1BRAA

Relocating a negative charge in the binding pocket of trypsin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKGSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPDVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Proteinase/inhibitor
molecule keywords TRYPSIN
publication title Relocating a negative charge in the binding pocket of trypsin.
pubmed doi rcsb
source organism Rattus rattus
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1992-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1braA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1braA02
4GVUA 1YCPM 1GHVH 3A82A 1QTFA 1LVOA 1ZZZA 2UUFB 1MCTA 2ANYA 2FIRH 2VWMA 5TCAA 2A32A 1TGNA 1C5MD 1Z1IA 2BQ7B 4AB9A 3BG8A 3BTME 1ANDA 1AZ8A 1KLTA 2EI7A 6LPRA 1NPMA 4CHAB 3KQEA 3U1IB 4JZ1A 1OYQA 2ZDNA 4HGCA 3BTQE 1TNGA 1YPMH 1ANBA 3PMHB 2A31A 1IQEA 1GL1A 1D3QB 5LPFA 3RP2A 1S6HA 1F0UA 1PQ7A 3KCGH 1L4DA 1Q31A 3BTTE 3SBKA 2AGGX 1NTPA 2R3UA 4UDWH 3RXPA 3B9FH 3RU4T 3M7UA 1GBFA 4SGBE 1WYKA 3P6ZB 1YKTA 1ZR0A 4NFEA 1XXDA 4DOQA 1YC0A 2ZGCA 2FI5E 1PYTC 2A4OA 3LGUA 4NFFA 1C5TA 5T6FA 2XBXA 1N1LA 4CHAC 3P92A 1ZMLA 3M5MA 1FY1A 2FOEA 4XE4A 5DP6A 4D7GA 2Z94A 1GL0E 4ZKNU 2QXHA 1AQ7A 1B5GH 4ZXXH 2A0QB 1HAXB 1NM6A 4K5ZA 3EQ0H 2BXUH 2AH4X 3Q00A 2ZIQH 4THNH 1BRCE 2Q6GA 3SUFA 9ESTA 1PJPA 4FUHA 1FJSA 1GBTA 1O3EA 2EA3A 2XWAA 5CMXH 1F5RA 3R3GB 1D6WA 3HPTB 2C8WB 4I31A 1C2DA 2P3UB 1C2IA 5IYTA 2ZFRH 1D4PB 5C1YA 1DDJA 3U8TH 2GDEH 1FN8A 1LVBA 3HGPA 1FY4A 4WXIA 3FFGA 1HXEH 3SU2A 1ABJH 4FUJA 4B1TA 2Y5HA 1BITA 1EZXC 2KAIA 1OP0A 3BTEE 5AF9H 5TCCA 1ACBE 3L33A 1S81A 4TWWA 2TIOA 3I78A 1DM4B 4X8VH 5FBIA 4ZH8A 2C8YB 2BTCE 2XBWA 1MCVA 2QN5T 1DE7H 3IG6B 1AE5A 1Y3VA 2QGRA 3BEIB 1HIAB 3P70B 1GHWH 2XCNA 1GBKA 4WWYA 4I8LA 5T6GA 3TH2H 1ZOMA 1DWBH 2GGVB 1LMWB 2ZDLA 2VU8E 3QGNB 1UVPA 1GMDG 1OX1A 1N6YA 3RXEA 3ATLA 4ESTE 1ZJKA 4UFFH 1TQ7B 1OPHB 1VCQA 3ESTA 3SORA 5SGAE 1O2HA 6GCHG 3Q76A 1T31A 1SGRE 1P09A 1CU1A 1GHYH 4FUFA 3GDSA 3BEFB 1XMNB 3GY7A 1V2KT 1LCYA 2XTTB 3RXCA 1TGCA 2GCHG 1N8OC 4FXGH 5A2MH 5GXPA 1V2MT 4JYVH 3LGWA 1ANCA 4GSOA 1C9PA 3M61U 5AVDA 3UTUH 3SU6A 1SC8U 1G2LA 3G01A 2YNAA 1PFXC 3A89A 2FTLE 1ELGA 4A92A 3RU4D 2TGPZ 1DOJA 5FXLA 1MZDA 1TONA 2VIDA 2UWPA 1NC6A 5IDKA 1LHDH 3S0NA 3RXOA 3KF2A 3MWIU 2ZC9H 2PV9B 3TJNA 2BDAA 1THPB 3PLBA 1T4UH 3PMJA 2PUXB 4OGYA 1G36A 3TK5A 1O3GA 3ZVGA 5EW1H 1TX7A 1C5SA 3T2NA 4YT7H 1A61H 3MH6A 1PPHE 3B8JA 1XUGA 2ZP0H 1LPKB 4U01A 1GBDA 3T26A 1NN6A 2DUCA 3GY5A 1MQ6A 1TRYA 2GX4A 1F0RA 1C4V2 3MHWU 1UTQA 3QGJA 4GPGA 1RFNA 1ZRBA 1MAYA 1VCWA 4MNWA 3DFLA 1FXYA 2BY6X 1S85A 2PKSB 2J38A 4MQAA 5TJXA 1XM1A 2HLCA 2FZZA 2VIPA 4A6LA 4ZKSU 5FPYA 1EB2A 1EZUC 3U8RH 2PGQB 2A7HA 4O3TA 1GPZA 2ULLA 1PPEE 2B9LA 1Y59T 3GCHB 3TJOA 2WPHS 3TPIZ 1DY8A 1GI0A 1QBOA 1H8DH 3K9XB 4DURA 4H6TA 4ISLA 1KY9A 2ZKSA 1VGCB 3MU4A 3F9EA 1CSOE 1THSH 4X1PU 2HPPH 2BLQA 1YP9A 1BMAA 3RXLA 1BRUP 3D62A 3Q77A 4QT8C 1JWTA 3ZZ7A 4AG2A 4K1TA 1SGNE 3PROA 2PUQH 4FVDA 2LNCA 3D49H 2HVXA 1C5LH 1MD8A 1ZTJA 3GCHC 5GDSH 1TB6H 1YPJH 3ZZ6A 2C90B 2B7DH 4I33A 3AW1A 3ZZDA 1O2NA 1QA0A 1VZQH 2BDBA 3K2UA 2SGPE 2AERH 4WJG2 3RXVA 4BTUB 2Z9KA 2J2UA 4CRCA 1QRXA 1W14U 2CJIA 1AWHB 1AKSA 1RTKA 1LPGB 4KTCA 2GTBA 1EPTB 1IQNA 4FUIA 3QX5H 4Q7YA 3RXTA 2F83A 5EXMA 1C1UH 1F2SE 3UNRA 4ASHA 2ZU5A 3BG4B 1OYTH 1SBWA 3SO3A 1GI5A 1XX9A 1MZAA 1ZLRA 1GBEA 4AYVB 1SG8B 1AFEH 2PFEA 1O32A 1DS2E 1TMTH 1LQEA 4TY6A 5DP9A 1SGPE 1GJ7B 3LC5A 3FANA 4I32A 4O9VA 1C2FA 2AIQA 3KNXA 1V2QT 2P16A 1ZPCA 1O3KA 5F6MA 3I29A 4A1XA 1O33A 2ZTZA 1O34A 3RXDA 3FZDA 2AYWA 1EPTC 5A8ZA 1IQFA 2BQWB 1GI1A 2C8ZB 4O97A 3QTOH 1LVMA 2J94A 4K60A 1FPHH 3VB5A 5FX5A 5EQRA 1QL8A 3BTKE 3BG4C 2WPJS 3CENA 1GJDB 1XUIA 2D2DA 1MMJN 2WUBA 3O8BA 3MH7A 3RXRA 3JZ1B 3SGBE 3FP8E 1VJ9U 5JB8S 1XVOA 1OSSA 3MU0A 1WCZA 3M36A 3M7QA 4XOJA 5BPEA 2HGTH 4YZUA 1P3EA 2TGAA 3AAVA 1G32B 3SHAH 3PTNA 3SU5A 1MBQA 1T8NA 4MNXA 1J8AA 1P10A 3SOSA 3K6ZA 1GBMA 1DFPA 1GI6A 1O2YA 1GHZA 3MYWA 1Y3XA 3PO1B 3RXJA 3AVZA 1B0EA 3TH4H 4AOQA 1TRNA 3PTBA 1C5XB 5AHGH 1SGCA 2JH0D 1IQKA 3FAOA 3RXUA 2ZGJA 2VGCC 2ZZUH 2GZ8A 1CT0E 2HNTE 3GY3A 3FP6E 1P9SA 4Y6DA 5CHAB 3M5NA 5DP5A 3V0XA 1O5BB 4AFSA 1THRH 1TX8A 5E2OA 5FCKA 1ELTA 1FAKH 2ESTE 1EATA 1UK4A 7GCHG 2XXLA 1ESBA 1EZSC 4WMEA 1C1SA 2XBYA 2STBE 1FAXA 4D9QA 2IJOB 3QUMP 3PMBB 3MU5A 3LDXH 4BAHB 1GMHF 1JOUB 3CS7A 1KTTB 3SNAA 3RXGA 1O35A 4DCDA 1BTZA 1YLDA 1EQ9A 2P94A 5CHAC 4Y8XA 2F9PA 2QXJA 4KTSA 1A5GH 4LZ1H 1C1RA 2ALVA 1MAXA 2VWOA 2B8OH 1MTSA 1SGYE 4WH8A 1GHAG 2G52A 1QJ7B 4AB8A 1TGSZ 4NIWA 3VEQB 4FUGA 3I77A 1AB9C 5HM2A 5JBTA 1TGTA 1GBBA 1KLJH 4AYYB 2FX4A 3SNCA 1MKXK 1LO6A 2R0KA 4U32A 1J14A 1OOKB 1D3TB 1GG6B 3SV2H 1EAXA 4K1EA 2BY8X 2FYQA 2M5TA 1HAZB 2RCEA 1GBJA 3SJ9A 2B5TB 3QDZB 4IC5A 2HNTF 4CR9A 2HNTC 2J34A 4B76A 3BV9B 1C1QA 8LPRA 5HXFA 1H1BA 4U30A 1A3EH 1BZXE 1SFIA 2FOHA 3ATIA 1AWFH 1O36A 1Y8TA 3OYPA 4B2BA 3A86A 3UNQA 1GDNA 3H7TA 1P2NA 2Q6DA 4X8SH 3LT3A 3LGTA 1FY8E 2H1UA 3MH4A 1W0YH 2ZPQA 5EG4A 1DANH 1F0TA 1V2UT 3F9FA 4ZMAH 2AEIH 4OS2A 2OBOA 4OGXA 1BMMH 5DGJA 2O8TA 5JBBS 4FUBA 2VVCA 1GJ4H 1C5VA 3SU4A 1AGJA 5F8ZA 1SHHB 