2R2WU

Urokinase plasminogen activator b-chain-gppe complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Plasminogen activator, urokinase
publication title Geometry of GPPE binding to picrate and to the urokinase type plasminogen activator.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2007-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r2wU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r2wU01
2Y7ZA 3SGAE 1MZDA 3PWCA 1OSSA 3K6YA 3SGBE 4AOQA 1O32A 4A1TA 3E0NB 3GYMA 2OBOA 1V2RT 3ATWA 4YZUA 4Y7BA 5C1UA 4INHA 2A0QB 2ODYB 5I25A 3RXAA 5AHGH 1G30B 2WPJS 5CMXH 2GCTB 1THPB 3T27A 1YPKH 3HKIB 2OXSA 1XXDA 2B5TB 1OWKA 1UTJA 5HM9A 2LPRA 3U9AH 1C2LA 5E0GA 3VB4A 4O9VA 1A5IA 5EQQA 1A5GH 1LO6A 3LH1A 1O36A 1WTGH 4KTSA 1ID5H 2IJOB 1O34A 1YLCA 3MMGA 3TJNA 3GICB 1L1JA 2DUCA 1NRNH 2VGCC 2BY8X 4WWYA 1OKXA 1O3IA 3SJIA 3SJ9A 1C5NH 2PGQB 4K2YA 2FS8A 1GHBG 1AUJA 1KXEA 1Q31A 3IG6B 1V2PT 2V3OH 4JMYA 4OS5A 2ZDNA 2VU8E 1A0LA 2PFEA 3ZZAA 5DPAA 1SFQB 2D2DA 2GMTB 3GDVA 1TQ7B 2ZDAH 2VWNA 5AVDA 1KYNA 2H9TH 3SV2H 4Y10E 3OY6U 1UTLM 4CREA 7GCHF 2FESH 2Z9GA 1G3BA 1PPZA 1Z6EA 3ENSB 5A09A 4D76A 1A46H 3KN2A 3TJUA 4AX9H 1FONA 1FAXA 1O2ZA 1D9IA 2A7CA 2XC5A 1EATA 3PLPA 1ZSLA 3I77A 2BYAX 3P6ZB 4F49A 5HMAA 3SV8A 1ZLRA 4RKJB 1ELFA 3UTUH 3M7TA 1UK4A 1LQDB 3FP6E 1T32A 1VITF 2PLXA 1EQ9A 1B0FA 3ZVCA 3UUZA 3O8BA 1XM1A 1CHGA 3E3TA 4NA8A 5E2OA 1BTYA 1O2QA 1MAYA 3S9AA 3M5OA 3P8OA 1J15A 1TNIA 5HM2A 1GG6C 4FVDA 1G36A 1AY6H 3NKKA 2ZO3H 3TNSA 3D23A 1XVMA 1BIOA 3LGWA 2OBQA 1X7AC 1O3LA 4ABEA 1MQ6A 2PKAA 1HBTH 3W95A 3QUMP 1GJ4H 1Y59T 4LK4A 1O2KA 1Y3VA 1DY8A 1BJUA 1QFKH 4YOJA 1QY6A 5LH8A 3GDSA 1IHSH 1GPZA 1PQ8A 3DUXH 1ORFA 3SU5A 1O2RA 4CR5A 1P04A 1H9HE 2EA3A 3EA8A 1A0JA 2FOGA 4DT7B 1CO7E 4MDSA 4GLYA 4AFQA 3UIRA 2Z7FE 5CHAC 1GJAB 2ZQ1A 1KXBA 1HXFH 2R3YA 2Z3EA 2HGTH 3VEQB 1C2KA 3M37A 1P2NA 1IQEA 3MYWA 4WMDA 3AAUA 1AWHB 4OS7A 3HKJB 1OXGA 1ETTH 1N6YA 4I32A 2BZAA 3QGJA 5F6MA 1NM6A 1DSTA 2GZ9A 1F0SA 3RXLA 4ZKSU 2FYRA 1FXYA 1O3JA 1A0HB 5J4SA 1EP5A 5SGAE 2O8MA 1K2I1 2Y5HA 3GCTG 3TIUA 5JBCS 3T26A 2BY7X 3ZZ9A 4Y7AA 3RC4A 4WF8A 1D6WA 1OX1A 1SHHB 1XUFA 2Y81A 1LVOA 3QWCH 2FS9A 4WY3A 3RXDA 2J4IA 3SQHE 1AZ8A 1FN6A 4MNYA 3GYLB 1LPZB 2PKSC 2ZFQH 2H9HA 1CGJE 4XOJA 3F9FA 1FLEE 8GCHF 4JZDH 1GBCA 2UWLA 5BPEA 4H6TA 3E16B 2ZCKP 3K65B 1FUJA 4VGCB 1C5MD 3SV6A 1A61H 4KELA 2GT8A 1G3CA 1YGCH 4X2WA 1SR5C 8ESTE 3PLBA 1GBIA 1PPGE 1YC0A 4ZKRU 4ZH8A 1GBDA 5FCRA 2TGAA 5E8EH 3P92A 1P03A 1J9CH 1NU9A 5L2YH 2C8ZB 3TH4H 4B1TA 3DD2H 1O2OA 1TGSZ 4M7GA 3MU5A 4XBDA 5F03A 3T62A 4MVNA 5EXLA 1GBAA 1HYLA 1DSUA 4ISOA 1CHOF 4GPGA 2Z9IA 1T31A 2QYIA 2BD3A 1P12E 5C20A 1HLTH 1TNGA 1EAIA 1OWHA 2W26A 1SGQE 3BEUA 4ISNA 3F1SB 1K28D 2A2QH 2ZHFH 2A4OA 5JPMH 2PUQH 3CS7A 1YPJH 2AIPA 5FX6A 1TQ0B 1JRSA 3HPTB 3P8NA 1EPTB 1V2UT 1C5QA 1KIGH 1GI5A 1PFXC 1ABIH 3SJ8A 2ANYA 5E2PA 2SNWA 3U8OH 2PSYA 4FUGA 4X1SU 3K9XB 4BAHB 4YESB 4B74A 5CE1A 1K1OA 2ZP0H 4BTUB 1J17T 1AVXA 1ELGA 4U30A 1EZQA 2P8OC 1GHZA 3E90B 1F5LA 3EA9A 4IC5A 3BTTE 3MHWU 1TPOA 3RU4E 4BANB 1NU7B 1K1PA 4FVBA 5GWZA 2ZHEH 1O5DH 1O2HA 4OS1A 1OP2A 1TMUH 3EAJA 3QZRA 2R0KA 5C5NA 2ZG0H 4A7IB 1MU6B 2V0BA 2FOAA 1GGDC 1GHBF 4KTCA 4LZ4B 1DWEH 3HGPA 1FY8E 2ZGXH 3UOUA 1C4U2 1LMWB 3SNDA 3RMLH 1BRAA 1ELDE 1G3DA 5GCHG 3QX5H 2VVUA 3ZZ8A 3Q3XA 1TNLA 3B23B 1T4VH 1Z6JH 3LT3A 2SFAA 1V2NT 2QA9E 3SU2A 1QJ6B 1LHCH 2FDAA 3Q00A 3UR6A 2BDAA 1TLDA 3RXEA 5G4BA 1ABJH 3KL6A 2V35A 3PTBA 4ISHH 4UEHH 1O31A 2FTMA 4FUJA 3ZYDA 1TX7A 5A0BA 3SN8A 2PW8H 3SBKA 2B0FA 3VXFH 1MQ5A 3M61U 1TONA 4KP0A 1C5ZB 1WQSA 1TRMA 2Z9JA 1BMAA 3GY5A 5EW2H 3U69H 1QRWA 1BRUP 1O3BA 1DX5M 1PYTC 3RU4D 4FU8A 2GCHG 2XWBI 2VINA 2XBYA 1HAYB 1FQ3A 1BMNH 2WYGA 4DOQA 4IC6A 3A89A 3BTGE 5DJ7A 3TJVA 2F9NA 4H4FA 2VJ1A 1HAHH 2FOHA 3LGYA 1PQ7A 1C1RA 2F9UA 1SG8B 1DICA 1DY9A 1WQVH 3GY4A 1LPGB 2CHAB 1C5TA 1W2KH 1HIAA 4XBBA 1C1NA 2PTNA 2G4UA 4NZLA 1L0ZA 1D4PB 4FUHA 1RTFB 1V2VT 3RXPA 3A8BA 2WPLS 2UWOA 5ESTE 5EXNA 1F5RA 3E0PB 1O3MA 2QXGA 1QRZA 1TBQH 3MI4A 2OQUA 1IQLA 2EI8A 4BTTB 4JK6A 2JETC 1OP0A 4Q2KA 2Z9KA 2FWWA 1O3FA 1KY9A 1O2NA 1SSXA 2SGPE 4CH8B 2BY9X 1GI0A 1P05A 1CVWH 5JBBS 4YOIA 1P2KA 1BTPA 5EG4A 2ZU3A 1DANH 2H5CA 4MQAA 2BQWB 3FZDA 1XVOA 1T8OA 2IPHA 1FY5A 3GY7A 4K1TA 1KXAA 3ZVGA 2Y7XA 1SVPA 1QL7A 4RKOB 1GJ9B 2BTCE 3T2NA 1OP8A 4B76A 2B8OH 1YCPK 3C1KA 2XC4A 3ODFA 1K1JA 3Q76A 1DE7H 3NPSA 3RXCA 1AO5A 3MNXA 3RM0H 1SI5H 5TCAA 1XKBC 3RXQA 1VCPA 1XXFA 2QF0A 2EI6A 1MD7A 8KME2 1FJSA 2F9BH 3GCTF 2TGDA 2K1QA 2BDBA 1Y3YA 1EB2A 3DA9B 3EDXB 3QTVH 4AYVB 1GMHG 1DM4B 5DK1A 2NU0E 3O8CA 3PO1C 2VIPA 1G37A 4X8UH 2XTTB 1G2MA 1FPHH 2AFQB 4AB8A 5C1YA 2ZGCA 3LIWA 1GL1A 4U01A 2ODQA 3SJKA 2P95A 1OWEA 2HOBA 1CQQA 4KGAA 1V3XA 3LGVA 1NY22 3F9EA 4FUCA 1AQ7A 1NRSH 1A4WH 2PV9B 2HNTC 5JB9S 2OCVB 2XNIA 1DWCH 1O3HA 5B6OA 5ESBA 1DLKB 2Z94A 1NFUA 1H9IE 1O5GH 2AGIX 2KAIA 1TGTA 4GCHG 4K1SA 5L2ZH 2FXRA 2FOEA 4X0WU 4A92A 3RXKA 3V12A 2VWMA 4Q80A 3UWJH 2ZI2H 3H5CB 1MTSA 1LVMA 3IITA 3TH2H 2G55A 2BDYA 3CENA 1AFEH 1EOJA 4MNXA 2WPMS 4O03A 2SGDE 3ZZ4A 5HXFA 1UVPA 1GWAA 1SGTA 3M35A 4ESTE 2GX4A 