1FXYA

Coagulation factor xa-trypsin chimera inhibited with d-phe-pro-arg-chloromethylketone
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
228
structure length
228
Chain Sequence
IVGGYNCKDGEVPWQALLINEENEGFCGGTILSEFYILTAAHCLYQAKRFKVRVGDRNTEQEEGGEAVHEVEVVIKHNRFTKETYDFDIAVLRLKTPITFRMNVAPASLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords COAGULATION FACTOR XA-TRYPSIN CHIMERA
publication title New enzyme lineages by subdomain shuffling.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 228
sequence length 228
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1998-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fxyA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fxyA02
2FS8A 1E37B 1O37A 5ESBA 1DDJA 1SGRE 4INLA 1D6RA 1AFEH 1ETTH 2V35A 2XBXA 1TX6A 1XX9A 1BBRH 3AVZA 1WAYB 4X8UH 3LH1A 1A0LA 1J17T 2G5VA 3M3TA 5T3HA 1GDUA 2J4IA 4NIXA 2FOCA 3MOCA 2GX4A 2QA9E 3SV7A 1G3DA 3PLKA 1B7XB 1LHGH 1EX3A 1TBQH 1IQIA 1EPTC 2G52A 7GCHG 9ESTA 1YCPM 4IMQA 2BXUH 4THNH 2C8WB 4AYYB 1MD8A 2OINA 1GBDA 1OS8A 4OS4A 2W7SA 1TONA 2A4QA 3RXFA 4Y8ZA 1NFWA 1F0TA 2Y6TA 1AWHB 1FIWA 1JXPA 3DFJA 5EQSA 1BTXA 3S69A 3OSYA 4JZIA 4X6OA 3FFGA 2FI5E 1YPLH 8KME2 1V2LT 1HRTH 5E2OA 1TYNA 1EZUC 1ZPCA 2LPRA 2G4TA 4ZUHA 4ZKOU 3M5OA 2BD7A 1GWAA 4ASHA 4A1XA 3SV6A 4WH6A 4JMYA 3M5LA 2Z6BD 1QJ1B 3A88A 2HLCA 5FHTA 1GL1A 1AVGH 3DUXH 2IPHA 1K1MA 2ZQ1A 1CHOG 3RC6A 2ZI2H 1IAUA 2FLBH 1XUHA 5IDKA 2OC0A 2BLOA 7LPRA 4X2XA 1YCPH 1LVMA 2EI8A 1N8OB 1TABE 5FCRA 3S0NA 1GJ6A 1OWHA 2STBE 8ESTE 2GZ9A 3T26A 4JCNA 1PQ8A 4J1YA 4ABAA 1NRRH 1QQUA 2H1UA 3RM2H 2WPMS 3MNCA 2AGEX 5CE1A 3ZVAA 4RKOB 1TRYA 2FYQA 2C8XB 5EODA 3S9BA 1ESAA 3O8RA 4Q7XA 2ZHQH 3T2NA 1EZQA 2NU0E 1Q2WA 3K9XB 5TCCA 1P9SA 1ZTKA 3RU4D 2Q6GA 1FY8E 2BZ6H 3MFJA 3BTKE 3SV8A 1CVWH 2IN2A 1Y3WA 3U8RH 1HJAB 2CJIA 5DP8A 1UCYH 3HKJB 2J92A 2ANKH 3VB7A 1IQHA 1GBIA 4YOIA 1L2EA 1C5XB 3PLPA 1ELEE 1HAVB 5EGMA 1AU8A 1C2KA 1SI5H 1ELBA 3LU9B 2F91A 1FAKH 1S5SA 2J9NA 3UNSA 2ZGXH 1HCGA 5EXNA 2FTLE 3AW0A 3LT3A 3VB4A 4WVPE 4CRAA 4GPGA 3AAUA 1GI1A 1AD8H 4ABEA 2BMGB 5T6FA 1C2EA 1C1UH 1O5FH 2C93B 5LPFA 2XWAA 3EAJA 1H4WA 1QQ4A 4TY7A 3Q3YA 1HJ8A 1ELGA 1AI8H 2SFAA 1HAZB 2ANYA 3TGJE 1K1IA 3GDSA 5ESTE 3T28A 5ABWA 1C2JA 1P02A 2A1DB 4MNWA 1ETSH 1V2ST 3A80A 4MPWA 4Z6AH 1P8VC 5L2ZH 2FOHA 4NIYA 1HXFH 1MBMA 3RLYH 4K1SA 1MBQA 3SZNA 1AB9C 1F5LA 1V6DA 3F1SB 3M35A 1ABJH 3TGKE 4TYDA 2FOBA 5TJXA 1D3PB 1SVPA 1OPHB 1FXYA 2TGDA 2AMQA 4E05H 4FVBA 1S0RA 5JPMH 1DUEA 2HWLB 2BX4A 2VWOA 2G81E 4O9VA 4X2YA 3TJOA 2PV9B 3T27A 2GGVB 2SGEE 3UQOA 3M7TA 1V2MT 1H8DH 1JRTA 1NPMA 2P95A 4GSOA 2JETC 2BHGA 7KMEH 1AFQB 3FAOA 2PKSB 3BTQE 4ESTE 