2R2WU

Urokinase plasminogen activator b-chain-gppe complex
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
247
structure length
247
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTISLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Plasminogen activator, urokinase
publication title Geometry of GPPE binding to picrate and to the urokinase type plasminogen activator.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 56
structure length 247
sequence length 247
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2007-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
U PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r2wU02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2r2wU01
2GCTC 2ODPA 1K9OE 1OP0A 1TPPA 3GY4A 2PUQH 1IQKA 4AB8A 1HFDA 2BDBA 1SGEE 4UEHH 1ETRH 1G3EA 2C8ZB 1CGJE 3LGTA 2OP9A 4I8GA 1G3DA 1UVOA 3P8GA 3HKJB 1O2UA 1Y5BT 3C27B 1BCUH 3MU1A 3RXLA 1C1NA 1C1TA 3U8TH 2AEIH 2AGGX 1BQYA 1OWEA 2VWOA 3ELAH 4WXVA 2YOLA 4NSVA 1OX1A 5C3NA 3TGIE 1DICA 1H8IH 2A7CA 1Y5UT 5FPYA 2CJIA 2GD4B 2GVFA 1HAIH 1MTVA 1QB1A 2H5CA 4YOIA 1UJ1A 2BDGA 3AW1A 2J2UA 2ZKSA 4K1SA 5L2ZH 4X8TH 1SGFG 3Q00A 5ESBA 1FN6A 1P2IA 3K65B 3RU4D 2AH4X 4Z0KA 3TK9A 3PWCA 1AMHA 4BANB 1T8LA 3BF6H 1KXEA 2H1UA 1C1OA 1HJAB 1NY22 1O5BB 1UO6A 3KQBA 3TU7H 3ZVGA 2G00A 1RGQA 3GY7A 1ZHRA 4J1YA 3FVFB 3GCTF 1MKXK 1BA8B 1EPTB 2FYRA 4NIYA 2OC0A 4YLQH 2A1DB 4E7NA 2DE9A 1BRBE 1CGHA 2ZWLH 2VGCC 3U98H 4KELA 3ESTA 4CRGA 3LJJA 1GBIA 1V2MT 4O9VA 1C2LA 5LPEA 1FXYA 3SV6A 1BRCE 1ZRKA 2BQWB 1QRZA 4X1PU 4CRDA 1P02A 2VWNA 4FUBA 1OWHA 3O8RA 1LDTT 1AY6H 1C5MD 1Y3YA 2FOHA 1ELEE 3UOPA 4BTIB 1B0FA 1PPZA 2BDYA 3DT0H 2J4IA 2C90B 5HM9A 3LPRA 5C1XA 1FV9A 3SHAH 4IW4E 1D3QB 1ESBA 1XMNB 3A85A 2XBWA 2STBE 3F68H 2HNTC 2R2MB 5FPTA 5F8XA 1CA8B 3H5CB 5GPIB 1JXPA 4AYVB 1K1JA 1AVWA 1HAVB 1BBRE 1D6WA 2V0BA 4X2VA 1TX6A 2W5EA 2QA9E 3QZQA 1ELTA 1NU9A 3LC5A 1CT2E 1SGTA 1OYQA 2VH6A 3UOUA 1MU8B 4D9QA 4H6TA 4M7GA 4ABFA 2UWPA 1O3KA 4AGKA 1QIXB 3F9GA 2GDDA 1K28D 1MH0A 1BTUA 2ZCKP 3Q3KA 3RXPA 1MAYA 3BIUH 1HUTH 2Z9JA 4BAQB 1HAGE 1E38B 1TPOA 3MNXA 2BTCE 3LDXH 4UDWH 1AZZA 1JBUH 3K2UA 4MPWA 1E35B 1NO9H 3HATH 4CR9A 1GJ4H 5J4SA 1PJPA 2QXHA 4WVPE 6ESTA 3ZZBA 1GJ5H 5JB8S 4XFQA 1NRSH 5A09A 1EAXA 3QTVH 3T62A 5EQQA 1O39A 3M61U 3SN8A 2ULLA 1J16A 1GMCF 1MQ5A 3FP7E 1J17T 1BMNH 1YM0A 5A0AE 1SLVB 1C2HA 2VIOA 5FPSA 2VWLA 1MU6B 1XUJA 4UD9H 1OWKA 5PTPA 1HAPH 3EDXB 1GI5A 1H9LB 5E8EH 2Y5GA 2Y5FA 2Y7XA 1CQQA 2ZIQH 1BBRK 2ZTZA 1CBWB 2XWAA 2TGPZ 3PLKA 1UTQA 4B73A 1SGPE 1G3CA 2VNTA 5GCHF 1GJ8B 2ZFSA 1QB6A 1BITA 1GBMA 1MKWK 1WCZA 5E0JA 2ZPRA 4YLUA 4X6MA 5A8XA 2BVXH 1A3BH 2FZZA 3PLPA 1G2MA 1KTSB 1K1MA 2GCHG 3A8DA 4X2WA 1TGNA 1FY1A 1DLEA 3A89A 2ZECA 3VB6A 2G4UA 3E91A 3FZDA 1VCWA 1G2LA 3OY5U 1GJCB 1LVBA 1C1SA 1WOFA 5EXLA 5L2YH 1GGDC 4X1SU 2GGVB 1IQNA 3PB1E 2PWXA 5CMXH 4MNWA 2GZ8A 3NCLA 4NWKA 4LK4A 1V2OT 1SPJA 1UCYH 3M37A 4FVBA 2ZG0H 2WUCA 2GT7A 1GMDG 2QXJA 3BTGE 1L2EA 1F0UA 1IQGA 3Q3YA 4GVUA 4TPYA 1DSTA 1MTNC 4ZHAA 4Y71A 4GUXA 4GAWA 3MNBA 1GBBA 2Z7FE 2PUXB 2CF9H 2CHAC 3B8JA 3SU0A 2P8OC 1D3TB 4XBCA 1SGYE 3M35A 1UHBB 1T8OA 1SGRE 1A3EH 1HV7A 3JZ2B 1P03A 4MG3A 2WPLS 2A4RA 1XUHA 4YO9A 3VGCB 3I78A 2G5VA 2ZC9H 1A5HA 1MCTA 3S69A 3D49H 1TE0A 2ZFQH 1GWAA 1B5GH 3PTNA 2TIOA 2BD2A 2ZFRH 1P01A 1QTFA 4FVDA 1RTFB 3EA7A 1EAIA 1O3MA 4O97A 3MU8A 5HGGA 1GHBG 2W3IA 2O9QA 1ETTH 1DANH 4AG2A 1T8NA 1CA0B 1GI8B 1C5OH 1SOZA 4DOQA 2C4FH 3SNAA 2F9PA 1C9PA 3AASA 4Y8YA 5H4IB 1AIXH 1AKSA 1GI7B 2QGRA 1IQEA 4GCHF 1GJDB 1WAYB 1LVMA 2FOFA 3RXIA 1Z6JH 1SC8U 2QN5T 2FOCA 1BMMH 5GXPA 3RU4T 1GMHG 2BLWA 2PKSB 4K3JA 5AVDA 3S0NA 4UFFH 5IDKA 1EZUC 5DP9A 2G51A 4AN7A 2OINA 4CRBA 1P05A 1FAXA 1C1WH 4B1TA 1G30B 2CXVA 1FDPA 1LHCH 2HNTE 4DW2U 1YYY1 1O0DH 1W13U 1TX8A 2ZU3A 5JBTA 4CR5A 2PHBA 1ABJH 1EOJA 1AUTC 4XOJA 1QB9A 2BDAA 5EQRA 2QXGA 4ABAA 4B71A 1C2IA 2G5NA 5C67A 1EPTC 3TGJE 4MVNA 4K1TA 3OX7U 1HPGA 1QY6A 3QO6A 1HXFH 3NKKA 2GKVE 1UTLM 5DP7A 2ZTYA 1UCYE 2P95A 4YOGA 2ANKH 5FCRA 4I8JA 1P11E 2ZGHA 1IQJA 1W0ZU 1FY5A 3M5OA 1SGNE 1KYNA 3SU2A 1MBMA 4FU9A 1EZSC 1Z8JB 5ESTE 1BRUP 1H8DH 2NU2E 1FONA 1ZTJA 4PROA 4YESB 2Z9KA 3IG6B 1TAWA 3SJIA 3L3TA 4CBOA 1XKBC 4YOJA 3VEQB 1LQEA 1SFIA 1UMAH 1Y3WA 2HNTF 1DITH 2NU3E 2SGFE 1AFQB 2ZHDA 3SHCH 1JIMA 5T3HA 7GCHG 1P2JA 2VIDA 5TCAA 1MTSA 1G36A 2BY6X 1NTPA 3SU3A 1GI0A 4AFQA 4U32A 1H4WA 3LGUA 5LGOA 1KIGH 1AFEH 1N6YA 1UK4A 1Z6EA 1TBQH 3S7HB 1IQIA 1QRWA 4MPUA 3RC4A 2Y6TA 1XXDA 1LHFH 1O3PB 4ABHA 3PWBA 1P0SH 2J9NA 4HTCH 1Q2WA 4GSOA 1ARCA 2ZCHP 1EP5A 5BPEA 2FS9A 5B6OA 1BDAA 1DM4B 1YPJH 5HYOA 3S9AA 3RXSA 2FOBA 2C3SA 3STIA 3SGBE 3BTWE 2BD7A 1YC0A 2WV4A 1C1VH 3RXGA 4DURA 3A8AA 1C9TA 5FXLA 1KXCA 1K1IA 3GCOA 1MKXH 2A32A 5DGJA 4TWYA 3ZZ3A 1T4VH 2GMTB 4IC5A 2ZGBH 1OXGA 3GDSA 1VR1H 3RXDA 1TA6A 1F5KU 2XC0A 3AVZA 2BM2A 1GBJA 1XVOA 3STJA 1CBWC 1GVLA 2NWNA 2ZDLA 3NUMA 4ZHLU 1S83A 2ZGJA 4MPVA 4LZ4B 4ZKOU 1HNEE 2UUFB 4ZXYH 2XYAA 4JZ1A 5EQSA 3TLOA 1DT2A 5JDUB 3T26A 1N6XA 2OBOA 3LIWA 1V2LT 2Y5HA 3QZRA 1ZJDA 1GDNA 4YM9A 2AMQA 3D65E 1FIWA 3EE0B 1WTHD 5EG4A 1QRXA 1UVSH 3SZNA 3ZZ7A 3M3SA 2I6QA 3FP8E 