2O8MA 1SL3A 1UVSH 4UD9H 2SGDE 1YYY1 2VVUA 1KDQA 1V2RT 3BTHE 4JYTA 4KGAA 2V6NA 3O8DA 3QWCH 5GWZA 3MNXA 3ATKA 4GCHF 2BQ6B 2VIWA 1DICA 2W5EA 1BJVA 3E0NB 2R2MB 3CS0A 4I8HA 4CREA 2A5AA 4BOHA 1GGDB 1QR3E 1CO7E 4IMZA 3V12A 3DT0H 1TNIA 2OC1A 2AS9A 3ODFA 2WINI 1ZSJA 3SV7A 3UOUA 1WQVH 5I46H 1GI3A 3SUDA 2AMPA 1ETSH 4Z0KA 1O3PB 3M5OA 3BN9A 3ZZCA 1HAVA 1BHXB 1YLCA 1YF4A 3T28A 1GCTC 1F7ZA 1BB0B 1GMCF 1ORFA 1ZSLA 5EXNA 1GI2A 3VXEH 1T8OA 2ODYB 4X1QU 2Y7XA 5F03A 2BLOA 1CVWH 3GY4A 4WH6A 3S69A 2F91A 4BTIB 4X6PA 4RSPA 1NO9H 2BVXH 2FI3E 1HB0B 4NG9H 3NK8A 2ZCHP 2JETB 1TNJA 5I25A 1MQ5A 5EW2H 5GIBA 1O3JA 5BRRE 1CHOF 1OXGA 5HM9A 1TQ0B 1HAGE 1HCGA 2A5IA 3F6UH 3VFEA 1BHXF 1GJCB 4B75A 4JZDH 3VPKA 3M7TA 1QQUA 1RS0A 2TGDA 1BA8B 1EOLA 4GUXA 4DGJA 4DT7B 3T5FH 2CV3A 5JYIA 2Y80A 1HAPH 2OUAA 2QCYA 2A45B 4ABIA 2RA3A 1IQLA 2JETC 1U6QA 3OU0A 5H4IB 1F92A 1ELCA 1UHBB 1GJ8B 1YPLH 2XRCA 2RDLA 1SI5H 1HV7A 1O5GH 2BMGB 2TGTA 3KHVA 1OWKA 5DG6A 2YOLA 1TABE 3O8CA 3FVFB 1E35B 3SN8A 4BAOB 1TOCB 1YPHE 2XC4A 2WUCA 1UMAH 3RXSA 3T25A 4F4OC 1UTOA 1CBWB 1UTKA 4DVAU 1GVKB 1AVXA 4NA7A 1NT1A 1FIWA 1TBZH 2AGIX 2NU3E 2G00A 1VCPA 4K2YA 1FPCH 3EA8A 1P06A 2EC9H 2Z7FE 2CGAA 4ISNA 2O8UA 1J16A 2FOGA 1EAIA 4BAQB 5K7RA 2QA9E 4HI3A 2PSXA 2VVVA 3GCNA 5C1UA 3GCTF 1P2MA 4JZFH 3LH3A 3ZZ8A 3V3MA 2A4GA 1UTNA 1O39A 5K0HA 1CBWC 4LK4A 1SGQE 1LPZB 1A0LA 1RIWC 4FVBA 1P04A 1GWAA 1WSSH 1JIRA 1ZHRA 2OTVA 1XKAC 1FMGA 2HWLB 2H5DA 6CHAB 3KGPA 4FU8A 1B0FA 5JB9S 1ZGIA 1O5EH 5FPTA 1AUTC 1GVZA 1QL9A 1WOFA 4NGAH 5GCHG 1ZMNA 4IN2A 1VJAU 3EA7A 3NPSA 4MNYA 1L1GA 3SZNA 1P02A 3TK9A 1FONA 1A3BH 3SGQE 2OC7A 2Z9LA 2ZFQH 1YPHC 3PYHA 3NKKA 1EAUA 4TY7A 2NU1E 2ZGBH 4AGJA 1HAOH 4O03A 1GJAB 1IHSH 6CHAC 2W26A 2J95A 2R9PA 1N8OB 4Q2KA 2OQUA 4HZHA 1FY5A 1C5NH 1D3PB 1LHGH 3RMMH 2BD7A 3W94A 2G8TA 1A2CH 2C93B 2FYRA 3DD2H 1OKXA 2ZFFH 1AU8A 2GZ7A 5C5NA 4BNRA 1DSTA 3BIVH 3SI4H 2GT8A 3A81A 4Y0YE 1HUTH 1PPCE 5CE1A 2WPMS 5T3HA 2G5NA 2ZDAH 1KXBA 1DSUA 4JK6A 2Y5GA 2R3YA 4IW4E 1YPEH 2ZECA 1H9HE 1O3AA 1A0HB 2P95A 3GCOA 1MKXH 3ODDA 5T6DA 1O0DH 3ITIA 1INCA 2B0FA 3ZVDA 3S9CA 4TPYA 2VJ1A 3VB6A 1T32A 2QF0A 2BD2A 4CH8B 3GICB 5FBEA 3KQCA 2G4TA 1HAYB 3AAUA 1SFQB 4H6SB 1TMUH 3E3TA 4NSYA 7LPRA 1GI4A 5C20A 1YPKH 1O2SA 2QIQA 1PYTD 1DXWA 2ODPA 4CBNA 1JRSA 2EEKA 2ZQ2A 4XBDA 5J4SA 4GHQA 3UWJH 4Q7XA 2F9UA 1KXFA 2ZNKH 1ETTH 5A0CA 1HLTH 3DA9B 5DP8A 1HDTH 2OXSA 3VGCC 3LGYA 4Q80A 3TK6A 4A1VA 4OS5A 4UFEH 3TNSA 2SGFE 4HFPB 3UOPA 3DFJA 1VITG 2EI8A 4D76A 4H4FA 1FLEE 1P9UA 3A8AA 4IC6A 1K1PA 5EU8A 2A1DB 1V2TT 3UREA 4K1SA 2AGEX 2C8XB 5EQSA 1AFQB 1RRKA 2Z9IA 3UFAA 1CGIE 1KLIH 3A7XA 1O3CA 4AFUA 2IN2A 1YM0A 3NWUA 2F9BH 2BLWA 1IQJA 1C1WH 4XDEA 1DXPA 2VIQA 1S6FA 5E0HA 1BMLA 2Z3DA 1GMDF 2BDYA 3UY9A 1L1JA 1O5CB 2I6SA 2BDGA 2BVRH 1E36B 3ZYEA 2GKVE 1K1IA 1MUEB 2GZ9A 5ETXA 3A80A 1SGDE 3CP7A 1HIAA 2HALA 1AFQC 1ID5H 6GCHF 1CQQA 2JH5D 2ZTYA 3MNCA 5C5OA 1P2KA 1F5KU 2ZFTA 1QJ1B 2GCTB 3RM0H 1C5RA 2JH6D 5DPAA 1HPGA 3SJOA 2BD3A 4AORA 1V6DA 1O2ZA 1P2OA 4NZQA 3SUGA 2CHAB 3TIUA 3A84A 2Z9GA 3GY6A 1ZJDA 3BEUA 4AFQA 1ESTA 2PLXA 1S0QA 2GDDA 1MKWK 3OX7U 1K1LA 1H9IE 1OWJA 2A4RA 2WYJA 4BANB 1FV9A 3FP7E 5HGGA 2H2ZA 1EJNA 2GCTC 5FX6A 1C1MA 2VINA 4ZROA 4ABHA 1GMHG 3M3SA 1C2LA 2CHAC 1UJ1A 2W7SA 2CXVA 2OQ5A 4SGAE 1AN1E 2PWXA 1H8IH 2FPZA 3RXBA 3URDA 2PKAB 2F9VA 1DPOA 1M9UA 2GV6A 3LJOA 2ZDVH 3ZZ3A 5DK1A 2FWWA 1L0ZA 1S5SA 1W2KH 2ZU2A 2WPLS 4B2AA 3SJIA 2Z3CA 3ATMA 2OP9A 4IN1A 3LC3A 1O2LA 4ZXYH 4TWYA 3HK3B 2BD9A 1S82A 3RUOA 2GVFA 3ZV9A 1YGCH 5JBAS 1LHEH 1TPOA 1PPZA 3T29A 2VGCB 1ZRKA 3MOCA 1EJMA 1NU7B 3RXFA 2A5KA 4BAKB 1TPAE 2WV4A 2QC2A 4WMDA 3EGKH 2FOCA 2GV7A 4Y79A 4UEHH 1DWCH 3E16B 1W3CA 2I6QA 1QQ4A 3A8BA 1A46H 2NU0E 5HMAA 4R8TB 1Y3UA 1W7GH 4FU9A 4X2YA 1TMBH 1QB1A 1A4WH 1QBVH 1WUNH 4B74A 5GPIB 1ZYOA 1GI8B 1O3HA 3ZZ4A 3OY5U 4K8BA 1O31A 1A5HA 1C2EA 1NRNH 1DX5M 1ESAA 1K1MA 1B7XB 5JDUB 4E06H 1V2LT 1HAHH 4YTAA 4UONA 6ESTA 2BD8A 1EOJA 1GBAA 4X8TH 1P8VC 1H9LB 1Y5BT 1TIOA 1WAYB 2ILNA 3RXAA 1AB9B 4ZKRU 1XUFA 2ZHWH 1MD7A 4GCHG 3ZVAA 2H6MA 4I8JA 1UVUH 2FP7B 3BTGE 1EP6A 4Y7BA 4X6OA 1C2MA 2XW9A 1ZSKA 3A7VA 4VGCB 3P95A 1O2OA 1C5ZB 2SGAA 1C4Y2 2OCVB 3BTFE 2FXRA 2AFQB 1J15A 3M3VA 3P8FA 1C1TA 1C5QA 1V2VT 3HATH 2O9QA 5EQQA 5EPNA 1O3BA 1NS3A 2O8WA 4ZKOU 3HKIB 1O2RA 2VB0A 2FOMB 2ZCKP 1NFXA 4AFZA 1FUJA 9LPRA 3LKWA 2ZHDA 4CRFA 2NWNA 1GMCG 3E90B 3N7OA 3UR9A 2AMDA 1AVGH 1XVMA 4VGCC 1TA6A 3FZZA 5C2ZA 1EPTA 4MPXA 1QJ6B 4O3UA 1XUKA 2P3TB 3URCA 2UUKB 1OWHA 3RMLH 2FLRH 3E6PH 7KMEH 1HBTH 3SNDA 1P03A 1KXCA 1RTLA 2QAAA 1MTNC 2A7JA 4NWKA 4YT6H 5DJ7A 3QTVH 1J9CH 2WPKS 3AASA 4TYDA 2EI6A 1GJ6A 2ZU4A 5E2PA 1OWIA 4YESB 3EAJA 1K1JA 1SB1H 2QY0B 4NIYA 2V3OH 3F9GA 1MU6B 4K69A 1Z8RA 3MNBA 5AFZH 1O38A 2GD4B 3RC5A 1AE8H 3KEEA 1FZZA 5EPYA 1C1OA 1AMHA 3GDVA 2D26C 5HYOA 1GBCA 1GHBF 1WQSA 1IOEA 2ZHFH 1K1NA 3EA9A 1Q2WA 1GBHA 1TFXA 1TLDA 2ZU1A 5FPSA 4CRGA 1V2WT 3MH5A 1N6XA 4DW2U 1LKAA 3SU0A 1O2IA 1GCTB 1T7CA 2XYAA 2O8LA 1IQGA 3IWMA 1G9IE 3K65B 1V2ST 1CGJE 3RXQA 1WV7H 4JCNA 1V3XA 4OS4A 1S84A 1TGBA 1Z7KA 3SU3A 5JBCS 5PTPA 3KN2A 1FY3A 4YOIA 3H7OA 1BUIA 3QZRA 4NCYA 3RU4E 3ZVFA 