1BRAA

Relocating a negative charge in the binding pocket of trypsin
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCQENSVPYQVSLNSGYHFCGGSLINDQWVVSAAHCYKSRIQVRLGEHNINVLEGNEQFVNAAKIIKHPNFDRKTLNNDIMLIKLSSPVKLNARVATVALPSSCAPAGTQCLISGWGNTLSSGVNEPDLLQCLDAPLLPQADCEASYPGKITDNMVCVGFLEGGKGSCQGDSGGPVVCNGELQGIVSWGYGCALPDNPDVYTKVCNYVDWIQDTIAAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPSIN
publication title Relocating a negative charge in the binding pocket of trypsin.
pubmed doi rcsb
source organism Rattus rattus
molecule tags Proteinase/inhibitor
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1992-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1braA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1braA02
1HAVB 2RDLA 1GCTB 3V7TA 4FUHA 2TBSA 1P2OA 2IPHA 4IS5A 1IQHA 2SGPE 1BMMH 3DT0H 4CRGA 1TBRH 1O2TA 2FS9A 3ZVEA 1FPHH 1YCPK 3SQHE 1IHSH 4CREA 1D6WA 3SJKA 2AGEX 1GI7B 5HM2A 2ZDVH 3SU4A 1LKAA 2FZZA 4RKOB 1SGFA 4X6OA 4SGAE 4YM9A 1N6YA 1W14U 3A7XA 1O30A 4X2XA 2Z6BD 3BEUA 3BTDE 4ISLA 1LVOA 2ZCLP 2WYJA 2VIPA 2ZFFH 2R0LA 1VITF 1ZHPA 2UWLA 3LJOA 1LKBA 2F91A 1TQ0B 1EX3A 3PTBA 3NWUA 2C3SA 2FDAA 3ZVCA 3V13A 2SGQE 3SO3A 4AOQA 1BTWA 2PSXA 1HAGE 2JETB 4MNVA 3SU0A 1FI8A 2AIPA 1XUHA 2FP7B 2O8MA 1QQ4A 1KXDA 4HFPB 1FV9A 1ELEE 3AW0A 1XVOA 1RGQA 1H9IE 1Z6EA 1LCYA 2R0KA 5I46H 1GI5A 1O2WA 2BVRH 2NU0E 4CHAB 3LU9B 2B5TB 1HCGA 1HAXB 2P8OC 3RXSA 2PFEA 1C4V2 1UTMA 3RMNH 3VXFH 1AE5A 1P09A 4WH6A 4GHTA 1LQDB 1YLCA 3M61U 1YPKH 1GCDA 4BTIB 1XM1A 3BTME 1QA7A 3LGVA 1YGCH 4U01A 4WJG2 4MVNA 3RXRA 4KGAA 4MNYA 1A1RA 1BBRE 1NZQH 2FOMB 3QLPH 4ASHA 4F4OC 1O2MA 2JH6D 3L3TA 1SOZA 2EI7A 5AHGH 1CVWH 1OWIA 2G51A 1JWTA 2PGBB 1UCYK 4OS4A 3FVFB 4GAWA 1F2SE 1ZRKA 5GWZA 2AYWA 4E06H 1ABJH 1C1UH 4Q7XA 2XW9A 1DWDH 1WQSA 3LKWA 5AF9H 4K3JA 1AUJA 1BTHH 3IWMA 5DKMA 3SUGA 1NY22 3OSYA 2VINA 4RKJB 5F8XA 1BMNH 3UTUH 6GCHF 3GYLB 2PLXA 4VGCB 3EA8A 3F9HA 3HK6B 1O3AA 5FX5A 1O3EA 2C90B 3M5OA 3NUMA 4B1TA 4CH2B 3P95A 2OQUA 1BZXE 4GPGA 1C5TA 3SU3A 1Z8JB 3VXEH 1ZTLA 3M5NA 1RIWC 3A8AA 1TNHA 5A8XA 1FLEE 2VNTA 5DPAA 2WPMS 5DJ7A 3UWJH 4YO9A 3MU0A 3RUOA 1V2PT 2ZGJA 1MQ6A 4D9RA 1T8OA 1GHBG 1BRBE 1ZJKA 1KXCA 3SU5A 3BTEE 1TGCA 2A5KA 1L1NA 1O5CB 3A84A 1P12E 1C4U2 3QX5H 2ZZUH 2XBWA 4I32A 3QN7A 1T8NA 1FAKH 2BD4A 5BRRE 2BQ7B 5EOKA 1S85A 2OLGA 3BTTE 1C2FA 1E34B 3SV2H 2ZHQH 1BRUP 1AI8H 4NFEA 2V3HH 4ABJA 2ODPA 2NU2E 3D62A 3M3TA 1A3BH 2R9PA 2Q1JA 4X2YA 5EQSA 1UCYE 2CGAA 4U30A 4D7GA 1L4ZA 4DURA 4AFSA 3OY5U 1YPJH 1O2UA 1TRMA 1O5DH 1O3LA 1TMTH 1K21H 1CBWB 2SGEE 2BD5A 3GCHB 2TGPZ 4FUCA 3SNBA 7LPRA 1OOKB 3TH2H 1C2KA 3F1SB 2XC0A 1NRRH 3RXMA 1BQYA 1SGYE 1KLIH 1AKSB 1SGQE 1S0QA 1YP9A 2XXLA 3AASA 2R3YA 2BDYA 1P3CA 2EI8A 1Z8GA 2ZA5A 1YPMH 1DPOA 1S81A 2SGDE 3M5LA 5EU8A 2JKHA 1P2MA 2OP9A 3PM3A 3ATIA 4AN7A 1JRSA 1WBGB 2ZGCA 2PUXB 1KDQB 2G4UA 1TONA 1TQ7B 3GCNA 1QRXA 4WMDA 3PO1B 3DUXH 3SNDA 2ZU3A 1AGJA 2P59A 5GCHG 3T27A 1O38A 1GBCA 1IQFA 1Y3VA 4GUXA 2EA3A 3SGBE 4MLFB 3RXIA 1SGDE 1SGEE 3OTJE 1QCPA 3ZV9A 1OWDA 1FY3A 3KQBA 3OU0A 4JYVH 1Q31A 4D8NA 1CHGA 1MMJN 4YT6H 1GDNA 1Y3YA 1PQ8A 4LOYH 3RXJA 5JBTA 1NRQH 1F5RA 1J8AA 1N1LA 1O2LA 3D49H 2FOFA 3HPTB 3SGQE 1NS3A 1OXGA 4MPXA 2GT7A 4FU8A 2I6SA 1ETSH 1C1NA 1HAIH 2A5IA 1NO9H 2R2WU 3T29A 1MU6B 2ZDKA 5L6NH 2OQ5A 1DANH 3TNSA 4AFZA 1GG6C 1GMHG 3BTFE 5F03A 2GCTC 5GIBA 3E0NB 1HAOH 5DP7A 4BTUB 1OS8A 2V6NA 1EB2A 1V2JT 3A87A 4WWYA 1FONA 3M7UA 2VB0A 1O2SA 2BQ6B 1EAIA 1C1MA 1AVXA 2ESTE 4RSPA 4E05H 2PKAA 3TK6A 4BANB 2UUYA 1A5IA 1GJ6A 3E91A 1QY6A 1O2JA 1C5XB 3SU1A 1T4UH 1J17T 1TE0A 3ATWA 3ATMA 2BY7X 1MKXK 1GVKB 4ZROA 1UTQA 4A1TA 2BTCE 3U8OH 3MOCA 4DVAU 4BAMB 1JOUB 4Y0YE 1E37B 3UUZA 1C2LA 1SGTA 2ZPRA 1DM4B 3S9CA 1G3DA 2TGDA 4ZKRU 1WAYB 1V2MT 3U1JB 3ESTA 3A86A 2FS8A 3GY5A 3UPEA 2QF3A 4JMYA 1NROH 2NU3E 4NWLA 3STJA 4I33A 2C93B 3TJOA 3ZZAA 2BYAX 3GCOA 1XUKA 2GMTC 3T2NA 3GDUA 2UWPA 4K1TA 2ZHWH 1GJ9B 1SI5H 1CHOG 1TNIA 1PYTD 3RP2A 1SQAA 1F5LA 2STAE 1EUFA 2KAIA 4E7RG 1ANEA 4ZAEA 1W7GH 4YOJA 2WPKS 1FJSA 2BOKA 4KP0A 4FUGA 1HFDA 3RC4A 1MBQA 4X2VA 1LO6A 3TPIZ 1NESE 1K1LA 1LVBA 2AMDA 1LDTT 1H8IH 1AKSA 5HM9A 1FIWA 1KTTB 1F0TA 1Y3UA 2OC8A 1MAXA 1O2XA 2WPIS 1GCTC 2BDGA 3PWBA 3TK5A 1RTFB 1AQ7A 4CRAA 5C20A 2O9QA 3SU6A 3S69A 2PHBA 2TGAA 3DFJA 2Y6TA 1LPKB 1GHXH 1KDQA 1P03A 4X6NA 4ABAA 1O33A 1BT7A 1S6FA 1TGSZ 1UTJA 1XX9A 3V0XA 2VWNA 4XE4A 1GGDB 5T6DA 2BZAA 1SGCA 4MNXA 1A61H 2ZGHA 4F49A 4WF8A 2XC5A 1P2QA 2J92A 1GBHA 3Q3XA 1HAPH 1IQJA 2W7UA 3NPSA 3PMHB 2FLRH 1SC8U 2DUCA 1GJ5H 3O8DA 1MQ5A 2HPQH 4IW4E 3P8FA 1W11U 4WH8A 4ZKNU 2VIVA 1BDAA 1KXFA 1T8LA 4UFFH 4ZHMU 1BHXB 4ISIH 4O3TA 4H42U 4JZIA 3ZVBA 3RDZA 3M35A 1WV7H 1H9HE 1C1SA 5C5NA 3Q77A 1ELFA 1G3BA 2BY9X 5EXLA 1C9PA 1C5MD 1MCVA 2C8YB 3GY2A 1ELDE 1CE5A 1NN6A 3STIA 2GGVB 5JBBS 1TPAE 4O03A 3RXBA 2ODYB 4IMQA 1EXFA 3LGUA 5GCHF 3BN9A 2NU1E 4X8SH 2QCYA 2V3OH 1V2WT 5AVDA 2IN2A 2F9BH 2Z9LA 1GBKA 4JCNA 3A80A 2ZPSA 1MU8B 3VPKA 3RXGA 4O3UA 1TYNA 1B0EA 3MNSA 2QIQA 3F9GA 4YLUA 1H4WA 4MPVA 3LPRA 1YLDA 3MU5A 2OBOA 1ZSKA 1SGIB 2P94A 4FUDA 1G9IE 2NWNA 2VVVA 1UJ1A 2ANWA 1GJ7B 1OSSA 2YNBA 1J16A 5DP3A 4YZUA 