3KF2A 4KGAA 1O30A 3UNQA 1HIAA 9LPRA 4ISHH 4Q7XA 1HAXB 5BRRE 1KXDA 1GHZA 3LH3A 3GCHC 3GYLB 3SQHE 5LPRA 1CT0E 1RIWB 1ZTKA 3Q3XA 2BZAA 3PO1B 2THFB 1TOMH 5JPMH 2HVXA 1JRSA 4BTUB 3BG4B 4ZUHA 1GJ6A 2KAIA 1LHEH 1SMFE 1S81A 4WF8A 4B2BA 1VGCB 1SG8B 1GG6B 5T6DA 3VXFH 1FNIA 1LVYA 1GHAG 1C5ZB 1O2RA 3E1XB 3A81A 1FY4A 2A5KA 7KMEH 1BJVA 1DY8A 3VGCC 3SV9A 1WBGB 4X8VH 3RXTA 1GBLA 1D9IA 3RXEA 4NG9H 1LPGB 3TH3H 4AOQA 2P3TB 1AO5A 2BX4A 2BXTH 3A87A 5A0CA 2D8WA 5FCKA 3FP6E 4O3TA 2ZEBA 2ZDMA 3PV4A 4B76A 2ZZUH 1SFQB 1VZQH 2ZFFH 2RDLA 1VITG 1BBRH 3A86A 1BTHH 4FUEA 1K1LA 1CA0C 5HMAA 1RRKA 4YT6H 1GDUA 2W7UA 1QGFA 3O8CA 2A0QB 4F49A 3KQCA 1IQHA 1MKWH 1V2RT 5DPAA 3UTUH 3VXEH 3DUXH 3LT3A 1HBTH 2ZA5A 3RXVA 3SV2H 3ZZ6A 4ABBA 1TX7A 2ALVA 2ZP0H 4R0IA 1S6FA 3CENA 3TITA 4SGBE 1UVUH 1B0EA 5FBEA 1GBEA 1A1RA 4U2WA 5EGMA 1TONA 2PKSC 2VH0A 1EAUA 4MNYA 6CHAB 3MNCA 3MYWA 2BY5X 2JH0D 1O3EA 2Z3CA 1ZYOA 1DFPA 1O2SA 1BIOA 1QHRB 3URCA 5J4QA 2TGTA 1PQ8A 4K69A 1NZQH 2WINI 3GY6A 3P8FA 4INKA 1TGSZ 2OBQA 1F92A 3T2NA 2VINA 3MI4A 3FZZA 2CMYA 4JMYA 1T4UH 1D6RA 2ZTXA 4JYUH 1NESE 5EXMA 3VB4A 1P8VC 1O2GH 4CREA 4ISOA 2SNVA 2FEQH 1C5LH 1VCQA 2Z6BD 4NWLA 1KDQA 1LPZB 3ATIA 3RXAA 1SR5C 3KCGH 1C4V2 1RJXB 4JCNA 1O2WA 1ZMJA 4RKOB 4CRCA 5EPYA 1E36B 1IQLA 2B8OH 2EEKA 5C5OA 1S6HA 3PTBA 3MO6A 1O2HA 2R9PA 2BHGA 1IAUA 1LKBA 4IGDA 1V2WT 4X2YA 1ZSLA 3P95A 1WTGH 3UWJH 4JZEH 2ZHQH 3U69H 3AW0A 3M3TA 1PYTD 1ESAA 4A1VA 1MZAA 3KGPA 2XCNA 1SHHB 1TPSA 1P2MA 3D23A 3GYMA 1AE8H 1C5PA 3R3GB 2PTNA 1C2FA 1CHOG 1CE5A 4WJG2 3SUDA 4BAMB 3UFAA 3MTYA 1LCYA 4HFPB 4MLFB 1W7XH 2ZDNA 4GHTA 1P2KA 1PQ7A 2FDAA 3MOCA 1EX3A 1O5FH 1T31A 1FMGA 2FI4E 1DUAA 3ZZ5A 1QBNA 4DY7B 3VB3A 1EAWA 4JZDH 1O2YA 3HK3B 2FXRA 3JZ1B 1JIRA 1AFQC 2P93A 2HGTH 5JB9S 3O8DA 3QX5H 1EJAA 1C5RA 1HAHH 2ZGXH 1BZXE 1JMOH 2G8TA 3V13A 2PW8H 1HAOH 3QTOH 1A0JA 3OY6U 3O8BA 2OD3B 1SVPA 3UUZA 2Y81A 1L4ZA 2BQ7B 4K8YA 1QA7A 2D1JA 1GI3A 3F9HA 3QLPH 2ANYA 2UWOA 2VVUA 1D3PB 2A45B 3AAUA 3RM0H 1SGFA 1QJ7B 2UWLA 2Q6DA 8ESTE 2ODYB 4RN6A 4D8NA 8GCHG 4MPXA 1AQ7A 2STAE 1Q3XA 3CS7A 2GCHF 3PYHA 1HRTH 5DO4H 4CH8B 1EXFA 1HCGA 1TMTH 3V3MA 4FUDA 5ABWA 2Q6GA 3BTQE 1IHTH 1KY9A 4RSPA 1MD8A 1ELFA 3T29A 3GY5A 3SJ9A 1ORFA 1DDJA 3KEEA 1BUIA 1RXPA 3SGQE 2BOKA 1GMDF 5DK1A 1QL9A 1RTLA 1UTNA 4Y11E 2B5TB 3BTDE 3M5MA 1F0RA 3U8RH 1AKSB 1FPHH 1TOCB 1YKTA 3P8NA 2Y82A 2AS9A 1ELGA 3SQEE 3MO3A 4TY6A 5CE1A 2PV9B 2UUJB 3RM2H 1O2VA 4MNVA 3NWUA 5HXFA 3F1SB 1TNGA 2AGEX 1GBAA 4CH2B 4B2AA 2PR3A 1O37A 4LXBH 1PPEE 3SOSA 1LVOA 1DPOA 1OSSA 2R0KA 3LH1A 1W3CA 3SJ8A 1C2KA 2FOEA 1NC6A 2BD5A 1GBFA 4K60A 3GCNA 1Y3VA 2AFQB 2BXUH 3A88A 5EW2H 5TCCA 2ILNA 1W14U 4DIHH 2NU4E 5HM2A 3W95A 3BG8A 1GHBF 2FTLE 1DX5M 2ZHWH 2VWMA 1QR3E 1IQMA 4CHAC 3C1KA 1O38A 2J38A 2CGAA 1DSUA 1UTMA 3BG4C 4JYTA 1E37B 4ABIA 1O2NA 5C20A 1INCA 3TK6A 2DE8A 2EI8A 3TJVA 3RLWH 1VGCC 2XRCA 1GG6C 2BY9X 2AMPA 5AF9H 1JWTA 4NIVA 3S9CA 3VB7A 1GCDA 1V2JT 2OC1A 5EU8A 5L6NH 2A7HA 1GMHF 2C8XB 1QL7A 1V2QT 1LHDH 1MTWA 1IQFA 1DWBH 2AIPA 7LPRA 1AB9B 3M3VA 1W11U 2JKHA 1Y3UA 3QWCH 4I8LA 4NFEA 2H9TH 4ABJA 4ABEA 3SUEA 2OC7A 1HAVA 4O3UA 3ODFA 1L1NA 2J95A 1BMLA 4BNRA 8KME2 1NS3A 2H6MA 1DS2E 2AYWA 3P92A 1DY9A 5GWZA 3ZV9A 3ZVAA 1FUJA 1GHWH 1P10A 3R0FA 4GPGA 2GX4A 1D3DB 1O2XA 1EJNA 2WPMS 1CU1A 1P3CA 4ZHMU 2BD9A 3E0NB 1HJ9A 5DP6A 2C8WB 3E16B 3ODDA 3QUMP 5GCHG 2VJ1A 4H6SB 1QQ4A 4J2YB 4I32A 3B9FH 4KP0A 1A0LA 1KLIH 4Q7YA 3UQVA 1O2MA 3GY2A 4WY3A 2QXIA 2TGAA 3VFEA 1VITH 3QK1A 1YCPM 1W8BH 1UVPA 4FU7A 1QJ6B 2M5TA 1Y3XA 6CHAC 3A7VA 1TALA 1ETSH 4B75A 1V2UT 2BD3A 1NT1A 3RXHA 1F7ZA 2PSXA 4X0WU 3SNDA 3QGJA 1ZHPA 2K1QA 1AI8H 4A5TS 1WV7H 1Z8GA 1MAXA 3LOXA 1S0QA 1MUEB 5F6MA 3E90B 4OS2A 4FU8A 4QT8C 1ACBE 2O8LA 1EB1H 1TBZH 2G4TA 2QCYA 3FFGA 1TNKA 4UFGH 3SV8A 3ZYEA 2O8MA 2GZ9A 1OOKB 1DWDH 3CS0A 3CP7A 1C4Y2 5JYIA 3UNSA 3PMHB 1O2JA 3RMMH 3A83A 1S82A 3SGAE 5EW1H 3SI4H 1ELAA 4O03A 3RXMA 1A61H 1EUFA 3FAOA 3SUGA 3TH2H 1LPKB 1BHXB 3TJNA 2QF0A 1O5AB 3BTME 1H9IE 3SU6A 7GCHF 1F0SA 4FUCA 1HJAC 1TGCA 3LGYA 5I46H 3AAVA 4ZKRU 2XTTB 2H9HA 3GY3A 2H2ZA 1GI1A 3RMOH 3SI3H 5K7RA 1HAZB 5JBAS 1T7CA 2UUKB 3ZYDA 3URDA 2ODQA 2QY0B 1GBTA 1T8MA 1THPB 3A8CA 2FI3E 3NK8A 3G01A 3LGIA 2SFAA 3A7ZA 2WUBA 5E2OA 1NFUA 1V2KT 1GBHA 1BOQA 1QJ1B 1O3NA 2QYIA 2WPHS 2YNBA 2BX3A 2ZFTA 2ZU2A 1QBOA 3LJOA 3E0PB 1LMWB 4UE7H 1SL3A 2YNAA 1TNHA 3KIDU 4F4OC 1L1JA 1XVMA 1FPCH 1O31A 3P6ZB 4HI3A 4Q2KA 2WPJS 3LU9B 4MDSA 4ISIH 2J94A 1SQOA 3IITA 4AFSA 1KSNA 3LGVA 4K5ZA 4OGYA 1DOJA 4D7FA 2F83A 1P2OA 3KN2A 3ZZDA 5GDSH 3U1JB 1Q31A 2QV1A 1IOEA 1ELDE 1TMBH 3IWMA 2JH5D 1YPGH 5AFYH 1Y5AT 5DP4A 8LPRA 3MH4A 1RTKA 1SBWA 4FXGH 3SU5A 4TYDA 2QF3A 3A7YA 4Y79A 3S7KB 4YT7H 3SORA 2HRVA 1YF4A 3TIUA 4A6LA 1Y8TA 4I33A 3M36A 3HPTB 1EKBB 3DFJA 1WUNH 1XKAC 4BAKB 2R3YA 2VIQA 2FMJA 2G81E 3EGKH 6LPRA 1GL0E 1OKXA 1FY3A 2V3OH 1C1RA 1FI8A 3T28A 1C4U2 4GHQA 4X1NU 2A4GA 3NXPA 6GCHG 1BB0B 3RUOA 2FOGA 1DUEA 3S9BA 1MBQA 4XE4A 1OYTH 3MH6A 1XUFA 4IMZA 1YCPK 3ZZ8A 3OSYA 3MWIU 3DD2H 1C5VA 4NSYA 1GHAF 1TB6H 2Z9IA 3V7TA 2FIRH 1TRNA 3ZVEA 2PKAA 2BVSH 3F6UH 1HB0B 3OYPA 1SLUB 1DXWA 1YPMH 1AHTH 4ZAEA 3GY8A 1GI6A 3PROA 1PFXC 