2H9TH 3SU5A 1ZSLA 1KYNA 4ZHAA 1KXCA 5A8ZA 5E0HA 1CQQA 1ZJDA 1TFXA 1KDQA 1KXFA 1N1LA 3LPRA 3S9AA 3KCGH 2Y5FA 4NWKA 2OUAA 3F68H 3LGYA 5C5OA 1QTFA 2H9HA 3RXVA 1HAVA 3C27B 4MPUA 1QIXB 1RTKA 4VGCC 1GBFA 1GBAA 1P0SH 1O0DH 4X1NU 1B0FA 3NUMA 5C3NA 3KIDU 4MVNA 2ZO3H 3Q3KA 1TQ0B 3E90B 2ANWA 4B2AA 3R0FA 2KAIA 1KXBA 1A7SA 1VITG 2ZTYA 6CHAB 2FI3E 4RN6A 2JH6D 4FU9A 3RUOA 1OX1A 2UWOA 3QTOH 2ZQ2A 2ZP0H 3BTEE 1O2UA 1BMLA 4UFEH 5AFZH 3TH4H 5DPAA 3RU4T 2QC2A 4DIIH 3F9HA 1EOLA 2BLWA 2QGRA 1AZ8A 1K1PA 2XTTB 1V2KT 1LQDB 1Y3YA 3BG4C 1K9OE 2Q1JA 5HM2A 1W7GH 3K2UA 4IN2A 4YO9A 1GMCG 1WQVH 1EJMA 1YPHE 1S84A 3U69H 1KSNA 4YTAA 3LKWA 2DE9A 2WV5A 2FX6A 2GVFA 1NRQH 1P2KA 3SU1A 2FPZA 1GI4A 2PUXB 3EA9A 1TPSA 1O2ZA 4B76A 3UY9A 1BJVA 3S7HB 4GUXA 1GHBG 3C1KA 3SU4A 4E7NA 4CRCA 1EPTB 1PPCE 1QL7A 3Q3XA 4F49A 4LZ4B 3QK1A 4GHQA 2GV7A 3ZVDA 3QGNB 1AZZA 3RXTA 1OP2A 4NA8A 2J2UA 4JK5A 1G3BA 3BTWE 2ZPSA 3TU7H 4DGJA 1GMHF 5A2MH 3TNTA 1DLEA 4A5TS 4DW2U 1P12E 2VVVA 3RC4A 5GCHF 1O2MA 1ZPZA 2GTBA 1AQ7A 3BTDE 1BMNH 4X8VH 3SV9A 4K1TA 4Y8YA 3TVJB 1Y8TA 2AMPA 5FPTA 1TGBA 5HMAA 2BD5A 1G30B 5EXMA 1O2VA 2BLVA 1T8OA 4MPXA 2VVUA 3A7WA 1ABIH 2GP9B 4FUBA 2C4FH 1UTNA 3Q00A 2GD4B 3O8DA 5A0BA 1O5AB 2J94A 1FONA 1QBNA 3M36A 1VJ9U 3UQVA 1ZHPA 1HAIH 2SNWA 1VCWA 1ESBA 1N8OC 2W3IA 3PROA 4O3TA 1A5GH 1ELTA 2FMJA 2WYJA 3GY7A 4DURA 3ZZ7A 2OQ5A 1OKXA 4FUIA 4WXIA 4XBCA 1MUEB 3UTUH 4X6NA 6LPRA 1K1OA 3UR9A 1G32B 3SJKA 1GBHA 1QBVH 3ZZAA 1SQAA 2BXTH 5K0HA 3ZZ8A 1AY6H 3BSQA 2VIPA 2FESH 2EEKA 4Q2KA 4X6MA 1O3FA 5C67A 4X1RU 3MH6A 1BRAA 3TLOA 2F9BH 2K1QA 1K21H 5GCHG 1UVUH 4ZKRU 4KP0A 4I32A 2ANMH 3P92A 3PWBA 1ZGVA 5DP4A 2OBOA 1H1BA 1P2OA 2O8UA 3TK5A 4BXSA 1MKWH 1GHAF 2VIQA 1KXAA 3SI4H 3UREA 2JKHA 3QDZB 3QZQA 1GBCA 1O2KA 5L30H 5HM9A 1T32A 1YF4A 1C2FA 1C5PA 2FX4A 1J9CH 3FZDA 2P59A 2LNCA 1HAGE 1A5IA 4R8TB 1C4U2 2FYRA 1G37A 4NSVA 3E6PH 4CH8B 1BBRK 1J15A 1AMHA 1Z8IB 1GJ5H 4K5ZA 1O2IA 4ZKNU 4Y79A 2F9VA 3GY2A 3I29A 3RXCA 1DXPA 4AFSA 1DE7H 3A8DA 1C9TA 2HNTC 4FUDA 5GXPA 1GHXH 3TH2H 2D2DA 4BANB 1NM6A 1GPZA 4SGAE 1SGIB 3LGUA 1FLEE 2GKVE 2PFEA 4UFFH 5HXFA 2QYIA 1P11E 2ZEBA 3ATIA 3ITIA 4K8BA 3S7KB 1E0FD 2ZU2A 4KELA 1C5UA 1O3OA 1XUGA 2OP9A 4X8SH 1ARBA 2Y7XA 3V7TA 3QLPH 1LHCH 1TQ7B 2H9EH 1P3CA 4X2VA 2XC5A 4Y8XA 2V6NA 2M5TA 3NCLA 5DP9A 2ZTZA 2AGIX 1GHYH 2PKAB 2ODYB 1Z7KA 2J95A 1ELVA 3MO6A 1F5KU 3RU4E 3ESTA 3IITA 3RXDA 5I46H 1OP8A 1Z8RA 3BTFE 5EQRA 1EASA 1KTSB 1QRXA 3R3GB 3QO6A 3D65E 3MU5A 3M61U 1AFQC 1YCPK 2A5KA 5B6OA 1O5EH 1W0YH 1W0ZU 4D7FA 1IQNA 2BD3A 5CMXH 1TPAE 1OWDA 2AIQA 4U30A 2ZTXA 3RXKA 1GBJA 1OSSA 1ZHRA 3QWCH 3SGQE 4WY3A 2ZFRH 2W3KA 1O2SA 5FBIA 4Y0YE 2Y5HA 1TOMH 3W94A 2VH6A 3LGVA 