2AIPA 4BXWA 3E91A 3PWCA 2KAIB 2PW8H 1TE0A 4OS6A 3GCTG 4I7YH 4MG3A 2Q1JA 8ESTE 4D9RA 4XSKU 2H9EH 1E38B 3QN7A 1ZHMA 2G5VA 1BTYA 1QCPA 1P57B 1TNKA 4LZ4B 4KTUA 4E05H 1P2IA 1RJXB 1BCUH 3U8OH 1TPPA 2XWBI 4A7IB 2D1JA 1KTSB 1KXEA 2FS8A 4X2VA 2ZQ1A 1ABIH 4FUEA 1DWEH 3RMOH 1UTPA 3TJUA 1WTGH 4ABDA 3MMGA 1GHXH 1AIXH 1NRQH 3GISB 3TNTA 3U9AH 4X1NU 5FAHA 1HNEE 2CF8H 1NRRH 3A83A 1S83A 1C9TA 2V35A 3MI4A 1OP8A 1P05A 4JZEH 2TRMA 1O5FH 1TA2A 3VXFH 2HPQH 1LQDB 2ZI2H 3WY8A 2FTMA 3MU8A 4OS1A 8GCHF 2GP9B 2OC0A 1MKWH 1O2JA 2PSYA 4X2WA 4Y71A 5GJ4B 1EKBB 4Y8YA 1CHGA 3ZZ5A 1SQOA 3LPRA 2WYGA 1A7SA 1BJUA 1HAIH 4JZIA 3STIA 1SGEE 4KKDA 1DWDH 2QV1A 4CR5A 1O2VA 1Y3YA 5LGOA 1NESE 1NFUA 2ZA5A 2AMQA 2Y81A 1GJBB 4LXBH 5C1XA 1W10U 2QYIA 1RIWB 4Y7AA 3F9HA 1MH0A 1JXPA 1UTLM 1XXFA 1SQAA 1UTMA 3C1KA 1MTWA 1ZGVA 2J4IA 1LHCH 2FX6A 1ARBA 1Y3WA 2F3CE 2BLVA 1O2UA 1BBRE 1ZHPA 1K28D 1IQHA 1HGTH 1O3DA 2IPHA 2ZU3A 3ZZ9A 2R2WU 4AG1A 2ZF0H 2BD5A 3GYLB 3S7KB 1IQIA 2Z3EA 3LGVA 4JYUH 1NY22 4XBCA 1EZQA 1OS8A 3LONA 5EODA 1BBRK 1Z8GA 5FCRA 3L3TA 1GJ5H 1O2TA 4X8UH 1EX3A 2SNWA 5A0AE 3MFJA 2VH6A 2PGBB 1ZTLA 1V2JT 2P8OB 1PQAA 2TBSA 4GLYA 3U69H 2K1QA 3NXPA 4ZHAA 1DLEA 3SJKA 1UK3A 1K21H 4R0IA 4INKA 3HK6B 1AZZA 1FN6A 3PLPA 1SLVB 1AO5A 3GDUA 5ESTE 1YCPK 3QK1A 2VWNA 1SGFG 1RD3B 4INLA 1H4WA 1RXPA 1UTJA 2P8OC 1GJ9B 1UVOA 2OBQA 3JZ2B 1FI8A 3S7HB 1EAWA 1QURH 1P3CA 3Q3XA 4WY3A 5LPRA 3GYMA 3M37A 1ZTKA 3OY6U 3EYDA 2NU4E 3TGIE 2ZFSA 1O3NA 1BTHH 1NRSH 3TGJE 3P8GA 1NU9A 1O2MA 1TX6A 5A0BA 1RTFB 3DHKH 1GVLA 3LU9B 1OWDA 1C1PA 1GBIA 1G3CA 1SLXB 2BX4A 3RXKA 3LH1A 1LVYA 3A7TA 1C5PA 2ZO3H 1NRPH 3VB4A 2C4FH 3ATWA 5AFYH 3P8NA 1LKBA 4ISIH 1T8MA 1C5UA 1TRMA 1QFKH 4X6MA 1EP5A 1O3LA 2JKHA 2ALPA 3ZVBA 4B2CA 2SNVA 3PM3A 3M35A 4UFGH 1HJ8A 3RLYH 4CRDA 3PV4A 2J92A 3QZQA 1A0JA 1K9OE 3F1SB 4YOJA 2XC0A 1TWXB 1ELEE 1QIXB 2HRVA 1CE5A 3ZVCA 1YBWA 1BT7A 4E7RG 1O30A 1T8LA 2ZTXA 3UPEA 3TU7H 2RA0A 4MPWA 1AKSB 5DP4A 4AN7A 2FLBH 3A88A 3A8DA 3HKJB 3E0PB 2SGEE 1SOZA 2ZPRA 2ZGXH 1UHBA 3VGCB 1LDTT 1HRTH 1C1NA 1PPFE 2XBVA 1CA0B 1QL7A 2BB4A 3LIWA 4KELA 4X6NA 2HOBA 3SV8A 2FOBA 1SLUB 3RLWH 1QRWA 1C2JA 4I8GA 3O8RA 3U98H 5JPMH 1VR1H 1UK2A 2P93A 1NFWA 5E8EH 2XC5A 2ZG0H 2BZAA 4Y11E 3UQOA 1IQMA 2W7UA 2BY9X 1DUEA 5A09A 1AVWA 1O3MA 1TOMH 1Z71A 2ZHEH 1QBNA 2G81E 3LGIA 4ABEA 1JBUH 4IGDA 3LJJA 1KXDA 1C5WB 3SNBA 3Q3YA 1J17T 4GAWA 1CA0C 1ELVA 5DP3A 2ZGHA 4MDSA 1W13U 1FQ3A 1PPBH 2VNTA 2WV5A 1BMNH 1SGIB 5GCHF 1D3DB 2A2XH 3UUZA 2CMYA 4B71A 2A2QH 4X1RU 1G2MA 1UO6A 1NROH 1TAWA 2VIVA 1C2HA 3KQBA 3RXMA 2BHGA 4NSVA 2STAE 2LPRA 1IAUA 4NA9H 2ZHQH 4X2XA 5F8XA 1D6RA 2UUJB 4X1SU 1WU1A 3A8CA 4U2WA 1XKBC 2OINA 3RC4A 1GDUA 2YNBA 1NFYA 1BTXA 1HXFH 4K8YA 1Z6JH 4Q7ZA 4DIIH 1O3OA 2VH0A 2BDHA 4MVNA 7ESTE 3KQDA 1UCYE 4FUCA 4D8NA 3AW0A 1BOQA 5L30H 1JIMA 1HJAB 1DVAH 1O37A 1QNJA 4KP0A 1UCYK 1QGFA 5A8XA 1SHYA 3MU1A 1OWEA 4WF8A 4YO9A 4ABGA 1TYNA 2WPIS 1T4VH 4CRBA 3TGKE 3MTYA 4DY7B 2CF9H 3RM2H 1C2GA 2ANWA 1G3BA 1CGHA 4RKOB 2ZEBA 3VB7A 2W3IA 1DY9A 1QRZA 3MO3A 2PKSC 2GCHF 1KSNA 1PQ8A 2Z6BD 3QLPH 5EXLA 2NU2E 1W12U 2PR3A 3SQEE 1HJAC 4Y0ZE 1TBRH 3TVJB 1Q3XA 2VIOA 3SNEA 1SGTA 1ETRH 3V13A 1GCDA 2BY5X 1S0RA 2PHBA 1QB6A 1BRBE 1TPSA 5LH8A 4BXSA 4MTBA 1P12E 4RKJB 1HYLA 5C3NA 1SVPA 2BYAX 1W11U 1Z8JB 5L6NH 1EUFA 1G30B 1VGCC 1SPJA 2BM2A 2H9TH 3NUMA 5C67A 3TJVA 3RDZA 2G55A 1K1OA 1BDAA 1QY6A 2UWOA 4MLFB 5FHTA 4ISOA 2G4UA 1L4ZA 2F9OA 1YPGH 4IS5A 1KYNA 3SJ8A 3GOVB 3NCLA 2FOAA 4Y76A 2QXIA 3UWIA 3PLKA 1SGFA 2BX3A 4ABFA 4D7FA 5DO4H 3MO9A 3T27A 4IMQA 4DG4A 1AD8H 1GBLA 4BAMB 1VITF 4YOGA 2Y5FA 4DJZB 1D9IA 3V7TA 1MBMA 1BTUA 1WTHD 2R0LA 4RN6A 2FEQH 1ARCA 2CN0H 3RXHA 1ZMJA 1RGQA 4NIXA 1DT2A 5F8TA 4IBLH 4GHTA 1K22H 1GI9B 3TLOA 3MNSA 2FO9A 1P2JA 3E1XB 1HJ9A 2H5CA 1L1NA 2FDAA 3ENSB 2Y7ZA 2DE8A 2RG3A 2ZDMA 2V0BA 4TPIZ 3RMNH 1Z6EA 1DLKB 3W95A 1Z8IB 1BQYA 2Y6TA 4NIVA 4ABAA 1BBRH 5B6OA 3M3TA 1W0ZU 4WVPE 1TALA 1O3FA 1JMOH 1SSXA 1KDQB 3U1JB 1DITH 3S9AA 5L2YH 2P59A 2F9NA 1W7XH 4INHA 3SI3H 1FNIA 1ELFA 3SU1A 1AI8H 4NZLA 1P01A 5EOKA 4ZHMU 1BTPA 1MTVA 2A7CA 2ASUB 3PB1E 1C4U2 4ISHH 4MPUA 1GHBG 1O2XA 3EE0B 3SGAE 1A1RA 3UIRA 2ODQA 2FS9A 2BOHB 4XBBA 3SUEA 1YCPH 1P2QA 1V2OT 1SR5C 4FU7A 2PTNA 1X7AC 3ELAH 4CRAA 4Y10E 3BIUH 2W3KA 1ELDE 1L2EA 1IHTH 1HAVB 3BSQA 4MNVA 3D65E 3RXIA 3SQHE 2FM2A 2XCFA 4LOYH 1E0FD 2P3FH 1EXFA 4AZ2B 3PMAB 1C5YB 1P11E 2ZPSA 4J1YA 4JK5A 5EGMA 2BY7X 3KL6A 4F49A 4UE7H 1ELBA 3A87A 3UQVA 3PWBA 3UR6A 5L2ZH 4PROA 4ABBA 4J2YB 4I8KA 3KIDU 3E8LA 4YLQH 1G3DA 1MTNB 3PO1C 1V2NT 4DIHH 3A85A 3ZV8A 3BTDE 1TNLA 1LHFH 3GY8A 5ABWA 1Z1JA 1FDPA 2THFB 4M7GA 1AY6H 4Z6AH 4Y8ZA 1PQ5A 1LTOA 3OTJE 1W8BH 2BXTH 3EDXB 2ANMH 1A5IA 5DP7A 2GT7A 4AX9H 1O5DH 3LOXA 2BZ6H 3T62A 4ZHLU 2FESH 1Y5UT 3SW2B 3A7WA 3K6YA 1C1VH 1OP2A 1O2GH 1CHOG 1WBGB 3P8OA 4WMFA 4B73A 1QA7A 1SLWB 2FOFA 2H9HA 1SMFE 3TH3H 1C2KA 1ELAA 2GMTB 3C27B 1XUJA 2FI4E 4MPVA 1F5LA 3D23A 2PKAA 4A5TS 4CH2B 3S9BA 3ZZAA 1UVTH 2QXGA 1CT2E 2PTCE 2ZWLH 2SFAA 1G37A 1K2I1 2ZDKA 1GI7B 1AUJA 1G3EA 4YLUA 1KXAA 3QO6A 8GCHG 2OC8A 4HTCH 2V3HH 2C3SA 1Y5AT 4OS7A 4BTTB 3Q3KA 4ZAEA 1DUAA 2BDIA 1SOTA 8KME2 