3RDZA

Crystal structure of rbti-trypsin complex at 2.26 angstrom resolution
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
223
structure length
220
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title Conformational Changes of rBTI from Buckwheat upon Binding to Trypsin: Implications for the Role of the P(8)' Residue in the Potato Inhibitor I Family
pubmed doi rcsb
source organism Fagopyrum esculentum
total genus 55
structure length 220
sequence length 223
chains with identical sequence B
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rdzA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rdzA02
3SQEE 3EE0B 1E38B 1GL1A 1LVMA 1YF4A 1TOCB 3C27B 3UR6A 3I78A 2BM2A 1BHXF 3ZZ6A 1GI6A 4DOQA 3LGVA 1TIOA 5DG6A 3GCHB 3ZVDA 1YPMH 1S82A 1O2NA 1AIXH 3GCOA 1LTOA 1VCQA 3R3GB 1GJCB 2ZCLP 2UUKB 3H7OA 3QWCH 3ZZDA 2J92A 1HUTH 2F83A 3A8AA 3K6ZA 2TGPZ 1HAOH 2F3CE 3E1XB 5SGAE 1GGDB 1V2OT 3K65B 3EA7A 1AQ7A 1GHXH 1EPTA 1HAYB 3I29A 3H5CB 3E0PB 3ODFA 2P3UB 1HGTH 4D9RA 2BX4A 1V2UT 1ZHPA 2OUAA 3PWCA 3OYPA 2BY8X 2OQUA 4X1PU 1PPBH 4BXSA 1UTKA 1MCTA 3RMMH 2QF3A 3CENA 2G5VA 1W7GH 2HNTC 2QF0A 4IC6A 4O3UA 3NK8A 1GJ9B 1K1MA 4OGXA 4QT8C 1L4DA 3U8TH 1ANBA 5JYIA 3M61U 2G4TA 2W5EA 1ZSKA 5E0GA 1MTWA 2XXLA 4I33A 1IQFA 4ABJA 5GWZA 1Z6JH 2Z94A 3QUMP 5DP3A 1O3NA 2BY5X 1IQKA 2JETB 3GCTF 1O3JA 1GJ4H 3RM0H 1FAKH 5A0AE 1BMMH 1GBCA 4JMYA 1F5RA 3P6ZB 4ZROA 1EX3A 4RKOB 3PTNA 4ABFA 4HZHA 1C5OH 1ZRKA 2ZNKH 1ANEA 4K8BA 2A5KA 1EAUA 1MTNC 3ATWA 3BIVH 2UWPA 4FUIA 4KTCA 7GCHG 1VZQH 5ETXA 1AKSB 3BEFB 1LPKB 3WY8A 4X2WA 2ZDKA 1W3CA 4ABBA 4K3JA 1G3CA 2BY6X 1G3BA 2THFB 4X2VA 2AMPA 1QL7A 2UWLA 3TH3H 1O3DA 4BOHA 2ZIQH 1O2ZA 1HRTH 4O03A 1EZXC 4NIXA 1DLEA 1SB1H 2OC7A 1K1NA 1NZQH 4Y71A 2J2UA 1IQJA 4E05H 4GVUA 1ZGIA 2WPHS 3RXGA 3FP7E 3VB6A 3TH2H 3RM2H 2VIWA 3UOUA 1RFNA 2BZAA 3L3TA 1GJAB 1L4ZA 3LDXH 1YPJH 2D8WA 3ESTA 2A31A 2ALPA 5AHGH 2BLOA 3BTTE 2H6MA 4A1XA 2BTCE 3UR9A 5F8TA 3A87A 1A0HB 2ODQA 4U30A 1TRYA 2ZPQA 3GYMA 4LOYH 4MTBA 2FOHA 4K69A 2R2WU 1P9UA 2ZG0H 1GI7B 3MH5A 1HBTH 1NPMA 5A8ZA 5DGJA 1DT2A 3RMLH 2KAIA 5I25A 1TMTH 8GCHF 2J95A 2VJ1A 4OS1A 2CN0H 3PMBB 3SJ9A 3ZVAA 1GI4A 2ESTE 1MD7A 4JYVH 4IBLH 5DKMA 1AHTH 2WYGA 4K60A 4X6OA 1EPTC 1WYKA 1L1NA 2GDEH 4AGKA 1IQEA 1O2WA 5AF9H 4THNH 1TONA 1NRNH 1YLCA 2WPMS 3KF2A 1TNIA 3UNQA 1SLVB 2O8UA 1AVWA 2PUXB 2PW8H 2TPIZ 3T29A 4CRBA 2FI4E 1Z71A 1EP6A 3P95A 1QCPA 4I8KA 1S5SA 4NIVA 2IN2A 1XKAC 1J9CH 2FZZA 2A32A 4GCHF 3A7XA 3ELAH 3MU5A 3KQDA 1PQAA 1QY6A 1UO6A 1DITH 3LH1A 1HAVB 1XUFA 4UFFH 1O2LA 4ZHMU 1JIRA 3A84A 4H4FA 3PTBA 4ISHH 3QLPH 1TRNA 1C5VA 1GJ7B 1H8DH 4X1NU 5AFZH 2QGRA 2SGEE 1GMDG 3GY4A 3MU0A 2J4IA 1SHYA 3FZDA 4NWLA 3MTYA 2OCVB 1BMNH 1O3BA 1Z8JB 5K7RA 1NFYA 3BG8A 2FPZA 4VGCB 1V2TT 1O36A 1GG6C 1NRPH 1C9PA 3OU0A 1SOTA 1LHEH 1QBVH 5G4BA 1C1PA 5FAHA 1RRKA 3MNCA 3VXEH 1P10A 1UCYK 3VB7A 1BTYA 3SV8A 4WVPE 1SLUB 2PSXA 4B71A 1SGYE 4X0WU 4ZMAH 1PPZA 2P59A 1F5LA 2XCFA 2ZGXH 4TWWA 1NU7B 1ZMLA 1UHBB 1H9LB 1NFWA 5HXFA 3O8DA 4Q80A 1O5BB 1SLWB 9ESTA 5C20A 2GMTC 4DURA 1O5DH 2BDYA 2FOCA 2NWNA 4ZAEA 1MD8A 4I8LA 3ENSB 3P70B 4B73A 1V2LT 1VGCC 3UTUH 3EQ0H 1DX5M 1UK2A 1B0EA 3SGAE 4CRFA 4YM9A 1LMWB 1K28D 1HLTH 4RKJB 3P8NA 3ZYEA 1ETSH 4ZXXH 4E7RG 5DP5A 1YPHC 1GHVH 1FMGA 3IG6B 3TVJB 1QURH 3RXJA 1TQ7B 3DFJA 5ABWA 2SNVA 4FUJA 4AFZA 2TIOA 3KQBA 1GI2A 3F9GA 3RXTA 4ABAA 4UFEH 5HM9A 4X6PA 2H9EH 1TWXB 1HCGA 2XTTB 4B74A 2BDGA 3BTME 4Y8YA 1QGFA 1GI3A 1HJAC 1MU8B 1KDQB 1JWTA 3SU2A 3LKWA 4F4OC 4CH2B 3LGTA 2PTCE 3U1IB 4NCYA 2H9HA 3ZZBA 3UWJH 1IQLA 1FY1A 1P05A 1ORFA 1TNGA 2O8MA 1QR3E 2H5DA 3B8JA 1YPLH 1THSH 3NXPA 3Q3YA 1AUJA 1YPKH 1K2I1 3AW1A 1WUNH 2FOMB 1V2VT 2V3OH 1P2KA 2PGQB 1O3LA 4CHAB 5BPEA 4YOIA 2ZGHA 3MH4A 3VEQB 5LGOA 3MO3A 2VINA 1KXBA 4Q7YA 2OP9A 4KELA 1KXAA 1AFQC 5C5OA 4BTUB 2DUCA 4MPVA 4MLFB 1ZPZA 1IQGA 2PKAB 1C1VH 4Y0YE 1GHZA 1TPSA 2BD5A 5HM2A 3BEIB 3BTQE 5GJ4B 2ZQ1A 1BDAA 1J16A 4KGAA 1HIAB 3RLWH 2QCYA 3U98H 3U8OH 3A85A 2ZGBH 4FU7A 1B7XB 3SJKA 1GHAG 1BHXB 2FESH 4H6TA 2EA3A 1O3KA 1P03A 1C1NA 1DY9A 2QY0B 2A5IA 3M35A 1AB9B 3UIRA 1ETTH 1T4UH 1C2KA 2Z9LA 3RMOH 1N8OC 1P02A 1KXFA 1CGJE 2ANKH 1TABE 2WUCA 2V3HH 1Y5AT 3CS7A 1Z1JA 1M9UA 1C2DA 1MKXH 2WPJS 1O39A 1O2JA 4NSVA 4FUCA 1OYQA 4YT7H 1Y59T 3KCGH 1CVWH 4CBNA 1H1BA 1K9OE 1OP2A 1EB2A 2A45B 2GP9B 4DGJA 1C5RA 2ZGJA 3SBKA 1GCTB 3DT0H 3ZV9A 1AN1E 1DM4B 1VITF 1CU1A 1YC0A 2VWNA 1YCPH 3S7HB 4Y7AA 4ZXYH 3URDA 5C3NA 3A82A 3PMAB 4AN7A 2ZPRA 1F5KU 4NG9H 1A61H 3BTEE 2H1UA 3MOCA 3SV9A 4ZH8A 3SGQE 3U8RH 1GBLA 5JBTA 2BD9A 1LPGB 2ALVA 2PV9B 4HTCH 3E91A 1GBKA 4JYTA 3A89A 5A8XA 2O8TA 4ASHA 4Y11E 1HXFH 1TGBA 1Y3YA 5GCHF 3ZZ4A 1KY9A 1P9SA 2ZO3H 1ELCA 4XDEA 4A7IB 2BXUH 1ZPCA 3UPEA 1AKSA 3AW0A 2Z9IA 3HK3B 1N8OB 1TMUH 4IN2A 3BTFE 1FJSA 3T2NA 5DJ7A 5J4QA 1D3DB 5DP8A 4MNVA 3UNSA 2A2QH 1QFKH 1ZRBA 2GCHF 2PTNA 3B9FH 3LGYA 4FUHA 4UE7H 2EEKA 2P3TB 2ZFPH 1KLTA 3BTHE 1WOFA 4CREA 3S9CA 1NFUA 2OINA 2BDIA 1QBOA 4O97A 1K1PA 1PPHE 8LPRA 1PQ5A 1O2GH 1ABJH 2XWAA 1O5GH 5FPYA 1SGFA 1OP0A 2R2MB 2XBVA 1XUIA 3E16B 1C5XB 3RXOA 1CHGA 1ZPBA 1EAWA 1QA7A 4WH6A 2AGEX 4AYYB 4IS5A 