1XXFA 1UHBA 3M37A 2ZDNA 4VGCB 2Q6DA 1YPMH 1DWCH 2UWLA 2VH0A 2ZFPH 2BD2A 2SGFE 1PPEE 5DP5A 3VB3A 4MDSA 1BUIA 3BIUH 3SUEA 3F6UH 2A4GA 3RXGA 4NWLA 1O3CA 3UFAA 1EB2A 4CRDA 3VGCC 2F9UA 2ULLA 3Q76A 3RXAA 1UCYK 1TNKA 2FOGA 1L0ZA 3P70B 1NESE 1X7AC 1A4WH 3M3VA 2G4UA 4IC6A 1OYQA 1O3NA 2ZWLH 4FU7A 4IW4E 2ZCLP 3SHAH 4X2WA 1NT1A 1QGFA 1EAWA 1SGQE 3BG4B 3VB6A 1LDTT 3DFLA 1WV7H 2C8ZB 2H5DA 4GHTA 3KL6A 2SGPE 3QZRA 1ELDE 1FPHH 4NZLA 4RKJB 4IGDA 4R0IA 1RTLA 2VNTA 4I7YH 1LPGB 2ZGBH 2B9LA 2UUYA 3RC5A 1QJ6B 1WBGB 1O3EA 3PMHB 2A7CA 5EOKA 3MO3A 3EGKH 1QL8A 1F7ZA 4LK4A 1Q3XA 1TALA 5DO4H 1T31A 1O31A 5AF9H 1GHZA 1YKTA 1TGSZ 3PMJA 2GZ7A 3MH5A 1C1NA 4Y7BA 1INCA 2W7UA 2AFQB 4IN1A 4MNXA 1GL0E 1KY9A 1UVTH 1DWEH 1EJAA 1DUAA 2HRVA 5FX5A 1CBWC 1SLWB 1HAHH 4BNRA 3QTVH 1CGHA 2WUCA 4AZ2B 4INKA 1CU1A 1LHDH 1A0JA 4X0WU 4ABGA 1C2IA 3FZZA 1ZMLA 5LPRA 2BM2A 1NU9A 1GMDG 4B74A 3NXPA 4ISLA 5JYIA 4LOYH 2TGAA 1H8IH 1MAYA 1UTLM 1BTUA 1Z8JB 2P94A 3RXJA 3GCTG 1LVOA 1PPBH 2B8OH 3MH7A 1SBWA 3KQDA 2PWXA 5LGOA 1JWTA 1U6QA 1TA6A 2ZDLA 3MTYA 4U01A 4H6TA 2BX3A 1AUJA 2VVCA 1TB6H 5AFYH 4K8YA 2THFB 3RMLH 1UO6A 2YNBA 4MLFB 1DOJA 4JZFH 3RXLA 2R9PA 4ZHMU 1BBRE 3GDUA 3SQHE 3A89A 1VZQH 3URCA 3U1IB 1A1RA 1V2TT 2FIRH 1C1TA 3EDXB 4Q7ZA 5GWZA 4D76A 1XUJA 1FIZA 1QB9A 3BTTE 1IOEA 1XXDA 2EA3A 2FOMB 3GDVA 1OP0A 1EP6A 1OWKA 3L33A 2R3UA 4CH2B 2UUFB 4TPYA 1GI9B 4IBLH 4D8NA 2HALA 1ELFA 3UR6A 5GJ4B 1GBKA 1PFXC 1C5RA 2GCTB 2G55A 1A2CH 3SUDA 4D7GA 2J34A 2CHAC 1F0SA 1LPKB 3P8GA 1XUFA 3W95A 5DGJA 1KLTA 3QGJA 1E35B 1UTQA 1FJSA 5GPIB 1JMOH 2Z94A 2AMDA 4OS1A 3ZZ9A 2GDEH 4NGAH 1ZJKA 2Y81A 2AIPA 1LVBA 1HGTH 1UTOA 1D4PB 1TAWA 2FDAA 3HKIB 3MMGA 1TBZH 4I8GA 1GG6B 1ZSJA 3PB1E 2BQWB 3IWMA 1O35A 4OS7A 1O3MA 2YNAA 3SO3A 2WV4A 1C1OA 3DT0H 3TJVA 2ZCHP 1S6HA 1GI6A 1G9IE 4TWWA 1GGDB 2CMYA 4AOQA 1C5VA 1LQEA 1IQLA 2RDLA 1Q31A 3ELAH 1VCQA 1CO7E 2ZU5A 1GCDA 1P3EA 4FUJA 3SUGA 4I8JA 1AE8H 2A45B 2FLRH 4YOJA 1L4ZA 3H7TA 4AFZA 3SNDA 1RS0A 3VXFH 1HIAB 1OYTH 2P3UB 4AG2A 2R2MB 1C5OH 1ELCA 3A7YA 3FP6E 2I6QA 2OLGA 5T6GA 1IQEA 2WUBA 2ZHFH 1Y5BT 3A86A 2CGAA 3CP7A 1DWBH 1UCYE 3QUMP 1WCZA 3A8BA 4ISIH 1TNJA 1L1NA 3PM3A 2SGAA 1GJBB 4FU8A 2F9NA 3SU0A 1C9PA 1RRKA 1F0UA 2F83A 1UVPA 1O38A 1ZOMA 4MG3A 3BTGE 3NWUA 1C2LA 4JYVH 1UVOA 4OGXA 1V2VT 4ABFA 1T7CA 2A7HA 3E91A 3WY8A 4JK6A 4K69A 1BMAA 4I8LA 3NKKA 5A09A 2Z3CA 2Z7FE 4AYVB 2NWNA 1SGEE 2D1JA 1C5YB 1ID5H 4KTCA 4FUHA 2P16A 3ZVGA 2VGCC 1CE5A 3P8NA 4Y6DA 3GCNA 2BYAX 3GYLB 3MNXA 2XBYA 2R0LA 2VIDA 1AIXH 1A0HB 1EJNA 5FCKA 4AN7A 3PWCA 3VGCB 1QHRB 1T8NA 2SNVA 5TCAA 4XSKU 1PPHE 1Z6JH 1KTTB 9LPRA 1THRH 3RMOH 1D3QB 1XKBC 2SGDE 1C5QA 4A7IB 5A8YA 4Y10E 4CHAC 1F92A 1T8LA 