1NU7B 1XXFA 1C5WB 1MTVA 1G36A 1O36A 1P2JA 4B75A 1DY8A 2AGIX 1QFKH 1G2MA 2WPJS 1C2EA 1A5HA 1GMHF 3ZZCA 1D4PB 5EPYA 2BY5X 2VH0A 1TOCB 1AIXH 1O3IA 4NIXA 2GDDA 3DD2H 5K7RA 1TLDA 2SNWA 4K1EA 1Z8RA 2Y82A 1TMUH 1C5QA 3EQ0H 1X7AC 3MH7A 3MU8A 4B2AA 1XKBC 4VGCC 1ESTA 2Z9JA 4HTCH 2ZU5A 2OBQA 2ZU1A 3FANA 5TJXA 3ZVDA 2FM2A 2VWOA 3Q76A 1ZZZA 4I8HA 1C2IA 1EZQA 1GI8B 5CE1A 3LC3A 2B0FA 1TX8A 1BCUH 7KMEH 6GCHG 5EQQA 2FOHA 4FUIA 2F83A 4FUFA 1O2ZA 3RMOH 2QC2A 4SGBE 4Y8ZA 1BTUA 5I25A 1GJ4H 1TGTA 1RXPA 2D1JA 3EGKH 3EA9A 4A1XA 3SW2B 1UO6A 5DP6A 1ELBA 1G37A 3DA9B 5FAHA 2C8WB 1D9IA 4JZDH 4R8TB 1BIOA 5HYOA 2H9HA 1W13U 1THPB 2BQWB 1LPZB 3QUMP 1LPGB 2BDIA 3SQEE 2F3CE 4I8KA 3AW1A 1QR3E 2OC7A 5DO4H 1G3CA 1UHBB 3S9BA 2ZWLH 3QTVH 3MH4A 2GP9B 2Y7ZA 2FTLE 1MTUA 2Q6DA 1CBWC 1OYQA 3O8BA 1GBIA 1ZPZA 1GBLA 2A45B 2ZQ1A 2VWMA 4XSKU 3F68H 2FMJA 5FPSA 1C1PA 1FN8A 1VJAU 3GY8A 3P17H 4ZKOU 1M9UA 1O3JA 2HALA 3SI4H 1HXFH 1DOJA 2BXUH 2NU4E 3RXFA 1CO7E 3NZIA 2XBXA 1GBEA 2CN0H 2B8OH 2ZDNA 1BBRK 1C4Y2 4DY7B 1KXEA 1S84A 4HZHA 2VVCA 1XUFA 1L2EA 2VU8E 2XNIA 1QBVH 3PO1C 1QGFA 9LPRA 1EAXA 1E38B 4X1NU 1W7XH 1DLEA 1KSNA 4JZEH 1AB9B 1MD8A 1V2QT 5JBAS 1NRSH 1PPEE 3LC5A 3ZV8A 4DW2U 3ZVGA 5FXLA 3BEIB 3RM0H 2ANYA 2J38A 4AYYB 4OGYA 3W94A 1NFUA 1O3MA 3KNXA 1ZHRA 4FVDA 2QF0A 2CF8H 1C1WH 4CBOA 4FU7A 4QT8C 1NFYA 2F9VA 4MNWA 2W5EA 4Y11E 3URCA 3RXHA 1GJCB 3A81A 5FPYA 1TB6H 5FBEA 2VGCC 4WMEA 2IOTA 3EDXB 3QGNB 1YPEH 4INHA 4Y76A 1RD3B 1XUIA 4Y7BA 2BDBA 1EJNA 1GI0A 1QBOA 3MO6A 2LNCA 3BSQA 1KTSB 1ID5H 2H2ZA 1NTPA 3RU4T 3SJ9A 3URDA 4NIYA 3H5CB 3ENSB 2ZCHP 4ABEA 1DICA 1O3PB 2IJOB 1FN6A 5JDUB 2FTMA 1W0YH 1QL8A 2BD3A 2H5CA 1HNEE 2WPHS 3I78A 1NRNH 3FZDA 2P3FH 2ZFQH 2BD7A 1LTOA 1V2ST 1OPHB 1S83A 1GBFA 2A4QA 4FUJA 2H9TH 1ELGA 3KHVA 1MAYA 3ZZ7A 4NA9H 2Z3EA 4OGXA 1HJAB 2ALVA 2WINI 3GOVB 3SUEA 4BAOB 2AIQA 2AS9A 1LVYA 5HMAA 1A4WH 3BTWE 3HKIB 3RXOA 4CBNA 3LGWA 2RA0A 1YF4A 5DP9A 1Y59T 1GL1A 1UTKA 4IN2A 1C5YB 2A5AA 2XWAA 1TIOA 2HNTE 2QV1A 3QWCH 3FAOA 3RLWH 3A7WA 3MTYA 4MQAA 1UHBA 1ZSLA 3NXPA 3PB1E 5F6MA 1LHFH 2ZDAH 1K28D 1OWJA 1U6QA 1SFIA 4JYUH 2PV9B 1EB1H 2AEIH 3UFAA 3ZZ4A 1DDJA 1VR1H 3A89A 8KME2 2A0QB 1ANDA 5G4BA 4AGJA 4NWKA 1N8OB 3GCTF 5TCCA 2GZ9A 1O3KA 4ZMAH 1MBMA 1PQAA 2PKAB 4CRFA 2WV4A 5H4IB 3UQVA 2GZ7A 1EJAA 2VIQA 5BPEA 2Z3DA 1GL0E 1TBQH 5A09A 3PYHA 3RXPA 3NKKA 2BX4A 2K1QA 1MUEB 2D8WA 4LXBH 2B7DH 1ZTJA 3KF2A 3KQDA 1ZPCA 1SHYA 1C1TA 5L2YH 5CHAB 2W7SA 1RS0A 2ZDLA 3JZ2B 3ZZ9A 4ZHLU 5LPRA 3FFGA 1UVPA 5EG4A 1HGTH 1EP5A 1Z6JH 2CMYA 3M7QA 1S5SA 2GT8A 1ACBE 1TPSA 1O32A 1SGNE 1SMFE 2Z94A 1GGDC 1OP8A 4NZQA 1MKWH 2CJIA 4Y6DA 4YOGA 3RLYH 1XXDA 5SGAE 5AFZH 1DWBH 1ZGIA 1VITH 1SQOA 2A4RA 2KAIB 2P3UB 1DWEH 1C5PA 3P8GA 3MNBA 4IBLH 2ZTXA 1PPHE 1WOFA 1YKTA 1FUJA 3ZZDA 3GDVA 1C2DA 1P11E 3FP8E 3TJNA 6ESTA 1DSUA 1EZXC 3P70B 5F8TA 4BAQB 3KN2A 5LPFA 3SORA 2V0BA 3TU7H 1O2NA 3GY3A 3B8JA 4B73A 2CXVA 2O8TA 2HVXA 5AFYH 1EPTA 1P01A 3I77A 1PPFE 4J1YA 6LPRA 1O5GH 3UR6A 3VB6A 4Y8YA 4O9VA 4GLYA 2HWLB 1EOJA 4DIHH 1A2CH 1E36B 1ORFA 3HKJB 1O2VA 3EE0B 3WY8A 1QB1A 2O8LA 2Z3CA 2HRVA 5E8EH 1UVTH 1O5EH 2ZIQH 1GMCG 3W95A 1ETTH 2AMQA 3MWIU 3A85A 2A1DB 1KY9A 2Y5FA 2ZFRH 4WVPE 5PTPA 1GHZA 3LOXA 2PUQH 2XCFA 1K1MA 2H1UA 2Z9IA 4Y0ZE 5EXNA 2QAAA 3CP7A 1CT0E 3TITA 1SR5C 3SU2A 1P57B 1O34A 1ANBA 2DE9A 3ZVAA 2FLBH 1KLTA 1C5OH 4ZHAA 3VB7A 3VFEA 1S82A 1UVSH 1F7ZA 1IHTH 5CMXH 3KL6A 2BMGB 4CRCA 5K0HA 4DG4A 5DGJA 2BVSH 3E0PB 1SLVB 1K1NA 4JZFH 3RU4E 4HI3A 2Y5HA 1CGIE 2TPIZ 2VJ1A 3MNCA 3PWCA 4ZUHA 1ELVA 4ESTE 1ETRH 3TLOA 3LGTA 2Y80A 1CSOE 1YPHE 4Y8XA 2BLOA 1YBWA 1SFQB 1O2IA 1VGCB 1ZJDA 2QXJA 1C2GA 3ZZ8A 3HATH 2EC9H 4YLQH 2FEQH 3GISB 1GBTA 1A0LA 3KEEA 1AN1E 5A8ZA 1YM0A 4Z6AH 1NU9A 2FO9A 5L30H 2GKVE 2ZCKP 1ESBA 3BG8A 3ZVFA 3A8DA 2QA9E 2VWLA 5JYIA 4KTUA 1G3EA 2XRCA 5EW2H 2G81E 1TA6A 1QRZA 1WYKA 2J9NA 1C5ZB 3MO9A 1AWHB 1C5NH 1BB0B 4KELA 2GX4A 3QTOH 4A92A 1O2QA 3VB3A 1GBAA 1AMHA 4ZKSU 1O3NA 4CRBA 1DLKB 4Q7ZA 3QGJA 2BX3A 2Z9GA 4YOIA 3BIUH 4X1RU 3F9EA 3C1KA 3AAVA 1TNKA 3CS0A 1OP2A 2SGFE 4FU9A 5GDSH 1B5GH 2ZHFH 2CF9H 1JIRA 1L0ZA 5C67A 1FPCH 1GBMA 4XOJA 3U8RH 1HPGA 4H4FA 2WUBA 1GVLA 3PLPA 3VGCB 4XBDA 2VIWA 1OWHA 1ABIH 3P6ZB 5E2PA 5JBCS 4Q80A 4H6TA 1UMAH 5FBIA 4GCHG 1CA0B 3RM2H 1CA8B 1B7XB 1O3GA 2HNTF 2GDEH 2XTTB 3P8NA 1HXEH 3ITIA 1NFWA 1G2LA 3QZQA 1VZQH 3T62A 4INLA 3GY6A 1V2UT 4ABGA 3O8RA 3K6YA 2QXIA 3MNXA 1BRCE 4NSYA 1JRTA 2A2QH 4YESB 1CGJE 1QJ6B 3PMJA 4AFUA 2Y81A 1TGBA 1ZHMA 2AFQB 4GHQA 1ELCA 1QNJA 1BUIA 3M37A 2OINA 4J2YB 4U32A 1L1GA 2W3KA 2YNAA 1AB9C 2ANMH 2Q6GA 5JPMH 1SGPE 2YOLA 1TX6A 3EA7A 5JB9S 2F9OA 2GZ8A 4K2YA 1UK2A 1P2NA 5A8YA 3KQEA 1P9SA 1KLJH 5LGOA 1AD8H 1BA8B 4AGKA 4DCDA 1ZSJA 2JETC 1SVPA 2P3TB 2ZTYA 7GCHG 1DXPA 4OS1A 1KYNA 2BZ6H 1TABE 1C1OA 1GMCF 3ODDA 4OS6A 1HDTH 1IAUA 1K1JA 4IMZA 4XDEA 1FIZA 5A2MH 3FZZA 1UK3A 3PROA 4RN6A 3UWIA 1D3DB 2ZFTA 4CHAC 4X1SU 3ZZ6A 2G52A 2QYIA 2ZU4A 3H7OA 4JK5A 3BIVH 3SJOA 3R0FA 1TGNA 2FPZA 4Z0KA 1V2TT 4X1QU 1BTXA 3A7TA 4UE7H 4Y7AA 1SGFG 3RXEA 4CH8B 2R3UA 1O37A 1T7CA 1P04A 3Q00A 1CGHA 4A1VA 1Z71A 5E0GA 4X8TH 2DE8A 2FWWA 1VCPA 3SBKA 4B2BA 1EP6A 3P92A 4R0IA 2G5NA 3SI3H 