1B0FA 1GMHF 1GBDA 2K1QA 1S81A 4A6LA 2WPKS 3ATLA 3SV6A 2HWLB 2OQ5A 1MUEB 4AFUA 1GL0E 2GKVE 2GTBA 4JK6A 4NA7A 3UFAA 1O5CB 2QC2A 4YO9A 2BMGB 3LJJA 1W8BH 1ZZZA 4O9VA 1GHYH 4ISIH 2QN5T 1NESE 3NWUA 2C3SA 5HGGA 3OY6U 3SJIA 1O34A 3G01A 3TGIE 4J1YA 5EPYA 1IQMA 2W7UA 5DP6A 1Z8RA 3RXMA 2VIOA 3F9EA 5LPFA 4B2BA 1HJ9A 4UD9H 2ZECA 2A4GA 3M37A 1KXEA 1C5PA 2XNIA 2HPQH 2RA0A 1TYNA 5L30H 1BRCE 2G81E 2BDBA 8ESTE 1UK4A 2VIVA 2B7DH 1KLJH 1B5GH 2Y5FA 4ABGA 2VH6A 2VGCB 5AVDA 1AGJA 5C2ZA 1AO5A 1C1WH 1ZSLA 1HYLA 1VCPA 1AI8H 1GJ8B 1GBMA 1EJAA 1BTHH 2D2DA 1HAPH 2HALA 5A09A 3BTGE 2JETC 1LHCH 2FI5E 3MO9A 3RC4A 3SUDA 2AGGX 1LHGH 1P12E 1MU6B 3Q3XA 1BTPA 2AIPA 4LZ1H 1C2HA 3KQEA 1HAVA 3D62A 1XUKA 1DICA 2FOEA 1P3EA 6GCHF 1KXDA 1UVUH 5C1YA 1CSOE 3BN9A 1FXYA 5EXLA 1C2GA 3GY8A 1TPPA 4DIHH 1HXEH 1O3AA 1DSUA 1XVOA 2VIDA 3RMNH 3Q77A 4KKDA 2FOFA 2W3KA 3RC6A 1WQVH 3PLBA 1K1JA 1SQAA 3BG4B 1TPOA 2ZZUH 3PB1E 1CHOG 1GI8B 3JZ2B 1L2EA 3DA9B 1C1OA 2GCTB 1K22H 1XX9A 1N6YA 4WXVA 2ILNA 1ZSJA 3RXBA 2CXVA 4MG3A 5LPEA 4BAMB 4MVNA 5J4SA 3RXEA 2H2ZA 3P17H 4Y76A 2ZHFH 4AG2A 4ESTE 1AE5A 3ZZ7A 1A0JA 1JRSA 5T6FA 5T6GA 4O3TA 1DOJA 1O5AB 1FZZA 1P11E 1LKBA 4SGBE 1BBRH 2QYIA 3GY2A 1LVOA 1UHBA 4OS4A 2VWLA 5DPAA 2FLRH 1D3TB 1C2JA 3URCA 1EP5A 2V35A 3F68H 5C67A 1SHHB 3EAJA 1A46H 3PROA 1TFXA 2W7SA 1EJNA 3CP7A 3FP8E 2A4RA 1NRRH 1QBNA 5EW2H 3P8GA 1S85A 3DHKH 3T28A 2Y7ZA 3HPTB 3I77A 1C2EA 2GDDA 1TX8A 1KYNA 4MQAA 3SI3H 1TBZH 2C90B 1C5UA 1RTFB 1S83A 5EOKA 4NGAH 5L2YH 3RXAA 4X8VH 1ZLRA 1F0RA 2A7JA 4IMQA 3M7TA 2OBQA 1C5NH 4WMFA 4Y8XA 3T62A 1SGQE 4ABDA 2D26C 2ZF0H 2FM2A 1H9IE 1OKXA 1P06A 1SGCA 3STIA 1BTZA 3SNBA 2WV4A 4MDSA 3RU4T 4PROA 1ANCA 1KDQA 3T26A 1O31A 1TQ0B 3QZRA 4ZKOU 3F1SB 4CRGA 5FX5A 3BSQA 1L1GA 1NO9H 5FXLA 1O3PB 2ZDNA 1L0ZA 4GSOA 4K5ZA 3GCTG 3ZZCA 1KTSB 2RDLA 1AE8H 1W0YH 1O3GA 2TGDA 2F9PA 2EI7A 4WH8A 3HKIB 1NRSH 4LK4A 4U01A 4FUFA 1O3FA 1WTGH 1YKTA 3N7OA 4FUGA 2ZU3A 3SNCA 7KMEH 1QIXB 4X6NA 1TBRH 4YTAA 5FHTA 1AWFH 3LIWA 3T25A 4YOGA 2R3YA 3QTOH 4K2YA 3SHCH 2XBXA 2AYWA 2NU0E 3RXSA 1ZHMA 1Y5BT 3F6UH 1C5TA 4AB9A 1O3MA 2PKAA 4CBOA 1ZMNA 3A83A 1AMHA 1FDPA 1C1SA 4JZIA 5CE1A 3EYDA 1HIAA 1OYTH 1MMJN 5EQRA 4A5TS 3HGNA 5F8XA 1NU9A 4VGCC 1O3IA 2BD3A 1SC8U 1VJAU 1QTFA 4ZHLU 4KP0A 3SU3A 1IHSH 1EQ9A 1U6QA 1DSTA 1TBQH 3W94A 2ZQ2A 1VCWA 1KTTB 2GV7A 3KNXA 1C4V2 4ZUHA 2C8YB 5FBEA 1FPHH 2HGTH 1AY6H 1ZOMA 3V13A 1V2QT 4I7YH 1G2MA 1CA0B 1WTHD 1WBGB 3TU7H 1AVGH 2I6SA 1ANDA 3A8DA 4FUDA 3Q00A 1JRTA 2J34A 5DK1A 1CBWC 2FWWA 5LPRA 1Y5UT 3E3TA 4ABEA 1A3EH 3NPSA 3QK1A 3PYHA 5JBAS 2F9NA 3A8BA 1QL8A 3JZ1B 8GCHG 2AIQA 2XWBI 2FIRH 2ZCKP 3GY7A 5BRRE 1V2PT 1C4U2 3PMHB 3D65E 3LC3A 1C5YB 2P8OB 2ZI2H 3O8CA 1PYTC 3MNXA 5H4IB 1MBQA 1Q31A 1BJUA 5EQSA 1O2PA 2FYQA 2ZPSA 2VB0A 1O2UA 4AX9H 3BV9B 4AYVB 1C2IA 1W14U 3RXDA 4JZEH 2UUJB 1DDJA 1P2NA 1PPEE 1C4Y2 1JXPA 1ZTLA 2P95A 4NA8A 5IDKA 1G36A 1GI9B 1RIWB 1BRUP 1CO7E 1K21H 3UREA 2Z7FE 1JMOH 4BAQB 1C5MD 1EAXA 3SUEA 2ZP0H 1V3XA 1DPOA 1GDUA 2TGTA 1PYTD 5DP9A 3VB5A 3S0NA 2GD4B 3CS0A 3IITA 1P2IA 2W3IA 4GCHG 1F2SE 2H5CA 1ELBA 1CBWB 1DLKB 1DXPA 1ELDE 1QJ6B 1IQNA 1GPZA 5A8YA 1P0SH 4Q2KA 1SPJA 1EZUC 5EU8A 2HOBA 9LPRA 2P16A 4UDWH 4AGJA 2FS9A 1L1JA 4CHAC 2STAE 1OWJA 1EZQA 2QXGA 4UFDH 4Y6DA 1UTJA 3MFJA 1C5WB 1IHTH 1O2VA 3PO1B 2ZHQH 3M3VA 4XBCA 3RP2A 4Z0KA 4XBBA 1QB6A 4BTTB 2BQ6B 2WUBA 2BDAA 1GI5A 1OWHA 1P3CA 5F03A 1FAXA 3SV2H 4NA9H 3GDSA 3VXFH 1FIWA 5EXMA 1A5HA 4Y8ZA 1O2SA 3UY9A 1J15A 3S9AA 5EW1H 1JBUH 3STJA 1EJMA 2VU8E 1BBRE 4ZKSU 1MH0A 1FY3A 1AB9C 2BLVA 1BMAA 2XYAA 2C8ZB 2P94A 1ELFA 1F7ZA 3GY6A 6CHAC 2VWOA 3MH7A 1F0TA 1HAHH 1SGNE 3RDZA 1YM0A 1X7AC 1DWBH 1Y3UA 1P8VC 3RXHA 4AG1A 4HGCA 3GOVB 5FPSA 2BOKA 1Z7KA 2CHAC 1BA8B 1GBTA 3AAVA 3VB4A 3KIDU 4INHA 1GJ6A 1UJ1A 3UOPA 1LVYA 1GCTC 5EG4A 2ZFQH 3A7TA 3UWIA 1NM6A 2ZHDA 2ZKSA 4NIYA 1DE7H 4FUEA 1C2LA 5T3HA 3A7WA 5JDUB 2ZA5A 4X6MA 1GVLA 1E36B 4XFQA 1TMBH 1SGFG 3W95A 1A4WH 1HJ8A 2WPLS 4KTUA 1GHBF 1TA2A 2BVRH 1XM1A 2ZFFH 1ZJDA 5L2ZH 2ZFSA 3M5OA 4Y0ZE 4A1TA 4D76A 4DT7B 4YOJA 3ZVBA 1NN6A 5K0HA 1QB9A 1XVMA 2GX4A 1NRQH 3M7UA 1O3EA 1Z1IA 3ZVEA 4CRDA 1UCYH 3BTWE 5PTPA 3RXPA 2BVSH 1T7CA 2A4OA 2ODPA 2AFQB 1G37A 3FZZA 1QRZA 4JZ1A 3T5FH 2FP7B 1DY8A 3UQOA 1TLDA 3SU1A 3LT3A 1O35A 1FPCH 1TGCA 2RG3A 1G2LA 6CHAB 2SGQE 2AEIH 2VIQA 4FVDA 6LPRA 1OP8A 1TNHA 2CHAB 4WJG2 1BTWA 1XKBC 1P2QA 4OS2A 4JK5A 1DUEA 1GMCF 5L6NH 2ANWA 2P3FH 2ZTXA 5FCRA 1C1MA 1WCZA 2OTVA 1TX6A 4NFFA 1T8LA 3SQHE 5GXPA 1V2NT 1J17T 1GBAA 4MPWA 2XW9A 2BD8A 1MKWK 2A2XH 1PQ8A 2FLBH 1TPAE 1A5IA 6ESTA 2XCNA 3K6YA 5C5NA 2G51A 1O2IA 2Z6BD 3MH6A 4AFSA 1Y3WA 1TOMH 3TGJE 5FPTA 4ABHA 3TH4H 3ITIA 5ESTE 4Q7ZA 4I32A 3VGCB 4B2AA 5GPIB 2I6QA 3TNSA 3RXLA 2F9VA 4NSYA 3U1JB 2CJIA 2CMYA 1LKAA 4FU9A 4LXBH 4X1RU 1LO6A 2ULLA 1LCYA 1QRWA 1SVPA 3A80A 2CGAA 5DP7A 2OBOA 3RXKA 1VR1H 1ZTJA 4MPUA 4NZQA 1LHFH 3M5LA 3M3TA 3L33A 1UMAH 1W7XH 3TK6A 2OC1A 1H9HE 2PUQH 1ABIH 1CQQA 3RU4E 2DE9A 1DWCH 3MMGA 2BXTH 3NKKA 2GGVB 2BLQA 1OWIA 3P92A 1BRAA 2Y81A 5FBIA 4MNXA 2GT8A 1D4PB 1N6XA 1FN8A 3E8LA 1D3PB 4R0IA 2VGCC 3ZZ9A 2HVXA 1OWEA 2QIQA 2FDAA 1VITG 4BTIB 3S9BA 5AFYH 4X8UH 