1QB1A 1BUIA 2ZGJA 4Q7YA 3A7TA 4O3TA 4UFFH 3U1JB 2PR3A 3M7QA 1JMOH 3RXOA 5E0HA 2FI4E 1O5CB 2XWAA 1SLVB 1TPSA 3V13A 2ZFSA 3NWUA 3DHKH 5C67A 2PWXA 1ZTLA 1HAPH 1C9TA 1GHAF 4GUXA 4CHAB 1AMHA 1UVTH 2F83A 3BG4B 1KXFA 2CV3A 1D6RA 2GCTC 3RXIA 2ZZUH 2YNBA 5PTPA 1SQAA 1GI2A 1P2IA 2B9LA 5T3HA 3H7OA 5A8YA 4D9QA 3M5NA 2NU1E 2J94A 4OGXA 5A0AE 3PM3A 2BQ6B 1GHVH 1C2EA 3LGTA 3SUEA 4X1PU 2ZEBA 3GCNA 2A4RA 4K8BA 4JK5A 3QDZB 2UUYA 1MTNB 2GZ7A 4AB9A 2ANWA 1O3DA 4ZUHA 1AB9C 2GKVE 4O3UA 5EQSA 1YM0A 1YPHE 3STIA 1QJ1B 1UO6A 1LCYA 1LDTT 3MH4A 4Y71A 5TCCA 4YT6H 6LPRA 4XBCA 1HB0B 2FX4A 1WV7H 3LU9B 3GY6A 3BIUH 2BB4A 1P2QA 1SQTA 3OYPA 1TYNA 1GJ6A 3PMJA 3VFEA 1Y3UA 4IS5A 2QIQA 3RUOA 3SNAA 3TGIE 2OC0A 3ELAH 1Z7KA 2GMTC 3SU1A 3FP7E 3KIDU 4A1XA 1DUEA 5GCHF 2A32A 2AERH 2XYAA 1QQUA 1OWIA 1O2MA 1CBWC 4CRDA 3QN7A 3RXFA 4UD9H 1F7ZA 4HGCA 1KDQB 1SFIA 1IQJA 1C5VA 1Z8JB 3ODDA 1S6FA 1U6QA 2D26C 1BHXF 2W3KA 1C1VH 1ELVA 1Y5UT 1YCPM 3SORA 3RXMA 4WJG2 1NN6A 2J95A 2FOFA 3N7OA 1IOEA 1GI7B 2VIQA 3F9GA 2TBSA 5AFZH 1DLEA 4Y76A 1CA0B 3TJOA 1GBEA 2BDIA 1Y3XA 2BOHB 4JYTA 4IMZA 2J9NA 1CT4E 3HATH 4UFDH 1Z71A 4K3JA 1ACBE 5GXPA 1C1QA 1YLDA 2BXTH 5HYOA 1C5SA 1BOQA 1HAVA 3UNSA 3BTDE 1GMCG 1Z8GA 2Q6GA 1OWDA 1V2OT 4QT8C 1EAWA 1MAXA 1C1UH 1KXDA 1TALA 2FMJA 4X2XA 3S9CA 1YYY1 3FZZA 2FM2A 1P9SA 1RIWB 2VGCB 2P16A 1V2JT 4Y79A 1TPPA 1XUJA 1C5RA 1N8OB 2QAAA 1XUIA 1MTWA 2W3IA 3A83A 1O0DH 2QXJA 2HALA 2BDCA 1FV9A 1O2YA 1W7GH 1TABE 2SGAA 4K69A 1P8VC 1ZPBA 4D7GA 3QO6A 2P3FH 1HIAB 1BHXB 2AIQA 2I6QA 3P8FA 4Z0KA 3K6ZA 1HAIH 1SGFG 3LGIA 1BRBE 1DDJA 4XE4A 1BTZA 5FAHA 2ALPA 2ZFTA 3MO6A 2F9PA 3PV4A 1SQOA 1EJNA 1J8AA 1EZUC 3FVFB 2R2WU 1QTFA 2GDDA 2A45B 1O2GH 1AIXH 1W8BH 4JZEH 1JIMA 1ANEA 1WBGB 4BAKB 4UDWH 3TVJB 3P70B 1KSNA 2VH6A 2WPIS 4ISIH 2W7UA 2ZTYA 1GMDG 3G01A 1GI6A 2P93A 2NU3E 3KQCA 1UCYE 1GHWH 1NPMA 3RU4T 3T25A 1EOLA 2Q6FA 2QXHA 4CRGA 2FX6A 3PWBA 4NWKA 1HFDA 1QGFA 2Z9LA 5AF9H 2HWLB 3M7UA 2XCFA 3RM2H 1SGFA 2C8XB 2ZFFH 1GMHF 2OP9A 1ZJDA 1FIWA 1GBHA 2AS9A 5LGOA 1RGQA 4YOGA 1ELEE 2ZDKA 4K1EA 1RTKA 1ANCA 1TRYA 1O3NA 3RXRA 1BITA 3DT0H 2V3HH 2XW9A 1C2JA 4NWLA 2ZPQA 1LPKB 1ESAA 1AE5A 2G5VA 3A80A 2FODA 2O8TA 1QL8A 3AW0A 3SNEA 1ARCA 3ZVFA 4BAQB 4HTCH 1O2UA 1V2ST 2QC2A 4IN2A 2VH0A 4GCHF 3SHAH 2QY0B 3VPKA 8LPRA 1B0EA 3GOVB 3S9BA 1W10U 4TY6A 4AG1A 4TPIZ 1TBRH 2PHBA 1EKBB 4H6SB 4CRAA 1K1IA 4BOHA 4DGJA 3ZV8A 6CHAB 1UVUH 4K60A 1N6XA 1P3CA 1ETRH 2YOLA 1TFXA 4FUIA 1UTKA 1Z8RA 1QBOA 1BJVA 1ESTA 4NIXA 3RXUA 2TRMA 2WYJA 3EGKH 4SGAE 1P01A 1RJXB 2TPIZ 1RRKA 1KLJH 2QV1A 3QLPH 1QJ7B 3S0NA 1YPEH 4TYDA 1KLIH 1EPTC 4RSPA 2AMDA 1W12U 2Y80A 1LHGH 1UTNA 3R3GB 1S82A 1TMTH 1EZXC 2STBE 1HNEE 3A7YA 1O3PB 2ZTXA 3MH5A 5IDKA 1OYTH 4WVPE 1A1RA 1GCTB 3M36A 1ANDA 3BV9B 3ZVDA 1P9UA 3O8DA 1Z1JA 4B71A 1MH0A 1YPLH 1VJAU 4INKA 3SOSA 1C5LH 1DUAA 3TPIZ 2PKSB 1THSH 1W14U 3ZZ3A 1Y3WA 3Q77A 1VGCB 2Y82A 4GVUA 3GDUA 1Z8IB 2ZU2A 1PJPA 1QR3E 4Y0YE 4X1RU 1C4V2 2STAE 1SOTA 2J2UA 1QHRB 1GHYH 1P57B 4X8VH 1G3EA 2AYWA 1SOZA 1SMFE 2H2ZA 2UWPA 1YF4A 1DXPA 3MWIU 2P94A 1SGCA 2Z3CA 2BDGA 4Y11E 3AVZA 3UNQA 1HJAB 1V2MT 4IGDA 4MG3A 1ZJKA 3UNRA 1AE8H 2PGBB 4UONA 1O37A 2IOTA 3I78A 5GIBA 3SUFA 1P06A 2CMYA 3SV9A 1HAGE 2WV5A 3BEIB 1ZPZA 5DP6A 7ESTE 1OYQA 1P10A 1HJ9A 1TNJA 3C27B 1C4Y2 4Y0ZE 1LHFH 1KTSB 2FOMB 2XCNA 1GJ5H 1MUEB 1EB1H 3OY5U 3A85A 3P17H 5ETXA 1CA8B 3BN9A 1VJ9U 2OLGA 1SGNE 5J4QA 1S84A 2D1JA 2VWOA 5C1XA 1SPJA 2BLVA 2CF8H 3RXBA 1IQKA 4JYUH 4LXBH 3MNCA 4NG9H 4ZROA 1DPOA 1C1WH 1CU1A 4NIWA 5JDUB 1GMCF 2EC9H 1TWXB 2WV4A 1IQFA 3SU3A 1EZSC 2R3UA 3F9HA 4NGAH 4I7YH 3WY8A 3MNSA 4ZKNU 7KMEH 2CHAC 2LNCA 3GCHB 4X6PA 1C2DA 1EP6A 3HK3B 4I8GA 4NA7A 4E05H 5A8ZA 1KXCA 5L30H 1JOUB 2JH0D 3VGCC 2VB0A 5FXLA 1GGDB 1O39A 4X1QU 2AH4X 1C1OA 5JB8S 4Z6AH 1H1BA 4IN1A 3STJA 2BXUH 4JZFH 1MBMA 2QGRA 3ZV9A 1PQ5A 1IAUA 3A7WA 2ZNKH 2ZPSA 1HRTH 2BLQA 1GJBB 1TIOA 3E6PH 1GI4A 1NRRH 2J92A 1E35B 1LHDH 1LVBA 7GCHG 2BD9A 2F9VA 1ZRBA 4ABHA 1AU8A 5LPEA 1TGCA 1UCYH 1UCYK 3BEFB 2OINA 3RP2A 1NC6A 2JH6D 2QF3A 4ABAA 1MBQA 1H9LB 2BY5X 1HV7A 4WMEA 1TGBA 3UWIA 1BCUH 1C5OH 2VIVA 1ZSKA 1BTXA 3LKWA 3TITA 4UE7H 3E91A 3A86A 3NK8A 4INLA 3TK9A 2HPPH 1YPHC 1SGDE 1T4UH 2PKAB 3MOCA 1GMDF 1ZGVA 4I8JA 4HZHA 5FPSA 1G2LA 1O2IA 1DFPA 1P3EA 3O8RA 1RFNA 1GHXH 2AMQA 1AN1E 5F8ZA 2G52A 1MKWH 1ZYOA 1MKXH 4LOYH 1MKXK 3VB5A 2A5AA 1DS2E 1GVLA 3A84A 2BD4A 4DY7B 1C9PA 1P2OA 1DWDH 1TRNA 2ZF0H 4AFUA 5C3NA 1E0FD 1O2LA 1AI8H 4DIHH 4NSVA 5GJ4B 3GCOA 3AAVA 3BTWE 4YLUA 2H1UA 1K1NA 1GDUA 1QURH 1GI8B 1MCVA 1BDAA 4OGYA 4D7FA 3P95A 1SHYA 1FY1A 2BLOA 2FLRH 1ANBA 3TGJE 3B8JA 2W7SA 4TWYA 1SLUB 3KGPA 3K2UA 2FO9A 3PYHA 7LPRA 1G9IE 2HPQH 1UK2A 1GJDB 1V2TT 2ZGBH 3SJOA 3VB6A 2ZGHA 1ZTKA 4NA9H 3FFGA 1AWFH 1V2QT 1GBLA 4BAOB 3U8RH 1TE0A 2BD5A 2F9OA 1A7SA 3A7VA 2B7DH 1W0YH 3SV7A 1A5HA 4ABDA 2RA0A 4DG4A 1UTQA 3RLYH 1AVWA 1UTMA 3TK5A 2UUJB 4UFEH 3ITIA 2DE8A 2ULLA 1O5BB 3MO9A 2ZKSA 4CHAC 1O30A 4FU9A 5C5OA 3MU8A 1C5PA 3BG4C 3AW1A 2ILNA 3CP7A 3A87A 1C2GA 1ELBA 2ZIQH 3M5MA 2BLWA 1RD3B 2AGGX 1W7XH 3SU6A 5FBIA 4CBNA 2OC1A 1DOJA 3SHCH 1TPAE 1AFQB 2Z6BD 4ZHAA 4DIIH 