1FXYA

Coagulation factor xa-trypsin chimera inhibited with d-phe-pro-arg-chloromethylketone
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
228
structure length
228
Chain Sequence
IVGGYNCKDGEVPWQALLINEENEGFCGGTILSEFYILTAAHCLYQAKRFKVRVGDRNTEQEEGGEAVHEVEVVIKHNRFTKETYDFDIAVLRLKTPITFRMNVAPASLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COAGULATION FACTOR XA-TRYPSIN CHIMERA
publication title New enzyme lineages by subdomain shuffling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 49
structure length 228
sequence length 228
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fxyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fxyA02
1BITA 1SLUB 3VB6A 4NIXA 3NPSA 3LGYA 1O5EH 1Z8JB 3TJNA 1O2YA 1IQKA 2GCHG 1CHGA 3ZV8A 2ZTYA 2OC1A 3KHVA 3P8FA 1MCTA 1HIAA 2ZU5A 3UOPA 1ZLRA 1C5XB 1BHXB 3SI4H 1Z71A 2FIRH 1UCYK 3BN9A 7ESTE 2OCVB 1RTLA 2Q6FA 5ESTE 1GL0E 1ID5H 4GUXA 2BOKA 3ZVCA 5L6NH 3V13A 1DLEA 1VGCB 3BTQE 3T28A 4R8TB 1FJSA 3TGKE 1OP0A 3SNAA 2GTBA 2ALPA 3SNDA 5E2PA 3PB1E 3S9CA 3M7UA 4O97A 5TCAA 3TNTA 2Y80A 1QB1A 1JBUH 2UWPA 1O32A 3PMJA 4YT6H 4ABBA 4ABFA 2ZHWH 4MG3A 1PPFE 3M3VA 3PMHB 3HKJB 3T25A 4UE7H 2AGEX 1KLIH 1CVWH 1NRPH 3LIWA 2P94A 2VWNA 4X2YA 1AI8H 4WMEA 1W12U 4H6SB 3PMAB 1TRYA 4ZHAA 2OC7A 1HFDA 4A92A 3RMMH 1DWDH 3A84A 3ZV9A 1HAHH 1ABJH 2R3YA 4WY3A 1EPTC 3CS7A 1P09A 2BY9X 1HAGE 1HAOH 5HMAA 4UD9H 2BDGA 1BRBE 3LPRA 4KTSA 1XKBC 3QWCH 3RXLA 2AH4X 4CREA 3SORA 1GPZA 1W10U 5FXLA 1GCTC 4FU7A 1BA8B 1J14A 1LVYA 4Y76A 4CBOA 2GZ8A 3GCTF 1GJDB 2QC2A 1GCDA 3SV9A 1RIWB 2PLXA 2IPHA 1IQGA 1TRNA 2ZU4A 1SSXA 2BXTH 2Y82A 4ABDA 7KMEH 5GCHG 1K9OE 1PPEE 4NIVA 3CP7A 1GMDF 2F3CE 3SV7A 4AFQA 1QGFA 2F9VA 1C5OH 1P9UA 3TK5A 1C1UH 2A7CA 1UTKA 4CRDA 2FX6A 3NKKA 2Y6TA 1O2TA 2A5KA 3F6UH 2VIVA 4XBDA 2J2UA 3BEIB 2A45B 3PWBA 2XTTB 1O3PB 1GBKA 2HVXA 3PMBB 3RLWH 2HNTC 4K5ZA 1KXFA 2O8TA 2EI6A 1DDJA 1OWKA 3P8NA 1MTNB 1SQAA 3V3MA 1E0FD 4WH8A 3ZYEA 3UNRA 2A32A 3Q00A 4TY6A 3MO9A 3CS0A 1GBCA 4XBBA 1UTOA 4TWYA 3M7TA 2W5EA 1T32A 3P17H 3M5MA 1VITH 9ESTA 4AOQA 1RD3B 2ANWA 4IMQA 1C9TA 1NFXA 2VGCB 7LPRA 2CHAB 1GDUA 4B73A 1S5SA 3A85A 4ZXXH 3PROA 1V2VT 3SQHE 3TNSA 3TGJE 1TGBA 2TGDA 2ZI2H 3PYHA 1ZPCA 8ESTE 1AB9C 3KQBA 4OS7A 1XMNB 3EA8A 5ABWA 1C2HA 2PTNA 1MTUA 2AGGX 4LZ4B 1K2I1 2V6NA 3UWIA 3SUFA 3UY9A 4FUIA 1TNIA 3DT0H 1Z1IA 1O2RA 2VWOA 1N1LA 2W7SA 1FI8A 4NWLA 3GY3A 3MOCA 3K9XB 2ANKH 1GDNA 1XUHA 4X1QU 2NU2E 1C1NA 1FN6A 1AD8H 3UREA 1ZSJA 2NU3E 1IQEA 3RXIA 2ZO3H 4Y79A 1YPEH 2ZDNA 4CH8B 1D4PB 3ZZCA 1O3CA 1O38A 5EPNA 1DWEH 4K8YA 4ZXYH 2TGAA 2FS9A 4MNWA 1MBQA 3SGQE 3SUEA 1DXWA 3VGCC 1VCQA 3RXGA 1A61H 1Y3WA 3QK1A 3LGUA 1IQFA 5E2OA 3A7ZA 2XYAA 4E06H 5JBTA 1ZMLA 3ODFA 4BTIB 4YOJA 4D7GA 1KXDA 4D76A 4MLFB 3PTBA 5TJXA 1HJ9A 1LPKB 1Y8TA 3EA9A 3PO1C 1WQVH 1GG6B 1AMHA 1TPOA 1K1OA 1CSOE 1FAXA 3ATWA 1VITF 3F9GA 1SLWB 2CV3A 5G4BA 1TNKA 2KAIB 3BTGE 1QQ4A 2GDEH 1P2KA 3A8AA 1IQNA 4ZKSU 1W7GH 1KXAA 2FOAA 2D2DA 2J38A 2ZPQA 1W2KH 3MH5A 1OP8A 1TONA 1W0YH 5A8XA 5DP4A 2BMGB 1V2TT 2AMDA 1GHXH 4K8BA 1JRSA 2BZ6H 2HPPH 2RA0A 2W26A 1FIWA 1ORFA 2PSYA 2AMPA 2C8YB 4NZLA 3SBKA 1ZZZA 4DW2U 2ZZUH 8LPRA 1DY8A 2FM2A 1GHAG 4WWYA 5A0BA 1UJ1A 4DIHH 1TNHA 3A81A 1B0FA 1CQQA 1C5VA 1LVMA 1A3EH 1T7CA 1HAZB 1CA0C 8GCHG 1P57B 2ZNKH 4ABIA 2VH0A 4A1XA 2XCFA 1JWTA 1TFXA 1EB1H 1P2MA 5EU8A 5HXFA 4OGYA 3AASA 4YOIA 1HBTH 3SU5A 1K1IA 1Y3XA 4RN6A 3SJOA 3ZYDA 2A4RA 1TNLA 1ETSH 2AEIH 2UUJB 3SI3H 4K3JA 1TBZH 1KY9A 2G4TA 4K60A 2WV4A 5TCCA 4E7RG 1GJ5H 1V2UT 4INHA 2A5AA 1Y5BT 1VR1H 2FOMB 4UONA 4NA7A 4TPYA 5C1XA 1G2MA 1Y3VA 1NO9H 4H6TA 1D3QB 4U01A 2ZFTA 1GI2A 2G00A 1P03A 3RU4T 3Q3KA 3AW1A 4F4OC 5I46H 1DUEA 3L3TA 3DD2H 1O3HA 3RXDA 3BTEE 4WH6A 2BD7A 2SNVA 1KYNA 1GL1A 5JBAS 4ZUHA 1E36B 2FOGA 3F9FA 1HJ8A 1A0HB 1GVKB 1O2LA 1OOKB 5F6MA 1N6YA 2FLBH 1Q31A 1NS3A 3A7YA 1INCA 1EJNA 2AIQA 2ZU2A 2G8TA 1SGQE 3A8CA 1BJVA 1S6FA 1HNEE 1C1WH 4UFDH 3Q77A 5EQSA 1CT0E 1THRH 1MMJN 3L6PA 1YYY1 1C1TA 3BG4B 2H1UA 1NY22 1AHTH 3SNCA 2Y5HA 3PLBA 3U98H 1D6WA 1UVTH 1G36A 2RCEA 1LKAA 4NA9H 4ISOA 1BBRK 4MDSA 2G81E 2HWLB 1GGDB 1HV7A 2Z3DA 3F9HA 1P05A 4NCYA 4AFUA 1V2PT 2BVRH 1CO7E 4I31A 4JZ1A 4THNH 5C67A 1TABE 1C2FA 2QGRA 1DUAA 4XFQA 2FOBA 4WVPE 4ZH8A 1AVWA 5JB8S 1FZZA 6GCHG 1EUFA 2XBXA 2STAE 1DLKB 4FUHA 3ZZDA 1TPAE 4WMDA 4AX9H 1MQ5A 3T29A 4NSVA 3HPTB 1NC6A 3UNSA 4Y8XA 3NWUA 1Z6JH 4NFEA 2AYWA 1T4VH 2ZHEH 3A7XA 4X6OA 1MKWH 3IG6B 3P8OA 1FQ3A 1HPGA 4JK6A 1FIZA 5AF9H 3ATMA 4Z0KA 1AKSB 3M36A 2G5VA 1A5GH 1EOLA 1BMNH 1GVLA 1LKBA 3MU0A 1RS0A 5BRRE 2GX4A 1YPJH 1LHEH 1V2WT 3D62A 1TQ7B 2EA3A 1AY6H 2O9QA 2ZHQH 1G9IE 1S0RA 1GVZA 2O8LA 1DY9A 2B5TB 3RP2A 1LHCH 4KP0A 3AAVA 1N6XA 1FPHH 1AKSA 2QN5T 1UHBA 4O03A 1TA6A 1KLTA 1AE8H 3ZZ6A 3LT3A 4IC6A 1O3FA 1FLEE 2Z9IA 1F2SE 3ATLA 1BDAA 2BVXH 4JZDH 3UOUA 4AORA 2PKSC 4IW4E 3UTUH 5I25A 1ZSLA 2PUQH 2P8OC 1H1BA 2UUFB 4FU9A 1BMMH 3ZVFA 2OQUA 1EZQA 1P2OA 1QJ6B 1HJAB 2BTCE 5E0JA 3GY8A 3MO3A 1MUEB 5GIBA 3MYWA 1P8VC 1SOTA 2VU8E 3MWIU 2HOBA 1ZTLA 2EI7A 1Y5UT 4RKOB 3I29A 5DJ7A 2BY8X 1SI5H 4JMYA 2TRMA 1A5HA 1A4WH 3RXKA 1WOFA 5FCRA 5EW2H 3E6PH 4I8GA 2ANYA 2R3UA 1NN6A 