3RXCA 1KXBA 2I6SA 4GLYA 3QN7A 2GP9B 2BLOA 5DJ7A 2GDEH 3ATKA 1SGIB 2BY8X 3EQ0H 4WMDA 3QGNB 2ZQ1A 5T6FA 1ZHMA 1O2TA 3HGPA 5C1YA 2ZU4A 4B74A 2PGQB 1VITF 1WQSA 4TPIZ 9ESTA 4WWYA 3GDVA 5I25A 1QL8A 4SGAE 4ZH8A 1YP9A 1SI5H 1SOTA 4FUFA 1N8OB 1ZZZA 1O2LA 1W2KH 3RXQA 2RG3A 3UR9A 3KQEA 3M5LA 3PMBB 4Q80A 3UR6A 1ESTA 2AIQA 1BMAA 5DP8A 2A7JA 4Z6AH 3RP2A 1W0YH 1P9SA 2OQ5A 1ELCA 1O3FA 3FANA 1NFXA 4X6PA 4TWWA 2P3UB 3P17H 1ZTLA 4U30A 4A7IB 2Y80A 5F03A 2ZDKA 4KTUA 2IN2A 3D62A 1O3CA 3RXOA 1AN1E 1V2NT 2P16A 1NU7B 3MU0A 3TJUA 5A2MH 4AORA 1L1GA 1P2NA 1O3JA 2F3CE 3RXRA 4X6NA 3Q77A 3M5NA 1Z1IA 1ELVA 3F9FA 3UREA 2UUYA 1X7AC 2J34A 4K2YA 1K1NA 1E0FD 5IYTA 1YLDA 2Z3DA 1F5RA 5FAHA 5LH8A 3ZZCA 2CHAB 3V0XA 4VGCB 1DE7H 3EAJA 2P8OB 3SU4A 1A0HB 2VIPA 4E06H 1ZSKA 4OGXA 2R2WU 4CBNA 2BY7X 1UTKA 3KNXA 2Q1JA 4A1TA 1ZPBA 5F8TA 4ZKSU 2ZPSA 2R3UA 1KLTA 4CRAA 1FN8A 1BJUA 3RC6A 2F9OA 4BAOB 1AVXA 1O5GH 2PTCE 4NIXA 1XXFA 2V35A 4WH8A 1VJAU 4MNXA 2WPKS 4WMFA 1K1PA 1TRMA 1CHOF 1TQ0B 1WYKA 1THSH 1UK2A 1SSXA 3P70B 3UPEA 4Y0YE 3SU1A 2ANWA 2ZHEH 2FLRH 4Y6DA 3EA8A 4CRFA 3SNCA 1B7XB 2DUCA 1ELBA 1HGTH 2NU1E 4H4FA 3MH5A 4XBDA 3DFLA 3RXBA 1AU8A 2J92A 4JK5A 2ESTE 2FOAA 4KTCA 1GL1A 4OS5A 2ANMH 1ZMNA 2BYAX 3MU5A 1V3XA 2XC4A 4K8BA 2GTBA 4NGAH 2W26A 2ZDVH 4AGJA 1O2IA 4Y76A 2AERH 2VIVA 2VB0A 5FBIA 1O33A 4FUHA 1OWJA 2EI7A 4MTBA 1EASA 4I7YH 1AE5A 1TGBA 2OQUA 4I31A 3E6PH 2SGPE 3SBKA 1P12E 2C93B 4AB9A 4D76A 8GCHF 1PPFE 1S85A 3TNTA 4THNH 2PGBB 1TMUH 1K1OA 1NN6A 3TNSA 1GBDA 1KLJH 2TPIZ 2BD8A 1MTUA 2JH6D 1J14A 2IJOB 1GJ9B 4Y8ZA 3QDZB 1K2I1 2F9UA 2O8UA 3K6YA 1DXPA 1EATA 1O5DH 3MU4A 1GHVH 2A5IA 1O5EH 4IS5A 4DGJA 2SGQE 3E3TA 3BTHE 4I8HA 3SJKA 1GHXH 3OTJE 4WXIA 1C5WB 1GI4A 2F9BH 1BTYA 4A1XA 2H5DA 5ETXA 1XX9A 1T32A 5GJ4B 1PQAA 2A2QH 2XXLA 3MFJA 1CGIE 1C5YB 3DHKH 3RMLH 4IN2A 3TGKE 1ZSJA 1EP6A 4NZQA 1XUIA 2ALPA 3RXKA 1BT7A 2BOHB 7ESTE 2ZO3H 3A82A 1O5CB 2BDCA 1L4DA 1V2TT 3SW2B 1SQAA 1W12U 2BDIA 2FPZA 2Z3EA 2LNCA 4UONA 1O3OA 1CT4E 3A7TA 1GI9B 4KTSA 1U6QA 2SGEE 2GT8A 3LONA 1W10U 1AUJA 4LZ1H 4E7RG 4XSKU 1YPLH 2A2XH 1HLTH 3H7TA 1UTJA 1S5SA 2LPRA 2Z9LA 3RU4E 2Q6FA 1C5NH 4UFEH 1CHGA 2XWBI 4HGCA 2A4QA 3MO9A 3P8OA 1LHGH 5FX5A 5EOKA 1GDQA 2GMTC 2OTVA 1C1UH 3GCTG 4HZHA 4K1EA 1GI2A 1TWXB 1C5SA 2HOBA 1O3DA 1PPHE 1G32B 1KXFA 2WV5A 3ATMA 3LKWA 5LPFA 1SQTA 5E0GA 4BXWA 1SB1H 3UY9A 2ZNKH 5EXNA 1EOLA 2PLXA 5E2PA 3ZZ4A 1G3BA 1GPZA 4RKJB 3ZVDA 3VB5A 2D2DA 1GJ7B 1NRRH 2FESH 4BOHA 1TNLA 2FTMA 2RCEA 1C5TA 2XBYA 4BTTB 1VJ9U 3EYDA 3L33A 3E8LA 4NA7A 1O3HA 2XW9A 2FO9A 5DP3A 3RXJA 1F2SE 3NZIA 5K0HA 2ZF0H 4ASHA 1AWHB 2G52A 3ATLA 3GICB 1EQ9A 1O3BA 3ZVFA 2FI5E 1ABIH 4YZUA 2VVCA 5C1UA 1EPTA 3KL6A 2CF8H 4XDEA 1N8OC 2O8WA 1RIWC 5T6GA 2ZI2H 1MQ6A 3T5FH 1O3GA 4AZ2B 3PO1C 2FS8A 3BTFE 1C2JA 4AX9H 4JZFH 1Z8IB 1TRYA 2CN0H 2OC8A 3RXUA 1ZR0A 2VVVA 2H9EH 1H9HE 1EB2A 3TPIZ 1O2PA 1F5LA 2A4OA 2XCFA 3LGWA 4ISNA 3PLBA 2FWWA 4TY7A 1C1MA 1V2ST 1O3LA 3K9XB 3MMGA 1NRPH 3MNSA 3RXFA 1M9UA 3F9EA 1HXEH 2JETB 5DP5A 4NZLA 2ZFPH 1ZPZA 5GIBA 5F8ZA 3GCHB 1AZ8A 1RD3B 3PMAB 1GMCG 2F9VA 1C2MA 1P9UA 4WH6A 3KHVA 1LO6A 1A46H 1GBCA 5CHAB 5TJXA 1UVTH 1A5GH 1W7GH 2OXSA 1BTZA 4X2XA 1OWDA 1O2KA 1H1BA 4OS6A 4AG1A 2OUAA 4B2CA 3UIRA 3TK5A 1YCPH 2BMGB 2FP7B 2OCVB 3RMNH 1SGCA 1V6DA 2W3KA 1YGCH 2G55A 2TGDA 2ASUB 2Z9GA 4VGCC 4DCDA 1TYNA 1SLWB 1O36A 4D9RA 3BEIB 1DWCH 1FJSA 2HPPH 4IN1A 4OS1A 4Y7AA 1ANEA 3A7WA 3H7OA 4NA9H 4XBBA 2BD4A 1FY8E 3BSQA 1TBRH 3SO3A 1D4PB 2HWLB 4X8UH 2O8TA 2OLGA 1E34B 1P06A 2TBSA 4FUIA 1OWIA 4NCYA 4OS7A 4WMEA 5A0BA 5DG6A 4Y10E 1C2EA 3PM3A 3W94A 4ESTE 2BVRH 1QQUA 1SLXB 2FX4A 2NU0E 2V6NA 1J15A 1ARBA 1TFXA 1TLDA 2BLVA 2ZDAH 1XUKA 1SGDE 5A8ZA 4INHA 1TGTA 1GCTB 1QURH 2EC9H 3K6ZA 2GZ7A 1Y59T 1BRAA 1O2OA 1ZLRA 1Z71A 2VIWA 2VU8E 1TNJA 3SNEA 2GCTB 2HLCA 1QFKH 2SGDE 1QA0A 2PSYA 4DVAU 2B9LA 2QIQA 1A2CH 1G37A 3Q76A 1BHXF 2BDHA 1TNIA 2B0FA 1OP2A 1S0RA 3ZVCA 3A80A 1N1LA 1TA2A 1AGJA 4AFZA 4DG4A 5EPNA 1CVWH 2C8YB 1GVZA 4ABGA 3MH7A 1ZPCA 2PKAB 5AFZH 1VCPA 1LKAA 1NFYA 2R0LA 3EA9A 3DA9B 1KTTB 4FUJA 1AVGH 1P57B 2W7SA 5C2ZA 1CSOE 5JBCS 1UTOA 1UK3A 3BTKE 1ZOMA 1GHYH 1YPHC 3SUFA 1OP8A 1EZQA 4IBLH 1CO7E 4X8SH 2P3FH 1A4WH 1BTPA 1ZMLA 4GCHG 2GV6A 1HIAB 3RC5A 1F0TA 2IPHA 1Z8RA 2FLBH 3U8OH 1YPKH 4YTAA 4UFDH 2FODA 1ZRBA 1UHBA 6GCHF 5SGAE 1NPMA 1PPBH 2ZU1A 1GJBB 1WSSH 4NA8A 1NROH 2WPIS 3BV9B 1A5IA 1FQ3A 3T25A 2VGCB 1NRQH 3ZVBA 2EA3A 1MZDA 2Y7ZA 1A7SA 2KAIB 1JRTA 4JYVH 5A8YA 1S84A 2CV3A 2QAAA 3N7OA 3OU0A 3PMJA 2Z94A 5G4BA 1ID5H 1ANCA 3TJOA 1ANBA 3HGNA 1BTWA 1C5QA 1HYLA 1G9IE 4E05H 1C5XB 1UTPA 1ZJKA 1O2ZA 3ZZ9A 3M7TA 1XUGA 2XBVA 2FM2A 3A7XA 3BTTE 3MHWU 4IMQA 1L0ZA 1RFNA 4ISLA 1PPGE 1C2GA 2EI6A 3ENSB 3LC3A 2P59A 1UCYK 5DKMA 2ZPQA 1FAKH 4Y7BA 1TPAE 1YBWA 3UNRA 1EJMA 1TQ7B 2FX6A 3B23B 3BTEE 1O3IA 3GDUA 3SJOA 1WQVH 4AYYB 2XNIA 3ITIA 3GISB 2BZ6H 4NIWA 1O3AA 1YPEH 4R8TB 1AWFH 3ZZAA 2BQ6B 2IOTA 1BTXA 1FLEE 1P04A 1SHYA 1AD8H 1K22H 4X1QU 2XC5A 3BN9A 4DT7B 1J8AA 1YLCA 1TIOA 2AMDA 4INLA 4ZKNU 1O32A 4DJZB 1C1QA 1DWEH 1OS8A 1WU1A 1Z7KA 4ZXXH 1GVKB 2QC2A 2ZHFH 1NM6A 5FX6A 3L6PA 4BXSA 2A5AA 3U9AH 2D26C 2SGAA 4I8KA 2XBXA 1O35A 3T27A 