5LPRA 1JWTA 1BBRH 4ZHMU 2XXLA 3MH7A 4GHTA 5EODA 3SQEE 1HGTH 3Q3YA 2FPZA 1D3DB 4Y8ZA 3RMNH 5BRRE 2C93B 2AGEX 2Y6TA 4MPWA 1XUGA 1O5FH 1S0QA 1O2WA 4X8TH 2Y5GA 4OS4A 3OSYA 1SC8U 1BT7A 4NIVA 1Y5BT 1NZQH 1K9OE 4CH2B 4DJZB 1AHTH 2A31A 1VZQH 1ELAA 1NESE 1CGIE 1K21H 5LPFA 1O3OA 2C8WB 1FMGA 1IQIA 1GI1A 1C2IA 2SGQE 1TOMH 4OS6A 1GL0E 1UTOA 4MLFB 2JKHA 2FYQA 3URDA 4B75A 3LONA 1WCZA 1LQEA 9LPRA 1CE5A 2FP7B 1EXFA 1YBWA 3JZ1B 2FOBA 3QTOH 1ZHRA 2IN2A 4AZ2B 4U2WA 1J16A 1C2HA 3R0FA 4B73A 3ZYEA 2BQ7B 3UOPA 3EE0B 3M3SA 5GPIB 4ISLA 1B5GH 4D8NA 1ZMNA 1L1NA 1BQYA 1F0UA 4X6NA 5JBTA 1CA0C 2FLBH 3NZIA 1BA8B 1J14A 2V6NA 2ZCHP 2OQ5A 3KEEA 1O2PA 2XBXA 4B2CA 1BMMH 1GBKA 1OOKB 1WUNH 5EOKA 5H4IB 4DURA 2OD3B 3NCLA 1EASA 5T6FA 1YKTA 2Q1JA 5EU8A 3TNTA 3W94A 1QNJA 3DFJA 3E8LA 1O3KA 3LJJA 4HI3A 3ZZBA 4FU7A 1QCPA 4ABGA 5ABWA 1XMNB 3UPEA 3MH6A 4X2YA 2BHGA 1E36B 1JXPA 3UR9A 3V0XA 4YO9A 2J38A 1NFXA 1PYTD 1K22H 1ZZZA 1UK3A 2CGAA 1O3CA 1AB9B 2G51A 5FPTA 2A7JA 2A5KA 3BTKE 1AKSA 3EYDA 1S83A 4NZQA 1RIWC 3M5LA 5L6NH 1IQNA 2HRVA 1ZMJA 1N8OC 4MNWA 1P2JA 5EPNA 1WOFA 4E7RG 1UVSH 2GCHF 2BVSH 2SNVA 4YT7H 4YM9A 6GCHG 1GBBA 3UQVA 3U8TH 1TBZH 4Q7XA 2ANMH 1HJ8A 3A8AA 2ZTZA 1QA0A 4X6OA 2UUKB 2THFB 4I8KA 4AG2A 2CF9H 4A5TS 1H8IH 1O35A 3NUMA 1SGEE 1CBWB 5IYTA 3UY9A 5F8TA 5A2MH 2BY6X 3RMMH 1WYKA 3A7XA 4BNRA 2TGTA 1ZRKA 1ZPCA 4JCNA 2QXIA 3LDXH 2ZHDA 2FI3E 2HNTE 4XSKU 2GTBA 3SU0A 1A3BH 1PPFE 2BVRH 4DCDA 1E34B 3ATMA 1C2FA 1W11U 2FI5E 3MU1A 3BTFE 5T6DA 2VNTA 4J1YA 5JYIA 3BIVH 1DXWA 2ZC9H 2RG3A 4Y8XA 4BXWA 1NT1A 1O2SA 4CRCA 3S69A 3MU4A 4KKDA 4GSOA 2WINI 1GCDA 1QBVH 3TGKE 1UHBA 3PROA 5A8XA 3LC3A 1GJCB 3EA7A 1ZTJA 2OTVA 1W0ZU 3GY8A 5DP3A 1FI8A 3BTME 1OPHB 1O33A 2ZCLP 1EAUA 1GJ7B 4ZAEA 1QA7A 4CBOA 5T6GA 1IQMA 2FOCA 3IWMA 3SW2B 5EXMA 2ZFRH 1XKAC 2BDHA 1JBUH 1FPCH 1SBWA 1S81A 3DFLA 1S85A 5DP9A 1P09A 1C1SA 1UTPA 1OS8A 5DP7A 4ASHA 3SUDA 3D49H 1EJMA 5EQRA 1RS0A 2C90B 1FIZA 4GAWA 1ESBA 1P2MA 1SGIB 3VB7A 3PMHB 1XUKA 1MMJN 1HAOH 1SB1H 1IQGA 1KLTA 5FPYA 4E7NA 1GG6B 1ELTA 1TA2A 1Y8TA 2ZDVH 3RC5A 2ASUB 1FY4A 2RCEA 1D3PB 6CHAC 1F92A 3TH3H 1PPEE 2SGFE 1JRTA 1HAXB 4I8LA 2H5DA 3TLOA 4I31A 3VXEH 1K1LA 2C4FH 3SNCA 3ATKA 4VGCC 4JZIA 2P3UB 3SGQE 3GY2A 3B9FH 2G4TA 1KTTB 1GBFA 3S7HB 1VR1H 4O97A 3URCA 2FTLE 1D3QB 2CXVA 4DW2U 2AMPA 3BSQA 2F3CE 4WH6A 3S7KB 2CJIA 3SU4A 2AEIH 2VWLA 3RLWH 1EJAA 1EX3A 2VVVA 1DWBH 4X8SH 2ALVA 3MFJA 1GVZA 5CHAB 2KAIB 3AASA 1GCTC 4WXIA 2O8UA 2FIRH 4CRFA 5FHTA 1QQ4A 1INCA 2QCYA 3RXGA 2Q6DA 2ZU4A 1TMBH 2VIOA 1C5UA 3JZ2B 3RXSA 3PLKA 1CGHA 1VGCC 2A4QA 2F91A 2J34A 1L1GA 3BTEE 4MPVA 2FEQH 1LVYA 2GD4B 5GDSH 3RXJA 4ABIA 1HCGA 5K7RA 1TNKA 3PMAB 2BX4A 1BTWA 1NROH 3LJOA 4XFQA 2GV7A 1T8MA 1C2MA 1M9UA 2ODPA 3T5FH 4KTUA 4AN7A 4IBLH 1TNHA 4LZ1H 1NRPH 5DGJA 4YTAA 2BOKA 3KQEA 1MTUA 3QGNB 4ABBA 1MZAA 1O5EH 2XC0A 1VCQA 2A1DB 4TWWA 4ABJA 4Q7ZA 1C5YB 4ZXYH 1GBMA 1YPMH 3ZZDA 1HJAC 1CSOE 1O3EA 1BRCE 5DP8A 1TX8A 3L3TA 1BMLA 2W5EA 1MD8A 1EAXA 4J2YB 3HK6B 4AFZA 1WU1A 4UFGH 4MTBA 4THNH 2OC7A 1PQAA 1UMAH 1TA6A 1WSSH 2TGPZ 5K0HA 1S0RA 3KNXA 3SO3A 4FXGH 1N1LA 4NSYA 1GVKB 5FCKA 1BBRE 3PTNA 4AGKA 1V2WT 1GHAG 1P11E 2ZFPH 4X1NU 1DT2A 2A7HA 3PB1E 2NU2E 1O2VA 1TX6A 2Z3DA 4WMFA 1W13U 1EUFA 2YNAA 2R2MB 2XBWA 2BMGB 2OC8A 1XX9A 3A88A 1T8NA 1ZSJA 1LTOA 1WTHD 3BTQE 1AVGH 3EQ0H 3OTJE 3BTHE 1V2KT 1LHEH 5DO4H 3TK6A 1NTPA 1JIRA 1QB6A 2EEKA 3A7ZA 2BVXH 2H9EH 3MTYA 3RMOH 1FDPA 4FUDA 4NCYA 1FAKH 1V2LT 4CRBA 2ZU1A 3UQOA 1BTHH 1P02A 3RC6A 3RDZA 4IMQA 1RXPA 3GCHC 1O38A 1GI9B 4MPUA 1L4DA 4IW4E 2PSXA 4RN6A 2XRCA 1ELCA 4NFEA 1AGJA 1MTVA 2GP9B 4CR9A 2P59A 4PROA 3BF6H 1L2EA 1AKSB 1NS3A 1O3AA 4Y8YA 6GCHF 1F5KU 1TAWA 1KDQA 1C1MA 2RA3A 2P8OB 1Q2WA 1TOCB 2UUFB 5FBEA 3TU7H 1S5SA 1UJ1A 1SL3A 1AUTC 1HPGA 3MNBA 1C1TA 2VIDA 5HGGA 1SGRE 4OS2A 4I8HA 1FY3A 4XDEA 1C1PA 1ZHMA 1FNIA 1HAVB 3LPRA 3SNBA 1BZXE 1OWJA 3SUGA 4F4OC 3LC5A 1FN8A 3QK1A 3PMBB 4R0IA 3D62A 2BZ6H 1AD8H 3A81A 3QZQA 1NFYA 2O9QA 1YPGH 1B7XB 4BAMB 4FUBA 9ESTA 2BD8A 2ZHWH 4JZ1A 2O8WA 3UFAA 2GDEH 2WPHS 2ZWLH 3U98H 1O2JA 2JH5D 1RTLA 1W3CA 3UREA 3ZZ6A 2ZU5A 3ZVAA 4BXSA 3A8CA 3ATLA 4NFFA 1H8DH 3A8DA 2PUXB 1HAZB 2R0LA 3RXHA 5DKMA 4GHQA 1ARBA 2G00A 3BG8A 1S6HA 1PPCE 1Z1IA 2ZPRA 3GISB 2EI7A 3HGNA 1CT2E 1LKBA 3VB3A 4ZKOU 3KHVA 1UHBB 1D3TB 4D9RA 1QL9A 1XUHA 3P8GA 2O8LA 1E37B 1HXEH 2GZ8A 2QN5T 1LKAA 4A6LA 3F68H 3M3VA 3NXPA 1ZOMA 3VGCB 3OU0A 2NWNA 1VITG 3F6UH 1QIXB 5C2ZA 3ZZ5A 2P3TB 1CT0E 1MKWK 2NU4E 4ZMAH 3D65E 4WH8A 4NIYA 3ZZ7A 5A0CA 1ZR0A 3FANA 2VIWA 1GI3A 2FZZA 4FUFA 4TY7A 1MCTA 1GDQA 1ZHPA 1ETSH 3KF2A 1PPBH 1DITH 3SI3H 2A2XH 4YLQH 5EW1H 4ABFA 1BB0B 5DG6A 1TGNA 2ESTE 4A1VA 1C5WB 1VCWA 3ATIA 4ZXXH 5FX5A 2BM2A 4H42U 2H6MA 4AGJA 2D8WA 3RXTA 1DVAH 2GGVB 4E06H 1WAYB 4Y6DA 1NRQH 2A4GA 1T8LA 3ZVEA 1QB9A 1YCPH 4DVAU 4X6MA 4I33A 5EPYA 1IQHA 4X2VA 2HLCA 1QBNA 1F0TA 2JETB 1SLXB 1TB6H 2I6SA 3L6PA 4SGBE 4AFSA 1UVOA 2TIOA 2XBVA 1AZZA 2BX3A 5F8XA 2BD7A 2G81E 2WPKS 2HNTF 3L33A 2ANKH 3KQBA 1A2CH 2VVCA 5DP4A 1BTUA 2ZDMA 1K1MA 6ESTA 4U32A 5E0JA 3CS0A 5DP5A 1AFQC 2A5IA 2GVFA 1P0SH 3Q3KA 4JYVH 4AYYB 3U1IB 4ZHLU 1G32B 1O2TA 2DE9A 1ZMLA 4K5ZA 2GV6A 5JBAS 2ZHQH 1HDTH 1QRXA 3RXVA 2PTCE 1F0RA 5EGMA 1HUTH 1T7CA 4R8TB 2G5NA 4HFPB 3ZVBA 1Y5AT 3A82A 1H4WA 3SZNA 4FUEA 3KQDA 3PO1B 1NFWA 3I29A 3MU0A 3T28A 1MTNC 1PPHE 1A3EH 1BBRK 2HVXA 2CN0H 1FZZA 3MO3A 4WXVA 1O3GA 8GCHG 4MPXA 1O5AB 2ZDLA 4BTIB 1O2XA 3GY3A 2C3SA 2WUBA 4AORA 2C8YB 4TPYA 3V7TA 1YP9A 2BD2A 2RDLA 1C5XB 2M5TA 3FP8E 2ZA5A 1MU8B 3H7TA 5AFYH 5I46H 4B2AA 2G8TA 2ZECA 2R9PA 1GDNA 1SLWB 1SGYE 1THRH 3FAOA 1NO9H 4B2BA 2OUAA 2WUCA 3E1XB 1ZGIA 3LH3A 3V3MA 4K8YA 1SGPE 1VITH 3LOXA 1Q3XA 3M3TA 2Y5FA 5TJXA 1E38B 1V6DA 1GBJA 4MNVA 1CHOG 1L4ZA 1F2SE 3KCGH 3ZZCA 2SGEE 3OX7U 2GT7A 2ZQ2A 1IHTH 3LGUA 1GBTA 3ESTA 1GJ8B 1EPTA 3SI4H 3T29A