1O0DH 1Y5BT 2BY8X 2GV6A 2VIDA 1TAWA 2CHAB 1TBZH 3SGAE 1TNJA 2ZFPH 1G30B 1HJAC 1ELAA 3AAUA 1LHCH 2UUKB 1JMOH 4BOHA 1AY6H 1O2HA 2OUAA 4NGAH 1IQMA 4K5ZA 4WY3A 1GBJA 3RXAA 1QJ1B 1C2JA 1W12U 1ARCA 1DY9A 2GV7A 3U9AH 1V6DA 5DP4A 1F5KU 1GJAB 4DIIH 2FESH 1YCPH 5GJ4B 1H8DH 3TJVA 1MTWA 1E0FD 1UK4A 1OKXA 2ULLA 3HGPA 3NCLA 3RXLA 2H9EH 1TOMH 3HGNA 2G8TA 1N8OC 3RXKA 4BXSA 4OS2A 1TFXA 2ZI2H 3T5FH 4O97A 1QBNA 1QURH 3F9FA 3PLKA 4ABIA 1C5VA 2XYAA 1TNGA 3PMBB 2PGQB 3S7HB 1GHYH 2AGGX 1OWKA 1T31A 1V2KT 2AMPA 1RTKA 2D26C 2C8XB 4FVBA 2I6QA 5L2ZH 3UNRA 1C5SA 1O35A 3KQCA 3GCTG 3ZZ5A 1BTZA 2WYGA 5CHAC 1Z8IB 1PQ7A 2A2XH 4MDSA 1W10U 1K2I1 5JB8S 3GYMA 4X2WA 1P10A 2GCHF 2O8UA 1K1OA 1TRYA 1XMNB 3DHKH 3HK3B 2Y7XA 3VB5A 5FCRA 3T26A 1PFXC 1HJ8A 2ZC9H 1GDQA 1CT2E 3SUFA 5HXFA 2QN5T 5E2OA 2FI3E 2A32A 2HNTC 5T3HA 1IQGA 3IG6B 2ZP0H 3BTHE 3M3VA 4DT7B 3A83A 1C2MA 4GCHF 1MH0A 1YPGH 1QRWA 4WXVA 3GCHC 1GHWH 5DP5A 4X1PU 1GMDF 3K9XB 3M36A 1FAXA 1TPOA 5ABWA 1HIAB 1MZAA 3LDXH 4Y79A 2F9UA 2FOEA 5EQRA 3S7KB 1THSH 3RXQA 1O2GH 2ZTZA 3FP7E 3MH6A 4AG2A 1C5LH 1FY4A 1V2RT 3LJJA 3B23B 3E1XB 1GWAA 4XBCA 2FIRH 2ZHEH 7ESTE 4CRDA 1PPGE 1WTGH 2P16A 3UOUA 1AZZA 1ELTA 2FX4A 1BHXF 1GI2A 1CU1A 3SJIA 1BITA 1VCWA 1UCYH 4ZH8A 4JK6A 1GHAF 1PJPA 1F0SA 1Z7KA 1NPMA 3BG4B 1HB0B 3SUDA 3OX7U 7GCHF 3PTNA 4TWWA 1V2OT 1HV7A 1WCZA 1AVWA 4MPUA 3D23A 4I7YH 4TY7A 2HGTH 3BF6H 1WQVH 4I8LA 4UD9H 3RMLH 3ODFA 1J14A 2RCEA 5FX6A 4ZXYH 1FQ3A 1TWXB 3EAJA 1AFQB 1DWCH 3LGYA 1DE7H 1O5AB 2FX6A 4CR9A 4H6SB 1GJDB 1C5UA 1ZYOA 4AORA 1TRNA 2BOHB 4ISOA 1ZTKA 3OYPA 1C1RA 1EPTB 1PQ5A 3GDSA 4AZ2B 3S9AA 1EAUA 4LK4A 1O39A 5C1XA 2V35A 1EJMA 2WUCA 1VGCC 3RXTA 1ZLRA 2ILNA 1GJ8B 1ZR0A 5A0AE 3LH3A 1LVMA 4KKDA 1P02A 1O3HA 1O3CA 1YCPM 1P2IA 3UOPA 1LHGH 2EEKA 1HBTH 4ABFA 1H1BA 4I8JA 2VIOA 2D2DA 1IQIA 2W3IA 2OXSA 1A46H 4BTTB 3CENA 4LZ4B 1MD7A 3L33A 1LHEH 1QL7A 2FOGA 3UNSA 1SB1H 2F9NA 2J4IA 4AYVB 1OYTH 3SV9A 4Q2KA 1DITH 3QZRA 1EZSC 1JIMA 3H7TA 1FY8E 5DG6A 1H9LB 5C1YA 1TX7A 3E3TA 1NC6A 1O5BB 2TIOA 4ISNA 3V12A 1L1JA 1KIGH 3R3GB 3QO6A 3RC5A 1AFEH 2PKSB 3KGPA 3RC6A 1CQQA 2BDAA 5FCKA 1DX5M 3LONA 1GBDA 4UFGH 1QIXB 1TMBH 1QJ7B 1CT4E 4UFEH 1YPHC 2QXGA 5GXPA 1AUTC 1C1QA 2BY6X 5DK1A 2ZFSA 2QY0B 1HIAA 4DOQA 3LT3A 2HOBA 2ALPA 3VGCC 1P0SH 2Z9KA 1A3EH 2A7CA 1EKBB 5ESTE 1JXPA 1JBUH 1QA0A 1O2KA 1ANCA 4X6MA 1EATA 1W3CA 2TRMA 4I8GA 1OWEA 3S0NA 3MU1A 4GVUA 1CA0C 4A7IB 2PW8H 3U69H 1P9UA 1HAVA 1EASA 1QB6A 1RRKA 1MTNB 1FDPA 3A8BA 3BV9B 4LZ1H 2QXHA 3UR9A 3SHAH 2ZQ2A 3PMAB 2BB4A 1THRH 3MHWU 2G4TA 5EODA 2BHGA 4D7FA 3LIWA 4JYTA 3A88A 4IN1A 1QB9A 1MCTA 2SGAA 2BD8A 5T6FA 1AHTH 4UONA 1NM6A 1HUTH 6CHAB 1Y8TA 2BM2A 2BD9A 1GI4A 5ETXA 4TWYA 3O8CA 2VVUA 2ZU2A 2J2UA 1AU8A 3TH3H 1DS2E 3RXDA 1GHVH 5HGGA 1B0FA 1Q3XA 1SLUB 1VCQA 3F6UH 1O5FH 1LQEA 2OC0A 1BMAA 4Q7YA 1K1PA 2XBYA 4NIVA 2BLVA 1HLTH 5IYTA 1ZPBA 2BDCA 2PSYA 4WXIA 1T32A 2Y5GA 4MG3A 1BJVA 1GI9B 3CS7A 4I31A 4B71A 3D65E 3NK8A 3TK9A 1WU1A 1MKXH 4Y71A 1GDUA 1EQ9A 1ZMJA 2FYQA 1O2YA 3RU4D 2R2MB 4PROA 3A7VA 1PPZA 4FUEA 1T4VH 1SG8B 2P93A 4UEHH 3Q3KA 2UWOA 1SOTA 4INKA 1V2VT 3A7ZA 1PPCE 2ZKSA 1FY1A 3BEFB 1P8VC 3U8TH 2ZO3H 2ZEBA 4K1SA 1PPBH 2JH5D 1OP0A 2A7HA 1HAHH 2BXTH 1HYLA 2VH6A 3MMGA 1F92A 1RJXB 4K8YA 3SV8A 4MTBA 4X6PA 1TNLA 2FI5E 2RA3A 2ANKH 8ESTE 1PYTC 2XBVA 4YT7H 1V2NT 5FPTA 4AFQA 1EAWA 1QTFA 2CHAC 1UTPA 1BOQA 4NA8A 3BTQE 1BRAA 2GTBA 1DVAH 2ZG0H 3K65B 3RXUA 4NA7A 2F9PA 1DT2A 1SSXA 2FOAA 4BNRA 1O3OA 4GSOA 5E0JA 1W8BH 1QL9A 1MKWK 1NRPH 3M7TA 1F0UA 1Z1IA 2M5TA 3A82A 4TY6A 3ZYEA 3TGJE 1FZZA 2J94A 4TPYA 2ZNKH 5EXMA 1Y3WA 1UVUH 2RG3A 3K2UA 2VGCB 1D3PB 4BXWA 3M3SA 4DJZB 4WMFA 2P8OB 4A6LA 1K1IA 2H6MA 3FP6E 3TGIE 1TPPA 1BTPA 1P05A 2FOBA 4NSVA 5ESBA 2PWXA 2EI6A 5GPIB 1C1VH 1AZ8A 1IQEA 4U2WA 2JH0D 1A0HB 3VEQB 1SQTA 3AVZA 3KCGH 1TALA 2J34A 2ASUB 3P8OA 1O2PA 1A0JA 1UTOA 3OY6U 3BTGE 1BMLA 1S0RA 1W2KH 2GVFA 3UNQA 1UTLM 3UIRA 1O3DA 1YC0A 2SFAA 2FXRA 1GVZA 4MPWA 2XC4A 1NT1A 4HGCA 2Z7FE 2ODQA 2BDHA 1V2LT 5A0CA 5F8ZA 2UUJB 1GBBA 3RMMH 2GCHG 5IDKA 2ZGXH 3E90B 3I29A 2FI4E 2H5DA 3JZ1B 5C5OA 5EPNA 1GJBB 3UREA 8GCHG 1P2KA 2PTCE 1GI3A 1SLWB 3MFJA 4X0WU 3MO3A 1G32B 2W26A 4TYDA 3V3MA 3EYDA 3TNTA 1YPLH 1GHBF 3SNCA 1XVMA 3SNEA 5EW1H 4AB9A 1Z1JA 3SZNA 1RIWB 1A7SA 4IC5A 5T6GA 3G01A 1GMDG 1UVOA 3RXCA 2ZHDA 1O2RA 4IC6A 1IOEA 2XCNA 1FMGA 4NIWA 2OCVB 3KIDU 1J15A 1WUNH 4AX9H 3T28A 3TJUA 2ZDMA 1ESAA 2GD4B 3QK1A 3PLBA 3VB4A 1A5GH 5LH8A 4B76A 2FODA 1LHDH 4NFFA 5J4SA 3BG4C 5LPEA 4ABBA 2STBE 1D6RA 1V3XA 2A7JA 2ZF0H 3L6PA 5DP8A 3RXVA 2A4GA 3TGKE 5B6OA 5TCAA 3SNAA 1D3QB 1GHAG 4FXGH 2BVXH 4FUBA 1OX1A 1SGRE 4ZXXH 4Y10E 2PR3A 2C8ZB 1GI1A 2J95A 4B2CA 3Q3YA 1AFQC 3N7OA 1SBWA 1HAYB 3PV4A 2OC1A 2A31A 4NZLA 2HLCA 3GY4A 3UQOA 1AO5A 2G00A 3MI4A 1Y5UT 1C9TA 4D9QA 3LH1A 1MZDA 3E6PH 1EPTC 4CR5A 1RTLA 1VITG 1GI6A 1L4DA 3SOSA 4E7NA 1IQLA 1RFNA 2B9LA 3E8LA 4XBBA 2ZPQA 1DFPA 3B9FH 2PTNA 4XFQA 4ISHH 3DFLA 4NCYA 1Y3XA 4X8UH 4THNH 3SV7A 1DSTA 1EOLA 2WPLS 4UDWH 5EGMA 1FXYA 4AG1A 5C2ZA 1DXWA 3BTKE 1T8MA 1NFXA 2BLQA 3SV6A 2A4OA 1KXAA 4TPIZ 1KXBA 1BTYA 1SHHB 4M7GA 1AE8H 3K6ZA 9ESTA 1K9OE 3M5MA 3U1IB 3SN8A 3A7YA 2UUFB 5C3NA 