1SB1H 1AU8A 2UUYA 1A0LA 1GBLA 3ZVDA 3RU4E 2BX4A 1G30B 3KEEA 4TYDA 3VXFH 1DX5M 4XSKU 4AGJA 4KKDA 4AB9A 1O3GA 2OD3B 2ZG0H 4U30A 3PV4A 4Q2KA 3S7KB 2H6MA 1UCYH 1DE7H 2PV9B 1SFQB 1AVXA 3MI4A 1AN1E 5GCHF 1IQJA 3QTVH 2GZ7A 2ZU3A 2BQ6B 1EASA 5DP8A 3RXTA 3FAOA 3BTWE 2FYRA 3GICB 2B9LA 2C8ZB 3P8GA 5HGGA 3ZVGA 4MQAA 4MVNA 3A7VA 4K1EA 3BTKE 1T4UH 2P93A 4MPUA 3ZZ7A 3BSQA 1C2MA 3N7OA 1T8NA 3SNBA 1GBMA 3SZNA 2ZDMA 2I6QA 1ANBA 2AIPA 1ELAA 2C3SA 3KN2A 1ANCA 2ZGCA 1OWJA 2WYGA 4E7NA 1M9UA 1RGQA 3VPKA 1O2UA 4Y6DA 3QN7A 4X1PU 1VGCC 5EQRA 3F9EA 1O5CB 1PYTD 4FUBA 4JK5A 4DY7B 3KF2A 2ZEBA 4TY7A 5H4IB 1XXFA 1B5GH 4ISNA 4I8KA 3ZZ9A 3ZVBA 3ITIA 4DURA 2ZIQH 5FX5A 3RXHA 4BAOB 1FNIA 2ZPRA 3ZZ5A 2QXGA 4JYVH 4X6MA 2TGPZ 4BAQB 4CHAC 1FN8A 4X2WA 2O8UA 3QO6A 3P95A 3A8BA 1MTWA 2O8WA 2LNCA 4FUGA 1QB6A 4M7GA 1C1OA 5EPYA 1ZTJA 2Z9GA 1BQYA 4ASHA 3K65B 1C1RA 1CU1A 1FAKH 2R0LA 3A83A 1XUGA 2BDAA 1K1NA 2BOHB 1V2RT 2G52A 1GWAA 1RTFB 1TWXB 2FEQH 1SHHB 3L33A 1W3CA 1F0RA 2JETB 3T27A 1XXDA 1O3EA 1TPPA 3VB7A 1DT2A 1QB9A 2BB4A 2NU0E 5C3NA 4CBNA 3F1SB 4OS1A 4YOGA 3O8BA 1GI7B 1AVGH 4AN7A 1RIWC 4DCDA 1DSTA 1UTJA 2J95A 1ARBA 1TOMH 2W3IA 1GBHA 3M7QA 1O3JA 3M5NA 3TK6A 4X8SH 1KLJH 1J15A 2HLCA 1HAPH 3MNCA 3RU4D 1QA7A 3A89A 2H9TH 5GJ4B 1YPKH 2ZQ2A 3E0PB 4WF8A 1C5SA 4FVBA 2RA3A 2F9BH 3LJJA 5ESBA 5T3HA 5FBEA 1C2DA 1Q3XA 1YPMH 2WPMS 3P70B 2BDYA 2BQWB 5GDSH 1WUNH 1O3LA 4TWWA 3IITA 1SGFG 3D49H 1EAXA 1GJ9B 1MD8A 1C2KA 2P3UB 1NU7B 1MTNC 1P0SH 1Z1JA 5LPRA 1C2IA 4MPVA 1DICA 1TGTA 1MCVA 2TBSA 3K2UA 1FY8E 1V2KT 1MAXA 1C1SA 1O2JA 2Y81A 1P04A 5DPAA 3QGJA 1V2QT 2VGCC 2FI4E 4AFSA 2CHAC 1FONA 4MNVA 1SLVB 3SU6A 2B0FA 2VIPA 1YP9A 1K22H 1A3BH 1BB0B 1E35B 1GHAF 2G51A 1WQSA 5DO4H 1OP2A 2PTCE 1MKXK 3GYLB 2D26C 8GCHF 2ZF0H 2VJ1A 1HRTH 5JBCS 3TITA 1XKAC 3BTME 1QY6A 1RFNA 4R0IA 3RXAA 1TGNA 3SJ8A 2QYIA 2BD2A 1C5MD 2ODPA 2ZWLH 4DT7B 1K1JA 1TIOA 3KQDA 3RC5A 3M3TA 1C5RA 1C2EA 3BIUH 1AWHB 1EZUC 4IN2A 5DP6A 2JH6D 1O3DA 3UPEA 1OSSA 1JMOH 3O8CA 2VIDA 3M3SA 1AUJA 4FU8A 4INLA 1SVPA 1OWEA 1F92A 1Y3YA 1RRKA 1SHYA 4D7FA 5EXLA 1RJXB 3Q3XA 1TX8A 4GHTA 1DOJA 4B2BA 3QZRA 1PYTC 1G3EA 1C4Y2 4ABAA 3A86A 2Y7ZA 5E0HA 3S9AA 2K1QA 2BLVA 2VVVA 1HAXB 1ZRBA 5EGMA 4CRGA 3E1XB 4Y0ZE 1A7SA 1YPGH 2QV1A 3I78A 2OXSA 1O36A 5C1UA 5BPEA 1GG6C 4ZKOU 1O2NA 3TIUA 3TGIE 1P2IA 4X6NA 2C93B 1O3AA 3EGKH 2ZKSA 2GCTB 1ZGVA 1BTZA 3EA7A 4NSYA 3Q76A 4WMFA 3P92A 3MU5A 5EXNA 1O2HA 1BRUP 3LC3A 4IGDA 1ZOMA 5DGJA 1UVOA 2GT8A 1BMAA 1D6RA 2JKHA 2H5CA 3UQVA 1C1QA 1L0ZA 3SHCH 1O5BB 1P3EA 1ZHMA 4GCHG 1SGRE 4NGAH 1W11U 3ZVEA 1KXCA 2ULLA 2W7UA 3HGPA 4CRAA 1EX3A 4AGKA 1EAUA 3LH3A 3PTNA 3QDZB 1BTUA 2ALVA 4MNXA 3KGPA 1UTQA 4BNRA 1UVUH 3LDXH 3MO6A 2FX4A 4YZUA 3RMLH 6LPRA 4X8UH 6CHAB 1BMLA 1S83A 2WPIS 3UUZA 1ELCA 1SGFA 1SPJA 1ABIH 3C1KA 2QF3A 3ATIA 3RC4A 1BTXA 3I77A 1C4U2 1DWCH 4FUJA 1AFQB 2Z94A 3E16B 1LQEA 1ZTKA 2QA9E 3RXBA 3KQEA 4YLQH 1HAYB 4HI3A 2Y7XA 1LPGB 1NU9A 3RMNH 2VVCA 5JPMH 4A1TA 5T6FA 1TYNA 4INKA 4RKJB 1UK2A 5C2ZA 1Y3UA 4BAHB 1NFYA 4CR5A 4ZHMU 3FFGA 1GHBG 1CT4E 2ZHFH 2ZTZA 2ZGXH 1F0UA 4Y71A 1NT1A 1ARCA 3URDA 1HXFH 2F9UA 3HKIB 1GMCF 5DP3A 1GHVH 1JOUB 1P06A 1SGYE 4A7IB 3BG8A 2BY7X 5A0AE 3QLPH 2BDHA 4FUCA 2VWMA 2RG3A 1SG8B 3RC6A 4ZKNU 1GJAB 2BYAX 2GP9B 3Q3YA 1A5IA 2FTMA 1P2NA 1C4V2 2P95A 3U8RH 2AFQB 2QXHA 4AG1A 1BBRH 2A0QB 3KIDU 3SGAE 4HZHA 1BHXF 1YGCH 2SFAA 3LJOA 2PWXA 1GMDG 5EODA 1BJUA 3OY6U 2NU1E 1O39A 1BBRE 3UWJH 1OXGA 1VZQH 2R2MB 4OS4A 2WPLS 3BG4C 1IHTH 1WYKA 2ZFFH 2WYJA 1J17T 2PGBB 1ELDE 1DPOA 4CRCA 1OWDA 4BOHA 2VIWA 2VVUA 3GDUA 4H4FA 3UIRA 3O8RA 1NRQH 1QL8A 1HAVA 3EYDA 1P9SA 3SN8A 3NCLA 2H9EH 4H42U 3M5LA 1U6QA 1GGDC 4GSOA 2PSXA 4X1RU 2A7JA 1YCPM 2Z9JA 1D3PB 1O2VA 2V0BA 1PQ5A 2H9HA 1HDTH 3OTJE 2FODA 5SGAE 2F9NA 2VIOA 3RXUA 3BTHE 1RXPA 3MU8A 3LONA 3SU4A 5A8YA 1HXEH 1P3CA 5HM2A 3EQ0H 1NPMA 3SU2A 1G3BA 2FMJA 5F8TA 2J34A 1XVOA 1O33A 4GPGA 2FDAA 1XM1A 1V3XA 3ZVAA 2SGPE 5FCKA 4IBLH 4JZIA 2FOFA 4CRBA 3JZ2B 1FDPA 2XXLA 5EOKA 3VB3A 3SHAH 3PWCA 4NZQA 1TGCA 4IC5A 3QGNB 1LHGH 2P3FH 3MNBA 2RDLA 4B2CA 1UVSH 1QBNA 3STJA 1GJ6A 4FVDA 3SQEE 2OQ5A 4NIYA 5C5NA 1YM0A 1DVAH 3A82A 5E8EH 2BY6X 1ZMJA 1O35A 4I32A 2H2ZA 1J16A 1GI1A 1F7ZA 3RXJA 1WAYB 1VJAU 1GHYH 1P10A 2C8WB 2Z9KA 2J94A 2AGIX 2SGAA 2Q6GA 3BEUA 2XC0A 4CRFA 2TIOA 1HYLA 2STBE 2V3OH 2DE9A 3RXQA 3A87A 3FANA 1D9IA 1BCUH 1KTSB 3SNEA 3SU3A 5PTPA 5CE1A 2EEKA 2OC0A 3BTFE 2UWLA 1HJAC 3URCA 1ELTA 1MBMA 1FPCH 1QQUA 3RXCA 3RM2H 1MU8B 2GCHF 3GDSA 1O2WA 3VXEH 1ELEE 2ZTXA 3MU1A 2AMQA 1THSH 1UHBB 4K1TA 1CT2E 2ZCKP 2WPKS 1SQOA 1P2JA 2ODYB 3EDXB 2YOLA 1P2QA 3LGIA 1O2XA 3V12A 4X1SU 5LGOA 2A4GA 1S84A 5JB9S 4A1VA 2LPRA 4UDWH 4IS5A 2XBYA 1O30A 1S82A 1BT7A 1DXPA 4Y11E 5A2MH 5T6GA 1VCWA 2QIQA 3SUGA 2WPJS 1OYTH 4Y7AA 2IN2A 2IJOB 4DVAU 1QURH 2F91A 2GV6A 5A09A 4KTCA 2SGEE 1QRXA 1YKTA 5E0GA 2FOCA 1YPHE 3ENSB 3P6ZB 2FI3E 2VINA 1BOQA 5ETXA 1EQ9A 5HYOA 1C5TA 4JZEH 3OYPA 4UFGH 3DHKH 3M61U 4MPXA 3M35A 4D8NA 5F03A 4WXVA 1EP6A 4X2VA 1SR5C 3W95A 1O3BA 1TB6H 1GBDA 2FLRH 3MHWU 1UMAH 4FUDA 2A5IA 1O31A 2BD3A 2IOTA 3TH4H 3FP6E 1H9LB 2FWWA 1ELBA 2ZGBH 1UTNA 2XNIA 1O2QA 1ZHRA 2Q6DA 3UR6A 