chains in the Genus database with same CATH superfamily
2Y7ZA 3SGAE 1MZDA 3F2HA 3PWCA 1OSSA 3K6YA 3SGBE 4AOQA 3SZEA 1O32A 5C0TA 4A1TA 3E0NB 3GYMA 2OBOA 1V2RT 3ATWA 4YZUA 4Y7BA 5C1UA 4INHA 2A0QB 2ODYB 5I25A 3RXAA 5AHGH 1G30B 2WPJS 5CMXH 2GCTB 1THPB 3T27A 1YPKH 3HKIB 2OXSA 1XXDA 2B5TB 1OWKA 1UTJA 5HM9A 2LPRA 3U9AH 1C2LA 5E0GA 3VB4A 4O9VA 1A5IA 5EQQA 2V3MA 1A5GH 1LO6A 3NRLA 3LH1A 1O36A 1WTGH 4KTSA 1ID5H 2IJOB 1O34A 1YLCA 3MMGA 3TJNA 3GICB 1L1JA 2DUCA 1NRNH 1S6LA 2VGCC 2BY8X 4WWYA 1OKXA 1O3IA 3SJIA 3SJ9A 1C5NH 3PRDA 2PGQB 4K2YA 2FS8A 1GHBG 1AUJA 1KXEA 1Q31A 3IG6B 1V2PT 2V3OH 4JMYA 4OS5A 2ZDNA 2VU8E 1A0LA 2PFEA 3ZZAA 4Q4LA 5DPAA 1SFQB 2D2DA 2GMTB 3GDVA 1TQ7B 2ZDAH 2VWNA 5AVDA 1KYNA 2H9TH 3SV2H 4Y10E 3OY6U 1UTLM 4CREA 7GCHF 2FESH 2Z9GA 1G3BA 1PPZA 1Z6EA 3ENSB 5A09A 4D76A 1A46H 3KN2A 3TJUA 2J98A 4AX9H 1FONA 1FAXA 1O2ZA 1D9IA 2A7CA 2XC5A 1EATA 3PLPA 1ZSLA 3I77A 2BYAX 3P6ZB 4F49A 5HMAA 2JDID 3SV8A 1ZLRA 4RKJB 1ELFA 3UTUH 3M7TA 1UK4A 1LQDB 3FP6E 1T32A 1VITF 2PLXA 1EQ9A 2IPQX 1B0FA 3ZVCA 3UUZA 3O8BA 1XM1A 1CHGA 3E3TA 4NA8A 5E2OA 1BTYA 1O2QA 1MAYA 3S9AA 3M5OA 3P8OA 1J15A 1TNIA 5HM2A 1GG6C 4FVDA 1G36A 1AY6H 3WW7A 4ACBA 3NKKA 2ZO3H 3TNSA 3D23A 1XVMA 1BIOA 3LGWA 2OBQA 1X7AC 1MABB 1O3LA 1MQ6A 4ABEA 2PKAA 1HBTH 3W95A 3QUMP 1GJ4H 1Y59T 3MQKC 4LK4A 1O2KA 1Y3VA 1DY8A 1BJUA 1QFKH 4YOJA 1QY6A 5LH8A 3GDSA 1IHSH 3SYJA 1GPZA 1PQ8A 3DUXH 1ORFA 3SU5A 1O2RA 4CR5A 1P04A 1H9HE 2EA3A 2WV9A 3EA8A 1A0JA 2FOGA 2QF5A 4DT7B 1CO7E 4MDSA 4GLYA 4AFQA 1W0JD 3UIRA 2Z7FE 5CHAC 1GJAB 1H8ED 1KXBA 2ZQ1A 1HXFH 2R3YA 2Z3EA 2HGTH 3VEQB 1C2KA 2K0QA 3M37A 1P2NA 1IQEA 3MYWA 4WMDA 3AAUA 1AWHB 4OS7A 3HKJB 1OXGA 1ETTH 1N6YA 4I32A 2BZAA 3QGJA 1H8HD 5F6MA 1NM6A 1DSTA 2GZ9A 1F0SA 3RXLA 4ZKSU 2FYRA 1FXYA 1O3JA 1A0HB 5J4SA 1EP5A 5SGAE 2O8MA 1K2I1 2Y5HA 3GCTG 3TIUA 5JBCS 3T26A 2BY7X 3ZZ9A 4Y7AA 3RC4A 4WF8A 1D6WA 1OX1A 1SHHB 1XUFA 2Y81A 1LVOA 3QWCH 2FS9A 4WY3A 3RXDA 2J4IA 3SQHE 1AZ8A 1FN6A 4MNYA 3GYLB 1LPZB 2PKSC 2ZFQH 2H9HA 1CGJE 4XOJA 3F9FA 1FLEE 8GCHF 4JZDH 4TSFD 1GBCA 2UWLA 5BPEA 4H6TA 3E16B 2ZCKP 3K65B 1FUJA 4VGCB 1C5MD 4TT3D 3SV6A 1A61H 4KELA 2GT8A 1G3CA 1YGCH 4X2WA 1SR5C 8ESTE 3PLBA 1GBIA 1K0HA 3F2FA 1PPGE 1YC0A 4ZKRU 4ZH8A 1GBDA 5FCRA 2TGAA 5E8EH 3P92A 1P03A 1J9CH 1NU9A 5L2YH 2C8ZB 3TH4H 4B1TA 3DD2H 1O2OA 1TGSZ 4M7GA 3MU5A 4XBDA 5F03A 3T62A 2J5UA 4MVNA 3W1EA 5EXLA 1GBAA 1HYLA 1DSUA 4ISOA 1CHOF 4GPGA 2Z9IA 1T31A 2QYIA 2JJ2D 1QZ8A 2BD3A 1P12E 5C20A 1HLTH 1TNGA 1EAIA 1OWHA 2W26A 1SGQE 3BEUA 4ISNA 3F1SB 1K28D 2A2QH 2ZHFH 2A4OA 5JPMH 2PUQH 3CS7A 1YPJH 2AIPA 5FX6A 1TQ0B 1JRSA 3HPTB 3P8NA 1EPTB 1V2UT 1C5QA 1KIGH 1GI5A 1PFXC 1ABIH 3SJ8A 2ANYA 5E2PA 2SNWA 3U8OH 2PSYA 4FUGA 4X1SU 3K9XB 4BAHB 4YESB 4B74A 5CE1A 1K1OA 2ZP0H 4BTUB 1J17T 1AVXA 1ELGA 4U30A 1EZQA 2P8OC 2KFWA 1GHZA 3E90B 1F5LA 3EA9A 4IC5A 3BTTE 3MHWU 1TPOA 3RU4E 4BANB 1NU7B 1K1PA 4FVBA 5GWZA 2ZHEH 1O5DH 1O2HA 4OS1A 1OP2A 1TMUH 3EAJA 3QZRA 4P02A 2R0KA 5C5NA 2ZG0H 4A7IB 1MU6B 2V0BA 2FOAA 1GGDC 3WWBA 1GHBF 4KTCA 4LZ4B 1DWEH 3HGPA 2OK5A 1FY8E 2ZGXH 3UOUA 1C4U2 1LMWB 3SNDA 3PRBA 3RMLH 1BRAA 1ELDE 1G3DA 5GCHG 3QX5H 2VVUA 3ZZ8A 3Q3XA 1TNLA 3B23B 1T4VH 1Z6JH 3LT3A 2SFAA 1V2NT 2QA9E 3SU2A 1QJ6B 1LHCH 2FDAA 3Q00A 3UR6A 4AC9A 2BDAA 3N7EA 1TLDA 3RXEA 5G4BA 1ABJH 3KL6A 2V35A 3PTBA 4ISHH 4UEHH 1O31A 2FTMA 4FUJA 3ZYDA 1TX7A 5A0BA 3SN8A 2PW8H 3SBKA 2B0FA 3VXFH 1MQ5A 3M61U 1TONA 4KP0A 1C5ZB 1WQSA 1TRMA 2Z9JA 1BMAA 3GY5A 5EW2H 3U69H 3N7DA 1QRWA 1UW7A 1BRUP 2AHME 1O3BA 5EJZA 1DX5M 1PYTC 2J98B 3RU4D 4FU8A 2GCHG 2XWBI 2VINA 2XBYA 2HVYB 1HAYB 1FQ3A 1BMNH 2WYGA 4DOQA 4IC6A 3A89A 3BTGE 5DJ7A 3TJVA 2F9NA 4H4FA 2VJ1A 1HAHH 2FOHA 3LGYA 1PQ7A 1C1RA 2F9UA 1SG8B 1DICA 1DY9A 3FOAA 1WQVH 3GY4A 1LPGB 2CHAB 1C5TA 1W2KH 1HIAA 4XBBA 1C1NA 2PTNA 2G4UA 4NZLA 1L0ZA 1D4PB 4FUHA 1RTFB 1V2VT 3RXPA 3A8BA 2WPLS 2UWOA 5ESTE 2KX4A 5EXNA 1F5RA 3E0PB 1O3MA 2QXGA 1QRZA 1TBQH 3MI4A 2OQUA 2L6OA 1IQLA 2EI8A 4BTTB 4JK6A 2JETC 1OP0A 4Q2KA 2Z9KA 2FWWA 1O3FA 1KY9A 1O2NA 1SSXA 2SGPE 4CH8B 2BY9X 1GI0A 1P05A 1CVWH 4ZCNA 5JBBS 4YOIA 1P2KA 3F0OA 1BTPA 5EG4A 2ZU3A 1OHHD 1DANH 2H5CA 4MQAA 2BQWB 3FZDA 1XVOA 1T8OA 2IPHA 1FY5A 3GY7A 4K1TA 1KXAA 3ZVGA 2Y7XA 1SVPA 1QL7A 4RKOB 1GJ9B 2BTCE 3T2NA 1OP8A 4B76A 2B8OH 1YCPK 3C1KA 2XC4A 3ODFA 1K1JA 3Q76A 1DE7H 3NPSA 3RXCA 1AO5A 4XRNA 3MNXA 3RM0H 1SI5H 5TCAA 1XKBC 3RXQA 1VCPA 1XXFA 2QF0A 2EI6A 4B6FA 