3F0OA

Crystal structure of merb, the organomercurial lyase involved in a bacterial mercury resistance system
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
208
structure length
208
Chain Sequence
MKLAPYILELLTSVNRTNGTADLLVPLLRELAKGRPVSRTTLAGILDWPAERVAAVLEQATSTEYDKDGNIIGYGLTLRETSYVFEIDDRRLYAWCALDTLIFPALIGRTARVSSHCAATGAPVSLTVSPSEIQAVEPAGMAVSLVLPQEAADVRQSFCCHVHFFASVPTAEDWASKHQGLEGLAIVSVHEAFGLGQEFNRHLLQTMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Alkylmercury lyase
publication title Crystal Structures of the Organomercurial Lyase MerB in Its Free and Mercury-bound Forms: INSIGHTS INTO THE MECHANISM OF METHYLMERCURY DEGRADATION
pubmed doi rcsb
source organism Escherichia coli
total genus 62
structure length 208
sequence length 208
chains with identical sequence B
ec nomenclature ec 4.99.1.2: Alkylmercury lyase.
pdb deposition date 2008-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03243 MerB Alkylmercury lyase
A PF12324 HTH_15 Helix-turn-helix domain of alkylmercury lyase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.490 Mainly Beta Beta Barrel Thrombin, subunit H Thrombin, subunit H 3f0oA00
3F0OA 3F2HA 3F0PA 5DSFA 3FN8A 5C0UA 3F2GA 5C17A 5C0TA 3F2FA
chains in the Genus database with same CATH superfamily
1VJAU 4MDSA 1V2UT 3SNCA 2H9HA 4Q80A 3GCNA 4AGJA 2RA0A 4NZQA 2CGAA 5H4IB 3OSYA 1CT4E 1TB6H 1HAVB 2EY4C 3ZVBA 3ZYEA 4Q7YA 3LT3A 5F8ZA 1UVTH 1K1JA 1TBRH 2A7HA 1QRWA 2AERH 1Z71A 1O37A 7GCHF 4P00A 3BTEE 1YGCH 1QCPA 2IOTA 1C1SA 2V35A 3CS7A 2W6ID 1J14A 1LVOA 1YKTA 2XC5A 6ESTA 1HV7A 3GDSA 5CHBA 2OC0A 4A1VA 1AZ8A 2OINA 1HPGA 3TNTA 1Q31A 3AK5A 2C4FH 3LGWA 4Y79A 1DSTA 3BTME 2KCPA 4BTTB 1BTYA 1MH0A 2PWXA 1Z8JB 3ELAH 1ZTKA 1SGCA 4A5TS 4DVAU 2Y6TA 1HLTH 4Z0KA 4IMQA 3F6UH 3QUMP 1XUFA 2CMYA 2J34A 3OY5U 2ZFPH 3IITA 2BXUH 3HKIB 5ETXA 4OGXA 4B2CA 2ZDNA 1GJ6A 4ZAEA 3Q3XA 5A0AE 1BTWA 2SGQE 2BZAA 3A86A 3LC5A 3NPSA 1BHXF 1GG6B 2BDCA 3GOVB 3H09A 3T28A 3SZEA 2ZO3H 4IC5A 1VJ9U 3RU4D 1B0EA 4WMFA 5C3NA 1EOLA 2OXSA 5EOKA 1H1BA 4B2BA 2BD7A 2PTNA 3FFGA 1SG8B 4YLQH 4OS7A 3CNRA 1D3PB 2KCYA 5DKMA 3MU4A 1JOUB 1HJAB 4YOGA 4SGBE 1MUEB 2DE9A 2Y7ZA 2ULLA 5DK1A 1P9UA 3AVZA 4I8KA 2BB4A 4BOHA 4NFEA 4DW2U 1LVYA 2FI4E 4AZ2B 1C4V2 4HFPB 2W26A 3BTGE 3EE7A 4B1TA 1PQ7A 4GAWA 1SQRA 1J16A 4TYDA 3N99A 1FY1A 3GS9A 4YM9A 2GMTB 3KEEA 4IN2A 1KXFA 1OYTH 4GCHF 1NU7B 1L1JA 1C4Y2 2ZDVH 4VGCC 1RIWC 3PMJA 4Z6AH 2PTCE 3CENA 4CBOA 1GI3A 1K9OE 1FY5A 1GWAA 1HAXB 2WUCA 5FPYA 4A1TA 1AN1E 1E34B 1CGIE 1VITG 2QXGA 4YOIA 1W2KH 4XBDA 1GBKA 2ZG0H 1GJCB 2FX6A 4X1PU 3GDVA 1ETRH 3M7QA 4XD7D 5HKKD 3GISB 3MNXA 1JMOH 4FU9A 2LELA 1XVMA 1E38B 1LHCH 6GCHF 1LHDH 4H6TA 3ZV9A 1OP2A 1O2HA 1DSUA 1O2OA 2VNTA 2YNAA 2NU4E 3OFND 3TJUA 4KELA 5FPSA 4B6EA 5LPFA 4SGAE 2BDGA 1C5UA 1F7ZA 1FDPA 3A89A 2Z7FE 3UOUA 2ALPA 4KGAA 1GJ4H 1QL9A 4JCNA 1NFUA 1ZJKA 3VXEH 1ESAA 1X7AC 3HK3B 1THSH 2B8OH 4X2YA 1UJ1A 1YWUA 3UR9A 3TK6A 4AB8A 1J8AA 1SGFG 1TALA 1IQHA 3LDXH 2FO9A 4AORA 4BTUB 5FBEA 3KQDA 1XKBC 4AOQA 2OC1A 4XE4A 1WAYB 3Q3YA 2JH0D 3W95A 3VB4A 1UHBA 2QF0A 3DCLA 1DWBH 2JJ2D 2BD5A 2FI3E 3OEED 2LNCA 4JYVH 3MQKC 1KY9A 1BUIA 2WV5A 1O3BA 5F53A 4GHQA 1LQEA 1V2KT 4XDEA 4UE7H 2ZECA 2CV3A 3KYGA 1GBCA 3H7TA 4D7FA 3F68H 5A2MH 2H6MA 3F9FA 1GJBB 1SLWB 1NO9H 1YPJH 3SQHE 1T8OA 1KMHB 2KCOA 2FOCA 4XOJA 3HGNA 2ZU3A 3VGCC 2WINI 1C1PA 3TGJE 1K0HA 4CREA 1P01A 3RC6A 4JYTA 2SGAA 5G4BA 4B74A 2Z6BD 1KIGH 2SGDE 2A5KA 1O2ZA 3F0OA 2FESH 1V2NT 2Z3EA 2ZU4A 1TBQH 1S84A 4MVNA 1O2RA 5HM2A 1D3QB 1O3KA 3RLYH 2KX4A 3T5FH 2BX4A 1V3XA 2QCYA 2XCFA 5DSFA 3A7WA 1G3EA 1CA8B 1GJDB 3WW7A 4MPVA 4A7IB 1GI0A 1P2OA 2A0QB 4DT7B 5KGOA 3UFAA 1RTKA 1VCWA 2GJGA 1UO6A 2VB0A 3LH3A 2AFQB 2ZIQH 3MNBA 3VB5A 1ANBA 3E3TA 4U30A 4KP0A 2AMQA 2V7QD 2ZGCA 1AUJA 4E7NA 2RDEA 1GMCF 3LJJA 2XWBI 1SGDE 3PMAB 3M37A 5LPEA 1NS3A 2FIRH 1L4ZA 1HGTH 1TFXA 4TWWA 4NA8A 2R2WU 4ZHMU 1ZTLA 1W13U 1O2GH 3ATKA 1UTJA 1FAXA 5AFYH 1GHZA 3GCHC 1W14U 1C9PA 1GDNA 2JH6D 1VGCB 2JH5D 1E1RD 2GV6A 1ESBA 3GY2A 1J15A 3UOPA 1WOFA 2FTLE 1EAUA 3NKKA 4YLUA 4A1XA 3C27B 2HLCA 1CSOE 5DN6D 1ZJDA 1S82A 3VB3A 2TGAA 1F5LA 1GBAA 1RGQA 1SGQE 2FMJA 2BTCE 4ISOA 2XW9A 1AVWA 1NT1A 4ABHA 2Z9IA 2VIOA 1ZMNA 2O8MA 4XSKU 1RTLA 2A31A 1CT0E 1TGBA 2VVCA 4OS4A 4TY7A 4XBBA 1LPZB 4K3JA 1XKAC 3M7TA 1B0FA 4K60A 3A8CA 1S85A 4Q63A 3OEHD 1S6LA 4RKJB 2WPJS 1B5GH 1CGJE 1DWDH 4R8TB 1F2SE 1TABE 1ZRKA 2UUKB 3LGIA 2HVYB 2BLVA 3SU5A 1GG6C 3DA9B 3E0NB 2O9QA 2W3KA 5BRRE 1P9SA 2ALVA 3M5NA 5T3HA 2XOKD 2V6NA 4B73A 1PJPA 4B2AA 3RXVA 4AFUA 4BANB 3GY6A 3TK9A 3TJVA 1SSXA 2BMGB 3OE7D 3AAUA 1G9IE 4CR5A 2ZGXH 2HOBA 1WCZA 2PKAB 3GYLB 1EASA 3PMBB 3B9FH 1Z8GA 5BPEA 5DG6A 4I33A 4LOYH 2PGQB 1HJAC 5GNDA 5DGJA 4BXSA 1OXGA 4E06H 3Q77A 4Y11E 1EAWA 1MQ6A 3ZVAA 1BMMH 2GCTB 3SU4A 5C17A 3BTFE 1EJAA 3PTBA 3F9HA 1BMNH 2ZNKH 2J98A 4RI0A 4X8TH 1SLUB 1LHFH 2GMTC 4WY3A 2PKSB 4DIHH 1LKAA 3V3MA 2FM2A 1GCTC 1GBBA 4X6OA 2Q6DA 1AE5A 1AI8H 4A6LA 4MNXA 1Y3UA 4ZHAA 4K8BA 3TVJB 1QTFA 5A8ZA 1TBZH 1MBMA 1QGFA 1IQIA 4I8LA 2JDID 3SNAA 1L1NA 1BDAA 4X1QU 3PWBA 2QIQA 2DE8A 2FYQA 3RXOA 1OWDA 4AG1A 2ANYA 4Y71A 1O3IA 2PR3A 5C1UA 2CXVA 4MNVA 1SKYE 1H8IH 1Z1IA 2P59A 4Q7ZA 4NWKA 1Y8TA 1RIWB 2WPDD 1N1LA 1T32A 1ARCA 3SV2H 2FTMA 4U2WA 1UK2A 1L1GA 1DITH 4ABIA 5E0GA 2HVXA 2HWLB 2G5NA 1P3CA 1WQSA 1O5EH 1FN6A 2ZGBH 1Y3WA 4XRNA 1TNKA 6CHAB 5JBCS 1IQMA 1GHYH 1SLVB 1D6RA 4RT1A 2W7UA 4LZ1H 4TT3D 3EGKH 4AGKA 2LP6A 1CE5A 3TGKE 2UUYA 3DSPA 5L2ZH 2HNTF 4FUHA 1TQ7B 1EKBB 3GDUA 1C2GA 1BRUP 1NZQH 3QTOH 3RXBA 1SGNE 3NRLA 1YLCA 1UTOA 4B76A 3S0NA 5C1YA 3MTYA 4MTBA 3BSQA 1UHBB 3ZZBA 1C5MD 2O8TA 4ABGA 2H9TH 1FZZA 1HFDA 1P2JA 1TA6A 1C1OA 2UWLA 3EE0B 1P05A 1UVOA 3U8TH 4E7RG 1IQNA 3SU1A 2AH4X 5L30H 1O3HA 1YPEH 3M5MA 5I46H 1FN8A 2WYGA 5EXLA 3DT0H 4FUEA 5LH8A 1O5AB 3GCOA 1C5YB 3K65B 1TNLA 2QC2A 4TY6A 1MCVA 1BRBE 4X2VA 1J9CH 1O38A 1GI8B 1V2TT 1BTZA 3BTHE 1HAIH 1AE8H 5A0CA 2ZQ2A 3B23B 