5ESBA 3SV9A 4NWLA 3M5LA 3A7YA 1MTUA 5G4BA 4A1TA 2GMTC 3OSYA 4X0WU 1GG6C 1E34B 4NA8A 3TITA 3ZYDA 2FMJA 3VB3A 3NZIA 1O2KA 4YM9A 3SV6A 1O2PA 2ZFPH 3BTWE 5LPEA 2BVSH 1ZPZA 4FUDA 1BTWA 4JMYA 1O2WA 3MO6A 2SGQE 4E7NA 1EASA 1O3IA 3B23B 2QF3A 7GCHF 3A7ZA 3GY2A 2VWLA 1BIOA 2D8WA 1TNHA 1PPGE 3DUXH 3F68H 2ZCLP 4K3JA 2OLGA 2FODA 4H42U 4ZUHA 3H5CB 1TBQH 1NZQH 1CA8B 5A8YA 1AHTH 1F0SA 2DE9A 2UUYA 1FIZA 2OD3B 3L6PA 4XFQA 3R0FA 2BOKA 1O5AB 5J4QA 2Q6FA 1HFDA 3RC6A 1EB1H 1KIGH 2IOTA 2A4QA 2BDCA 3BF6H 2XNIA 1GHAF 2TPIZ 1EJAA 1QHRB 1QB9A 2UWLA 1ANEA 1UCYH 5DKMA 2BD4A 1C5OH 1E37B 3P17H 2ANKH 2J9NA 1V2PT 3HGNA 4UFDH 3ZVEA 1JRTA 3IITA 4CBOA 1SQTA 2G51A 1BRAA 1GGDC 3STJA 2Z9JA 4ABJA 5E0GA 1VITH 1CT4E 3ZZBA 2Y82A 1O2QA 1GDQA 1MU8B 3SHCH 1ZPBA 4WXVA 3UNSA 1XUHA 5E0JA 1P0SH 4AGKA
chains in the Genus database with same CATH superfamily
4GVUA 1YCPM 1GHVH 3A82A 1QTFA 1LVOA 1ZZZA 2UUFB 1MCTA 2ANYA 2FIRH 2VWMA 3DSOA 5TCAA 2A32A 1TGNA 1C5MD 1Z1IA 2BQ7B 4AB9A 3BG8A 3BTME 1ANDA 1AZ8A 1KLTA 2EI7A 6LPRA 1NPMA 4CHAB 3KQEA 3U1IB 4JZ1A 1OYQA 2ZDNA 2JIZD 4HGCA 3F0PA 3BTQE 1TNGA 1YPMH 1ANBA 3PMHB 2A31A 1IQEA 1GL1A 1D3QB 5LPFA 3RP2A 1S6HA 1F0UA 1PQ7A 3KCGH 1L4DA 1Q31A 3BTTE 4OM9A 3SBKA 2AGGX 2YMSB 1NTPA 2R3UA 4UDWH 3RXPA 3B9FH 3RU4T 3M7UA 1GBFA 4SGBE 1WYKA 3P6ZB 1YKTA 1ZR0A 4NFEA 1XXDA 4DOQA 1YC0A 2ZGCA 2FI5E 1PYTC 2A4OA 3LGUA 4NFFA 1C5TA 5T6FA 2XBXA 1N1LA 4CHAC 3P92A 1ZMLA 2L74A 3M5MA 1FY1A 2FOEA 4XE4A 5DP6A 2XNDD 4D7GA 2Z94A 1GL0E 4ZKNU 2QXHA 1AQ7A 1B5GH 4ZXXH 2A0QB 2YMSC 1HAXB 1NM6A 4K5ZA 3EQ0H 2BXUH 2AH4X 3Q00A 2ZIQH 4THNH 5B6LA 2J5UA 1BRCE 2Q6GA 3SUFA 9ESTA 5C0TA 1PJPA 4FUHA 1FJSA 1GBTA 1O3EA 2EA3A 2XWAA 5CMXH 1F5RA 3R3GB 1D6WA 3HPTB 2C8WB 4I31A 1C2DA 2P3UB 1C2IA 5IYTA 2WHXA 2ZFRH 1D4PB 5C1YA 1DDJA 3U8TH 2GDEH 1FN8A 1LVBA 3HGPA 1FY4A 4FOUC 4WXIA 3FFGA 1HXEH 3SU2A 1ABJH 4M9FA 4FUJA 4B1TA 2Y5HA 4Z1MD 1BITA 1EZXC 2KAIA 1OP0A 3BTEE 5AF9H 5TCCA 1ACBE 3L33A 1S81A 4TWWA 2TIOA 3I78A 1DM4B 4X8VH 5FBIA 4ZH8A 2C8YB 2BTCE 2XBWA 1MCVA 2QN5T 1DE7H 3IG6B 1AE5A 1Y3VA 2QGRA 3BEIB 1HIAB 3P70B 1GHWH 2XCNA 1YLNA 1GBKA 4WWYA 4I8LA 5T6GA 3TH2H 1ZOMA 1DWBH 2GGVB 1LMWB 2ZDLA 2VU8E 4F55A 3QGNB 1UVPA 1GMDG 1OX1A 1N6YA 3RXEA 3ATLA 4ESTE 2L6OA 1ZJKA 4UFFH 1TQ7B 1OPHB 1VCQA 3ESTA 3SORA 5SGAE 1O2HA 2KCPA 6GCHG 3Q76A 1T31A 1SGRE 1P09A 1CU1A 1GHYH 4FUFA 3GDSA 3BEFB 1XMNB 3GY7A 5FL7D 1V2KT 1LCYA 2XTTB 3RXCA 1TGCA 2GCHG 1N8OC 4FXGH 4XD7D 5CDFE 5A2MH 5GXPA 1V2MT 4JYVH 3LGWA 1ANCA 4GSOA 1C9PA 3M61U 5AVDA 3UTUH 3SU6A 1SC8U 1G2LA 3G01A 2EY4C 2YNAA 1PFXC 3A89A 2FTLE 1ELGA 4A92A 4HG6A 2TGPZ 1DOJA 3RU4D 5FXLA 1MZDA 1TONA 2VIDA 2UWPA 1NC6A 5IDKA 1LHDH 3S0NA 3RXOA 3KF2A 3MWIU 2ZC9H 2PV9B 3TJNA 2BDAA 1THPB 3PLBA 1T4UH 3PMJA 2PUXB 4OGYA 1G36A 3TK5A 1O3GA 3ZVGA 5EW1H 3GS9A 1TX7A 1C5SA 3T2NA 4YT7H 1A61H 3MH6A 1PPHE 3UB0A 3OEED 3B8JA 1XUGA 2ZP0H 1LPKB 4U01A 1GBDA 3T26A 1NN6A 2DUCA 3GY5A 2W6JD 1MQ6A 1TRYA 2GX4A 1F0RA 3OAAD 1C4V2 1NBMD 3MHWU 1UTQA 3QGJA 4GPGA 1RFNA 1ZRBA 3N99A 1MAYA 1VCWA 4MNWA 3DFLA 1FXYA 2BY6X 1S85A 2PKSB 2J38A 4MQAA 5TJXA 1XM1A 4AC9A 2HLCA 2FZZA 2VIPA 4A6LA 4ZKSU 5FPYA 1EB2A 1EZUC 3U8RH 4XRNA 2PGQB 2A7HA 4O3TA 1GPZA 2ULLA 1PPEE 2KCAA 2B9LA 1Y59T 3GCHB 3TJOA 2WPHS 3TPIZ 1DY8A 1GI0A 1QBOA 1H8DH 3K9XB 4DURA 4H6TA 4ISLA 1KY9A 2ZKSA 1VGCB 3MU4A 3F9EA 1CSOE 1THSH 4X1PU 2HPPH 2BLQA 1YP9A 1BMAA 3RXLA 1BRUP 3D62A 3Q77A 4QT8C 1JWTA 3ZZ7A 4AG2A 4K1TA 1FX0B 1SGNE 3PROA 2PUQH 4FVDA 2LNCA 3D49H 2WV9A 3F3BA 2HVXA 1C5LH 1MD8A 1ZTJA 3GCHC 5GDSH 1TB6H 1YPJH 3ZZ6A 2C90B 2B7DH 4I33A 3AW1A 3ZZDA 1O2NA 1QA0A 1VZQH 2BDBA 3K2UA 2SGPE 2AERH 4WJG2 3RXVA 4BTUB 2Z9KA 2J2UA 4CRCA 1QRXA 1W14U 2CJIA 1AWHB 1AKSA 1RTKA 1LPGB 4KTCA 2GTBA 1EPTB 1IQNA 4FUIA 3QX5H 4Q7YA 3RXTA 2F83A 5EXMA 1C1UH 1F2SE 3UNRA 4ASHA 2ZU5A 3BG4B 1OYTH 1SBWA 3SO3A 1GI5A 1XX9A 2F43B 1MZAA 1ZLRA 1GBEA 2KX4A 4AYVB 1SG8B 1AFEH 2PFEA 1O32A 1DS2E 1TMTH 4I86A 1LQEA 4TY6A 5DP9A 1SGPE 1GJ7B 3LC5A 5C94A 3FANA 4I32A 4O9VA 1C2FA 2AIQA 3KNXA 1V2QT 2JJ2D 2P16A 1ZPCA 1O3KA 5F6MA 5KGOA 3I29A 4A1XA 1O33A 2W6ID 2ZTZA 1O34A 3RXDA 3FZDA 2AYWA 1EPTC 5A8ZA 1IQFA 2BQWB 1GI1A 2C8ZB 4O97A 3QTOH 1LVMA 2J94A 4K60A 1FPHH 3VB5A 5FX5A 5EQRA 1QL8A 3BTKE 3BG4C 2WPJS 3CENA 3PRDA 1GJDB 1XUIA 2D2DA 1MMJN 2WUBA 3O8BA 3MH7A 3RXRA 3JZ1B 3SGBE 3FP8E 1VJ9U 5JB8S 1XVOA 1OSSA 3MU0A 1WCZA 3M36A 3M7QA 4XOJA 1E1QD 5BPEA 2HGTH 4YZUA 1P3EA 2TGAA 3AAVA 1G32B 3SHAH 3PTNA 3SU5A 1MBQA 1T8NA 3OEHD 4MNXA 1J8AA 1P10A 3SOSA 3K6ZA 1GBMA 1DFPA 1GI6A 1O2YA 1GHZA 3MYWA 5F53A 1Y3XA 3PO1B 3RXJA 3AVZA 1B0EA 3TH4H 4AOQA 1TRNA 3PTBA 1C5XB 5AHGH 1SGCA 2JH0D 1IQKA 3FAOA 3RXUA 2AHME 2VGCC 2ZGJA 2ZZUH 2GZ8A 1CT0E 2HNTE 3GY3A 3FP6E 1P9SA 4Y6DA 5CHAB 3M5NA 5DP5A 3V0XA 1O5BB 4AFSA 1THRH 1TX8A 5E2OA 5FCKA 1ELTA 3OTPA 1FAKH 2ESTE 1EATA 3F2HA 1UK4A 2LP6A 7GCHG 2XXLA 1ESBA 1EZSC 4WMEA 1C1SA 2XBYA 2STBE 1FAXA 4D9QA 4P00A 2IJOB 3QUMP 3PMBB 3MU5A 1WDIA 3LDXH 4BAHB 1GMHF 1JOUB 2WPDD 3CS7A 1KTTB 3SNAA 3RXGA 1O35A 5T1VA 4DCDA 1BTZA 1YLDA 1EQ9A 2P94A 5CHAC 4Y8XA 2F9PA 2QXJA 4KTSA 1A5GH 4LZ1H 1C1RA 2ALVA 1MAXA 2VWOA 2B8OH 1MTSA 1SGYE 4WH8A 1GHAG 