1KDQB 1C1PA 1IHSH 2BB4A 1O2QA 2WYJA 2RA3A 1K21H 1HDTH 1ANDA 1THRH 1FZZA 1QBVH 4JZIA 1QNJA 3A84A 3RLYH 1Z1JA 2ZGCA 1QCPA 4NFFA 1NRNH 1SGQE 1PYTC 3M7UA 5AHGH 3BIVH 1J9CH 4Q7ZA 3U1IB 1DLKB 2JETC 1P09A 3TVJB 1OPHB 4DIIH 4IC6A 4ABDA 4BAHB 4D7GA 1AB9C 1RS0A 1C5UA 3NPSA 2ZCLP 3TH4H 4KKDA 1GJAB 2F91A 1LTOA 1MD7A 3BEUA 5CHAC 5L30H 2BLQA 1V2VT 3KQDA 1NFWA 4U01A 4OS4A 1C2DA 4CHAB 5JBBS 1GGDB 4H42U 2HPQH 2A31A 4AFUA 2B7DH 5FHTA 2ZU5A 2FYQA 3VPKA 4MQAA 1EZXC 4JK6A 1MTNB 1PPCE 2P94A 3HK6B 4Y8XA 4ZMAH 1PQ5A 2HALA 3I29A 3BEFB 1KXAA 1LQDB 4X6OA 3ATWA 3HKIB 1ZGVA 2RA0A 3UWIA 2V3HH 4A92A 1HAYB 4FUGA 5EODA 1O34A 2SNWA 3GOVB 1DVAH 4ZROA 1P2QA 3SNBA 1HJ8A 1V2PT 4Y0ZE 2FOMB 3WY8A 2PFEA 3SV7A 2WYGA 1TABE 3V12A 5E0HA 4LOYH 5C5NA 2GV7A 1MMJN 2TRMA 1ZGIA 3UQOA 1GBKA 2ZQ2A 1YPHE 3RDZA 2F9NA 1P3EA 3M7QA 3A8BA 1GCTC 3ZV8A 1FIZA 2AGIX 1JOUB 4X1RU 1MCVA 3I77A 1XM1A
chains in the Genus database with same CATH superfamily
2GCTC 2ODPA 1K9OE 1OP0A 1TPPA 3GY4A 2PUQH 1IQKA 4AB8A 1HFDA 2BDBA 1E79D 1SGEE 1ETRH 3F2FA 4UEHH 5HIYA 1G3EA 2LELA 5EJLA 2C8ZB 1CGJE 3LGTA 2OP9A 4I8GA 1G3DA 1UVOA 3P8GA 3HKJB 1O2UA 1Y5BT 3C27B 1BCUH 3MU1A 3RXLA 1C1NA 4Q4LA 1C1TA 3U8TH 2AEIH 2AGGX 5KGOA 1BQYA 1OWEA 2VWOA 3ELAH 4WXVA 2YOLA 4NSVA 1OX1A 5C3NA 3TGIE 1DICA 1H8IH 2A7CA 1Y5UT 5FPYA 2CJIA 2GD4B 2GVFA 2GJGA 1HAIH 1YLNA 1MTVA 1QB1A 2H5CA 4YOIA 1UJ1A 2BDGA 3AW1A 2J2UA 2ZKSA 4K1SA 5L2ZH 4X8TH 1SGFG 3Q00A 5ESBA 1FN6A 1P2IA 3K65B 3RU4D 2AH4X 4Z0KA 3TK9A 3PWCA 1AMHA 4BANB 1W0JD 1T8LA 4XD7D 3BF6H 1KXEA 2H1UA 1C1OA 1HJAB 1NY22 1O5BB 1UO6A 3KQBA 3TU7H 3ZVGA 4ASUD 2G00A 1RGQA 3GY7A 1ZHRA 4J1YA 3FVFB 3GCTF 1MKXK 1BA8B 1EPTB 2FYRA 4NIYA 2OC0A 4YLQH 2A1DB 4E7NA 2DE9A 1BRBE 1CGHA 2ZWLH 2VGCC 3U98H 4KELA 3ESTA 4CRGA 3LJJA 1GBIA 1V2MT 4O9VA 1C2LA 5LPEA 1FXYA 3SV6A 1BRCE 1ZRKA 2BQWB 1QRZA 4X1PU 4CRDA 1P02A 2VWNA 4FUBA 1OWHA 3O8RA 1LDTT 1AY6H 1C5MD 1Y3YA 2FOHA 1ELEE 3UOPA 4BTIB 1B0FA 1BMFD 1PPZA 2BDYA 3DT0H 2J4IA 2C90B 5HM9A 3U28C 3LPRA 5C1XA 1FV9A 3SHAH 4IW4E 1D3QB 1ESBA 1XMNB 3A85A 2XBWA 2STBE 3F68H 2HNTC 2R2MB 5FPTA 5F8XA 1CA8B 3AK5A 3H5CB 5GPIB 1JXPA 4AYVB 1K1JA 1AVWA 1HAVB 1BBRE 1D6WA 2V0BA 3CNRA 4P02A 4X2VA 1TX6A 2W5EA 5C0UA 2QA9E 3QZQA 1ELTA 3OFND 1NU9A 3LC5A 1CT2E 1SGTA 1OYQA 2VH6A 3UOUA 1MU8B 4D9QA 4H6TA 4M7GA 2W6JD 1S6LA 2UWPA 1O3KA 4ABFA 4AGKA 1QIXB 3F9GA 2GDDA 1K28D 1MH0A 1BTUA 2ZCKP 3Q3KA 3RXPA 1MAYA 3BIUH 1HUTH 2Z9JA 4BAQB 1HAGE 1E38B 1TPOA 3MNXA 2BTCE 3LDXH 4UDWH 1AZZA 1JBUH 3K2UA 4MPWA 1E35B 1NO9H 3HATH 4CR9A 1GJ4H 5J4SA 1PJPA 2QXHA 4WVPE 6ESTA 3ZZBA 1GJ5H 5JB8S 4XFQA 1NRSH 5A09A 1EAXA 3QTVH 3T62A 4HG6A 5EQQA 1O39A 3M61U 3SN8A 2ULLA 1J16A 1GMCF 1MQ5A 3FP7E 1J17T 1BMNH 1YM0A 5A0AE 1SLVB 1C2HA 2VIOA 5FPSA 3ZIAD 2VWLA 1MU6B 1WXRA 1XUJA 4UD9H 1OWKA 2WHXA 5PTPA 1HAPH 3EDXB 1GI5A 1H9LB 5E8EH 2Y5GA 2Y5FA 2Y7XA 1CQQA 2YMSC 2ZIQH 1BBRK 2ZTZA 1CBWB 2XWAA 2TGPZ 3PLKA 1UTQA 4B73A 1SGPE 1G3CA 2VNTA 5GCHF 1GJ8B 2ZFSA 1QB6A 3OEED 1BITA 1GBMA 1MKWK 1WCZA 5E0JA 3SYJA 2ZPRA 4YLUA 4X6MA 5A8XA 2BVXH 1A3BH 2FZZA 3PLPA 1G2MA 2J5UA 1KTSB 1K1MA 4RI0A 2GCHG 3A8DA 4X2WA 1TGNA 1FY1A 1DLEA 3A89A 2ZECA 3VB6A 2G4UA 3E91A 3FZDA 1VCWA 1G2LA 3OY5U 1GJCB 1LVBA 1OHHD 1FX0B 1C1SA 1WOFA 5EXLA 5L2YH 1GGDC 4X1SU 2GGVB 1IQNA 3PB1E 3MQKC 2PWXA 3PV5A 3UAIC 2J97A 5CMXH 4MNWA 2GZ8A 3NCLA 4NWKA 4LK4A 1V2OT 1SPJA 1UCYH 3M37A 3UB0A 4FVBA 2ZG0H 2WUCA 2GT7A 1GMDG 2QXJA 3BTGE 1L2EA 1F0UA 1IQGA 3Q3YA 4GVUA 5EJ1A 4TPYA 1DSTA 1MTNC 5C17A 4ZHAA 4Y71A 4GUXA 4GAWA 3MNBA 1GBBA 2Z7FE 2PUXB 2CF9H 2CHAC 3B8JA 3SU0A 2P8OC 1D3TB 4XBCA 1SGYE 3M35A 1UHBB 1T8OA 1SGRE 1A3EH 1HV7A 5C0TA 3JZ2B 1P03A 4MG3A 2WPLS 2A4RA 1XUHA 4YO9A 3VGCB 3I78A 2G5VA 2ZC9H 1A5HA 1MCTA 3S69A 3D49H 1TE0A 4RT1A 2ZFQH 1NBMD 1GWAA 1B5GH 3PTNA 2TIOA 2BD2A 2ZFRH 1P01A 1QTFA 4FVDA 1RTFB 3EA7A 1EAIA 1O3MA 4O97A 3MU8A 5HGGA 1GHBG 2W3IA 2O9QA 1ETTH 1DANH 4AG2A 1T8NA 1CA0B 1GI8B 1C5OH 1SOZA 4DOQA 2C4FH 3SNAA 2F9PA 1C9PA 2V3MA 3AASA 4Y8YA 5H4IB 1AIXH 1AKSA 4F48B 1GI7B 2QGRA 1IQEA 4GCHF 1GJDB 1WAYB 1LVMA 2FOFA 3RXIA 1Z6JH 1SC8U 2QN5T 2FOCA 1BMMH 5GXPA 3RU4T 1GMHG 2BLWA 2PKSB 4K3JA 5AVDA 3S0NA 4UFFH 5IDKA 1EZUC 5DP9A 2G51A 4AN7A 2OINA 4CRBA 1P05A 1FAXA 1C1WH 4B1TA 1G30B 2J98A 2CXVA 1FDPA 1LHCH 2HNTE 4DW2U 1YYY1 1O0DH 1W13U 1TX8A 2ZU3A 5JBTA 3W1EA 4CR5A 2PHBA 1ABJH 1EOJA 2YMSD 1AUTC 4XOJA 1QB9A 2BDAA 5EQRA 2QXGA 4ABAA 4B71A 1C2IA 2G5NA 5C67A 1EPTC 3TGJE 4MVNA 4K1TA 4ACAA 3OX7U 1HPGA 1QY6A 3QO6A 1HXFH 3NKKA 2GKVE 1UTLM 5DP7A 2ZTYA 1UCYE 2P95A 4YOGA 2ANKH 5FCRA 4I8JA 1P11E 2ZGHA 1IQJA 1W0ZU 1FY5A 3M5OA 1SGNE 1KYNA 3SU2A 1MBMA 2KCOA 4FU9A 1EZSC 1Z8JB 5ESTE 1BRUP 1H8DH 2NU2E 1FONA 1ZTJA 4PROA 4YESB 2Z9KA 3IG6B 1TAWA 3SJIA 3L3TA 4CBOA 1XKBC 4YOJA 3VEQB 1LQEA 1SFIA 1UMAH 1Y3WA 2HNTF 1DITH 2NU3E 2SGFE 1AFQB 2ZHDA 3SHCH 1JIMA 5T3HA 3KYFA 7GCHG 1P2JA 2VIDA 5TCAA 1MTSA 1G36A 2BY6X 1NTPA 3SU3A 1GI0A 4AFQA 4U32A 1H4WA 3LGUA 5LGOA 2OK5A 1KIGH 1AFEH 4RT0A 1N6YA 1UK4A 1Z6EA 1TBQH 2KFWA 3S7HB 1IQIA 1QRWA 4MPUA 3RC4A 2Y6TA 2IJD1 1XXDA 1LHFH 1O3PB 4ABHA 3PWBA 1P0SH 2J9NA 4HTCH 1Q2WA 4GSOA 1ARCA 2ZCHP 1EP5A 5BPEA 2FS9A 5B6OA 1BDAA 1DM4B 