5EGMA 1RTLA 2ZFTA 2HPPH 1GBIA 5JPMH 3SU6A 1AWHB 1G30B 2ZTYA 1WU1A 3LPRA 4CH8B 1XMNB 5I46H 4NWKA 1HDTH 1NY22 3VFEA 1BCUH 5A2MH 1T8MA 1QL9A 1SGDE 1OWDA 2QXHA 5GCHG 3TNTA 1FY8E 1MQ5A 1RGQA 1LQEA 4BNRA 2BQ7B 5C1UA 1THPB 1FQ3A 4RN6A 1S6FA 1ZTKA 4BAHB 3TGKE 1GCDA 2Z3CA 3MU4A 3GYLB 2AMDA 2BZ6H 1FI8A 4TPYA 3SNDA 3LC5A 2SGPE 1V6DA 1S6HA 4INKA 3BG4C 1GDNA 2GCHG 2B0FA 2SGDE 3ZVGA 1GBFA 1T31A 3DFLA 3FFGA 1EAIA 2GCTC 5HMAA 3FAOA 1A0LA 1SL3A 4IMZA 4KTSA 1O32A 4D7GA 2NU1E 2R0LA 2H9TH 1YBWA 3ZZ8A 2HNTE 3ZYDA 2FTLE 4WMDA 2PLXA 1G32B 1HAXB 2OC0A 4DVAU 1TNKA 2NU4E 1BOQA 2PKSB 3K9XB 2O9QA 1J8AA 1GMHG 2UWOA 1W10U 2QAAA 1GBHA 1TGSZ 1GJDB 3R0FA 3ZZ5A 2UUYA 1T32A 3QX5H 1TRMA 1C2MA 1EASA 2C8XB 3A7YA 3PLPA 1FY5A 1FLEE 2PR3A 4YESB 1EUFA 4SGAE 4DY7B 2ZHWH 2Q6FA 2XBYA 2V0BA 1TNLA 1F0SA 3RXVA 1YP9A 4DIIH 1S0QA 3ATMA 5F6MA 1YLDA 2G00A 3A7ZA 2SGAA 1GVKB 1UTNA 1UTQA 5ESBA 4ABIA 1CT2E 1O38A 4IN1A 2XBWA 2BYAX 3UQVA 1Z8GA 1NT1A 4GUXA 3SGBE 7GCHF 4X8TH 4F49A 4WF8A 1T4VH 2WINI 2ZU5A 1BZXE 1UK3A 1G3DA 1P09A 3F9HA 1E0FD 2B8OH 1HB0B 2QXIA 1A2CH 3OSYA 4U32A 1GDQA 3SV7A 3ATIA 4OS6A 1DFPA 4TY6A 1UTPA 3EDXB 5CHAB 1IOEA 2A7CA 1O2HA 1AZ8A 2NU2E 2UUFB 3QN7A 1MTVA 4J2YB 4XOJA 1UCYE 4HI3A 1BITA 3GDVA 4YLUA 1ARBA 4AZ2B 1ESTA 1BJVA 1YCPM 2ZU2A 1Z8IB 2ODYB 1O3CA 3UNRA 3RLYH 3RXIA 4B2CA 1MCVA 3OY5U 1HPGA 1S84A 2ZU4A 1MTSA 2WPIS 4A92A 4B75A 6GCHG 2WV5A 1BT7A 3SU4A 1FNIA 1FONA 2RCEA 1GI0A 3SUFA 1CGHA 1Y3XA 2CV3A 4CRCA 1EZSC 1SSXA 2F9BH 3QDZB 4Q7XA 3NUMA 1DVAH 5IYTA 1SGEE 1OSSA 1P2MA 1TE0A 3EA9A 4DCDA 3KHVA 1N1LA 1NFXA 2QA9E 4CR5A 3GCNA 1RS0A 2R9PA 2FEQH 2IOTA 2FX4A 4I8GA 3PLKA 1ZJKA 2G4UA 2OC8A 2XRCA 3PWBA 1QJ1B 5JB8S 1C1QA 2VVUA 4Y10E 4D8NA 1WQSA 3T27A 2Y5GA 3RUOA 5TJXA 1A5GH 1C2FA 1HNEE 2ANYA 4IC5A 1ZYOA 2Z9JA 3KL6A 4X2XA 4BANB 1C5SA 3LGWA 4HFPB 4RSPA 1V2KT 4WXIA 1EOLA 1DWEH 1PPCE 3SNEA 2BX3A 1FY4A 1W2KH 1KSNA 3GY5A 1BIOA 1ZGVA 2GZ7A 3FP6E 1CA0C 1Y8TA 4GPGA 1P2JA 4FUBA 1SMFE 2FXRA 1QQUA 2FO9A 7LPRA 1C5LH 1LVBA 2XC0A 1FIZA 4I8JA 2FI3E 1QRXA 3A81A 1SQTA 3GY3A 3PMJA 2ZFRH 4M7GA 5T6DA 1LHDH 2DE8A 3HATH 1K1OA 1T8OA 1MTNB 1O2RA 1PQ7A 1NTPA 1EOJA 2J9NA 3LH3A 2FTMA 1DS2E 4UFGH 4B1TA 2P8OC 1GMDF 1ZHRA 3BIUH 1XXDA 3NCLA 3E90B 4UONA 2ZU1A 4WY3A 4Z6AH 1BB0B 3A8CA 2JH0D 2ASUB 1V2ST 4Y7BA 3TJNA 4ZHAA 1O2QA 4E7NA 3O8RA 4AORA 1G3EA 4FXGH 3AAUA 3LJOA 1RIWC 2ZDVH 1PPGE 3UUZA 1H8IH 2HRVA 1BTXA 1V2WT 4R8TB 2A4QA 1OXGA 2BHGA 3RXRA 3MU1A 1NS3A 4JZDH 1GHWH 2ZWLH 3PM3A 3QO6A 1JIMA 2AERH 3M36A 4GLYA 2FMJA 4ZKRU 2VVCA 1D3QB 3HKJB 1D6RA 2JH5D 2SNWA 1H4WA 1BRBE 3SU5A 2PGBB 1QHRB 5B6OA 1O3HA 5LH8A 4YLQH 1RD3B 2PHBA 1CT4E 3DD2H 1TB6H 5F8ZA 2FYRA 3A7VA 3KGPA 1C9TA 2BOHB 1CT0E 1V2RT 1O37A 3D23A 2GZ9A 5DO4H 2AH4X 3SNAA 3U69H 5TCCA 3NZIA 2R3UA 3ZVCA 2NU3E 1Z6EA 2VIPA 1LDTT 2BD4A 2AGIX 1P01A 1GVZA 1AU8A 3C1KA 3QZQA 1AFEH 2VWMA 1OOKB 5CMXH 1YPHE 2W26A 1EKBB 1BUIA 2IPHA 3PO1C 1ZMJA 1IQIA 3HK6B 1LQDB 1SGIB 1C5QA 2HLCA 2OD3B 4K1EA 1GBBA 2EI6A 1EPTB 3BTKE 4OS7A 3KN2A 1ETRH 1ID5H 1MAYA 3EA8A 5A0CA 1BQYA 1FN6A 3SO3A 3BEUA 1O2KA 3M5NA 3TK5A 3M5MA 3TITA 1MBMA 2Z3EA 3SHAH 4ISNA 4X1SU 1QB1A 1Y3VA 1DXWA 3A88A 2JH6D 1J14A 1CGIE 1TGTA 3MWIU 1BTUA 2JKHA 3SU0A 3GDUA 5HYOA 4WWYA 4CRAA 1HAGE 2V6NA 2VH0A 5A0BA 4GAWA 1UVTH 5DP4A 3MNSA 2BVXH 2G8TA 2BDHA 1NROH 1D6WA 2Y80A 3M3SA 1ELTA 4X8SH 3RXUA 5E0JA 3RXFA 4LZ4B 4IGDA 4TPIZ 1GBEA 4BXWA 1V2JT 3HGPA 3M7QA 1OX1A 2F9UA 1YYY1 4H42U 3LONA 5GIBA 5EXNA 3D49H 5E2OA 1MKXK 1GJ5H 3A86A 1AZZA 3E6PH 3RXQA 5GDSH 3TJVA 2Y6TA 2HNTF 4CR9A 2XC4A 1XUGA 1PFXC 3MU8A 1SG8B 3RC5A 2A7HA 3K2UA 1A3BH 1ARCA 2F91A 1O5FH 2ZC9H 3SJOA 1YCPK 1FV9A 4NFEA 3KQCA 1P04A 3QGNB 1SFQB 1KLIH 2R0KA 4XBDA 3EGKH 4AFQA 1GJBB 2A0QB 3SJ8A 4DJZB 1AD8H 1FUJA 5JBCS 1GG6B 3SUGA 5E0HA 2SGFE 2ZGCA 4ISLA 2FOAA 1GHAF 4D9QA 2BY9X 1O5EH 1QJ7B 2PFEA 2J94A 2YOLA 2BLWA 4TWYA 1UTOA 2CF8H 3MYWA 3ATKA 1JOUB 4K8YA 1K1LA 1O3OA 2M5TA 1EATA 1QQ4A 2ZDAH 1C1TA 2Q1JA 3E0NB 2P93A 4I8HA 1GI1A 1MTUA 4OGYA 5FCKA 1W13U 2D1JA 2YNBA 1SR5C 1O2OA 3SI4H 1MAXA 1SI5H 4ZKNU 1RTKA 1UVOA 2B5TB 2GMTB 2TBSA 3GICB 3ODDA 1YPEH 4MNYA 4OS5A 3ZV8A 2ZDLA 3FANA 1AUTC 1RXPA 2C4FH 1QA0A 1VGCB 3SZNA 3OX7U 1ESBA 1OS8A 1Q3XA 2B9LA 1W12U 2Q6DA 4MPXA 5FX6A 2QXJA 2STBE 1T8NA 2KAIB 5EODA 2O8WA 3V12A 1QNJA 4U2WA 5C1XA 3LGIA 2G55A 3SORA 1DUAA 1SQOA 4NZLA 2BD7A 4XE4A 1ACBE 1DANH 3LOXA 3L6PA 3VGCC 1IAUA 3S69A 2RA3A 1UTMA 1SGTA 3TK9A 4IW4E 1BMLA 4BAKB 4MNWA 4E06H 1C1RA 3RXCA 3P8FA 1SFIA 2Q6GA 4BAOB 2IJOB 2OXSA 1HJAB 1K1IA 2GV6A 2FOGA 1KIGH 1XUHA 1C5ZB 4I31A 2WYJA 4JYUH 5E8EH 1AVXA 2PSYA 4B76A 1MZAA 1C1UH 3TJOA 3BTDE 3V0XA 3KEEA 1PPFE 2Y5HA 3GISB 1SLXB 2BB4A 2BQWB 2Z3DA 3PV4A 1TALA 1O2XA 1CA8B 1SGRE 2ZTZA 3VB3A 1Q2WA 1TNJA 2LNCA 1E35B 3ZVFA 2AS9A 1VITH 1XUJA 3Q3KA 4K1SA 3AVZA 3OTJE 3S7KB 1GWAA 2FOBA 1WAYB 2O8LA 1S0RA 3ZZ3A 1GHBG 3LGUA 1AFQB 3VPKA 5TCAA 2GZ8A 3SW2B 4WMEA 1TA6A 5EQQA 1YGCH 4Y79A 1MQ6A 2G52A 3O8BA 2F9OA 2C8WB 2G5NA 1W0ZU 2EC9H 4FVBA 1O2TA 1HAZB 2VVVA 4K1TA 4D7FA 4XSKU 5JB9S 1E37B 3Q76A 1SBWA 2ZHEH 1GBJA 1ELGA 1HAIH 2Z9KA 2LPRA 1G9IE 3ZZAA 1EB1H 2OLGA 1F0UA 1E34B 1WSSH 3IWMA 4AB8A 2C93B 1ESAA 