2G52A 1QJ7B 4AB8A 1TGSZ 4NIWA 3VEQB 4FUGA 3I77A 1AB9C 5HM2A 5JBTA 1TGTA 1GBBA 1KLJH 4AYYB 2FX4A 5EJZA 3SNCA 1MKXK 1LO6A 2R0KA 4U32A 1J14A 1OOKB 1D3TB 1GG6B 3SV2H 1EAXA 4K1EA 3F2GA 2BY8X 4TSFD 2FYQA 2M5TA 1HAZB 2RCEA 1GBJA 3SJ9A 2B5TB 3QDZB 4IC5A 2HNTF 4CR9A 2HNTC 2J34A 4B76A 3BV9B 1C1QA 8LPRA 5HXFA 1H1BA 4U30A 1A3EH 1BZXE 1SFIA 2FOHA 3ATIA 1AWFH 1O36A 1Y8TA 3OYPA 4B2BA 3A86A 4Q4LA 3UNQA 2WZQA 1GDNA 3H7TA 1P2NA 2Q6DA 4X8SH 3LT3A 3LGTA 1FY8E 3MQKC 2H1UA 3MH4A 1W0YH 2ZPQA 5EG4A 1DANH 1F0TA 1V2UT 3F9FA 4ZMAH 2AEIH 4OS2A 2OBOA 4OGXA 1BMMH 5DGJA 2O8TA 5JBBS 4FUBA 2VVCA 1GJ4H 1C5VA 3SU4A 1AGJA 5F8ZA 1SHHB 2O8MA 1SL3A 1UVSH 4UD9H 2SGDE 1YYY1 2VVUA 1KDQA 1V2RT 3BTHE 4JYTA 4KGAA 2V6NA 3O8DA 3QWCH 5GWZA 3MNXA 3ATKA 4GCHF 2BQ6B 2VIWA 1DICA 2W5EA 3KYFA 1BJVA 3E0NB 2R2MB 3CS0A 4I8HA 4CREA 2A5AA 4BOHA 1GGDB 1QR3E 1CO7E 4IMZA 1K0HA 3V12A 3DT0H 1TNIA 2OC1A 2AS9A 3ODFA 2WINI 1ZSJA 3SV7A 3UOUA 1WQVH 5I46H 1GI3A 3SUDA 2AMPA 3SZEA 1ETSH 4Z0KA 1O3PB 5KEDA 3M5OA 3BN9A 5GNDA 3ZZCA 1HAVA 1BHXB 1YLCA 1YF4A 2CK3D 3T28A 1GCTC 1F7ZA 1BB0B 1GMCF 1ORFA 1ZSLA 5EXNA 1GI2A 3VXEH 1T8OA 2ODYB 4X1QU 2Y7XA 5F03A 2BLOA 1CVWH 3GY4A 4WH6A 3S69A 2F91A 4BTIB 4X6PA 4RSPA 1NO9H 2BVXH 2FI3E 1HB0B 1E1RD 4NG9H 3NK8A 2ZCHP 2JETB 1TNJA 5I25A 1MQ5A 5EW2H 4ACAA 5GIBA 1O3JA 5BRRE 1CHOF 1OXGA 5HM9A 1TQ0B 1HAGE 1BMFD 1HCGA 2A5IA 3F6UH 3VFEA 2V7QD 1BHXF 2KM0A 1GJCB 4B75A 4JZDH 3VPKA 3M7TA 1QQUA 1RS0A 2TGDA 3OFND 1BA8B 1EOLA 4GUXA 4DGJA 4DT7B 3T5FH 2CV3A 5JYIA 2Y80A 1HAPH 2OUAA 2QCYA 2A45B 4ABIA 2RA3A 1IQLA 2GJGA 2JETC 1U6QA 3OU0A 5H4IB 1F92A 1ELCA 1UHBB 1GJ8B 1YPLH 2XRCA 1WXRA 2RDLA 1SI5H 1HV7A 1O5GH 2BMGB 2TGTA 3KHVA 1OWKA 5DG6A 2YOLA 1TABE 3O8CA 3FVFB 1E35B 3SN8A 4BAOB 1TOCB 1YPHE 2XC4A 2WUCA 1UMAH 3RXSA 3T25A 5EIYA 4F4OC 1UTOA 1CBWB 1UTKA 4DVAU 1GVKB 1AVXA 4NA7A 1NT1A 5IK2D 1FIWA 1TBZH 2AGIX 2NU3E 2G00A 1VCPA 4K2YA 1FPCH 3EA8A 1P06A 2EC9H 2Z7FE 2CGAA 4ISNA 3DCLA 2O8UA 1J16A 2FOGA 2K8IA 5C17A 1EAIA 4BAQB 5K7RA 2QA9E 4HI3A 2PSXA 2VVVA 3GCNA 5C1UA 3GCTF 1P2MA 4JZFH 3FKSD 3LH3A 3ZZ8A 3V3MA 2A4GA 1UTNA 1O39A 5K0HA 1CBWC 4LK4A 1SGQE 1LPZB 1A0LA 1RIWC 4FVBA 1P04A 1GWAA 1WSSH 1JIRA 4B6FA 1ZHRA 2OTVA 1XKAC 1FMGA 2HWLB 2H5DA 6CHAB 3KGPA 4FU8A 1B0FA 5JB9S 1ZGIA 1O5EH 5FPTA 1AUTC 1GVZA 1QL9A 1WOFA 4NGAH 5GCHG 1ZMNA 4IN2A 1VJAU 3EA7A 3NPSA 4MNYA 1L1GA 3SZNA 1P02A 3TK9A 1FONA 1A3BH 3SGQE 2OC7A 2Z9LA 2ZFQH 1YPHC 3PYHA 3NKKA 1EAUA 4TY7A 2NU1E 2ZGBH 4AGJA 1HAOH 5EJLA 4O03A 1GJAB 1IHSH 6CHAC 2W26A 2J95A 2R9PA 1N8OB 4Q2KA 2OQUA 2M2AA 4HZHA 1FY5A 1C5NH 1D3PB 1LHGH 3RMMH 2BD7A 3W94A 2G8TA 1A2CH 3KQ5A 2C93B 2FYRA 3DD2H 1OKXA 2ZFFH 1AU8A 2GZ7A 5C5NA 3H09A 4BNRA 1DSTA 3BIVH 3SI4H 1UW7A 2GT8A 3A81A 4Y0YE 1HUTH 1PPCE 5CE1A 3CNRA 3FOAA 2WPMS 5T3HA 2G5NA 1YWUA 2ZDAH 1KXBA 1DSUA 4JK6A 2Y5GA 2R3YA 4IW4E 1YPEH 2ZECA 1H9HE 1O3AA 1A0HB 2P95A 5HIZA 3GCOA 1MKXH 3ODDA 4ACBA 5T6DA 1O0DH 3ITIA 1INCA 2B0FA 3F0OA 3ZIAD 3ZVDA 3S9CA 4TPYA 2VJ1A 3VB6A 1T32A 2QF0A 2BD2A 4CH8B 3GICB 5FBEA 3KQCA 2G4TA 1HAYB 3AAUA 1SFQB 3KYGA 4H6SB 1TMUH 3E3TA 3W1EA 4NSYA 7LPRA 5DSFA 1GI4A 5C20A 2J98B 1YPKH 1O2SA 2QIQA 1PYTD 4F48B 1DXWA 2ODPA 4CBNA 1JRSA 2EEKA 2ZQ2A 4XBDA 5J4SA 4GHQA 3UWJH 4Q7XA 2F9UA 1KXFA 2ZNKH 1ETTH 5A0CA 1HLTH 3DA9B 5DP8A 1HDTH 2OXSA 3VGCC 3LGYA 4Q80A 3TK6A 4A1VA 4OS5A 4UFEH 2YMSD 3TNSA 2SGFE 4HFPB 3UOPA 3DFJA 1VITG 2EI8A 4D76A 4H4FA 1FLEE 1P9UA 3A8AA 4IC6A 1K1PA 5EU8A 2A1DB 1V2TT 3UREA 4K1SA 2AGEX 2C8XB 5EQSA 1AFQB 1RRKA 2Z9IA 3UFAA 1CGIE 1KLIH 3A7XA 1O3CA 4AFUA 2IN2A 1YM0A 3NWUA 2F9BH 2BLWA 1IQJA 1C1WH 4XDEA 1DXPA 2VIQA 1S6FA 5E0HA 1BMLA 2Z3DA 1GMDF 2BDYA 3UY9A 1L1JA 1YY3A 1O5CB 2I6SA 2BDGA 2BVRH 1E36B 3ZYEA 2GKVE 1K1IA 1MUEB 2GZ9A 5ETXA 3A80A 1SGDE 3CP7A 1HIAA 2HALA 1AFQC 1ID5H 6GCHF 1CQQA 2JH5D 2ZTYA 3MNCA 5C5OA 1P2KA 1F5KU 2ZFTA 1QJ1B 2GCTB 3RM0H 1C5RA 2JH6D 5DPAA 1HPGA 3SJOA 2BD3A 2KCYA 4AORA 1V6DA 1O2ZA 1P2OA 4NZQA 3SUGA 4TT3D 2CHAB 3TIUA 3A84A 2Z9GA 3PV5A 3GY6A 1ZJDA 3BEUA 4AFQA 1ESTA 3WWFA 2PLXA 1S0QA 2GDDA 1MKWK 3OX7U 1K1LA 1H9IE 1OWJA 2A4RA 2WYJA 4BANB 1FV9A 3FP7E 5HGGA 2H2ZA 1EJNA 2GCTC 5FX6A 1C1MA 2VINA 4ZROA 4ABHA 1GMHG 3M3SA 1C2LA 2CHAC 1UJ1A 2W7SA 2CXVA 2QF4A 2OQ5A 2RDEA 4SGAE 1AN1E 2PWXA 1H8IH 2FPZA 3RXBA 3URDA 2PKAB 2F9VA 1DPOA 1M9UA 2GV6A 3LJOA 2ZDVH 3ZZ3A 5DK1A 2FWWA 1L0ZA 1S5SA 1W2KH 2ZU2A 2WPLS 4B2AA 3SJIA 2Z3CA 3ATMA 3WWBA 2OP9A 4IN1A 3LC3A 1O2LA 3UAIC 4RT0A 4ZXYH 4TWYA 3HK3B 2BD9A 1S82A 3RUOA 2GVFA 3OE7D 3ZV9A 1YGCH 2J97A 5JBAS 1LHEH 1TPOA 1PPZA 3T29A 2VGCB 1ZRKA 3MOCA 1EJMA 1NU7B 3RXFA 2A5KA 4BAKB 1TPAE 2WV4A 2QC2A 4WMDA 3VG8A 3EGKH 2FOCA 2GV7A 4Y79A 4UEHH 1DWCH 3E16B 1W3CA 2I6QA 1QQ4A 3PRBA 3A8BA 1A46H 2NU0E 5HMAA 4R8TB 1Y3UA 1W7GH 4FU9A 4X2YA 1TMBH 1QB1A 1A4WH 1QBVH 1WUNH 4B74A 5GPIB 1ZYOA 1GI8B 4ZCNA 1O3HA 3ZZ4A 3OY5U 4K8BA 1O31A 1A5HA 1C2EA 1NRNH 1DX5M 1ESAA 1K1MA 1B7XB 5JDUB 1W0JD 4E06H 1V2LT 1HAHH 4YTAA 4UONA 6ESTA 2BD8A 1EOJA 1GBAA 4X8TH 1P8VC 1H9LB 1Y5BT 1TIOA 1WAYB 2ILNA 3RXAA 1AB9B 4ZKRU 1XUFA 2ZHWH 1MD7A 4GCHG 3ZVAA 2H6MA 4I8JA 1UVUH 2FP7B 3BTGE 1EP6A 4Y7BA 4X6OA 1C2MA 2XW9A 1ZSKA 3A7VA 4VGCB 3P95A 