1JBUH 1MKWK 3T29A 1WU1A 2Z3EA 2EI7A 2QXIA 2ZDVH 3ZV9A 3SQEE 4CRBA 3H7OA 2ZDAH 1G3CA 1C2DA 1GJ9B 1W10U 2V3OH 3AW1A 1O36A 4K60A 3VXEH 1E36B 4HI3A 1FN6A 1FUJA 1EAUA 2FXRA 2QF3A 1SHYA 3MU4A 5E0GA 3UUZA 1BZXE 1G3EA 4AGKA 3KNXA 1ZHMA 2BZAA 2C3SA 2IJOB 1DX5M 3A7VA 1MD7A 2QAAA 2XXLA 3DHKH 1MAXA 3D23A 1CA8B 1SFQB 5JBTA 4U32A 3U8TH 2VINA 2XNIA 1MTSA 1XUKA 2R2WU 5JDUB 4BAHB 1FQ3A 1N6XA 1VCPA 1XMNB 4H6SB 3K6ZA 5EU8A 4LXBH 2IOTA 2RG3A 4NA7A 5F03A 1CBWB 4MPVA 2QF0A 4DY7B 8GCHF 1QRWA 2PUQH 1YPEH 4YT6H 4YZUA 1A3BH 1V2JT 3E3TA 3RXBA 5FAHA 1OWEA 5T6DA 4XBDA 1C5LH 1WYKA 3SBKA 1G2LA 1BTYA 1BCUH 1Z6EA 3T25A 1NU7B 1BDAA 3P8FA 2PTCE 1Y5UT 4ABIA 3F9GA 4UDWH 4ZMAH 2W26A 1LVYA 4Z0KA 3FVFB 1AVWA 4O97A 1O2GH 5G4BA 4GVUA 1C1MA 1DLKB 2Z3DA 2VIWA 1TGTA 2BQ6B 3ATKA 1SHHB 1TMBH 2ASUB 1F5RA 3UPEA 1FNIA 2AH4X 1QFKH 1G2MA 2PHBA 3BF6H 5C2ZA 2A32A 3F9FA 2VWNA 2VWMA 1MTUA 2CV3A 2GT8A 4XOJA 4GCHF 1SLXB 1J14A 3ZYDA 4D9QA 1PQAA 5J4SA 1SQTA 1NY22 4DOQA 1QY6A 1UTKA 1EUFA 2OTVA 3M5MA 3D62A 1GDQA 2CXVA 1WOFA 2ZF0H 4FUEA 3V12A 2WYGA 2ZECA 5JBBS 4BAQB 4WH8A 3A84A 2P8OC 4KKDA 3ZZ3A 3TJNA 1V2QT 4JYUH 4B2CA 1KXEA 1SG8B 1GMHG 1O2HA 1C1RA 1E34B 2R0KA 2Z9JA 3OYPA 2FODA 2UUJB 2A0QB 3GY8A 2FM2A 1ZTLA 1DY9A 2GCTC 1AKSB 5F8XA 5HYOA 1O3DA 2QY0B 2CHAB 2JH5D 4UONA 3TK9A 1D9IA 1XVOA 1P2MA 1WUNH 4MTBA 5C1UA 3ZZCA 2NU3E 3LGWA 3RMNH 2QV1A 4WMEA 1K1JA 1SOZA 5DKMA 1Y5AT 3URDA 1QURH 1SR5C 2OD3B 2PGQB 1EPTA 1QRZA 1CA0C 4NFEA 4AG1A 2NU1E 1MTNC 2AYWA 4CREA 4HTCH 2ZFSA 4AORA 4I8KA 4AB9A 1GI2A 1GG6C 4BTIB 2O9QA 1ANBA 3V0XA 1DM4B 1QA0A 1YYY1 3L3TA 4XBBA 4GCHG 2HPQH 1TRMA 5BPEA 1HPGA 4A92A 2FOEA 2P3FH 1THSH 1PJPA 1GGDC 5LPEA 1GBEA 4ISNA 2O8TA 1NRPH 2ZG0H 4AGJA 2BDAA 3ZVFA 2TGPZ 2A5IA 1ZYOA 3H5CB 5LH8A 2GDDA 2UWPA 1SOTA 3QX5H 2ZKSA 1W14U 1ANEA 3T62A 2OXSA 4AB8A 4AFQA 1GI5A 3LOXA 1OWJA 3UIRA 4TPIZ 3STIA 1IQGA 1FPCH 1GBBA 1FV9A 1HB0B 1GCTC 3GCOA 2CN0H 2ZZUH 1SGYE 1RGQA 3IG6B 3O8BA 3A8AA 1HLTH 1GHAG 3TJUA 3DA9B 3SHCH 1GI7B 2AERH 3LDXH 4CRGA 1GJCB 3SJOA 1B5GH 4IMZA 5A0AE 2WPLS 2NU4E 2Y80A 5EQQA 4DG4A 3L6PA 2A7JA 4YT7H 1HAYB 2EI6A 2BDHA 2Z9KA 1O5BB 1TIOA 4MNYA 3PMBB 2QXJA 1SGPE 1HJ9A 4CR9A 1TNGA 1ZRBA 3MHWU 1O32A 4Y11E 2RA0A 2VGCB 5PTPA 4A1TA 1C2GA 1L1GA 1O2QA 1BIOA 4BTTB 1XVMA 1LCYA 1NS3A 5C1XA 1CHGA 1Z1IA 3RXUA 1FY3A 3RXPA 3BTHE 4NIWA 1TOCB 1O2YA 4HZHA 5EW2H 1V3XA 2AGGX 4KGAA 4ZXXH 4U2WA 4IS5A 3SGBE 1TX8A 2STAE 1DWDH 3SORA 3LGIA 3TIUA 1MCVA 1L4DA 1KLJH 3GY5A 1GJDB 1V2PT 1XKAC 2WPIS 4AX9H 4JZDH 1GI3A 2G51A 2BDCA 1P2NA 1W7XH 1BTPA 1BITA 1O5CB 1QL9A 1MCTA 3FP7E 2BY5X 1O30A 1O5DH 4DJZB 3RXIA 1O2PA 1GHVH 2BY7X 3N7OA 4LZ1H 1SB1H 3RXRA 7GCHF 1TNLA 5I25A 4CHAB 4D9RA 3E0PB 