1RJXB 1HFDA 3H7TA 3SN8A 3V7TA 1DWDH 3SOSA 4NIWA 3DUXH 2VNTA 1OPHB 2GVFA 4A1VA 3P8OA 3QTVH 1F92A 2Y82A 3B23B 1D9IA 1GMCG 7ESTE 2CF9H 1EXFA 2SFAA 1A7SA 1TX7A 3MNBA 2PKSC 2YNAA 4H6SB 1TGNA 1INCA 2ZEBA 5JBBS 3BF6H 1W11U 5E2PA 1A1RA 2Y7XA 4FU8A 4YZUA 2TRMA 4TYDA 1YPGH 8KME2 1UVPA 2BDCA 1O30A 1O0DH 1OWKA 3TLOA 2FODA 1CE5A 1WV7H 3V3MA 2A5AA 1O2MA 3MO6A 1SOZA 3U9AH 1ELAA 2BY7X 2XC5A 4JZFH 2PWXA 3LU9B 3GCHC 1HV7A 1IQHA 4ISOA 5EPNA 3TJUA 1BBRK 4TY7A 4X1QU 4YT6H 4INLA 1P2OA 3TPIZ 1V2MT 2ZCHP 1UTLM 1TAWA 2TGAA 1O33A 2GT7A 1P57B 4JCNA 2ANMH 4DG4A 2Z9GA 1GGDC 1XXFA 1THRH 1CHOF 2QV1A 1ELEE 3FVFB 3AASA 1MKWH 2AMQA 2FX6A 3TIUA 3MHWU 3MI4A 1ZR0A 2J38A 2BD2A 2FS8A 1LPZB 3QGJA 1O2YA 5CHAC 1VJ9U 3F9FA 2EI8A 1NC6A 1PJPA 4GHQA 4AOQA 1ELVA 1KXCA 4X2YA 2A1DB 1MZDA 4DW2U 4UEHH 2ZDMA 3RU4D 4GHTA 1UVSH 1SGPE
chains in the Genus database with same CATH superfamily
3SQEE 3EE0B 1E38B 1GL1A 1LVMA 1YF4A 1TOCB 3C27B 3UR6A 3I78A 2BM2A 1BHXF 3ZZ6A 1GI6A 4DOQA 3LGVA 1TIOA 5DG6A 3GCHB 3ZVDA 1YPMH 1S82A 1O2NA 1AIXH 3GCOA 1LTOA 2WV9A 1VCQA 3R3GB 1GJCB 2ZCLP 2UUKB 3H7OA 3QWCH 3ZZDA 2J92A 1HUTH 2F83A 3A8AA 3K6ZA 2TGPZ 1HAOH 2F3CE 3E1XB 4FETA 5SGAE 1GGDB 1V2OT 3K65B 3EA7A 1AQ7A 1GHXH 1EPTA 1HAYB 3I29A 3H5CB 3E0PB 3ODFA 2P3UB 1HGTH 4D9RA 2BX4A 1V2UT 1ZHPA 2OUAA 3PWCA 3OYPA 2BY8X 2J97A 2OQUA 4X1PU 1PPBH 4BXSA 1UTKA 1MCTA 3RMMH 2QF3A 3CENA 2G5VA 1W7GH 2HNTC 2QF0A 4IC6A 4O3UA 3NK8A 1GJ9B 1K1MA 4OGXA 4QT8C 1L4DA 3U8TH 1ANBA 5JYIA 3M61U 2G4TA 2W5EA 1ZSKA 5E0GA 1MTWA 2XXLA 4I33A 1IQFA 4ABJA 5GWZA 1Z6JH 2Z94A 3QUMP 3KYGA 1O3NA 5DP3A 2BY5X 1IQKA 2JETB 3GCTF 1O3JA 1GJ4H 3RM0H 1FAKH 5A0AE 1BMMH 1GBCA 4JMYA 1F5RA 3P6ZB 4ZROA 4F48B 1EX3A 4RKOB 3PTNA 4ABFA 4HZHA 1C5OH 1ZRKA 2ZNKH 1ANEA 4K8BA 2A5KA 1EAUA 1MTNC 3ATWA 3BIVH 2UWPA 4FUIA 4KTCA 7GCHG 1VZQH 5ETXA 2V7QD 1AKSB 3BEFB 1LPKB 3WY8A 4X2WA 2ZDKA 1W3CA 4ABBA 4K3JA 1G3CA 2BY6X 1G3BA 2THFB 4X2VA 2AMPA 1QL7A 2UWLA 3TH3H 1O3DA 4BOHA 2ZIQH 1O2ZA 1HRTH 4O03A 1EZXC 4NIXA 1DLEA 1SB1H 2OC7A 1K1NA 1NZQH 4Y71A 2J2UA 1IQJA 4E05H 4GVUA 1ZGIA 2WPHS 3RXGA 3FP7E 3VB6A 3TH2H 1WDIA 3RM2H 5IK2D 2VIWA 3UOUA 1RFNA 1SKYE 2BZAA 3L3TA 4XD7D 1GJAB 1L4ZA 3LDXH 1YPJH 2D8WA 3ESTA 2A31A 2ALPA 2KFWA 5AHGH 2BLOA 3BTTE 2H6MA 4A1XA 2BTCE 3UR9A 5F8TA 3A87A 1A0HB 2ODQA 4U30A 1TRYA 2ZPQA 3GYMA 4LOYH 4MTBA 2FOHA 4K69A 2R2WU 1P9UA 2ZG0H 1GI7B 3MH5A 5C0TA 1HBTH 1NPMA 5A8ZA 5DGJA 1DT2A 3RMLH 2KAIA 5I25A 1TMTH 8GCHF 2J95A 2VJ1A 1E79D 4OS1A 1BMFD 2CN0H 3PMBB 3SJ9A 3ZVAA 1GI4A 2ESTE 3FN8A 1MD7A 4JYVH 3N7DA 4IBLH 5DKMA 1AHTH 2WYGA 4K60A 4X6OA 1EPTC 1WYKA 1L1NA 2GDEH 4AGKA 1IQEA 1O2WA 5AF9H 4THNH 1TONA 1NRNH 1YLCA 2WPMS 3KF2A 1TNIA 3UNQA 1SLVB 5C0UA 2O8UA 1AVWA 2PUXB 2PW8H 2TPIZ 3T29A 4CRBA 2FI4E 1E1QD 1Z71A 1EP6A 3P95A 1QCPA 4I8KA 1S5SA 4NIVA 2IN2A 1XKAC 1J9CH 2FZZA 3F2HA 2A32A 4GCHF 5C94A 3A7XA 3ELAH 3MU5A 3KQDA 1PQAA 1QY6A 2JJ2D 1COWD 1DITH 1UO6A 3LH1A 1HAVB 1XUFA 2J98A 4UFFH 1O2LA 4ZHMU 1JIRA 3A84A 4H4FA 3PTBA 4ISHH 3QLPH 1TRNA 1C5VA 1GJ7B 1H8DH 4X1NU 3DSGA 5AFZH 2QGRA 2SGEE 1GMDG 3GY4A 3MU0A 2J4IA 3ZIAD 3KYFA 1SHYA 3FZDA 4NWLA 3MTYA 1BMNH 1O3BA 2OCVB 1Z8JB 5K7RA 1NFYA 3BG8A 2FPZA 4VGCB 1V2TT 1O36A 1GG6C 1NRPH 1C9PA 3OU0A 1SOTA 1LHEH 1QBVH 5G4BA 1C1PA 5FAHA 1RRKA 3MNCA 3VXEH 1P10A 1UCYK 3VB7A 1BTYA 3SV8A 1EFRD 1FX0B 4WVPE 1SLUB 2PSXA 4B71A 1SGYE 4X0WU 4ZMAH 1PPZA 2P59A 1F5LA 2XCFA 2ZGXH 4TWWA 1NU7B 1ZMLA 1UHBB 1H9LB 1NFWA 5HXFA 3O8DA 4Q80A 1O5BB 1SLWB 9ESTA 5C20A 2GMTC 4DURA 1O5DH 2BDYA 2F43B 2FOCA 2NWNA 4ZAEA 1MD8A 4I8LA 3ENSB 3P70B 4B73A 5EIYA 1V2LT 1VGCC 3UTUH 3EQ0H 1DX5M 1UK2A 1B0EA 3SGAE 4CRFA 4YM9A 1LMWB 1K28D 1HLTH 4RKJB 3P8NA 3ZYEA 1ETSH 4ZXXH 4E7RG 5DP5A 1YPHC 1GHVH 1FMGA 3IG6B 4HG6A 3TVJB 1QURH 3RXJA 1TQ7B 3DFJA 5ABWA 2SNVA 4FUJA 4AFZA 4P02A 2RFKC 2TIOA 3KQBA 1GI2A 3F9GA 3RXTA 4ABAA 4UFEH 5HM9A 4X6PA 2H9EH 1TWXB 1HCGA 2XTTB 4B74A 2BDGA 3BTME 4Y8YA 1QGFA 1GI3A 1HJAC 1MU8B 1KDQB 1JWTA 3SU2A 3LKWA 4F4OC 4CH2B 3LGTA 3DSPA 2PTCE 3U1IB 3FKSD 4NCYA 2H9HA 4Z1MD 3ZZBA 3UWJH 1IQLA 1FY1A 1P05A 1ORFA 2CK3D 1TNGA 2O8MA 1QR3E 2H5DA 3B8JA 1YPLH 1THSH 3NXPA 3Q3YA 1AUJA 2GJGA 1YPKH 1K2I1 3AW1A 1WUNH 2FOMB 1V2VT 2V3OH 1P2KA 2PGQB 3OTPA 1O3LA 4CHAB 5BPEA 4YOIA 2ZGHA 3MH4A 3VEQB 5LGOA 3MO3A 2VINA 3EE7A 1KXBA 4Q7YA 2OP9A 4KELA 1KXAA 4P00A 1AFQC 5C5OA 4BTUB 2DUCA 4MPVA 4MLFB 1ZPZA 1IQGA 2PKAB 1C1VH 4Y0YE 1GHZA 1TPSA 2BD5A 5HM2A 3BEIB 3BTQE 5GJ4B 2ZQ1A 1BDAA 1J16A 4KGAA 1HIAB 3RLWH 2QCYA 3U98H 3U8OH 3A85A 2ZGBH 3KQ5A 4FU7A 1B7XB 3SJKA 1GHAG 1BHXB 2FESH 4H6TA 2EA3A 1O3KA 1P03A 1C1NA 1DY9A 2QY0B 2A5IA 3M35A 1AB9B 3UIRA 1ETTH 1T4UH 4XRNA 1C2KA 2Z9LA 3RMOH 1N8OC 1P02A 1KXFA 1CGJE 2ANKH 1TABE 1YWUA 2WUCA 2V3HH 1Y5AT 3CS7A 1Z1JA 3PV5A 1M9UA 1C2DA 1MKXH 3F3BA 2WPJS 1O39A 1O2JA 4NSVA 4FUCA 1OYQA 4YT7H 1Y59T 3KCGH 1CVWH 4CBNA 1H1BA 1NBME 1OP2A 1K9OE 1EB2A 2A45B 2GP9B 4DGJA 1C5RA 3OAAD 2ZGJA 3SBKA 1GCTB 3DT0H 3ZV9A 1AN1E 1DM4B 1VITF 1CU1A 1YC0A 2VWNA 1YCPH 3S7HB 4Y7AA 4ZXYH 3URDA 5C3NA 3A82A 3PMAB 4AN7A 2ZPRA 1F5KU 4NG9H 1A61H 3BTEE 2H1UA 3MOCA 3SV9A 4ZH8A 3SGQE 3U8RH 1GBLA 5JBTA 2BD9A 3DCLA 1LPGB 2ALVA 