1TMTH 1MTVA 1DY8A 1UTKA 3BTTE 1S81A 8GCHG 1BZXE 3ZV8A 1OS8A 4O97A 3ITIA 5JDUB 1EOJA 1TX7A 1DT2A 1OWKA 1TGTA 1AWHB 2A45B 1MCTA 1GHXH 3NXPA 1AQ7A 4BAOB 1LKBA 2GT7A 3O8CA 1PQAA 2V0BA 1C5ZB 1H9HE 2ANKH 4H42U 2QF3A 1GBDA 4TPYA 1FI8A 2J4IA 2ZHEH 4GVUA 3T29A 3ZVDA 3F0PA 3M3SA 5SGAE 5FXLA 3SYJA 2EQNA 3TNSA 3ZVCA 4U32A 2F9UA 2GDEH 5HM9A 1F5RA 5LPRA 3LH1A 3RXEA 2BYAX 2J2UA 2ZEBA 4ZUHA 1D9IA 1DXPA 1MU6B 4AG2A 2ILNA 1O3OA 1TPSA 3L3TA 2WPIS 1K1LA 4RT0A 3EA8A 1SR5C 3AASA 1ANDA 1VGCC 1RFNA 3N7DA 2XXLA 4IC6A 4GLYA 1SC8U 3K6ZA 1AB9B 1AGJA 4HZHA 1BB0B 3QLPH 4DGJA 1ELVA 3ZVEA 1O34A 2GVFA 3SU3A 1E37B 1MQ5A 5K0HA 5DP3A 1KSNA 2I6SA 3TPIZ 3NCLA 1SL3A 1G3DA 5HXFA 2VGCB 3ZZ9A 3NWUA 2GKVE 5FPTA 4ACBA 2Z9GA 1CVWH 4WXIA 3A8BA 3MMGA 5C5OA 2ZHDA 1FUJA 3GCHB 1FY4A 1DY9A 1GHWH 4MPWA 1F0RA 1QQ4A 1RRKA 2A4OA 2GZ7A 4CBNA 1ELDE 4ZKOU 4NZLA 1BTXA 2EI6A 2VBCA 2G51A 4KKDA 1AUTC 1PPHE 4YO9A 2AMDA 3ZZ5A 1ZMJA 3MO6A 7LPRA 3D65E 1OSSA 4X8UH 2J97A 2OQ5A 2L74A 2YMSB 5AHGH 1Y5UT 4NSYA 3A7XA 4GHTA 4WMEA 5F8XA 3UAIC 5T6FA 3MI4A 1P8VC 5HGGA 2VH6A 2F9OA 2QGRA 1EP5A 1T4UH 4HTCH 2FOEA 2VWMA 1YM0A 1A0HB 1A3EH 1SLXB 1LQDB 2GDDA 4F4OC 2PW8H 5AVDA 2XTTB 3F1SB 1AD8H 3ZVGA 2CK3D 1J17T 2LPRA 1FXYA 1GI1A 4FUDA 1UCYK 2GCTC 3RMLH 4AB9A 2J5UA 1U6QA 2D8WA 2GZ8A 2BD4A 2CF8H 4X0WU 1C2HA 3PO1B 1RXPA 3RXUA 2ZTYA 1A2CH 2W7SA 4Y7BA 1NBME 1YLDA 4MLFB 1MD8A 1E79D 2R9PA 4ZCNA 1ZLRA 1SGPE 1ZPZA 4UD9H 1NROH 1NTPA 2J98B 4ZROA 2PKAA 2PKSC 5FHTA 5EU8A 1SQTA 3SW2B 4AFSA 1T7CA 2KM0A 3UNSA 5GWZA 2ZPQA 4MPXA 2OQUA 1GJ5H 2BY8X 1KLIH 2ZFFH 5F8TA 4ASUD 1C5PA 4Y7AA 3LONA 1BQYA 4FUGA 3RXSA 2BQWB 3RXKA 2NU2E 1N6XA 1UK3A 3OU0A 1G37A 3W94A 5KEDA 1C2IA 2IPQX 1ELCA 1S83A 2AHME 3F9EA 3SV6A 4AC9A 1SQAA 1SGEE 1ZHPA 4ACAA 2BLOA 2AYWA 3R0FA 1C1QA 1KTSB 4ABJA 3ODFA 2QF4A 3DFLA 1C2EA 3P17H 1DPOA 3N7OA 1MZAA 1QJ6B 2ANMH 3PLBA 1TA2A 4Q7XA 4FUJA 3GY5A 2H1UA 2RCEA 3FP7E 1GCTB 2M5TA 4XBCA 4ISIH 4DOQA 3SV8A 2XBWA 1Z6JH 2TGDA 5DP8A 1XUHA 3K6YA 1PQ5A 3MU0A 1V2LT 3SBKA 2ZPRA 4Y76A 1GI2A 5DP7A 3FAOA 2F9NA 2OD3B 4DCDA 4YESB 1O2MA 1VR1H 6CHAC 1GJ8B 2Y82A 3TITA 1ORFA 1EZQA 2IJOB 2V3HH 1AKSB 2VIQA 1RD3B 1VKYA 3ENSB 1EFRD 3EA7A 2V3OH 3F2HA 1GVLA 3P95A 1WBGB 4LXBH 1C1TA 5EIYA 2FOAA 3RXJA 2G4TA 1S0QA 1QJ1B 1V2OT 2EEKA 2XBYA 4X6MA 2ZTZA 1O3EA 4AFQA 2B5TB 4MQAA 1Z8RA 1W0KD 1BBRK 2ANWA 3FVFB 1ZR0A 1BTPA 4K8YA 4X2WA 1GDQA 1MBQA 4INHA 4ZKSU 2BD9A 2WV4A 3HK6B 1NRQH 1TMUH 2UUFB 1QB9A 2Z9LA 1HXFH 2A7JA 1V2VT 4IN1A 5EG4A 3D49H 3A87A 3P8GA 3SV9A 4ABBA 2VIDA 1TRMA 3V0XA 3EA9A 1PYTC 1W7GH 2H9EH 1GI7B 1P3EA 3F2FA 5EJZA 1AFQC 3MNSA 4YZUA 1INCA 2ODYB 4X2XA 2J38A 3SGQE 1NRRH 1EJNA 2P94A 1HYLA 3P8NA 3IWMA 5EQSA 1YPLH 1A3BH 1NBMD 2VWLA 2AGGX 3SI4H 3RXAA 1EZXC 3A7YA 1TOCB 1W3CA 1C5QA 1NY22 1QNJA 5F03A 2VWOA 4CRDA 2RFKC 2HPQH 3LJOA 3RUOA 5AF9H 2A1DB 1K2I1 1DFPA 4NA9H 3SJ8A 1THRH 2BY7X 2BQ6B 2OBQA 2QV1A 1F92A 2ZCLP 3GY8A 1UCYH 5EXMA 2HPPH 5DP4A 1GL0E 2Y7XA 1P12E 1ZZZA 2Z9KA 1OX1A 2M2AA 4FUCA 3ZZAA 5DJ7A 5DP5A 2HLDD 3MU8A 3SOSA 4JZ1A 1UTMA 2OTVA 1ACBE 2Z94A 5DP9A 1BA8B 2BHGA 3H5CB 2F9PA 2ZFSA 2QY0B 1LMWB 1QBOA 2P8OB 1JIMA 2F9BH 2ZGJA 5E2PA 2P16A 3SHAH 1YCPM 3ZVFA 1GCDA 1LPGB 1WQVH 3UY9A 1AB9C 5E0JA 2J9NA 3HGPA 3QK1A 1O2VA 2AEIH 1DX5M 1PPZA 3SGAE 4H6SB 2QE7D 4Y8ZA 1O3NA 2FX4A 1D4PB 2P3TB 4O9VA 1O35A 1QZ8A 3A88A 1TGCA 4DIIH 2ZPSA 1WTHD 3MO9A 8GCHF 3LGUA 2VGCC 4OGYA 2G8TA 4J2YB 3O8DA 3L33A 1D6WA 1ZSKA 2WPKS 1SQOA 3PLPA 4P02A 4BAKB 2AIQA 4CRAA 2SGFE 1H9LB 1L0ZA 3TGIE 1K1MA 2BVRH 3KQBA 1O2UA 4YXWD 1HAYB 1BHXB 2NU1E 1PPEE 1EPTB 1G30B 5B6OA 1A46H 3VB7A 1G3BA 1YPHC 4JZDH 5A09A 4I7YH 2ZDLA 4UDWH 2PSYA 2YMSC 2XCNA 1UTLM 1LCYA 1EUFA 4CHAB 1T8NA 2RG3A 3S9CA 1SFQB 1SI5H 3E90B 3U69H 3BTKE 1ID5H 5K7RA 2R2MB 1NM6A 4OM9A 3BG4B 3RC4A 3UTUH 1ABJH 3A8AA 1C1UH 3L6PA 1MTSA 3SUEA 2AGEX 2FP7B 1CQQA 1W11U 1FY3A 2BQ7B 1LHEH 5JBBS 1P2IA 3A8DA 3MNCA 5C94A 1QR3E 1S0RA 9ESTA 5JPMH 1AVGH 1O30A 5GJ4B 1K1IA 1A4WH 3LU9B 4ABDA 3S7HB 4RSPA 1WXRA 1O5DH 2W6JD 4I32A 3PO1C 3A7TA 3SU0A 1HJ8A 3RM2H 3TLOA 1BBRH 2VVUA 2BOKA 1O5BB 5T1VA 1TWXB 1GGDB 2TRMA 1P57B 1HAHH 5C0UA 3SN8A 1P10A 1WUNH 2CHAB 1GJ9B 1LHGH 1GHBF 2KCAA 2IJD1 2FOHA 3MH6A 4IMZA 2PFEA 1P2NA 1UK4A 3EDXB 2Q6GA 1V2RT 5EJLA 1DXWA 3DUXH 2EA3A 3S9BA 1P06A 1XUGA 4UFFH 1C1MA 4NIYA 1W10U 2BD8A 1ELAA 2WYJA 3FP8E 3PYHA 1GBEA 1GMDG 4I31A 5ABWA 1FY8E 3M5OA 5HIYA 1NC6A 3FP6E 4KTSA 3OTPA 3M36A 1ZGIA 1O2PA 1CGHA 1IQJA 3UREA 4HI3A 2GD4B 4ZH8A 4ABFA 1FONA 5EQQA 1OWEA 3UWJH 1BMFD 5CHAC 3DSOA 2FEQH 4TWYA 4CH2B 2VH0A 1C5LH 5GDSH 2XC4A 1Q3XA 4ZHLU 1XXFA 3MH4A 1OWIA 3RXDA 1O2SA 4BXWA 4UONA 1QRZA 4H4FA 3U1JB 1BMLA 3ATMA 4X8VH 5FCKA 4B71A 1ABIH 1AWFH 3M5LA 1HBTH 3S69A 4ISLA 3P8OA 2L6OA 4THNH 1SB1H 2J92A 2KR7A 1JBUH 2B9LA 1GPZA 1HUTH 3LKWA 1YC0A 3ZIAD 2ESTE 1O2TA 1MTUA 1CBWB 2PUQH 2BLWA 3SJOA 1ANCA 3I29A 3FO8D 2VJ1A 4GPGA 1QA0A 1FIWA 2BD2A 2GGVB 3AW0A 3QGJA 2UWOA 2RA3A 4NIXA 2UUJB 1MKWK 1P0SH 1N8OC 5EW2H 2ZCHP 1V2WT 4ZMAH 2TGTA 1DDJA 3SNEA 1L2EA 1XX9A 1Y59T 2WPMS 3F9GA 3SQEE 1UW7A 3LGYA 3E0PB 2D2DA 3OYPA 1OOKB 2ZZUH 2QXIA 1AKSA 4FXGH 7KMEH 2ZKSA 1L4DA 3UUZA 3WWFA 1TYNA 5GPIB 1VZQH 1PFXC 3NK8A 1JRSA 2O8WA 2NU3E 2OCVB 4JMYA 1DANH 4TPIZ 3BF6H 1SGFA 4GUXA 5TJXA 3UB0A 1C9TA 1OPHB 3LOXA 2FPZA 2F43B 2Z9JA 2TGPZ 4ABAA 2XBVA 1W0ZU 3B8JA 1UTNA 3UNRA 4I8JA 1C1NA 1P11E 1C4U2 1CT2E 3FANA 3BIUH 2R0KA 3N7EA 1GBMA 1EAIA 3KHVA 1SFIA 1F0UA 2Y5FA 3TJOA 1GJ7B 4CH8B 2ZDAH 1Q2WA 5A0BA 3P92A 1CA0B 1BITA 2ZWLH 3HATH 5A8YA 4ISNA 1PPBH 2JETC 1JXPA 3UPEA 5L6NH 5F6MA 2XYAA 1IAUA 3DFJA 9LPRA 4ZKNU 3SNDA 1YY3A 2ZF0H 3K9XB 1AFQB 2W5EA 1GI6A 4ZXXH 4MNWA 4O03A 3VB6A 4CRBA 2OLGA 4FETA 4Q2KA 1EZSC 1HNEE 1OP0A 2KFWA 4Y0ZE 5FX6A 3C1KA 1YPHE 2P8OC 4MPUA 1ELTA 1A0JA 3A7ZA 3KQ5A 4I8GA 4DG4A 3MU1A 3UR6A 2BLQA 3NZIA 1K1NA 1XM1A 2KZ4A 5C2ZA 1QFKH 2VWNA 3GY3A 2BDIA 3KQEA 2FDAA 1MAYA 1PPCE 1QB1A 1ZSLA 1BBRE 1TMBH 1V2PT 3HPTB 3P8FA 4B6FA 3SZNA 4NWLA 4Z1MD 1S5SA 2THFB 1A1RA 