1O2OA 2EQNA 1C5ZB 2SGAA 1C4Y2 1H8HD 2OCVB 3BTFE 2FXRA 2AFQB 1J15A 3M3VA 3P8FA 1C1TA 1C5QA 1V2VT 3HATH 2O9QA 5EQQA 5EPNA 1O3BA 2OK5A 1NS3A 2O8WA 4ZKOU 3HKIB 1O2RA 4YXWD 2VB0A 2FOMB 2ZCKP 1NFXA 4AFZA 1FUJA 9LPRA 3LKWA 2ZHDA 4CRFA 2NWNA 1GMCG 3E90B 3N7OA 3UR9A 2AMDA 1AVGH 1XVMA 2HLDD 4VGCC 1TA6A 3FZZA 5C2ZA 1EPTA 2JJ1D 4MPXA 1QJ6B 2QF5A 4O3UA 1XUKA 2P3TB 3URCA 2UUKB 1OHHD 1OWHA 3RMLH 2FLRH 3E6PH 7KMEH 1HBTH 3SNDA 1P03A 1KXCA 1RTLA 3WW7A 2QAAA 1MTNC 2A7JA 4NWKA 4YT6H 5DJ7A 3QTVH 1J9CH 2WPKS 3AK5A 3AASA 4TYDA 2EI6A 1GJ6A 2ZU4A 5E2PA 1OWIA 4YESB 3EAJA 1K1JA 1SB1H 2QY0B 4NIYA 2V3OH 3F9GA 1MU6B 4K69A 1Z8RA 3MNBA 1COWD 1O38A 2GD4B 5AFZH 3RC5A 1AE8H 3KEEA 1FZZA 5EPYA 5KECA 1C1OA 1AMHA 4RI0A 5DN6D 3GDVA 2D26C 5HYOA 1GBCA 1GHBF 1WQSA 1IOEA 2ZHFH 1K1NA 3EA9A 1MABB 1Q2WA 1GBHA 1TFXA 1TLDA 2ZU1A 5FPSA 4CRGA 1V2WT 3MH5A 1N6XA 4DW2U 1LKAA 1W0KD 3SU0A 1O2IA 1GCTB 1T7CA 2XYAA 2O8LA 1IQGA 3IWMA 1G9IE 3K65B 1V2ST 1CGJE 3RXQA 1WV7H 4JCNA 1V3XA 4OS4A 1SKYE 1S84A 1TGBA 1Z7KA 3SU3A 5JBCS 5PTPA 3KN2A 1FY3A 4YOIA 3H7OA 1BUIA 3QZRA 4NCYA 3RU4E 3ZVFA 2AIPA 4BXWA 2KCOA 3E91A 3PWCA 2KAIB 2PW8H 1TE0A 4OS6A 3GCTG 4I7YH 4MG3A 2Q1JA 8ESTE 4D9RA 4XSKU 2H9EH 1E38B 3QN7A 1ZHMA 2XOKD 2G5VA 1BTYA 1QCPA 1P57B 1TNKA 4LZ4B 4KTUA 4E05H 1P2IA 1RJXB 1BCUH 3U8OH 1TPPA 2XWBI 4A7IB 2D1JA 1KTSB 1KXEA 2FS8A 4X2VA 2ZQ1A 1ABIH 4FUEA 1DWEH 3RMOH 1UTPA 3TJUA 1WTGH 4ABDA 2JDID 3MMGA 1GHXH 1AIXH 1NRQH 4ASUD 3GISB 3TNTA 3U9AH 4X1NU 5FAHA 1HNEE 2CF8H 1NRRH 3A83A 1S83A 1C9TA 2V35A 3MI4A 1OP8A 1P05A 4JZEH 5EJ1A 2TRMA 1O5FH 1TA2A 3VXFH 2HPQH 1LQDB 2ZI2H 3WY8A 2FTMA 3MU8A 4OS1A 8GCHF 2GP9B 2OC0A 1MKWH 1O2JA 1E79D 2PSYA 4X2WA 4Y71A 5GJ4B 1EKBB 5HKKD 4Y8YA 1CHGA 3ZZ5A 1SQOA 3LPRA 2WYGA 1A7SA 1BJUA 1HAIH 4JZIA 3STIA 1SGEE 4KKDA 1DWDH 2QV1A 4CR5A 1O2VA 1Y3YA 5LGOA 1NESE 1NFUA 2ZA5A 2AMQA 2Y81A 1GJBB 4LXBH 5C1XA 1W10U 2QYIA 1RIWB 4Y7AA 3F9HA 2LELA 1MH0A 1JXPA 1UTLM 2WSSD 1XXFA 1SQAA 1UTMA 3C1KA 1MTWA 1ZGVA 2J4IA 4DT4A 1LHCH 2FX6A 1ARBA 1Y3WA 2F3CE 2BLVA 1O2UA 1BBRE 1ZHPA 1K28D 1IQHA 1HGTH 1O3DA 2IPHA 2ZU3A 3ZZ9A 2R2WU 4AG1A 2ZF0H 2BD5A 3GYLB 3S7KB 1IQIA 2Z3EA 3LGVA 4JYUH 1NY22 4XBCA 1EZQA 1OS8A 3LONA 5EODA 1BBRK 1Z8GA 5FCRA 3L3TA 1GJ5H 1O2TA 4X8UH 1EX3A 2SNWA 5A0AE 3MFJA 2VH6A 2PGBB 1ZTLA 1V2JT 2P8OB 1PQAA 2TBSA 4GLYA 3U69H 2K1QA 3NXPA 4ZHAA 1DLEA 3SJKA 1UK3A 1K21H 4R0IA 4INKA 3HK6B 1AZZA 1FN6A 3PLPA 1SLVB 1AO5A 3GDUA 5ESTE 1YCPK 3QK1A 2VWNA 1SGFG 1RD3B 4INLA 1H4WA 1RXPA 1UTJA 1GJ9B 2P8OC 1UVOA 2OBQA 3JZ2B 1FI8A 3S7HB 1EAWA 1QURH 1P3CA 3Q3XA 4WY3A 5LPRA 3GYMA 3M37A 1ZTKA 3OY6U 3EYDA 2NU4E 3TGIE 2ZFSA 1O3NA 1BTHH 1NRSH 3TGJE 3P8GA 1NU9A 1O2MA 1TX6A 5A0BA 1RTFB 3DHKH 1GVLA 3LU9B 1OWDA 1C1PA 1G3CA 1GBIA 1SLXB 2BX4A 3RXKA 3LH1A 1LVYA 3A7TA 1C5PA 2ZO3H 1NRPH 3VB4A 2C4FH 3ATWA 5AFYH 3P8NA 1LKBA 4ISIH 1T8MA 1C5UA 1TRMA 1QFKH 4X6MA 1EP5A 1O3LA 2JKHA 2ALPA 3ZVBA 4B2CA 2SNVA 3PM3A 3M35A 4UFGH 1HJ8A 3RLYH 4CRDA 3PV4A 2J92A 3QZQA 1A0JA 1K9OE 3F1SB 4YOJA 2XC0A 1TWXB 1ELEE 1QIXB 2HRVA 1CE5A 3ZVCA 1YBWA 1BT7A 4E7RG 1O30A 1T8LA 1SQRA 2ZTXA 3TU7H 3UPEA 2RA0A 4MPWA 1AKSB 5DP4A 4AN7A 2FLBH 3A88A 2KFWA 3A8DA 3HKJB 2IJD1 3E0PB 2SGEE 1SOZA 2ZPRA 2ZGXH 1UHBA 3VGCB 1LDTT 1HRTH 1C1NA 1PPFE 2VBCA 2XBVA 4FETA 1CA0B 1QL7A 2BB4A 2F4LA 3LIWA 4KELA 4X6NA 2HOBA 3SV8A 2FOBA 1SLUB 3RLWH 3N7EA 1QRWA 1C2JA 4I8GA 3O8RA 1QZ8A 3U98H 5JPMH 1VR1H 1UK2A 2P93A 1NFWA 5E8EH 2XC5A 2ZG0H 2BZAA 4Y11E 2V3MA 3UQOA 1IQMA 2W7UA 2BY9X 1DUEA 5A09A 1AVWA 1O3MA 1TOMH 1Z71A 2ZHEH 1QBNA 2G81E 3LGIA 4ABEA 1JBUH 4IGDA 3LJJA 1KXDA 1C5WB 3SNBA 3Q3YA 1J17T 4GAWA 1CA0C 1ELVA 4RT1A 5DP3A 2ZGHA 4MDSA 1W13U 1FQ3A 1PPBH 2VNTA 2WV5A 1BMNH 1SGIB 5GCHF 1D3DB 2A2XH 3UUZA 2CMYA 4B71A 2A2QH 4X1RU 1G2MA 1UO6A 3N7DA 1NROH 1TAWA 2VIVA 1C2HA 3KQBA 3RXMA 2BHGA 4NSVA 2STAE 2LPRA 1IAUA 4NA9H 2ZHQH 4X2XA 5F8XA 1D6RA 2UUJB 4X1SU 1WU1A 3A8CA 4U2WA 1XKBC 2OINA 3RC4A 2IPQX 1GDUA 2YNBA 1NFYA 1BTXA 1HXFH 4K8YA 1Z6JH 4Q7ZA 4DIIH 1O3OA 2VH0A 2BDHA 4MVNA 7ESTE 3KQDA 1S6LA 1UCYE 4FUCA 4D8NA 3AW0A 1BOQA 5L30H 1JIMA 1HJAB 1DVAH 1O37A 1QNJA 4KP0A 1UCYK 1QGFA 5A8XA 1SHYA 3MU1A 1OWEA 4WF8A 4YO9A 4ABGA 1TYNA 2WPIS 4P02A 1T4VH 4CRBA 3TGKE 3MTYA 4DY7B 2CF9H 3RM2H 1C2GA 2ANWA 1G3BA 1CGHA 2HVYB 4RKOB 2ZEBA 3VB7A 2W3IA 1DY9A 1QRZA 3MO3A 2PKSC 2GCHF 1KSNA 1PQ8A 2Z6BD 3QLPH 5EXLA 2NU2E 1W12U 2PR3A 3SQEE 1HJAC 4Y0ZE 1TBRH 3TVJB 1Q3XA 2VIOA 3SNEA 1SGTA 1ETRH 3V13A 1GCDA 2BY5X 1S0RA 2PHBA 1QB6A 1BRBE 1TPSA 5LH8A 4BXSA 4MTBA 1P12E 4RKJB 1HYLA 5C3NA 1SVPA 2BYAX 1W11U 1Z8JB 5L6NH 1EUFA 1G30B 1VGCC 1SPJA 2BM2A 2H9TH 3NUMA 5C67A 3TJVA 3RDZA 2G55A 1K1OA 1BDAA 1QY6A 2UWOA 4MLFB 5FHTA 4ISOA 2G4UA 1L4ZA 2F9OA 1YPGH 4IS5A 1KYNA 3SJ8A 3GOVB 3NCLA 2FOAA 4Y76A 2QXIA 3UWIA 3PLKA 3EE7A 1SGFA 2BX3A 4ABFA 4D7FA 5DO4H 3MO9A 3T27A 4IMQA 4DG4A 1AD8H 1GBLA 4BAMB 1VITF 2J98A 4YOGA 2Y5FA 4DJZB 1D9IA 3V7TA 5C0UA 1MBMA 1BTUA 1WTHD 2R0LA 4RN6A 2FEQH 1ARCA 2CN0H 3RXHA 1ZMJA 1RGQA 4NIXA 1DT2A 5F8TA 4IBLH 4GHTA 1K22H 1GI9B 2KR7A 3TLOA 3MNSA 2FO9A 1P2JA 3E1XB 1HJ9A 2H5CA 1L1NA 2FDAA 3ENSB 2Y7ZA 2DE8A 2RG3A 2ZDMA 2V0BA 4TPIZ 3RMNH 1Z6EA 1DLKB 