1YPJH 5HYOA 3S9AA 3RXSA 2FOBA 2C3SA 3STIA 3SGBE 3BTWE 2BD7A 1YC0A 2WV4A 1C1VH 3RXGA 4DURA 3A8AA 1C9TA 5FXLA 1KXCA 1K1IA 3GCOA 1MKXH 2A32A 5DGJA 4TWYA 3ZZ3A 1T4VH 2GMTB 4IC5A 2ZGBH 1OXGA 3GDSA 1VR1H 3RXDA 1SKYE 2QE7D 1TA6A 1F5KU 2XC0A 3AVZA 2BM2A 1GBJA 1XVOA 3STJA 1CBWC 1GVLA 2NWNA 2ZDLA 3NUMA 4ZHLU 1S83A 2ZGJA 4MPVA 4LZ4B 4ZKOU 1HNEE 2UUFB 4ZXYH 2XYAA 4JZ1A 5EQSA 3TLOA 1DT2A 5JDUB 3T26A 1N6XA 2OBOA 3LIWA 1V2LT 2Y5HA 3QZRA 1ZJDA 1GDNA 4YM9A 2AMQA 3D65E 1FIWA 3EE0B 1WTHD 5EG4A 1QRXA 1UVSH 3SZNA 2EY4C 3ZZ7A 3M3SA 2I6QA 4TSFD 3FP8E 3KF2A 4KGAA 1O30A 3UNQA 2XNDD 1HIAA 4M9FA 4ISHH 4Q7XA 1HAXB 5BRRE 9LPRA 1KXDA 1GHZA 3LH3A 3GCHC 3GYLB 3SQHE 5LPRA 1CT0E 1RIWB 1ZTKA 3Q3XA 2BZAA 3PO1B 2THFB 1TOMH 5JPMH 2HVXA 1JRSA 4BTUB 3BG4B 4ZUHA 1GJ6A 2KAIA 1LHEH 1SMFE 1S81A 4WF8A 4B2BA 1VGCB 2WSSD 1SG8B 1GG6B 4ACBA 5T6DA 3VXFH 1FNIA 1LVYA 1GHAG 1C5ZB 1O2RA 3E1XB 3A81A 1FY4A 2A5KA 7KMEH 1BJVA 1DY8A 3WW7A 3VGCC 3SV9A 1WBGB 4X8VH 3RXTA 1GBLA 1D9IA 3RXEA 4NG9H 1LPGB 3TH3H 4AOQA 2P3TB 1AO5A 2BX4A 2BXTH 3N7DA 3A87A 5A0CA 2D8WA 5FCKA 3FP6E 4O3TA 2ZEBA 2ZDMA 3PV4A 4B76A 2ZZUH 1SFQB 5T1VA 1VZQH 2ZFFH 4ZCNA 2RDLA 1VITG 1BBRH 3A86A 1BTHH 4FUEA 1K1LA 1CA0C 5HMAA 1RRKA 4YT6H 1GDUA 2W7UA 3DSPA 1QGFA 3O8CA 2A0QB 4F49A 3KQCA 1IQHA 1MKWH 1V2RT 5DPAA 3UTUH 3VXEH 3DUXH 3LT3A 1HBTH 2ZA5A 3RXVA 3SV2H 3ZZ6A 4ABBA 1TX7A 2ALVA 2ZP0H 4R0IA 1S6FA 3CENA 3TITA 4SGBE 1UVUH 1B0EA 5FBEA 1GBEA 1A1RA 4U2WA 5EGMA 1TONA 2PKSC 2VH0A 1EAUA 4MNYA 6CHAB 3MNCA 1KMHB 3MYWA 2BY5X 2JH0D 1O3EA 2Z3CA 1ZYOA 1DFPA 1O2SA 1BIOA 1QHRB 3URCA 5J4QA 2TGTA 1PQ8A 4K69A 1NZQH 2WINI 3GY6A 3P8FA 4INKA 1TGSZ 2OBQA 1F92A 3T2NA 2VINA 3MI4A 3FZZA 2CMYA 4JMYA 1T4UH 1D6RA 2ZTXA 4JYUH 1NESE 5EXMA 3VB4A 1P8VC 1O2GH 4CREA 4ISOA 2SNVA 2FEQH 2L6OA 1C5LH 1VCQA 2Z6BD 4NWLA 1KDQA 1LPZB 3ATIA 1K0HA 2KCYA 3RXAA 1SR5C 3KCGH 1C4V2 1RJXB 4JCNA 1O2WA 1ZMJA 4RKOB 4CRCA 5EPYA 1E36B 1IQLA 2B8OH 2EEKA 5C5OA 1S6HA 3PTBA 3MO6A 1O2HA 2R9PA 2BHGA 1IAUA 2W6ID 1LKBA 2EQNA 4IGDA 1V2WT 4X2YA 1ZSLA 3P95A 1WTGH 3UWJH 4JZEH 2ZHQH 3U69H 3AW0A 3M3TA 1PYTD 1ESAA 4A1VA 1MZAA 2L74A 3KGPA 2XCNA 1SHHB 1TPSA 1P2MA 3D23A 3GYMA 1AE8H 1C5PA 3R3GB 2PTNA 1C2FA 1CHOG 1CE5A 4WJG2 3SUDA 4BAMB 3UFAA 3MTYA 1LCYA 4HFPB 4MLFB 4XRNA 1W7XH 2ZDNA 4GHTA 1P2KA 1PQ7A 2FDAA 3MOCA 1EX3A 1O5FH 1T31A 1FMGA 2FI4E 1DUAA 3ZZ5A 1QBNA 4DY7B 3VB3A 1EAWA 4JZDH 1O2YA 3HK3B 2FXRA 3JZ1B 1JIRA 1AFQC 2P93A 3F2HA 2HGTH 5JB9S 3O8DA 3QX5H 1EJAA 1C5RA 1HAHH 2ZGXH 1BZXE 1JMOH 2G8TA 3V13A 2PW8H 1HAOH 2K0QA 3QTOH 1A0JA 3OY6U 3O8BA 2OD3B 1SVPA 3UUZA 2Y81A 1L4ZA 2BQ7B 4K8YA 1QA7A 2D1JA 1GI3A 3F9HA 2F4LA 3QLPH 2ANYA 2UWOA 2AHME 2VVUA 1D3PB 2A45B 3AAUA 3RM0H 1SGFA 1QJ7B 2UWLA 2Q6DA 8ESTE 2ODYB 4RN6A 4D8NA 8GCHG 4MPXA 1AQ7A 2STAE 1Q3XA 3CS7A 2GCHF 3PYHA 1HRTH 5DO4H 4CH8B 1EXFA 1HCGA 1TMTH 3V3MA 4FUDA 5ABWA 2Q6GA 4FETA 3BTQE 1IHTH 1KY9A 2KM0A 4RSPA 1MD8A 1ELFA 3T29A 3GY5A 3SJ9A 1ORFA 1DDJA 3KEEA 1BUIA 1RXPA 3SGQE 2BOKA 1GMDF 5DK1A 1QL9A 1RTLA 1UTNA 4Y11E 2B5TB 3BTDE 3M5MA 1F0RA 3U8RH 1AKSB 1FPHH 1TOCB 1YKTA 3P8NA 2Y82A 2AS9A 1ELGA 3SQEE 5HKKD 3MO3A 4TY6A 5CE1A 2PV9B 2UUJB 3RM2H 1O2VA 3OEHD 4MNVA 3NWUA 5HXFA 3F1SB 1TNGA 2AGEX 1GBAA 4CH2B 4B2AA 2PR3A 1O37A 2F43B 4LXBH 1PPEE 3SOSA 1LVOA 1DPOA 1OSSA 2R0KA 3LH1A 1W3CA 3SJ8A 1VKYA 1C2KA 2FOEA 1NC6A 2BD5A 1GBFA 4K60A 3GCNA 1Y3VA 2AFQB 2BXUH 3A88A 5EW2H 5TCCA 2ILNA 1W14U 4DIHH 2NU4E 5HM2A 3W95A 2KCAA 3BG8A 3FN8A 1GHBF 2FTLE 1DX5M 2ZHWH 2VWMA 1QR3E 1IQMA 4AC9A 4CHAC 3C1KA 1O38A 2J38A 2CGAA 1DSUA 1UTMA 3BG4C 4JYTA 1E37B 4ABIA 1O2NA 5C20A 1INCA 3TK6A 2DE8A 2EI8A 3TJVA 3RLWH 1VGCC 2XRCA 1GG6C 2BY9X 2AMPA 5AF9H 1JWTA 4NIVA 3S9CA 3VB7A 1GCDA 1V2JT 2OC1A 5EU8A 5L6NH 2A7HA 1GMHF 2C8XB 1QL7A 1V2QT 1LHDH 1MTWA 1IQFA 1DWBH 2AIPA 7LPRA 3PRBA 1AB9B 3M3VA 1W11U 2JKHA 1Y3UA 3QWCH 4I8LA 4NFEA 2H9TH 4ABJA 4ABEA 4FOUC 2OC7A 1HAVA 4O3UA 3SUEA 3ODFA 1L1NA 2J95A 1BMLA 4BNRA 8KME2 1NS3A 2H6MA 1DS2E 2AYWA 3P92A 1DY9A 5GWZA 3ZV9A 1COWD 3ZVAA 1FUJA 1GHWH 1P10A 3R0FA 4GPGA 2GX4A 1D3DB 1O2XA 1EJNA 2WPMS 1CU1A 1P3CA 4ZHMU 2BD9A 3E0NB 1HJ9A 5DP6A 2C8WB 3E16B 3ODDA 3QUMP 5GCHG 2VJ1A 4H6SB 1QQ4A 4J2YB 4I32A 1H8ED 3B9FH 4KP0A 1A0LA 1KLIH 4Q7YA 3UQVA 1O2MA 3GY2A 4WY3A 2QXIA 2QF5A 2TGAA 3VFEA 1VITH 3QK1A 1YCPM 1W8BH 1UVPA 4FU7A 1QJ6B 2M5TA 1Y3XA 5EJZA 6CHAC 3A7VA 1TALA 1ETSH 4B75A 1V2UT 2BD3A 1NT1A 3RXHA 1F7ZA 2PSXA 4X0WU 3SNDA 3QGJA 1ZHPA 2K1QA 5EIYA 1AI8H 4A5TS 1WV7H 1Z8GA 1MAXA 3LOXA 1S0QA 1MUEB 5F6MA 3E90B 4OS2A 4FU8A 4QT8C 1ACBE 2O8LA 1EB1H 1TBZH 2G4TA 3FKSD 2QCYA 3FFGA 1TNKA 4UFGH 3SV8A 3ZYEA 2O8MA 1W0KD 2GZ9A 1OOKB 1DWDH 3CS0A 3CP7A 1C4Y2 5JYIA 3UNSA 3PMHB 1O2JA 3RMMH 3A83A 1S82A 3SGAE 3PV2A 5EW1H 3NRLA 3SI4H 1ELAA 4O03A 3RXMA 1A61H 1EUFA 3FAOA 3SUGA 3TH2H 1LPKB 1BHXB 3TJNA 2QF0A 1O5AB 3BTME 1H9IE 3SU6A 7GCHF 1F0SA 4FUCA 1HJAC 1TGCA 3LGYA 5I46H 3AAVA 1YWUA 4ZKRU 2XTTB 2H9HA 3GY3A 2H2ZA 1GI1A 3RMOH 3SI3H 5K7RA 1HAZB 5JBAS 1T7CA 2UUKB 3ZYDA 3URDA 2ODQA 2QY0B 1GBTA 1T8MA 3KYGA 1THPB 3A8CA 2FI3E 3NK8A 3G01A 3LGIA 2SFAA 3A7ZA 2WUBA 5E2OA 1NFUA 1V2KT 1GBHA 1BOQA 1QJ1B 1O3NA 2PP6A 2QYIA 2WPHS 2YNBA 2BX3A 4YXWD 