1MD7A 8KME2 1FJSA 2RFKC 2F9BH 3GCTF 2TGDA 2K1QA 2BDBA 1Y3YA 1EB2A 3DA9B 3EDXB 3QTVH 4AYVB 1GMHG 1DM4B 5DK1A 2NU0E 3O8CA 3PO1C 2VIPA 1G37A 4X8UH 2XTTB 1G2MA 1FPHH 2AFQB 4AB8A 5C1YA 2ZGCA 3LIWA 1GL1A 4U01A 2ODQA 3SJKA 2P95A 1OWEA 2HOBA 1CQQA 4KGAA 1V3XA 3LGVA 1NY22 3F9EA 4FUCA 1AQ7A 1NRSH 1A4WH 2PV9B 2HNTC 5JB9S 2OCVB 2XNIA 1DWCH 1O3HA 5B6OA 3F0PA 5ESBA 1DLKB 2Z94A 1NFUA 1H9IE 1O5GH 2AGIX 2KAIA 1TGTA 4GCHG 4K1SA 5L2ZH 2FXRA 2FOEA 4X0WU 4A92A 3RXKA 3V12A 2VWMA 4Q80A 3UWJH 2ZI2H 3H5CB 1MTSA 1LVMA 3IITA 3TH2H 2G55A 2BDYA 3CENA 1AFEH 1EOJA 4MNXA 2WPMS 4O03A 2SGDE 3ZZ4A 5HXFA 1UVPA 1GWAA 1SGTA 3M35A 4ESTE 2GX4A 1QB1A 1BUIA 2ZGJA 4Q7YA 3A7TA 4O3TA 4UFFH 3U1JB 2PR3A 3M7QA 1JMOH 3RXOA 5E0HA 2FI4E 1O5CB 2XWAA 1SLVB 1TPSA 3V13A 2ZFSA 3NWUA 3DHKH 5C67A 2XNDD 2PWXA 1ZTLA 1HAPH 1C9TA 1GHAF 4GUXA 4CHAB 1AMHA 1UVTH 2F83A 3BG4B 1KXFA 2CV3A 1D6RA 3UB0A 2GCTC 3RXIA 2ZZUH 2YNBA 5PTPA 1SQAA 1GI2A 1P2IA 2B9LA 5T3HA 3H7OA 5A8YA 4D9QA 3M5NA 2NU1E 2J94A 4OGXA 5A0AE 3PM3A 2BQ6B 1GHVH 1C2EA 3LGTA 3SUEA 4X1PU 3DSGA 2ZEBA 3GCNA 2A4RA 4K8BA 4JK5A 3QDZB 2UUYA 1MTNB 2GZ7A 4AB9A 2ANWA 1O3DA 4ZUHA 1AB9C 2GKVE 4O3UA 5EQSA 1YM0A 1YPHE 3STIA 1QJ1B 1UO6A 1LCYA 1LDTT 3MH4A 4Y71A 5GNDA 5TCCA 4YT6H 5T1VA 6LPRA 4XBCA 1HB0B 2FX4A 1FX0B 1WV7H 3LU9B 5DN6D 1VKYA 3GY6A 3BIUH 2BB4A 1P2QA 1SQTA 3OYPA 1TYNA 1GJ6A 3PMJA 3VFEA 1Y3UA 4IS5A 2QIQA 3RUOA 3SNAA 3TGIE 2OC0A 3ELAH 1Z7KA 2GMTC 3SU1A 3FP7E 3KIDU 4A1XA 1DUEA 5GCHF 2A32A 2AERH 2XYAA 1QQUA 1OWIA 1O2MA 1CBWC 4CRDA 3QN7A 3RXFA 4UD9H 1F7ZA 4HGCA 4ACAA 1KDQB 1SFIA 1IQJA 1C5VA 4HG6A 1Z8JB 3ODDA 1YY3A 1S6FA 1U6QA 2D26C 1BHXF 2W3KA 1C1VH 1ELVA 1Y5UT 1YCPM 3SORA 3RXMA 4WJG2 1NN6A 2J95A 2FOFA 3N7OA 1IOEA 2GJGA 1GI7B 2VIQA 3F9GA 2TBSA 5AFZH 1DLEA 4Y76A 1CA0B 3TJOA 1GBEA 2BDIA 1Y3XA 2BOHB 4JYTA 4IMZA 2J9NA 1CT4E 3HATH 4UFDH 1Z71A 4K3JA 3DCLA 3KYGA 1ACBE 5GXPA 1C1QA 1YLDA 2BXTH 5HYOA 5FL7D 1C5SA 1BOQA 1HAVA 4FETA 3UNSA 3BTDE 1GMCG 1Z8GA 2Q6GA 1OWDA 1V2OT 4QT8C 1EAWA 1MAXA 1C1UH 1KXDA 1TALA 2FMJA 4X2XA 3S9CA 1YYY1 3FZZA 2FM2A 1P9SA 1RIWB 2VGCB 2P16A 1V2JT 4Y79A 1TPPA 1XUJA 5EJLA 1C5RA 2K8IA 1N8OB 2QAAA 1XUIA 1MTWA 2W3IA 3A83A 1O0DH 2QXJA 2HALA 2BDCA 1FV9A 1O2YA 1W7GH 2VBCA 1TABE 2SGAA 4K69A 1P8VC 1ZPBA 4D7GA 3QO6A 1HIAB 1BHXB 2AIQA 2I6QA 2P3FH 3P8FA 4YXWD 4Z0KA 3K6ZA 1HAIH 1SGFG 3LGIA 1BRBE 1DDJA 4XE4A 1BTZA 5FAHA 2ALPA 2ZFTA 3MO6A 2F9PA 3PV4A 1SQOA 1EJNA 3CNRA 4Q63A 1J8AA 1EZUC 2XOKD 3FVFB 2R2WU 1E1QD 1QTFA 2GDDA 2A45B 1O2GH 1AIXH 1W8BH 4JZEH 1JIMA 1ANEA 1WBGB 4BAKB 4UDWH 3TVJB 3P70B 1KSNA 2VH6A 2WPIS 4ISIH 2W7UA 2ZTYA 1GMDG 3G01A 1GI6A 2P93A 2NU3E 3KQCA 1UCYE 4Z1MD 1GHWH 1NPMA 3RU4T 3T25A 1EOLA 2Q6FA 2QXHA 4CRGA 2FX6A 3PWBA 4NWKA 1HFDA 1QGFA 2Z9LA 5AF9H 2HWLB 3M7UA 5KGOA 2XCFA 3RM2H 1YLNA 1SGFA 2C8XB 3UAIC 2ZFFH 1GMHF 2OP9A 1ZJDA 1FIWA 1GBHA 2AS9A 5LGOA 1RGQA 4YOGA 1ELEE 2ZDKA 4K1EA 1RTKA 1ANCA 1TRYA 1O3NA 2YMSC 3RXRA 1BITA 3DT0H 2V3HH 2XW9A 1C2JA 4NWLA 2ZPQA 1LPKB 2LP6A 1ESAA 5B6LA 1AE5A 2G5VA 3A80A 2FODA 2O8TA 1QL8A 3AW0A 3SNEA 1ARCA 3ZVFA 4BAQB 3OFND 4HTCH 1O2UA 1V2ST 2QC2A 4IN2A 2VH0A 4GCHF 3SHAH 2QY0B 3VPKA 8LPRA 5DSFA 1B0EA 3GOVB 3S9BA 1W10U 4TY6A 4AG1A 4TPIZ 1TBRH 2PHBA 1EKBB 4H6SB 4CRAA 1K1IA 4BOHA 4DGJA 3ZV8A 6CHAB 1UVUH 4K60A 1N6XA 1P3CA 1ETRH 2YOLA 1TFXA 4FUIA 2KM0A 3KYFA 1UTKA 1Z8RA 1QBOA 1BJVA 1ESTA 4NIXA 3RXUA 2TRMA 2WYJA 3EGKH 4SGAE 1P01A 1RJXB 2TPIZ 1RRKA 1KLJH 2QV1A 3QLPH 1QJ7B 3S0NA 1YPEH 4TYDA 1KLIH 1EPTC 3DSPA 4RSPA 2AMDA 1W12U 2Y80A 1LHGH 2J97A 1UTNA 3R3GB 1S82A 1TMTH 1EZXC 2STBE 1HNEE 3A7YA 1O3PB 2ZTXA 3MH5A 5IDKA 1OYTH 2WPDD 1A1RA 4WVPE 1GCTB 3M36A 1ANDA 3BV9B 3ZVDA 1P9UA 3O8DA 1Z1JA 4B71A 1W0KD 1MH0A 3U28C 1YPLH 1VJAU 4INKA 3SOSA 1C5LH 1DUAA 3TPIZ 2PKSB 1THSH 4ASUD 1W14U 3ZZ3A 1Y3WA 3Q77A 1VGCB 2Y82A 4GVUA 3GDUA 1Z8IB 2WHXA 1YWUA 2ZU2A 1PJPA 1QR3E 4Y0YE 4X1RU 1C4V2 2STAE 1SOTA 2J2UA 1QHRB 1GHYH 1P57B 4X8VH 5EJ1A 1G3EA 2AYWA 1SOZA 1SMFE 2H2ZA 2UWPA 5IK2D 2M2AA 1YF4A 1DXPA 3MWIU 2P94A 1SGCA 2Z3CA 3H09A 2BDGA 4Y11E 3AVZA 3UNQA 1HJAB 1V2MT 4IGDA 4MG3A 1ZJKA 3UNRA 1AE8H 4RT1A 2PGBB 4UONA 1O37A 2IOTA 3I78A 5GIBA 3SUFA 1P06A 2CMYA 3SV9A 1HAGE 2WV5A 3BEIB 1ZPZA 5DP6A 7ESTE 1OYQA 1P10A 1HJ9A 1TNJA 3C27B 1C4Y2 4Y0ZE 2EY4C 1LHFH 2KCOA 1KTSB 2FOMB 2XCNA 1GJ5H 1MUEB 1EB1H 3OY5U 3A85A 3P17H 5ETXA 1CA8B 3BN9A 1VJ9U 2OLGA 1SGNE 5J4QA 1S84A 2D1JA 2VWOA 5C1XA 1SPJA 2BLVA 2CF8H 3RXBA 1IQKA 4JYUH 4LXBH 3MNCA 4NG9H 4ZROA 1DPOA 1C1WH 1CU1A 4NIWA 5JDUB 1GMCF 2EC9H 1TWXB 2WV4A 1IQFA 3SU3A 5C0UA 1EZSC 2R3UA 3F9HA 4NGAH 4I7YH 2F4LA 3WY8A 3MNSA 4ZKNU 7KMEH 2CHAC 2LNCA 3GCHB 4X6PA 1C2DA 1EP6A 3HK3B 4I8GA 4NA7A 4E05H 5A8ZA 1KXCA 5L30H 3F3BA 1JOUB 2JH0D 3VGCC 2VB0A 5FXLA 1GGDB 1O39A 4X1QU 2AH4X 3VG8A 1C1OA 5JB8S 4Z6AH 1H1BA 4IN1A 2F43B 3STJA 2BXUH 4JZFH 1MBMA 2QGRA 3ZV9A 1PQ5A 1IAUA 3A7WA 2ZNKH 2ZPSA 1HRTH 2BLQA 1GJBB 1TIOA 3E6PH 1GI4A 1NRRH 2J92A 1E35B 1LHDH 1LVBA 7GCHG 2BD9A 2F9VA 1ZRBA 4ABHA 1AU8A 5LPEA 2L74A 1TGCA 1UCYH 1UCYK 3BEFB 2OINA 3RP2A 1NC6A 2JH6D 2QF3A 4ABAA 1MBQA 1H9LB 2BY5X 1HV7A 4WMEA 1TGBA 3UWIA 1BCUH 1C5OH 2VIVA 