1O3FA 1BJUA 2WV5A 5C1UA 4K8BA 1ARBA 2OD3B 3ATKA 1HRTH 2P95A 4ABHA 2QGRA 3IITA 4IGDA 2PKSC 1QHRB 2BLWA 1Q2WA 5E0HA 1N6XA 1MTSA 5FHTA 3ATLA 1XKAC 1XUGA 4D76A 1C5RA 3GICB 2OTVA 1ZMNA 1K22H 1O31A 4BAHB 1O3BA 1O2OA 1BBRH 3ZYDA 1D3TB 2G5VA 1IQKA 1EZUC 8LPRA 1GG6B 4KTSA 2LPRA 2GCTB 1IQNA 1HJ9A 1XUJA 1FNIA 4BAKB 1ZRBA 4ABDA 1P06A 3U98H 2CV3A 1S6HA 1SL3A 2AH4X 2FYRA 2AERH 2BD2A 4K69A 3SHCH 1J9CH 2Q6FA 3MYWA 1SLXB 4KTCA 1TA2A 3MU4A 2C4FH 1MTNC 4NG9H 2FOCA 4K60A 2O8WA 1UTNA 3QDZB 1AVGH 1DUAA 2XWBI 4UFDH 1SPJA 3ELAH 8GCHF 3TIUA 1CHOF 1P3EA 4OS5A 1WTHD 4OS7A 1INCA 4B74A 1ZGVA 1YYY1 1HAZB 6CHAC 1F0RA 3UY9A 1ZMLA 4JZ1A 1ZOMA 2GMTB 1C2HA 3ZZ3A 3ZZBA 1QQUA 3TH4H 1WSSH 4X8VH 4DGJA 3SJ8A 5A0BA 3C27B 1GPZA 3A8CA 3LGIA 3E16B 1AWFH 1E35B 4A5TS 1FY5A 2HPPH 2ZGBH 1DUEA 3TVJB 1LMWB 2TGTA 5J4QA 2G55A 1W0ZU 3T25A 3GY7A 4YTAA 2ZECA 3MH5A 2SNVA 1Y5AT 4AB8A 2THFB 1VJ9U
chains in the Genus database with same CATH superfamily
1HAVB 2RDLA 1GCTB 3V7TA 4FUHA 2TBSA 1P2OA 2IPHA 4IS5A 1IQHA 2SGPE 1BMMH 3DT0H 4CRGA 1TBRH 1O2TA 2FS9A 3ZVEA 1FPHH 1YCPK 3SQHE 1IHSH 4CREA 4ZCNA 1D6WA 3SJKA 2AGEX 1GI7B 5HM2A 2ZDVH 3SU4A 1LKAA 2FZZA 4RKOB 1SGFA 4X6OA 1COWD 4SGAE 5C17A 4YM9A 1N6YA 1W14U 3A7XA 1O30A 4X2XA 2Z6BD 3BEUA 3BTDE 4ISLA 1LVOA 2ZCLP 2WYJA 2VIPA 4ACBA 1YLNA 2ZFFH 2R0LA 1VITF 1ZHPA 2UWLA 3LJOA 1LKBA 2F91A 1TQ0B 1EX3A 3PTBA 3NWUA 2C3SA 2FDAA 3ZVCA 3V13A 2SGQE 3SO3A 4AOQA 1BTWA 2PSXA 1HAGE 2JETB 4MNVA 3SU0A 1FI8A 2AIPA 1XUHA 2FP7B 2O8MA 1QQ4A 1KXDA 4HFPB 1FV9A 1ELEE 2KCAA 3AW0A 1XVOA 1RGQA 1H9IE 1Z6EA 1LCYA 2R0KA 5I46H 1GI5A 1O2WA 3F0PA 2BVRH 2NU0E 4CHAB 3LU9B 2B5TB 1HCGA 1HAXB 2P8OC 3RXSA 2PFEA 1C4V2 1UTMA 3RMNH 3VXFH 1AE5A 1P09A 4WH6A 4GHTA 1LQDB 1YLCA 3M61U 1YPKH 1GCDA 5EJZA 4BTIB 1XM1A 3BTME 1QA7A 3LGVA 1YGCH 4U01A 4WJG2 4MVNA 3RXRA 4KGAA 4MNYA 1A1RA 1BBRE 1NZQH 3GS9A 2FOMB 3QLPH 4ASHA 4F4OC 1O2MA 2JH6D 3L3TA 1SOZA 2EI7A 5AHGH 1CVWH 1OWIA 2G51A 1JWTA 2PGBB 4M9FA 1UCYK 4OS4A 3FVFB 4GAWA 1F2SE 1ZRKA 5GWZA 1WXRA 2AYWA 4E06H 1ABJH 1C1UH 4Q7XA 2XW9A 1DWDH 1WQSA 3LKWA 5AF9H 4K3JA 1AUJA 1BTHH 1E1RD 3IWMA 5DKMA 3F2GA 3SUGA 1NY22 3OSYA 2VINA 4RKJB 5F8XA 1BMNH 3UTUH 6GCHF 3GYLB 2PLXA 4VGCB 3EA8A 3F9HA 3HK6B 1O3AA 5FX5A 1O3EA 2C90B 3M5OA 3NUMA 4B1TA 4CH2B 3P95A 2OQUA 1BZXE 4GPGA 1C5TA 3SU3A 1Z8JB 2KCOA 3VXEH 1ZTLA 3M5NA 1RIWC 3A8AA 1TNHA 5A8XA 1FLEE 2VNTA 5DPAA 2WPMS 5DJ7A 3UWJH 4YO9A 3MU0A 3RUOA 1V2PT 2ZGJA 1MQ6A 4D9RA 1T8OA 1GHBG 1BRBE 1ZJKA 1KXCA 3SU5A 3BTEE 1TGCA 2A5KA 1L1NA 1O5CB 3A84A 1P12E 1C4U2 3QX5H 2ZZUH 2XBWA 4I32A 3QN7A 1T8NA 4RT1A 1FAKH 2BD4A 5BRRE 2BQ7B 5EOKA 1S85A 2OLGA 3BTTE 2W6JD 1C2FA 1E34B 3SV2H 2ZHQH 1BRUP 1AI8H 4NFEA 2V3HH 4ABJA 2ODPA 2NU2E 3D62A 3M3TA 1A3BH 3KYGA 2R9PA 3PV5A 2Q1JA 4X2YA 5EQSA 1UCYE 2CGAA 4U30A 4D7GA 1L4ZA 4DURA 4AFSA 3OY5U 1YPJH 1O2UA 1TRMA 1O5DH 1O3LA 1TMTH 1K21H 1CBWB 2SGEE 2BD5A 3GCHB 2TGPZ 4FUCA 3SNBA 7LPRA 1OOKB 3TH2H 1C2KA 3F1SB 2XC0A 1NRRH 3RXMA 1BQYA 1SGYE 1KLIH 1AKSB 1SGQE 1S0QA 1YP9A 2XXLA 3AASA 2R3YA 2BDYA 1P3CA 2EI8A 5CDFE 1Z8GA 2ZA5A 1YPMH 1DPOA 1S81A 2SGDE 3M5LA 5EU8A 2JKHA 1P2MA 2OP9A 3PM3A 3ATIA 4AN7A 1JRSA 1WBGB 2ZGCA 2PUXB 1KDQB 2G4UA 1TONA 1TQ7B 3GCNA 1QRXA 4WMDA 3PO1B 3DUXH 3SNDA 2ZU3A 1AGJA 2QF4A 2P59A 1SQRA 5GCHG 3T27A 1O38A 1GBCA 1IQFA 1Y3VA 4GUXA 2EA3A 3SGBE 4MLFB 3RXIA 1SGDE 1SGEE 3OTJE 1QCPA 3ZV9A 1OWDA 1FY3A 3KQBA 3OU0A 4JYVH 1Q31A 4D8NA 1CHGA 1MMJN 4YT6H 1GDNA 1Y3YA 1PQ8A 4LOYH 3RXJA 5JBTA 1NRQH 1F5RA 1J8AA 1N1LA 1O2LA 3D49H 2FOFA 3HPTB 3SGQE 1NS3A 1OXGA 4MPXA 2GT7A 4FU8A 2I6SA 1ETSH 1C1NA 1HAIH 2A5IA 1NO9H 2R2WU 3T29A 1MU6B 2ZDKA 5L6NH 2OQ5A 1DANH 3TNSA 4AFZA 1GG6C 1GMHG 3BTFE 5F03A 2GCTC 5GIBA 3E0NB 1HAOH 5DP7A 4BTUB 1OS8A 2V6NA 1EB2A 1V2JT 3A87A 4WWYA 1FONA 3M7UA 2VB0A 1O2SA 2BQ6B 1EAIA 1C1MA 1AVXA 2ESTE 4RSPA 4E05H 2PKAA 3TK6A 4BANB 2UUYA 1A5IA 1GJ6A 3E91A 1QY6A 1O2JA 1C5XB 3SU1A 1T4UH 1J17T 1TE0A 3ATWA 3ATMA 2BY7X 1MKXK 1GVKB 4ZROA 1UTQA 4A1TA 2BTCE 3U8OH 3MOCA 2WZQA 4DVAU 4BAMB 1JOUB 4Y0YE 1E37B 3UUZA 1C2LA 1SGTA 2ZPRA 1DM4B 3S9CA 1G3DA 2TGDA 4ZKRU 1WAYB 1V2MT 3U1JB 3ESTA 3A86A 2FS8A 3GY5A 3UPEA 2QF3A 4JMYA 1NROH 2NU3E 4NWLA 3STJA 4I33A 2C93B 3TJOA 2WPDD 3ZZAA 2BYAX 3GCOA 1XUKA 4TT3D 2GMTC 3T2NA 3GDUA 2UWPA 4K1TA 2ZHWH 1GJ9B 1SI5H 1CHOG 1TNIA 1PYTD 4RI0A 3RP2A 1QZ8A 1SQAA 1F5LA 2STAE 1EUFA 2KAIA 4E7RG 1ANEA 4ZAEA 1W7GH 4YOJA 2WPKS 2QE7D 1FJSA 1OHHD 2BOKA 3NRLA 4FUGA 4KP0A 4ASUD 1HFDA 3RC4A 1MBQA 4X2VA 1LO6A 3TPIZ 1NESE 3DSPA 1K1LA 1LVBA 2AMDA 1LDTT 1H8IH 1AKSA 5HM9A 1FIWA 1KTTB 1F0TA 1Y3UA 2OC8A 1MAXA 2KFWA 1O2XA 2WPIS 1GCTC 2BDGA 3PWBA 3TK5A 1RTFB 2M2AA 1AQ7A 4CRAA 5C20A 2O9QA 3SU6A 5KECA 3S69A 2PHBA 2TGAA 2KCYA 3DFJA 2Y6TA 4P02A 1LPKB 1GHXH 1KDQA 1P03A 4X6NA 4ABAA 1O33A 1BT7A 1S6FA 1TGSZ 1UTJA 1XX9A 3V0XA 2VWNA 4XE4A 1GGDB 5T6DA 2BZAA 1SGCA 4MNXA 1A61H 2ZGHA 4F49A 4WF8A 2XC5A 1P2QA 2J92A 1GBHA 3Q3XA 1HAPH 1IQJA 2EY4C 2W7UA 2WV9A 3NPSA 3PMHB 2FLRH 1SC8U 2DUCA 1GJ5H 3O8DA 1MQ5A 2HPQH 4IW4E 3P8FA 2L74A 1W11U 4WH8A 4ZKNU 2VIVA 1BDAA 1KXFA 1T8LA 4UFFH 4ZHMU 1BHXB 4ISIH 3N99A 4H42U 4JZIA 4O3TA 3ZVBA 3RDZA 3W1EA 3M35A 1WV7H 1H9HE 4FOUC 