA 2KCAA 1HJ9A 1UJ1A 3T2NA 1NBME 4X1SU 2BDBA 3H09A 1EAXA 2ZHEH 1CGIE 4NA7A 1RTKA 1E0FD 1AIXH 1T7CA 1A5GH 4OS4A 3HGNA 2YOLA 1C2EA 1QJ1B 5F53A 1G3BA 3K9XB 4AG2A 1XVOA 3GCTF 2D26C 4Q7XA 1HAXB 2VGCC 4THNH 4FUGA 4CREA 2Y5GA 1XUFA 1RGQA 3SU6A 1Z71A 1DSUA 2EEKA 2FOAA 3HGPA 3I78A 1AZ8A 1BZXE 3PV5A 4OS2A 1VGCC 3WW7A 1BQYA 4AYYB 3LONA 4NA8A 1UCYH 4IMQA 3GY6A 1QL7A 2A4GA 1O30A 3FKSD 4Y8YA 2SFAA 3W1EA 1D6RA 2CF9H 4HTCH 1K1PA 2HNTE 2ASUB 1EQ9A 3D49H 1GBMA 2PSYA 4ZKNU 2BTCE 3A88A 4AB9A 3KIDU 2ANYA 2B5TB 2ZU3A 2OC1A 8KME2 4D7GA 3MU1A 2IPHA 5IDKA 1H1BA 3A8DA 3RU4E
chains in the Genus database with same CATH topology
2RFKC 3MQKC 3U28C 3UAIC 2HVYB 2V3MA 2EY4C 2EQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RFK C;  3MQK C;  3U28 C;  3UAI C;  2HVY B;  2V3M A;  2EY4 C;  2EQN A; 
#chains in the Genus database with same CATH topology
 3ZVC A;  2SGQ E;  5LPR A;  5EU8 A;  1BBR K;  1YPL H;  1O2N A;  3RU4 T;  1O3I A;  5JYI A;  4D76 A;  3BTT E;  1GDU A;  1IQM A;  1QB6 A;  3Q3K A;  2FYQ A;  4NG9 H;  1T4V H;  1GBL A;  1G3D A;  1J8A A;  2WIN I;  4X8S H;  2C8Z B;  3R0F A;  1EOL A;  2VID A;  1SGD E;  3RXL A;  2Y81 A;  1GMC G;  4XFQ A;  1UTJ A;  1IQN A;  1OSS A;  3BN9 A;  2PUX B;  1JIR A;  2JKH A;  1MAB B;  1NU7 B;  1MZD A;  4I8J A;  1TAW A;  4OS5 A;  3SJ9 A;  2Z9J A;  1AU8 A;  1MBQ A;  1GI0 A;  1ELF A;  5ESB A;  1J16 A;  2PKA B;  5EOD A;  4Z0K A;  2TIO A;  2SNW A;  2THF B;  4FUI A;  3ZYE A;  1O33 A;  3TNT A;  1E79 D;  3AVZ A;  2G81 E;  2Y5F A;  2KCP A;  3GIC B;  1L1N A;  2GCH G;  2IJO B;  3ZV9 A;  2BD3 A;  1ZHP A;  4H6T A;  1MU6 B;  3EST A;  1HGT H;  2QY0 B;  2W26 A;  1MU8 B;  4B2B A;  1ZPC A;  1ARC A;  1G2L A;  3DFL A;  4P00 A;  1AI8 H;  4NIY A;  1O5G H;  1C5M D;  1E37 B;  2JET C;  1QRW A;  1BRA A;  1LVM A;  1TYN A;  4UDW H;  1PQ5 A;  5BRR E;  2P94 A;  1H4W A;  1GCT C;  2WYJ A;  4ACB A;  2CHA C;  1AQ7 A;  1OX1 A;  1WTG H;  3SUE A;  4CHA C;  3UQV A;  5I25 A;  2RFK C;  1QHR B;  3ZIA D;  4O03 A;  2A5K A;  1GI9 B;  5JDU B;  3E6P H;  1O5A B;  3RXS A;  3KQ5 A;  2P59 A;  3M36 A;  1DWE H;  3SU1 A;  2J38 A;  4Y7A A;  4HI3 A;  3OEH D;  5EST E;  1BRU P;  2ZFR H;  1DY9 A;  1O2G H;  1XUI A;  5LGO A;  4BAH B;  2ZCK P;  3V0X A;  4TY7 A;  3BTH E;  2PR3 A;  1BML A;  5EXL A;  2R2M B;  4NIX A;  1YPK H;  3W95 A;  1FV9 A;  3MU8 A;  1HDT H;  1YLC A;  2O8U A;  2Y5H A;  1VIT H;  1UTN A;  4R8T B;  1C5R A;  1FX0 B;  1EZX C;  3BTE E;  3A8B A;  3U8O H;  4D8N A;  1U6Q A;  1E38 B;  3FAN A;  4CR9 A;  1Q2W A;  2JDI D;  5EJ1 A;  2IPQ X;  4ZMA H;  5I46 H;  3TGK E;  1SI5 H;  1NBM D;  1DWB H;  2A7H A;  1AFQ C;  1P01 A;  3HKI B;  1UTK A;  2W7U A;  2YNB A;  1AO5 A;  1OS8 A;  3DD2 H;  2OP9 A;  3SU2 A;  1L1G A;  3SU5 A;  5JBA S;  1JRT A;  2P8O C;  3SHC H;  4XOJ A;  2L74 A;  5LPF A;  1IQF A;  3LC3 A;  3M35 A;  3A8A A;  5AFY H;  5C1U A;  1MTV A;  2BD9 A;  1TMT H;  5JPM H;  1A7S A;  2R3Y A;  1YPH C;  2GGV B;  2PFE A;  4CH2 B;  2UUY A;  1JRS A;  1V6D A;  4IMZ A;  3E8L A;  4MLF B;  1TIO A;  1C5L H;  1OP0 A;  3MI4 A;  5B6O A;  2W3I A;  1PYT C;  4ZHL U;  1P8V C;  1OWD A;  1SL3 A;  1UO6 A;  1Y5U T;  2GX4 A;  1CBW C;  2CV3 A;  2EST E;  3PTB A;  4EST E;  3SO3 A;  2Z9K A;  1NS3 A;  1O3F A;  1ZMN A;  1FI8 