4BXWA 5C1YA 3PLKA 3DFJA 1AZ8A 1BTPA 1QNJA 2EI8A 4DJZB 4X1NU 1L1GA 1BZXE 1SC8U 2THFB 2FESH 1TMUH 2CN0H 3TH2H 3GCHB 1Z8IB 1SGNE 3GY6A 1ZR0A 4NWKA 3RXFA 1ESAA 4ISIH 2V35A 5IDKA 3G01A 4J1YA 1CE5A 3TK9A 2BLWA 1C2GA 2UWOA 2ZCLP 3FP7E 4Q7YA 1O2GH 2FOEA 1HUTH 2WUBA 2Z7FE 1A2CH 1MZDA 3SO3A 3VB5A 1MD7A 1O37A 3ZZBA 2Z3EA 4LZ1H 4ZAEA 3MU4A 4JYTA 2PUXB 1OKXA 3V7TA 2ZGJA 2ZQ1A 3V0XA 2WV5A 3GCNA 4SGBE 3WY8A 1WTGH 1H9HE 1N8OB 2G55A 4ZHLU 1YBWA 4ABJA 4AG2A 2JETC 5GXPA 2A2QH 1PQ8A 4IMZA 1PPHE 1K1LA 2PKSB 1O2ZA 1H8IH 3SW2B 2ODQA 1CHOG 1EAIA 3TJVA 4X8VH 2FP7B 1CGIE 4ZROA 1EKBB 1PPZA 2C8XB 2J9NA 3GY2A 5EG4A 1NRRH 1SOZA 1THPB 3DFLA 3TH3H 2GGVB 2A2XH 2BQ7B 5L30H 1E38B 1O2MA 1G2LA 1ZPBA 1KXEA 4VGCB 1F5RA 4YLUA 1K1MA 2D8WA 1GMHG 2GV7A 1AIXH 1EXFA 2SGDE 1GJBB 1NFWA 5K7RA 1PPGE 1CA8B 1DS2E 1O2PA 2ZA5A 4JYUH 1FY5A 3IWMA 1DWBH 1JRTA 3RUOA 3T2NA 1IQMA 1L4DA 1MKXH 1SBWA 1BTHH 3MH6A 5DG6A 1W8BH 4GCHF 1SQTA 5IYTA 1FMGA 1CBWB 3T62A 2CMYA 5DP7A 1TAWA 3SV6A 1BUIA 2ZDVH 4DG4A 1AWFH 2GMTB 4MPWA 1O2KA 3E91A 2QY0B 1IHSH 2ZPSA 4KELA 4TPIZ 1DITH 1HLTH 1ACBE 1DM4B 2A31A 4ZKRU 5CMXH 2BDBA 2ZDLA 1TNJA 5CHAB 3FZDA 5AFZH 5FPTA 1C2JA 4QT8C 3AVZA 3EAJA 2FTLE 2FYQA 3H5CB 1NM6A 3HATH 1ZRKA 5GPIB 2XC4A 4AFZA 1PPBH 1MTSA 1HGTH 5FBIA 1GJ7B 4Y10E 1IQLA 4B2AA 3A88A 3FP8E 1FUJA 1Z8RA 2ZDAH 1F0SA 4LOYH 4Y7BA 1ZYOA 1A46H 1YCPK 2ZFQH 2JH5D 4B71A 1GHZA 5DK1A 1LPZB 4CHAB 1FXYA 1H9IE 2PKAB 2F83A 3M37A 5DP9A 3E0NB 1GBTA 1EAWA 3K6ZA 2GD4B 2BM2A 1VJ9U 4I7YH 1TX7A 1GHBF 1JIRA 4FUEA 1C5NH 1QRZA 2Z9LA 3LH1A 5FPYA 3FZZA 3LGTA 2BX3A 4A6LA 1MQ6A 2HRVA 2GDDA 2DUCA 1QR3E 1SGEE 2BHGA 1TA2A 1Z8GA 4ABHA 4BAKB 2CGAA 1X7AC 5C5OA 3U69H 1W14U 1GI9B 1AUTC 2PKAA 1G3DA 1KDQB 1T31A 1W13U 1XUFA 2Z6BD 2OTVA 1D3DB 1LCYA 4IN1A 1F5KU 4ZMAH 1V2JT 3U8OH 1ELGA 3S69A 1NESE 2GCTC 1A0JA 2BDIA 1O2OA 1F5LA 1IQIA 1ZGIA 3NXPA 4E05H 1ANEA 1IQHA 2SNWA 2PGQB 2WPHS 1QBVH 3DA9B 2BXUH 1KDQA 1J8AA 2BD8A 1GI4A 1J9CH 2W3KA 1KIGH 4F49A 1IOEA 3A7TA 2EC9H 4NA8A 1TX6A 3OU0A 4ABGA 2TGTA 1KTTB 5FAHA 1S0QA 3NUMA 3D23A 2HPQH 1WBGB 3RXMA 1TBQH 5LH8A 1EZSC 3HK3B 1OWIA 2G4UA 1GBJA 1OWHA 2A4QA 4OGXA 3NZIA 4ABEA 2JH0D 6CHAC 1EPTB 5LPEA 1TQ0B 1LMWB 2ZHDA 3SV2H 3UR9A 2ANMH 1AE5A 4LK4A 1AGJA 1NZQH 2FO9A 1UK3A 2CF9H 1LHFH 2XCNA 3TJOA 3RXSA 1GCTB 5L2YH 2CF8H 7GCHG 1V2NT 1V6DA 4CR9A 1C1VH 2ZU1A 2CJIA 1AFQC 1ELFA 1C5YB 4HTCH 2PFEA 3LOXA 2OP9A 1EB2A 2O8MA 4XOJA 1C5PA 1O0DH 3CENA 2C4FH 3OY5U 4DOQA 3BEFB 3MH4A 1EPTA 1S85A 2FZZA 3RLYH 1TNGA 2J92A 1GJ4H 1C5UA 2C90B 4XE4A 1TE0A 2FPZA 1YPHC 4X2XA 3U1IB 2A7HA 1GBBA 2BD5A 1AFEH 1YPLH 2BZAA 1C9PA 3EE0B 4B74A 3M5OA 5EXMA 1AZZA 3U1JB 3SJIA 2G5NA 5GWZA 2H5DA 1E34B 4WXIA 4X6PA 3VEQB 3SGBE 1QJ1B 3SOSA 2J4IA 2Y5FA 1S6HA 5JDUB 2BLOA 3ZZ3A 3RXVA 3QTOH 5FX6A 4OS6A 1C2LA 1WU1A 3GISB 5K0HA 1GJ8B 4X8TH 3TJUA 3GYMA 3RXOA 2XBWA 2BVSH 1LQDB 1HB0B 1O3NA 4KGAA 2D1JA 4B75A 2VIQA 3RMOH 6GCHF 3MTYA 1OS8A 2HGTH 4D9QA 4D9RA 1QTFA 1PFXC 1GBIA 3O8DA 2BD9A 1SGDE 1ZJKA 1PJPA 2OC8A 2XW9A 1NTPA 1UVPA 3ZZ4A 1AB9B 3HGNA 3U8TH 2PR3A 2AS9A 1C5QA 1AQ7A 3ZZAA 3RXPA 2V3HH 3OSYA 4B76A 1L1NA 1UTLM 1D3TB 2CXVA 1KSNA 2XC5A 3S7HB 3FVFB 3UQOA 3SU1A 5C20A 3QZQA 4J2YB 3S9BA 2YNAA 4JCNA 3H7TA 1FV9A 2OBOA 3E3TA 2QXJA 1QCPA 4YM9A 1NRNH 1B0EA 4Y8ZA 1ETTH 4Q7XA 1ZJDA 2VB0A 1V2MT 3TLOA 2XWBI 2XBVA 3AW0A 1T8OA 3GCTG 1W0ZU 3NK8A 3B23B 2KAIA 3VGCB 1PQAA 4O3UA 4PROA 5EQQA 2XWAA 1EOJA 4HFPB 1UTPA 2HALA 5FPSA 1BRCE 1GBEA 1HAVB 2GT7A 1O5FH 2P59A 1T8MA 3T26A 3SJKA 4DGJA 1O34A 1EP5A 3OX7U 4FUFA 1PPCE 3GOVB 1ESBA 1SGTA 3PO1B 1H4WA 3JZ1B 4GHQA 4UFFH 1IAUA 3MH7A 1DANH 1LHDH 3E90B 1K28D 2FS8A 3AAUA 4YT7H 1OX1A 3LC5A 1QRWA 1TGSZ 4KTUA 1XUJA 1V2LT 4GLYA 1BTWA 1FY4A 4X0WU 4JZFH 1JXPA 2PHBA 3A80A 3BIVH 4XBCA 2Q1JA 4O3TA 3VFEA 1BTYA 1DSUA 1OPHB 1TALA 4AZ2B 1EZXC 6ESTA 4OS5A 4AYYB 1SL3A 3U9AH 1LTOA 1YLDA 4K2YA 4BAMB 1MAYA 1P01A 2B7DH 1SGIB 1WCZA 2YNBA 3D65E 2ZFSA 3B9FH 1ETRH 2XRCA 1C5WB 4A5TS 3RXRA 3STIA 1AO5A 1CA0B 4MNYA 1B7XB 3T5FH 1QBOA 4U2WA 2ZP0H 1XX9A 1GI8B 1GDQA 1CHOF 3H7OA 2DE8A 2OLGA 1TMBH 1WTHD 1G32B 2I6SA 3RDZA 9LPRA 5T6DA 1NFUA 3R0FA 3ZZ8A 1LDTT 1ZHPA 1LVBA 1P02A 4FXGH 1TBRH 1Q2WA 5F8XA 1YF4A 1WV7H 4B1TA 1QL9A 3TVJB 1QJ7B 1MU6B 5JYIA 1MH0A 1PQ7A 4Y0YE 8KME2 1Z7KA 2ZFRH 1GMHF 3F68H 1QIXB 4NFFA 4I8LA 1L1JA 1C5LH 1W7XH 3KL6A 4AB8A 2A4OA 5AHGH 5DKMA 1F0TA 2HNTE 1XUIA 3LGWA 2NU4E 3LGVA 1GI0A 2BD4A 1HAIH 1UO6A 1Y59T 1GBAA 1P12E 2ZFPH 4OS2A 3LU9B 5FHTA 1C1PA 3ODDA 3RM0H 2ILNA 3R3GB 1ELVA 1TPSA 3MFJA 2GZ9A 1VITG 4BANB 1UK4A 2PW8H 4GVUA 4YTAA 3VB4A 1Z6EA 5A0CA 2WINI 4LXBH 4BTTB 1G37A 4YESB 1TMTH 3ELAH 2OINA 3GCHC 1O3KA 5LPFA 2GVFA 3MMGA 1SGCA 1SGPE 3SUDA 3UNQA 2NWNA 1SLXB 3A8DA 4BTUB 1O3OA 2QXIA 2SGQE 1GI5A 3TU7H 2QAAA 3S0NA 2GKVE 1S81A 3UFAA 3BV9B 2P3TB 1V2OT 4ESTE 5B6OA 1GMCG 4BXSA 1QHRB 4UFEH 1JIMA 1O3MA 3PM3A 4ISLA 1XVMA 1TOCB 1O2SA 3TPIZ 3GY4A 1ZMNA 2FOHA 3SJ9A 2VH6A 4WJG2 2UUKB 1CGJE 1N8OC 3LKWA 1EATA 4GAWA 1XUKA 1C5ZB 2ZECA 5AVDA 1T8LA 2HNTF 2VWLA 5EW1H 3E8LA 1TLDA 1FY3A 1BIOA 1L4ZA 1YLCA 3MNXA 2ZGHA 2A1DB 4RSPA 2BY5X 1WSSH 3GCOA 4U32A 1Y5AT 1LVOA 2OBQA 3RXEA 3B8JA 1DFPA 1GI3A 1L2EA 1FY1A 