2ZFTA 2ZU2A 1QBOA 3LJOA 3E0PB 1LMWB 4UE7H 2WZQA 1SL3A 2YNAA 1TNHA 3KIDU 4F4OC 1L1JA 1XVMA 1FPCH 1O31A 3P6ZB 4HI3A 4Q2KA 2WPJS 3LU9B 4MDSA 4ISIH 2J94A 1SQOA 3IITA 4AFSA 2JJ2D 1KSNA 3LGVA 4K5ZA 4OGYA 1DOJA 4D7FA 2F83A 1P2OA 3KN2A 3ZZDA 5GDSH 3U1JB 1Q31A 2QV1A 1IOEA 1ELDE 1TMBH 3IWMA 2JH5D 1YPGH 5AFYH 1Y5AT 5DP4A 8LPRA 3MH4A 1RTKA 1SBWA 4FXGH 3SU5A 4TYDA 2QF3A 3A7YA 4Y79A 3S7KB 4YT7H 3SORA 3F2GA 2HRVA 1YF4A 3TIUA 4A6LA 1Y8TA 4I33A 3M36A 3HPTB 1EKBB 3DFJA 1WUNH 1XKAC 4BAKB 2KX4A 2R3YA 2VIQA 2QF4A 2FMJA 2G81E 3EGKH 6LPRA 1GL0E 1OKXA 1FY3A 2V3OH 2HLDD 1C1RA 1FI8A 3T28A 1C4U2 4GHQA 4X1NU 1SQRA 2A4GA 3OAAD 3NXPA 6GCHG 1BB0B 3RUOA 2FOGA 1DUEA 3S9BA 1MBQA 4XE4A 1OYTH 3MH6A 1XUFA 4IMZA 1YCPK 3ZZ8A 3OSYA 3MWIU 3DD2H 1C5VA 4NSYA 1GHAF 1TB6H 2Z9IA 3V7TA 2FIRH 1TRNA 3ZVEA 2PKAA 2BVSH 2V7QD 3F6UH 1HB0B 3OYPA 1SLUB 1DXWA 1YPMH 1AHTH 4ZAEA 3GY8A 1GI6A 3PROA 1PFXC 3RXCA 1KXBA 2I6SA 4GLYA 3QN7A 2GP9B 2BLOA 5DJ7A 2GDEH 3ATKA 1SGIB 2BY8X 3EQ0H 4WMDA 3QGNB 2ZQ1A 5T6FA 5B6LA 1ZHMA 1O2TA 4DT4A 3HGPA 5C1YA 2ZU4A 4B74A 2PGQB 3OE7D 1VITF 1WQSA 4TPIZ 9ESTA 4WWYA 3GDVA 3OTPA 5I25A 2YMSB 1QL8A 4SGAE 4ZH8A 1YP9A 1SI5H 1SOTA 2LP6A 4FUFA 1N8OB 1ZZZA 1O2LA 1W2KH 3RXQA 2RG3A 3UR9A 3KQEA 3M5LA 3PMBB 4Q80A 3UR6A 1ESTA 2AIQA 1BMAA 5DP8A 2A7JA 4Z6AH 3RP2A 1W0YH 1P9SA 2OQ5A 1ELCA 1O3FA 3FANA 1NFXA 4X6PA 4TWWA 2P3UB 3P17H 1ZTLA 4U30A 4A7IB 2Y80A 5F03A 3DSOA 2ZDKA 4KTUA 2IN2A 3D62A 1O3CA 3RXOA 1AN1E 1V2NT 2P16A 1NU7B 3MU0A 3TJUA 5A2MH 4AORA 1L1GA 1P2NA 1O3JA 2F3CE 3RXRA 4X6NA 3FOAA 3Q77A 3M5NA 3EE7A 1Z1IA 1ELVA 2RFKC 3F9FA 3UREA 2UUYA 1X7AC 2J34A 4K2YA 1K1NA 1E0FD 5IYTA 1YLDA 2Z3DA 1F5RA 5FAHA 5LH8A 3ZZCA 2CHAB 3V0XA 4VGCB 1DE7H 3EAJA 2P8OB 3SU4A 1A0HB 2VIPA 1YY3A 4E06H 1ZSKA 4OGXA 2R2WU 4CBNA 2BY7X 1UTKA 2CK3D 3KNXA 2Q1JA 4A1TA 1ZPBA 5F8TA 4ZKSU 2ZPSA 2R3UA 1KLTA 4CRAA 1FN8A 1BJUA 3RC6A 2F9OA 4BAOB 1AVXA 1O5GH 2PTCE 4NIXA 1XXFA 2V35A 4WH8A 2HVYB 1VJAU 4MNXA 2WPKS 4WMFA 3WWBA 1K1PA 1TRMA 1CHOF 1TQ0B 1WYKA 1THSH 1UK2A 1SSXA 3P70B 3UPEA 4Y0YE 3SU1A 2ANWA 2ZHEH 2FLRH 4Y6DA 3EA8A 4B6EA 4CRFA 3SNCA 1B7XB 2DUCA 1ELBA 1HGTH 2NU1E 4H4FA 3MH5A 4XBDA 3DFLA 3RXBA 1AU8A 2J92A 4JK5A 2ESTE 2FOAA 4KTCA 1GL1A 4OS5A 2ANMH 3KQ5A 1ZMNA 2BYAX 3MU5A 1V3XA 2XC4A 3WWFA 4K8BA 2GTBA 4NGAH 2W26A 2ZDVH 4AGJA 1O2IA 4Y76A 2AERH 2VIVA 2VB0A 5FBIA 1O33A 4FUHA 1OWJA 2EI7A 4MTBA 1E1RD 1EASA 3VG8A 4I7YH 1AE5A 1TGBA 2OQUA 4I31A 3E6PH 2SGPE 3SBKA 1P12E 2C93B 4AB9A 4D76A 8GCHF 1PPFE 1S85A 3TNTA 2JIZD 4THNH 2PGBB 1TMUH 1K1OA 1NN6A 3TNSA 1GBDA 3DCLA 1KLJH 2TPIZ 2BD8A 1MTUA 2JH6D 1J14A 2IJOB 1GJ9B 4Y8ZA 3QDZB 1K2I1 2F9UA 2O8UA 3K6YA 1DXPA 1EATA 1O5DH 3MU4A 1GHVH 2A5IA 1O5EH 4IS5A 4DGJA 2SGQE 3E3TA 3BTHE 4I8HA 3SJKA 1GHXH 3OTJE 4WXIA 1C5WB 2KZ4A 1GI4A 2F9BH 1BTYA 4A1XA 2H5DA 5ETXA 1XX9A 1T32A 5GJ4B 1PQAA 2A2QH 1MABB 2XXLA 5KEDA 3MFJA 1CGIE 1C5YB 3DHKH 3RMLH 4IN2A 3TGKE 1ZSJA 1EP6A 4NZQA 1XUIA 2ALPA 3RXKA 1BT7A 2BOHB 7ESTE 2ZO3H 3A82A 1O5CB 2BDCA 1L4DA 1V2TT 3SW2B 1SQAA 1W12U 2BDIA 2FPZA 2Z3EA 2LNCA 4UONA 1O3OA 1CT4E 3A7TA 1GI9B 4KTSA 1U6QA 2SGEE 2GT8A 3LONA 1W10U 1AUJA 4LZ1H 3GS9A 4E7RG 4XSKU 1YPLH 2A2XH 3F0PA 1HLTH 3H7TA 1UTJA 1S5SA 2LPRA 2Z9LA 3RU4E 2Q6FA 1C5NH 4UFEH 1CHGA 2XWBI 4HGCA 2A4QA 3MO9A 3P8OA 1LHGH 5FX5A 5EOKA 1GDQA 2GMTC 2OTVA 1C1UH 3GCTG 4HZHA 4K1EA 1GI2A 1TWXB 1C5SA 2HOBA 1WDIA 1O3DA 1PPHE 1G32B 1KXFA 2WV5A 3ATMA 3LKWA 5LPFA 1SQTA 5E0GA 4BXWA 1SB1H 3UY9A 2ZNKH 5EXNA 1EOLA 2PLXA 5E2PA 3ZZ4A 5DSFA 1G3BA 1GPZA 4RKJB 3ZVDA 2RDEA 3VB5A 2D2DA 1GJ7B 1NRRH 2FESH 4BOHA 1TNLA 2FTMA 2RCEA 1C5TA 2XBYA 4BTTB 1VJ9U 3EYDA 2KR7A 3L33A 3E8LA 4NA7A 1O3HA 2XW9A 2FO9A 5DP3A 3RXJA 1F2SE 3NZIA 5K0HA 2ZF0H 4ASHA 1AWHB 2G52A 3ATLA 3GICB 1EQ9A 1O3BA 3ZVFA 2FI5E 1ABIH 4YZUA 2VVCA 5C1UA 1EPTA 3KL6A 2CF8H 4XDEA 2J98B 1N8OC 2O8WA 1RIWC 5T6GA 2ZI2H 1MQ6A 3T5FH 1O3GA 4AZ2B 3PO1C 2FS8A 3BTFE 1C2JA 4AX9H 4JZFH 1Z8IB 1TRYA 2CN0H 2OC8A 3H09A 3RXUA 1ZR0A 2VVVA 2H9EH 1H9HE 5GNDA 1EB2A 3TPIZ 1O2PA 1F5LA 2A4OA 2XCFA 3LGWA 4ISNA 3PLBA 2FWWA 4TY7A 1C1MA 1V2ST 1O3LA 3K9XB 3MMGA 1NRPH 3MNSA 3RXFA 1M9UA 3F9EA 1HXEH 2JETB 5DP5A 4NZLA 2ZFPH 1ZPZA 5GIBA 5F8ZA 3GCHB 1AZ8A 1RD3B 3PMAB 1GMCG 2F9VA 1C2MA 1P9UA 4WH6A 3KHVA 1LO6A 1A46H 1GBCA 5CHAB 5TJXA 1UVTH 1A5GH 1W7GH 2OXSA 1BTZA 4X2XA 1OWDA 1O2KA 1H1BA 4OS6A 4AG1A 2OUAA 4B2CA 3UIRA 3TK5A 1YCPH 2BMGB 2FP7B 2OCVB 3RMNH 1SGCA 1V6DA 2W3KA 1YGCH 2G55A 2TGDA 2ASUB 2Z9GA 4VGCC 4DCDA 1TYNA 1SLWB 1O36A 4D9RA 3BEIB 1DWCH 1FJSA 2HPPH 4IN1A 4OS1A 4Y7AA 1ANEA 3A7WA 3H7OA 4NA9H 4XBBA 2BD4A 1FY8E 3DSGA 3BSQA 1TBRH 3SO3A 1D4PB 2HWLB 4X8UH 2O8TA 2OLGA 1E34B 1P06A 2TBSA 3N99A 4FUIA 5FL7D 1OWIA 4NCYA 4OS7A 4WMEA 5A0BA 5DG6A 4Y10E 1C2EA 3PM3A 3W94A 4ESTE 2BVRH 1QQUA 1SLXB 2FX4A 2NU0E 2V6NA 3F0OA 1J15A 1ARBA 1TFXA 1TLDA 2BLVA 2ZDAH 1XUKA 1SGDE 5A8ZA 4INHA 1TGTA 1GCTB 1QURH 2EC9H 3K6ZA 1EFRD 2GZ7A 3PRDA 1Y59T 1BRAA 1O2OA 1ZLRA 1Z71A 2VIWA 2VU8E 1TNJA 3SNEA 2GCTB 2HLCA 1QFKH 2SGDE 1QA0A 2PSYA 4DVAU 2B9LA 2QIQA 1A2CH 1G37A 3Q76A 1BHXF 4F55A 2BDHA 1TNIA 2B0FA 1QZ8A 1OP2A 1S0RA 3ZVCA 3A80A 1N1LA 1TA2A 1AGJA 4AFZA 4DG4A 5EPNA 1CVWH 2C8YB 1GVZA 