2J95A 5HIZA 1PYTD 3KGPA 1C2DA 4CRCA 1YYY1 2HALA 1AHTH 5JBAS 2W3IA 2VIVA 1Z7KA 4K5ZA 5IYTA 1OHHD 2IPHA 1QBVH 2ZFRH 4WWYA 2BDBA 2C3SA 2QAAA 1DWEH 1DUAA 1EPTC 1TE0A 1ELFA 3T27A 4RN6A 1AVXA 1ESTA 1H8HD 5JB8S 6LPRA 1GHVH 1C5NH 1O5FH 1OP8A 1LPKB 2FOMB 3EYDA 4BAHB 1O5CB 4CHAC 1NFXA 3I78A 3LPRA 2BDAA 4D9RA 1C1RA 2H5CA 2WPHS 1QQUA 3BG4C 5B6LA 3JZ1B 1A5IA 3SUGA 4LZ4B 3QO6A 4BNRA 1FV9A 4K69A 1TGSZ 2B0FA 3QZQA 1EATA 3OTJE 1KXBA 4INLA 1EPTA 1GHBG 1GMHF 1SBWA 5KECA 1C2FA 1W0YH 3P6ZB 2FOGA 1MKWH 3ZZ8A 1TNIA 1QL8A 3U9AH 1KXEA 1ELGA 3RMMH 2O8LA 1W0JD 2TIOA 3VG8A 1KXCA 3TIUA 5FL7D 2OC8A 1NFWA 4LK4A 3IG6B 1GGDC 2STBE 1W8BH 2ZTXA 5GXPA 4YT7H 2F91A 3E6PH 1SMFE 1JWTA 1O3PB 1TQ0B 2FYRA 1TRNA 4NG9H 3SJ9A 4OS6A 1D3TB 2UWPA 2CHAC 3URDA 3SV7A 1C1WH 2PP6A 1O3FA 2ZGHA 4DJZB 1SOTA 2TBSA 4D76A 3LC3A 5ESTE 1YBWA 2HGTH 1KLTA 2GZ9A 4NIVA 1O2YA 4O3TA 3Q00A 1KDQA 1KXDA 1VCPA 3BN9A 4J1YA 1BOQA 2C93B 3WY8A 3RXGA 4INKA 3E91A 2C8YB 1PQ8A 2FI5E 3KN2A 1DOJA 4ZXYH 2C8WB 1O5GH 2ZI2H 2R3UA 1WU1A 4JK5A 1O2QA 4WH6A 1Y5BT 5EW1H 1WYKA 4IW4E 2P95A 1HAPH 4KTUA 4YTAA 3FOAA 1P2MA 4AX9H 3PROA 2YMSD 3GY4A 1S6HA 4BAMB 5E0HA 1ZOMA 2C90B 3ZZ6A 1TLDA 2J94A 2B7DH 4QT8C 1DWCH 3SUDA 2ZFQH 4OS1A 3PRDA 5GCHF 3STJA 2AIPA 5J4SA 2FS9A 1FJSA 1EXFA 1WTGH 3A80A 1H9IE 4NFFA 1HCGA 1TNJA 3BEUA 4FOUC 1EAXA 3TK5A 2P3UB 1H8ED 3ODDA 1UVSH 4FVDA 2XC0A 1IHTH 1K22H 2BY5X 4DY7B 2GP9B 3VFEA 1CBWC 1O3JA 4U01A 2G5VA 2V3MA 5JBTA 1FX0B 3Q3KA 1ETSH 2EC9H 5CHAB 1GBLA 3CS0A 1Y3XA 1IHSH 5TCCA 2Z3DA 3RC5A 1QIXB 4TSFD 1AZZA 1SGRE 4CRFA 1K28D 1A0LA 4I86A 2BVSH 4A92A 1GMDF 1V2QT 3PRBA 2G4UA 3H7OA 3A82A 1XUKA 2Z3CA 1T8MA 3MWIU 3MU5A 1GBJA 5JYIA 3QDZB 3RLWH 1O2NA 3JZ2B 1HB0B 4D8NA 2KAIB 7ESTE 1AFEH 2I6QA 3SHCH 1O2KA 1H8DH 1T8LA 1W7XH 4Y8XA 3QZRA 1XUIA 5FAHA 3BTWE 3ATWA 1T31A 1P02A 2JJ1D 1GL1A 1C5VA 1COWD 1BJVA 2CJIA 5EPYA 2FOBA 1LTOA 1O2XA 2AMPA 2JIZD 2XBXA 4UFGH 1AMHA 1N8OB 5CE1A 1CHGA 1C5RA 2BD3A 3D23A 3ZZ4A 4FU8A 1G2LA 2G81E 1AIXH 1AY6H 3RXQA 3ATIA 1MABB 2ZFTA 1D3DB 8KME2 1O36A 1K1PA 2QXHA 1A5GH 2PV9B 3MOCA 4K1SA 1RJXB 1O3LA 2D1JA 2K8IA 1QURH 3PM3A 4NIWA 1C1VH 3EAJA 1CA0C 4MG3A 3GCTG 5E8EH 4F48B 2WV9A 3W1EA 1C5WB 1MTWA 1SOZA 3PV2A 5CDFE 2Y80A 1PPGE 2R3YA 2EI7A 1EB1H 1GVKB 4D7GA 1CO7E 3ATLA 4JYUH 2ODPA 1MZDA 2WHXA 1HDTH 3URCA 2YNBA 4UFDH 1H4WA 3RXIA 3RXHA 2IN2A 3A83A 5EGMA 2AGIX 3T26A 4JK6A 5FX5A 3V7TA 1THPB 1ZMLA 8ESTE 2A5AA 1KXAA 4O3UA 2OP9A 1WDIA 3M61U 2G52A 4KTCA 1GI4A 3RMOH 1K21H 2EI8A 1FIZA 4AYVB 4X6NA 1WV7H 1ZPBA 1GBTA 1VCQA 2JETB 2ZQ1A 4B75A 1ZGVA 2F3CE 5I25A 4F55A 3DD2H 1V2JT 2FLBH 2FS8A 1JIRA 3BTDE 1P2QA 2WZQA 3VPKA 4FVBA 2A32A 2BDHA 4IBLH 3SU2A 2VIPA 1SVPA 2XNIA 3KL6A 3M3TA 3QX5H 3R3GB 1DICA 3VEQB 1HIAA 3AW1A 3TH4H 1MKXK 4CRGA 2DUCA 2A5IA 1F0SA 2GCHF 2ODQA 1BT7A 1MMJN 1GMHG 5J4QA 1XVOA 5GIBA 4XFQA 3UWIA 3MH7A 2BDYA 4M7GA 1CU1A 2XWAA 2K0QA 1FMGA 2ZDKA 3STIA 3M3VA 2WSSD 3TH2H 1E0FD 1C5XB 3BIVH 4PROA 5FBIA 2H2ZA 4YT6H 3QWCH 3U1IB 1GHAF 1C2LA 4BAQB 4AFZA 1YPGH 3TH3H 3RXPA 5EXNA 5EQRA 4K2YA 3E16B 1GBIA 1O3CA 5DP6A 1V6DA 1TPOA 7GCHG 1DE7H 3T2NA 1GBHA 1O2JA 1IQKA 3U98H 1EZUC 3LGTA 1OWJA 2PUXB 5C20A 1LVBA 3RP2A 1O32A 4OS2A 4WF8A 1XUJA 4Y0YE 1EB2A 1BIOA 1NRSH 5E2OA 2PGBB 1Z1JA 4X1SU 3ZZCA 1O39A 3PB1E 3A85A 3TJNA 1MTNB 1ZYOA 4I8HA 4JZIA 3OY6U 1HXEH 1AU8A 5AFZH 4M9FA 2VINA 2TPIZ 3SJKA 1B7XB 3RU4T 2A4QA 1O0DH 1KYNA 3O8RA 1ZSJA 4HGCA 4K1TA 3U28C 4AYYB 3KIDU 1EP6A 5HYOA 1GJAB 1FQ3A 2F9VA 3RXRA 2CN0H 1WSSH 1O3DA 2Q6FA 1Z8IB 2BY6X 2WPLS 5GCHG 1ARBA 3TU7H 2HRVA 1E36B 4IS5A 1KDQB 1QBNA 1HAVA 3LGVA 4WVPE 1NRNH 1TONA 5ESBA 5JB9S 1E1QD 1GI9B 3NUMA 4UEHH 2GX4A 3SJIA 1ZHMA 1C5TA 1SGIB 1GI5A 2G55A 1CHOF 1O3GA 2FXRA 3MYWA 5TCAA 2BX3A 1F0TA 3MO3A 2A7CA 2C8ZB 2SNVA 3FN8A 3VXFH 4ZKRU 2CF9H 3ZZ7A 1ZRBA 2VVVA 1RTFB 2ZU1A 2BM2A 3PWCA 2SGPE 3CP7A 4X8SH 1Z6EA 1LO6A 1TAWA 3I77A 3SUFA 3AAVA 5EPNA 2BVXH 2HNTC 4Y6DA 3KCGH 3UQOA 3GYMA 1HJ9A 3RM0H 5C67A 1UVPA 1A5HA 2F4LA 1ETTH 3G01A 3O8BA 5A8XA 1TPAE 1HAZB 1O2WA 1ZHRA 2ZP0H 3F2GA 4GCHG 3RDZA 3WWBA 2STAE 2K1QA 2ZCKP 1P09A 1G3CA 1YCPK 2NWNA 4K1EA 3SORA 1NESE 3KYFA 3ZYDA 1QHRB 5IK2D 1TX8A 1BRAA 3OX7U 1GBFA 3T25A 3PLKA 5HMAA 3LIWA 2Q1JA 1LDTT 1LVMA 2BXTH 1VITH 2D26C 3BTQE 3UIRA 3MFJA 4IGDA 1ANEA 5L2YH 1EJMA 2H5DA 1XMNB 2WUBA 6GCHG 1FNIA 3ESTA 4HG6A 3QTVH 1A61H 8LPRA 1O2IA 1MKXH 3QN7A 1IQEA 3SNBA 3K2UA 2ZDMA 3S9AA 2QF5A 1M9UA 1ZTJA 2VIWA 1FPCH 2BOHB 1C5SA 1TNGA 3FZZA 3MHWU 1BJUA 2Y5GA 3U8OH 5DPAA 1O2LA 1UCYE 2P93A 3P70B 4X1NU 2FODA 1UVUH 3BG8A 3SU6A 4JZFH 2YOLA 1BTHH 1OWHA 1TX6A 1IQFA 1P03A 1K1OA 2ZA5A 1DLEA 5C5NA 1SPJA 1TOMH 1GDUA 1YF4A 1BTUA 4Y10E 1OYQA 5C1XA 5T6DA 2KAIA 1G32B 1ELEE 1O33A 1C2KA 1EQ9A 4MNYA 2QN5T 4ABEA 1YPMH 1JRTA 3DSGA 4VGCB 4JZEH 4NSVA 2Y81A 1FLEE 2Y5HA 3T62A 2ZU5A 2ZHQH 1QY6A 1UMAH 4ISHH 2BZ6H 2G00A 1NRPH 1ZPCA 2ZHFH 2F83A 3UQVA 1BRCE 3BEIB 2A4GA 3D62A 1YP9A 1SGTA 1OKXA 3SGBE 2GV7A 4NA7A 5LGOA 2AS9A 1UTQA 2OUAA 3E1XB 1DM4B 2ZHWH 1SHYA 3OAAD 2ZU2A 1AO5A 1GVZA 2ASUB 2O8UA 2PHBA 4GSOA 2SGEE 4WMDA 3FZDA 3RXFA 3RXCA 3EQ0H 2ZC9H 2FWWA 3U8RH 3ZZDA 3E8LA 5EJ1A 4WH8A 3M35A 2GCHG 1QB6A 1IQGA 1YPKH 1V2MT 2C8XB 1TNHA 1VITF 1F5KU 2PLXA 2QYIA 4Q4LA 3BV9B 4WXVA 1QL7A 1NPMA 1NFYA 4FUIA 4DURA 1NN6A 1Y3VA 2FLRH 1HRTH 5C0TA 2PSXA 2SFAA 1DLKB 1DVAH 3RXMA 4AN7A 1C2MA 4DT4A 4RKOB 1SHHB 2OBOA 1MU8B 1TGNA 1GHAG 1QA7A 2BY9X 2FZZA 2OK5A 1DUEA 1TIOA 3PV4A 4FUBA 1XXDA 2VU8E 1HIAB 3GCTF 3KQCA 1IOEA 4F49A 2SNWA 4Y8YA 1BCUH 1W12U 3M7UA 2R0LA 3V12A 3S7KB 1BMAA 4X1RU 3PV5A 4X6PA 3FKSD 3GICB 1E35B 3MH5A 3UNQA 3RXTA 4ESTE 5DO4H 1N6YA 2NU0E 1P04A 3KF2A 1GMCG 2GTBA 2QXJA 3SI3H 2OC7A 3QGNB 3Q76A 1KTTB 3V13A 1ELBA 1MD7A 1EX3A 3RU4E 1FAKH 1TRYA 2RDLA 3HKJB 1Y3YA 1TPPA 1YLNA 1T4VH 1O31A 4YOJA 5IDKA 3RXLA 2A2XH 1QJ7B 3ZZ3A 4NCYA 1MAXA 1KLJH 1YCPH 3VGCB 3A84A 4WJG2 3A7VA 3F3BA 1O3AA 4R0IA 1UTPA 2A4RA 1S6FA 3BEFB 1NU9A 1FPHH 3PTNA 4BTIB 3GY7A 5FCRA 4FUFA 3SO3A 4FU7A 1PPFE 5PTPA 3PMHB 1IQLA 1C5OH 1P2KA 3KNXA 4UFEH 5EODA 4ASHA 2XNDD 1MTNC 2JKHA 4CR9A 2A2QH 4NGAH 1V2ST 1HAOH 1C2JA 1HAGE 3A81A 5T6GA 1A7SA 1G36A 1G2MA 5CMXH 2QA9E 1O3MA 4D9QA 1CHOG 3DHKH 4E05H 2HNTE 1DS2E 1SGYE 3RMNH 4OS5A 1RS0A 2GT8A 2P3FH 1Y5AT 2XRCA 2FOFA 1QRXA