1QL7A 4K1SA 2TPIZ 4I8JA 2ZDKA 4VGCC 1ESTA 1K1PA 2BLQA 2B8OH 4XDEA 3BTDE 2BDCA 1H8DH 2ZCHP 3KQCA 4AYVB 1V2ST 2QF0A 5J4SA 3A7WA 4ISHH 1G3CA 1MZAA 1O3IA 3PLPA 4SGAE 1K21H 1BRAA 2R9PA 3ESTA 1KXBA 2OUAA 1MKWK 1TRMA 5F8ZA 2FXRA 1NROH 5AFYH 5HM9A 2VNTA 2R2WU 2P16A 3ATKA 3DUXH 4DIIH 1ZPZA 3BTTE 1O2IA 4I33A 1EJAA 2P8OB 1CBWC 1QFKH 1UCYE 3MNSA 5L2ZH 4NIWA 2QCYA 2F9OA 2AERH 1GHWH 3W94A 1NRSH 2Y5GA 4I8HA 2GMTC 2F9PA 3KCGH 1GJCB 1YC0A 3QX5H 1CGHA 3BF6H 2FI5E 3C27B 1C1MA 1YCPH 2ZC9H 4Y8YA 1E37B 1O5DH 1HCGA 4MTBA 2R0KA 4CH2B 3KNXA 5DP5A 3SV8A 1GI6A 5CHAC 3GY7A 4O9VA 2ASUB 1O5GH 3HK6B 4Z6AH 2M5TA 3GY5A 1OYQA 1GBFA 1ANDA 1RTKA 1LO6A 4YO9A 2SGFE 2WUCA 4Q7ZA 1UTMA 7GCHF 2Z3CA 4K69A 3K6YA 2ESTE 1EJMA 1P11E 3SU0A 1SMFE 1ZSKA 3GDVA 5A8ZA 4NG9H 1HIAB 5J4QA 4HGCA 5JBBS 3QUMP 1MTVA 4Q80A 4UEHH 1O5AB 1VCPA 1A1RA 1QA0A 1SFIA
chains in the Genus database with same CATH superfamily
1BITA 1SLUB 3VB6A 4NIXA 3NPSA 3LGYA 1O5EH 1Z8JB 3TJNA 1O2YA 1IQKA 2GCHG 1CHGA 3ZV8A 2ZTYA 4FOUC 4F48B 2OC1A 3KHVA 3P8FA 1MCTA 1HIAA 2ZU5A 3UOPA 4AC9A 1ZLRA 1C5XB 1BHXB 3SI4H 1Z71A 2FIRH 1UCYK 3BN9A 7ESTE 2OCVB 1RTLA 2Q6FA 5ESTE 1GL0E 1ID5H 4GUXA 2BOKA 3ZVCA 5L6NH 3V13A 1DLEA 1VGCB 3BTQE 3T28A 4R8TB 1FJSA 3TGKE 1OP0A 3SNAA 2GTBA 2ALPA 3SNDA 1BMFD 5E2PA 3PB1E 3S9CA 3M7UA 4O97A 5TCAA 3TNTA 2Y80A 1QB1A 1JBUH 2UWPA 1O32A 3PMJA 4YT6H 4ABBA 4ABFA 2ZHWH 4MG3A 1PPFE 3M3VA 3OEED 3PMHB 3HKJB 3T25A 4UE7H 2AGEX 1KLIH 1CVWH 1NRPH 3LIWA 2P94A 2VWNA 4X2YA 4HG6A 1AI8H 4WMEA 1K0HA 1W12U 4H6SB 3PMAB 1TRYA 4ZHAA 2OC7A 1HFDA 3SZEA 4A92A 3F2HA 3RMMH 1DWDH 3A84A 3ZV9A 1HAHH 1ABJH 2R3YA 4WY3A 1EPTC 2CK3D 3CS7A 1P09A 2BY9X 1HAGE 1HAOH 5HMAA 4UD9H 2BDGA 1BRBE 3LPRA 4KTSA 1XKBC 3QWCH 3RXLA 2AH4X 4CREA 3SORA 1GPZA 1W10U 5FXLA 1GCTC 4FU7A 1BA8B 1J14A 1LVYA 4Y76A 4CBOA 2GZ8A 3GCTF 1GJDB 2QC2A 1GCDA 3SV9A 1RIWB 2PLXA 2IPHA 1IQGA 1TRNA 2ZU4A 1SSXA 2BXTH 2Y82A 4ABDA 7KMEH 5GCHG 1K9OE 1PPEE 4NIVA 3CP7A 1GMDF 2F3CE 3SV7A 4AFQA 1NBME 1QGFA 2F9VA 1C5OH 1P9UA 3TK5A 1C1UH 3N7DA 2A7CA 1UTKA 4CRDA 2FX6A 3NKKA 2Y6TA 1O2TA 2A5KA 3F6UH 2VIVA 4XBDA 2J2UA 3BEIB 2A45B 3PWBA 2XTTB 1O3PB 1GBKA 2HVXA 3PMBB 3RLWH 2HNTC 4K5ZA 2JDID 1KXFA 2O8TA 2EI6A 3EE7A 4RT1A 1DDJA 1OWKA 3P8NA 1MTNB 1SQAA 3V3MA 1E0FD 1WDIA 4WH8A 3ZYEA 3UNRA 2A32A 3Q00A 4TY6A 3MO9A 3CS0A 1GBCA 4XBBA 1UTOA 4TWYA 3M7TA 2W5EA 1T32A 3P17H 3M5MA 1VITH 3NRLA 9ESTA 4AOQA 1RD3B 2ANWA 4IMQA 1C9TA 1NFXA 2VGCB 7LPRA 2CHAB 1GDUA 4B73A 1S5SA 3A85A 4ZXXH 3PROA 1V2VT 3SQHE 3TNSA 3TGJE 1TGBA 2TGDA 2ZI2H 3PYHA 1ZPCA 8ESTE 1AB9C 3KQBA 4OS7A 1XMNB 3EA8A 5ABWA 1C2HA 2PTNA 1MTUA 2AGGX 3FOAA 4LZ4B 1K2I1 2V6NA 3UWIA 3SUFA 3UY9A 5KGOA 4FUIA 3PV5A 1TNIA 5KECA 3DT0H 1Z1IA 1O2RA 2VBCA 2VWOA 2HVYB 1N1LA 2W7SA 1FI8A 4NWLA 3GY3A 3MOCA 3K9XB 2ANKH 1GDNA 1XUHA 4X1QU 2NU2E 1C1NA 1FN6A 1AD8H 3UREA 1ZSJA 2NU3E 1IQEA 3RXIA 2ZO3H 4Y79A 1YPEH 2ZDNA 4CH8B 1W0KD 1D4PB 3ZZCA 1O3CA 1O38A 5EIYA 5EPNA 1DWEH 4K8YA 4ZXYH 2TGAA 2FS9A 4MNWA 1MBQA 3SGQE 3SUEA 1DXWA 3VGCC 1VCQA 3RXGA 1EFRD 1A61H 1Y3WA 3QK1A 3LGUA 1IQFA 5E2OA 3A7ZA 2XYAA 4E06H 5JBTA 1ZMLA 1FX0B 3ODFA 4BTIB 4YOJA 4D7GA 1KXDA 4D76A 4MLFB 3PTBA 5TJXA 1HJ9A 1LPKB 1Y8TA 3EA9A 3PO1C 1WQVH 1GG6B 1AMHA 3F0OA 2L6OA 1TPOA 1K1OA 1CSOE 1FAXA 3ATWA 1VITF 3F2GA 3F9GA 1SLWB 2CV3A 5G4BA 1TNKA 2KAIB 3BTGE 1QQ4A 5EJZA 2GDEH 1P2KA 3A8AA 1IQNA 4ZKSU 1W7GH 1KXAA 2FOAA 2D2DA 2J38A 2W6JD 2ZPQA 1W2KH 3SYJA 3MH5A 1OP8A 1TONA 1W0YH 5A8XA 5DP4A 2BMGB 1V2TT 2AMDA 1GHXH 4K8BA 1JRSA 2BZ6H 2HPPH 2RA0A 2W26A 1FIWA 1ORFA 2PSYA 2AMPA 2C8YB 4NZLA 3SBKA 1ZZZA 4DW2U 2ZZUH 8LPRA 1DY8A 2FM2A 1GHAG 4WWYA 5A0BA 1UJ1A 4DIHH 4P02A 1TNHA 3A81A 1B0FA 1CQQA 1C5VA 1LVMA 1A3EH 1T7CA 1HAZB 1CA0C 8GCHG 1P57B 2ZNKH 4ABIA 2VH0A 4A1XA 2XCFA 1JWTA 1TFXA 1EB1H 1P2MA 5EU8A 5HXFA 4OGYA 3AASA 4YOIA 1HBTH 3SU5A 1K1IA 1Y3XA 4RN6A 3SJOA 3ZYDA 2A4RA 1TNLA 1ETSH 2AEIH 2UUJB 3SI3H 4K3JA 1TBZH 1KY9A 2WSSD 2G4TA 4K60A 2WV4A 5TCCA 2XOKD 4E7RG 1GJ5H 1V2UT 4INHA 2A5AA 1Y5BT 1VR1H 2FOMB 3WWFA 4UONA 4NA7A 4TPYA 5C1XA 1G2MA 1Y3VA 1NO9H 4H6TA 1D3QB 4U01A 2ZFTA 1GI2A 2G00A 1P03A 3RU4T 3Q3KA 3AW1A 4F4OC 5I46H 1DUEA 3L3TA 3DD2H 1O3HA 3RXDA 3BTEE 4WH6A 2BD7A 2SNVA 3U28C 1KYNA 1GL1A 5JBAS 4ZUHA 1E36B 2FOGA 3F9FA 1HJ8A 1A0HB 1GVKB 1O2LA 1OOKB 5F6MA 1N6YA 2FLBH 1Q31A 1NS3A 3A7YA 1INCA 1EJNA 2AIQA 2ZU2A 2G8TA 1SGQE 3A8CA 1BJVA 1S6FA 5DN6D 1HNEE 1C1WH 4UFDH 3Q77A 5EQSA 1CT0E 2KM0A 1THRH 1MMJN 3L6PA 1YYY1 1C1TA 3BG4B 2H1UA 1NY22 1AHTH 3SNCA 2Y5HA 3PLBA 3U98H 1D6WA 1UVTH 2JJ2D 1G36A 2RCEA 1LKAA 4NA9H 4ISOA 4Q63A 1BBRK 4MDSA 2G81E 2HWLB 1GGDB 1HV7A 2Z3DA 3F9HA 1P05A 4NCYA 4AFUA 1V2PT 2BVRH 3DSPA 5HKKD 1CO7E 4I31A 4JZ1A 4THNH 5C67A 1TABE 1C2FA 2QGRA 1DUAA 4XFQA 2FOBA 4WVPE 4ZH8A 1AVWA 5JB8S 1FZZA 6GCHG 1EUFA 2XBXA 2STAE 1DLKB 4FUHA 3ZZDA 1TPAE 4WMDA 4AX9H 1MQ5A 3T29A 4NSVA 3HPTB 1NC6A 3UNSA 4Y8XA 3NWUA 1Z6JH 4NFEA 2AYWA 1T4VH 2ZHEH 3A7XA 4X6OA 1MKWH 3IG6B 3P8OA 1FQ3A 1HPGA 4JK6A 1FIZA 5AF9H 3ATMA 4Z0KA 1AKSB 3M36A 2YMSB 2G5VA 1A5GH 1EOLA 3OE7D 1BMNH 1GVLA 1LKBA 3MU0A 1RS0A 5BRRE 2GX4A 1YPJH 1LHEH 1V2WT 3D62A 2RFKC 1TQ7B 2EA3A 1AY6H 2O9QA 2ZHQH 1G9IE 