A;  4ABF A;  1E35 B;  1GGD B;  1P3E A;  1BJU A;  1TON A;  1SLV B;  2AEI H;  4ISI H;  3VXF H;  1EP5 A;  4NSV A;  5EW2 H;  2P93 A;  5GWZ A;  4ABI A;  1AVW A;  1TGB A;  3EGK H;  1FXY A;  4I8L A;  3RU4 D;  1DDJ A;  3TH3 H;  1HAH H;  2DUC A;  2G55 A;  2J98 A;  2QCY A;  2ZFT A;  4X2Y A;  1GBA A;  1LPK B;  3NZI A;  1ZPB A;  1GPZ A;  3FZD A;  5EJL A;  3PV4 A;  5A2M H;  4I31 A;  3AW0 A;  3Q76 A;  3UB0 A;  2OBO A;  2ZCH P;  5FHT A;  3P92 A;  4NWL A;  1CA0 B;  1EB1 H;  2ZDA H;  4X8U H;  5BPE A;  1V2Q T;  4X6M A;  1QFK H;  5C0U A;  4Y11 E;  1ZPZ A;  4IN2 A;  4K1E A;  3LPR A;  4E05 H;  1HJ8 A;  4KKD A;  1F2S E;  2FM2 A;  2IJD 1;  2QV1 A;  5FPS A;  2FX6 A;  1O2Y A;  1DUA A;  2F3C E;  1SOZ A;  4HGC A;  3SU0 A;  1XMN B;  4K2Y A;  4TPI Z;  1C1V H;  2Y6T A;  6CHA C;  4A1V A;  5FPY A;  2F4L A;  5CMX H;  1UK4 A;  2KAI A;  3FVF B;  2FEQ H;  4WMD A;  3RXC A;  1V2M T;  2UWP A;  3TH2 H;  4BAO B;  4TY6 A;  2WPL S;  2PW8 H;  1LVB A;  3OSY A;  1F5K U;  3LGY A;  2ZEC A;  1UW7 A;  4GLY A;  1WQS A;  1C5X B;  3RMN H;  1OYQ A;  1XUH A;  1FN8 A;  2XWA A;  3MO9 A;  4OS6 A;  2HNT F;  1K28 D;  1V2J T;  2ZPR A;  7KME H;  2SGF E;  4JYU H;  1J9C H;  1PPZ A;  4B74 A;  1MMJ N;  3QDZ B;  1E1R D;  3BEI B;  2I6Q A;  3GYL B;  2A7J A;  1UCY E;  3GOV B;  1QL9 A;  3SGA E;  1KIG H;  1C1U H;  1TLD A;  2ANM H;  1LHF H;  3ZZB A;  1G30 B;  2Q6D A;  3PRO A;  4RT1 A;  2V3O H;  3D23 A;  2G00 A;  3VPK A;  1GMC F;  3VB6 A;  3LIW A;  1O3K A;  1A4W H;  4O3T A;  2XTT B;  2WZQ A;  1K2I 1;  2SNV A;  1AWH B;  1O3M A;  3A84 A;  3RM2 H;  2K0Q A;  1TX8 A;  1W7G H;  2J92 A;  1SQA A;  1GHA G;  4FUH A;  4ABH A;  1D4P B;  1GJ5 H;  2G5V A;  3M7U A;  4X2W A;  2BQW B;  4XSK U;  5PTP A;  1AND A;  2VIQ A;  1P2I A;  2GCH F;  1HJA B;  3PO1 B;  4JCN A;  3MFJ A;  1EP6 A;  2C93 B;  3E16 B;  2H1U A;  5L6N H;  1SGY E;  1EXF A;  2GT7 A;  1E36 B;  2HOB A;  4Y10 E;  1YBW A;  2VVV A;  1OXG A;  3PM3 A;  3MYW A;  3BSQ A;  4F55 A;  2J95 A;  2STB E;  4JK6 A;  4Y76 A;  1UVT H;  1O3A A;  1P12 E;  3C1K A;  2R9P A;  4I86 A;  1OPH B;  1O5E H;  1AMH A;  1GBH A;  3GCN A;  1K1M A;  2GDD A;  1GWA A;  1GMH F;  1AWF H;  1TPS A;  1EAU A;  1EPT B;  2ZNK H;  2B8O H;  2VB0 A;  1PFX C;  1WOF A;  1BCU H;  2ANK H;  2JH5 D;  5IK2 D;  1C9T A;  4BTI B;  1C1M A;  1W2K H;  2L6O A;  2ZKS A;  5DO4 H;  3PRD A;  4JZE H;  1C5Q A;  3TNS A;  2ZHD A;  2UWL A;  3FP8 E;  4ZKO U;  3FP7 E;  3VB4 A;  1G3C A;  1P57 B;  2SGA A;  3TJV A;  3IWM A;  1O5D H;  1UTQ A;  1YKT A;  1KXB A;  2AS9 A;  4SGB E;  2JH0 D;  5DP7 A;  5L30 H;  2A0Q B;  2WUB A;  3F6U H;  1XUJ A;  3BF6 H;  1TA6 A;  4X8V H;  2Z9I A;  3ZVD A;  4Z6A H;  3P8N A;  5H4I B;  2VH6 A;  3ZZ9 A;  2A32 A;  1J17 T;  1P2N A;  3RXR A;  3T28 A;  1B0E A;  3RXH A;  5HXF A;  4WWY A;  1C2F A;  3ZV8 A;  3WWF A;  4NGA H;  4PRO A;  4U30 A;  3P70 B;  4OS7 A;  1SLU B;  1W0K D;  3MU0 A;  1E34 B;  1ZSK A;  1NZQ H;  5TJX A;  2Z94 A;  1TB6 H;  3DA9 B;  1C4Y 2;  3U28 C;  2XBY A;  4YLQ H;  1Y5A T;  8EST E;  3LOX A;  3TPI Z;  1GJB B;  1SGQ E;  3ATI A;  3GCO A;  2CJI A;  3BTD E;  5AVD A;  4F49 A;  5C67 A;  1ETT H;  2GJG A;  3URD A;  3AK5 A;  1DXW A;  3BV9 B;  3JZ2 B;  1G2M A;  2PSX A;  2JIZ D;  1HB0 B;  3O8C A;  3A7Z A;  