2PV9B 4HTCH 3E91A 2KCOA 1GBKA 4JYTA 3A89A 5HIZA 5A8XA 2O8TA 4ASHA 4Y11E 1HXFH 1TGBA 1Y3YA 5GCHF 3ZZ4A 1KY9A 1P9SA 2ZO3H 1ELCA 4XDEA 4A7IB 2BXUH 1ZPCA 3UPEA 1AKSA 3AW0A 3AK5A 2Z9IA 3HK3B 1N8OB 1TMUH 4IN2A 3BTFE 1FJSA 3T2NA 5DJ7A 5J4QA 1D3DB 4B6FA 5DP8A 4MNVA 3UNSA 2A2QH 3FOAA 1QFKH 1ZRBA 2GCHF 2PTNA 3B9FH 3LGYA 4FUHA 4UE7H 2EEKA 2P3TB 2ZFPH 1KLTA 3BTHE 1WOFA 4CREA 3S9CA 1NFUA 2OINA 2BDIA 1QBOA 4O97A 1K1PA 1PPHE 8LPRA 1PQ5A 2QF5A 1O2GH 1ABJH 2XWAA 1O5GH 5FPYA 1SGFA 1OP0A 2R2MB 2XBVA 1XUIA 3E16B 1C5XB 3RXOA 1CHGA 1ZPBA 1EAWA 1QA7A 4WH6A 2AGEX 4AYYB 4IS5A 1B0FA 1GMHF 1GBDA 2K1QA 1S81A 4A6LA 2WPKS 3ATLA 2LELA 3SV6A 2HWLB 2OQ5A 1MUEB 4AFUA 1GL0E 2GKVE 2GTBA 4JK6A 4NA7A 3UFAA 1O5CB 2QC2A 4YO9A 2BMGB 3LJJA 1W8BH 1ZZZA 4O9VA 1GHYH 4ISIH 2QN5T 5GNDA 1NESE 3NWUA 2C3SA 5HGGA 3OY6U 3SJIA 1O34A 1NBMD 3G01A 3TGIE 4J1YA 5EPYA 1IQMA 2W7UA 5DP6A 1Z8RA 1W0JD 3RXMA 2VIOA 3F9EA 5LPFA 4RT1A 4B2BA 1HJ9A 4UD9H 2ZECA 2A4GA 3M37A 1KXEA 1C5PA 2XNIA 2HPQH 2RA0A 1TYNA 5L30H 1BRCE 2G81E 2BDBA 8ESTE 1UK4A 2VIVA 2B7DH 1KLJH 1B5GH 2Y5FA 4ABGA 2VH6A 2VGCB 5AVDA 1AGJA 5C2ZA 1AO5A 1C1WH 1ZSLA 1HYLA 1VCPA 1AI8H 1GJ8B 1GBMA 1EJAA 1BTHH 2D2DA 1HAPH 2HALA 5A09A 3BTGE 2JETC 1LHCH 3DSOA 2FI5E 3MO9A 3RC4A 3SUDA 2AGGX 1LHGH 1P12E 1MU6B 3Q3XA 1BTPA 2AIPA 4LZ1H 1C2HA 3KQEA 1HAVA 3D62A 1XUKA 1DICA 2FOEA 1P3EA 6GCHF 1KXDA 1UVUH 5C1YA 3W1EA 1CSOE 3BN9A 1FXYA 5EXLA 1C2GA 3GY8A 1TPPA 2PP6A 4DIHH 1HXEH 1O3AA 1DSUA 1XVOA 2VIDA 3RMNH 3Q77A 4KKDA 2FOFA 2W3KA 3RC6A 1WQVH 3PLBA 1K1JA 1SQAA 1OHHD 3BG4B 1TPOA 2ZZUH 3PB1E 1CHOG 1GI8B 3JZ2B 1L2EA 3DA9B 1C1OA 2GCTB 1K22H 1XX9A 1N6YA 4WXVA 2VBCA 2ILNA 1ZSJA 3RXBA 2CXVA 4MG3A 5LPEA 4BAMB 4MVNA 5J4SA 3RXEA 2H2ZA 2RDEA 3P17H 4Y76A 2ZHFH 4AG2A 4ESTE 1AE5A 3ZZ7A 1A0JA 1JRSA 5T6FA 5T6GA 2LP6A 4O3TA 1DOJA 1O5AB 1FZZA 1P11E 1LKBA 4SGBE 1BBRH 2QYIA 3GY2A 1LVOA 1UHBA 4OS4A 2VWLA 5DPAA 2FLRH 1D3TB 1C2JA 3URCA 1EP5A 2V35A 3F68H 5C67A 1SHHB 3EAJA 1A46H 3PROA 1TFXA 2W7SA 1EJNA 3CP7A 3FP8E 2A4RA 1NRRH 1QBNA 5EW2H 3P8GA 1S85A 3DHKH 3T28A 2Y7ZA 3HPTB 3I77A 1C2EA 2GDDA 1TX8A 1KYNA 4MQAA 3SI3H 1TBZH 2C90B 4FOUC 1C5UA 1RTFB 1S83A 5EOKA 4NGAH 5L2YH 3RXAA 4X8VH 1ZLRA 1F0RA 1H8HD 2A7JA 4IMQA 3M7TA 2OBQA 1C5NH 4WMFA 4Y8XA 3T62A 1SGQE 4ABDA 2D26C 2ZF0H 2FM2A 1H9IE 1OKXA 1P06A 1SGCA 3STIA 1BTZA 3SNBA 2WV4A 4MDSA 3RU4T 4PROA 1ANCA 1KDQA 3T26A 1O31A 1TQ0B 3QZRA 4ZKOU 3F1SB 4CRGA 5FX5A 3PV2A 3BSQA 1L1GA 1NO9H 5FXLA 1O3PB 2ZDNA 1L0ZA 4GSOA 4K5ZA 3GCTG 3ZZCA 1KTSB 2RDLA 1AE8H 1W0YH 1O3GA 2TGDA 2F9PA 2EI7A 4WH8A 3HKIB 1NRSH 4LK4A 4U01A 4FUFA 1O3FA 1WTGH 1YKTA 3N7OA 4FUGA 2ZU3A 3SNCA 7KMEH 1QIXB 4X6NA 1TBRH 4YTAA 5FHTA 1AWFH 3LIWA 3T25A 4YOGA 2R3YA 3QTOH 4K2YA 3SHCH 2XBXA 2HVYB 2AYWA 2NU0E 3RXSA 1ZHMA 1Y5BT 3F6UH 1C5TA 4AB9A 1O3MA 2PKAA 4CBOA 1ZMNA 3A83A 1AMHA 1FDPA 1C1SA 4JZIA 5CE1A 3EYDA 3VG8A 1HIAA 1OYTH 1MMJN 5EQRA 4A5TS 3HGNA 5F8XA 1NU9A 4VGCC 1O3IA 2BD3A 1SC8U 1VJAU 1QTFA 4ZHLU 4KP0A 3SU3A 1IHSH 1EQ9A 1U6QA 1DSTA 4YXWD 1TBQH 3W94A 2QE7D 2ZQ2A 1VCWA 1KTTB 2GV7A 3KNXA 1C4V2 4ZUHA 2C8YB 5FBEA 1FPHH 2HGTH 1AY6H 1ZOMA 3V13A 1V2QT 4I7YH 5FL7D 3PRBA 1G2MA 1CA0B 1WTHD 1WBGB 3TU7H 1AVGH 2I6SA 1ANDA 3A8DA 4FUDA 3Q00A 1JRTA 2J34A 5DK1A 1CBWC 2FWWA 5LPRA 1Y5UT 3E3TA 4ABEA 1A3EH 3NPSA 3QK1A 3PYHA 5JBAS 2F9NA 3A8BA 1QL8A 3JZ1B 8GCHG 2AIQA 2XWBI 2FIRH 2ZCKP 3GY7A 5BRRE 1V2PT 1C4U2 3PMHB 3D65E 3LC3A 1C5YB 2P8OB 2ZI2H 3O8CA 1PYTC 3MNXA 5H4IB 1MBQA 1Q31A 1BJUA 5EQSA 1O2PA 2FYQA 2ZPSA 2VB0A 1O2UA 4AX9H 3BV9B 2EQNA 4AC9A 1C2IA 4AYVB 1W14U 3RXDA 4JZEH 2UUJB 1DDJA 1P2NA 1PPEE 1C4Y2 1JXPA 1ZTLA 3GS9A 1K0HA 2P95A 4NA8A 5IDKA 1G36A 3N7EA 1GI9B 1RIWB 1BRUP 1CO7E 1K21H 3UREA 3N99A 2Z7FE 1JMOH 4BAQB 1C5MD 1EAXA 3SUEA 2ZP0H 1V3XA 1DPOA 1GDUA 2TGTA 1PYTD 5DP9A 2F4LA 3VB5A 3S0NA 2GD4B 3CS0A 3IITA 1P2IA 2W3IA 4GCHG 1F2SE 2H5CA 1ELBA 1CBWB 1DLKB 1DXPA 1ELDE 1QJ6B 1IQNA 1GPZA 1H8ED 5A8YA 1P0SH 4Q2KA 1SPJA 2EY4C 1EZUC 5EU8A 2HOBA 9LPRA 2P16A 4UDWH 4AGJA 2FS9A 1L1JA 4CHAC 2STAE 1OWJA 1EZQA 2QXGA 4UFDH 4Y6DA 1UTJA 3MFJA 1C5WB 1IHTH 1O2VA 3PO1B 2ZHQH 3M3VA 4XBCA 3RP2A 4Z0KA 4XBBA 1E1RD 1QB6A 4BTTB 2BQ6B 2WUBA 2BDAA 1GI5A 1OWHA 1P3CA 5F03A 1FAXA 3SV2H 4NA9H 3GDSA 3VXFH 1FIWA 5EXMA 1A5HA 5F53A 4Y8ZA 1O2SA 3UY9A 1J15A 3S9AA 5EW1H 1JBUH 2XNDD 3STJA 1KMHB 1EJMA 3F0OA 2VU8E 1BBRE 4ZKSU 1MH0A 3OEHD 1FY3A 1AB9C 2BLVA 2YMSD 1BMAA 2XYAA 2C8ZB 2P94A 1ELFA 1F7ZA 3GY6A 6CHAC 2VWOA 3MH7A 1F0TA 1HAHH 1SGNE 3RDZA 1YM0A 1X7AC 1DWBH 1Y3UA 1P8VC 3RXHA 2L74A 4AG1A 2KM0A 3GOVB 4HGCA 5FPSA 2BOKA 1Z7KA 2CHAC 1BA8B 1GBTA 3AAVA 3VB4A 3KIDU 4INHA 2KR7A 1GJ6A 1UJ1A 3UOPA 1LVYA 1GCTC 5EG4A 2ZFQH 3A7TA 3UWIA 1NM6A 2ZHDA 2ZKSA 5HKKD 4NIYA 1DE7H 4FUEA 1C2LA 2YMSB 5T3HA 3A7WA 5JDUB 2ZA5A 4X6MA 1GVLA 1E36B 4XFQA 1TMBH 1SGFG 3W95A 1A4WH 1HJ8A 2WPLS 4KTUA 1GHBF 1TA2A 2BVRH 1XM1A 2ZFFH 1ZJDA 5L2ZH 2ZFSA 3M5OA 4Y0ZE 4A1TA 4D76A 4DT7B 4YOJA 3ZVBA 1NN6A 5K0HA 1QB9A 1XVMA 2GX4A 1NRQH 3M7UA 1O3EA 1Z1IA 3ZVEA 4CRDA 1UCYH 3BTWE 5PTPA 3RXPA 2BVSH 1T7CA 2A4OA 2ODPA 2AFQB 1G37A 3FZZA 1QRZA 3WWBA 2J5UA 4JZ1A 3T5FH 2FP7B 1DY8A 3UQOA 1TLDA 3SU1A 3LT3A 1O35A 1FPCH 