5F53A 1C1SA 5C5NA 3Q77A 1ELFA 1G3BA 2BY9X 5EXLA 1C9PA 1C5MD 1MCVA 2C8YB 3GY2A 1ELDE 1CE5A 1NN6A 3STIA 2GGVB 4TSFD 5JBBS 1TPAE 4O03A 3RXBA 2ODYB 4IMQA 1EXFA 3LGUA 5GCHF 3BN9A 3FO8D 2NU1E 4X8SH 2QCYA 2V3OH 1V2WT 1W0JD 5AVDA 2IN2A 2F9BH 2Z9LA 1GBKA 4JCNA 3A80A 2ZPSA 1MU8B 3VPKA 3RXGA 4O3UA 1TYNA 1B0EA 3MNSA 2QIQA 3F9GA 4YLUA 1H4WA 2L6OA 3F0OA 4MPVA 3LPRA 1YLDA 5EJ1A 3MU5A 2OBOA 1ZSKA 1SGIB 2P94A 4FUDA 1G9IE 2NWNA 2VVVA 1UJ1A 2ANWA 1GJ7B 1OSSA 2YNBA 1J16A 5DP3A 2K0QA 4YZUA 1NU7B 1XXFA 1C5WB 1MTVA 3OAAD 1G36A 1O36A 1P2JA 4B75A 1DY8A 2AGIX 1QFKH 1G2MA 2WPJS 1C2EA 1A5HA 1GMHF 3ZZCA 1D4PB 3DSGA 5EPYA 2BY5X 2VH0A 1TOCB 1AIXH 3MQKC 1O3IA 4NIXA 2GDDA 3DD2H 5K7RA 1TLDA 2SNWA 4K1EA 1Z8RA 2Y82A 1TMUH 1C5QA 3EQ0H 1X7AC 3MH7A 3MU8A 4B2AA 1XKBC 4VGCC 1ESTA 2Z9JA 4HTCH 2ZU5A 2OBQA 2ZU1A 3FANA 5TJXA 3ZVDA 2FM2A 2VWOA 3EE7A 3Q76A 1ZZZA 4I8HA 1C2IA 1EZQA 1GI8B 5CE1A 3LC3A 3KYFA 2B0FA 1TX8A 1BCUH 7KMEH 6GCHG 5EQQA 2FOHA 4FUIA 2F83A 4FUFA 1O2ZA 3RMOH 2QC2A 4SGBE 4Y8ZA 1BTUA 5I25A 1GJ4H 1TGTA 1RXPA 2D1JA 3EGKH 3EA9A 4A1XA 3SW2B 1UO6A 5DP6A 1ELBA 1G37A 3DA9B 5FAHA 2C8WB 1D9IA 4JZDH 4R8TB 1BIOA 5HYOA 2H9HA 4F55A 1W13U 1THPB 5CHBA 2BQWB 1LPZB 3QUMP 1LPGB 2BDIA 3SQEE 2F3CE 4I8KA 3AW1A 2F43B 1QR3E 2OC7A 5DO4H 1NBME 1G3CA 1UHBB 2JJ1D 3S9BA 2ZWLH 3QTVH 3MH4A 2GP9B 2Y7ZA 2FTLE 1MTUA 2Q6DA 1CBWC 1OYQA 3O8BA 1GBIA 2RFKC 1ZPZA 1GBLA 2A45B 2ZQ1A 2VWMA 4XSKU 3F68H 2FMJA 3F2HA 5FPSA 1C1PA 1FN8A 1VJAU 3GY8A 3P17H 4ZKOU 1M9UA 1O3JA 2HALA 3SI4H 1HXFH 1DOJA 2BXUH 2NU4E 3RXFA 1CO7E 3NZIA 2XBXA 5HKKD 1GBEA 2CN0H 2B8OH 2ZDNA 1BBRK 1C4Y2 2KX4A 4B6FA 2EQNA 4DY7B 1KXEA 1S84A 4HZHA 2VVCA 1XUFA 5HIYA 1L2EA 4F48B 2VU8E 2XNIA 1QBVH 3PO1C 1QGFA 9LPRA 1EAXA 1H8HD 1E38B 4X1NU 1W7XH 1DLEA 1KSNA 4JZEH 1AB9B 1MD8A 1V2QT 5JBAS 1NRSH 1PPEE 3LC5A 3ZV8A 4DW2U 3ZVGA 5FXLA 3SYJA 3BEIB 3RM0H 2ANYA 2J38A 4AYYB 4OGYA 3W94A 1NFUA 1O3MA 3KNXA 1ZHRA 4FVDA 2QF0A 2CF8H 1C1WH 4CBOA 4FU7A 4Z1MD 4QT8C 1NFYA 2F9VA 4MNWA 2W5EA 4Y11E 3URCA 3RXHA 1GJCB 3A81A 5FPYA 1TB6H 5FBEA 2VGCC 4WMEA 2IOTA 3EDXB 3QGNB 1YPEH 4INHA 4Y76A 1RD3B 1XUIA 4Y7BA 2BDBA 1EJNA 1GI0A 1QBOA 3MO6A 2LNCA 3BSQA 3FN8A 1KTSB 1ID5H 2H2ZA 1NTPA 3RU4T 3SJ9A 3URDA 4NIYA 3H5CB 3ENSB 2ZCHP 4ABEA 1DICA 1O3PB 2IJOB 1FN6A 5JDUB 2FTMA 1W0YH 1QL8A 2BD3A 2H5CA 1HNEE 2LP6A 2WPHS 3I78A 3KQ5A 1NRNH 3FZDA 2P3FH 2ZFQH 2BD7A 1LTOA 1V2ST 2GJGA 2XNDD 1OPHB 1S83A 1GBFA 2A4QA 4FUJA 2H9TH 1ELGA 3PRDA 3KHVA 1MAYA 3ZZ7A 4NA9H 2Z3EA 4OGXA 1HJAB 2ALVA 2WINI 3GOVB 3SUEA 4BAOB 2AIQA 2AS9A 1LVYA 5HMAA 1A4WH 3BTWE 3HKIB 3RXOA 4CBNA 3LGWA 2RA0A 1YF4A 2JJ2D 5DP9A 1Y59T 1GL1A 1UTKA 4IN2A 1C5YB 2A5AA 2XWAA 1TIOA 2HNTE 2QV1A 3QWCH 3FAOA 3RLWH 3A7WA 3MTYA 4MQAA 1UHBA 1ZSLA 3NXPA 3PB1E 5F6MA 1LHFH 2ZDAH 1K28D 1OWJA 1U6QA 1SFIA 4JYUH 2PV9B 1EB1H 2AEIH 3UFAA 3ZZ4A 1DDJA 1VR1H 3A89A 8KME2 2A0QB 1ANDA 5G4BA 4AGJA 4NWKA 1N8OB 3GCTF 5TCCA 2GZ9A 1O3KA 4ZMAH 1MBMA 1PQAA 2PKAB 4CRFA 2WV4A 5H4IB 3UQVA 2GZ7A 1EJAA 2VIQA 5BPEA 2Z3DA 1GL0E 1TBQH 5A09A 3PYHA 3RXPA 3NKKA 2BX4A 2K1QA 1MUEB 2D8WA 4LXBH 2B7DH 1ZTJA 3KF2A 3KQDA 1ZPCA 1SHYA 1C1TA 5L2YH 5CHAB 2W7SA 1RS0A 2ZDLA 3JZ2B 3UB0A 3ZZ9A 4ZHLU 5LPRA 3FFGA 1UVPA 5EG4A 1HGTH 1EP5A 1Z6JH 2CMYA 3M7QA 2HLDD 1S5SA 2GT8A 4FETA 1ACBE 1TPSA 1O32A 1SGNE 1SMFE 2Z94A 1YY3A 1GGDC 1OP8A 3DCLA 1MKWH 4NZQA 2CJIA 4Y6DA 4YOGA 3RLYH 1XXDA 5SGAE 5AFZH 3UAIC 1DWBH 1ZGIA 1VITH 1SQOA 2A4RA 2KAIB 2P3UB 1DWEH 1C5PA 3P8GA 3MNBA 4IBLH 2ZTXA 1PPHE 1WOFA 1YKTA 1FUJA 3ZZDA 5FL7D 3GDVA 1C2DA 1P11E 3FP8E 4Q63A 3TJNA 6ESTA 5T1VA 1DSUA 1EZXC 3P70B 5F8TA 4BAQB 3KN2A 5LPFA 3SORA 2V0BA 3TU7H 1O2NA 3GY3A 3B8JA 4B73A 2CXVA 2O8TA 2HVXA 5AFYH 1EPTA 1P01A 3I77A 1PPFE 4J1YA 6LPRA 1O5GH 3UR6A 3VB6A 4Y8YA 4O9VA 4GLYA 2HWLB 1EOJA 4DIHH 1A2CH 1E36B 1ORFA 3HKJB 1O2VA 3EE0B 3WY8A 1QB1A 2O8LA 2Z3CA 2HRVA 5E8EH 1UVTH 4B6EA 1O5EH 2VBCA 2ZIQH 1GMCG 2XOKD 1ETTH 3W95A 1SKYE 2AMQA 3MWIU 3A85A 2A1DB 1KY9A 2Y5FA 2ZFRH 4WVPE 5PTPA 1GHZA 3LOXA 2PUQH 2XCFA 1K1MA 2H1UA 3DSOA 2Z9IA 4Y0ZE 5EXNA 2QAAA 3CP7A 1CT0E 2OK5A 3TITA 1SR5C 3SU2A 1P57B 1EFRD 1O34A 1ANBA 2DE9A 3ZVAA 2FLBH 1KLTA 1C5OH 4ZHAA 2IJD1 3VB7A 3VFEA 1S82A 1UVSH 1F7ZA 1IHTH 3FOAA 5CMXH 3KL6A 2BMGB 4CRCA 5K0HA 4DG4A 5DGJA 2BVSH 3E0PB 1SLVB 1K1NA 4JZFH 3RU4E 4HI3A 2Y5HA 1CGIE 2TPIZ 2VJ1A 3MNCA 3PWCA 4ZUHA 1ELVA 4ESTE 1ETRH 3TLOA 3LGTA 2Y80A 1CSOE 1YPHE 4Y8XA 2BLOA 1YBWA 1SFQB 1O2IA 1VGCB 1ZJDA 2QXJA 1C2GA 3ZZ8A 3HATH 2EC9H 4Q4LA 4YLQH 2FEQH 3GISB 1GBTA 1A0LA 3KEEA 1AN1E 5A8ZA 1YM0A 2J98A 4Z6AH 2KCPA 1NU9A 2FO9A 2YMSB 5L30H 2GKVE 2ZCKP 1ESBA 3BG8A 3ZVFA 3A8DA 2QA9E 2VWLA 5JYIA 4KTUA 1G3EA 2XRCA 5EW2H 2G81E 1TA6A 1QRZA 1WYKA 2J9NA 1C5ZB 3MO9A 1AWHB 1C5NH 1BB0B 4KELA 2GX4A 3QTOH 4A92A 1O2QA 3VB3A 1GBAA 1AMHA 4ZKSU 1O3NA 4CRBA 1DLKB 4Q7ZA 3QGJA 2BX3A 2Z9GA 4YOIA 3BIUH 4X1RU 3F9EA 3C1KA 3AAVA 1TNKA 3CS0A 1OP2A 2SGFE 4FU9A 5GDSH 2WHXA 1B5GH 2ZHFH 2CF9H 1JIRA 1L0ZA 5C67A 1FPCH 1GBMA 4XOJA 3U8RH 1HPGA 4H4FA 2WUBA 1GVLA 4AC9A 3PLPA 3VGCB 4XBDA 2VIWA 1OWHA 1ABIH 3P6ZB 5E2PA 5JBCS 4Q80A 4H6TA 1UMAH 5FBIA 4GCHG 1CA0B 3RM2H 1CA8B 1B7XB 1O3GA 2HNTF 2GDEH 2XTTB 3P8NA 3WW7A 1HXEH 3ITIA 