2G51 A;  1KXE A;  2H9H A;  4FUF A;  3SUF A;  2AIQ A;  3A7X A;  2GCT B;  1Y3U A;  3F0O A;  4WF8 A;  1TGN A;  4Y0Z E;  2AHM E;  4CRC A;  4UFE H;  2OC7 A;  1BMF D;  3VB7 A;  1O2J A;  3N7O A;  1AZZ A;  2ILN A;  1LHC H;  4GUX A;  2ZP0 H;  3ENS B;  1AFQ B;  1NPM A;  2EC9 H;  4LZ1 H;  1TNJ A;  3TLO A;  1NFY A;  1UTM A;  2WPH S;  3SNB A;  5CDF E;  1O3C A;  1W8B H;  2A2Q H;  5T3H A;  3H7O A;  4B6E A;  3A85 A;  2ZHW H;  2WPM S;  4QT8 C;  2HRV A;  3AAV A;  3UFA A;  2G8T A;  2OXS A;  4A7I B;  2ODP A;  1LVO A;  1P09 A;  1GI1 A;  5IYT A;  2C8W B;  4DUR A;  4XBB A;  2TGT A;  1ZLR A;  3GY2 A;  4K3J A;  2EI6 A;  2TGD A;  1SGF A;  4NSY A;  4Y79 A;  1O2X A;  3U69 H;  1S84 A;  1TBR H;  4ABB A;  1GHB G;  1YPE H;  3ZZ6 A;  1Q31 A;  2SGP E;  3EDX B;  1GL1 A;  1OWE A;  1WTH D;  4Y6D A;  1MTU A;  1A5I A;  5DP4 A;  1A61 H;  2VVU A;  1YPJ H;  1LO6 A;  3NRL A;  1MTN C;  1H9I E;  4I8K A;  3RC4 A;  5CHA C;  4FU8 A;  4MPU A;  1HAV A;  3OFN D;  3T26 A;  6EST A;  1GVL A;  3SI3 H;  3TJO A;  2ZI2 H;  2SGD E;  2WPJ S;  2XW9 A;  2G52 A;  2R3U A;  3I77 A;  2OCV B;  3Q3Y A;  3ZZD A;  5EXM A;  3OE7 D;  3ZVG A;  3P8G A;  1JOU B;  2BY6 X;  3MU5 A;  2QIQ A;  1NU9 A;  2GZ9 A;  3M5L A;  1ELA A;  1AY6 H;  4ABD A;  5GDS H;  1YY3 A;  1GJ8 B;  2Y7Z A;  1V2V T;  1THS H;  1BTW A;  1GMD G;  2NU1 E;  5K0H A;  1LHG H;  3RXG A;  2D8W A;  3MOC A;  4CBN A;  1T8M A;  2QC2 A;  1LKB A;  1NTP A;  3PTN A;  1FY4 A;  4K5Z A;  3PRB A;  3E3T A;  1NY2 2;  4X6N A;  1CHO F;  4K69 A;  4TWY A;  1IQJ A;  1HAY B;  4FET A;  1UHB A;  2H6M A;  4ISN A;  1C2K A;  3LH1 A;  1C1S A;  1BMN H;  2FTM A;  4AOQ A;  2VIW A;  1GHA F;  1KXA A;  2FXR A;  1HBT H;  4FUB A;  3DUX H;  1ETR H;  4I32 A;  1OWH A;  1QBO A;  1W11 U;  3FN8 A;  3LDX H;  6LPR A;  3SU3 A;  2CK3 D;  1EB2 A;  1ZMJ A;  4AG1 A;  2FP7 B;  3ATW A;  1FDP A;  2F91 A;  2V3M A;  1C5O H;  3UOU A;  4X1R U;  2HLD D;  1Z1J A;  3A80 A;  3AAS A;  5DGJ A;  3SJ8 A;  2GTB A;  1O35 A;  3CS0 A;  1UTP A;  3QO6 A;  3RLY H;  1C9P A;  1MD7 A;  2OQU A;  3G01 A;  4WME A;  2Z6B D;  3A87 A;  1BB0 B;  1SGF G;  2BD8 A;  1VCW A;  2YNA A;  1O2Z A;  1SSX A;  1BUI A;  3MNB A;  3TH4 H;  4DCD A;  1FPH H;  7GCH G;  3PV2 A;  4H4F A;  3STJ A;  2PP6 A;  1TPP A;  1ESA A;  4I8H A;  3TK5 A;  2ZIQ H;  3BIU H;  1KXD A;  1RIW C;  4UFD H;  1QR3 E;  2A31 A;  3BTF E;  3HK6 B;  1WU1 A;  2XND D;  2AFQ B;  4P02 A;  3RUO A;  5GCH F;  8GCH F;  3A7V A;  3F3B A;  4X1Q U;  1A3B H;  1WUN H;  2O8W A;  2WHX A;  1F5R A;  1KDQ A;  1O2S A;  1SLW B;  2YMS D;  3CEN A;  2PWX A;  3BTQ E;  2ALP A;  4YTA A;  3SJI A;  2ZGC A;  1L4D A;  2UWO A;  5HIZ A;  1YCP K;  1GJC B;  3KN2 A;  1EX3 A;  5HMA A;  4Y71 A;  2V7Q D;  1P03 A;  1QRZ A;  3LKW A;  1ZHM A;  1GG6 C;  4Z1M D;  3JZ1 B;  1ACB E;  1ID5 H;  1AKS A;  3IIT A;  2XC0 A;  2ZWL H;  2ZPS A;  3URE A;  4X0W U;  1TQ0 B;  4A1T A;  1AB9 B;  1EST A;  2PKS C;  3QX5 H;  3A83 A;  4TYD A;  1THP B;  1QBV H;  3KNX A;  3H7T A;  4DIH H;  2BY5 X;  2IOT A;  1QJ7 B;  1BJV A;  1ELC A;  2ZQ2 A;  4FUE A;  1TRY A;  2F9B H;  4JYT A;  2ULL A;  2W6I D;  4K8Y A;  1DM4 B;  3S9A A;  2AGE X;  3EA9 A;  3FO8 D;  3QWC H;  1SGR E;  1GI5 A;  1H8E D;  4I7Y H;  1NES E;  4WXV A;  4MPW A;  1A0L A;  1HAP