3W95A 1Z8IB 1BQYA 2Y6TA 4NIVA 4ABAA 1BBRH 5B6OA 3M3TA 1W0ZU 4WVPE 1KMHB 1TALA 1O3FA 1JMOH 1SSXA 1KDQB 3U1JB 1DITH 3S9AA 5L2YH 2P59A 2F9NA 1W7XH 4INHA 2KZ4A 1FNIA 3SI3H 1ELFA 3SU1A 1AI8H 4NZLA 1P01A 5EOKA 4ZHMU 1BTPA 1MTVA 2A7CA 2ASUB 3PB1E 1C4U2 1VKYA 4ISHH 4MPUA 1GHBG 1O2XA 3EE0B 3SGAE 1A1RA 3UIRA 2ODQA 2FS9A 2BOHB 4XBBA 3SUEA 1YCPH 3DSGA 1P2QA 1V2OT 1SR5C 4FU7A 2PTNA 1X7AC 3ELAH 4CRAA 4Y10E 3BIUH 2W3KA 1ELDE 1L2EA 1IHTH 1HAVB 3BSQA 4MNVA 3D65E 3RXIA 3SQHE 2FM2A 2XCFA 4LOYH 1E0FD 2P3FH 1EXFA 4AZ2B 3PMAB 1C5YB 1P11E 2K0QA 2ZPSA 4J1YA 4JK5A 2BY7X 3KL6A 4F49A 5EGMA 4UE7H 1ELBA 3A87A 3UQVA 3PWBA 3UR6A 4B6EA 5L2ZH 4PROA 4ABBA 4J2YB 3U28C 4Q63A 4I8KA 3KIDU 3E8LA 4YLQH 1G3DA 1MTNB 3PO1C 1V2NT 4DIHH 3A85A 3ZV8A 3BTDE 1TNLA 1LHFH 3GY8A 5ABWA 1Z1JA 1FDPA 2THFB 3FN8A 4M7GA 1AY6H 4Z6AH 4Y8ZA 3F2FA 1PQ5A 1LTOA 3OTJE 1W8BH 2BXTH 3EDXB 2ANMH 3NRLA 1A5IA 5DP7A 2GT7A 4AX9H 1O5DH 3LOXA 2BZ6H 2PP6A 3T62A 4ZHLU 2FESH 1Y5UT 3SW2B 3A7WA 3K6YA 1C1VH 1OP2A 1O2GH 1CHOG 1WBGB 3P8OA 4WMFA 4B73A 1QA7A 1SLWB 1EFRD 2FOFA 2H9HA 1SMFE 3TH3H 1C2KA 1ELAA 2GMTB 3C27B 1XUJA 2FI4E 4MPVA 1F5LA 3D23A 2PKAA 4A5TS 4CH2B 3S9BA 3ZZAA 1UVTH 2QXGA 1CT2E 2PTCE 2ZWLH 2SFAA 1G37A 1K2I1 2ZDKA 1GI7B 1AUJA 1G3EA 4YLUA 1KXAA 3QO6A 8GCHG 2OC8A 4HTCH 2V3HH 2C3SA 1Y5AT 4OS7A 4BTTB 3Q3KA 4ZAEA 1DUAA 2BDIA 1SOTA 8KME2 5ESBA 3SV9A 4NWLA 3M5LA 3A7YA 1MTUA 5G4BA 4A1TA 2GMTC 3OSYA 4X0WU 5CHBA 2RFKC 1GG6C 1E34B 4NA8A 3PV2A 3SYJA 3TITA 3ZYDA 2FMJA 3VB3A 3NZIA 1O2KA 4YM9A 3SV6A 1O2PA 2ZFPH 3BTWE 5LPEA 2BVSH 1ZPZA 4FUDA 1BTWA 4JMYA 1O2WA 3MO6A 2SGQE 4E7NA 1EASA 1O3IA 3B23B 2QF3A 7GCHF 3A7ZA 3GY2A 2VWLA 1BIOA 2D8WA 1TNHA 2QE7D 1PPGE 3DUXH 3F68H 2ZCLP 3FO8D 4K3JA 2OLGA 2FODA 4H42U 4ZUHA 3H5CB 1TBQH 1NZQH 1CA8B 5A8YA 1AHTH 1F0SA 2DE9A 2UUYA 1FIZA 2OD3B 3L6PA 4XFQA 3R0FA 2BOKA 1O5AB 5J4QA 2Q6FA 1HFDA 3RC6A 1EB1H 1KIGH 2IOTA 2A4QA 2BDCA 3BF6H 2XNIA 1GHAF 2TPIZ 1EJAA 1QHRB 1QB9A 2UWLA 1ANEA 1UCYH 5DKMA 2BD4A 1C5OH 1E37B 5HIYA 3P17H 2ANKH 2J9NA 1V2PT 3HGNA 4UFDH 3ZVEA 1JRTA 3IITA 4CBOA 1SQTA 2G51A 1BRAA 1GGDC 3STJA 2Z9JA 4ABJA 5E0GA 1VITH 1CT4E 3ZZBA 2Y82A 1O2QA 1GDQA 1MU8B 1NBME 3SHCH 1ZPBA 4WXVA 1H8ED 3DSPA 3UNSA 1XUHA 5E0JA 1P0SH 4AGKA
chains in the Genus database with same CATH topology
4GVUA 1YCPM 1GHVH 3A82A 1QTFA 1LVOA 1ZZZA 2UUFB 1MCTA 2ANYA 2FIRH 2VWMA 5TCAA 2A32A 1TGNA 1C5MD 1Z1IA 2BQ7B 4AB9A 3BG8A 3BTME 1ANDA 1AZ8A 1KLTA 2EI7A 6LPRA 1NPMA 4CHAB 3KQEA 3U1IB 4JZ1A 1OYQA 2ZDNA 4HGCA 3BTQE 1TNGA 1YPMH 1ANBA 3PMHB 2A31A 1IQEA 1GL1A 1D3QB 5LPFA 3RP2A 1S6HA 1F0UA 1PQ7A 3KCGH 1L4DA 1Q31A 3BTTE 3SBKA 2AGGX 1NTPA 2R3UA 4UDWH 3RXPA 3B9FH 3RU4T 3M7UA 1GBFA 4SGBE 1WYKA 3P6ZB 1YKTA 1ZR0A 4NFEA 1XXDA 4DOQA 1YC0A 2ZGCA 2FI5E 1PYTC 2A4OA 3LGUA 4NFFA 1C5TA 5T6FA 2XBXA 1N1LA 4CHAC 3P92A 1ZMLA 3M5MA 1FY1A 2FOEA 4XE4A 5DP6A 4D7GA 2Z94A 1GL0E 4ZKNU 2QXHA 1AQ7A 1B5GH 4ZXXH 2A0QB 1HAXB 1NM6A 4K5ZA 3EQ0H 2BXUH 2AH4X 3Q00A 2ZIQH 4THNH 1BRCE 2Q6GA 3SUFA 9ESTA 1PJPA 4FUHA 1FJSA 1GBTA 1O3EA 2EA3A 2XWAA 5CMXH 1F5RA 3R3GB 1D6WA 3HPTB 2C8WB 4I31A 1C2DA 2P3UB 1C2IA 5IYTA 2ZFRH 1D4PB 5C1YA 1DDJA 3U8TH 2GDEH 1FN8A 1LVBA 3HGPA 1FY4A 4WXIA 3FFGA 1HXEH 3SU2A 1ABJH 4FUJA 4B1TA 2Y5HA 1BITA 1EZXC 2KAIA 1OP0A 3BTEE 5AF9H 5TCCA 1ACBE 3L33A 1S81A 4TWWA 2TIOA 3I78A 1DM4B 4X8VH 5FBIA 4ZH8A 2C8YB 2BTCE 2XBWA 1MCVA 2QN5T 1DE7H 3IG6B 1AE5A 1Y3VA 2QGRA 3BEIB 1HIAB 3P70B 1GHWH 2XCNA 1GBKA 4WWYA 4I8LA 5T6GA 3TH2H 1ZOMA 1DWBH 2GGVB 1LMWB 2ZDLA 2VU8E 3QGNB 1UVPA 1GMDG 1OX1A 1N6YA 3RXEA 3ATLA 4ESTE 1ZJKA 4UFFH 1TQ7B 1OPHB 1VCQA 3ESTA 3SORA 5SGAE 1O2HA 6GCHG 3Q76A 1T31A 1SGRE 1P09A 1CU1A 1GHYH 4FUFA 3GDSA 3BEFB 1XMNB 3GY7A 1V2KT 1LCYA 2XTTB 3RXCA 1TGCA 2GCHG 1N8OC 4FXGH 5A2MH 5GXPA 1V2MT 4JYVH 3LGWA 1ANCA 4GSOA 1C9PA 3M61U 5AVDA 3UTUH 3SU6A 1SC8U 1G2LA 3G01A 2YNAA 1PFXC 3A89A 2FTLE 1ELGA 4A92A 3RU4D 2TGPZ 1DOJA 5FXLA 1MZDA 1TONA 2VIDA 2UWPA 1NC6A 5IDKA 1LHDH 3S0NA 3RXOA 3KF2A 3MWIU 2ZC9H 2PV9B 3TJNA 2BDAA 1THPB 3PLBA 1T4UH 3PMJA 2PUXB 4OGYA 1G36A 3TK5A 1O3GA 3ZVGA 5EW1H 1TX7A 1C5SA 3T2NA 4YT7H 1A61H 3MH6A 1PPHE 3B8JA 1XUGA 2ZP0H 1LPKB 4U01A 1GBDA 3T26A 1NN6A 2DUCA 3GY5A 1MQ6A 1TRYA 2GX4A 1F0RA 1C4V2 3MHWU 1UTQA 3QGJA 4GPGA 1RFNA 1ZRBA 1MAYA 1VCWA 4MNWA 3DFLA 1FXYA 2BY6X 1S85A 2PKSB 2J38A 4MQAA 5TJXA 1XM1A 2HLCA 2FZZA 2VIPA 4A6LA 4ZKSU 5FPYA 1EB2A 1EZUC 3U8RH 2PGQB 2A7HA 4O3TA 1GPZA 2ULLA 1PPEE 2B9LA 1Y59T 3GCHB 3TJOA 2WPHS 3TPIZ 1DY8A 1GI0A 1QBOA 1H8DH 3K9XB 4DURA 4H6TA 4ISLA 1KY9A 2ZKSA 1VGCB 3MU4A 3F9EA 1CSOE 1THSH 4X1PU 2HPPH 2BLQA 1YP9A 1BMAA 3RXLA 1BRUP 3D62A 3Q77A 4QT8C 1JWTA 3ZZ7A 4AG2A 4K1TA 1SGNE 3PROA 2PUQH 4FVDA 2LNCA 3D49H 2HVXA 1C5LH 1MD8A 1ZTJA 3GCHC 5GDSH 1TB6H 1YPJH 3ZZ6A 2C90B 2B7DH 4I33A 3AW1A 3ZZDA 1O2NA 1QA0A 1VZQH 2BDBA 3K2UA 2SGPE 2AERH 4WJG2 3RXVA 4BTUB 2Z9KA 2J2UA 4CRCA 1QRXA 1W14U 2CJIA 1AWHB 1AKSA 1RTKA 1LPGB 4KTCA 2GTBA 1EPTB 1IQNA 4FUIA 3QX5H 4Q7YA 3RXTA 2F83A 5EXMA 1C1UH 1F2SE 3UNRA 4ASHA 2ZU5A 3BG4B 1OYTH 1SBWA 3SO3A 1GI5A 1XX9A 1MZAA 1ZLRA 1GBEA 4AYVB 1SG8B 1AFEH 2PFEA 1O32A 1DS2E 1TMTH 1LQEA 4TY6A 5DP9A 1SGPE 1GJ7B 