1NFWA 1G2LA 3QZQA 1VZQH 3T62A 4INLA 3PRBA 3GY6A 1V2UT 4ABGA 3O8RA 3K6YA 2QXIA 3MNXA 1BRCE 4NSYA 1JRTA 2A2QH 4YESB 1CGJE 1QJ6B 3PMJA 4AFUA 2Y81A 1TGBA 1ZHMA 2AFQB 4GHQA 5C0TA 1ELCA 1QNJA 1BUIA 3M37A 2OINA 4J2YB 4U32A 1L1GA 2W3KA 2YNAA 1AB9C 2AHME 2ANMH 2Q6GA 5JPMH 1SGPE 2YOLA 1TX6A 3EA7A 5JB9S 2F9OA 2GZ8A 4K2YA 1UK2A 1P2NA 5A8YA 3KQEA 1P9SA 1KLJH 5LGOA 1AD8H 1BA8B 4AGKA 4DCDA 1ZSJA 2JETC 1SVPA 2P3TB 2ZTYA 7GCHG 1DXPA 4OS1A 1KYNA 2BZ6H 1TABE 1C1OA 1GMCF 2CK3D 3ODDA 1HDTH 1IAUA 1K1JA 4IMZA 4OS6A 1FIZA 4XDEA 5A2MH 3FZZA 1UK3A 5B6LA 3PROA 4RN6A 3UWIA 1D3DB 2ZFTA 4CHAC 4X1SU 3ZZ6A 2G52A 2QYIA 2ZU4A 3H7OA 2HVYB 4JK5A 3BIVH 3SJOA 3R0FA 1TGNA 2FPZA 4Z0KA 1V2TT 3N7EA 4X1QU 1BTXA 3A7TA 4UE7H 4Y7AA 1SGFG 3RXEA 4CH8B 2R3UA 1O37A 1T7CA 3SZEA 1P04A 3Q00A 1CGHA 4A1VA 1Z71A 5E0GA 4X8TH 2DE8A 4I86A 2FWWA 1VCPA 3SBKA 4B2BA 1EP6A 3P92A 4R0IA 2G5NA 3SI3H 1O0DH 1Y5BT 2BY8X 2GV6A 2VIDA 1TAWA 2CHAB 1TBZH 1H8ED 3SGAE 1TNJA 2ZFPH 1G30B 1HJAC 5IK2D 1ELAA 3AAUA 1LHCH 2UUKB 1E79D 1JMOH 4BOHA 1AY6H 1O2HA 2OUAA 4NGAH 1IQMA 4K5ZA 4WY3A 5DN6D 1GBJA 3RXAA 1QJ1B 1K0HA 1C2JA 1W12U 1ARCA 1DY9A 2GV7A 3U9AH 1V6DA 5DP4A 1F5KU 1GJAB 4DIIH 2FESH 4OM9A 1YCPH 5GJ4B 1H8DH 3TJVA 1MTWA 1E0FD 1UK4A 1OKXA 2ULLA 3HGPA 3NCLA 3RXLA 3ZIAD 2H9EH 1NBMD 1TOMH 3HGNA 2G8TA 1N8OC 3RXKA 4BXSA 4OS2A 1TFXA 2ZI2H 3T5FH 4O97A 1QBNA 1QURH 3F9FA 3PLKA 4ABIA 1C5VA 2XYAA 1TNGA 3VG8A 3PMBB 2PGQB 3S7HB 1GHYH 2AGGX 1OWKA 1T31A 1V2KT 2AMPA 1RTKA 2D26C 2C8XB 1BMFD 4FVBA 2I6QA 5L2ZH 3UNRA 1C5SA 1O35A 3KQCA 3GCTG 3ZZ5A 1BTZA 2WYGA 3WWFA 5CHAC 1Z8IB 1PQ7A 2A2XH 4MDSA 1W10U 1K2I1 5JB8S 3GYMA 4RT0A 4X2WA 1P10A 2GCHF 2O8UA 1K1OA 1TRYA 1XMNB 3DHKH 3HK3B 2Y7XA 3VB5A 5FCRA 3T26A 1PFXC 5EJLA 1HJ8A 2ZC9H 1GDQA 1CT2E 3SUFA 5HXFA 2QN5T 5E2OA 2FI3E 2A32A 2HNTC 5T3HA 1IQGA 3IG6B 2ZP0H 3BTHE 3M3VA 4DT7B 3A83A 1C2MA 4GCHF 1MH0A 1YPGH 1QRWA 4WXVA 5DSFA 3GCHC 1GHWH 5DP5A 4X1PU 1FX0B 1GMDF 3K9XB 3M36A 1FAXA 1TPOA 5ABWA 3H09A 1HIAB 1MZAA 3LDXH 4Y79A 2F9UA 2FOEA 5EQRA 3S7KB 1THSH 3RXQA 1O2GH 2ZTZA 3FP7E 3MH6A 4AG2A 1C5LH 1FY4A 1V2RT 3LJJA 3B23B 3E1XB 1GWAA 4XBCA 2FIRH 2ZHEH 7ESTE 4CRDA 1PPGE 1WTGH 2P16A 3UOUA 1AZZA 1ELTA 2FX4A 1BHXF 4ACAA 1GI2A 1CU1A 3SJIA 1BITA 1VCWA 1UCYH 4ZH8A 2KM0A 4HG6A 4JK6A 1GHAF 1PJPA 3OEED 1F0SA 1Z7KA 1NPMA 3BG4B 1HB0B 3SUDA 3OX7U 7GCHF 5KGOA 1YWUA 3PTNA 4TWWA 1V2OT 1HV7A 1WCZA 1AVWA 2W6ID 4MPUA 3D23A 4I7YH 4TY7A 2HGTH 3BF6H 1WQVH 4I8LA 4UD9H 3RMLH 3ODFA 1J14A 2RCEA 5FX6A 4ZXYH 1FQ3A 1TWXB 3EAJA 1AFQB 1DWCH 3LGYA 1DE7H 1O5AB 2FX6A 4CR9A 4H6SB 1GJDB 1C5UA 1ZYOA 4AORA 1TRNA 2BOHB 4ISOA 1ZTKA 3OYPA 1C1RA 1EPTB 1PQ5A 3GDSA 4AZ2B 3S9AA 1EAUA 4LK4A 1O39A 5C1XA 2V35A 1EJMA 2WUCA 1VGCC 3RXTA 1ZLRA 2ILNA 1GJ8B 1ZR0A 5A0AE 3LH3A 1LVMA 4KKDA 1P02A 1O3HA 1O3CA 1YCPM 1P2IA 3U28C 3UOPA 1LHGH 2EEKA 1HBTH 4ABFA 1H1BA 4I8JA 2VIOA 2D2DA 1IQIA 2YMSC 2W3IA 2OXSA 1A46H 3OEHD 4BTTB 3CENA 4LZ4B 1MD7A 3L33A 1LHEH 1QL7A 2FOGA 3UNSA 1SB1H 2F9NA 2J4IA 4AYVB 1OYTH 3SV9A 4Q2KA 1DITH 3QZRA 3F3BA 1EZSC 1JIMA 3H7TA 1FY8E 5DG6A 1H9LB 5C1YA 1TX7A 3E3TA 1NC6A 1O5BB 2TIOA 4ISNA 3V12A 1L1JA 1KIGH 3R3GB 3QO6A 3RC5A 1AFEH 2PKSB 3KGPA 3RC6A 1CQQA 2BDAA 5FCKA 1DX5M 1S6LA 3LONA 1GBDA 4UFGH 1QIXB 1TMBH 1QJ7B 1CT4E 4UFEH 1YPHC 2QXGA 5GXPA 1AUTC 1C1QA 2BY6X 5DK1A 2ZFSA 2QY0B 1HIAA 4DOQA 3OTPA 3LT3A 2HOBA 2ALPA 3VGCC 1P0SH 2Z9KA 1A3EH 2A7CA 1EKBB 2J98B 2J97A 1JXPA 5ESTE 1JBUH 1QA0A 1O2KA 1ANCA 4X6MA 1EATA 1W3CA 2TRMA 4I8GA 1OWEA 3S0NA 3MU1A 4GVUA 1CA0C 4A7IB 2PW8H 3U69H 1P9UA 1HAVA 1EASA 1QB6A 1RRKA 1MTNB 1FDPA 3A8BA 3BV9B 4LZ1H 2QXHA 3UR9A 3SHAH 2ZQ2A 3PMAB 2BB4A 1THRH 3MHWU 2G4TA 5EODA 2BHGA 4D7FA 3LIWA 4JYTA 3A88A 4IN1A 1QB9A 1MCTA 2SGAA 5C0UA 2BD8A 2JDID 5T6FA 1AHTH 4UONA 1NM6A 1HUTH 6CHAB 1Y8TA 2BM2A 3WWBA 2BD9A 1GI4A 5ETXA 4TWYA 3O8CA 2VVUA 2YMSD 2ZU2A 2J2UA 1UW7A 1AU8A 3TH3H 1DS2E 1W0KD 3RXDA 5GNDA 1GHVH 5HGGA 1B0FA 3AK5A 1Q3XA 1SLUB 4XRNA 1VCQA 3F6UH 1O5FH 1LQEA 2OC0A 1BMAA 4Q7YA 1K1PA 2XBYA 4NIVA 2BLVA 1HLTH 5IYTA 1ZPBA 2IPQX 2BDCA 2PSYA 4WXIA 1T32A 2Y5GA 4MG3A 2JIZD 1BJVA 1GI9B 3CS7A 4I31A 4B71A 3D65E 3NK8A 3TK9A 1WU1A 1MKXH 4Y71A 1GDUA 1EQ9A 1ZMJA 2FYQA 1O2YA 3RU4D 5C94A 2R2MB 4PROA 3A7VA 1PPZA 4FUEA 1T4VH 1SG8B 2P93A 4UEHH 3Q3KA 2UWOA 1SOTA 5EIYA 4INKA 1V2VT 3A7ZA 1PPCE 2ZKSA 1FY1A 3BEFB 1P8VC 3U8TH 2ZO3H 2ZEBA 4K1SA 1PPBH 2JH5D 1OP0A 2A7HA 1HAHH 2BXTH 1HYLA 2VH6A 3MMGA 1F92A 1RJXB 4K8YA 3SV8A 4MTBA 4X6PA 1TNLA 2FI5E 2RA3A 2ANKH 8ESTE 1PYTC 3N7DA 2XBVA 4YT7H 1V2NT 5FPTA 4AFQA 1EAWA 1QTFA 2CHAC 1UTPA 3FKSD 1BOQA 4NA8A 3BTQE 1BRAA 2GTBA 1DVAH 2ZG0H 3K65B 3RXUA 4NA7A 2F9PA 1DT2A 1SSXA 2FOAA 4BNRA 1O3OA 4GSOA 5E0JA 1W8BH 1QL9A 1MKWK 1NRPH 3M7TA 1F0UA 1Z1IA 2M5TA 3A82A 4TY6A 3ZYEA 3TGJE 1FZZA 2J94A 4TPYA 2ZNKH 5EXMA 1Y3WA 1VKYA 1UVUH 2RG3A 3K2UA 2VGCB 1D3PB 4BXWA 3F2FA 3M3SA 4DJZB 4WMFA 2P8OB 4A6LA 1K1IA 2H6MA 3FP6E 3TGIE 1TPPA 1BTPA 1P05A 2FOBA 4NSVA 5ESBA 2PWXA 3PV2A 2EI6A 5GPIB 1C1VH 1AZ8A 1IQEA 4U2WA 2JH0D 1A0HB 3VEQB 1SQTA 3AVZA 3KCGH 1TALA 2J34A 2ASUB 3P8OA 1O2PA 1A0JA 1UTOA 3OY6U 3BTGE 1BMLA 1S0RA 1W2KH 2GVFA 3UNQA 1UTLM 3UIRA 1O3DA 1YC0A 2SFAA 2FXRA 