chains in the Genus database with same CATH topology
3P8OA 2F4LA 2L6OA 5EPYA 2WSSD 1DXPA 1KMHB 1S6LA 2JIZD 2KCOA 2YMSC 3O8BA 2XCNA 2KR7A 3F2GA 4TYDA 3WWBA 2KM0A 4R8TB 3F2FA 3LKWA 3N99A 2K1QA 3U1IB 3ZIAD 2KZ4A 3GS9A 4Q4LA 3KEEA 3E90B 5H4IB 1MABB 4OM9A 4ASUD 5EQRA 3N7DA 3RC4A 3SU5A 3RC6A 3FO8D 5IK2D 3P8NA 3KN2A 3LONA 5EQSA 3L6PA 3M5NA 1NBMD 4B74A 2XOKD 2GGVB 5C0TA 4TT3D 3SUEA 4B73A 2K8IA 2FP7B 3F0OA 4DT4A 1W3CA 5FPYA 3DSPA 2AHME 3SV6A 4A1TA 3SV9A 3OE7D 4WH6A 2OBOA 2WV9A 3W1EA 4B6FA 4WF8A 3FOAA 4NWLA 4Z1MD 3PV2A 2XCFA 5DSFA 2OK5A 2W6ID 5CDFE 5GJ4B 2YMSD 2GVFA 1A1RA 3NRLA 3SU3A 4B76A 2QF4A 4I33A 2OC0A 5CHBA 1WXRA 3WW7A 4A1VA 2W6JD 5GNDA 2OINA 4I32A 2WHXA 1OHHD 3OYPA 4XD7D 5HKKD 3AK5A 3SUDA 3SU0A 2LELA 2OBQA 2QF5A 3PV5A 2QV1A 3FKSD 3PRDA 5FPTA 3WWFA 4M9FA 2KCPA 5GPIB 3SU1A 3KF2A 5T1VA 3SU4A 3SV8A 5C17A 1DY9A 2M2AA 2A4QA 2OC7A 4JMYA 2HLDD 3OFND 1H8HD 3M5MA 5FPSA 2V7QD 3UB0A 4B6EA 3LOXA 4RI0A 5C0UA 3O8RA 2VBCA 2FOMB 1H8ED 3EYDA 2F43B 3SU6A 2YOLA 1NS3A 2F9VA 2IJD1 2KCAA 5IDKA 4KTCA 5ETXA 4U01A 2YMSB 5B6LA 2FM2A 1FX0B 4B75A 3N7EA 2IJOB 3SUGA 1DXWA 4F55A 4K8BA 3F3BA 1E1RD 2JDID 2WZQA 5ESBA 2A4RA 1E1QD 3H09A 3RC5A 3SZEA 1EFRD 4I31A 3F2HA 4TSFD 1DY8A 3M5OA 3SU2A 4A1XA 2XNIA 2QE7D 3OTPA 2OC1A 3KNXA 5DN6D 4A92A 2XNDD 3PRBA 1JXPA 3DCLA 1RGQA 5EQQA 2JJ2D 2CK3D 2A4GA 1BMFD 2KCYA 3DSOA 3FN8A 3O8DA 1W0JD 1W0KD 3VG8A 3O8CA 5FL7D 2OC8A 3OEED 1SKYE 2J5UA 2O8MA 5F53A 1BT7A 1RTLA 3F0PA 3OAAD 4YXWD 3SUFA 2P59A 3SYJA 4NWKA 1NBME 5EPNA 3U1JB 2F9UA 4FETA 4B71A 2JJ1D 2WPDD 1CU1A 2KFWA 3M5LA 1E79D 2K0QA 4Q63A 3SV7A 4ZCNA 3OEHD 1N1LA 1COWD 4WH8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F0O A;  3F2H A;  3F0P A;  5DSF A;  3FN8 A;  5C0U A;  3F2G A;  5C17 A;  5C0T A;  3F2F A; 
#chains in the Genus database with same CATH topology
 1VJA U;  4MDS A;  1V2U T;  3SNC A;  2H9H A;  4Q80 A;  3GCN A;  4AGJ A;  2RA0 A;  4NZQ A;  2CGA A;  5H4I B;  3OSY A;  1CT4 E;  1TB6 H;  1HAV B;  2EY4 C;  3ZVB A;  3ZYE A;  4Q7Y A;  3LT3 A;  5F8Z A;  1UVT H;  1K1J A;  1TBR H;  2A7H A;  1QRW A;  2AER H;  1Z71 A;  1O37 A;  7GCH F;  4P00 A;  3BTE E;  1YGC H;  1QCP A;  2IOT A;  1C1S A;  2V35 A;  3CS7 A;  2W6I D;  1J14 A;  1LVO A;  1YKT A;  2XC5 A;  6EST A;  1HV7 A;  3GDS A;  5CHB A;  2OC0 A;  4A1V A;  1AZ8 A;  2OIN A;  1HPG A;  3TNT A;  1Q31 A;  3AK5 A;  2C4F H;  3LGW A;  4Y79 A;  1DST A;  3BTM E;  2KCP A;  4BTT B;  1BTY A;  1MH0 A;  2PWX A;  1Z8J B;  3ELA H;  1ZTK A;  1SGC A;  4A5T S;  4DVA U;  2Y6T A;  1HLT H;  4Z0K A;  4IMQ A;  3F6U H;  3QUM P;  1XUF A;  2CMY A;  2J34 A;  3OY5 U;  2ZFP H;  3IIT A;  2BXU H;  3HKI B;  5ETX A;  4OGX A;  4B2C A;  2ZDN A;  1GJ6 A;  4ZAE A;  3Q3X A;  5A0A E;  1BTW A;  2SGQ E;  2BZA A;  3A86 A;  3LC5 A;  3NPS A;  1BHX F;  1GG6 B;  2BDC A;  3GOV B;  3H09 A;  3T28 A;  3SZE A;  2ZO3 H;  4IC5 A;  1VJ9 U;  3RU4 D;  1B0E A;  4WMF A;  5C3N A;  1EOL A;  2OXS A;  5EOK A;  1H1B A;  4B2B A;  2BD7 A;  2PTN A;  3FFG A;  1SG8 B;  4YLQ H;  4OS7 A;  3CNR A;  1D3P B;  2KCY A;  5DKM A;  3MU4 A;  1JOU B;  1HJA B;  4YOG A;  4SGB E;  1MUE B;  2DE9 A;  2Y7Z A;  2ULL A;  5DK1 A;  1P9U A;  3AVZ A;  4I8K A;  2BB4 A;  4BOH A;  4NFE A;  4DW2 U;  1LVY A;  2FI4 E;  4AZ2 B;  1C4V 2;  4HFP B;  2W26 A;  3BTG E;  3EE7 A;  4B1T A;  1PQ7 A;  4GAW A;  1SQR A;  1J16 A;  4TYD A;  3N99 A;  1FY1 A;  3GS9 A;  4YM9 A;  2GMT B;  3KEE A;  4IN2 A;  1KXF A;  1OYT H;  4GCH F;  1NU7 B;  1L1J A;  1C4Y 2;  2ZDV H;  4VGC C;  1RIW C;  3PMJ A;  4Z6A H;  2PTC E;  3CEN A;  4CBO A;  1GI3 A;  1K9O E;  1FY5 A;  1GWA A;  1HAX B;  2WUC A;  5FPY A;  4A1T A;  1AN1 E;  1E34 B;  1CGI E;  1VIT G;  2QXG A;  4YOI A;  1W2K H;  4XBD A;  1GBK A;  2ZG0 H;  1GJC B;  2FX6 A;  4X1P U;  3GDV A;  1ETR H;  3M7Q A;  4XD7 D;  5HKK D;  3GIS B;  3MNX A;  1JMO H;  4FU9 A;  2LEL A;  1XVM A;  1E38 B;  1LHC H;  6GCH F;  1LHD H;  4H6T A;  3ZV9 A;  1OP2 A;  1O2H A;  1DSU A;  1O2O A;  2VNT A;  2YNA A;  2NU4 E;  3OFN D;  3TJU A;  4KEL A;  5FPS A;  4B6E A;  5LPF A;  4SGA E;  2BDG A;  1C5U A;  1F7Z A;  1FDP A;  3A89 A;  2Z7F E;  3UOU A;  2ALP A;  4KGA A;  1GJ4 H;  1QL9 A;  4JCN A;  1NFU A;  1ZJK A;  3VXE H;  1ESA A;  1X7A C;  3HK3 B;  1THS H;  2B8O H;  4X2Y A;  1UJ1 A;  1YWU A;  3UR9 A;  3TK6 A;  4AB8 A;  1J8A A;  1SGF G;  1TAL A;  1IQH A;  3LDX H;  2FO9 A;  4AOR A;  4BTU B;  5FBE A;  3KQD A;  1XKB C;  4AOQ A;  2OC1 A;  4XE4 A;  1WAY B;  3Q3Y A;  2JH0 D;  3W95 A;  3VB4 A;  1UHB A;  2QF0 A;  3DCL A;  1DWB H;  2JJ2 D;  2BD5 A;  2FI3 E;  3OEE D;  2LNC A;  4JYV H;  3MQK C;  1KY9 A;  1BUI A;  2WV5 A;  1O3B A;  5F53 A;  4GHQ A;  1LQE A;  1V2K T;  4XDE A;  4UE7 H;  2ZEC A;  2CV3 A;  3KYG A;  1GBC A;  3H7T A;  4D7F A;  3F68 H;  5A2M H;  2H6M A;  3F9F A;  1GJB B;  1SLW B;  1NO9 H;  1YPJ H;  3SQH E;  1T8O A;  1KMH B;  2KCO A;  2FOC A;  4XOJ A;  3HGN A;  2ZU3 A;  3VGC C;  2WIN I;  1C1P A;  3TGJ E;  1K0H A;  4CRE A;  1P01 A;  3RC6 A;  4JYT A;  2SGA A;  5G4B A;  4B74 A;  2Z6B D;  1KIG H;  2SGD E;  2A5K A;  1O2Z A;  3F0O A;  2FES H;  1V2N T;  2Z3E A;  2ZU4 A;  1TBQ H;  1S84 A;  4MVN A;  1O2R A;  5HM2 A;  1D3Q B;  1O3K A;  3RLY H;  2KX4 A;  3T5F H;  2BX4 A;  1V3X A;  2QCY A;  2XCF A;  5DSF A;  3A7W A;  1G3E A;  1CA8 B;  1GJD B;  3WW7 A;  4MPV A;  4A7I B;  1GI0 A;  1P2O A;  2A0Q B;  4DT7 B;  5KGO A;  3UFA A;  1RTK A;  1VCW A;  2GJG A;  1UO6 A;  2VB0 A;  3LH3 A;  2AFQ B;  2ZIQ H;  3MNB A;  3VB5 A;  1ANB A;  3E3T A;  4U30 A;  4KP0 A;  2AMQ A;  2V7Q D;  2ZGC A;  1AUJ A;  4E7N A;  2RDE A;  1GMC F;  3LJJ A;  2XWB I;  1SGD E;  3PMA B;  3M37 A;  5LPE A;  1NS3 A;  2FIR H;  1L4Z A;  1HGT H;  