4ABGA 3MH7A 1ZPCA 1NBME 2PKAB 5AFZH 1VCPA 1LKAA 1NFYA 2R0LA 3EA9A 3DA9B 1KTTB 4FUJA 1AVGH 1P57B 2W7SA 5C2ZA 1CSOE 5JBCS 1UTOA 1UK3A 3BTKE 1ZOMA 1GHYH 1YPHC 3SUFA 1OP8A 1EZQA 4IBLH 1CO7E 3SZEA 4X8SH 2P3FH 1A4WH 1BTPA 1ZMLA 4GCHG 2GV6A 1HIAB 3RC5A 1F0TA 2IPHA 1Z8RA 2JJ1D 2FLBH 3U8OH 1YPKH 4YTAA 4UFDH 2FODA 1ZRBA 1UHBA 6GCHF 5SGAE 1NPMA 1PPBH 2ZU1A 1GJBB 1WSSH 5DN6D 4NA8A 1NROH 2WPIS 3BV9B 1A5IA 1FQ3A 3T25A 5CDFE 2M2AA 2VGCB 1NRQH 3ZVBA 2EA3A 1MZDA 2Y7ZA 1A7SA 4B6FA 2KAIB 1JRTA 4JYVH 5A8YA 1S84A 2CV3A 2QAAA 3N7OA 3OU0A 1UW7A 5F53A 3PMJA 2Z94A 4Z1MD 5G4BA 1ID5H 2K8IA 1ANCA 3TJOA 1ANBA 2WPDD 3HGNA 1BTWA 1C5QA 1HYLA 1G9IE 4E05H 1C5XB 1UTPA 1ZJKA 1O2ZA 4P00A 3ZZ9A 3M7TA 1XUGA 2XBVA 2FM2A 3A7XA 3BTTE 3MHWU 4TT3D 4IMQA 1L0ZA 1RFNA 4ISLA 1PPGE 1C2GA 2EI6A 3ENSB 3LC3A 2P59A 1UCYK 5DKMA 2ZPQA 1FAKH 4Y7BA 1TPAE 1YBWA 3UNRA 1EJMA 1TQ7B 2FX6A 3B23B 3BTEE 1O3IA 3GDUA 3SJOA 1WQVH 4AYYB 2XNIA 3ITIA 3GISB 2BZ6H 4NIWA 1O3AA 1YPEH 5IK2D 4R8TB 1AWFH 3ZZAA 5KECA 1H8HD 2BQ6B 2IOTA 3F3BA 1BTXA 1FLEE 1P04A 1SHYA 1AD8H 1K22H 4X1QU 2XC5A 3BN9A 4DT7B 1J8AA 1YLCA 1TIOA 2AMDA 2JDID 4INLA 4ZKNU 1O32A 4DJZB 1C1QA 1DWEH 1OS8A 1WU1A 1Z7KA 4Q63A 4ZXXH 5HIZA 1GVKB 2QC2A 2ZHFH 1NM6A 5FX6A 3L6PA 4BXSA 2A5AA 3U9AH 2D26C 2SGAA 4I8KA 2XBXA 1O35A 3T27A 1KDQB 1C1PA 1IHSH 2BB4A 1O2QA 2WYJA 4OM9A 2RA3A 1K21H 1HDTH 1ANDA 1THRH 1FZZA 1QBVH 4JZIA 2XOKD 1QNJA 3A84A 3RLYH 1Z1JA 2ZGCA 1QCPA 4NFFA 1NRNH 1SGQE 1PYTC 3M7UA 5AHGH 3BIVH 1J9CH 4Q7ZA 3U1IB 1DLKB 2JETC 1E1QD 1P09A 3TVJB 1OPHB 4DIIH 4IC6A 4ABDA 4BAHB 4D7GA 1AB9C 1RS0A 1C5UA 3NPSA 2ZCLP 3TH4H 4KKDA 1GJAB 2F91A 1LTOA 1MD7A 3BEUA 2VBCA 5CHAC 5L30H 2BLQA 1V2VT 2WV9A 3KQDA 1NFWA 4U01A 4OS4A 1C2DA 3N7EA 4CHAB 5JBBS 1GGDB 4H42U 2HPQH 3FO8D 2A31A 4AFUA 2B7DH 5FHTA 2ZU5A 2FYQA 3VPKA 4MQAA 1EZXC 4JK6A 4I86A 1MTNB 1PPCE 2P94A 3HK6B 4Y8XA 4ZMAH 1PQ5A 2HALA 3I29A 3BEFB 1KXAA 1LQDB 4X6OA 3ATWA 2IPQX 3HKIB 1ZGVA 2RA0A 3UWIA 2V3HH 4A92A 1HAYB 4FUGA 5EODA 5CHBA 1O34A 2SNWA 3GOVB 1DVAH 4ZROA 1P2QA 3SNBA 1HJ8A 1V2PT 4Y0ZE 2FOMB 3WY8A 2PFEA 3SV7A 2WYGA 1TABE 3V12A 5E0HA 4LOYH 5C5NA 2GV7A 1MMJN 2KCPA 2TRMA 1ZGIA 3UQOA 1GBKA 2ZQ2A 1YPHE 3RDZA 2F9NA 1P3EA 3M7QA 3A8BA 1GCTC 3ZV8A 1FIZA 5C94A 2AGIX 1JOUB 4X1RU 1MCVA 3I77A 1XM1A
chains in the Genus database with same CATH topology
2GCTC 2ODPA 1K9OE 1OP0A 1TPPA 3GY4A 2PUQH 1IQKA 4AB8A 1HFDA 2BDBA 1SGEE 4UEHH 1ETRH 1G3EA 2C8ZB 1CGJE 3LGTA 2OP9A 4I8GA 1G3DA 1UVOA 3P8GA 3HKJB 1O2UA 1Y5BT 3C27B 1BCUH 3MU1A 3RXLA 1C1NA 1C1TA 3U8TH 2AEIH 2AGGX 1BQYA 1OWEA 2VWOA 3ELAH 4WXVA 2YOLA 4NSVA 1OX1A 5C3NA 3TGIE 1DICA 1H8IH 2A7CA 1Y5UT 5FPYA 2CJIA 2GD4B 2GVFA 1HAIH 1MTVA 1QB1A 2H5CA 4YOIA 1UJ1A 2BDGA 3AW1A 2J2UA 2ZKSA 4K1SA 5L2ZH 4X8TH 1SGFG 3Q00A 5ESBA 1FN6A 1P2IA 3K65B 3RU4D 2AH4X 4Z0KA 3TK9A 3PWCA 1AMHA 4BANB 1T8LA 3BF6H 1KXEA 2H1UA 1C1OA 1HJAB 1NY22 1O5BB 1UO6A 3KQBA 3TU7H 3ZVGA 2G00A 1RGQA 3GY7A 1ZHRA 4J1YA 3FVFB 3GCTF 1MKXK 1BA8B 1EPTB 2FYRA 4NIYA 2OC0A 4YLQH 2A1DB 4E7NA 2DE9A 1BRBE 1CGHA 2ZWLH 2VGCC 3U98H 4KELA 3ESTA 4CRGA 3LJJA 1GBIA 1V2MT 4O9VA 1C2LA 5LPEA 1FXYA 3SV6A 1BRCE 1ZRKA 2BQWB 1QRZA 4X1PU 4CRDA 1P02A 2VWNA 4FUBA 1OWHA 3O8RA 1LDTT 1AY6H 1C5MD 1Y3YA 2FOHA 1ELEE 3UOPA 4BTIB 1B0FA 1PPZA 2BDYA 3DT0H 2J4IA 2C90B 5HM9A 3LPRA 5C1XA 1FV9A 3SHAH 4IW4E 1D3QB 1ESBA 1XMNB 3A85A 2XBWA 2STBE 3F68H 2HNTC 2R2MB 5FPTA 5F8XA 1CA8B 3H5CB 5GPIB 1JXPA 4AYVB 1K1JA 1AVWA 1HAVB 1BBRE 1D6WA 2V0BA 4X2VA 1TX6A 2W5EA 2QA9E 3QZQA 1ELTA 1NU9A 3LC5A 1CT2E 1SGTA 1OYQA 2VH6A 3UOUA 1MU8B 4D9QA 4H6TA 4M7GA 4ABFA 2UWPA 1O3KA 4AGKA 1QIXB 3F9GA 2GDDA 1K28D 1MH0A 1BTUA 2ZCKP 3Q3KA 3RXPA 1MAYA 3BIUH 1HUTH 2Z9JA 4BAQB 1HAGE 1E38B 1TPOA 3MNXA 2BTCE 3LDXH 4UDWH 1AZZA 1JBUH 3K2UA 4MPWA 1E35B 1NO9H 3HATH 4CR9A 1GJ4H 5J4SA 1PJPA 2QXHA 4WVPE 6ESTA 3ZZBA 1GJ5H 5JB8S 4XFQA 1NRSH 5A09A 1EAXA 3QTVH 3T62A 5EQQA 1O39A 3M61U 3SN8A 2ULLA 1J16A 1GMCF 1MQ5A 3FP7E 1J17T 1BMNH 1YM0A 5A0AE 1SLVB 1C2HA 2VIOA 5FPSA 2VWLA 1MU6B 1XUJA 4UD9H 1OWKA 5PTPA 1HAPH 3EDXB 1GI5A 1H9LB 5E8EH 2Y5GA 2Y5FA 2Y7XA 1CQQA 2ZIQH 1BBRK 2ZTZA 1CBWB 2XWAA 2TGPZ 3PLKA 1UTQA 4B73A 1SGPE 1G3CA 2VNTA 5GCHF 1GJ8B 2ZFSA 1QB6A 1BITA 1GBMA 1MKWK 1WCZA 5E0JA 2ZPRA 4YLUA 4X6MA 5A8XA 2BVXH 1A3BH 2FZZA 3PLPA 1G2MA 1KTSB 1K1MA 2GCHG 3A8DA 4X2WA 1TGNA 1FY1A 1DLEA 3A89A 2ZECA 3VB6A 2G4UA 3E91A 3FZDA 1VCWA 1G2LA 3OY5U 1GJCB 1LVBA 1C1SA 1WOFA 5EXLA 5L2YH 1GGDC 4X1SU 2GGVB 1IQNA 3PB1E 2PWXA 5CMXH 4MNWA 2GZ8A 3NCLA 4NWKA 4LK4A 1V2OT 1SPJA 1UCYH 3M37A 4FVBA 2ZG0H 2WUCA 2GT7A 1GMDG 2QXJA 3BTGE 1L2EA 1F0UA 1IQGA 3Q3YA 4GVUA 4TPYA 1DSTA 1MTNC 4ZHAA 4Y71A 4GUXA 4GAWA 3MNBA 1GBBA 2Z7FE 2PUXB 2CF9H 2CHAC 3B8JA 3SU0A 2P8OC 1D3TB 4XBCA 1SGYE 3M35A 1UHBB 1T8OA 1SGRE 1A3EH 1HV7A 3JZ2B 1P03A 4MG3A 2WPLS 2A4RA 1XUHA 4YO9A 3VGCB 3I78A 2G5VA 2ZC9H 1A5HA 1MCTA 3S69A 3D49H 1TE0A 2ZFQH 1GWAA 1B5GH 3PTNA 2TIOA 2BD2A 2ZFRH 1P01A 1QTFA 4FVDA 1RTFB 3EA7A 1EAIA 1O3MA 4O97A 3MU8A 5HGGA 1GHBG 2W3IA 2O9QA 1ETTH 1DANH 4AG2A 1T8NA 1CA0B 1GI8B 1C5OH 1SOZA 4DOQA 2C4FH 3SNAA 2F9PA 1C9PA 3AASA 4Y8YA 5H4IB 1AIXH 1AKSA 1GI7B 2QGRA 1IQEA 4GCHF 1GJDB 1WAYB 1LVMA 