H;  4NZQ A;  1O39 A;  1SHH B;  1O3G A;  3O8R A;  5JB8 S;  2CF8 H;  4D9Q A;  5ABW A;  5J4Q A;  1TRM A;  1C1O A;  1GHV H;  1LHE H;  1T8O A;  2D2D A;  3RXK A;  1BTH H;  4JZD H;  1GBB A;  5JB9 S;  3SND A;  1VIT F;  1K1L A;  2XBW A;  2Z3D A;  2ZPQ A;  2GZ7 A;  1CT4 E;  3DHK H;  3RXU A;  1L0Z A;  5A0C A;  1F92 A;  1PQ7 A;  1UK2 A;  2A4Q A;  1S81 A;  2R0K A;  4Q63 A;  2I6S A;  2BY9 X;  1MKW K;  2V35 A;  1BRC E;  4ZRO A;  2ZU4 A;  4FU9 A;  3UWI A;  2F43 B;  2BZ6 H;  1S83 A;  2PHB A;  1TGC A;  2BLV A;  4Q80 A;  4UE7 H;  3OTJ E;  4TWW A;  1VJA U;  2P3T B;  3BG4 B;  1GJ9 B;  2YMS B;  4XRN A;  1YCP H;  1LDT T;  2VH0 A;  3RXV A;  3S0N A;  5EPN A;  3UNQ A;  5DP8 A;  2A1D B;  2EQN A;  1O2I A;  3S69 A;  1GHB F;  1AN1 E;  4YZU A;  5L2Z H;  2V6N A;  1RRK A;  4DW2 U;  2ZA5 A;  5HIY A;  1TAL A;  2OLG A;  4J2Y B;  1GI7 B;  1BBR H;  1KTS B;  5AF9 H;  3EQ0 H;  1ZOM A;  2A4O A;  3SV9 A;  1XKB C;  1CGJ E;  4VGC C;  2W5E A;  5EQQ A;  2OQ5 A;  4KEL A;  4AZ2 B;  2GV7 A;  1E1Q D;  4FXG H;  1C2D A;  1P2M A;  4MNV A;  1CA8 B;  4D7F A;  2BXT H;  4XBC A;  1SHY A;  3RXQ A;  2F9O A;  4TSF D;  3KF2 A;  3ZZA A;  1GMD F;  3UWJ H;  1NM6 A;  2ALV A;  3MNX A;  1C5Y B;  3U8R H;  3QUM P;  4ISL A;  2XXL A;  1K1N A;  1UVP A;  2XOK D;  4NFE A;  3ZZ7 A;  1ELE E;  5E2P A;  1QB1 A;  2PLX A;  3OEE D;  1XUK A;  9LPR A;  3F2G A;  1S6F A;  3NXP A;  1N8O C;  2OD3 B;  1MAY A;  4YT7 H;  3F2H A;  1DVA H;  1ELV A;  4BAN B;  1OWJ A;  2KCY A;  2ZGH A;  4JZI A;  4Y8Z A;  2HVX A;  2Z9L A;  5CE1 A;  1KLJ H;  1MKW H;  1O5F H;  1MCT A;  2KX4 A;  2V0B A;  1GBF A;  2FPZ A;  3OYP A;  2J2U A;  2M5T A;  4YOG A;  1FAK H;  3VGC C;  9EST A;  3LT3 A;  3O8D A;  2AMP A;  1QBN A;  3SOR A;  1G37 A;  4O97 A;  2VIN A;  1GJ7 B;  1GL0 E;  1Z6J H;  2BD7 A;  3BIV H;  1F0S A;  1YPH E;  2BX4 A;  3A89 A;  3KHV A;  4KP0 A;  3LC5 A;  1D3Q B;  1EJA A;  4RI0 A;  2KM0 A;  2VWM A;  1HV7 A;  3TIU A;  5JBC S;  1YP9 A;  2CMY A;  2FS9 A;  4XE4 A;  1WYK A;  3SV7 A;  4ASU D;  3E0N B;  1K1O A;  2BDA A;  2VWL A;  2QXG A;  1TWX B;  2ZU5 A;  3SV8 A;  2NU0 E;  3K2U A;  2J5U A;  4INH A;  7GCH F;  2ZGX H;  3NWU A;  4FVB A;  1NRQ H;  3L33 A;  4E06 H;  4E7R G;  3UNS A;  1C4U 2;  1SKY E;  2HAL A;  3RXF A;  1ZSL A;  5FBI A;  1J14 A;  3GCH C;  1TNL A;  4A92 A;  1O36 A;  1Y3V A;  2ZG0 H;  5A09 A;  2HWL B;  1ZZZ A;  4AB8 A;  4YM9 A;  4ABJ A;  1SG8 B;  1ETS H;  3I29 A;  2F9N A;  5C1X A;  1O3E A;  4BXW A;  2Z9G A;  4WH6 A;  5FCK A;  2WV9 A;  1SR5 C;  2PUQ H;  2QYI A;  4JZF H;  3QTV H;  2KR7 A;  1HIA B;  2ZTX A;  1DT2 A;  2BQ7 B;  4H6S B;  2ZTY A;  3ODF A;  6GCH G;  5E0H A;  2WSS D;  4LXB H;  4GHT A;  4ACA A;  3U8T H;  4M9F A;  1XM1 A;  3EAJ A;  2WPI S;  1COW D;  3UQO A;  1SGT A;  2P95 A;  4Y7B A;  1SGI B;  2XCN A;  1FLE E;  1T4U H;  1GVK B;  2FOB A;  3CNR A;  4B6F A;  1ZSJ A;  3OY5 U;  4DGJ A;  3D62 A;  1GJD B;  2D1J A;  3SOS A;  4A5T S;  4ZAE A;  3SBK A;  1MCV A;  2VGC B;  1VR1 H;  4OM9 A;  3F1S B;  2BD4 A;  1IQI A;  1C5Z B;  1TBZ H;  4AC9 A;  1YWU A;  4U01 A;  3BTW E;  1W13 U;  1H9L B;  4NCY A;  1WXR A;  4AGJ A;  3RXP A;  2Q6G A;  3UOP A;  1UMA H;  1VGC B;  1FQ3 A;  5G4B A;  5FAH A;  1EAT A;  4BTU B;  5DN6 D;  2ZDN A;  4Q7Y A;  4R0I A;  