1GVZA 4MPWA 2XC4A 1NT1A 4HGCA 2Z7FE 2ODQA 2BDHA 1V2LT 1WDIA 5A0CA 5F8ZA 2UUJB 1GBBA 3RMMH 2GCHG 4YXWD 5IDKA 2ZGXH 3E90B 3I29A 2FI4E 2H5DA 3JZ1B 5C5OA 5EPNA 1GJBB 3UREA 8GCHG 1P2KA 2PTCE 1E1QD 1GI3A 1SLWB 3MFJA 4X0WU 3MO3A 1G32B 2W26A 4TYDA 3V3MA 3EYDA 3TNTA 1YPLH 1GHBF 3SNCA 1XVMA 3SNEA 5EW1H 4AB9A 1Z1JA 2RDEA 3SZNA 1RIWB 1A7SA 4IC5A 5T6GA 3G01A 1GMDG 1UVOA 3RXCA 2ZHDA 1O2RA 4IC6A 1IOEA 2XCNA 1FMGA 4NIWA 3CNRA 2OCVB 3KIDU 1J15A 1WUNH 4AX9H 2V7QD 3T28A 3TJUA 2ZDMA 1ESAA 2GD4B 3QK1A 4XD7D 3PLBA 3VB4A 1A5GH 5LH8A 4B76A 2FODA 1LHDH 2J5UA 4NFFA 5J4SA 3BG4C 5LPEA 4ABBA 2STBE 5HIZA 1D6RA 1V3XA 2A7JA 2ZF0H 3L6PA 5DP8A 3RXVA 4DT4A 1MABB 2A4GA 5KEDA 3TGKE 5B6OA 5TCAA 3SNAA 1D3QB 1GHAG 4FXGH 2BVXH 4FUBA 1OX1A 1SGRE 4ZXXH 4Y10E 2PR3A 2C8ZB 2PP6A 1GI1A 2J95A 1KMHB 4B2CA 3Q3YA 1AFQC 3N7OA 1SBWA 1HAYB 3PV4A 2OC1A 2A31A 4NZLA 2HLCA 3GY4A 3UQOA 1AO5A 2G00A 3MI4A 1Y5UT 1C9TA 4D9QA 3LH1A 1MZDA 3E6PH 1EPTC 4CR5A 1RTLA 1VITG 1GI6A 1L4DA 3SOSA 4E7NA 1IQLA 1RFNA 2QF5A 2B9LA 3E8LA 4XBBA 2ZPQA 1DFPA 3B9FH 2PTNA 4XFQA 4ISHH 3DFLA 4NCYA 1Y3XA 4X8UH 4THNH 3SV7A 1DSTA 1EOLA 2V3MA 2WPLS 4UDWH 5EGMA 1FXYA 4AG1A 5C2ZA 1DXWA 3BTKE 1T8MA 1NFXA 2BLQA 3SV6A 2A4OA 1KXAA 4TPIZ 1KXBA 1BTYA 1SHHB 4M7GA 3OFND 4P00A 1AE8H 3K6ZA 2K8IA 9ESTA 1K9OE 3M5MA 3U1IB 3SN8A 3A7YA 2UUFB 5C3NA 1O3FA 1BJUA 2WV5A 5C1UA 4K8BA 1ARBA 2OD3B 3ATKA 1HRTH 2P95A 4ABHA 2QGRA 3IITA 4IGDA 2PKSC 1QHRB 2BLWA 1Q2WA 5E0HA 1N6XA 1MTSA 5FHTA 3ATLA 1XKAC 1XUGA 4D76A 1C5RA 3GICB 2OTVA 1ZMNA 1K22H 1O31A 2KZ4A 4BAHB 1O3BA 1O2OA 1BBRH 3ZYDA 1D3TB 2G5VA 1IQKA 1EZUC 8LPRA 1GG6B 4KTSA 2GCTB 2LPRA 1IQNA 1HJ9A 1XUJA 1FNIA 4BAKB 1ZRBA 4ABDA 2WSSD 1P06A 3U98H 2CV3A 2F4LA 1S6HA 1SL3A 2AH4X 2FYRA 2AERH 2BD2A 4K69A 3SHCH 1J9CH 2Q6FA 3MYWA 1SLXB 4KTCA 1TA2A 3MU4A 2C4FH 1MTNC 4NG9H 2LELA 2FOCA 2KR7A 4K60A 2O8WA 1UTNA 3QDZB 1AVGH 1DUAA 2XWBI 4UFDH 1SPJA 3ELAH 8GCHF 3TIUA 1CHOF 1P3EA 4OS5A 1WTHD 4OS7A 1INCA 4B74A 1ZGVA 1YYY1 1HAZB 6CHAC 1F0RA 3UY9A 1ZMLA 4JZ1A 1ZOMA 2GMTB 1C2HA 3ZZ3A 3ZZBA 1QQUA 3TH4H 1WSSH 4X8VH 4DGJA 3SJ8A 5A0BA 3C27B 1GPZA 3A8CA 3LGIA 3E16B 1AWFH 1E35B 4A5TS 1FY5A 2HPPH 2ZGBH 1DUEA 3TVJB 1LMWB 2TGTA 5J4QA 2G55A 1W0ZU 3T25A 3GY7A 4YTAA 2ZECA 3MH5A 2SNVA 1Y5AT 4AB8A 3OE7D 2THFB 1VJ9U
chains in the Genus database with same CATH topology
1HAVB 2RDLA 1GCTB 3V7TA 4FUHA 2TBSA 1P2OA 2IPHA 4IS5A 1IQHA 2SGPE 1BMMH 3DT0H 4CRGA 1TBRH 1O2TA 2FS9A 3ZVEA 1FPHH 1YCPK 3SQHE 1IHSH 4CREA 1D6WA 3SJKA 2AGEX 1GI7B 5HM2A 2ZDVH 3SU4A 1LKAA 2FZZA 4RKOB 1SGFA 4X6OA 4SGAE 4YM9A 1N6YA 1W14U 3A7XA 1O30A 4X2XA 2Z6BD 3BEUA 3BTDE 4ISLA 1LVOA 2ZCLP 2WYJA 2VIPA 2ZFFH 2R0LA 1VITF 1ZHPA 2UWLA 3LJOA 1LKBA 2F91A 1TQ0B 1EX3A 3PTBA 3NWUA 2C3SA 2FDAA 3ZVCA 3V13A 2SGQE 3SO3A 4AOQA 1BTWA 2PSXA 1HAGE 2JETB 4MNVA 3SU0A 1FI8A 2AIPA 1XUHA 2FP7B 2O8MA 1QQ4A 1KXDA 4HFPB 1FV9A 1ELEE 3AW0A 1XVOA 1RGQA 1H9IE 1Z6EA 1LCYA 2R0KA 5I46H 1GI5A 1O2WA 2BVRH 2NU0E 4CHAB 3LU9B 2B5TB 1HCGA 1HAXB 2P8OC 3RXSA 2PFEA 1C4V2 1UTMA 3RMNH 3VXFH 1AE5A 1P09A 4WH6A 4GHTA 1LQDB 1YLCA 3M61U 1YPKH 1GCDA 4BTIB 1XM1A 3BTME 1QA7A 3LGVA 1YGCH 4U01A 4WJG2 4MVNA 3RXRA 4KGAA 4MNYA 1A1RA 1BBRE 1NZQH 2FOMB 3QLPH 4ASHA 4F4OC 1O2MA 2JH6D 3L3TA 1SOZA 2EI7A 5AHGH 1CVWH 1OWIA 2G51A 1JWTA 2PGBB 1UCYK 4OS4A 3FVFB 4GAWA 1F2SE 1ZRKA 5GWZA 2AYWA 4E06H 1ABJH 1C1UH 4Q7XA 2XW9A 1DWDH 1WQSA 3LKWA 5AF9H 4K3JA 1AUJA 1BTHH 3IWMA 5DKMA 3SUGA 1NY22 3OSYA 2VINA 4RKJB 5F8XA 1BMNH 3UTUH 6GCHF 3GYLB 2PLXA 4VGCB 3EA8A 3F9HA 3HK6B 1O3AA 5FX5A 1O3EA 2C90B 3M5OA 3NUMA 4B1TA 4CH2B 3P95A 2OQUA 1BZXE 4GPGA 1C5TA 3SU3A 1Z8JB 3VXEH 1ZTLA 3M5NA 1RIWC 3A8AA 1TNHA 5A8XA 1FLEE 2VNTA 5DPAA 2WPMS 5DJ7A 3UWJH 4YO9A 3MU0A 3RUOA 1V2PT 2ZGJA 1MQ6A 4D9RA 1T8OA 1GHBG 1BRBE 1ZJKA 1KXCA 3SU5A 3BTEE 1TGCA 2A5KA 1L1NA 1O5CB 3A84A 1P12E 1C4U2 3QX5H 2ZZUH 2XBWA 4I32A 3QN7A 1T8NA 1FAKH 2BD4A 5BRRE 2BQ7B 5EOKA 1S85A 2OLGA 3BTTE 1C2FA 1E34B 3SV2H 2ZHQH 1BRUP 1AI8H 4NFEA 2V3HH 4ABJA 2ODPA 2NU2E 3D62A 3M3TA 1A3BH 2R9PA 2Q1JA 4X2YA 5EQSA 1UCYE 2CGAA 4U30A 4D7GA 1L4ZA 4DURA 4AFSA 3OY5U 1YPJH 1O2UA 1TRMA 1O5DH 1O3LA 1TMTH 1K21H 1CBWB 2SGEE 2BD5A 3GCHB 2TGPZ 4FUCA 3SNBA 7LPRA 1OOKB 3TH2H 1C2KA 3F1SB 2XC0A 1NRRH 3RXMA 1BQYA 1SGYE 1KLIH 1AKSB 1SGQE 1S0QA 1YP9A 2XXLA 3AASA 2R3YA 2BDYA 1P3CA 2EI8A 1Z8GA 2ZA5A 1YPMH 1DPOA 1S81A 2SGDE 3M5LA 5EU8A 2JKHA 1P2MA 2OP9A 3PM3A 3ATIA 4AN7A 1JRSA 1WBGB 2ZGCA 2PUXB 1KDQB 2G4UA 1TONA 1TQ7B 3GCNA 1QRXA 4WMDA 3PO1B 3DUXH 3SNDA 2ZU3A 1AGJA 2P59A 5GCHG 3T27A 1O38A 1GBCA 1IQFA 1Y3VA 4GUXA 2EA3A 3SGBE 4MLFB 3RXIA 1SGDE 1SGEE 3OTJE 1QCPA 3ZV9A 1OWDA 1FY3A 3KQBA 3OU0A 4JYVH 1Q31A 4D8NA 1CHGA 1MMJN 4YT6H 1GDNA 1Y3YA 1PQ8A 4LOYH 3RXJA 5JBTA 1NRQH 1F5RA 1J8AA 1N1LA 1O2LA 3D49H 2FOFA 3HPTB 3SGQE 1NS3A 1OXGA 4MPXA 2GT7A 4FU8A 2I6SA 1ETSH 1C1NA 1HAIH 2A5IA 1NO9H 2R2WU 3T29A 1MU6B 2ZDKA 5L6NH 2OQ5A 1DANH 3TNSA 4AFZA 1GG6C 1GMHG 3BTFE 5F03A 2GCTC 5GIBA 3E0NB 1HAOH 5DP7A 4BTUB 1OS8A 2V6NA 1EB2A 1V2JT 3A87A 4WWYA 1FONA 3M7UA 2VB0A 1O2SA 2BQ6B 1EAIA 1C1MA 1AVXA 2ESTE 4RSPA 4E05H 2PKAA 3TK6A 4BANB 2UUYA 1A5IA 1GJ6A 3E91A 1QY6A 1O2JA 1C5XB 3SU1A 1T4UH 1J17T 