1S0RA 1GVZA 2O8LA 1DY9A 2B5TB 3RP2A 5FL7D 1LHCH 4KP0A 3AAVA 1N6XA 1FPHH 1AKSA 2QN5T 1UHBA 4O03A 1TA6A 1KLTA 1AE8H 3ZZ6A 3LT3A 4IC6A 1O3FA 1FLEE 2Z9IA 1F2SE 3ATLA 1BDAA 2BVXH 4JZDH 3UOUA 4AORA 2PKSC 4IW4E 3UTUH 5I25A 1ZSLA 4RT0A 2PUQH 2P8OC 1H1BA 2UUFB 4FU9A 1BMMH 3ZVFA 2OQUA 1EZQA 1P2OA 1QJ6B 1HJAB 2BTCE 5E0JA 3GY8A 3MO3A 1MUEB 5GIBA 3MYWA 1P8VC 1SOTA 2VU8E 3MWIU 2HOBA 1ZTLA 2EI7A 1Y5UT 4RKOB 3I29A 1H8HD 5DJ7A 2BY8X 1SI5H 4JMYA 2TRMA 1A5HA 1A4WH 1E1RD 3RXKA 1WOFA 5FCRA 5EW2H 3E6PH 4I8GA 2ANYA 2R3UA 1NN6A 1SB1H 1AU8A 2UUYA 1A0LA 1GBLA 3ZVDA 3RU4E 2BX4A 1G30B 3KEEA 4TYDA 3VXFH 1DX5M 4XSKU 4AGJA 4KKDA 4FETA 4AB9A 2IPQX 1O3GA 2OD3B 5C0UA 2ZG0H 4U30A 3PV4A 1W0JD 4Q2KA 3S7KB 2H6MA 1UCYH 1DE7H 2PV9B 1SFQB 1AVXA 3MI4A 1AN1E 5GCHF 1IQJA 3QTVH 2GZ7A 2ZU3A 2BQ6B 3WW7A 1EASA 5DP8A 3RXTA 3FAOA 3BTWE 2FYRA 5B6LA 3GICB 2B9LA 2C8ZB 3P8GA 5HGGA 3ZVGA 4MQAA 4MVNA 3A7VA 4K1EA 3BTKE 1T4UH 2P93A 4MPUA 3ZZ7A 3BSQA 1C2MA 3N7OA 1S6LA 1T8NA 3SNBA 1GBMA 3SZNA 2ZDMA 2I6QA 1ANBA 2AIPA 1ELAA 2C3SA 3KN2A 1ANCA 2ZGCA 1OWJA 5HIZA 2WYGA 4E7NA 1M9UA 1RGQA 2GJGA 3VPKA 1O2UA 4Y6DA 3QN7A 4X1PU 1VGCC 5EQRA 3F9EA 1O5CB 1PYTD 4FUBA 4JK5A 4DY7B 3KF2A 2ZEBA 4TY7A 5H4IB 1XXFA 1B5GH 4ISNA 4I8KA 3ZZ9A 3ZVBA 3ITIA 4DURA 2ZIQH 3OFND 1E79D 5FX5A 3RXHA 1FNIA 4BAOB 2ZPRA 3ZZ5A 2QXGA 4JYVH 4X6MA 2TGPZ 4BAQB 4CHAC 1FN8A 4X2WA 2O8UA 3QO6A 3P95A 3A8BA 1MTWA 2LELA 2O8WA 2LNCA 4FUGA 1QB6A 4M7GA 4XD7D 1C1OA 5EPYA 1ZTJA 2Z9GA 1BQYA 4ASHA 3K65B 1C1RA 1CU1A 1FAKH 2KX4A 2R0LA 3A83A 1XUGA 2BDAA 1YLNA 1K1NA 2BOHB 1V2RT 2G52A 1GWAA 1RTFB 1TWXB 2FEQH 1SHHB 3L33A 1W3CA 1F0RA 2JETB 3T27A 1XXDA 1O3EA 1TPPA 3VB7A 1DT2A 1QB9A 2BB4A 2NU0E 5C3NA 4CBNA 3F1SB 4OS1A 4YOGA 3O8BA 1GI7B 1AVGH 4AN7A 1RIWC 4DCDA 1DSTA 1UTJA 2J95A 1ARBA 1TOMH 2W3IA 1GBHA 3M7QA 1O3JA 3M5NA 3TK6A 4X8SH 2JJ1D 1KLJH 1J15A 2HLCA 1HAPH 3MNCA 2QF5A 3RU4D 1QA7A 3A89A 2H9TH 5GJ4B 1YPKH 2ZQ2A 3E0PB 1H8ED 4WF8A 1C5SA 4FVBA 2RA3A 2F9BH 3LJJA 5ESBA 5T3HA 5DSFA 1C2DA 5FBEA 1Q3XA 4ACBA 1YPMH 2WPMS 3P70B 2BDYA 2BQWB 5GDSH 2W6ID 1WUNH 1O3LA 4TWWA 3IITA 1SGFG 3D49H 1EAXA 1GJ9B 1MD8A 1C2KA 1NU7B 2P3UB 1MTNC 1P0SH 1Z1JA 5LPRA 1C2IA 4MPVA 1DICA 1TGTA 1MCVA 2TBSA 3K2UA 1FY8E 1V2KT 1MAXA 1C1SA 1O2JA 2Y81A 4P00A 1P04A 4F55A 5DPAA 3VG8A 3QGJA 1V2QT 2VGCC 2FI4E 4AFSA 2CHAC 1FONA 4MNVA 1SLVB 3SU6A 3DSOA 2B0FA 2VIPA 1YP9A 1K22H 1A3BH 1BB0B 1E35B 1GHAF 2G51A 1WQSA 5DO4H 1OP2A 2KCOA 2PTCE 1MKXK 3GYLB 2D26C 8GCHF 2ZF0H 2VJ1A 1HRTH 5JBCS 3TITA 1XKAC 3BTME 1QY6A 1RFNA 4R0IA 3RXAA 1TGNA 3SJ8A 2QYIA 2BD2A 1C5MD 2ODPA 2ZWLH 4DT7B 1K1JA 1TIOA 3KQDA 3RC5A 3M3TA 1C5RA 1C2EA 2XNDD 3BIUH 1AWHB 1EZUC 4IN2A 5DP6A 2JH6D 1O3DA 3UPEA 1OSSA 1JMOH 3O8CA 2VIDA 3M3SA 1AUJA 4FU8A 4INLA 1SVPA 1OWEA 1F92A 1Y3YA 1RRKA 1SHYA 4D7FA 2OK5A 5EXLA 1RJXB 3Q3XA 1TX8A 4GHTA 5C17A 1DOJA 4B2BA 3QZRA 1PYTC 1G3EA 1C4Y2 4ABAA 3A86A 2Y7ZA 5E0HA 3S9AA 2K1QA 2BLVA 2VVVA 1HAXB 3F0PA 1ZRBA 5EGMA 4CRGA 2J98B 3E1XB 4Y0ZE 1A7SA 1YPGH 2QV1A 3I78A 2OXSA 1O36A 5C1UA 5BPEA 5C94A 1GG6C 2KCAA 4ZKOU 3KYFA 1O2NA 3TIUA 3TGIE 1P2IA 4X6NA 2C93B 1O3AA 3EGKH 2ZKSA 2GCTB 1ZGVA 1BTZA 3EA7A 4NSYA 2WHXA 3Q76A 4WMFA 3P92A 3MU5A 5EXNA 1O2HA 2J98A 1BRUP 3LC3A 4IGDA 1ZOMA 5DGJA 1UVOA 2GT8A 5HIYA 1BMAA 1D6RA 2JKHA 2H5CA 3UQVA 1C1QA 1L0ZA 3SHCH 1O5BB 1P3EA 1ZHMA 4GCHG 1SGRE 4NGAH 1W11U 3ZVEA 1KXCA 2ULLA 2W7UA 3HGPA 4CRAA 1EX3A 4AGKA 1EAUA 3LH3A 3PTNA 3QDZB 1BTUA 2ALVA 4MNXA 3KGPA 1UTQA 4BNRA 4B6FA 1UVUH 3LDXH 3H09A 3MO6A 2FX4A 4YZUA 3RMLH 6LPRA 4X8UH 6CHAB 1BMLA 1S83A 2WPIS 3UUZA 4ACAA 1ELCA 1SGFA 1SPJA 1ABIH 3C1KA 3KYGA 2QF4A 2QF3A 3ATIA 3RC4A 1BTXA 3I77A 1C4U2 1DWCH 4FUJA 1AFQB 2Z94A 3E16B 1LQEA 1ZTKA 2QA9E 3RXBA 3KQEA 2KR7A 4TSFD 4YLQH 1HAYB 4HI3A 2Y7XA 1LPGB 1NU9A 3RMNH 2VVCA 5JPMH 4A1TA 5T6FA 1TYNA 4INKA 2WV9A 4RKJB 1UK2A 5C2ZA 1Y3UA 4BAHB 1NFYA 1COWD 4CR5A 4ZHMU 3FFGA 1GHBG 1CT4E 2ZHFH 2ZTZA 3DCLA 2ZGXH 1F0UA 4Y71A 1NT1A 1ARCA 3URDA 1HXFH 2F9UA 3HKIB 1GMCF 5DP3A 1GHVH 1JOUB 1P06A 1SGYE 1SQRA 4A7IB 3BG8A 2BY7X 2L74A 3CNRA 5A0AE 3QLPH 2BDHA 4FUCA 2VWMA 2RG3A 1SG8B 3RC6A 4ZKNU 1WXRA 1GJAB 2BYAX 2GP9B 3Q3YA 1A5IA 2FTMA 1P2NA 2KZ4A 1C4V2 2P95A 3U8RH 2AFQB 2QXHA 4AG1A 1BBRH 2A0QB 3KIDU 4ASUD 3SGAE 4HZHA 1BHXF 1YGCH 2SFAA 3LJOA 2PWXA 1GMDG 2KFWA 5EODA 3MQKC 1BJUA 3OY6U 2NU1E 1O39A 1BBRE 3UWJH 1OXGA 1VZQH 2R2MB 4OS4A 2WPLS 3BG4C 1IHTH 1WYKA 2ZFFH 2WYJA 1J17T 2PGBB 1ELDE 1DPOA 4CRCA 1OWDA 4BOHA 2VIWA 2VVUA 3GDUA 4H4FA 3UIRA 3O8RA 1NRQH 1QL8A 1HAVA 3EYDA 1P9SA 3SN8A 3NCLA 2H9EH 4H42U 3M5LA 1U6QA 1GGDC 4GSOA 2PSXA 4X1RU 2A7JA 1YCPM 2Z9JA 1D3PB 1O2VA 2V0BA 2KCYA 2HLDD 1PQ5A 2H9HA 1HDTH 3OTJE 2FODA 5SGAE 2F9NA 2VIOA 3RXUA 3BTHE 1RXPA 3MU8A 3LONA 3SU4A 5A8YA 1HXEH 1P3CA 5HM2A 3EQ0H 1NPMA 3SU2A 1G3BA 2FMJA 5F8TA 2J34A 1XVOA 1O33A 4GPGA 2FDAA 1XM1A 1V3XA 3ZVAA 2SGPE 5FCKA 2YMSC 4IBLH 4JZIA 2FOFA 4CRBA 3JZ2B 1FDPA 2XXLA 5EOKA 3VB3A 3SHAH 3PWCA 2EQNA 4NZQA 1TGCA 4IC5A 3QGNB 1LHGH 2P3FH 3MNBA 2RDLA 4B2CA 1UVSH 1QBNA 2K8IA 3STJA 1GJ6A 4FVDA 3SQEE 2OQ5A 4NIYA 5C5NA 1YM0A 1DVAH 3A82A 3N99A 5E8EH 2BY6X 1ZMJA 1O35A 4I32A 2H2ZA 1J16A 1GI1A 1F7ZA 3RXJA 1WAYB 