4YOGA 2PSXA 4ISHH 3I78A 3S9CA 1BTWA 1CSOE 1MZDA 1MZAA 3NK8A 1ANCA 1GBMA 1V2UT 4GLYA 1DITH 2BTCE 3M7UA 5BRRE 1EB1H 1OWIA 2ZFTA 1QBOA 3SU6A 3SGAE 1SLVB 4IC5A 5DP6A 1O3LA 2ZFFH 5EW1H 3SNAA 1PYTC 3HGPA 1HV7A 1RFNA 3HGNA 2C90B 1CT4E 2V0BA 3MI4A 4CR5A 1CGIE 1NRNH 1P05A 1C1WH 1PYTD 3RM0H 2PTNA 1CHOF 4B71A 3U98H 1JRSA 5J4QA 2PKAA 1TPOA 1TMTH 3ZV8A 3FP8E 1ZPBA 2BVSH 3K6YA 4JYTA 4YLQH 1TGCA 3STJA 1B0EA 3LONA 4OS2A 1K28D 1YPKH 3A8CA 3A87A 5K7RA 1LMWB 1T8MA 1P2QA 8LPRA 1EZXC 3ZYEA 2Y82A 1TE0A 2ZGCA 5HGGA 2BY8X 2HNTF 2ZCKP 1O34A 2ZPRA 3KQEA 5FBEA 3TPIZ 5GDSH 2P93A 3KGPA 1YC0A 1HFDA 1W8BH 2UUKB 5E2PA 2A2QH 1AVXA 4F4OC 3NZIA 2ZA5A 5FX6A 4B1TA 2BDGA 1LKAA 3OY5U 1O2OA 4KTUA 3A83A 2OC7A 1L1JA 1DVAH 1CT2E 4ABHA 2ZHEH 1ESTA 4I33A 3UWIA 3E0NB 2D26C 1Y3XA 1ZRKA 1O3AA 3KEEA 1PQ7A 3GICB 1GHWH 3MYWA 3HK6B 4PROA 2ZC9H 1C2HA 2ZIQH 1FI8A 2WPHS 1GI8B 5EXLA 3A85A 2ZFQH 1PPZA 2FP7B 3HATH 4ZKSU 3PTBA 4WJG2 3E16B 2BOHB 1O3KA 2GCHF 3BEFB 1EZSC 3LJOA 1HAOH 1W13U 2FEQH 1LHEH 3PTNA 1QA7A 3SU3A 3SUFA 3EQ0H 1DFPA 1T4UH 2P8OB 4H42U 5E8EH 3SJIA 5F6MA 2AS9A 2PR3A 1UTPA 3GCHC 1DPOA 4ISOA 2BY9X 1C5WB 1LPZB 3VPKA 1A5HA 1LTOA 2BQ7B 3AAVA 1AWFH 1TA2A 3B23B 3HPTB 1V2OT 4NIVA 1P06A 3EA7A 3OY6U 2XW9A 3UOPA 1MH0A 1RTFB 3BTME 4FXGH 2A4RA 3B9FH 4JZ1A 3RDZA 3OX7U 1TNHA 1EXFA 2ILNA 1C1VH 1WQSA 1CGJE 2XRCA 4DIHH 3E8LA 1YLDA 1E38B 1Z1JA 1C1PA 2FOFA 2Z9IA 2GV6A 3SN8A 1S82A 1MKXH 4A1VA 1BMMH 1MU6B 1SGCA 5DG6A 1SGFA 1CA0B 3QN7A 3SU2A 1Y3VA 1KDQB 1MTNB 4TWYA 4BTUB 2GT7A 1YM0A 3KN2A 4K1EA 1SGNE 1QR3E 1Y3UA 1HAXB 1UVSH 1RIWC 2VWLA 1BTHH 1BRUP 2BB4A 2G5NA 4ABBA 4A6LA 2GCHG 3SW2B 6ESTA 1UMAH 4FUGA 2KAIB 1DT2A 3JZ1B 3ODDA 1KLIH 1DY8A 2XBWA 4B75A 5CHAB 1P2IA 2B7DH 1P04A 5EG4A 3DD2H 1ZZZA 1IHSH 1WTHD 3LH3A 4FVDA 5EPNA 1O2TA 3EYDA 1FMGA 3BG8A 2CF9H 2D8WA 2OBQA 1NTPA 2GZ8A 3TITA 1GCTB 4Q7YA 2VB0A 2TRMA 3ATWA 1W12U 1XUIA 3M5NA 1K1LA 1SMFE 1UK2A 3PO1C 1VGCC 5GIBA 1SSXA 4JZEH 1TWXB 2OQUA 2A2XH 3TK6A 1VITF 2BLQA 2ZU4A 3BEUA 4NZQA 3TNSA 1O5GH 2G00A 1RJXB 1GJ8B 2FI4E 1KIGH 1DS2E 1O2LA 3MU8A 1UTMA 2BD8A 3RLWH 2VJ1A 4J2YB 1C5ZB 1JIRA 2A4OA 3GY4A 1ZMJA 4K3JA 3T5FH 1GBTA 3P17H 1HBTH 1W11U 2C8YB 4XDEA 1GJ7B 4I8HA 1EATA 1DSUA 2RCEA 4X1SU 3V3MA 4BAKB 2Q6FA 3OU0A 4TY6A 2GMTC 3F9EA 4CRFA 1F0RA 4XFQA 5DP7A 1FY1A 3GY3A 1ARCA 1Z8GA 1A61H 1AO5A 1IHTH 1GMCF 4NFFA 2F9OA 1GBLA 3SJ9A 4K2YA 3NPSA 2Z9GA 3ZVEA 2FWWA 3RXHA 2A5AA 3BEIB 2ZNKH 4MQAA 4ABJA 1ZTJA 1O39A 4WWYA 2HGTH 5C5NA 1PPGE 4DCDA 2F9PA 3RMMH 2CF8H 1GHBF 3UNQA 2QN5T 1C4V2 1BOQA 3GOVB 1N6YA 3G01A 5DJ7A 1FDPA 5JBCS 1D3TB 4GAWA 2HNTE 1LO6A 3HK3B 3U8OH 1WSSH 2Z9LA 2V3HH 3SOSA 1EAXA 1ELAA 3SI3H 1SGDE 1BTZA 3K65B 1P09A 3GYMA 2I6SA 