1TGCA 2RG3A 1G2LA 6CHAB 2SGQE 2JIZD 4RI0A 2AEIH 2VIQA 4FVDA 2WHXA 6LPRA 1OP8A 1TNHA 2CHAB 4WJG2 1BTWA 1XKBC 1P2QA 4OS2A 4JK5A 1DUEA 1GMCF 5L6NH 2ANWA 2P3FH 2ZTXA 5FCRA 1C1MA 1WCZA 2OTVA 2KCAA 1TX6A 2AHME 4NFFA 1T8LA 3SQHE 5GXPA 1V2NT 1J17T 1GBAA 4MPWA 2XW9A 2BD8A 1MKWK 2A2XH 1PQ8A 2FLBH 1TPAE 1A5IA 1MABB 6ESTA 2XCNA 3K6YA 5C5NA 2G51A 1O2IA 2Z6BD 3MH6A 4AFSA 1Y3WA 1TOMH 3TGJE 5FPTA 2V3MA 4ABHA 3TH4H 3ITIA 5ESTE 4Q7ZA 4I32A 3VGCB 4B2AA 5GPIB 2I6QA 3TNSA 3RXLA 2F9VA 4NSYA 3SYJA 3U1JB 2CJIA 2CMYA 1LKAA 4FU9A 4LXBH 4X1RU 1LO6A 3MQKC 2ULLA 1LCYA 1QRWA 1SVPA 3A80A 2CGAA 5DP7A 2OBOA 5DSFA 3RXKA 1VR1H 1ZTJA 4MPUA 4NZQA 1LHFH 3M5LA 3M3TA 3L33A 1UMAH 1W7XH 3TK6A 2OC1A 1H9HE 2PUQH 1ABIH 1CQQA 3RU4E 2DE9A 1DWCH 3MMGA 2BXTH 3NKKA 2GGVB 2BLQA 1OWIA 3P92A 1BRAA 2Y81A 5FBIA 4MNXA 2GT8A 1D4PB 1N6XA 1FN8A 3E8LA 1D3PB 4R0IA 2VGCC 3ZZ9A 2HVXA 1OWEA 2QIQA 2FDAA 1VITG 4BTIB 3S9BA 5AFYH 4X8UH 5EGMA 1RTLA 2ZFTA 2HPPH 1GBIA 2K8IA 5JPMH 3F2GA 3SU6A 4I86A 1AWHB 1G30B 2ZTYA 1WU1A 3LPRA 4CH8B 3PRDA 1XMNB 5I46H 4NWKA 1HDTH 1NY22 3VFEA 1BCUH 5A2MH 1T8MA 1QL9A 1SGDE 1OWDA 2QXHA 5GCHG 3TNTA 1FY8E 3H09A 1MQ5A 1RGQA 1LQEA 4BNRA 2BQ7B 5C1UA 1THPB 1FQ3A 4RN6A 1S6FA 1ZTKA 4BAHB 3TGKE 1GCDA 2Z3CA 3MU4A 3FO8D 3GYLB 2AMDA 2BZ6H 1FI8A 4TPYA 3SNDA 3LC5A 2SGPE 1V6DA 1S6HA 4INKA 3BG4C 1GDNA 2GCHG 2B0FA 2SGDE 3ZVGA 1GBFA 1T31A 3DFLA 3FFGA 1EAIA 2GCTC 5HMAA 3FAOA 1A0LA 1SL3A 4IMZA 4KTSA 1O32A 4D7GA 2NU1E 2R0LA 4Q63A 2H9TH 1YBWA 3ZZ8A 2HNTE 3ZYDA 2FTLE 4WMDA 2PLXA 1G32B 1HAXB 2OC0A 4DVAU 1TNKA 2KCPA 2NU4E 1BOQA 2PKSB 3K9XB 2O9QA 1J8AA 1GMHG 2UWOA 1W10U 2QAAA 1GBHA 1TGSZ 1GJDB 3R0FA 5EJ1A 3ZZ5A 1YLNA 2UUYA 1T32A 3QX5H 1TRMA 1C2MA 1EASA 2C8XB 3A7YA 3PLPA 1FY5A 1FLEE 2PR3A 4YESB 1EUFA 4SGAE 4DY7B 2ZHWH 2Q6FA 2XBYA 5CDFE 2V0BA 1TNLA 1F0SA 3RXVA 1YP9A 4DIIH 1S0QA 3ATMA 5F6MA 1YLDA 2G00A 3A7ZA 2SGAA 1GVKB 1UTNA 1UTQA 5ESBA 4ABIA 1CT2E 1O38A 4IN1A 2XBWA 2BYAX 3UQVA 1Z8GA 1NT1A 4GUXA 3SGBE 7GCHF 4X8TH 4F49A 4WF8A 1T4VH 2WINI 2ZU5A 1BZXE 1S6LA 1UK3A 1G3DA 1P09A 3F9HA 1E0FD 2B8OH 1HB0B 2QXIA 1A2CH 3OSYA 5EJZA 4U32A 1GDQA 5C17A 2JDID 3SV7A 3WWFA 3ATIA 4OS6A 1DFPA 4TY6A 1UTPA 2W6JD 3EDXB 5CHAB 1IOEA 2A7CA 1O2HA 1AZ8A 2NU2E 2UUFB 3QN7A 1MTVA 4J2YB 5DN6D 4XOJA 1UCYE 4HI3A 1BITA 3GDVA 4YLUA 1ARBA 4AZ2B 1ESTA 1BJVA 1YCPM 3F2FA 2ZU2A 1Z8IB 2ODYB 1O3CA 3UNRA 3RLYH 3UB0A 3RXIA 4B2CA 1MCVA 3OY5U 1HPGA 1S84A 2ZU4A 1MTSA 2WPIS 4A92A 4B75A 6GCHG 2WV5A 1BT7A 3SU4A 1FNIA 1FONA 2RCEA 1GI0A 3SUFA 1CGHA 1Y3XA 2CV3A 4CRCA 1EZSC 2WPDD 1SSXA 2F9BH 3QDZB 4Q7XA 3NUMA 1DVAH 5IYTA 1SGEE 1OSSA 1P2MA 1TE0A 3EA9A 4DCDA 3KHVA 1N1LA 1NFXA 2QA9E 4CR5A 3GCNA 1RS0A 2R9PA 2FEQH 5KECA 2IOTA 2FX4A 4I8GA 3PLKA 1ZJKA 2G4UA 2OC8A 2XRCA 3PWBA 1QJ1B 4M9FA 5JB8S 1C1QA 2IPQX 2VVUA 5HIYA 4Y10E 4D8NA 1WQSA 3T27A 2Y5GA 3RUOA 5TJXA 1A5GH 1C2FA 1HNEE 2ANYA 4IC5A 1ZYOA 2Z9JA 3KL6A 4X2XA 4BANB 1C5SA 3LGWA 4HFPB 4RSPA 1V2KT 4WXIA 1EOLA 1DWEH 1PPCE 3SNEA 2BX3A 1FY4A 1W2KH 1KSNA 3GY5A 1BIOA 1ZGVA 2GZ7A 3FP6E 1CA0C 1Y8TA 4GPGA 1P2JA 4FUBA 1SMFE 2FXRA 1QQUA 2FO9A 7LPRA 1C5LH 1WXRA 1LVBA 2XC0A 1FIZA 4I8JA 2FI3E 1QRXA 3A81A 1SQTA 3GY3A 3PMJA 2ZFRH 4M7GA 5T6DA 1LHDH 4ZCNA 3UAIC 2DE8A 3HATH 1K1OA 3U28C 1T8OA 1MTNB 2W6ID 1O2RA 1PQ7A 1NTPA 5KEDA 1EOJA 2J9NA 3LH3A 4DT4A 2FTMA 1DS2E 4UFGH 4B1TA 2P8OC 1GMDF 1ZHRA 3BIUH 1XXDA 3NCLA 3E90B 4UONA 2ZU1A 4Q4LA 4WY3A 2XOKD 4Z6AH 1BB0B 3A8CA 2JH0D 2ASUB 1V2ST 4Y7BA 3TJNA 4ZHAA 1O2QA 4E7NA 1YY3A 3O8RA 4AORA 1G3EA 4FXGH 3AAUA 5CHBA 3LJOA 1RIWC 2ZDVH 1PPGE 3UUZA 1H8IH 2HRVA 1BTXA 1V2WT 4R8TB 5EJLA 2A4QA 1OXGA 2BHGA 3RXRA 3MU1A 1NS3A 4JZDH 1GHWH 2ZWLH 3PM3A 3QO6A 1JIMA 2AERH 3M36A 4GLYA 2FMJA 4ZKRU 2VVCA 1D3QB 3HKJB 1D6RA 2JH5D 2SNWA 2OK5A 4OM9A 1H4WA 1BRBE 3SU5A 2PGBB 1QHRB 5B6OA 1O3HA 5LH8A 4YLQH 1RD3B 2PHBA 1CT4E 3DD2H 1TB6H 5F8ZA 2FYRA 3A7VA 3KGPA 1C9TA 2BOHB 1CT0E 1V2RT 1O37A 3D23A 2GZ9A 5DO4H 2AH4X 3SNAA 3U69H 1UW7A 5TCCA 3NZIA 2R3UA 3ZVCA 2NU3E 1Z6EA 2VIPA 1LDTT 2BD4A 2AGIX 1P01A 1GVZA 1AU8A 3C1KA 3QZQA 1AFEH 2VWMA 1OOKB 5CMXH 1YPHE 2W26A 1EKBB 1BUIA 2IPHA 3PO1C 1ZMJA 1IQIA 3HK6B 1LQDB 2WZQA 1SGIB 1C5QA 2HLCA 2OD3B 4K1EA 1GBBA 2EI6A 1EPTB 3BTKE 4OS7A 3KN2A 1ETRH 1ID5H 1MAYA 3EA8A 5A0CA 1BQYA 1FN6A 3SO3A 3BEUA 1O2KA 3OEED 3M5NA 3TK5A 3M5MA 3TITA 1MBMA 2Z3EA 3SHAH 4ISNA 4X1SU 1QB1A 1Y3VA 1DXWA 3A88A 2JH6D 1J14A 1CGIE 1TGTA 3MWIU 1BTUA 2JKHA 3SU0A 3GDUA 5HYOA 4WWYA 4CRAA 1HAGE 2V6NA 2VH0A 2KCYA 2KX4A 5A0BA 4GAWA 1UVTH 5DP4A 3MNSA 2BVXH 2G8TA 2BDHA 1NROH 1D6WA 2Y80A 3M3SA 1ELTA 4X8SH 3RXUA 5E0JA 3RXFA 4LZ4B 4IGDA 4TPIZ 1GBEA 4BXWA 1V2JT 3HGPA 3M7QA 1OX1A 2F9UA 1YYY1 4H42U 3LONA 5GIBA 5EXNA 3NRLA 3D49H 5E2OA 1MKXK 1GJ5H 2YMSC 2M2AA 3A86A 2HLDD 1AZZA 3E6PH 3RXQA 5GDSH 3TJVA 2Y6TA 2HNTF 4CR9A 2XC4A 1XUGA 1PFXC 3MU8A 1SG8B 3RC5A 2A7HA 3K2UA 1A3BH 1ARCA 2F91A 1O5FH 2ZC9H 3SJOA 1YCPK 1FV9A 4NFEA 2JJ1D 3KQCA 1P04A 3QGNB 1SFQB 1KLIH 4ASUD 3WW7A 2R0KA 4XBDA 2L6OA 3EGKH 4AFQA 1GJBB 2A0QB 3SJ8A 4DJZB 1AD8H 1FUJA 5JBCS 1GG6B 3SUGA 5E0HA 2SGFE 2ZGCA 4ISLA 2FOAA 1GHAF 4D9QA 2BY9X 1O5EH 1QJ7B 2PFEA 2J94A 2YOLA 2BLWA 4TWYA 1UTOA 2CF8H 