1ZSKA 1BTXA 3LKWA 3TITA 4UE7H 3E91A 3A86A 3NK8A 4INLA 3TK9A 2HPPH 1YPHC 1SGDE 2EQNA 1T4UH 2PKAB 3MOCA 1GMDF 1ZGVA 4I8JA 4HZHA 5FPSA 1G2LA 3N99A 1O2IA 1DFPA 1P3EA 3O8RA 1RFNA 1GHXH 2AMQA 1AN1E 5F8ZA 2G52A 1MKWH 1ZYOA 1MKXH 4LOYH 1MKXK 3VB5A 2A5AA 1DS2E 2JIZD 1GVLA 3A84A 2BD4A 4DY7B 1C9PA 1P2OA 1DWDH 1TRNA 2ZF0H 4AFUA 5C3NA 1E0FD 2KR7A 1O2LA 1AI8H 4DIHH 4NSVA 5GJ4B 3GCOA 3AAVA 3BTWE 4YLUA 2H1UA 1K1NA 1GDUA 1QURH 1GI8B 1BMFD 1MCVA 1BDAA 4OGYA 4D7FA 3P95A 1SHYA 1FY1A 2BLOA 2FLRH 1ANBA 3TGJE 3B8JA 2W7SA 4TWYA 1SLUB 4RT0A 3KGPA 3K2UA 2FO9A 3PYHA 7LPRA 1G9IE 2HPQH 1UK2A 4I86A 1GJDB 1V2TT 2ZGBH 4OM9A 3SJOA 3VB6A 2ZGHA 1ZTKA 3OE7D 4NA9H 3FFGA 1AWFH 1V2QT 1GBLA 3WWFA 4BAOB 3U8RH 1TE0A 2V7QD 2BD5A 2F9OA 2WSSD 1A7SA 3A7VA 2B7DH 1W0YH 3SV7A 1A5HA 4ABDA 2KCPA 2RA0A 1UTQA 4DG4A 3RLYH 1AVWA 1UTMA 3TK5A 2UUJB 4UFEH 3ITIA 2DE8A 2KCAA 2ULLA 1O5BB 3MO9A 2ZKSA 4CHAC 1O30A 3EE7A 4FU9A 5C5OA 3MU8A 1C5PA 3BG4C 3AW1A 2ILNA 3CP7A 3A87A 1C2GA 1ELBA 2ZIQH 3M5MA 2BLWA 2W6JD 1RD3B 5C94A 2AGGX 1W7XH 5F53A 3SU6A 5FBIA 3AK5A 4CBNA 2OC1A 1DOJA 3SHCH 5C17A 1TPAE 1AFQB 2Z6BD 4ZHAA 4DIIH 5LPRA 1JWTA 1BBRH 4ZHMU 2XXLA 3MH7A 4GHTA 2W6ID 5EODA 3SQEE 1HGTH 3Q3YA 2FPZA 1D3DB 4Y8ZA 3RMNH 5BRRE 2C93B 3FKSD 2AGEX 2Y6TA 4MPWA 1XUGA 1O5FH 1S0QA 1O2WA 4X8TH 2Y5GA 4OS4A 3OSYA 1SC8U 1BT7A 4NIVA 2PP6A 1Y5BT 1NZQH 1K9OE 4CH2B 4DJZB 1AHTH 2A31A 1VZQH 1ELAA 1NESE 2CK3D 1CGIE 1K21H 5LPFA 1O3OA 2C8WB 1FMGA 1IQIA 1GI1A 1C2IA 2SGQE 1TOMH 4OS6A 1GL0E 1UTOA 4MLFB 2JKHA 2FYQA 3URDA 4B75A 3LONA 1WCZA 1LQEA 9LPRA 1CE5A 2FP7B 1EXFA 1YBWA 3JZ1B 2FOBA 3QTOH 1ZHRA 2IN2A 4AZ2B 4U2WA 1J16A 1C2HA 3R0FA 4B73A 3ZYEA 2BQ7B 3UOPA 3EE0B 3M3SA 5GPIB 4ISLA 1B5GH 4D8NA 1ZMNA 1L1NA 1BQYA 1F0UA 4X6NA 5JBTA 1CA0C 2FLBH 3NZIA 1BA8B 1J14A 2V6NA 2ZCHP 2OQ5A 3KEEA 1O2PA 2XBXA 4B2CA 1BMMH 1GBKA 1OOKB 1WUNH 5EOKA 5H4IB 4DURA 2OD3B 3NCLA 1EASA 5T6FA 1YKTA 2Q1JA 5EU8A 3TNTA 3W94A 1QNJA 3DFJA 3E8LA 1O3KA 3LJJA 4HI3A 3ZZBA 4FU7A 1QCPA 4ABGA 5ABWA 1XMNB 3UPEA 3MH6A 4X2YA 2BHGA 1E36B 1JXPA 3UR9A 3V0XA 4YO9A 2J38A 1NFXA 1PYTD 1K22H 1WDIA 1ZZZA 1UK3A 2CGAA 4DT4A 1O3CA 1AB9B 2G51A 5FPTA 2A7JA 2A5KA 3BTKE 1AKSA 3EYDA 1S83A 4NZQA 1RIWC 3M5LA 5L6NH 1IQNA 2HRVA 1ZMJA 1N8OC 4F48B 4MNWA 1P2JA 5EPNA 1WOFA 4E7RG 1UVSH 2GCHF 2BVSH 2SNVA 2IJD1 4YT7H 4YM9A 6GCHG 1GBBA 3UQVA 3U8TH 1TBZH 4Q7XA 2ANMH 1HJ8A 3A8AA 2ZTZA 1QA0A 4X6OA 2UUKB 2THFB 4I8KA 4AG2A 2CF9H 4A5TS 1H8IH 1O35A 3NUMA 1SGEE 1CBWB 5IYTA 3UY9A 5F8TA 5A2MH 2BY6X 3RMMH 1WYKA 3A7XA 4BNRA 2TGTA 1ZRKA 1ZPCA 4JCNA 2QXIA 3LDXH 2ZHDA 2FI3E 2HNTE 4XSKU 2GTBA 3SU0A 1A3BH 4P00A 1PPFE 2BVRH 3FO8D 4DCDA 1E34B 3ZIAD 3ATMA 1C2FA 1W11U 2FI5E 3MU1A 3BTFE 5T6DA 2VNTA 4J1YA 5JYIA 3BIVH 1DXWA 2ZC9H 2RG3A 4Y8XA 4BXWA 1NT1A 1O2SA 4CRCA 3S69A 3MU4A 4KKDA 4GSOA 2WINI 1GCDA 1QBVH 3TGKE 1UHBA 3PROA 5A8XA 3LC3A 1GJCB 2WZQA 3EA7A 1ZTJA 2OTVA 1W0ZU 3GY8A 5DP3A 2KZ4A 1FI8A 1SKYE 3BTME 1OPHB 1O33A 2ZCLP 1EAUA 1GJ7B 4ZAEA 1QA7A 4CBOA 5T6GA 1IQMA 2FOCA 3IWMA 3SW2B 5EXMA 2ZFRH 1XKAC 2BDHA 1JBUH 1FPCH 1SBWA 1S81A 3PV2A 3DFLA 1S85A 5DP9A 1P09A 1C1SA 1UTPA 1OS8A 5DP7A 4ASHA 3SUDA 3D49H 1EJMA 5EQRA 1RS0A 2C90B 1FIZA 4GAWA 3GS9A 1ESBA 1P2MA 1SGIB 3VB7A 3PMHB 1XUKA 1MMJN 1HAOH 1SB1H 1IQGA 1KLTA 5FPYA 4E7NA 1GG6B 1ELTA 1TA2A 1Y8TA 2QF4A 2ZDVH 3RC5A 2ASUB 1FY4A 2RCEA 1D3PB 6CHAC 1F92A 3TH3H 1PPEE 2SGFE 1JRTA 1HAXB 4I8LA 2H5DA 3TLOA 4I31A 3VXEH 1K1LA 2C4FH 3SNCA 3ATKA 4VGCC 4JZIA 2P3UB 3SGQE 3GY2A 3B9FH 2G4TA 1KTTB 1GBFA 3S7HB 1VR1H 4O97A 3URCA 2FTLE 1D3QB 2CXVA 4DW2U 2AMPA 3BSQA 2F3CE 4WH6A 3S7KB 2CJIA 3SU4A 2AEIH 2VWLA 3RLWH 1EJAA 3F2GA 4M9FA 1EX3A 2VVVA 1DWBH 4X8SH 1NBME 2ALVA 3MFJA 1GVZA 5CHAB 2KAIB 3AASA 1GCTC 4WXIA 2O8UA 3OAAD 2FIRH 4CRFA 5FHTA 1QQ4A 1INCA 2QCYA 3RXGA 2Q6DA 2ZU4A 2YMSB 4RI0A 1TMBH 2VIOA 1C5UA 3JZ2B 3RXSA 3PLKA 1CGHA 1VGCC 2A4QA 2F91A 2J34A 1L1GA 3BTEE 4MPVA 2FEQH 1LVYA 2GD4B 5GDSH 3RXJA 4ABIA 1HCGA 5K7RA 1TNKA 1WXRA 3PMAB 2BX4A 1BTWA 1NROH 3LJOA 4XFQA 2GV7A 1T8MA 1C2MA 1M9UA 2ODPA 3T5FH 4KTUA 4AN7A 4IBLH 1TNHA 4LZ1H 1NRPH 5DGJA 4YTAA 2BOKA 3KQEA 1MTUA 3QGNB 4ABBA 1MZAA 1O5EH 2XC0A 1VCQA 2A1DB 4TWWA 4ABJA 4Q7ZA 1C5YB 4ZXYH 1GBMA 1YPMH 3ZZDA 1HJAC 1CSOE 1O3EA 1BRCE 5DP8A 1TX8A 3L3TA 1BMLA 2W5EA 1MD8A 1EAXA 4J2YB 3HK6B 4AFZA 1WU1A 4UFGH 4MTBA 4THNH 2OC7A 1PQAA 1UMAH 1TA6A 1WSSH 2TGPZ 5K0HA 1S0RA 3KNXA 1NBMD 3SO3A 4FXGH 1N1LA 4NSYA 1GVKB 5FCKA 1BBRE 3PTNA 4AGKA 1V2WT 1GHAG 1P11E 2ZFPH 4X1NU 1DT2A 2A7HA 3PB1E 2NU2E 1O2VA 1TX6A 1E79D 2Z3DA 4WMFA 4XD7D 1W13U 1EUFA 2YNAA 1SQRA 2R2MB 2XBWA 2BMGB 2OC8A 1XX9A 3A88A 1T8NA 1ZSJA 1LTOA 1WTHD 3BTQE 1AVGH 3EQ0H 3OTJE 3BTHE 1V2KT 1LHEH 5DO4H 3TK6A 1NTPA 1JIRA 1QB6A 5KECA 2EEKA 3A7ZA 2BVXH 2H9EH 3MTYA 3RMOH 1FDPA 4FUDA 4NCYA 1FAKH 1V2LT 4CRBA 2ZU1A 3UQOA 1BTHH 1P02A 3RC6A 3OEHD 4IMQA 3RDZA 1RXPA 3GCHC 1O38A 1GI9B 3DSOA 4MPUA 1L4DA 4IW4E 2PSXA 4RN6A 2XRCA 1ELCA 4NFEA 1AGJA 1MTVA 2GP9B 4CR9A 2P59A 4PROA 3BF6H 1L2EA 1AKSB 1NS3A 1O3AA 2LELA 4Y8YA 1F5KU 6GCHF 1TAWA 1KDQA 1C1MA 2RA3A 2P8OB 1Q2WA 1KMHB 1TOCB 2UUFB 5FBEA 3TU7H 1S5SA 1UJ1A 1SL3A 1AUTC 1HPGA 