2FS9A 2R3YA 4UD9H 3ZVCA 1O3JA 2O8MA 1DANH 2QIQA 2VIVA 3MU0A 3UWJH 3A81A 2ZHWH 1TNIA 5C1YA 3EE0B 1FY5A 1HIAA 2WINI 1ORFA 4O03A 2QCYA 3A7TA 1O3HA 1Z71A 5ETXA 3SV2H 1W3CA 1T4VH 1MTVA 4E7RG 1IQFA 2VU8E 3LIWA 2TIOA 5A8XA 2G8TA 3RXOA 2XBVA 4H4FA 4CBOA 1PPFE 3CENA 4OGYA 2DUCA 1C5SA 2TBSA 1BRCE 4ABDA 4ZROA 3A7XA 1YLCA 3A82A 5DP3A 1HUTH 3RP2A 5IYTA 3RXQA 3ZVBA 1ETRH 1D3DB 4Y71A 2PGBB 5F8ZA 2B0FA 1C1QA 2BDBA 2TPIZ 1LHFH 4HFPB 1J16A 3I77A 1O33A 1TX7A 1MTWA 1UJ1A 5A0CA 1G36A 3PLBA 3ODFA 2OCVB 1F2SE 1BA8B 1SPJA 3MO9A 2J38A 2XCNA 2BDYA 5L2YH 2TGTA 1P9UA 5E0JA 3Q77A 4MNVA 2ZGHA 1ANDA 3TH3H 4ZXYH 3SJ8A 3U9AH 1VITH 2PSYA 4XE4A 4YESB 3PYHA 5FXLA 3ATMA 1YPGH 1EP5A 1RD3B 1SFIA 1HAPH 2OC8A 4NG9H 2BY6X 3E1XB 1V2WT 2AEIH 1YGCH 4YM9A 6GCHF 4INHA 3U1JB 2QXGA 1BHXF 2BOKA 2FO9A 4OS5A 1O2RA 3ZZDA 1EQ9A 1NFYA 2WPJS 1IQKA 3MWIU 1HXEH 1VR1H 3B8JA 2BD9A 2ZGJA 1OXGA 3SNEA 1TBRH 2WPKS 3GCHB 1CT0E 3VEQB 1NROH 3V13A 8GCHG 1ZMNA 5EPYA 2ZPQA 1BQYA 3LJJA 2ZDMA 4E06H 4UEHH 1HYLA 1P10A 2ZU1A 1DSTA 1S83A 4HGCA 1QCPA 4RSPA 1S81A 2HVXA 4FUCA 3UOUA 1H9IE 4M7GA 4YLUA 1RXPA 1YPJH 1P2JA 1O2XA 4Y0ZE 4Y76A 3GISB 4WMFA 2JH0D 2ALPA 1FAXA 4Y7AA 1S6FA 3SNBA 1UTJA 2FZZA 3P6ZB 1O3GA 2FTMA 4Q80A 1BJUA 1HJAC 1YP9A 4WXVA 1BRBE 1M9UA 1RIWB 1UHBB 1TGNA 4NA9H 1DICA 1P57B 4BAOB 3VB5A 1O3BA 4OS6A 5AVDA 1WTGH 2XYAA 4X6PA 1C2MA 1SQOA 6GCHG 3JZ2B 2W5EA 3P95A 5SGAE 2OC1A 1LKBA 1C5MD 3BV9B 5JB9S 3UNRA 1NN6A 1QB1A 1PQ5A 1TMUH 3AASA 3RXEA 3CS7A 1UK3A 4ZH8A 3LGTA 3ZZ6A 5CHAC 2HOBA 4FUFA 3PMAB 2NU2E 2BD4A 4X8TH 1JOUB 1IQJA 2XCFA 2ZU3A 1DXWA 1EKBB 1C1SA 1O2JA 3ZZBA 1JIMA 2DE8A 1TRNA 5FPSA 4CBNA 1MMJN 4DT7B 4KTSA 2XC0A 3ZZ5A 5AHGH 1K22H 1HDTH 1SLUB 4NCYA 4NSYA 5FPYA 5DK1A 4X1PU 1IQMA 2PW8H 3SNCA 5L6NH 1XM1A 4WMDA 3RXMA 3PO1B 1VGCB 1J8AA 3ENSB 3MH4A 1AB9B 1OOKB 4BOHA 3ATLA 1GI0A 2SGQE 4BXWA 2Y5GA 1NO9H 1YPHC 5F8TA 1HNEE 1BHXB 1THPB 3LC3A 3EA8A 1QNJA 4UFDH 1MU8B 1P01A 1C5TA 1GVZA 1AHTH 1AUTC 1YBWA 3M7QA 5JB8S 3MU1A 1NC6A 1QJ7B 2ALVA 1O2WA 1MQ6A 1EAIA 1QB6A 1UK4A 1O3IA 3ZZ4A 7ESTE 1A3EH 2EC9H 5C20A 4O3UA 2XWBI 4X1QU 1GJ4H 1O2NA 2XC4A 2GMTB 3MNBA 2H5CA 4BAMB 1AKSA 4SGBE 2JETB 1MQ5A 4I31A 4B2BA 2FOAA 1K1NA 3VFEA 2O8LA 2VIOA 4UE7H 1ZLRA 2PKSC 1K2I1 2A31A 3P8OA 2BDIA 1NFUA 1NZQH 3M3SA 1TPPA 2QXHA 3LC5A 2O8WA 3PV4A 3KQBA 1FZZA 4ZAEA 2H2ZA 1SGFG 1TLDA 1GVKB 1SL3A 1GJAB 4ZHLU 3RXSA 3TGIE 3GY6A 1KXDA 1O3PB 2PLXA 1C5NH 4QT8C 1V2RT 2F3CE 1FN8A 1A46H 2H6MA 1NRSH 1Y59T 1AN1E 2BVRH 1H9LB 4WF8A 1MKXK 2BVXH 1AE5A 2ODPA 6CHAC 3KQCA 1ACBE 1EOJA 2P3TB 1S85A 2ZHDA 2ODQA 5H4IB 3BIVH 3MNSA 1NFXA 1W2KH 3BN9A 3OTJE 1D6WA 3D49H 4AFUA 3FANA 2B5TB 1AGJA 1C4Y2 1V2NT 1GVLA 1ZGIA 2ESTE 1BT7A 1P03A 1GMDF 4B73A 4UFGH 3CS0A 2RA3A 3O8CA 1FY4A 1ZR0A 3KHVA 3A7ZA 1H9HE 2HPPH 1S0QA 1GDNA 1SGTA 1VJAU 2YOLA 5JBAS 3GCTF 1SC8U 2ZDKA 2Y7ZA 1BB0B 1ZSKA 4DVAU 3KF2A