1TFX A;  4TWW A;  4NA8 A;  2R2W U;  4ZHM U;  1ZTL A;  1W13 U;  1O2G H;  3ATK A;  1UTJ A;  1FAX A;  5AFY H;  1GHZ A;  3GCH C;  1W14 U;  1C9P A;  1GDN A;  2JH6 D;  1VGC B;  2JH5 D;  1E1R D;  2GV6 A;  1ESB A;  3GY2 A;  1J15 A;  3UOP A;  1WOF A;  2FTL E;  1EAU A;  3NKK A;  4YLU A;  4A1X A;  3C27 B;  2HLC A;  1CSO E;  5DN6 D;  1ZJD A;  1S82 A;  3VB3 A;  2TGA A;  1F5L A;  1GBA A;  1RGQ A;  1SGQ E;  2FMJ A;  2BTC E;  4ISO A;  2XW9 A;  1AVW A;  1NT1 A;  4ABH A;  2Z9I A;  2VIO A;  1ZMN A;  2O8M A;  4XSK U;  1RTL A;  2A31 A;  1CT0 E;  1TGB A;  2VVC A;  4OS4 A;  4TY7 A;  4XBB A;  1LPZ B;  4K3J A;  1XKA C;  3M7T A;  1B0F A;  4K60 A;  3A8C A;  1S85 A;  4Q63 A;  3OEH D;  1S6L A;  4RKJ B;  2WPJ S;  1B5G H;  1CGJ E;  1DWD H;  4R8T B;  1F2S E;  1TAB E;  1ZRK A;  2UUK B;  3LGI A;  2HVY B;  2BLV A;  3SU5 A;  1GG6 C;  3DA9 B;  3E0N B;  2O9Q A;  2W3K A;  5BRR E;  1P9S A;  2ALV A;  3M5N A;  5T3H A;  2XOK D;  2V6N A;  4B73 A;  1PJP A;  4B2A A;  3RXV A;  4AFU A;  4BAN B;  3GY6 A;  3TK9 A;  3TJV A;  1SSX A;  2BMG B;  3OE7 D;  3AAU A;  1G9I E;  4CR5 A;  2ZGX H;  2HOB A;  1WCZ A;  2PKA B;  3GYL B;  1EAS A;  3PMB B;  3B9F H;  1Z8G A;  5BPE A;  5DG6 A;  4I33 A;  4LOY H;  2PGQ B;  1HJA C;  5GND A;  5DGJ A;  4BXS A;  1OXG A;  4E06 H;  3Q77 A;  4Y11 E;  1EAW A;  1MQ6 A;  3ZVA A;  1BMM H;  2GCT B;  3SU4 A;  5C17 A;  3BTF E;  1EJA A;  3PTB A;  3F9H A;  1BMN H;  2ZNK H;  2J98 A;  4RI0 A;  4X8T H;  1SLU B;  1LHF H;  2GMT C;  4WY3 A;  2PKS B;  4DIH H;  1LKA A;  3V3M A;  2FM2 A;  1GCT C;  1GBB A;  4X6O A;  2Q6D A;  1AE5 A;  1AI8 H;  4A6L A;  4MNX A;  1Y3U A;  4ZHA A;  4K8B A;  3TVJ B;  1QTF A;  5A8Z A;  1TBZ H;  1MBM A;  1QGF A;  1IQI A;  4I8L A;  2JDI D;  3SNA A;  1L1N A;  1BDA A;  4X1Q U;  3PWB A;  2QIQ A;  2DE8 A;  2FYQ A;  3RXO A;  1OWD A;  4AG1 A;  2ANY A;  4Y71 A;  1O3I A;  2PR3 A;  5C1U A;  2CXV A;  4MNV A;  1SKY E;  1H8I H;  1Z1I A;  2P59 A;  4Q7Z A;  4NWK A;  1Y8T A;  1RIW B;  2WPD D;  1N1L A;  1T32 A;  1ARC A;  3SV2 H;  2FTM A;  4U2W A;  1UK2 A;  1L1G A;  1DIT H;  4ABI A;  5E0G A;  2HVX A;  2HWL B;  2G5N A;  1P3C A;  1WQS A;  1O5E H;  1FN6 A;  2ZGB H;  1Y3W A;  4XRN A;  1TNK A;  6CHA B;  5JBC S;  1IQM A;  1GHY H;  1SLV B;  1D6R A;  4RT1 A;  2W7U A;  4LZ1 H;  4TT3 D;  3EGK H;  4AGK A;  2LP6 A;  1CE5 A;  3TGK E;  2UUY A;  3DSP A;  5L2Z H;  2HNT F;  4FUH A;  1TQ7 B;  1EKB B;  3GDU A;  1C2G A;  1BRU P;  1NZQ H;  3QTO H;  3RXB A;  1SGN E;  3NRL A;  1YLC A;  1UTO A;  4B76 A;  3S0N A;  5C1Y A;  3MTY A;  4MTB A;  3BSQ A;  1UHB B;  3ZZB A;  1C5M D;  2O8T A;  4ABG A;  2H9T H;  1FZZ A;  1HFD A;  1P2J A;  1TA6 A;  1C1O A;  2UWL A;  3EE0 B;  1P05 A;  1UVO A;  3U8T H;  4E7R G;  1IQN A;  3SU1 A;  2AH4 X;  5L30 H;  1O3H A;  1YPE H;  3M5M A;  5I46 H;  1FN8 A;  2WYG A;  5EXL A;  3DT0 H;  4FUE A;  5LH8 A;  1O5A B;  3GCO A;  1C5Y B;  3K65 B;  1TNL A;  2QC2 A;  4TY6 A;  1MCV A;  1BRB E;  4X2V A;  1J9C H;  1O38 A;  1GI8 B;  1V2T T;  1BTZ A;  3BTH E;  1HAI H;  1AE8 H;  5A0C A;  2ZQ2 A;  3B23 B;  1TMT H;  1MTV A;  1DY8 A;  1UTK A;  3BTT E;  1S81 A;  8GCH G;  1BZX E;  3ZV8 A;  1OS8 A;  4O97 A;  3ITI A;  5JDU B;  1EOJ A;  1TX7 A;  1DT2 A;  1OWK A;  1TGT A;  1AWH B;  2A45 B;  1MCT A;  1GHX H;  3NXP A;  1AQ7 A;  4BAO B;  1LKB A;  2GT7 A;  3O8C A;  1PQA A;  2V0B A;  1C5Z B;  1H9H E;  2ANK H;  4H42 U;  2QF3 A;  1GBD A;  4TPY A;  1FI8 A;  2J4I A;  2ZHE H;  4GVU A;  3T29 A;  3ZVD A;  3F0P A;  3M3S A;  5SGA E;  5FXL A;  3SYJ A;  2EQN A;  3TNS A;  3ZVC A;  4U32 A;  2F9U A;  2GDE H;  5HM9 A;  1F5R A;  5LPR A;  3LH1 A;  3RXE A;  2BYA X;  2J2U A;  2ZEB A;  4ZUH A;  1D9I A;  1DXP A;  1MU6 B;  4AG2 A;  2ILN A;  1O3O A;  1TPS A;  3L3T A;  2WPI S;  1K1L A;  4RT0 A;  3EA8 A;  1SR5 C;  3AAS A;  1AND A;  1VGC C;  1RFN A;  3N7D A;  2XXL A;  4IC6 A;  4GLY A;  1SC8 U;  3K6Z A;  1AB9 B;  1AGJ A;  4HZH A;  1BB0 B;  3QLP H;  4DGJ A;  1ELV A;  3ZVE A;  1O34 A;  2GVF A;  3SU3 A;  1E37 B;  1MQ5 A;  5K0H A;  5DP3 A;  1KSN A;  2I6S A;  3TPI Z;  3NCL A;  1SL3 A;  1G3D A;  5HXF A;  2VGC B;  3ZZ9 A;  3NWU A;  2GKV E;  5FPT A;  4ACB A;  2Z9G A;  1CVW H;  4WXI A;  3A8B A;  3MMG A;  5C5O A;  2ZHD A;  1FUJ A;  3GCH B;  1FY4 A;  1DY9 A;  1GHW H;  4MPW A;  1F0R A;  1QQ4 A;  1RRK A;  2A4O A;  2GZ7 A;  4CBN A;  1ELD E;  4ZKO U;  4NZL A;  1BTX A;  2EI6 A;  2VBC A;  2G51 A;  4KKD A;  1AUT C;  1PPH E;  4YO9 A;  2AMD A;  3ZZ5 A;  1ZMJ A;  3MO6 A;  7LPR A;  3D65 E;  1OSS A;  4X8U H;  2J97 A;  2OQ5 A;  2L74 A;  2YMS B;  5AHG H;  1Y5U T;  4NSY A;  3A7X A;  4GHT A;  4WME A;  5F8X A;  3UAI C;  5T6F A;  3MI4 A;  1P8V C;  5HGG A;  2VH6 A;  2F9O A;  2QGR A;  1EP5 A;  1T4U H;  4HTC H;  2FOE A;  2VWM A;  1YM0 A;  1A0H B;  1A3E H;  1SLX B;  1LQD B;  2GDD A;  4F4O C;  2PW8 H;  5AVD A;  2XTT B;  3F1S B;  1AD8 H;  3ZVG A;  2CK3 D;  1J17 T;  2LPR A;  1FXY A;  1GI1 A;  4FUD A;  1UCY K;  2GCT C;  3RML H;  4AB9 A;  2J5U A;  1U6Q A;  2D8W A;  2GZ8 A;  2BD4 A;  2CF8 H;  4X0W U;  1C2H A;  3PO1 B;  1RXP A;  3RXU A;  2ZTY A;  1A2C H;  2W7S A;  4Y7B A;  1NBM E;  1YLD A;  4MLF B;  1MD8 A;  1E79 D;  2R9P A;  4ZCN A;  1ZLR A;  1SGP E;  1ZPZ A;  4UD9 H;  1NRO H;  1NTP A;  2J98 B;  4ZRO A;  2PKA A;  2PKS C;  5FHT A;  5EU8 A;  1SQT A;  3SW2 B;  4AFS A;  1T7C A;  2KM0 A;  3UNS A;  5GWZ A;  2ZPQ A;  4MPX A;  2OQU A;  1GJ5 H;  2BY8 X;  1KLI H;  2ZFF H;  5F8T A;  4ASU D;  1C5P A;  4Y7A A;  3LON A;  1BQY A;  4FUG A;  3RXS A;  2BQW B;  3RXK A;  2NU2 E;  1N6X A;  1UK3 A;  3OU0 A;  1G37 A;  3W94 A;  5KED A;  1C2I A;  2IPQ X;  1ELC A;  1S83 A;  2AHM E;  3F9E A;  3SV6 A;  4AC9 A;  1SQA A;  1SGE E;  1ZHP A;  4ACA A;  2BLO A;  2AYW A;  3R0F A;  1C1Q A;  1KTS B;  4ABJ A;  3ODF A;  2QF4 A;  3DFL A;  1C2E A;  3P17 H;  1DPO A;  3N7O A;  1MZA A;  1QJ6 B;  2ANM H;  3PLB A;  1TA2 A;  4Q7X A;  4FUJ A;  3GY5 A;  2H1U A;  2RCE A;  3FP7 