1TE0A 3ATWA 3ATMA 2BY7X 1MKXK 1GVKB 4ZROA 1UTQA 4A1TA 2BTCE 3U8OH 3MOCA 4DVAU 4BAMB 1JOUB 4Y0YE 1E37B 3UUZA 1C2LA 1SGTA 2ZPRA 1DM4B 3S9CA 1G3DA 2TGDA 4ZKRU 1WAYB 1V2MT 3U1JB 3ESTA 3A86A 2FS8A 3GY5A 3UPEA 2QF3A 4JMYA 1NROH 2NU3E 4NWLA 3STJA 4I33A 2C93B 3TJOA 3ZZAA 2BYAX 3GCOA 1XUKA 2GMTC 3T2NA 3GDUA 2UWPA 4K1TA 2ZHWH 1GJ9B 1SI5H 1CHOG 1TNIA 1PYTD 3RP2A 1SQAA 1F5LA 2STAE 1EUFA 2KAIA 4E7RG 1ANEA 4ZAEA 1W7GH 4YOJA 2WPKS 1FJSA 2BOKA 4KP0A 4FUGA 1HFDA 3RC4A 1MBQA 4X2VA 1LO6A 3TPIZ 1NESE 1K1LA 1LVBA 2AMDA 1LDTT 1H8IH 1AKSA 5HM9A 1FIWA 1KTTB 1F0TA 1Y3UA 2OC8A 1MAXA 1O2XA 2WPIS 1GCTC 2BDGA 3PWBA 3TK5A 1RTFB 1AQ7A 4CRAA 5C20A 2O9QA 3SU6A 3S69A 2PHBA 2TGAA 3DFJA 2Y6TA 1LPKB 1GHXH 1KDQA 1P03A 4X6NA 4ABAA 1O33A 1BT7A 1S6FA 1TGSZ 1UTJA 1XX9A 3V0XA 2VWNA 4XE4A 1GGDB 5T6DA 2BZAA 1SGCA 4MNXA 1A61H 2ZGHA 4F49A 4WF8A 2XC5A 1P2QA 2J92A 1GBHA 3Q3XA 1HAPH 1IQJA 2W7UA 3NPSA 3PMHB 2FLRH 1SC8U 2DUCA 1GJ5H 3O8DA 1MQ5A 2HPQH 4IW4E 3P8FA 1W11U 4WH8A 4ZKNU 2VIVA 1BDAA 1KXFA 1T8LA 4UFFH 4ZHMU 1BHXB 4ISIH 4O3TA 4H42U 4JZIA 3ZVBA 3RDZA 3M35A 1WV7H 1H9HE 1C1SA 5C5NA 3Q77A 1ELFA 1G3BA 2BY9X 5EXLA 1C9PA 1C5MD 1MCVA 2C8YB 3GY2A 1ELDE 1CE5A 1NN6A 3STIA 2GGVB 5JBBS 1TPAE 4O03A 3RXBA 2ODYB 4IMQA 1EXFA 3LGUA 5GCHF 3BN9A 2NU1E 4X8SH 2QCYA 2V3OH 1V2WT 5AVDA 2IN2A 2F9BH 2Z9LA 1GBKA 4JCNA 3A80A 2ZPSA 1MU8B 3VPKA 3RXGA 4O3UA 1TYNA 1B0EA 3MNSA 2QIQA 3F9GA 4YLUA 1H4WA 4MPVA 3LPRA 1YLDA 3MU5A 2OBOA 1ZSKA 1SGIB 2P94A 4FUDA 1G9IE 2NWNA 2VVVA 1UJ1A 2ANWA 1GJ7B 1OSSA 2YNBA 1J16A 5DP3A 4YZUA 1NU7B 1XXFA 1C5WB 1MTVA 1G36A 1O36A 1P2JA 4B75A 1DY8A 2AGIX 1QFKH 1G2MA 2WPJS 1C2EA 1A5HA 1GMHF 3ZZCA 1D4PB 5EPYA 2BY5X 2VH0A 1TOCB 1AIXH 1O3IA 4NIXA 2GDDA 3DD2H 5K7RA 1TLDA 2SNWA 4K1EA 1Z8RA 2Y82A 1TMUH 1C5QA 3EQ0H 1X7AC 3MH7A 3MU8A 4B2AA 1XKBC 4VGCC 1ESTA 2Z9JA 4HTCH 2ZU5A 2OBQA 2ZU1A 3FANA 5TJXA 3ZVDA 2FM2A 2VWOA 3Q76A 1ZZZA 4I8HA 1C2IA 1EZQA 1GI8B 5CE1A 3LC3A 2B0FA 1TX8A 1BCUH 7KMEH 6GCHG 5EQQA 2FOHA 4FUIA 2F83A 4FUFA 1O2ZA 3RMOH 2QC2A 4SGBE 4Y8ZA 1BTUA 5I25A 1GJ4H 1TGTA 1RXPA 2D1JA 3EGKH 3EA9A 4A1XA 3SW2B 1UO6A 5DP6A 1ELBA 1G37A 3DA9B 5FAHA 2C8WB 1D9IA 4JZDH 4R8TB 1BIOA 5HYOA 2H9HA 1W13U 1THPB 2BQWB 1LPZB 3QUMP 1LPGB 2BDIA 3SQEE 2F3CE 4I8KA 3AW1A 1QR3E 2OC7A 5DO4H 1G3CA 1UHBB 3S9BA 2ZWLH 3QTVH 3MH4A 2GP9B 2Y7ZA 2FTLE 1MTUA 2Q6DA 1CBWC 1OYQA 3O8BA 1GBIA 1ZPZA 1GBLA 2A45B 2ZQ1A 2VWMA 4XSKU 3F68H 2FMJA 5FPSA 1C1PA 1FN8A 1VJAU 3GY8A 3P17H 4ZKOU 1M9UA 1O3JA 2HALA 3SI4H 1HXFH 1DOJA 2BXUH 2NU4E 3RXFA 1CO7E 3NZIA 2XBXA 1GBEA 2CN0H 2B8OH 2ZDNA 1BBRK 1C4Y2 4DY7B 1KXEA 1S84A 4HZHA 2VVCA 1XUFA 1L2EA 2VU8E 2XNIA 1QBVH 3PO1C 1QGFA 9LPRA 1EAXA 1E38B 4X1NU 1W7XH 1DLEA 1KSNA 4JZEH 1AB9B 1MD8A 1V2QT 5JBAS 1NRSH 1PPEE 3LC5A 3ZV8A 4DW2U 3ZVGA 5FXLA 3BEIB 3RM0H 2ANYA 2J38A 4AYYB 4OGYA 3W94A 1NFUA 1O3MA 3KNXA 1ZHRA 4FVDA 2QF0A 2CF8H 1C1WH 4CBOA 4FU7A 4QT8C 1NFYA 2F9VA 4MNWA 2W5EA 4Y11E 3URCA 3RXHA 1GJCB 3A81A 5FPYA 1TB6H 5FBEA 2VGCC 4WMEA 2IOTA 3EDXB 3QGNB 1YPEH 4INHA 4Y76A 1RD3B 1XUIA 4Y7BA 2BDBA 1EJNA 1GI0A 1QBOA 3MO6A 2LNCA 3BSQA 1KTSB 1ID5H 2H2ZA 1NTPA 3RU4T 3SJ9A 3URDA 4NIYA 3H5CB 3ENSB 2ZCHP 4ABEA 1DICA 1O3PB 2IJOB 1FN6A 5JDUB 2FTMA 1W0YH 1QL8A 2BD3A 2H5CA 1HNEE 2WPHS 3I78A 1NRNH 3FZDA 2P3FH 2ZFQH 2BD7A 1LTOA 1V2ST 1OPHB 1S83A 1GBFA 2A4QA 4FUJA 2H9TH 1ELGA 3KHVA 1MAYA 3ZZ7A 4NA9H 2Z3EA 4OGXA 1HJAB 2ALVA 2WINI 3GOVB 3SUEA 4BAOB 2AIQA 2AS9A 1LVYA 5HMAA 1A4WH 3BTWE 3HKIB 3RXOA 4CBNA 3LGWA 2RA0A 1YF4A 5DP9A 1Y59T 1GL1A 1UTKA 4IN2A 1C5YB 2A5AA 2XWAA 1TIOA 2HNTE 2QV1A 3QWCH 3FAOA 3RLWH 3A7WA 3MTYA 4MQAA 1UHBA 1ZSLA 3NXPA 3PB1E 5F6MA 1LHFH 2ZDAH 1K28D 1OWJA 1U6QA 1SFIA 4JYUH 2PV9B 1EB1H 2AEIH 3UFAA 3ZZ4A 1DDJA 1VR1H 3A89A 8KME2 2A0QB 1ANDA 5G4BA 4AGJA 4NWKA 1N8OB 3GCTF 5TCCA 2GZ9A 1O3KA 4ZMAH 1MBMA 1PQAA 2PKAB 4CRFA 2WV4A 5H4IB 3UQVA 2GZ7A 1EJAA 2VIQA 5BPEA 2Z3DA 1GL0E 1TBQH 5A09A 3PYHA 3RXPA 3NKKA 2BX4A 2K1QA 1MUEB 2D8WA 4LXBH 2B7DH 1ZTJA 3KF2A 3KQDA 1ZPCA 1SHYA 1C1TA 5L2YH 5CHAB 2W7SA 1RS0A 2ZDLA 3JZ2B 3ZZ9A 4ZHLU 5LPRA 3FFGA 1UVPA 5EG4A 1HGTH 1EP5A 1Z6JH 2CMYA 3M7QA 1S5SA 2GT8A 1ACBE 1TPSA 1O32A 1SGNE 1SMFE 2Z94A 1GGDC 1OP8A 4NZQA 1MKWH 2CJIA 4Y6DA 4YOGA 3RLYH 1XXDA 5SGAE 5AFZH 1DWBH 1ZGIA 1VITH 1SQOA 2A4RA 2KAIB 2P3UB 1DWEH 1C5PA 3P8GA 3MNBA 4IBLH 2ZTXA 1PPHE 1WOFA 1YKTA 1FUJA 3ZZDA 3GDVA 1C2DA 1P11E 3FP8E 3TJNA 6ESTA 1DSUA 1EZXC 3P70B 5F8TA 4BAQB 3KN2A 5LPFA 3SORA 2V0BA 3TU7H 1O2NA 3GY3A 3B8JA 4B73A 2CXVA 2O8TA 2HVXA 5AFYH 1EPTA 1P01A 3I77A 1PPFE 4J1YA 6LPRA 1O5GH 3UR6A 3VB6A 4Y8YA 4O9VA 4GLYA 2HWLB 1EOJA 4DIHH 1A2CH 1E36B 1ORFA 3HKJB 1O2VA 3EE0B 3WY8A 1QB1A 2O8LA 2Z3CA 2HRVA 5E8EH 1UVTH 1O5EH 2ZIQH 1GMCG 3W95A 1ETTH 2AMQA 3MWIU 3A85A 2A1DB 1KY9A 2Y5FA 2ZFRH 4WVPE 5PTPA 1GHZA 3LOXA 2PUQH 2XCFA 1K1MA 2H1UA 2Z9IA 4Y0ZE 5EXNA 2QAAA 3CP7A 1CT0E 3TITA 1SR5C 3SU2A 1P57B 1O34A 1ANBA 2DE9A 3ZVAA 2FLBH 1KLTA 1C5OH 4ZHAA 3VB7A 3VFEA 1S82A 1UVSH 1F7ZA 1IHTH 5CMXH 3KL6A 2BMGB 4CRCA 5K0HA 4DG4A 5DGJA 2BVSH 3E0PB 1SLVB 1K1NA 4JZFH 3RU4E 4HI3A 2Y5HA 1CGIE 2TPIZ 2VJ1A 3MNCA 3PWCA 4ZUHA 1ELVA 4ESTE 1ETRH 3TLOA 3LGTA 2Y80A 1CSOE 1YPHE 4Y8XA 2BLOA 1YBWA