2FOFA 3RXIA 1Z6JH 1SC8U 2QN5T 2FOCA 1BMMH 5GXPA 3RU4T 1GMHG 2BLWA 2PKSB 4K3JA 5AVDA 3S0NA 4UFFH 5IDKA 1EZUC 5DP9A 2G51A 4AN7A 2OINA 4CRBA 1P05A 1FAXA 1C1WH 4B1TA 1G30B 2CXVA 1FDPA 1LHCH 2HNTE 4DW2U 1YYY1 1O0DH 1W13U 1TX8A 2ZU3A 5JBTA 4CR5A 2PHBA 1ABJH 1EOJA 1AUTC 4XOJA 1QB9A 2BDAA 5EQRA 2QXGA 4ABAA 4B71A 1C2IA 2G5NA 5C67A 1EPTC 3TGJE 4MVNA 4K1TA 3OX7U 1HPGA 1QY6A 3QO6A 1HXFH 3NKKA 2GKVE 1UTLM 5DP7A 2ZTYA 1UCYE 2P95A 4YOGA 2ANKH 5FCRA 4I8JA 1P11E 2ZGHA 1IQJA 1W0ZU 1FY5A 3M5OA 1SGNE 1KYNA 3SU2A 1MBMA 4FU9A 1EZSC 1Z8JB 5ESTE 1BRUP 1H8DH 2NU2E 1FONA 1ZTJA 4PROA 4YESB 2Z9KA 3IG6B 1TAWA 3SJIA 3L3TA 4CBOA 1XKBC 4YOJA 3VEQB 1LQEA 1SFIA 1UMAH 1Y3WA 2HNTF 1DITH 2NU3E 2SGFE 1AFQB 2ZHDA 3SHCH 1JIMA 5T3HA 7GCHG 1P2JA 2VIDA 5TCAA 1MTSA 1G36A 2BY6X 1NTPA 3SU3A 1GI0A 4AFQA 4U32A 1H4WA 3LGUA 5LGOA 1KIGH 1AFEH 1N6YA 1UK4A 1Z6EA 1TBQH 3S7HB 1IQIA 1QRWA 4MPUA 3RC4A 2Y6TA 1XXDA 1LHFH 1O3PB 4ABHA 3PWBA 1P0SH 2J9NA 4HTCH 1Q2WA 4GSOA 1ARCA 2ZCHP 1EP5A 5BPEA 2FS9A 5B6OA 1BDAA 1DM4B 1YPJH 5HYOA 3S9AA 3RXSA 2FOBA 2C3SA 3STIA 3SGBE 3BTWE 2BD7A 1YC0A 2WV4A 1C1VH 3RXGA 4DURA 3A8AA 1C9TA 5FXLA 1KXCA 1K1IA 3GCOA 1MKXH 2A32A 5DGJA 4TWYA 3ZZ3A 1T4VH 2GMTB 4IC5A 2ZGBH 1OXGA 3GDSA 1VR1H 3RXDA 1TA6A 1F5KU 2XC0A 3AVZA 2BM2A 1GBJA 1XVOA 3STJA 1CBWC 1GVLA 2NWNA 2ZDLA 3NUMA 4ZHLU 1S83A 2ZGJA 4MPVA 4LZ4B 4ZKOU 1HNEE 2UUFB 4ZXYH 2XYAA 4JZ1A 5EQSA 3TLOA 1DT2A 5JDUB 3T26A 1N6XA 2OBOA 3LIWA 1V2LT 2Y5HA 3QZRA 1ZJDA 1GDNA 4YM9A 2AMQA 3D65E 1FIWA 3EE0B 1WTHD 5EG4A 1QRXA 1UVSH 3SZNA 3ZZ7A 3M3SA 2I6QA 3FP8E 3KF2A 4KGAA 1O30A 3UNQA 1HIAA 9LPRA 4ISHH 4Q7XA 1HAXB 5BRRE 1KXDA 1GHZA 3LH3A 3GCHC 3GYLB 3SQHE 5LPRA 1CT0E 1RIWB 1ZTKA 3Q3XA 2BZAA 3PO1B 2THFB 1TOMH 5JPMH 2HVXA 1JRSA 4BTUB 3BG4B 4ZUHA 1GJ6A 2KAIA 1LHEH 1SMFE 1S81A 4WF8A 4B2BA 1VGCB 1SG8B 1GG6B 5T6DA 3VXFH 1FNIA 1LVYA 1GHAG 1C5ZB 1O2RA 3E1XB 3A81A 1FY4A 2A5KA 7KMEH 1BJVA 1DY8A 3VGCC 3SV9A 1WBGB 4X8VH 3RXTA 1GBLA 1D9IA 3RXEA 4NG9H 1LPGB 3TH3H 4AOQA 2P3TB 1AO5A 2BX4A 2BXTH 3A87A 5A0CA 2D8WA 5FCKA 3FP6E 4O3TA 2ZEBA 2ZDMA 3PV4A 4B76A 2ZZUH 1SFQB 1VZQH 2ZFFH 2RDLA 1VITG 1BBRH 3A86A 1BTHH 4FUEA 1K1LA 1CA0C 5HMAA 1RRKA 4YT6H 1GDUA 2W7UA 1QGFA 3O8CA 2A0QB 4F49A 3KQCA 1IQHA 1MKWH 1V2RT 5DPAA 3UTUH 3VXEH 3DUXH 3LT3A 1HBTH 2ZA5A 3RXVA 3SV2H 3ZZ6A 4ABBA 1TX7A 2ALVA 2ZP0H 4R0IA 1S6FA 3CENA 3TITA 4SGBE 1UVUH 1B0EA 5FBEA 1GBEA 1A1RA 4U2WA 5EGMA 1TONA 2PKSC 2VH0A 1EAUA 4MNYA 6CHAB 3MNCA 3MYWA 2BY5X 2JH0D 1O3EA 2Z3CA 1ZYOA 1DFPA 1O2SA 1BIOA 1QHRB 3URCA 5J4QA 2TGTA 1PQ8A 4K69A 1NZQH 2WINI 3GY6A 3P8FA 4INKA 1TGSZ 2OBQA 1F92A 3T2NA 2VINA 3MI4A 3FZZA 2CMYA 4JMYA 1T4UH 1D6RA 2ZTXA 4JYUH 1NESE 5EXMA 3VB4A 1P8VC 1O2GH 4CREA 4ISOA 2SNVA 2FEQH 1C5LH 1VCQA 2Z6BD 4NWLA 1KDQA 1LPZB 3ATIA 3RXAA 1SR5C 3KCGH 1C4V2 1RJXB 4JCNA 1O2WA 1ZMJA 4RKOB 4CRCA 5EPYA 1E36B 1IQLA 2B8OH 2EEKA 5C5OA 1S6HA 3PTBA 3MO6A 1O2HA 2R9PA 2BHGA 1IAUA 1LKBA 4IGDA 1V2WT 4X2YA 1ZSLA 3P95A 1WTGH 3UWJH 4JZEH 2ZHQH 3U69H 3AW0A 3M3TA 1PYTD 1ESAA 4A1VA 1MZAA 3KGPA 2XCNA 1SHHB 1TPSA 1P2MA 3D23A 3GYMA 1AE8H 1C5PA 3R3GB 2PTNA 1C2FA 1CHOG 1CE5A 4WJG2 3SUDA 4BAMB 3UFAA 3MTYA 1LCYA 4HFPB 4MLFB 1W7XH 2ZDNA 4GHTA 1P2KA 1PQ7A 2FDAA 3MOCA 1EX3A 1O5FH 1T31A 1FMGA 2FI4E 1DUAA 3ZZ5A 1QBNA 4DY7B 3VB3A 1EAWA 4JZDH 1O2YA 3HK3B 2FXRA 3JZ1B 1JIRA 1AFQC 2P93A 2HGTH 5JB9S 3O8DA 3QX5H 1EJAA 1C5RA 1HAHH 2ZGXH 1BZXE 1JMOH 2G8TA 3V13A 2PW8H 1HAOH 3QTOH 1A0JA 3OY6U 3O8BA 2OD3B 1SVPA 3UUZA 2Y81A 1L4ZA 2BQ7B 4K8YA 1QA7A 2D1JA 1GI3A 3F9HA 3QLPH 2ANYA 2UWOA 2VVUA 1D3PB 2A45B 3AAUA 3RM0H 1SGFA 1QJ7B 2UWLA 2Q6DA 8ESTE 2ODYB 4RN6A 4D8NA 8GCHG 4MPXA 1AQ7A 2STAE 1Q3XA 3CS7A 2GCHF 3PYHA 1HRTH 5DO4H 4CH8B 1EXFA 1HCGA 1TMTH 3V3MA 4FUDA 5ABWA 2Q6GA 3BTQE 1IHTH 1KY9A 4RSPA 1MD8A 1ELFA 3T29A 3GY5A 3SJ9A 1ORFA 1DDJA 3KEEA 1BUIA 1RXPA 3SGQE 2BOKA 1GMDF 5DK1A 1QL9A 1RTLA 1UTNA 4Y11E 2B5TB 3BTDE 3M5MA 1F0RA 3U8RH 1AKSB 1FPHH 1TOCB 1YKTA 3P8NA 2Y82A 2AS9A 1ELGA 3SQEE 3MO3A 4TY6A 5CE1A 2PV9B 2UUJB 3RM2H 1O2VA 4MNVA 3NWUA 5HXFA 3F1SB 1TNGA 2AGEX 1GBAA 4CH2B 4B2AA 2PR3A 1O37A 4LXBH 1PPEE 3SOSA 1LVOA 1DPOA 1OSSA 2R0KA 3LH1A 1W3CA 3SJ8A 1C2KA 2FOEA 1NC6A 2BD5A 1GBFA 4K60A 3GCNA 1Y3VA 2AFQB 2BXUH 3A88A 5EW2H 5TCCA 2ILNA 1W14U 4DIHH 2NU4E 5HM2A 3W95A 3BG8A 1GHBF 2FTLE 1DX5M 2ZHWH 2VWMA 1QR3E 1IQMA 4CHAC 3C1KA 1O38A 2J38A 2CGAA 1DSUA 1UTMA 3BG4C 4JYTA 1E37B 4ABIA 1O2NA 5C20A 1INCA 3TK6A 2DE8A 2EI8A 3TJVA 3RLWH 1VGCC 2XRCA 1GG6C 2BY9X 2AMPA 5AF9H 1JWTA 4NIVA 3S9CA 3VB7A 1GCDA 1V2JT 2OC1A 5EU8A 5L6NH 2A7HA 1GMHF 2C8XB 1QL7A 1V2QT 1LHDH 1MTWA 1IQFA 1DWBH 2AIPA 7LPRA 1AB9B 3M3VA 1W11U 2JKHA 1Y3UA 3QWCH 4I8LA 4NFEA 2H9TH 4ABJA 4ABEA 3SUEA 2OC7A 1HAVA 4O3UA 3ODFA 1L1NA 2J95A 1BMLA 4BNRA 8KME2 1NS3A 2H6MA 1DS2E 2AYWA 3P92A 1DY9A 5GWZA 3ZV9A 3ZVAA 1FUJA 1GHWH 1P10A 3R0FA 4GPGA 2GX4A 1D3DB 1O2XA 1EJNA 2WPMS 1CU1A 1P3CA 4ZHMU 2BD9A 3E0NB 1HJ9A 5DP6A 2C8WB 3E16B 3ODDA 3QUMP 5GCHG 2VJ1A 4H6SB 1QQ4A 4J2YB 4I32A 3B9FH 4KP0A 1A0LA 1KLIH 4Q7YA 3UQVA 1O2MA 3GY2A 4WY3A 2QXIA 2TGAA 3VFEA 1VITH 3QK1A 1YCPM 1W8BH 1UVPA 4FU7A 1QJ6B 2M5TA 1Y3XA 6CHAC 3A7VA 1TALA 1ETSH 4B75A 1V2UT 2BD3A