1VJAU 1GHYH 1P10A 2C8WB 2Z9KA 2J94A 2AGIX 2SGAA 2IJD1 3BEUA 2Q6GA 2XC0A 4CRFA 2TIOA 1HYLA 2STBE 2V3OH 2DE9A 3RXQA 3A87A 3FANA 1D9IA 1BCUH 1KTSB 3SNEA 3SU3A 5PTPA 5CE1A 2EEKA 2OC0A 2WZQA 2UWLA 3BTFE 1HJAC 3URCA 1ELTA 1MBMA 5EJ1A 1FPCH 1QQUA 3RXCA 1MABB 3RM2H 1MU8B 2GCHF 3GDSA 1O2WA 3VXEH 1ELEE 3N7EA 2ZTXA 3MU1A 2AMQA 1THSH 1UHBB 4K1TA 1CT2E 2ZCKP 2WPKS 1SQOA 1P2JA 2ODYB 3EDXB 2YOLA 1P2QA 3LGIA 3UAIC 1O2XA 3V12A 4X1SU 4B6EA 5LGOA 2A4GA 1S84A 5JB9S 4A1VA 2LPRA 4UDWH 4IS5A 2XBYA 1O30A 1S82A 1BT7A 1DXPA 4Y11E 5A2MH 5T6GA 1VCWA 2QIQA 3SUGA 2WPJS 1OYTH 4Y7AA 2IN2A 2IJOB 4DVAU 1QURH 2F91A 2GV6A 5A09A 4KTCA 2SGEE 1QRXA 1YKTA 5E0GA 2FOCA 1YPHE 3ENSB 3P6ZB 2FI3E 2VINA 1BOQA 5ETXA 1EQ9A 5HYOA 1C5TA 4JZEH 3OYPA 4UFGH 3DHKH 3M61U 4MPXA 3M35A 4D8NA 5F03A 4WXVA 1EP6A 4X2VA 1SR5C 3W95A 1O3BA 1TB6H 1GBDA 2FLRH 3MHWU 1UMAH 4FUDA 2A5IA 1O31A 2BD3A 2IOTA 3TH4H 3FP6E 1H9LB 2FWWA 1ELBA 2ZGBH 1UTNA 2XNIA 1O2QA 1ZHRA 2Q6DA 3UR6A 4OM9A 4BXWA 5C1YA 3PLKA 2V3MA 3DFJA 1AZ8A 1BTPA 1QNJA 3DSGA 2EI8A 4DJZB 4X1NU 1L1GA 1BZXE 1SC8U 2THFB 2FESH 1TMUH 2CN0H 3TH2H 3GCHB 1Z8IB 1SGNE 3GY6A 1ZR0A 4NWKA 3WWBA 3RXFA 2F4LA 1ESAA 4ISIH 2V35A 2PP6A 5IDKA 3G01A 4J1YA 1CE5A 3TK9A 2BLWA 1C2GA 2UWOA 2ZCLP 3FP7E 4Q7YA 1O2GH 2FOEA 1HUTH 2WUBA 2Z7FE 1A2CH 1MZDA 3SO3A 3VB5A 1MD7A 1O37A 3ZZBA 2Z3EA 4LZ1H 4ZAEA 3MU4A 4JYTA 2PUXB 1OKXA 3V7TA 2ZGJA 2ZQ1A 3V0XA 2WV5A 3GCNA 4SGBE 3WY8A 1WTGH 1H9HE 1N8OB 2G55A 4ZHLU 1YBWA 4ABJA 4AG2A 2JETC 5GXPA 2A2QH 1PQ8A 4IMZA 1PPHE 1K1LA 2PKSB 1O2ZA 1H8IH 3SW2B 2ODQA 1CHOG 1EAIA 3TJVA 4X8VH 2FP7B 1CGIE 4ZROA 1EKBB 1PPZA 2C8XB 2J9NA 3GY2A 5EG4A 1NRRH 1SOZA 1THPB 2V7QD 3DFLA 3TH3H 2GGVB 2A2XH 2BQ7B 5L30H 1E38B 1O2MA 4ZCNA 1G2LA 1ZPBA 1KXEA 4VGCB 1F5RA 4YLUA 1K1MA 2D8WA 1GMHG 2GV7A 1AIXH 1EXFA 2SGDE 1GJBB 1NFWA 5K7RA 1PPGE 1CA8B 1DS2E 1O2PA 2ZA5A 4JYUH 1FY5A 3IWMA 1DWBH 1JRTA 3RUOA 3T2NA 1IQMA 1L4DA 1MKXH 1SBWA 2J5UA 1BTHH 3MH6A 3KQ5A 5DG6A 1W8BH 4GCHF 1SQTA 5IYTA 1FMGA 3PRBA 1CBWB 3T62A 2CMYA 5DP7A 1TAWA 3SV6A 1BUIA 2ZDVH 4DG4A 1AWFH 2GMTB 4MPWA 1O2KA 3E91A 2QY0B 1IHSH 2ZPSA 4KELA 4TPIZ 1DITH 1HLTH 1ACBE 3PV2A 1DM4B 2A31A 4ZKRU 5CMXH 2BDBA 2ZDLA 1TNJA 5CHAB 3FZDA 5AFZH 5FPTA 2M2AA 1C2JA 4QT8C 3AVZA 3EAJA 2FTLE 2FYQA 3PRDA 3H5CB 1NM6A 3HATH 1ZRKA 5GPIB 2XC4A 4AFZA 1KMHB 1PPBH 1MTSA 3GS9A 1HGTH 5FBIA 1GJ7B 4Y10E 1IQLA 4B2AA 3A88A 3FP8E 1FUJA 1Z8RA 2ZDAH 1F0SA 4LOYH 4Y7BA 1ZYOA 1A46H 1YCPK 2ZFQH 2JH5D 4B71A 1GHZA 5DK1A 1LPZB 4CHAB 1VKYA 1FXYA 1H9IE 2PKAB 2F43B 2F83A 2K0QA 3E0NB 1GBTA 3M37A 1EAWA 5DP9A 3K6ZA 2GD4B 2BM2A 1VJ9U 4I7YH 1TX7A 1GHBF 1JIRA 4FUEA 1C5NH 1QRZA 2Z9LA 3LH1A 5FPYA 3FZZA 3LGTA 2BX3A 4A6LA 1MQ6A 2HRVA 2GDDA 2DUCA 1QR3E 1SGEE 2BHGA 1TA2A 1Z8GA 4ABHA 4BAKB 2CGAA 1X7AC 5C5OA 3U69H 1W14U 1GI9B 1AUTC 1G3DA 2PKAA 1KDQB 1T31A 1W13U 1XUFA 2Z6BD 2OTVA 1D3DB 1LCYA 4IN1A 1F5KU 4ZMAH 1V2JT 2QE7D 3U8OH 1ELGA 5KEDA 3S69A 1NESE 2GCTC 1A0JA 2BDIA 1O2OA 1F5LA 1IQIA 1ZGIA 3NXPA 4E05H 1ANEA 1IQHA 2SNWA 2PGQB 2WPHS 1QBVH 3DA9B 2BXUH 1KDQA 1J8AA 2BD8A 1GI4A 4Z1MD 1J9CH 2W3KA 1KIGH 1YWUA 4F49A 1IOEA 3A7TA 2EC9H 4NA8A 1TX6A 3OU0A 4ABGA 2TGTA 1KTTB 5FAHA 1S0QA 3NUMA 3D23A 2HPQH 1WBGB 1SKYE 3RXMA 1TBQH 5LH8A 1EZSC 3HK3B 1OWIA 2G4UA 1GBJA 1OWHA 2A4QA 4OGXA 3NZIA 4ABEA 2JH0D 6CHAC 1EPTB 5LPEA 1TQ0B 1LMWB 2ZHDA 3SV2H 3UR9A 2ANMH 1AE5A 4LK4A 1AGJA 1NZQH 2FO9A 1UK3A 2CF9H 1LHFH 2XCNA 3TJOA 3RXSA 1GCTB 5L2YH 2CF8H 7GCHG 1V2NT 1V6DA 4CR9A 1C1VH 2ZU1A 2CJIA 1AFQC 1ELFA 1C5YB 4HTCH 2PFEA 3LOXA 2OP9A 1EB2A 2O8MA 4XOJA 1C5PA 1O0DH 3CENA 2C4FH 3OY5U 4DOQA 2YMSD 3BEFB 3MH4A 1EPTA 1S85A 2FZZA 3RLYH 4M9FA 1TNGA 2J92A 1GJ4H 1C5UA 2C90B 4XE4A 1TE0A 2FPZA 1YPHC 4X2XA 3U1IB 2A7HA 1GBBA 2BD5A 1AFEH 1YPLH 2BZAA 1C9PA 3EE0B 4B74A 3M5OA 5EXMA 1AZZA 3U1JB 3SJIA 2G5NA 5GWZA 2H5DA 1E34B 4WXIA 4X6PA 3VEQB 3SGBE 1QJ1B 3SOSA 2J4IA 2Y5FA 1S6HA 5JDUB 2BLOA 3ZZ3A 3RXVA 3QTOH 5FX6A 4OS6A 1C2LA 1WU1A 3GISB 5K0HA 1GJ8B 4X8TH 3TJUA 3GYMA 3RXOA 2XBWA 2JIZD 2BVSH 1LQDB 1OHHD 1HB0B 1O3NA 4KGAA 4Q4LA 2D1JA 4B75A 2VIQA 3RMOH 6GCHF 3MTYA 1OS8A 2HGTH 4D9QA 4D9RA 1QTFA 1PFXC 1GBIA 3O8DA 2BD9A 1SGDE 1ZJKA 1PJPA 2OC8A 2XW9A 1NTPA 1UVPA 3ZZ4A 1AB9B 3HGNA 3U8TH 2PR3A 2AS9A 1C5QA 1AQ7A 3UB0A 3ZZAA 3RXPA 2V3HH 3OSYA 4B76A 1L1NA 1UTLM 1D3TB 1QZ8A 2CXVA 1KSNA 2XC5A 3S7HB 3FVFB 3UQOA 3SU1A 5C20A 3QZQA 4J2YB 3FO8D 3S9BA 2YNAA 3FKSD 4JCNA 4TT3D 3H7TA 1FV9A 2OBOA 1NBMD 3E3TA 2QXJA 2J97A 1QCPA 4I86A 4YM9A 1NRNH 1B0EA 4DT4A 4Y8ZA 1ETTH 4Q7XA 1ZJDA 2VB0A 1V2MT 3TLOA 2XWBI 2XBVA 3AW0A 1T8OA 3GCTG 1W0ZU 3NK8A 3B23B 2KAIA 3VGCB 1PQAA 4O3UA 4PROA 5EQQA 2XWAA 1EOJA 4HFPB 1UTPA 2HALA 5FPSA 1BRCE 2WPDD 1GBEA 1HAVB 2GT7A 1O5FH 2P59A 1T8MA 3T26A 3SJKA 4DGJA 1O34A 1EP5A 3OX7U 4FUFA 1PPCE 3GOVB 1ESBA 1SGTA 3PO1B 1H4WA 3JZ1B 4GHQA 4UFFH 1IAUA 3MH7A 1DANH 1LHDH 3E90B 1K28D 2FS8A 3AAUA 4YT7H 3AK5A 1OX1A 3LC5A 1QRWA 1TGSZ 2EY4C 4KTUA 1XUJA 1V2LT 4GLYA 1BTWA 1FY4A 4X0WU 4JZFH 1JXPA 2PHBA 3A80A 3BIVH 4XBCA 4XRNA 5EJLA 2Q1JA 4O3TA 5C0TA 3VFEA 1BTYA 1DSUA 1OPHB 1TALA 4AZ2B 1EZXC 6ESTA 4OS5A 4AYYB 1SL3A 2RDEA 3U9AH 4RI0A 1LTOA 1YLDA 4K2YA 4YXWD 4BAMB 1MAYA 