3MNBA 1C1TA 2VIDA 5HGGA 1SGRE 4OS2A 4I8HA 1FY3A 2HLDD 4XDEA 1C1PA 1ZHMA 1FNIA 1HAVB 2RDEA 3LPRA 3SNBA 1BZXE 1OWJA 5CHBA 3SUGA 4F4OC 3LC5A 1FN8A 3QK1A 3PMBB 4R0IA 3D62A 2BZ6H 1AD8H 3A81A 3QZQA 1NFYA 2O9QA 1YPGH 1B7XB 4BAMB 4FUBA 9ESTA 2BD8A 2ZHWH 4JZ1A 2O8WA 3UFAA 2GDEH 2WPHS 2ZWLH 3U98H 1O2JA 2JH5D 1RTLA 1W3CA 3UREA 3ZZ6A 2ZU5A 3ZVAA 4BXSA 3A8CA 3ATLA 4NFFA 1H8DH 3A8DA 1EFRD 2PUXB 1HAZB 2R0LA 3RXHA 5DKMA 4B6EA 2KCYA 4GHQA 1ARBA 2G00A 3BG8A 1S6HA 1PPCE 1Z1IA 3OEED 2ZPRA 3GISB 2EI7A 3HGNA 1CT2E 1LKBA 3VB3A 4ZKOU 3KHVA 1UHBB 5HKKD 1D3TB 4D9RA 1QL9A 1XUHA 3P8GA 2O8LA 1E37B 1HXEH 2GZ8A 2QN5T 3FN8A 1LKAA 4A6LA 3F68H 3M3VA 3NXPA 3PV5A 1ZOMA 3VGCB 3OU0A 2NWNA 1VITG 3F6UH 1QIXB 5C2ZA 3ZZ5A 2P3TB 2YMSD 1CT0E 1MKWK 2NU4E 4ZMAH 3D65E 4WH8A 4NIYA 3ZZ7A 5A0CA 1ZR0A 3FANA 2VIWA 1GI3A 2FZZA 3KQ5A 3OTPA 4FUFA 1MCTA 4TY7A 1GDQA 1ZHPA 1ETSH 3KF2A 1PPBH 1DITH 3SI3H 2A2XH 4YLQH 5EW1H 4ABFA 1BB0B 5DG6A 1TGNA 2ESTE 4A1VA 1C5WB 1VCWA 3ATIA 4ZXXH 5FX5A 2BM2A 4H42U 2H6MA 4AGJA 2D8WA 3RXTA 1DVAH 2GGVB 4E06H 1WAYB 4Y6DA 1NRQH 2A4GA 1T8LA 3ZVEA 1QB9A 1YCPH 4DVAU 4X6MA 4I33A 5EPYA 1IQHA 4X2VA 2HLCA 1QBNA 1F0TA 2JETB 1SLXB 1TB6H 2I6SA 3L6PA 4SGBE 4AFSA 1UVOA 2TIOA 2XBVA 1AZZA 5KEDA 2BX3A 2QE7D 2BD7A 5F8XA 2G81E 2WPKS 2HNTF 3L33A 2ANKH 3KQBA 1A2CH 2VVCA 1COWD 4F55A 5DP4A 1BTUA 2ZDMA 1K1MA 6ESTA 4U32A 5E0JA 3CS0A 5DP5A 1AFQC 2A5IA 2GVFA 1P0SH 3Q3KA 4JYVH 4AYYB 3U1IB 4ZHLU 1G32B 1O2TA 2DE9A 1ZMLA 4K5ZA 2GV6A 5JBAS 2ZHQH 1HDTH 1QRXA 3RXVA 2PTCE 1F0RA 5EGMA 1HUTH 1T7CA 4R8TB 2G5NA 4HFPB 3ZVBA 1Y5AT 3A82A 1H4WA 3SZNA 5HIZA 4FUEA 3KQDA 3PO1B 1NFWA 3I29A 3MU0A 3T28A 1MTNC 1PPHE 5HIYA 1A3EH 1BBRK 2HVXA 2CN0H 1FZZA 3MO3A 4WXVA 1O3GA 8GCHG 4MPXA 1O5AB 2ZDLA 4BTIB 1O2XA 3GY3A 2C3SA 2WUBA 4AORA 2C8YB 4TPYA 3V7TA 1YP9A 2BD2A 2RDLA 1C5XB 2M5TA 3FP8E 2ZA5A 1MU8B 3H7TA 5AFYH 5I46H 4B2AA 2G8TA 2ZECA 2R9PA 1GDNA 1SLWB 1SGYE 1THRH 3FAOA 1NO9H 4B2BA 2OUAA 2WUCA 3E1XB 1ZGIA 3LH3A 3V3MA 4K8YA 1SGPE 1VITH 2JJ1D 3LOXA 5CDFE 1Q3XA 1E1RD 3M3TA 2Y5FA 5TJXA 1E38B 1V6DA 1GBJA 4MNVA 5EIYA 1CHOG 1L4ZA 1F2SE 3KCGH 3ZZCA 2SGEE 3OX7U 2GT7A 2ZQ2A 1IHTH 3LGUA 1GBTA 3ESTA 1GJ8B 1EPTA 3SI4H 4FOUC 3T29A
chains in the Genus database with same CATH topology
2Y7ZA 3SGAE 1MZDA 3PWCA 1OSSA 3K6YA 3SGBE 4AOQA 1O32A 4A1TA 3E0NB 3GYMA 2OBOA 1V2RT 3ATWA 4YZUA 4Y7BA 5C1UA 4INHA 2A0QB 2ODYB 5I25A 3RXAA 5AHGH 1G30B 2WPJS 5CMXH 2GCTB 1THPB 3T27A 1YPKH 3HKIB 2OXSA 1XXDA 2B5TB 1OWKA 1UTJA 5HM9A 2LPRA 3U9AH 1C2LA 5E0GA 3VB4A 4O9VA 1A5IA 5EQQA 1A5GH 1LO6A 3LH1A 1O36A 1WTGH 4KTSA 1ID5H 2IJOB 1O34A 1YLCA 3MMGA 3TJNA 3GICB 1L1JA 2DUCA 1NRNH 2VGCC 2BY8X 4WWYA 1OKXA 1O3IA 3SJIA 3SJ9A 1C5NH 2PGQB 4K2YA 2FS8A 1GHBG 1AUJA 1KXEA 1Q31A 3IG6B 1V2PT 2V3OH 4JMYA 4OS5A 2ZDNA 2VU8E 1A0LA 2PFEA 3ZZAA 5DPAA 1SFQB 2D2DA 2GMTB 3GDVA 1TQ7B 2ZDAH 2VWNA 5AVDA 1KYNA 2H9TH 3SV2H 4Y10E 3OY6U 1UTLM 4CREA 7GCHF 2FESH 2Z9GA 1G3BA 1PPZA 1Z6EA 3ENSB 5A09A 4D76A 1A46H 3KN2A 3TJUA 4AX9H 1FONA 1FAXA 1O2ZA 1D9IA 2A7CA 2XC5A 1EATA 3PLPA 1ZSLA 3I77A 2BYAX 3P6ZB 4F49A 5HMAA 3SV8A 1ZLRA 4RKJB 1ELFA 3UTUH 3M7TA 1UK4A 1LQDB 3FP6E 1T32A 1VITF 2PLXA 1EQ9A 1B0FA 3ZVCA 3UUZA 3O8BA 1XM1A 1CHGA 3E3TA 4NA8A 5E2OA 1BTYA 1O2QA 1MAYA 3S9AA 3M5OA 3P8OA 1J15A 1TNIA 5HM2A 1GG6C 4FVDA 1G36A 1AY6H 3NKKA 2ZO3H 3TNSA 3D23A 1XVMA 1BIOA 3LGWA 2OBQA 1X7AC 1O3LA 4ABEA 1MQ6A 2PKAA 1HBTH 3W95A 3QUMP 1GJ4H 1Y59T 4LK4A 1O2KA 1Y3VA 1DY8A 1BJUA 1QFKH 4YOJA 1QY6A 5LH8A 3GDSA 1IHSH 1GPZA 1PQ8A 3DUXH 1ORFA 3SU5A 1O2RA 4CR5A 1P04A 1H9HE 2EA3A 3EA8A 1A0JA 2FOGA 4DT7B 1CO7E 4MDSA 4GLYA 4AFQA 3UIRA 2Z7FE 5CHAC 1GJAB 2ZQ1A 1KXBA 1HXFH 2R3YA 2Z3EA 2HGTH 3VEQB 1C2KA 3M37A 1P2NA 1IQEA 3MYWA 4WMDA 3AAUA 1AWHB 4OS7A 3HKJB 1OXGA 1ETTH 1N6YA 4I32A 2BZAA 3QGJA 5F6MA 1NM6A 1DSTA 2GZ9A 1F0SA 3RXLA 4ZKSU 2FYRA 1FXYA 1O3JA 1A0HB 5J4SA 1EP5A 5SGAE 2O8MA 1K2I1 2Y5HA 3GCTG 3TIUA 5JBCS 3T26A 2BY7X 3ZZ9A 4Y7AA 3RC4A 4WF8A 1D6WA 1OX1A 1SHHB 1XUFA 2Y81A 1LVOA 3QWCH 2FS9A 4WY3A 3RXDA 2J4IA 3SQHE 1AZ8A 1FN6A 4MNYA 3GYLB 1LPZB 2PKSC 2ZFQH 2H9HA 1CGJE 4XOJA 3F9FA 1FLEE 8GCHF 4JZDH 1GBCA 2UWLA 5BPEA 4H6TA 3E16B 2ZCKP 3K65B 1FUJA 4VGCB 1C5MD 3SV6A 1A61H 4KELA 2GT8A 1G3CA 1YGCH 4X2WA 1SR5C 8ESTE 3PLBA 1GBIA 1PPGE 1YC0A 4ZKRU 4ZH8A 1GBDA 5FCRA 2TGAA 5E8EH 3P92A 1P03A 1J9CH 1NU9A 5L2YH 2C8ZB 3TH4H 4B1TA 3DD2H 1O2OA 1TGSZ 4M7GA 3MU5A 4XBDA 5F03A 3T62A 4MVNA 5EXLA 1GBAA 1HYLA 1DSUA 4ISOA 1CHOF 4GPGA 2Z9IA 1T31A 2QYIA 2BD3A 1P12E 5C20A 1HLTH 1TNGA 1EAIA 1OWHA 2W26A 1SGQE 3BEUA 4ISNA 3F1SB 1K28D 2A2QH 2ZHFH 2A4OA 5JPMH 2PUQH 3CS7A 1YPJH 2AIPA 5FX6A 1TQ0B 1JRSA 3HPTB 3P8NA 1EPTB 1V2UT 1C5QA 1KIGH 1GI5A 1PFXC 1ABIH 3SJ8A 2ANYA 5E2PA 2SNWA 3U8OH 2PSYA 4FUGA 4X1SU 3K9XB 4BAHB 4YESB 4B74A 5CE1A 1K1OA 2ZP0H 4BTUB 1J17T 1AVXA 1ELGA 4U30A 1EZQA 2P8OC 1GHZA 3E90B 1F5LA 3EA9A 4IC5A 3BTTE 3MHWU 1TPOA 3RU4E 4BANB 1NU7B 1K1PA 4FVBA 5GWZA 2ZHEH 1O5DH 1O2HA 4OS1A 1OP2A 1TMUH 3EAJA 3QZRA 2R0KA 5C5NA 2ZG0H 4A7IB 1MU6B 2V0BA 2FOAA 1GGDC 1GHBF 4KTCA 4LZ4B 1DWEH 3HGPA 1FY8E 2ZGXH 3UOUA 1C4U2 1LMWB 3SNDA 3RMLH 1BRAA 1ELDE 1G3DA 