chains in the Genus database with same CATH superfamily
2FS8A 1E37B 1O37A 5ESBA 1DDJA 1SGRE 4INLA 1D6RA 1AFEH 1ETTH 2V35A 2XBXA 1TX6A 1XX9A 1BBRH 3AVZA 1S6LA 1WAYB 4X8UH 3LH1A 1A0LA 1J17T 2G5VA 3M3TA 5T3HA 1GDUA 2J4IA 4NIXA 2FOCA 3MOCA 2GX4A 4FETA 1EFRD 2QA9E 3SV7A 1G3DA 3PLKA 1B7XB 1LHGH 1EX3A 1TBQH 1IQIA 1EPTC 2G52A 7GCHG 9ESTA 1YCPM 4IMQA 2BXUH 4THNH 2C8WB 4AYYB 2YMSB 1QZ8A 1MD8A 1WDIA 2OINA 1GBDA 1OS8A 4OS4A 2GJGA 1TONA 2A4QA 2W7SA 3RXFA 4Y8ZA 1NFWA 1F0TA 2Y6TA 1AWHB 1FIWA 1JXPA 3DFJA 5EQSA 1BTXA 3PRBA 3OSYA 3S69A 4JZIA 4X6OA 3FFGA 2FI5E 1YPLH 8KME2 1V2LT 1HRTH 5E2OA 1TYNA 1EZUC 1ZPCA 5B6LA 2LPRA 2G4TA 4I86A 4ZUHA 3M5OA 4ZKOU 2BD7A 1GWAA 4ASHA 4A1XA 3SV6A 4WH6A 4JMYA 3M5LA 2Z6BD 1QJ1B 4XD7D 3A88A 2HLCA 5FHTA 1GL1A 1AVGH 3DUXH 2IPHA 1K1MA 2ZQ1A 1CHOG 3RC6A 2ZI2H 1IAUA 2FLBH 1XUHA 5IDKA 2OC0A 2BLOA 7LPRA 4X2XA 1YCPH 3W1EA 1LVMA 2EI8A 1N8OB 1TABE 5FCRA 3S0NA 1GJ6A 1OWHA 2STBE 3EE7A 8ESTE 2GZ9A 4ZCNA 3T26A 4JCNA 1PQ8A 4J1YA 4ABAA 1NRRH 1QQUA 2H1UA 3RM2H 2WPMS 3MNCA 2AGEX 5CE1A 3ZVAA 4RKOB 1TRYA 2FYQA 2C8XB 5EODA 3S9BA 3DCLA 1ESAA 3O8RA 4Q7XA 2ZHQH 3T2NA 1EZQA 2NU0E 1Q2WA 3K9XB 5TCCA 1P9SA 1ZTKA 4OM9A 3RU4D 2Q6GA 1FY8E 2BZ6H 3MFJA 3BTKE 3SV8A 1CVWH 2IN2A 1Y3WA 3U8RH 1HJAB 2CJIA 5DP8A 1UCYH 3HKJB 2J92A 2ANKH 3VB7A 1IQHA 1GBIA 4YOIA 1L2EA 1C5XB 3PLPA 1ELEE 1HAVB 5EGMA 1AU8A 1C2KA 1SI5H 1ELBA 3LU9B 2F91A 1FAKH 1S5SA 2J9NA 3UNSA 2ZGXH 1HCGA 5EXNA 2FTLE 3AW0A 3LT3A 3VB4A 4WVPE 4CRAA 4GPGA 2KX4A 3AAUA 1GI1A 1AD8H 4ABEA 2BMGB 5T6FA 1C2EA 1C1UH 1O5FH 2C93B 5LPFA 5F53A 2XWAA 3EAJA 1H4WA 1QQ4A 4TY7A 3Q3YA 1HJ8A 1ELGA 1AI8H 2SFAA 1HAZB 2ANYA 3TGJE 1K1IA 3GDSA 5ESTE 3T28A 2KCPA 5ABWA 1C2JA 2QF4A 1P02A 2A1DB 4MNWA 1ETSH 1V2ST 3A80A 4MPWA 4Z6AH 1P8VC 5L2ZH 2FOHA 4NIYA 1HXFH 1MBMA 3RLYH 4K1SA 1MBQA 3SZNA 1AB9C 1F5LA 1V6DA 3F1SB 3SZEA 2J98A 3M35A 1ABJH 3TGKE 4TYDA 2FOBA 5TJXA 1D3PB 1SVPA 1OPHB 1FXYA 2TGDA 2AMQA 4E05H 4FVBA 1S0RA 5JPMH 1DUEA 2HWLB 2BX4A 2VWOA 2G81E 1E79D 4O9VA 4X2YA 3TJOA 3N99A 2PV9B 3T27A 2GGVB 2SGEE 3UQOA 3M7TA 1V2MT 1H8DH 4B6EA 1JRTA 1NPMA 2P95A 4GSOA 2JETC 2BHGA 7KMEH 1AFQB 3FAOA 2PKSB 3BTQE 4ESTE 2H9TH 3SU5A 1ZSLA 1KYNA 4ZHAA 1KXCA 5A8ZA 5E0HA 1CQQA 1ZJDA 1TFXA 1KDQA 5CHBA 1KXFA 1N1LA 3LPRA 3S9AA 3KCGH 2Y5FA 4NWKA 2OUAA 3F68H 4TSFD 3LGYA 5C5OA 1QTFA 4ACAA 2H9HA 3RXVA 1HAVA 3C27B 4MPUA 1QIXB 1RTKA 4VGCC 1GBFA 1GBAA 1P0SH 1O0DH 4X1NU 1B0FA 3NUMA 5C3NA 3KIDU 4MVNA 2ZO3H 3Q3KA 1TQ0B 3E90B 2ANWA 4B2AA 3R0FA 2KAIA 1KXBA 1A7SA 1VITG 