E;  1GCT B;  2M5T A;  4XBC A;  4ISI H;  4DOQ A;  3SV8 A;  2XBW A;  1Z6J H;  2TGD A;  5DP8 A;  1XUH A;  3K6Y A;  1PQ5 A;  3MU0 A;  1V2L T;  3SBK A;  2ZPR A;  4Y76 A;  1GI2 A;  5DP7 A;  3FAO A;  2F9N A;  2OD3 B;  4DCD A;  4YES B;  1O2M A;  1VR1 H;  6CHA C;  1GJ8 B;  2Y82 A;  3TIT A;  1ORF A;  1EZQ A;  2IJO B;  2V3H H;  1AKS B;  2VIQ A;  1RD3 B;  1VKY A;  3ENS B;  1EFR D;  3EA7 A;  2V3O H;  3F2H A;  1GVL A;  3P95 A;  1WBG B;  4LXB H;  1C1T A;  5EIY A;  2FOA A;  3RXJ A;  2G4T A;  1S0Q A;  1QJ1 B;  1V2O T;  2EEK A;  2XBY A;  4X6M A;  2ZTZ A;  1O3E A;  4AFQ A;  2B5T B;  4MQA A;  1Z8R A;  1W0K D;  1BBR K;  2ANW A;  3FVF B;  1ZR0 A;  1BTP A;  4K8Y A;  4X2W A;  1GDQ A;  1MBQ A;  4INH A;  4ZKS U;  2BD9 A;  2WV4 A;  3HK6 B;  1NRQ H;  1TMU H;  2UUF B;  1QB9 A;  2Z9L A;  1HXF H;  2A7J A;  1V2V T;  4IN1 A;  5EG4 A;  3D49 H;  3A87 A;  3P8G A;  3SV9 A;  4ABB A;  2VID A;  1TRM A;  3V0X A;  3EA9 A;  1PYT C;  1W7G H;  2H9E H;  1GI7 B;  1P3E A;  3F2F A;  5EJZ A;  1AFQ C;  3MNS A;  4YZU A;  1INC A;  2ODY B;  4X2X A;  2J38 A;  3SGQ E;  1NRR H;  1EJN A;  2P94 A;  1HYL A;  3P8N A;  3IWM A;  5EQS A;  1YPL H;  1A3B H;  1NBM D;  2VWL A;  2AGG X;  3SI4 H;  3RXA A;  1EZX C;  3A7Y A;  1TOC B;  1W3C A;  1C5Q A;  1NY2 2;  1QNJ A;  5F03 A;  2VWO A;  4CRD A;  2RFK C;  2HPQ H;  3LJO A;  3RUO A;  5AF9 H;  2A1D B;  1K2I 1;  1DFP A;  4NA9 H;  3SJ8 A;  1THR H;  2BY7 X;  2BQ6 B;  2OBQ A;  2QV1 A;  1F92 A;  2ZCL P;  3GY8 A;  1UCY H;  5EXM A;  2HPP H;  5DP4 A;  1GL0 E;  2Y7X A;  1P12 E;  1ZZZ A;  2Z9K A;  1OX1 A;  2M2A A;  4FUC A;  3ZZA A;  5DJ7 A;  5DP5 A;  2HLD D;  3MU8 A;  3SOS A;  4JZ1 A;  1UTM A;  2OTV A;  1ACB E;  2Z94 A;  5DP9 A;  1BA8 B;  2BHG A;  3H5C B;  2F9P A;  2ZFS A;  2QY0 B;  1LMW B;  1QBO A;  2P8O B;  1JIM A;  2F9B H;  2ZGJ A;  5E2P A;  2P16 A;  3SHA H;  1YCP M;  3ZVF A;  1GCD A;  1LPG B;  1WQV H;  3UY9 A;  1AB9 C;  5E0J A;  2J9N A;  3HGP A;  3QK1 A;  1O2V A;  2AEI H;  1DX5 M;  1PPZ A;  3SGA E;  4H6S B;  2QE7 D;  4Y8Z A;  1O3N A;  2FX4 A;  1D4P B;  2P3T B;  4O9V A;  1O35 A;  1QZ8 A;  3A88 A;  1TGC A;  4DII H;  2ZPS A;  1WTH D;  3MO9 A;  8GCH F;  3LGU A;  2VGC C;  4OGY A;  2G8T A;  4J2Y B;  3O8D A;  3L33 A;  1D6W A;  1ZSK A;  2WPK S;  1SQO A;  3PLP A;  4P02 A;  4BAK B;  2AIQ A;  4CRA A;  2SGF E;  1H9L B;  1L0Z A;  3TGI E;  1K1M A;  2BVR H;  3KQB A;  1O2U A;  4YXW D;  1HAY B;  1BHX B;  2NU1 E;  1PPE E;  1EPT B;  1G30 B;  5B6O A;  1A46 H;  3VB7 A;  1G3B A;  1YPH C;  4JZD H;  5A09 A;  4I7Y H;  2ZDL A;  4UDW H;  2PSY A;  2YMS C;  2XCN A;  1UTL M;  1LCY A;  1EUF A;  4CHA B;  1T8N A;  2RG3 A;  3S9C A;  1SFQ B;  1SI5 H;  3E90 B;  3U69 H;  3BTK E;  1ID5 H;  5K7R A;  2R2M B;  1NM6 A;  4OM9 A;  3BG4 B;  3RC4 A;  3UTU H;  1ABJ H;  3A8A A;  1C1U H;  3L6P A;  1MTS A;  3SUE A;  2AGE X;  2FP7 B;  1CQQ A;  1W11 U;  1FY3 A;  2BQ7 B;  1LHE H;  5JBB S;  1P2I A;  3A8D A;  3MNC A;  5C94 A;  1QR3 E;  1S0R A;  9EST A;  5JPM H;  1AVG H;  1O30 A;  5GJ4 B;  1K1I A;  1A4W H;  3LU9 B;  4ABD A;  3S7H B;  4RSP A;  1WXR A;  1O5D H;  2W6J D;  4I32 A;  3PO1 C;  3A7T A;  3SU0 A;  1HJ8 A;  3RM2 H;  3TLO A;  1BBR H;  2VVU A;  2BOK A;  1O5B B;  5T1V A;  1TWX B;  1GGD B;  2TRM A;  1P57 B;  1HAH H;  5C0U A;  3SN8 A;  1P10 A;  1WUN H;  2CHA B;  1GJ9 B;  1LHG H;  1GHB F;  2KCA A;  2IJD 1;  2FOH A;  3MH6 A;  4IMZ A;  2PFE A;  1P2N A;  1UK4 A;  3EDX B;  2Q6G A;  1V2R T;  5EJL A;  1DXW A;  3DUX H;  2EA3 A;  3S9B A;  1P06 A;  1XUG A;  4UFF H;  1C1M A;  4NIY A;  1W10 U;  2BD8 A;  1ELA A;  2WYJ A;  3FP8 E;  3PYH A;  1GBE A;  1GMD G;  4I31 A;  5ABW A;  1FY8 E;  3M5O A;  5HIY A;  1NC6 A;  3FP6 E;  4KTS A;  3OTP A;  3M36 A;  1ZGI A;  1O2P A;  1CGH A;  1IQJ A;  3URE A;  4HI3 A;  2GD4 B;  4ZH8 A;  4ABF A;  1FON A;  5EQQ A;  1OWE A;  3UWJ H;  1BMF D;  5CHA C;  3DSO A;  2FEQ H;  4TWY A;  4CH2 B;  2VH0 A;  1C5L H;  5GDS H;  2XC4 A;  1Q3X A;  4ZHL U;  1XXF A;  3MH4 A;  1OWI A;  3RXD A;  1O2S A;  4BXW A;  4UON A;  1QRZ A;  4H4F A;  3U1J B;  1BML A;  3ATM A;  4X8V H;  5FCK A;  4B71 A;  1ABI H;  1AWF H;  3M5L A;  1HBT H;  3S69 A;  4ISL A;  3P8O A;  2L6O A;  4THN H;  1SB1 H;  2J92 A;  2KR7 A;  1JBU H;  2B9L A;  1GPZ A;  1HUT H;  3LKW A;  1YC0 A;  3ZIA D;  2EST E;  1O2T A;  1MTU A;  1CBW B;  2PUQ H;  2BLW A;  3SJO A;  1ANC A;  3I29 A;  3FO8 D;  2VJ1 A;  4GPG A;  1QA0 A;  1FIW A;  2BD2 A;  2GGV B;  3AW0 A;  3QGJ A;  2UWO A;  2RA3 A;  4NIX A;  2UUJ B;  1MKW K;  1P0S H;  1N8O C;  5EW2 H;  2ZCH P;  1V2W T;  4ZMA H;  2TGT A;  1DDJ A;  3SNE A;  1L2E A;  1XX9 A;  1Y59 T;  2WPM S;  3F9G A;  3SQE E;  1UW7 A;  3LGY A;  3E0P B;  2D2D A;  3OYP A;  1OOK B;  2ZZU H;  2QXI A;  1AKS A;  4FXG H;  7KME H;  2ZKS A;  1L4D A;  3UUZ A;  3WWF A;  1TYN A;  5GPI B;  1VZQ H;  1PFX C;  3NK8 A;  1JRS A;  2O8W A;  2NU3 E;  2OCV B;  4JMY A;  1DAN H;  4TPI Z;  3BF6 H;  1SGF A;  4GUX A;  5TJX A;  3UB0 A;  1C9T A;  1OPH B;  3LOX A;  2FPZ A;  2F43 B;  2Z9J A;  2TGP Z;  4ABA A;  2XBV A;  1W0Z U;  3B8J A;  1UTN A;  3UNR A;  4I8J A;  1C1N A;  1P11 E;  1C4U 2;  1CT2 E;  3FAN A;  3BIU H;  2R0K A;  3N7E A;  1GBM A;  1EAI A;  3KHV A;  1SFI A;  1F0U A;  2Y5F A;  3TJO A;  1GJ7 B;  4CH8 B;  2ZDA H;  1Q2W A;  5A0B A;  3P92 A;  1CA0 B;  1BIT A;  2ZWL H;  3HAT H;  5A8Y A;  4ISN A;  1PPB H;  2JET C;  1JXP A;  3UPE A;  5L6N H;  5F6M A;  2XYA A;  1IAU A;  3DFJ A;  9LPR A;  4ZKN U;  3SND A;  1YY3 A;  2ZF0 H;  3K9X B;  1AFQ B;  2W5E A;  1GI6 A;  4ZXX H;  4MNW A;  4O03 A;  3VB6 A;  4CRB A;  2OLG A;  4FET A;  4Q2K A;  1EZS C;  1HNE E;  1OP0 A;  2KFW A;  4Y0Z E;  5FX6 A;  3C1K A;  1YPH E;  2P8O C;  4MPU A;  1ELT A;  1A0J A;  3A7Z A;  3KQ5 A;  4I8G A;  4DG4 A;  3MU1 A;  3UR6 A;  2BLQ A;  3NZI A;  1K1N A;  1XM1 A;  2KZ4 A;  5C2Z A;  1QFK H;  2VWN A;  3GY3 A;  2BDI A;  3KQE A;  2FDA A;  1MAY A;  1PPC E;  1QB1 A;  1ZSL A;  1BBR E;  1TMB