3LC5A 3FANA 4I32A 4O9VA 1C2FA 2AIQA 3KNXA 1V2QT 2P16A 1ZPCA 1O3KA 5F6MA 3I29A 4A1XA 1O33A 2ZTZA 1O34A 3RXDA 3FZDA 2AYWA 1EPTC 5A8ZA 1IQFA 2BQWB 1GI1A 2C8ZB 4O97A 3QTOH 1LVMA 2J94A 4K60A 1FPHH 3VB5A 5FX5A 5EQRA 1QL8A 3BTKE 3BG4C 2WPJS 3CENA 1GJDB 1XUIA 2D2DA 1MMJN 2WUBA 3O8BA 3MH7A 3RXRA 3JZ1B 3SGBE 3FP8E 1VJ9U 5JB8S 1XVOA 1OSSA 3MU0A 1WCZA 3M36A 3M7QA 4XOJA 5BPEA 2HGTH 4YZUA 1P3EA 2TGAA 3AAVA 1G32B 3SHAH 3PTNA 3SU5A 1MBQA 1T8NA 4MNXA 1J8AA 1P10A 3SOSA 3K6ZA 1GBMA 1DFPA 1GI6A 1O2YA 1GHZA 3MYWA 1Y3XA 3PO1B 3RXJA 3AVZA 1B0EA 3TH4H 4AOQA 1TRNA 3PTBA 1C5XB 5AHGH 1SGCA 2JH0D 1IQKA 3FAOA 3RXUA 2ZGJA 2VGCC 2ZZUH 2GZ8A 1CT0E 2HNTE 3GY3A 3FP6E 1P9SA 4Y6DA 5CHAB 3M5NA 5DP5A 3V0XA 1O5BB 4AFSA 1THRH 1TX8A 5E2OA 5FCKA 1ELTA 1FAKH 2ESTE 1EATA 1UK4A 7GCHG 2XXLA 1ESBA 1EZSC 4WMEA 1C1SA 2XBYA 2STBE 1FAXA 4D9QA 2IJOB 3QUMP 3PMBB 3MU5A 3LDXH 4BAHB 1GMHF 1JOUB 3CS7A 1KTTB 3SNAA 3RXGA 1O35A 4DCDA 1BTZA 1YLDA 1EQ9A 2P94A 5CHAC 4Y8XA 2F9PA 2QXJA 4KTSA 1A5GH 4LZ1H 1C1RA 2ALVA 1MAXA 2VWOA 2B8OH 1MTSA 1SGYE 4WH8A 1GHAG 2G52A 1QJ7B 4AB8A 1TGSZ 4NIWA 3VEQB 4FUGA 3I77A 1AB9C 5HM2A 5JBTA 1TGTA 1GBBA 1KLJH 4AYYB 2FX4A 3SNCA 1MKXK 1LO6A 2R0KA 4U32A 1J14A 1OOKB 1D3TB 1GG6B 3SV2H 1EAXA 4K1EA 2BY8X 2FYQA 2M5TA 1HAZB 2RCEA 1GBJA 3SJ9A 2B5TB 3QDZB 4IC5A 2HNTF 4CR9A 2HNTC 2J34A 4B76A 3BV9B 1C1QA 8LPRA 5HXFA 1H1BA 4U30A 1A3EH 1BZXE 1SFIA 2FOHA 3ATIA 1AWFH 1O36A 1Y8TA 3OYPA 4B2BA 3A86A 3UNQA 1GDNA 3H7TA 1P2NA 2Q6DA 4X8SH 3LT3A 3LGTA 1FY8E 2H1UA 3MH4A 1W0YH 2ZPQA 5EG4A 1DANH 1F0TA 1V2UT 3F9FA 4ZMAH 2AEIH 4OS2A 2OBOA 4OGXA 1BMMH 5DGJA 2O8TA 5JBBS 4FUBA 2VVCA 1GJ4H 1C5VA 3SU4A 1AGJA 5F8ZA 1SHHB 2O8MA 1SL3A 1UVSH 4UD9H 2SGDE 1YYY1 2VVUA 1KDQA 1V2RT 3BTHE 4JYTA 4KGAA 2V6NA 3O8DA 3QWCH 5GWZA 3MNXA 3ATKA 4GCHF 2BQ6B 2VIWA 1DICA 2W5EA 1BJVA 3E0NB 2R2MB 3CS0A 4I8HA 4CREA 2A5AA 4BOHA 1GGDB 1QR3E 1CO7E 4IMZA 3V12A 3DT0H 1TNIA 2OC1A 2AS9A 3ODFA 2WINI 1ZSJA 3SV7A 3UOUA 1WQVH 5I46H 1GI3A 3SUDA 2AMPA 1ETSH 4Z0KA 1O3PB 3M5OA 3BN9A 3ZZCA 1HAVA 1BHXB 1YLCA 1YF4A 3T28A 1GCTC 1F7ZA 1BB0B 1GMCF 1ORFA 1ZSLA 5EXNA 1GI2A 3VXEH 1T8OA 2ODYB 4X1QU 2Y7XA 5F03A 2BLOA 1CVWH 3GY4A 4WH6A 3S69A 2F91A 4BTIB 4X6PA 4RSPA 1NO9H 2BVXH 2FI3E 1HB0B 4NG9H 3NK8A 2ZCHP 2JETB 1TNJA 5I25A 1MQ5A 5EW2H 5GIBA 1O3JA 5BRRE 1CHOF 1OXGA 5HM9A 1TQ0B 1HAGE 1HCGA 2A5IA 3F6UH 3VFEA 1BHXF 1GJCB 4B75A 4JZDH 3VPKA 3M7TA 1QQUA 1RS0A 2TGDA 1BA8B 1EOLA 4GUXA 4DGJA 4DT7B 3T5FH 2CV3A 5JYIA 2Y80A 1HAPH 2OUAA 2QCYA 2A45B 4ABIA 2RA3A 1IQLA 2JETC 1U6QA 3OU0A 5H4IB 1F92A 1ELCA 1UHBB 1GJ8B 1YPLH 2XRCA 2RDLA 1SI5H 1HV7A 1O5GH 2BMGB 2TGTA 3KHVA 1OWKA 5DG6A 2YOLA 1TABE 3O8CA 3FVFB 1E35B 3SN8A 4BAOB 1TOCB 1YPHE 2XC4A 2WUCA 1UMAH 3RXSA 3T25A 4F4OC 1UTOA 1CBWB 1UTKA 4DVAU 1GVKB 1AVXA 4NA7A 1NT1A 1FIWA 1TBZH 2AGIX 2NU3E 2G00A 1VCPA 4K2YA 1FPCH 3EA8A 1P06A 2EC9H 2Z7FE 2CGAA 4ISNA 2O8UA 1J16A 2FOGA 1EAIA 4BAQB 5K7RA 2QA9E 4HI3A 2PSXA 2VVVA 3GCNA 5C1UA 3GCTF 1P2MA 4JZFH 3LH3A 3ZZ8A 3V3MA 2A4GA 1UTNA 1O39A 5K0HA 1CBWC 4LK4A 1SGQE 1LPZB 1A0LA 1RIWC 4FVBA 1P04A 1GWAA 1WSSH 1JIRA 1ZHRA 2OTVA 1XKAC 1FMGA 2HWLB 2H5DA 6CHAB 3KGPA 4FU8A 1B0FA 5JB9S 1ZGIA 1O5EH 5FPTA 1AUTC 1GVZA 1QL9A 1WOFA 4NGAH 5GCHG 1ZMNA 4IN2A 1VJAU 3EA7A 3NPSA 4MNYA 1L1GA 3SZNA 1P02A 3TK9A 1FONA 1A3BH 3SGQE 2OC7A 2Z9LA 2ZFQH 1YPHC 3PYHA 3NKKA 1EAUA 4TY7A 2NU1E 2ZGBH 4AGJA 1HAOH 4O03A 1GJAB 1IHSH 6CHAC 2W26A 2J95A 2R9PA 1N8OB 4Q2KA 2OQUA 4HZHA 1FY5A 1C5NH 1D3PB 1LHGH 3RMMH 2BD7A 3W94A 2G8TA 1A2CH 2C93B 2FYRA 3DD2H 1OKXA 2ZFFH 1AU8A 2GZ7A 5C5NA 4BNRA 1DSTA 3BIVH 3SI4H 2GT8A 3A81A 4Y0YE 1HUTH 1PPCE 5CE1A 2WPMS 5T3HA 2G5NA 2ZDAH 1KXBA 1DSUA 4JK6A 2Y5GA 2R3YA 4IW4E 1YPEH 2ZECA 1H9HE 1O3AA 1A0HB 2P95A 3GCOA 1MKXH 3ODDA 5T6DA 1O0DH 3ITIA 1INCA 2B0FA 3ZVDA 3S9CA 4TPYA 2VJ1A 3VB6A 1T32A 2QF0A 2BD2A 4CH8B 3GICB 5FBEA 3KQCA 2G4TA 1HAYB 3AAUA 1SFQB 4H6SB 1TMUH 3E3TA 4NSYA 7LPRA 1GI4A 5C20A 1YPKH 1O2SA 2QIQA 1PYTD 1DXWA 2ODPA 4CBNA 1JRSA 2EEKA 2ZQ2A 4XBDA 5J4SA 4GHQA 3UWJH 4Q7XA 2F9UA 1KXFA 2ZNKH 1ETTH 5A0CA 1HLTH 3DA9B 5DP8A 1HDTH 2OXSA 3VGCC 3LGYA 4Q80A 3TK6A 4A1VA 4OS5A 4UFEH 3TNSA 2SGFE 4HFPB 3UOPA 3DFJA 1VITG 2EI8A 4D76A 4H4FA 1FLEE 1P9UA 3A8AA 4IC6A 1K1PA 5EU8A 2A1DB 1V2TT 3UREA 4K1SA 2AGEX 2C8XB 5EQSA 1AFQB 1RRKA 2Z9IA 3UFAA 1CGIE 1KLIH 3A7XA 1O3CA 4AFUA 2IN2A 1YM0A 3NWUA 2F9BH 2BLWA 1IQJA 1C1WH 4XDEA 1DXPA 2VIQA 1S6FA 5E0HA 1BMLA 2Z3DA 1GMDF 2BDYA 3UY9A 1L1JA 1O5CB 2I6SA 2BDGA 2BVRH 1E36B 3ZYEA 2GKVE 1K1IA 1MUEB 2GZ9A 5ETXA 3A80A 1SGDE 3CP7A 1HIAA 2HALA 1AFQC 1ID5H 6GCHF 1CQQA 2JH5D 2ZTYA 3MNCA 5C5OA 1P2KA 1F5KU 2ZFTA 1QJ1B 2GCTB 3RM0H 1C5RA 2JH6D 5DPAA 1HPGA 3SJOA 2BD3A 4AORA 1V6DA 1O2ZA 1P2OA 4NZQA 3SUGA 2CHAB 3TIUA 3A84A 2Z9GA 3GY6A 1ZJDA 3BEUA 4AFQA 1ESTA 2PLXA 1S0QA 2GDDA 1MKWK 3OX7U 1K1LA 1H9IE 1OWJA 2A4RA 2WYJA 4BANB 1FV9A 3FP7E 5HGGA 2H2ZA 1EJNA 2GCTC 5FX6A 1C1MA 2VINA 4ZROA 4ABHA 1GMHG 3M3SA 1C2LA 2CHAC 1UJ1A 2W7SA 2CXVA 2OQ5A 4SGAE 1AN1E 2PWXA 1H8IH 2FPZA 3RXBA 3URDA 2PKAB 2F9VA 1DPOA 1M9UA 2GV6A 3LJOA 2ZDVH 3ZZ3A 5DK1A 2FWWA 1L0ZA 1S5SA 1W2KH 2ZU2A 2WPLS 4B2AA 3SJIA 2Z3CA 3ATMA 2OP9A 4IN1A