3FOA A;  3PYH A;  1OKX A;  3PMJ A;  1TGS Z;  1O2H A;  1O32 A;  2TGP Z;  5EPY A;  5C20 A;  1SQR A;  2J4I A;  2A5A A;  1HYL A;  1D9I A;  3SW2 B;  1ELD E;  2Q1J A;  2F83 A;  1IQH A;  2RG3 A;  3U1J B;  1MQ6 A;  2NU4 E;  4U32 A;  4O3U A;  2FOE A;  3NPS A;  1TX7 A;  4TT3 D;  1W0Y H;  3OTP A;  1GBC A;  3M37 A;  3C27 B;  2FI5 E;  1O31 A;  1QA7 A;  1ELB A;  2BVX H;  2FOG A;  2ZFF H;  2GD4 B;  3MU4 A;  1EUF A;  2FTL E;  2A45 B;  4BAM B;  3UAI C;  2PKA A;  2FI3 E;  2QF4 A;  2ZGJ A;  4K1S A;  1GI2 A;  3SUG A;  1C2L A;  5FXL A;  3SYJ A;  1WV7 H;  3MO6 A;  1AD8 H;  3LGI A;  4CRD A;  4WJG 2;  1B0F A;  1O3B A;  2ZEB A;  1ZRB A;  3ZVA A;  1S0Q A;  1DX5 M;  3ELA H;  1NFW A;  1C4V 2;  4DJZ B;  5T6G A;  4ABA A;  1P2O A;  2GT8 A;  4NWK A;  1THR H;  4UON A;  4WY3 A;  4YLU A;  1FY3 A;  1HCG A;  3UPE A;  3RXB A;  2ANW A;  1KLT A;  2K8I A;  1PYT D;  4WMF A;  1ABJ H;  2V3H H;  3RXT A;  1W0Z U;  5C17 A;  1UVS H;  4MDS A;  5T1V A;  5A8X A;  2QE7 D;  3BEF B;  3CS7 A;  3S7H B;  1F0T A;  4SGA E;  1CHG A;  1TAB E;  2CN0 H;  1EAS A;  2JET B;  3HAT H;  2TGA A;  1ZGI A;  3F9H A;  1GBD A;  2FLB H;  4E7N A;  4RN6 A;  5LPE A;  4AN7 A;  4YOI A;  5HYO A;  1BBR E;  1GCT B;  1YPG H;  1QY6 A;  2CHA B;  2Z3C A;  1OHH D;  1SFI A;  4CHA B;  3QK1 A;  3TJU A;  4X2V A;  4WXI A;  4NFF A;  1ANB A;  3GY7 A;  1A2C H;  2QF5 A;  2HGT H;  1IHT H;  2OC8 A;  1AE5 A;  2LP6 A;  4OS1 A;  1ANE A;  2BLO A;  3SZE A;  2FZZ A;  3MH4 A;  1UVU H;  1QL8 A;  3ATK A;  5C5N A;  5JBB S;  2VWN A;  3E90 B;  3AAU A;  4AFS A;  3SGQ E;  3BTM E;  2H5C A;  4O9V A;  4ASH A;  1SPJ A;  1HXF H;  4YXW D;  5LH8 A;  1Q3X A;  3PLP A;  2BLW A;  3M3T A;  3W94 A;  4CRB A;  5EXN A;  1HFD A;  5FL7 D;  2J34 A;  2IN2 A;  4IGD A;  1C5W B;  1RTL A;  3M3V A;  2PGB B;  2Y7X A;  1LPG B;  3DCL A;  4K60 A;  3UIR A;  1SGE E;  3S9B A;  1TFX A;  2AMD A;  1H8H D;  2ODQ A;  2BM2 A;  1GBJ A;  3FP6 E;  3V3M A;  1ORF A;  2FOH A;  1GJ4 H;  3QGJ A;  4CR5 A;  5CHB A;  1YM0 A;  2BDI A;  2P8O B;  3RC5 A;  1JBU H;  3SQE E;  5FPT A;  1O3L A;  1TOC B;  3RMM H;  1TNK A;  1S6H A;  1N8O B;  1IOE A;  2NWN A;  2P3U B;  1SGC A;  1C5N H;  2C8Y B;  2ZHQ H;  1FIW A;  1O37 A;  1BDA A;  3L6P A;  1FY1 A;  5B6L A;  1P9U A;  4IS5 A;  1SFQ B;  2LEL A;  3UR9 A;  3A7T A;  2R0L A;  2HPP H;  1CBW B;  1TPO A;  2LPR A;  1A46 H;  3ZYD A;  4BAK B;  1HPG A;  4UFF H;  1V2O T;  2FOM B;  1BTU A;  3SJO A;  4F4O C;  1C5U A;  1WAY B;  1ZTJ A;  2FS8 A;  2ZFP H;  2ZDM A;  6GCH F;  4GCH G;  1NFU A;  1LCY A;  2P16 A;  3SGB E;  2ZC9 H;  4IC6 A;  3A86 A;  5KED A;  4ISO A;  3B9F H;  3RXE A;  2RA0 A;  4KTU A;  2WV5 A;  5T6F A;  2W3K A;  1LTO A;  2ZFQ H;  1O2P A;  2H9T H;  4TPY A;  3IG6 B;  2VBC A;  1RTF B;  4HFP B;  1QJ6 B;  1C5S A;  1DST A;  2VWO A;  3E1X B;  1W10 U;  2VIP A;  4AFQ A;  1DLK B;  4IW4 E;  3M3S A;  4AGK A;  5F8T A;  1PQ8 A;  2OUA A;  1JXP A;  2C4F H;  5A8Y A;  4ZXY H;  1C1N A;  1GGD C;  3ZZ4 A;  3QZR A;  1FJS A;  4DT4 A;  1DXP A;  4RKO B;  5C3N A;  5E8E H;  1QQ4 A;  2Z7F E;  3LU9 B;  4JK5 A;  3RXI A;  1OWI A;  3U1I B;  1AGJ A;  3GIS B;  4BAQ B;  1MKX K;  2AYW A;  2BD2 A;  2ODY B;  4AFU A;  2C3S A;  3NKK A;  6CHA B;  4F48 B;  1UCY K;  1O2R A;  4AOR A;  2G4U A;  1GBE A;  