3MYWA 3ATKA 1JOUB 4K8YA 1K1LA 1O3OA 2M5TA 1EATA 1QQ4A 2ZDAH 1C1TA 2Q1JA 3E0NB 2P93A 4I8HA 1GI1A 1MTUA 4OGYA 5FCKA 1W13U 2D1JA 2YNBA 1SR5C 1O2OA 3SI4H 1MAXA 1SI5H 4ZKNU 1RTKA 1UVOA 2B5TB 2GMTB 2TBSA 3GICB 2WSSD 3ODDA 3SZEA 1YPEH 4MNYA 4OS5A 3ZV8A 2ZDLA 3FANA 1AUTC 1RXPA 2C4FH 1QA0A 1VGCB 3SZNA 3OX7U 1ESBA 1OS8A 1Q3XA 5T1VA 2B9LA 1W12U 2Q6DA 4MPXA 5FX6A 1W0KD 2QXJA 2STBE 1T8NA 2KAIB 5EODA 2O8WA 3V12A 1QNJA 4U2WA 5C1XA 3LGIA 2G55A 3SORA 1DUAA 1SQOA 4NZLA 2BD7A 4B6EA 2QF4A 4XE4A 1ACBE 1DANH 3LOXA 3L6PA 5KGOA 3VGCC 1IAUA 3S69A 2RA3A 1UTMA 1SGTA 3TK9A 4IW4E 1BMLA 4BAKB 4RT0A 4MNWA 4E06H 1C1RA 3RXCA 3P8FA 1SFIA 2Q6GA 4BAOB 2IJOB 2OXSA 1HJAB 1K1IA 2GV6A 2FOGA 1KIGH 1XUHA 1C5ZB 4I31A 2WYJA 4JYUH 5E8EH 1AVXA 2PSYA 4B76A 1MZAA 1C1UH 5B6LA 3TJOA 3BTDE 3V0XA 3KEEA 1PPFE 2Y5HA 3GISB 1SLXB 2BB4A 2BQWB 2Z3DA 3PV4A 1TALA 1O2XA 1CA8B 1SGRE 1SQRA 2ZTZA 3VB3A 1Q2WA 1TNJA 2LNCA 1E35B 3ZVFA 2AS9A 1VITH 1XUJA 3Q3KA 4K1SA 4ACAA 3AVZA 3OTJE 3S7KB 2J98B 1GWAA 2FOBA 1WAYB 2O8LA 4ACBA 1S0RA 3ZZ3A 1GHBG 3LGUA 1AFQB 3VPKA 5TCAA 2GZ8A 3SW2B 4WMEA 1TA6A 2IJD1 5EQQA 1YGCH 4Y79A 1MQ6A 2G52A 3O8BA 2F9OA 2C8WB 2G5NA 1W0ZU 2EC9H 4FVBA 1O2TA 1HAZB 2VVVA 4K1TA 4D7FA 4XSKU 5JB9S 1E37B 3Q76A 1SBWA 2ZHEH 1GBJA 1ELGA 1HAIH 2Z9KA 2LPRA 1G9IE 3ZZAA 1EB1H 4F55A 2OLGA 1F0UA 1E34B 1WSSH 3IWMA 4AB8A 2C93B 1ESAA 1RJXB 1HFDA 3H7TA 3SN8A 3V7TA 1DWDH 3SOSA 4NIWA 3DUXH 2VNTA 1OPHB 2GVFA 4A1VA 3P8OA 3QTVH 1F92A 2Y82A 3B23B 1D9IA 1GMCG 7ESTE 2CF9H 1EXFA 1VKYA 3F0PA 2SFAA 1A7SA 3CNRA 1TX7A 3MNBA 2PKSC 2YNAA 4H6SB 1TGNA 1INCA 2ZEBA 5JBBS 3BF6H 1W11U 5E2PA 1A1RA 2Y7XA 4FU8A 4TT3D 4YZUA 2TRMA 4TYDA 1YPGH 8KME2 1UVPA 2BDCA 1O30A 1O0DH 1OWKA 3TLOA 2FODA 1CE5A 1WV7H 3V3MA 2A5AA 1O2MA 3MO6A 1SOZA 3U9AH 1ELAA 2BY7X 2XC5A 4JZFH 2PWXA 3LU9B 4TSFD 3GCHC 1HV7A 1IQHA 3OE7D 4ISOA 5EPNA 1BBRK 3TJUA 4TY7A 4X1QU 4YT6H 4INLA 1P2OA 3TPIZ 1V2MT 2ZCHP 1UTLM 1TAWA 2TGAA 1O33A 2GT7A 1P57B 4JCNA 2ANMH 4DG4A 2Z9GA 1QZ8A 1GGDC 1XXFA 1THRH 1CHOF 2QV1A 1ELEE 3FVFB 3OFND 3AASA 1MKWH 2AMQA 2FX6A 2K0QA 3MHWU 3TIUA 3MI4A 1ZR0A 2J38A 2BD2A 2FS8A 1LPZB 2KZ4A 3QGJA 1O2YA 5CHAC 1VJ9U 3F9FA 2EI8A 1NC6A 1PJPA 4GHQA 4AOQA 1ELVA 1KXCA 4X2YA 2A1DB 1MZDA 4DW2U 4UEHH 2ZDMA 3RU4D 4GHTA 1UVSH 1SGPE
chains in the Genus database with same CATH topology
3SQEE 3EE0B 1E38B 1GL1A 1LVMA 1YF4A 1TOCB 3C27B 3UR6A 3I78A 2BM2A 1BHXF 3ZZ6A 1GI6A 4DOQA 3LGVA 1TIOA 5DG6A 3GCHB 3ZVDA 1YPMH 1S82A 1O2NA 1AIXH 3GCOA 1LTOA 1VCQA 3R3GB 1GJCB 2ZCLP 2UUKB 3H7OA 3QWCH 3ZZDA 2J92A 1HUTH 2F83A 3A8AA 3K6ZA 2TGPZ 1HAOH 2F3CE 3E1XB 5SGAE 1GGDB 1V2OT 3K65B 3EA7A 1AQ7A 1GHXH 1EPTA 1HAYB 3I29A 3H5CB 3E0PB 3ODFA 2P3UB 1HGTH 4D9RA 2BX4A 1V2UT 1ZHPA 2OUAA 3PWCA 3OYPA 2BY8X 2OQUA 4X1PU 1PPBH 4BXSA 1UTKA 1MCTA 3RMMH 2QF3A 3CENA 2G5VA 1W7GH 2HNTC 2QF0A 4IC6A 4O3UA 3NK8A 1GJ9B 1K1MA 4OGXA 4QT8C 1L4DA 3U8TH 1ANBA 5JYIA 3M61U 2G4TA 2W5EA 1ZSKA 5E0GA 1MTWA 2XXLA 4I33A 1IQFA 4ABJA 5GWZA 1Z6JH 2Z94A 3QUMP 5DP3A 1O3NA 2BY5X 1IQKA 2JETB 3GCTF 1O3JA 1GJ4H 3RM0H 1FAKH 5A0AE 1BMMH 1GBCA 4JMYA 1F5RA 3P6ZB 4ZROA 1EX3A 4RKOB 3PTNA 4ABFA 4HZHA 1C5OH 1ZRKA 2ZNKH 1ANEA 4K8BA 2A5KA 1EAUA 1MTNC 3ATWA 3BIVH 2UWPA 4FUIA 4KTCA 7GCHG 1VZQH 5ETXA 1AKSB 3BEFB 1LPKB 3WY8A 4X2WA 2ZDKA 1W3CA 4ABBA 4K3JA 1G3CA 2BY6X 1G3BA 2THFB 4X2VA 2AMPA 1QL7A 2UWLA 3TH3H 1O3DA 4BOHA 2ZIQH 1O2ZA 1HRTH 4O03A 1EZXC 4NIXA 1DLEA 1SB1H 2OC7A 1K1NA 1NZQH 4Y71A 2J2UA 1IQJA 4E05H 4GVUA 1ZGIA 2WPHS 3RXGA 3FP7E 3VB6A 3TH2H 3RM2H 2VIWA 3UOUA 1RFNA 2BZAA 3L3TA 1GJAB 1L4ZA 3LDXH 1YPJH 2D8WA 3ESTA 2A31A 2ALPA 5AHGH 2BLOA 3BTTE 2H6MA 4A1XA 2BTCE 3UR9A 5F8TA 3A87A 1A0HB 2ODQA 4U30A 1TRYA 2ZPQA 3GYMA 4LOYH 4MTBA 2FOHA 4K69A 2R2WU 1P9UA 2ZG0H 1GI7B 3MH5A 1HBTH 1NPMA 5A8ZA 5DGJA 1DT2A 3RMLH 2KAIA 5I25A 1TMTH 8GCHF 2J95A 2VJ1A 4OS1A 2CN0H 3PMBB 3SJ9A 3ZVAA 1GI4A 2ESTE 1MD7A 4JYVH 4IBLH 5DKMA 1AHTH 2WYGA 4K60A 4X6OA 1EPTC 1WYKA 1L1NA 2GDEH 4AGKA 1IQEA 1O2WA 5AF9H 4THNH 1TONA 1NRNH 1YLCA 2WPMS 3KF2A 1TNIA 3UNQA 1SLVB 2O8UA 1AVWA 2PUXB 2PW8H 2TPIZ 3T29A 4CRBA 2FI4E 1Z71A 1EP6A 3P95A 1QCPA 4I8KA 1S5SA 4NIVA 2IN2A 1XKAC 1J9CH 2FZZA 2A32A 4GCHF 3A7XA 3ELAH 3MU5A 3KQDA 1PQAA 1QY6A 1UO6A 1DITH 3LH1A 1HAVB 1XUFA 4UFFH 1O2LA 4ZHMU 1JIRA 3A84A 4H4FA 3PTBA 4ISHH 3QLPH 1TRNA 1C5VA 1GJ7B 1H8DH 4X1NU 5AFZH 2QGRA 2SGEE 1GMDG 3GY4A 3MU0A 2J4IA 1SHYA 3FZDA 4NWLA 3MTYA 2OCVB 1BMNH 1O3BA 1Z8JB 5K7RA 1NFYA 3BG8A 2FPZA 4VGCB 1V2TT 1O36A 1GG6C 1NRPH 1C9PA 3OU0A 1SOTA 1LHEH 1QBVH 5G4BA 1C1PA 5FAHA 1RRKA 3MNCA 3VXEH 1P10A 1UCYK 3VB7A 1BTYA 3SV8A 4WVPE 1SLUB 2PSXA 4B71A 1SGYE 4X0WU 4ZMAH 1PPZA 2P59A 1F5LA 2XCFA 2ZGXH 4TWWA 1NU7B 1ZMLA 1UHBB 1H9LB 1NFWA 5HXFA 3O8DA 4Q80A 1O5BB 1SLWB 9ESTA 5C20A 2GMTC 4DURA 1O5DH 2BDYA 2FOCA 2NWNA 4ZAEA 1MD8A 4I8LA 3ENSB 3P70B 4B73A 1V2LT 1VGCC 3UTUH 3EQ0H 1DX5M 1UK2A 1B0EA 3SGAE 4CRFA 4YM9A 1LMWB 1K28D 1HLTH 4RKJB 3P8NA 3ZYEA 1ETSH 4ZXXH 4E7RG 5DP5A 1YPHC 1GHVH 1FMGA 3IG6B 3TVJB 1QURH 3RXJA 1TQ7B 3DFJA 5ABWA 2SNVA 4FUJA 4AFZA 2TIOA 3KQBA 1GI2A 3F9GA 3RXTA 4ABAA 4UFEH 5HM9A 4X6PA 2H9EH 1TWXB 1HCGA 2XTTB 4B74A 2BDGA 3BTME 4Y8YA 1QGFA 