H;  1V2P T;  3HPT B;  3P8F A;  4B6F A;  3SZN A;  4NWL A;  4Z1M D;  1S5S A;  2THF B;  1A1R A;  2J95 A;  5HIZ A;  1PYT D;  3KGP A;  1C2D A;  4CRC A;  1YYY 1;  2HAL A;  1AHT H;  5JBA S;  2W3I A;  2VIV A;  1Z7K A;  4K5Z A;  5IYT A;  1OHH D;  2IPH A;  1QBV H;  2ZFR H;  4WWY A;  2BDB A;  2C3S A;  2QAA A;  1DWE H;  1DUA A;  1EPT C;  1TE0 A;  1ELF A;  3T27 A;  4RN6 A;  1AVX A;  1EST A;  1H8H D;  5JB8 S;  6LPR A;  1GHV H;  1C5N H;  1O5F H;  1OP8 A;  1LPK B;  2FOM B;  3EYD A;  4BAH B;  1O5C B;  4CHA C;  1NFX A;  3I78 A;  3LPR A;  2BDA A;  4D9R A;  1C1R A;  2H5C A;  2WPH S;  1QQU A;  3BG4 C;  5B6L A;  3JZ1 B;  1A5I A;  3SUG A;  4LZ4 B;  3QO6 A;  4BNR A;  1FV9 A;  4K69 A;  1TGS Z;  2B0F A;  3QZQ A;  1EAT A;  3OTJ E;  1KXB A;  4INL A;  1EPT A;  1GHB G;  1GMH F;  1SBW A;  5KEC A;  1C2F A;  1W0Y H;  3P6Z B;  2FOG A;  1MKW H;  3ZZ8 A;  1TNI A;  1QL8 A;  3U9A H;  1KXE A;  1ELG A;  3RMM H;  2O8L A;  1W0J D;  2TIO A;  3VG8 A;  1KXC A;  3TIU A;  5FL7 D;  2OC8 A;  1NFW A;  4LK4 A;  3IG6 B;  1GGD C;  2STB E;  1W8B H;  2ZTX A;  5GXP A;  4YT7 H;  2F91 A;  3E6P H;  1SMF E;  1JWT A;  1O3P B;  1TQ0 B;  2FYR A;  1TRN A;  4NG9 H;  3SJ9 A;  4OS6 A;  1D3T B;  2UWP A;  2CHA C;  3URD A;  3SV7 A;  1C1W H;  2PP6 A;  1O3F A;  2ZGH A;  4DJZ B;  1SOT A;  2TBS A;  4D76 A;  3LC3 A;  5EST E;  1YBW A;  2HGT H;  1KLT A;  2GZ9 A;  4NIV A;  1O2Y A;  4O3T A;  3Q00 A;  1KDQ A;  1KXD A;  1VCP A;  3BN9 A;  4J1Y A;  1BOQ A;  2C93 B;  3WY8 A;  3RXG A;  4INK A;  3E91 A;  2C8Y B;  1PQ8 A;  2FI5 E;  3KN2 A;  1DOJ A;  4ZXY H;  2C8W B;  1O5G H;  2ZI2 H;  2R3U A;  1WU1 A;  4JK5 A;  1O2Q A;  4WH6 A;  1Y5B T;  5EW1 H;  1WYK A;  4IW4 E;  2P95 A;  1HAP H;  4KTU A;  4YTA A;  3FOA A;  1P2M A;  4AX9 H;  3PRO A;  2YMS D;  3GY4 A;  1S6H A;  4BAM B;  5E0H A;  1ZOM A;  2C90 B;  3ZZ6 A;  1TLD A;  2J94 A;  2B7D H;  4QT8 C;  1DWC H;  3SUD A;  2ZFQ H;  4OS1 A;  3PRD A;  5GCH F;  3STJ A;  2AIP A;  5J4S A;  2FS9 A;  1FJS A;  1EXF A;  1WTG H;  3A80 A;  1H9I E;  4NFF A;  1HCG A;  1TNJ A;  3BEU A;  4FOU C;  1EAX A;  3TK5 A;  2P3U B;  1H8E D;  3ODD A;  1UVS H;  4FVD A;  2XC0 A;  1IHT H;  1K22 H;  2BY5 X;  4DY7 B;  2GP9 B;  3VFE A;  1CBW C;  1O3J A;  4U01 A;  2G5V A;  2V3M A;  5JBT A;  1FX0 B;  3Q3K A;  1ETS H;  2EC9 H;  5CHA B;  1GBL A;  3CS0 A;  1Y3X A;  1IHS H;  5TCC A;  2Z3D A;  3RC5 A;  1QIX B;  4TSF D;  1AZZ A;  1SGR E;  4CRF A;  1K28 D;  1A0L A;  4I86 A;  2BVS H;  4A92 A;  1GMD F;  1V2Q T;  3PRB A;  2G4U A;  3H7O A;  3A82 A;  1XUK A;  2Z3C A;  1T8M A;  3MWI U;  3MU5 A;  1GBJ A;  5JYI A;  3QDZ B;  3RLW H;  1O2N A;  3JZ2 B;  1HB0 B;  4D8N A;  2KAI B;  7EST E;  1AFE H;  2I6Q A;  3SHC H;  1O2K A;  1H8D H;  1T8L A;  1W7X H;  4Y8X A;  3QZR A;  1XUI A;  5FAH A;  3BTW E;  3ATW A;  1T31 A;  1P02 A;  2JJ1 D;  1GL1 A;  1C5V A;  1COW D;  1BJV A;  2CJI A;  5EPY A;  2FOB A;  1LTO A;  1O2X A;  2AMP A;  2JIZ D;  2XBX A;  4UFG H;  1AMH A;  1N8O B;  5CE1 A;  1CHG A;  1C5R A;  2BD3 A;  3D23 A;  3ZZ4 A;  4FU8 A;  1G2L A;  2G81 E;  1AIX H;  1AY6 H;  3RXQ A;  3ATI A;  1MAB B;  2ZFT A;  1D3D B;  8KME 2;  1O36 A;  1K1P A;  2QXH A;  1A5G H;  2PV9 B;  3MOC A;  4K1S A;  1RJX B;  1O3L A;  2D1J A;  2K8I A;  1QUR H;  3PM3 A;  4NIW A;  1C1V H;  3EAJ A;  1CA0 C;  4MG3 A;  3GCT G;  5E8E H;  4F48 B;  2WV9 A;  3W1E A;  1C5W B;  1MTW A;  1SOZ A;  3PV2 A;  5CDF E;  2Y80 A;  1PPG E;  2R3Y A;  2EI7 A;  1EB1 H;  1GVK B;  4D7G A;  1CO7 E;  3ATL A;  4JYU H;  2ODP A;  1MZD A;  2WHX A;  1HDT H;  3URC A;  2YNB A;  4UFD H;  1H4W A;  3RXI A;  3RXH A;  2IN2 A;  3A83 A;  5EGM A;  2AGI X;  3T26 A;  4JK6 A;  5FX5 A;  3V7T A;  1THP B;  1ZML A;  8EST E;  2A5A A;  1KXA A;  4O3U A;  2OP9 A;  1WDI A;  3M61 U;  2G52 A;  4KTC A;  1GI4 A;  3RMO H;  1K21 H;  2EI8 A;  1FIZ A;  4AYV B;  4X6N A;  1WV7 H;  1ZPB A;  1GBT A;  1VCQ A;  2JET B;  2ZQ1 A;  4B75 A;  1ZGV A;  2F3C E;  5I25 A;  4F55 A;  3DD2 H;  1V2J T;  2FLB H;  2FS8 A;  1JIR A;  3BTD E;  1P2Q A;  2WZQ A;  3VPK A;  4FVB A;  2A32 A;  2BDH A;  4IBL H;  3SU2 A;  2VIP A;  1SVP A;  2XNI A;  3KL6 A;  3M3T A;  3QX5 H;  3R3G B;  1DIC A;  3VEQ B;  1HIA A;  3AW1 A;  3TH4 H;  1MKX K;  4CRG A;  2DUC A;  2A5I A;  1F0S A;  2GCH F;  2ODQ A;  1BT7 A;  1MMJ N;  1GMH G;  5J4Q A;  1XVO A;  5GIB A;  4XFQ A;  3UWI A;  3MH7 A;  2BDY A;  4M7G A;  1CU1 A;  2XWA A;  2K0Q A;  1FMG A;  2ZDK A;  3STI A;  3M3V A;  2WSS D;  3TH2 H;  1E0F D;  1C5X B;  3BIV H;  4PRO A;  5FBI A;  2H2Z A;  4YT6 H;  3QWC H;  3U1I B;  1GHA F;  1C2L A;  4BAQ B;  4AFZ A;  1YPG H;  3TH3 H;  3RXP A;  5EXN A;  5EQR A;  4K2Y A;  3E16 B;  1GBI A;  1O3C A;  5DP6 A;  1V6D A;  1TPO A;  7GCH G;  1DE7 H;  3T2N A;  1GBH A;  1O2J A;  1IQK A;  3U98 H;  1EZU C;  3LGT A;  1OWJ A;  2PUX B;  5C20 A;  1LVB A;  3RP2 A;  1O32 A;  4OS2 A;  4WF8 A;  1XUJ A;  4Y0Y E;  1EB2 A;  1BIO A;  1NRS H;  5E2O A;  2PGB B;  1Z1J A;  4X1S U;  3ZZC A;  1O39 A;  3PB1 E;  3A85 A;  3TJN A;  1MTN B;  1ZYO A;  4I8H A;  4JZI A;  3OY6 U;  1HXE H;  1AU8 A;  5AFZ H;  4M9F A;  2VIN A;  2TPI Z;  3SJK A;  1B7X B;  3RU4 T;  2A4Q A;  1O0D H;  1KYN A;  3O8R A;  1ZSJ A;  4HGC A;  4K1T A;  3U28 C;  4AYY B;  3KID U;  1EP6 A;  5HYO A;  1GJA B;  1FQ3 A;  2F9V A;  3RXR A;  2CN0 H;  1WSS H;  1O3D A;  2Q6F A;  1Z8I B;  2BY6 X;  2WPL S;  5GCH G;  1ARB A;  3TU7 H;  2HRV A;  1E36 B;  4IS5 A;  1KDQ B;  1QBN A;  1HAV A;  3LGV A;  4WVP E;  1NRN H;  1TON A;  5ESB A;  5JB9 S;  1E1Q D;  1GI9 B;  3NUM A;  4UEH H;  2GX4 A;  3SJI A;  1ZHM A;  1C5T A;  1SGI B;  1GI5 A;  2G55 A;  1CHO F;  1O3G A;  2FXR A;  3MYW A;  5TCA A;  2BX3 A;  1F0T A;  3MO3 A;  2A7C A;  2C8Z B;  2SNV A;  3FN8 A;  3VXF H;  4ZKR U;  2CF9 H;  3ZZ7 A;  1ZRB A;  2VVV A;  1RTF B;  2ZU1 A;  2BM2 A;  3PWC A;  2SGP E;  3CP7 A;  4X8S H;  1Z6E A;  1LO6 A;  1TAW A;  3I77 A;  3SUF A;  3AAV A;  5EPN A;  2BVX H;  2HNT C;  4Y6D A;  