1ZJD A;  3MH5 A;  1CT0 E;  4UEH H;  2JJ2 D;  2OBQ A;  1P2K A;  3QGN B;  3S7K B;  1CA0 C;  1KXC A;  1DIC A;  1ARB A;  1EAW A;  1H9H E;  1QUR H;  5DPA A;  2J98 B;  4UD9 H;  2AH4 X;  5TCC A;  1FY8 E;  2QF0 A;  1YLN A;  3SV2 H;  3UNR A;  1C1R A;  1ANC A;  4DT7 B;  3A8C A;  1PPF E;  1SC8 U;  1SB1 H;  2EI7 A;  1FY5 A;  1S82 A;  1ZML A;  3SN8 A;  1QGF A;  1EZU C;  2BY8 X;  2VJ1 A;  1N1L A;  2QF3 A;  3P8F A;  2BOK A;  1Z7K A;  4CRF A;  3STI A;  1FIZ A;  1RXP A;  2VU8 E;  2ZO3 H;  1GI3 A;  3RXM A;  1DY8 A;  4U2W A;  3SI4 H;  2RDE A;  1GBI A;  1P02 A;  3QZQ A;  3WY8 A;  5GXP A;  1G3E A;  2BHG A;  3MWI U;  3RP2 A;  2NU2 E;  2BVS H;  4MTB A;  3RXA A;  4GSO A;  1TMB H;  4RT0 A;  2J9N A;  3M61 U;  2KAI B;  2QXI A;  3E0P B;  5F8Z A;  3SQH E;  1A3E H;  4FVD A;  3VB5 A;  3ZZC A;  1AVX A;  1RJX B;  5DSF A;  1TA2 A;  1TQ7 B;  3BTG E;  5F8X A;  3ODD A;  2HNT C;  4ISH H;  4Y8X A;  1D6W A;  2XNI A;  3QN7 A;  5AHG H;  1N6X A;  4MPX A;  3K6Z A;  1W3C A;  1BMA A;  4INK A;  2O8T A;  1NRP H;  7EST E;  5F03 A;  1MKX H;  2F9P A;  1SVP A;  1DFP A;  1EPT A;  5EW1 H;  1MTS A;  4FUD A;  3MO3 A;  1PPE E;  3GS9 A;  1KY9 A;  5DP5 A;  4X1P U;  2A4R A;  1FMG A;  5C0T A;  1XVM A;  1PPB H;  4IN1 A;  1BIT A;  5HKK D;  5GIB A;  1Z1I A;  1W14 U;  1HJA C;  3PO1 C;  1MAX A;  2BD5 A;  1IAU A;  2F9V A;  5J4S A;  2BDY A;  1O38 A;  4XD7 D;  3LGU A;  1MZA A;  2WYG A;  1O2V A;  4YOJ A;  4B76 A;  1BTP A;  2DE9 A;  4Q2K A;  4RSP A;  2OK5 A;  2GMT C;  3M5N A;  1A0H B;  3KYG A;  4AX9 H;  2ZU2 A;  2RCE A;  2DE8 A;  1BTX A;  3URC A;  2G5N A;  2OIN A;  2ZZU H;  1HAO H;  3TK6 A;  5AFZ H;  1EPT C;  1VJ9 U;  3RDZ A;  1VCQ A;  3LJJ A;  3TGJ E;  3F9E A;  4IBL H;  1DOJ A;  4NIV A;  1YGC H;  4DOQ A;  3VB3 A;  1YYY 1;  1JWT A;  1V2T T;  1NC6 A;  1HXE H;  3HKJ B;  3EA8 A;  3PMH B;  2TPI Z;  4BOH A;  1ABI H;  3ATL A;  3K6Y A;  1BA8 B;  3MH6 A;  4GAW A;  1C5V A;  2ZHF H;  3N7D A;  1EZS C;  1Y3Y A;  1NFX A;  1AUJ A;  3NUM A;  1GDN A;  2AIP A;  1XX9 A;  1FPC H;  5EQR A;  1K1J A;  1GDQ A;  2GZ8 A;  2BOH B;  4H42 U;  1BT7 A;  1CT2 E;  4M7G A;  1ELG A;  3P95 A;  4K8B A;  1C1Q A;  1ZGV A;  2UUK B;  2Y82 A;  1FZZ A;  1MTW A;  3MTY A;  4LOY H;  1Z8I B;  4CRA A;  2HVY B;  3UY9 A;  1INC A;  1MD8 A;  1SQO A;  1V2K T;  3CP7 A;  4I8G A;  4J1Y A;  5C5O A;  3LGV A;  4I33 A;  3OU0 A;  1AVG H;  1JIM A;  1J15 A;  2BB4 A;  4GCH F;  1V2U T;  3AW1 A;  5DK1 A;  1C2J A;  1YLD A;  4MNY A;  1MQ5 A;  1V2S T;  3QLP H;  1GMH G;  1AFE H;  3PWC A;  1JMO H;  1T8N A;  3EE0 B;  1C2M A;  3NK8 A;  3ZVB A;  2W6J D;  1DWD H;  3WWB A;  4JZ1 A;  1O2O A;  4ZKS U;  1XKA C;  1TX6 A;  2C90 B;  2FOD A;  2M2A A;  1BRB E;  1NN6 A;  1GBK A;  3U98 H;  5C1Y A;  5DKM A;  1BHX F;  1DS2 E;  7LPR A;  2JJ1 D;  1O0D H;  1P10 A;  1BTZ A;  2B0F A;  4MQA A;  5DP6 A;  3GY3 A;  3SNC A;  1HAI H;  1L2E A;  3V13 A;  3RML H;  3E91 A;  3A7W A;  1X7A C;  1F0U A;  2R2W U;  1WBG B;  1BHX B;  1K21 H;  1G32 B;  3UR6 A;  5GPI B;  1XXF A;  1O3D A;  2FO9 A;  1TNI A;  2GCT C;  1CE5 A;  4BTT B;  3P17 H;  5E2O A;  5FX5 A;  4X6P A;  1Z6E A;  5KEC A;  1BIO A;  1KLI H;  1PJP A;  5L2Y H;  2Z3E A;  3LH3 A;  1SBW A;  1K22 H;  2QXJ A;  1ZJK A;  1MH0 A;  4XDE A;  2XBX A;  2XC5 