5GCHG 3QX5H 2VVUA 3ZZ8A 3Q3XA 1TNLA 3B23B 1T4VH 1Z6JH 3LT3A 2SFAA 1V2NT 2QA9E 3SU2A 1QJ6B 1LHCH 2FDAA 3Q00A 3UR6A 2BDAA 1TLDA 3RXEA 5G4BA 1ABJH 3KL6A 2V35A 3PTBA 4ISHH 4UEHH 1O31A 2FTMA 4FUJA 3ZYDA 1TX7A 5A0BA 3SN8A 2PW8H 3SBKA 2B0FA 3VXFH 1MQ5A 3M61U 1TONA 4KP0A 1C5ZB 1WQSA 1TRMA 2Z9JA 1BMAA 3GY5A 5EW2H 3U69H 1QRWA 1BRUP 1O3BA 1DX5M 1PYTC 3RU4D 4FU8A 2GCHG 2XWBI 2VINA 2XBYA 1HAYB 1FQ3A 1BMNH 2WYGA 4DOQA 4IC6A 3A89A 3BTGE 5DJ7A 3TJVA 2F9NA 4H4FA 2VJ1A 1HAHH 2FOHA 3LGYA 1PQ7A 1C1RA 2F9UA 1SG8B 1DICA 1DY9A 1WQVH 3GY4A 1LPGB 2CHAB 1C5TA 1W2KH 1HIAA 4XBBA 1C1NA 2PTNA 2G4UA 4NZLA 1L0ZA 1D4PB 4FUHA 1RTFB 1V2VT 3RXPA 3A8BA 2WPLS 2UWOA 5ESTE 5EXNA 1F5RA 3E0PB 1O3MA 2QXGA 1QRZA 1TBQH 3MI4A 2OQUA 1IQLA 2EI8A 4BTTB 4JK6A 2JETC 1OP0A 4Q2KA 2Z9KA 2FWWA 1O3FA 1KY9A 1O2NA 1SSXA 2SGPE 4CH8B 2BY9X 1GI0A 1P05A 1CVWH 5JBBS 4YOIA 1P2KA 1BTPA 5EG4A 2ZU3A 1DANH 2H5CA 4MQAA 2BQWB 3FZDA 1XVOA 1T8OA 2IPHA 1FY5A 3GY7A 4K1TA 1KXAA 3ZVGA 2Y7XA 1SVPA 1QL7A 4RKOB 1GJ9B 2BTCE 3T2NA 1OP8A 4B76A 2B8OH 1YCPK 3C1KA 2XC4A 3ODFA 1K1JA 3Q76A 1DE7H 3NPSA 3RXCA 1AO5A 3MNXA 3RM0H 1SI5H 5TCAA 1XKBC 3RXQA 1VCPA 1XXFA 2QF0A 2EI6A 1MD7A 8KME2 1FJSA 2F9BH 3GCTF 2TGDA 2K1QA 2BDBA 1Y3YA 1EB2A 3DA9B 3EDXB 3QTVH 4AYVB 1GMHG 1DM4B 5DK1A 2NU0E 3O8CA 3PO1C 2VIPA 1G37A 4X8UH 2XTTB 1G2MA 1FPHH 2AFQB 4AB8A 5C1YA 2ZGCA 3LIWA 1GL1A 4U01A 2ODQA 3SJKA 2P95A 1OWEA 2HOBA 1CQQA 4KGAA 1V3XA 3LGVA 1NY22 3F9EA 4FUCA 1AQ7A 1NRSH 1A4WH 2PV9B 2HNTC 5JB9S 2OCVB 2XNIA 1DWCH 1O3HA 5B6OA 5ESBA 1DLKB 2Z94A 1NFUA 1H9IE 1O5GH 2AGIX 2KAIA 1TGTA 4GCHG 4K1SA 5L2ZH 2FXRA 2FOEA 4X0WU 4A92A 3RXKA 3V12A 2VWMA 4Q80A 3UWJH 2ZI2H 3H5CB 1MTSA 1LVMA 3IITA 3TH2H 2G55A 2BDYA 3CENA 1AFEH 1EOJA 4MNXA 2WPMS 4O03A 2SGDE 3ZZ4A 5HXFA 1UVPA 1GWAA 1SGTA 3M35A 4ESTE 2GX4A 1QB1A 1BUIA 2ZGJA 4Q7YA 3A7TA 4O3TA 4UFFH 3U1JB 2PR3A 3M7QA 1JMOH 3RXOA 5E0HA 2FI4E 1O5CB 2XWAA 1SLVB 1TPSA 3V13A 2ZFSA 3NWUA 3DHKH 5C67A 2PWXA 1ZTLA 1HAPH 1C9TA 1GHAF 4GUXA 4CHAB 1AMHA 1UVTH 2F83A 3BG4B 1KXFA 2CV3A 1D6RA 2GCTC 3RXIA 2ZZUH 2YNBA 5PTPA 1SQAA 1GI2A 1P2IA 2B9LA 5T3HA 3H7OA 5A8YA 4D9QA 3M5NA 2NU1E 2J94A 4OGXA 5A0AE 3PM3A 2BQ6B 1GHVH 1C2EA 3LGTA 3SUEA 4X1PU 2ZEBA 3GCNA 2A4RA 4K8BA 4JK5A 3QDZB 2UUYA 1MTNB 2GZ7A 4AB9A 2ANWA 1O3DA 4ZUHA 1AB9C 2GKVE 4O3UA 5EQSA 1YM0A 1YPHE 3STIA 1QJ1B 1UO6A 1LCYA 1LDTT 3MH4A 4Y71A 5TCCA 4YT6H 6LPRA 4XBCA 1HB0B 2FX4A 1WV7H 3LU9B 3GY6A 3BIUH 2BB4A 1P2QA 1SQTA 3OYPA 1TYNA 1GJ6A 3PMJA 3VFEA 1Y3UA 4IS5A 2QIQA 3RUOA 3SNAA 3TGIE 2OC0A 3ELAH 1Z7KA 2GMTC 3SU1A 3FP7E 3KIDU 4A1XA 1DUEA 5GCHF 2A32A 2AERH 2XYAA 1QQUA 1OWIA 1O2MA 1CBWC 4CRDA 3QN7A 3RXFA 4UD9H 1F7ZA 4HGCA 1KDQB 1SFIA 1IQJA 1C5VA 1Z8JB 3ODDA 1S6FA 1U6QA 2D26C 1BHXF 2W3KA 1C1VH 1ELVA 1Y5UT 1YCPM 3SORA 3RXMA 4WJG2 1NN6A 2J95A 2FOFA 3N7OA 1IOEA 1GI7B 2VIQA 3F9GA 2TBSA 5AFZH 1DLEA 4Y76A 1CA0B 3TJOA 1GBEA 2BDIA 1Y3XA 2BOHB 4JYTA 4IMZA 2J9NA 1CT4E 3HATH 4UFDH 1Z71A 4K3JA 1ACBE 5GXPA 1C1QA 1YLDA 2BXTH 5HYOA 1C5SA 1BOQA 1HAVA 3UNSA 3BTDE 1GMCG 1Z8GA 2Q6GA 1OWDA 1V2OT 4QT8C 1EAWA 1MAXA 1C1UH 1KXDA 1TALA 2FMJA 4X2XA 3S9CA 1YYY1 3FZZA 2FM2A 1P9SA 1RIWB 2VGCB 2P16A 1V2JT 4Y79A 1TPPA 1XUJA 1C5RA 1N8OB 2QAAA 1XUIA 1MTWA 2W3IA 3A83A 1O0DH 2QXJA 2HALA 2BDCA 1FV9A 1O2YA 1W7GH 1TABE 2SGAA 4K69A 1P8VC 1ZPBA 4D7GA 3QO6A 2P3FH 1HIAB 1BHXB 2AIQA 2I6QA 3P8FA 4Z0KA 3K6ZA 1HAIH 1SGFG 3LGIA 1BRBE 1DDJA 4XE4A 1BTZA 5FAHA 2ALPA 2ZFTA 3MO6A 2F9PA 3PV4A 1SQOA 1EJNA 1J8AA 1EZUC 3FVFB 2R2WU 1QTFA 2GDDA 2A45B 1O2GH 1AIXH 1W8BH 4JZEH 1JIMA 1ANEA 1WBGB 4BAKB 4UDWH 3TVJB 3P70B 1KSNA 2VH6A 2WPIS 4ISIH 2W7UA 2ZTYA 1GMDG 3G01A 1GI6A 2P93A 2NU3E 3KQCA 1UCYE 1GHWH 1NPMA 3RU4T 3T25A 1EOLA 2Q6FA 2QXHA 4CRGA 2FX6A 3PWBA 4NWKA 1HFDA 1QGFA 2Z9LA 5AF9H 2HWLB 3M7UA 2XCFA 3RM2H 1SGFA 2C8XB 2ZFFH 1GMHF 2OP9A 1ZJDA 1FIWA 1GBHA 2AS9A 5LGOA 1RGQA 4YOGA 1ELEE 2ZDKA 4K1EA 1RTKA 1ANCA 1TRYA 1O3NA 3RXRA 1BITA 3DT0H 2V3HH 2XW9A 1C2JA 4NWLA 2ZPQA 1LPKB 1ESAA 1AE5A 2G5VA 3A80A 2FODA 2O8TA 1QL8A 3AW0A 3SNEA 1ARCA 3ZVFA 4BAQB 4HTCH 1O2UA 1V2ST 2QC2A 4IN2A 2VH0A 4GCHF 3SHAH 2QY0B 3VPKA 8LPRA 1B0EA 3GOVB 3S9BA 1W10U 4TY6A 4AG1A 4TPIZ 1TBRH 2PHBA 1EKBB 4H6SB 4CRAA 1K1IA 4BOHA 4DGJA 3ZV8A 6CHAB 1UVUH 4K60A 1N6XA 1P3CA 1ETRH 2YOLA 1TFXA 4FUIA 1UTKA 1Z8RA 1QBOA 1BJVA 1ESTA 4NIXA 3RXUA 2TRMA 2WYJA 3EGKH 4SGAE 1P01A 1RJXB 2TPIZ 1RRKA 1KLJH 2QV1A 3QLPH 1QJ7B 3S0NA 1YPEH 4TYDA 1KLIH 1EPTC 4RSPA 2AMDA 1W12U 2Y80A 1LHGH 1UTNA 3R3GB 1S82A 1TMTH 1EZXC 2STBE 1HNEE 3A7YA 1O3PB 2ZTXA 3MH5A 5IDKA 1OYTH 4WVPE 1A1RA 1GCTB 3M36A 1ANDA 3BV9B 3ZVDA 1P9UA 3O8DA 1Z1JA 4B71A 1MH0A 1YPLH 1VJAU 4INKA 3SOSA 1C5LH 1DUAA 3TPIZ 2PKSB 1THSH 1W14U 3ZZ3A 1Y3WA 3Q77A 1VGCB 2Y82A 4GVUA 3GDUA 1Z8IB 2ZU2A 1PJPA 1QR3E 4Y0YE 4X1RU 1C4V2 2STAE 1SOTA 2J2UA 1QHRB 1GHYH 1P57B 4X8VH 1G3EA 2AYWA 1SOZA 1SMFE 2H2ZA 2UWPA 1YF4A 1DXPA 3MWIU 2P94A 1SGCA 2Z3CA 2BDGA 4Y11E 3AVZA 3UNQA 1HJAB 1V2MT 4IGDA 4MG3A 1ZJKA 3UNRA 1AE8H 2PGBB 4UONA 1O37A 2IOTA 3I78A 5GIBA 3SUFA 1P06A 2CMYA 3SV9A 1HAGE 2WV5A 3BEIB 1ZPZA 5DP6A 7ESTE 1OYQA 1P10A 1HJ9A 1TNJA 3C27B 1C4Y2 4Y0ZE 1LHFH