3KCG H;  3UQO A;  3GYM A;  1HJ9 A;  3RM0 H;  5C67 A;  1UVP A;  1A5H A;  2F4L A;  1ETT H;  3G01 A;  3O8B A;  5A8X A;  1TPA E;  1HAZ B;  1O2W A;  1ZHR A;  2ZP0 H;  3F2G A;  4GCH G;  3RDZ A;  3WWB A;  2STA E;  2K1Q A;  2ZCK P;  1P09 A;  1G3C A;  1YCP K;  2NWN A;  4K1E A;  3SOR A;  1NES E;  3KYF A;  3ZYD A;  1QHR B;  5IK2 D;  1TX8 A;  1BRA A;  3OX7 U;  1GBF A;  3T25 A;  3PLK A;  5HMA A;  3LIW A;  2Q1J A;  1LDT T;  1LVM A;  2BXT H;  1VIT H;  2D26 C;  3BTQ E;  3UIR A;  3MFJ A;  4IGD A;  1ANE A;  5L2Y H;  1EJM A;  2H5D A;  1XMN B;  2WUB A;  6GCH G;  1FNI A;  3EST A;  4HG6 A;  3QTV H;  1A61 H;  8LPR A;  1O2I A;  1MKX H;  3QN7 A;  1IQE A;  3SNB A;  3K2U A;  2ZDM A;  3S9A A;  2QF5 A;  1M9U A;  1ZTJ A;  2VIW A;  1FPC H;  2BOH B;  1C5S A;  1TNG A;  3FZZ A;  3MHW U;  1BJU A;  2Y5G A;  3U8O H;  5DPA A;  1O2L A;  1UCY E;  2P93 A;  3P70 B;  4X1N U;  2FOD A;  1UVU H;  3BG8 A;  3SU6 A;  4JZF H;  2YOL A;  1BTH H;  1OWH A;  1TX6 A;  1IQF A;  1P03 A;  1K1O A;  2ZA5 A;  1DLE A;  5C5N A;  1SPJ A;  1TOM H;  1GDU A;  1YF4 A;  1BTU A;  4Y10 E;  1OYQ A;  5C1X A;  5T6D A;  2KAI A;  1G32 B;  1ELE E;  1O33 A;  1C2K A;  1EQ9 A;  4MNY A;  2QN5 T;  4ABE A;  1YPM H;  1JRT A;  3DSG A;  4VGC B;  4JZE H;  4NSV A;  2Y81 A;  1FLE E;  2Y5H A;  3T62 A;  2ZU5 A;  2ZHQ H;  1QY6 A;  1UMA H;  4ISH H;  2BZ6 H;  2G00 A;  1NRP H;  1ZPC A;  2ZHF H;  2F83 A;  3UQV A;  1BRC E;  3BEI B;  2A4G A;  3D62 A;  1YP9 A;  1SGT A;  1OKX A;  3SGB E;  2GV7 A;  4NA7 A;  5LGO A;  2AS9 A;  1UTQ A;  2OUA A;  3E1X B;  1DM4 B;  2ZHW H;  1SHY A;  3OAA D;  2ZU2 A;  1AO5 A;  1GVZ A;  2ASU B;  2O8U A;  2PHB A;  4GSO A;  2SGE E;  4WMD A;  3FZD A;  3RXF A;  3RXC A;  3EQ0 H;  2ZC9 H;  2FWW A;  3U8R H;  3ZZD A;  3E8L A;  5EJ1 A;  4WH8 A;  3M35 A;  2GCH G;  1QB6 A;  1IQG A;  1YPK H;  1V2M T;  2C8X B;  1TNH A;  1VIT F;  1F5K U;  2PLX A;  2QYI A;  4Q4L A;  3BV9 B;  4WXV A;  1QL7 A;  1NPM A;  1NFY A;  4FUI A;  4DUR A;  1NN6 A;  1Y3V A;  2FLR H;  1HRT H;  5C0T A;  2PSX A;  2SFA A;  1DLK B;  1DVA H;  3RXM A;  4AN7 A;  1C2M A;  4DT4 A;  4RKO B;  1SHH B;  2OBO A;  1MU8 B;  1TGN A;  1GHA G;  1QA7 A;  2BY9 X;  2FZZ A;  2OK5 A;  1DUE A;  1TIO A;  3PV4 A;  4FUB A;  1XXD A;  2VU8 E;  1HIA B;  3GCT F;  3KQC A;  1IOE A;  4F49 A;  2SNW A;  4Y8Y A;  1BCU H;  1W12 U;  3M7U A;  2R0L A;  3V12 A;  3S7K B;  1BMA A;  4X1R U;  3PV5 A;  4X6P A;  3FKS D;  3GIC B;  1E35 B;  3MH5 A;  3UNQ A;  3RXT A;  4EST E;  5DO4 H;  1N6Y A;  2NU0 E;  1P04 A;  3KF2 A;  1GMC G;  2GTB A;  2QXJ A;  3SI3 H;  2OC7 A;  3QGN B;  3Q76 A;  1KTT B;  3V13 A;  1ELB A;  1MD7 A;  1EX3 A;  3RU4 E;  1FAK H;  1TRY A;  2RDL A;  3HKJ B;  1Y3Y A;  1TPP A;  1YLN A;  1T4V H;  1O31 A;  4YOJ A;  5IDK A;  3RXL A;  2A2X H;  1QJ7 B;  3ZZ3 A;  4NCY A;  1MAX A;  1KLJ H;  1YCP H;  3VGC B;  3A84 A;  4WJG 2;  3A7V A;  3F3B A;  1O3A A;  4R0I A;  1UTP A;  2A4R A;  1S6F A;  3BEF B;  1NU9 A;  1FPH H;  3PTN A;  4BTI B;  3GY7 A;  5FCR A;  4FUF A;  3SO3 A;  4FU7 A;  1PPF E;  5PTP A;  3PMH B;  1IQL A;  1C5O H;  1P2K A;  3KNX A;  4UFE H;  5EOD A;  4ASH A;  2XND D;  1MTN C;  2JKH A;  4CR9 A;  2A2Q H;  4NGA H;  1V2S T;  1HAO H;  1C2J A;  1HAG E;  3A81 A;  5T6G A;  1A7S A;  1G36 A;  1G2M A;  5CMX H;  2QA9 E;  1O3M A;  4D9Q A;  1CHO G;  3DHK H;  4E05 H;  2HNT E;  1DS2 E;  1SGY E;  3RMN H;  4OS5 A;  1RS0 A;  2GT8 A;  2P3F H;  1Y5A T;  2XRC A;  2FOF A;  1QRX A; 
#chains in the Genus database with same CATH homology
 3P8O A;  2F4L A;  2L6O A;  5EPY A;  2WSS D;  1DXP A;  1KMH B;  1S6L A;  2JIZ D;  2KCO A;  2YMS C;  3O8B A;  2XCN A;  2KR7 A;  3F2G A;  4TYD A;  3WWB A;  2KM0 A;  4R8T B;  3F2F A;  3LKW A;  3N99 A;  2K1Q A;  3U1I B;  3ZIA D;  2KZ4 A;  3GS9 A;  4Q4L A;  3KEE A;  3E90 B;  5H4I B;  1MAB B;  4OM9 A;  4ASU D;  5EQR A;  3N7D A;  3RC4 A;  3SU5 A;  3RC6 A;  3FO8 D;  5IK2 D;  3P8N A;  3KN2 A;  3LON A;  5EQS A;  3L6P A;  3M5N A;  1NBM D;  4B74 A;  2XOK D;  2GGV B;  5C0T A;  4TT3 D;  3SUE A;  4B73 A;  2K8I A;  2FP7 B;  3F0O A;  4DT4 A;  1W3C A;  5FPY A;  3DSP A;  2AHM E;  3SV6 A;  4A1T A;  3SV9 A;  3OE7 D;  4WH6 A;  2OBO A;  2WV9 A;  3W1E A;  4B6F A;  4WF8 A;  3FOA A;  4NWL A;  4Z1M D;  3PV2 A;  2XCF A;  5DSF A;  2OK5 A;  2W6I D;  5CDF E;  5GJ4 B;  2YMS D;  2GVF A;  1A1R A;  3NRL A;  3SU3 A;  4B76 A;  2QF4 A;  4I33 A;  2OC0 A;  5CHB A;  1WXR A;  3WW7 A;  4A1V A;  2W6J D;  5GND A;  2OIN A;  4I32 A;  2WHX A;  1OHH D;  3OYP A;  4XD7 D;  5HKK D;  3AK5 A;  3SUD A;  3SU0 A;  2LEL A;  2OBQ A;  2QF5 A;  3PV5 A;  2QV1 A;  3FKS D;  3PRD A;  5FPT A;  3WWF A;  4M9F A;  2KCP A;  5GPI B;  3SU1 A;  3KF2 A;  5T1V A;  3SU4 A;  3SV8 A;  5C17 A;  1DY9 A;  2M2A A;  2A4Q A;  2OC7 A;  4JMY A;  2HLD D;  3OFN D;  1H8H D;  3M5M A;  5FPS A;  2V7Q D;  3UB0 A;  4B6E A;  3LOX A;  4RI0 A;  5C0U A;  3O8R A;  2VBC A;  2FOM B;  1H8E D;  3EYD A;  2F43 B;  3SU6 A;  2YOL A;  1NS3 A;  2F9V A;  2IJD 1;  2KCA A;  5IDK A;  4KTC A;  5ETX A;  4U01 A;  2YMS B;  5B6L A;  2FM2 A;  1FX0 B;  4B75 A;  3N7E A;  2IJO B;  3SUG A;  1DXW A;  4F55 A;  4K8B A;  3F3B A;  1E1R D;  2JDI D;  2WZQ A;  5ESB A;  2A4R A;  1E1Q D;  3H09 A;  3RC5 A;  3SZE A;  1EFR D;  4I31 A;  3F2H A;  4TSF D;  1DY8 A;  3M5O A;  3SU2 A;  4A1X A;  2XNI A;  2QE7 D;  3OTP A;  2OC1 A;  3KNX A;  5DN6 D;  4A92 A;  2XND D;  3PRB A;  1JXP A;  3DCL A;  1RGQ A;  5EQQ A;  2JJ2 D;  2CK3 D;  2A4G A;  1BMF D;  2KCY A;  3DSO A;  3FN8 A;  3O8D A;  1W0J D;  1W0K D;  3VG8 A;  3O8C A;  5FL7 D;  2OC8 A;  3OEE D;  1SKY E;  2J5U A;  2O8M A;  5F53 A;  1BT7 A;  1RTL A;  3F0P A;  3OAA D;  4YXW D;  3SUF A;  2P59 A;  3SYJ A;  4NWK A;  1NBM E;  5EPN A;  3U1J B;  2F9U A;  4FET A;  4B71 A;  2JJ1 D;  2WPD D;  1CU1 A;  2KFW A;  3M5L A;  1E79 D;  2K0Q A;  4Q63 A;  3SV7 A;  4ZCN A;  3OEH D;  1N1L A;  1COW D;  4WH8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...