A;  1GJ6 A;  1W0J D;  2XCF A;  5E0J A;  4Q4L A;  2ZGB H;  4OGX A;  5FCR A;  2QA9 E;  3BG8 A;  1DPO A;  2B7D H;  1F5L A;  1MTN B;  4DY7 B;  1TNH A;  5EQS A;  1TBQ H;  2BXU H;  5CHA B;  3Q77 A;  2WPK S;  2BYA X;  5E0G A;  1C2H A;  3A7Y A;  1O3H A;  3DSP A;  3T25 A;  4GPG A;  4FU7 A;  4NIW A;  3HK3 B;  5ETX A;  3ZZ8 A;  1GVZ A;  3RMO H;  2XRC A;  1TNG A;  2FYR A;  1OP8 A;  1ZR0 A;  5GND A;  1SQT A;  2TRM A;  5FX6 A;  3DSO A;  3R3G B;  1RD3 B;  2FOF A;  2FWW A;  1NRS H;  4UFG H;  1DAN H;  4ZHM U;  3ATM A;  3KQC A;  1P11 E;  3LGW A;  1WCZ A;  1OWK A;  3UUZ A;  2GVF A;  4HG6 A;  1T8L A;  4ZUH A;  2XYA A;  1RFN A;  1S5S A;  5EOK A;  2C8X B;  1C5P A;  4ZXX H;  3V7T A;  1VCP A;  3RXD A;  1TPA E;  2PTC E;  4YO9 A;  1HNE E;  1MBM A;  2WPD D;  1F0R A;  1A1R A;  1C2I A;  1QA0 A;  4B73 A;  1HAV B;  2VIV A;  5EJZ A;  1DE7 H;  1OP2 A;  3F68 H;  2F9U A;  1ELT A;  5F6M A;  1P9S A;  4LK4 A;  1Y5B T;  1CSO E;  1W12 U;  1GBT A;  1O3P B;  1S85 A;  5HGG A;  1O34 A;  1ZRK A;  2QAA A;  3OAA D;  1KMH B;  1O2W A;  4GVU A;  3VXE H;  1DLE A;  4XBD A;  4BXS A;  1P0S H;  1O3J A;  4ZHA A;  3S9C A;  1AUT C;  1BMM H;  2XWB I;  3VFE A;  5HM2 A;  1VZQ H;  4WVP E;  2Q6F A;  3GDU A;  2UUJ B;  2FMJ A;  4Q7Z A;  3M7Q A;  1VKY A;  3GDV A;  1HUT H;  1O5C B;  5T6D A;  1V2L T;  4A1X A;  3O8B A;  1KSN A;  1UHB B;  2STA E;  3SJK A;  1Y3W A;  1GCD A;  1DUE A;  1SLX B;  3GY4 A;  3PMB B;  1TE0 A;  4JMY A;  1P2Q A;  3KYF A;  2GKV E;  1UVO A;  1RIW B;  2AGI X;  1CU1 A;  2CXV A;  3PLB A;  1D3P B;  1EAI A;  2AGG X;  1G9I E;  5EIY A;  1DWC H;  4OGY A;  4B71 A;  1L1J A;  1NRN H;  1K1I A;  4GHQ A;  1L4Z A;  3MMG A;  3PB1 E;  3KQB A;  1IHS H;  2BZA A;  1NRO H;  3TGI E;  4MNW A;  3H5C B;  3N99 A;  1PQA A;  4BNR A;  1EFR D;  1EZQ A;  1V2P T;  3K65 B;  1QB9 A;  4B1T A;  1CHO G;  1GG6 B;  2HLC A;  2WV4 A;  2RA3 A;  3LGT A;  2J97 A;  2HPQ H;  3MNS A;  1PPG E;  1QTF A;  4AFZ A;  2ZCL P;  2PKS B;  3P6Z B;  2BDC A;  2VVC A;  2G4T A;  3D65 E;  1OYT H;  1YPM H;  1ZTK A;  1Z8R A;  1CVW H;  3B23 B;  2ZDV H;  1P06 A;  3FFG A;  4B2A A;  2JH6 D;  1C5T A;  1Z8G A;  4MVN A;  1QCP A;  1ZHR A;  4WH8 A;  1CGH A;  1A5H A;  3T27 A;  1AE8 H;  1N6Y A;  3TJN A;  3EYD A;  1ZYO A;  4DG4 A;  1QNJ A;  8LPR A;  1UTO A;  2WUC A;  2FX4 A;  2EA3 A;  2Y80 A;  4KTC A;  1KDQ B;  3OY6 U;  2GMT B;  1KYN A;  1O3N A;  5C2Z A;  2W7S A;  1IQL A;  1AB9 C;  1SMF E;  1FNI A;  3DSG A;  1D3D B;  1EJM A;  2XBV A;  3QTO H;  1F7Z A;  4ABG A;  2BLQ A;  2PV9 B;  1P05 A;  2EI8 A;  3PMA B;  4ZH8 A;  1AKS B;  3TIT A;  3GCT G;  1PPH E;  4FOU C;  3TVJ B;  1WDI A;  4LZ4 B;  1C1P A;  1NO9 H;  1GJA B;  4CBO A;  1GHZ A;  3FAO A;  1O2Q A;  1T31 A;  2H9E H;  2A7C A;  5A0A E;  4KTS A;  1T32 A;  1FON A;  2ZQ1 A;  3RXO A;  2QN5 T;  8GCH G;  2ZFS A;  5GCH G;  2FES H;  4AYV B;  3ZZ3 A;  3DT0 H;  1WSS H;  1GHY H;  1CO7 E;  4X8T H;  5SGA E;  2KCO A;  4X6O A;  3EE7 A;  4INL A;  5GJ4 B;  5C94 A;  4B75 A;  1YF4 A;  3ZVF A;  4NA9 H;  3RXJ A;  3TK9 A;  1ZTL A;  2EY4 C;  1LKA A;  2O9Q A;  2PTN A;  2BMG B;  2CGA A;  1O2K A;  3A82 A;  4DVA U;  3BEU A;  3KL6 A;  3KQE A;  2FDA A;  2BY7 X;  1GI6 A;  3M5M A;  3T29 A;  3VG8 A;  1TRN A;  2GV6 A;  4VGC B;  1YCP M;  