1P01A 2B7DH 1SGIB 1WCZA 2YNBA 3D65E 2ZFSA 3B9FH 1ETRH 2XRCA 1C5WB 4A5TS 3RXRA 3STIA 1AO5A 1CA0B 4MNYA 1B7XB 1UW7A 3T5FH 1QBOA 4U2WA 2ZP0H 1XX9A 1GI8B 1GDQA 1CHOF 3H7OA 2DE8A 2OLGA 1TMBH 1WTHD 1G32B 2I6SA 3RDZA 9LPRA 3F2FA 5T6DA 1NFUA 3R0FA 3ZZ8A 1LDTT 1ZHPA 1LVBA 1P02A 4FXGH 1TBRH 1Q2WA 5F8XA 1YF4A 1WV7H 4B1TA 1QL9A 3TVJB 1QJ7B 1MU6B 5JYIA 1MH0A 1PQ7A 4Y0YE 8KME2 1Z7KA 2ZFRH 1GMHF 3F68H 1QIXB 4NFFA 4I8LA 1L1JA 1C5LH 1W7XH 3KL6A 4AB8A 2A4OA 5AHGH 5DKMA 1F0TA 2HNTE 1XUIA 3LGWA 2NU4E 3OEHD 3LGVA 1GI0A 2BD4A 1HAIH 1UO6A 1Y59T 1GBAA 1P12E 2ZFPH 4OS2A 3LU9B 5FHTA 1C1PA 3ODDA 3RM0H 2ILNA 3R3GB 1ELVA 1TPSA 3MFJA 2GZ9A 1VITG 4BANB 1UK4A 2PW8H 4GVUA 4YTAA 3VB4A 1Z6EA 5A0CA 2WINI 4LXBH 4BTTB 1G37A 4YESB 1TMTH 3ELAH 2OINA 3GCHC 1O3KA 5LPFA 2GVFA 3MMGA 1SGCA 2KCPA 1SGPE 3SUDA 3UNQA 2NWNA 1SLXB 3A8DA 4BTUB 1O3OA 2QXIA 2SGQE 1GI5A 3TU7H 2QAAA 3S0NA 2GKVE 1S81A 3UFAA 3BV9B 2P3TB 1V2OT 4ESTE 5B6OA 5CHBA 1GMCG 4BXSA 1QHRB 4UFEH 1JIMA 1O3MA 3PM3A 4ISLA 1XVMA 1TOCB 1O2SA 3TPIZ 3GY4A 1ZMNA 2FOHA 3SJ9A 2VH6A 4WJG2 2UUKB 1CGJE 1N8OC 3LKWA 1EATA 4GAWA 1XUKA 5F53A 1C5ZB 2ZECA 3OAAD 5AVDA 1T8LA 2HNTF 2VWLA 5CDFE 5EW1H 3E8LA 1TLDA 1FY3A 1BIOA 1L4ZA 1YLCA 3MNXA 2ZGHA 2A1DB 4RSPA 2BY5X 1WSSH 5T1VA 3GCOA 4U32A 1Y5AT 1LVOA 2OBQA 3RXEA 3B8JA 1DFPA 1GI3A 1L2EA 1FY1A 1QL7A 4K1SA 2TPIZ 4I8JA 2ZDKA 4VGCC 1ESTA 1K1PA 2BLQA 2B8OH 1YY3A 4XDEA 3BTDE 2BDCA 1H8DH 2ZCHP 3KQCA 3FN8A 4AYVB 1V2ST 2QF0A 5J4SA 3A7WA 4ISHH 1G3CA 1MZAA 5GNDA 1O3IA 3PLPA 4SGAE 1K21H 1BRAA 2R9PA 3ESTA 1KXBA 1MKWK 1TRMA 2OUAA 3W1EA 5F8ZA 2FXRA 2AHME 1NROH 5IK2D 5AFYH 5HM9A 2LP6A 2VNTA 2R2WU 2P16A 3ATKA 3DUXH 4DIIH 1ZPZA 3BTTE 1O2IA 4I33A 1EJAA 2P8OB 1CBWC 1QFKH 1UCYE 3MNSA 5L2ZH 4NIWA 2QCYA 2F9OA 2AERH 1GHWH 3W94A 1NRSH 2Y5GA 4I8HA 2GMTC 2F9PA 3KCGH 1GJCB 1YC0A 3QX5H 1CGHA 3BF6H 2FI5E 3C27B 1C1MA 1YCPH 2ZC9H 4Y8YA 1E37B 1O5DH 1HCGA 4MTBA 2R0KA 4CH2B 3KNXA 1E1QD 5DP5A 3SV8A 1GI6A 5CHAC 3GY7A 4O9VA 2ASUB 1O5GH 3HK6B 3F3BA 4Z6AH 2M5TA 3GY5A 1OYQA 1GBFA 1ANDA 1RTKA 1LO6A 4YO9A 2SGFE 2WUCA 3ZIAD 4Q7ZA 1UTMA 7GCHF 2Z3CA 4K69A 3K6YA 2ESTE 1EJMA 1P11E 3SU0A 1SMFE 1ZSKA 3GDVA 5A8ZA 4NG9H 1HIAB 5J4QA 4HGCA 5JBBS 3QUMP 1MTVA 3OTPA 4Q80A 4UEHH 1O5AB 1VCPA 1A1RA 1QA0A 1SFIA
chains in the Genus database with same CATH topology
1BITA 1SLUB 3VB6A 4NIXA 3NPSA 3LGYA 1O5EH 1Z8JB 3TJNA 1O2YA 1IQKA 2GCHG 1CHGA 3ZV8A 2ZTYA 2OC1A 3KHVA 3P8FA 1MCTA 1HIAA 2ZU5A 3UOPA 1ZLRA 1C5XB 1BHXB 3SI4H 1Z71A 2FIRH 1UCYK 3BN9A 7ESTE 2OCVB 1RTLA 2Q6FA 5ESTE 1GL0E 1ID5H 4GUXA 2BOKA 3ZVCA 5L6NH 3V13A 1DLEA 1VGCB 3BTQE 3T28A 4R8TB 1FJSA 3TGKE 1OP0A 3SNAA 2GTBA 2ALPA 3SNDA 5E2PA 3PB1E 3S9CA 3M7UA 4O97A 5TCAA 3TNTA 2Y80A 1QB1A 1JBUH 2UWPA 1O32A 3PMJA 4YT6H 4ABBA 4ABFA 2ZHWH 4MG3A 1PPFE 3M3VA 3PMHB 3HKJB 3T25A 4UE7H 2AGEX 1KLIH 1CVWH 1NRPH 3LIWA 2P94A 2VWNA 4X2YA 1AI8H 4WMEA 1W12U 4H6SB 3PMAB 1TRYA 4ZHAA 2OC7A 1HFDA 4A92A 3RMMH 1DWDH 3A84A 3ZV9A 1HAHH 1ABJH 2R3YA 4WY3A 1EPTC 3CS7A 1P09A 2BY9X 1HAGE 1HAOH 5HMAA 4UD9H 2BDGA 1BRBE 3LPRA 4KTSA 1XKBC 3QWCH 3RXLA 2AH4X 4CREA 3SORA 1GPZA 1W10U 5FXLA 1GCTC 4FU7A 1BA8B 1J14A 1LVYA 4Y76A 4CBOA 2GZ8A 3GCTF 1GJDB 2QC2A 1GCDA 3SV9A 1RIWB 2PLXA 2IPHA 1IQGA 1TRNA 2ZU4A 1SSXA 2BXTH 2Y82A 4ABDA 7KMEH 5GCHG 1K9OE 1PPEE 4NIVA 3CP7A 1GMDF 2F3CE 3SV7A 4AFQA 1QGFA 2F9VA 1C5OH 1P9UA 3TK5A 1C1UH 2A7CA 1UTKA 4CRDA 2FX6A 3NKKA 2Y6TA 1O2TA 2A5KA 3F6UH 2VIVA 4XBDA 2J2UA 3BEIB 2A45B 3PWBA 2XTTB 1O3PB 1GBKA 2HVXA 3PMBB 3RLWH 2HNTC 4K5ZA 1KXFA 2O8TA 2EI6A 1DDJA 1OWKA 3P8NA 1MTNB 1SQAA 3V3MA 1E0FD 4WH8A 3ZYEA 3UNRA 2A32A 3Q00A 4TY6A 3MO9A 3CS0A 1GBCA 4XBBA 1UTOA 4TWYA 3M7TA 2W5EA 1T32A 3P17H 3M5MA 1VITH 9ESTA 4AOQA 1RD3B 2ANWA 4IMQA 1C9TA 1NFXA 2VGCB 7LPRA 2CHAB 1GDUA 4B73A 1S5SA 3A85A 4ZXXH 3PROA 1V2VT 3SQHE 3TNSA 3TGJE 1TGBA 2TGDA 2ZI2H 3PYHA 1ZPCA 8ESTE 1AB9C 3KQBA 4OS7A 1XMNB 3EA8A 5ABWA 1C2HA 2PTNA 1MTUA 2AGGX 4LZ4B 1K2I1 2V6NA 3UWIA 3SUFA 3UY9A 4FUIA 1TNIA 3DT0H 1Z1IA 1O2RA 2VWOA 1N1LA 2W7SA 1FI8A 4NWLA 3GY3A 3MOCA 3K9XB 2ANKH 1GDNA 1XUHA 4X1QU 2NU2E 1C1NA 1FN6A 1AD8H 3UREA 1ZSJA 2NU3E 1IQEA 3RXIA 2ZO3H 4Y79A 1YPEH 2ZDNA 4CH8B 1D4PB 3ZZCA 1O3CA 1O38A 5EPNA 1DWEH 4K8YA 4ZXYH 2TGAA 2FS9A 4MNWA 1MBQA 3SGQE 3SUEA 1DXWA 3VGCC 1VCQA 3RXGA 1A61H 1Y3WA 3QK1A 3LGUA 1IQFA 5E2OA 3A7ZA 2XYAA 4E06H 5JBTA 1ZMLA 3ODFA 4BTIB 4YOJA 4D7GA 1KXDA 4D76A 4MLFB 3PTBA 5TJXA 1HJ9A 1LPKB 1Y8TA 3EA9A 3PO1C 1WQVH 1GG6B 1AMHA 1TPOA 1K1OA 1CSOE 1FAXA 3ATWA 1VITF 3F9GA 1SLWB 2CV3A 5G4BA 1TNKA 2KAIB 3BTGE 1QQ4A 2GDEH 1P2KA 3A8AA 1IQNA 4ZKSU 1W7GH 1KXAA 2FOAA 2D2DA 2J38A 2ZPQA 1W2KH 3MH5A 1OP8A 1TONA 1W0YH 5A8XA 5DP4A 2BMGB 1V2TT 2AMDA 1GHXH 4K8BA 1JRSA 2BZ6H 2HPPH 2RA0A 2W26A 1FIWA 1ORFA 2PSYA 2AMPA 2C8YB 4NZLA 3SBKA 1ZZZA 4DW2U 2ZZUH 8LPRA 1DY8A 2FM2A 1GHAG 4WWYA 5A0BA 1UJ1A 4DIHH 1TNHA 3A81A 1B0FA 1CQQA 1C5VA 1LVMA 1A3EH 1T7CA 1HAZB 1CA0C 8GCHG 1P57B 2ZNKH 4ABIA 2VH0A 4A1XA 2XCFA 1JWTA 1TFXA 1EB1H 1P2MA 5EU8A 5HXFA 4OGYA 3AASA 4YOIA 1HBTH 3SU5A 1K1IA 1Y3XA 4RN6A 3SJOA 3ZYDA 2A4RA 1TNLA 1ETSH 2AEIH 2UUJB 3SI3H 4K3JA 1TBZH 1KY9A 2G4TA 4K60A 2WV4A 5TCCA 4E7RG 1GJ5H 1V2UT 