1GI3A 1HJAC 1MU8B 1KDQB 1JWTA 3SU2A 3LKWA 4F4OC 4CH2B 3LGTA 2PTCE 3U1IB 4NCYA 2H9HA 3ZZBA 3UWJH 1IQLA 1FY1A 1P05A 1ORFA 1TNGA 2O8MA 1QR3E 2H5DA 3B8JA 1YPLH 1THSH 3NXPA 3Q3YA 1AUJA 1YPKH 1K2I1 3AW1A 1WUNH 2FOMB 1V2VT 2V3OH 1P2KA 2PGQB 1O3LA 4CHAB 5BPEA 4YOIA 2ZGHA 3MH4A 3VEQB 5LGOA 3MO3A 2VINA 1KXBA 4Q7YA 2OP9A 4KELA 1KXAA 1AFQC 5C5OA 4BTUB 2DUCA 4MPVA 4MLFB 1ZPZA 1IQGA 2PKAB 1C1VH 4Y0YE 1GHZA 1TPSA 2BD5A 5HM2A 3BEIB 3BTQE 5GJ4B 2ZQ1A 1BDAA 1J16A 4KGAA 1HIAB 3RLWH 2QCYA 3U98H 3U8OH 3A85A 2ZGBH 4FU7A 1B7XB 3SJKA 1GHAG 1BHXB 2FESH 4H6TA 2EA3A 1O3KA 1P03A 1C1NA 1DY9A 2QY0B 2A5IA 3M35A 1AB9B 3UIRA 1ETTH 1T4UH 1C2KA 2Z9LA 3RMOH 1N8OC 1P02A 1KXFA 1CGJE 2ANKH 1TABE 2WUCA 2V3HH 1Y5AT 3CS7A 1Z1JA 1M9UA 1C2DA 1MKXH 2WPJS 1O39A 1O2JA 4NSVA 4FUCA 1OYQA 4YT7H 1Y59T 3KCGH 1CVWH 4CBNA 1H1BA 1K9OE 1OP2A 1EB2A 2A45B 2GP9B 4DGJA 1C5RA 2ZGJA 3SBKA 1GCTB 3DT0H 3ZV9A 1AN1E 1DM4B 1VITF 1CU1A 1YC0A 2VWNA 1YCPH 3S7HB 4Y7AA 4ZXYH 3URDA 5C3NA 3A82A 3PMAB 4AN7A 2ZPRA 1F5KU 4NG9H 1A61H 3BTEE 2H1UA 3MOCA 3SV9A 4ZH8A 3SGQE 3U8RH 1GBLA 5JBTA 2BD9A 1LPGB 2ALVA 2PV9B 4HTCH 3E91A 1GBKA 4JYTA 3A89A 5A8XA 2O8TA 4ASHA 4Y11E 1HXFH 1TGBA 1Y3YA 5GCHF 3ZZ4A 1KY9A 1P9SA 2ZO3H 1ELCA 4XDEA 4A7IB 2BXUH 1ZPCA 3UPEA 1AKSA 3AW0A 2Z9IA 3HK3B 1N8OB 1TMUH 4IN2A 3BTFE 1FJSA 3T2NA 5DJ7A 5J4QA 1D3DB 5DP8A 4MNVA 3UNSA 2A2QH 1QFKH 1ZRBA 2GCHF 2PTNA 3B9FH 3LGYA 4FUHA 4UE7H 2EEKA 2P3TB 2ZFPH 1KLTA 3BTHE 1WOFA 4CREA 3S9CA 1NFUA 2OINA 2BDIA 1QBOA 4O97A 1K1PA 1PPHE 8LPRA 1PQ5A 1O2GH 1ABJH 2XWAA 1O5GH 5FPYA 1SGFA 1OP0A 2R2MB 2XBVA 1XUIA 3E16B 1C5XB 3RXOA 1CHGA 1ZPBA 1EAWA 1QA7A 4WH6A 2AGEX 4AYYB 4IS5A 1B0FA 1GMHF 1GBDA 2K1QA 1S81A 4A6LA 2WPKS 3ATLA 3SV6A 2HWLB 2OQ5A 1MUEB 4AFUA 1GL0E 2GKVE 2GTBA 4JK6A 4NA7A 3UFAA 1O5CB 2QC2A 4YO9A 2BMGB 3LJJA 1W8BH 1ZZZA 4O9VA 1GHYH 4ISIH 2QN5T 1NESE 3NWUA 2C3SA 5HGGA 3OY6U 3SJIA 1O34A 3G01A 3TGIE 4J1YA 5EPYA 1IQMA 2W7UA 5DP6A 1Z8RA 3RXMA 2VIOA 3F9EA 5LPFA 4B2BA 1HJ9A 4UD9H 2ZECA 2A4GA 3M37A 1KXEA 1C5PA 2XNIA 2HPQH 2RA0A 1TYNA 5L30H 1BRCE 2G81E 2BDBA 8ESTE 1UK4A 2VIVA 2B7DH 1KLJH 1B5GH 2Y5FA 4ABGA 2VH6A 2VGCB 5AVDA 1AGJA 5C2ZA 1AO5A 1C1WH 1ZSLA 1HYLA 1VCPA 1AI8H 1GJ8B 1GBMA 1EJAA 1BTHH 2D2DA 1HAPH 2HALA 5A09A 3BTGE 2JETC 1LHCH 2FI5E 3MO9A 3RC4A 3SUDA 2AGGX 1LHGH 1P12E 1MU6B 3Q3XA 1BTPA 2AIPA 4LZ1H 1C2HA 3KQEA 1HAVA 3D62A 1XUKA 1DICA 2FOEA 1P3EA 6GCHF 1KXDA 1UVUH 5C1YA 1CSOE 3BN9A 1FXYA 5EXLA 1C2GA 3GY8A 1TPPA 4DIHH 1HXEH 1O3AA 1DSUA 1XVOA 2VIDA 3RMNH 3Q77A 4KKDA 2FOFA 2W3KA 3RC6A 1WQVH 3PLBA 1K1JA 1SQAA 3BG4B 1TPOA 2ZZUH 3PB1E 1CHOG 1GI8B 3JZ2B 1L2EA 3DA9B 1C1OA 2GCTB 1K22H 1XX9A 1N6YA 4WXVA 2ILNA 1ZSJA 3RXBA 2CXVA 4MG3A 5LPEA 4BAMB 4MVNA 5J4SA 3RXEA 2H2ZA 3P17H 4Y76A 2ZHFH 4AG2A 4ESTE 1AE5A 3ZZ7A 1A0JA 1JRSA 5T6FA 5T6GA 4O3TA 1DOJA 1O5AB 1FZZA 1P11E 1LKBA 4SGBE 1BBRH 2QYIA 3GY2A 1LVOA 1UHBA 4OS4A 2VWLA 5DPAA 2FLRH 1D3TB 1C2JA 3URCA 1EP5A 2V35A 3F68H 5C67A 1SHHB 3EAJA 1A46H 3PROA 1TFXA 2W7SA 1EJNA 3CP7A 3FP8E 2A4RA 1NRRH 1QBNA 5EW2H 3P8GA 1S85A 3DHKH 3T28A 2Y7ZA 3HPTB 3I77A 1C2EA 2GDDA 1TX8A 1KYNA 4MQAA 3SI3H 1TBZH 2C90B 1C5UA 1RTFB 1S83A 5EOKA 4NGAH 5L2YH 3RXAA 4X8VH 1ZLRA 1F0RA 2A7JA 4IMQA 3M7TA 2OBQA 1C5NH 4WMFA 4Y8XA 3T62A 1SGQE 4ABDA 2D26C 2ZF0H 2FM2A 1H9IE 1OKXA 1P06A 1SGCA 3STIA 1BTZA 3SNBA 2WV4A 4MDSA 3RU4T 4PROA 1ANCA 1KDQA 3T26A 1O31A 1TQ0B 3QZRA 4ZKOU 3F1SB 4CRGA 5FX5A 3BSQA 1L1GA 1NO9H 5FXLA 1O3PB 2ZDNA 1L0ZA 4GSOA 4K5ZA 3GCTG 3ZZCA 1KTSB 2RDLA 1AE8H 1W0YH 1O3GA 2TGDA 2F9PA 2EI7A 4WH8A 3HKIB 1NRSH 4LK4A 4U01A 4FUFA 1O3FA 1WTGH 1YKTA 3N7OA 4FUGA 2ZU3A 3SNCA 7KMEH 1QIXB 4X6NA 1TBRH 4YTAA 5FHTA 1AWFH 3LIWA 3T25A 4YOGA 2R3YA 3QTOH 4K2YA 3SHCH 2XBXA 2AYWA 2NU0E 3RXSA 1ZHMA 1Y5BT 3F6UH 1C5TA 4AB9A 1O3MA 2PKAA 4CBOA 1ZMNA 3A83A 1AMHA 1FDPA 1C1SA 4JZIA 5CE1A 3EYDA 1HIAA 1OYTH 1MMJN 5EQRA 4A5TS 3HGNA 5F8XA 1NU9A 4VGCC 1O3IA 2BD3A 1SC8U 1VJAU 1QTFA 4ZHLU 4KP0A 3SU3A 1IHSH 1EQ9A 1U6QA 1DSTA 1TBQH 3W94A 2ZQ2A 1VCWA 1KTTB 2GV7A 3KNXA 1C4V2 4ZUHA 2C8YB 5FBEA 1FPHH 2HGTH 1AY6H 1ZOMA 3V13A 1V2QT 4I7YH 1G2MA 1CA0B 1WTHD 1WBGB 3TU7H 1AVGH 2I6SA 1ANDA 3A8DA 4FUDA 3Q00A 1JRTA 2J34A 5DK1A 1CBWC 2FWWA 5LPRA 1Y5UT 3E3TA 4ABEA 1A3EH 3NPSA 3QK1A 3PYHA 5JBAS 2F9NA 3A8BA 1QL8A 3JZ1B 8GCHG 2AIQA 2XWBI 2FIRH 2ZCKP 3GY7A 5BRRE 1V2PT 1C4U2 3PMHB 3D65E 3LC3A 1C5YB 2P8OB 2ZI2H 3O8CA 1PYTC 3MNXA 5H4IB 1MBQA 1Q31A 1BJUA 5EQSA 1O2PA 2FYQA 2ZPSA 2VB0A 1O2UA 4AX9H 3BV9B 4AYVB 1C2IA 1W14U 3RXDA 4JZEH 2UUJB 1DDJA 1P2NA 1PPEE 1C4Y2 1JXPA 1ZTLA 2P95A 4NA8A 5IDKA 1G36A 1GI9B 1RIWB 1BRUP 1CO7E 1K21H 3UREA 2Z7FE 1JMOH 4BAQB 1C5MD 1EAXA 3SUEA 2ZP0H 1V3XA 1DPOA 1GDUA 2TGTA 1PYTD 5DP9A 3VB5A 3S0NA 2GD4B 3CS0A 3IITA 1P2IA 2W3IA 4GCHG 1F2SE 2H5CA 1ELBA 1CBWB 1DLKB 1DXPA 1ELDE 1QJ6B 1IQNA 1GPZA 5A8YA 1P0SH 4Q2KA 1SPJA 1EZUC 5EU8A 2HOBA 9LPRA 2P16A 4UDWH 4AGJA 2FS9A 1L1JA 4CHAC 2STAE 1OWJA 1EZQA 2QXGA 4UFDH 4Y6DA 1UTJA 3MFJA 1C5WB 1IHTH 1O2VA 3PO1B 2ZHQH 3M3VA 4XBCA 3RP2A 4Z0KA 4XBBA 1QB6A 4BTTB 2BQ6B 2WUBA 2BDAA 1GI5A 1OWHA 1P3CA 5F03A 1FAXA 3SV2H 4NA9H 3GDSA 3VXFH 1FIWA 5EXMA 1A5HA 4Y8ZA 1O2SA 3UY9A 1J15A