4MG3 A;  1S0R A;  2BDG A;  3MNC A;  3BG4 C;  1CQQ A;  2YMS C;  1LQE A;  1H8I H;  2O8L A;  1Y8T A;  3LJO A;  1LQD B;  1SGN E;  1OOK B;  3N7E A;  3PWB A;  3FZZ A;  3ZVE A;  3F2F A;  2J94 A;  4IC5 A;  3UTU H;  1GHX H;  1H8D H;  1V2W T;  2FI4 E;  1HAG E;  5A0B A;  2GDE H;  3KQD A;  3F9F A;  3RLW H;  1P2J A;  1TMU H;  1FAX A;  3SHA H;  3KGP A;  4JYV H;  1C1T A;  2A2X H;  1UTL M;  1VIT G;  3F9G A;  4ZKR U;  4ABE A;  5EG4 A;  1IQK A;  3KCG H;  1B7X B;  2VIO A;  1O5B B;  2BDH A;  1K0H A;  1TOM H;  5EGM A;  3ZZ5 A;  5A8Z A;  5JBT A;  2ZDL A;  1NRR H;  3MH7 A;  3PLK A;  5DP3 A;  2FLR H;  2O8M A;  3BTK E;  2BVR H;  2RDL A;  4MNX A;  4YT6 H;  3T62 A;  3VGC B;  1W7X H;  4CH8 B;  1WQV H;  2VNT A;  1KXF A;  1LVY A;  1SOT A;  4X2X A;  1XUG A;  2TBS A;  1O3O A;  1G36 A;  3GY8 A;  4B2C A;  3SNA A;  1YC0 A;  1FUJ A;  1IQG A;  1LHD H;  2UUF B;  2P3F H;  4K1T A;  1V2R T;  2NU3 E;  4D9R A;  3P8O A;  1A0J A;  1O2T A;  2FIR H;  1GI4 A;  1RS0 A;  5DP9 A;  1FN6 A;  2FOC A;  2SGE E;  4Y0Y E;  1TGT A;  4HZH A;  3B8J A;  4ZCN A;  2BX3 A;  5TCA A;  5FBE A;  1BOQ A;  1NT1 A;  3RC6 A;  2ZF0 H;  2ZTZ A;  1LMW B;  1Z8J B;  4FUJ A;  3GDS A;  1P3C A;  2OTV A;  3U9A H;  3SNE A;  2QGR A;  1M9U A;  4A6L A;  2B9L A;  1O2U A;  1MUE B;  1C1W H;  3GCH B;  1HLT H;  5K7R A;  1PPC E;  1HAZ B;  3TU7 H;  1P04 A;  1HIA A;  5DJ7 A;  1AHT H;  3F0P A;  4X1N U;  3HPT B;  1S6L A;  1B5G H;  3T5F H;  2KFW A;  1C2G A;  5DG6 A;  3SZN A;  3GY5 A;  1EJN A;  3Q3X A;  1ESB A;  3SUD A;  3MQK C;  2H2Z A;  3SU4 A;  4FUC A;  3M5O A;  3MHW U;  2GP9 B;  1BTY A;  3ITI A;  3EA7 A;  1V2N T;  2AER H;  1DIT H;  2QXH A;  3OX7 U;  1QRX A;  1GI8 B;  4YES B;  5KGO A;  3VEQ B;  1EKB B;  1V3X A;  1O2L A;  4NZL A;  2KZ4 A;  2A5I A;  1D3T B;  1XXD A;  2ZDK A;  4MPV A;  3SV6 A;  1K9O E;  2PGQ B;  4RKJ B;  3RM0 H;  3NCL A;  3V12 A;  3GYM A;  1O2M A;  1SGP E;  1Y3X A;  4KGA A;  3A81 A;  3L3T A;  2LNC A;  1GHW H;  4DII H;  1HRT H;  1QQU A;  2K1Q A;  2OC0 A;  4CRG A;  1QZ8 A;  3DFJ A;  1UK3 A;  5HM9 A;  1LPZ B;  1QIX B;  3KEE A;  1EOJ A;  2AMQ A;  3M7T A;  1Y59 T;  2XC4 A;  1KTT B;  2ZU1 A;  2BQ6 B;  1IQE A;  3Q00 A;  2H5D A;  2KCA A;  1HJ9 A;  1UJ1 A;  3T2N A;  1NBM E;  4X1S U;  2BDB A;  3H09 A;  1EAX A;  2ZHE H;  1CGI E;  4NA7 A;  1RTK A;  1E0F D;  1AIX H;  1T7C A;  1A5G H;  4OS4 A;  3HGN A;  2YOL A;  1C2E A;  1QJ1 B;  5F53 A;  1G3B A;  3K9X B;  4AG2 A;  1XVO A;  3GCT F;  2D26 C;  4Q7X A;  1HAX B;  2VGC C;  4THN H;  4FUG A;  4CRE A;  2Y5G A;  1XUF A;  1RGQ A;  3SU6 A;  1Z71 A;  1DSU A;  2EEK A;  2FOA A;  3HGP A;  3I78 A;  1AZ8 A;  1BZX E;  3PV5 A;  4OS2 A;  1VGC C;  3WW7 A;  1BQY A;  4AYY B;  3LON A;  4NA8 A;  1UCY H;  4IMQ A;  3GY6 A;  1QL7 A;  2A4G A;  1O30 A;  3FKS D;  4Y8Y A;  2SFA A;  3W1E A;  1D6R A;  2CF9 H;  4HTC H;  1K1P A;  2HNT E;  2ASU B;  1EQ9 A;  3D49 H;  1GBM A;  2PSY A;  4ZKN U;  2BTC E;  3A88 A;  4AB9 A;  3KID U;  2ANY A;  2B5T B;  2ZU3 A;  2OC1 A;  8KME 2;  4D7G A;  3MU1 A;  2IPH A;  5IDK A;  1H1B A;  3A8D A;  3RU4 E; 
#chains in the Genus database with same CATH homology
 2RFK C;  3MQK C;  3U28 C;  3UAI C;  2HVY B;  2V3M A;  2EY4 C;  2EQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...