4INHA 2A5AA 1Y5BT 1VR1H 2FOMB 4UONA 4NA7A 4TPYA 5C1XA 1G2MA 1Y3VA 1NO9H 4H6TA 1D3QB 4U01A 2ZFTA 1GI2A 2G00A 1P03A 3RU4T 3Q3KA 3AW1A 4F4OC 5I46H 1DUEA 3L3TA 3DD2H 1O3HA 3RXDA 3BTEE 4WH6A 2BD7A 2SNVA 1KYNA 1GL1A 5JBAS 4ZUHA 1E36B 2FOGA 3F9FA 1HJ8A 1A0HB 1GVKB 1O2LA 1OOKB 5F6MA 1N6YA 2FLBH 1Q31A 1NS3A 3A7YA 1INCA 1EJNA 2AIQA 2ZU2A 2G8TA 1SGQE 3A8CA 1BJVA 1S6FA 1HNEE 1C1WH 4UFDH 3Q77A 5EQSA 1CT0E 1THRH 1MMJN 3L6PA 1YYY1 1C1TA 3BG4B 2H1UA 1NY22 1AHTH 3SNCA 2Y5HA 3PLBA 3U98H 1D6WA 1UVTH 1G36A 2RCEA 1LKAA 4NA9H 4ISOA 1BBRK 4MDSA 2G81E 2HWLB 1GGDB 1HV7A 2Z3DA 3F9HA 1P05A 4NCYA 4AFUA 1V2PT 2BVRH 1CO7E 4I31A 4JZ1A 4THNH 5C67A 1TABE 1C2FA 2QGRA 1DUAA 4XFQA 2FOBA 4WVPE 4ZH8A 1AVWA 5JB8S 1FZZA 6GCHG 1EUFA 2XBXA 2STAE 1DLKB 4FUHA 3ZZDA 1TPAE 4WMDA 4AX9H 1MQ5A 3T29A 4NSVA 3HPTB 1NC6A 3UNSA 4Y8XA 3NWUA 1Z6JH 4NFEA 2AYWA 1T4VH 2ZHEH 3A7XA 4X6OA 1MKWH 3IG6B 3P8OA 1FQ3A 1HPGA 4JK6A 1FIZA 5AF9H 3ATMA 4Z0KA 1AKSB 3M36A 2G5VA 1A5GH 1EOLA 1BMNH 1GVLA 1LKBA 3MU0A 1RS0A 5BRRE 2GX4A 1YPJH 1LHEH 1V2WT 3D62A 1TQ7B 2EA3A 1AY6H 2O9QA 2ZHQH 1G9IE 1S0RA 1GVZA 2O8LA 1DY9A 2B5TB 3RP2A 1LHCH 4KP0A 3AAVA 1N6XA 1FPHH 1AKSA 2QN5T 1UHBA 4O03A 1TA6A 1KLTA 1AE8H 3ZZ6A 3LT3A 4IC6A 1O3FA 1FLEE 2Z9IA 1F2SE 3ATLA 1BDAA 2BVXH 4JZDH 3UOUA 4AORA 2PKSC 4IW4E 3UTUH 5I25A 1ZSLA 2PUQH 2P8OC 1H1BA 2UUFB 4FU9A 1BMMH 3ZVFA 2OQUA 1EZQA 1P2OA 1QJ6B 1HJAB 2BTCE 5E0JA 3GY8A 3MO3A 1MUEB 5GIBA 3MYWA 1P8VC 1SOTA 2VU8E 3MWIU 2HOBA 1ZTLA 2EI7A 1Y5UT 4RKOB 3I29A 5DJ7A 2BY8X 1SI5H 4JMYA 2TRMA 1A5HA 1A4WH 3RXKA 1WOFA 5FCRA 5EW2H 3E6PH 4I8GA 2ANYA 2R3UA 1NN6A 1SB1H 1AU8A 2UUYA 1A0LA 1GBLA 3ZVDA 3RU4E 2BX4A 1G30B 3KEEA 4TYDA 3VXFH 1DX5M 4XSKU 4AGJA 4KKDA 4AB9A 1O3GA 2OD3B 2ZG0H 4U30A 3PV4A 4Q2KA 3S7KB 2H6MA 1UCYH 1DE7H 2PV9B 1SFQB 1AVXA 3MI4A 1AN1E 5GCHF 1IQJA 3QTVH 2GZ7A 2ZU3A 2BQ6B 1EASA 5DP8A 3RXTA 3FAOA 3BTWE 2FYRA 3GICB 2B9LA 2C8ZB 3P8GA 5HGGA 3ZVGA 4MQAA 4MVNA 3A7VA 4K1EA 3BTKE 1T4UH 2P93A 4MPUA 3ZZ7A 3BSQA 1C2MA 3N7OA 1T8NA 3SNBA 1GBMA 3SZNA 2ZDMA 2I6QA 1ANBA 2AIPA 1ELAA 2C3SA 3KN2A 1ANCA 2ZGCA 1OWJA 2WYGA 4E7NA 1M9UA 1RGQA 3VPKA 1O2UA 4Y6DA 3QN7A 4X1PU 1VGCC 5EQRA 3F9EA 1O5CB 1PYTD 4FUBA 4JK5A 4DY7B 3KF2A 2ZEBA 4TY7A 5H4IB 1XXFA 1B5GH 4ISNA 4I8KA 3ZZ9A 3ZVBA 3ITIA 4DURA 2ZIQH 5FX5A 3RXHA 4BAOB 1FNIA 2ZPRA 3ZZ5A 2QXGA 4JYVH 4X6MA 2TGPZ 4BAQB 4CHAC 1FN8A 4X2WA 2O8UA 3QO6A 3P95A 3A8BA 1MTWA 2O8WA 2LNCA 4FUGA 1QB6A 4M7GA 1C1OA 5EPYA 1ZTJA 2Z9GA 1BQYA 4ASHA 3K65B 1C1RA 1CU1A 1FAKH 2R0LA 3A83A 1XUGA 2BDAA 1K1NA 2BOHB 1V2RT 2G52A 1GWAA 1RTFB 1TWXB 2FEQH 1SHHB 3L33A 1W3CA 1F0RA 2JETB 3T27A 1XXDA 1O3EA 1TPPA 3VB7A 1DT2A 1QB9A 2BB4A 2NU0E 5C3NA 4CBNA 3F1SB 4OS1A 4YOGA 3O8BA 1GI7B 1AVGH 4AN7A 1RIWC 4DCDA 1DSTA 1UTJA 2J95A 1ARBA 1TOMH 2W3IA 1GBHA 3M7QA 1O3JA 3M5NA 3TK6A 4X8SH 1KLJH 1J15A 2HLCA 1HAPH 3MNCA 3RU4D 1QA7A 3A89A 2H9TH 5GJ4B 1YPKH 2ZQ2A 3E0PB 4WF8A 1C5SA 4FVBA 2RA3A 2F9BH 3LJJA 5ESBA 5T3HA 5FBEA 1C2DA 1Q3XA 1YPMH 2WPMS 3P70B 2BDYA 2BQWB 5GDSH 1WUNH 1O3LA 4TWWA 3IITA 1SGFG 3D49H 1EAXA 1GJ9B 1MD8A 1C2KA 2P3UB 1NU7B 1MTNC 1P0SH 1Z1JA 5LPRA 1C2IA 4MPVA 1DICA 1TGTA 1MCVA 2TBSA 3K2UA 1FY8E 1V2KT 1MAXA 1C1SA 1O2JA 2Y81A 1P04A 5DPAA 3QGJA 1V2QT 2VGCC 2FI4E 4AFSA 2CHAC 1FONA 4MNVA 1SLVB 3SU6A 2B0FA 2VIPA 1YP9A 1K22H 1A3BH 1BB0B 1E35B 1GHAF 2G51A 1WQSA 5DO4H 1OP2A 2PTCE 1MKXK 3GYLB 2D26C 8GCHF 2ZF0H 2VJ1A 1HRTH 5JBCS 3TITA 1XKAC 3BTME 1QY6A 1RFNA 4R0IA 3RXAA 1TGNA 3SJ8A 2QYIA 2BD2A 1C5MD 2ODPA 2ZWLH 4DT7B 1K1JA 1TIOA 3KQDA 3RC5A 3M3TA 1C5RA 1C2EA 3BIUH 1AWHB 1EZUC 4IN2A 5DP6A 2JH6D 1O3DA 3UPEA 1OSSA 1JMOH 3O8CA 2VIDA 3M3SA 1AUJA 4FU8A 4INLA 1SVPA 1OWEA 1F92A 1Y3YA 1RRKA 1SHYA 4D7FA 5EXLA 1RJXB 3Q3XA 1TX8A 4GHTA 1DOJA 4B2BA 3QZRA 1PYTC 1G3EA 1C4Y2 4ABAA 3A86A 2Y7ZA 5E0HA 3S9AA 2K1QA 2BLVA 2VVVA 1HAXB 1ZRBA 5EGMA 4CRGA 3E1XB 4Y0ZE 1A7SA 1YPGH 2QV1A 3I78A 2OXSA 1O36A 5C1UA 5BPEA 1GG6C 4ZKOU 1O2NA 3TIUA 3TGIE 1P2IA 4X6NA 2C93B 1O3AA 3EGKH 2ZKSA 2GCTB 1ZGVA 1BTZA 3EA7A 4NSYA 3Q76A 4WMFA 3P92A 3MU5A 5EXNA 1O2HA 1BRUP 3LC3A 4IGDA 1ZOMA 5DGJA 1UVOA 2GT8A 1BMAA 1D6RA 2JKHA 2H5CA 3UQVA 1C1QA 1L0ZA 3SHCH 1O5BB 1P3EA 1ZHMA 4GCHG 1SGRE 4NGAH 1W11U 3ZVEA 1KXCA 2ULLA 2W7UA 3HGPA 4CRAA 1EX3A 4AGKA 1EAUA 3LH3A 3PTNA 3QDZB 1BTUA 2ALVA 4MNXA 3KGPA 1UTQA 4BNRA 1UVUH 3LDXH 3MO6A 2FX4A 4YZUA 3RMLH 6LPRA 4X8UH 6CHAB 1BMLA 1S83A 2WPIS 3UUZA 1ELCA 1SGFA 1SPJA 1ABIH 3C1KA 2QF3A 3ATIA 3RC4A 1BTXA 3I77A 1C4U2 1DWCH 4FUJA 1AFQB 2Z94A 3E16B 1LQEA 1ZTKA 2QA9E 3RXBA 3KQEA 4YLQH 1HAYB 4HI3A 2Y7XA 1LPGB 1NU9A 3RMNH 2VVCA 5JPMH 4A1TA 5T6FA 1TYNA 4INKA 4RKJB 1UK2A 5C2ZA 1Y3UA 4BAHB 1NFYA 4CR5A 4ZHMU 3FFGA 1GHBG 1CT4E 2ZHFH 2ZTZA 2ZGXH 1F0UA 4Y71A 1NT1A 1ARCA 3URDA 1HXFH 2F9UA 3HKIB 1GMCF 5DP3A 1GHVH 1JOUB 1P06A 1SGYE 4A7IB 3BG8A 2BY7X 5A0AE 3QLPH 2BDHA 4FUCA 2VWMA 2RG3A 1SG8B 3RC6A 4ZKNU 1GJAB 2BYAX 2GP9B 3Q3YA 1A5IA 2FTMA 1P2NA 1C4V2 2P95A 3U8RH 2AFQB 2QXHA 4AG1A 1BBRH 2A0QB 3KIDU 3SGAE 4HZHA 1BHXF 1YGCH 2SFAA 3LJOA 2PWXA 1GMDG 5EODA 1BJUA 3OY6U 2NU1E 1O39A 1BBRE 3UWJH 1OXGA 1VZQH 2R2MB 4OS4A 2WPLS 3BG4C 1IHTH 1WYKA 2ZFFH 2WYJA 1J17T 2PGBB 1ELDE 1DPO