2ZTYA 3F0OA 6CHAB 2FI3E 4FOUC 4RN6A 2JH6D 4FU9A 3RUOA 1OX1A 2UWOA 3QTOH 2ZQ2A 2ZP0H 3BTEE 1O2UA 1BMLA 4UFEH 5AFZH 3TH4H 5DPAA 3RU4T 2QC2A 4DIIH 3F9HA 1EOLA 2BLWA 2QGRA 1AZ8A 1K1PA 2XTTB 1V2KT 1LQDB 1Y3YA 3BG4C 1K9OE 3PRDA 2Q1JA 5HM2A 1W7GH 3K2UA 4IN2A 4YO9A 1GMCG 1WQVH 1EJMA 1YPHE 1S84A 3U69H 2JDID 1KSNA 4YTAA 3LKWA 2DE9A 2RFKC 2W6ID 2WV5A 2FX6A 2GVFA 1NRQH 1P2KA 3SU1A 2FPZA 1GI4A 2PUXB 3EA9A 1TPSA 1O2ZA 4B76A 3UY9A 1BJVA 3S7HB 4GUXA 1GHBG 3C1KA 3SU4A 4E7NA 4CRCA 1EPTB 1PPCE 1QL7A 3Q3XA 4F49A 3SYJA 4LZ4B 3QK1A 4GHQA 2GV7A 3ZVDA 3QGNB 1AZZA 3RXTA 1OP2A 4NA8A 2J2UA 3FO8D 4JK5A 1G3BA 5C0TA 2YMSC 3BTWE 2ZPSA 3TU7H 4DGJA 1GMHF 5A2MH 3TNTA 1DLEA 4A5TS 4DW2U 3FKSD 1P12E 2VVVA 3RC4A 2YMSD 5GCHF 1O2MA 2KCAA 1E1QD 1ZPZA 2GTBA 1AQ7A 3BTDE 1BMNH 3NRLA 4X8VH 3SV9A 4K1TA 4Y8YA 3TVJB 1Y8TA 2AMPA 5FPTA 1TGBA 5HMAA 2BD5A 1G30B 5EXMA 1O2VA 2BLVA 1T8OA 4MPXA 2VVUA 3A7WA 1ABIH 2GP9B 4FUBA 2C4FH 1UTNA 3Q00A 2GD4B 3O8DA 5A0BA 3PV2A 1W0KD 1O5AB 2J94A 1FONA 1QBNA 3M36A 1VJ9U 3UQVA 1ZHPA 1HAIH 2SNWA 1VCWA 1ESBA 1N8OC 2W3IA 3OAAD 3PROA 4O3TA 1A5GH 1ELTA 2FMJA 2WYJA 3GY7A 4DURA 3ZZ7A 2OQ5A 1OKXA 4FUIA 4WXIA 4XBCA 1MUEB 3UTUH 4X6NA 6LPRA 1K1OA 3UR9A 1G32B 3SJKA 1GBHA 3OE7D 1QBVH 3ZZAA 1SQAA 2BXTH 5K0HA 3ZZ8A 1AY6H 3BSQA 2VIPA 2FESH 2EEKA 4Q2KA 4X6MA 1O3FA 1H8HD 5C67A 4X1RU 3MH6A 1BRAA 3TLOA 2F9BH 2K1QA 1K21H 5GCHG 1UVUH 4ZKRU 4KP0A 3F3BA 4I32A 2ANMH 3P92A 3PWBA 1ZGVA 5DP4A 2OBOA 1H1BA 1P2OA 2O8UA 3TK5A 4BXSA 1MKWH 1GHAF 2VIQA 1KXAA 3SI4H 5EIYA 3UREA 2JKHA 3QDZB 3QZQA 1GBCA 1O2KA 5L30H 5HM9A 1T32A 1YF4A 4P02A 1C2FA 1C5PA 2FX4A 1J9CH 3FZDA 2P59A 2LNCA 1HAGE 2JIZD 1A5IA 4R8TB 1C4U2 2FYRA 1G37A 4NSVA 3E6PH 4CH8B 1BBRK 1J15A 1AMHA 1Z8IB 1GJ5H 4K5ZA 1O2IA 4ZKNU 4Y79A 2F9VA 3GY2A 3I29A 3RXCA 1DXPA 4AFSA 1DE7H 3A8DA 1C9TA 2HNTC 4FUDA 5GXPA 1GHXH 3TH2H 2D2DA 4BANB 2KZ4A 1NM6A 1GPZA 2AHME 4SGAE 1SGIB 3LGUA 1FLEE 2GKVE 2PFEA 4UFFH 5HXFA 2QYIA 1P11E 2ZEBA 3ATIA 3ITIA 4K8BA 3S7KB 1E0FD 2ZU2A 4KELA 1C5UA 1O3OA 1XUGA 2OP9A 4X8SH 1ARBA 2Y7XA 5EJZA 3V7TA 3QLPH 1LHCH 1TQ7B 2H9EH 1P3CA 4X2VA 2XC5A 4Y8XA 2V6NA 2M5TA 3NCLA 5DP9A 2ZTZA 2AGIX 1GHYH 2PKAB 2ODYB 1Z7KA 2J95A 1ELVA 3MO6A 1F5KU 3RU4E 3ESTA 3IITA 3RXDA 5I46H 1OP8A 1Z8RA 3BTFE 5EQRA 1EASA 1KTSB 2JJ1D 1QRXA 3R3GB 3QO6A 3D65E 3MU5A 3M61U 1AFQC 1YCPK 2A5KA 4TT3D 5B6OA 1O5EH 1W0YH 4Z1MD 1W0ZU 4D7FA 1IQNA 2BD3A 5CMXH 1TPAE 1OWDA 2AIQA 4U30A 2ZTXA 3RXKA 1GBJA 1OSSA 3VG8A 1ZHRA 3QWCH 3SGQE 4WY3A 2ZFRH 2W3KA 1O2SA 5FBIA 4Y0YE 2Y5HA 1TOMH 3W94A 2VH6A 3LGVA 1XXFA 1UHBA 3M37A 2ZDNA 4VGCB 2Q6DA 1YPMH 1DWCH 2UWLA 2VH0A 2ZFPH 2BD2A 2SGFE 5HKKD 1PPEE 5DP5A 3VB3A 4MDSA 1BUIA 3BIUH 3SUEA 3UB0A 3F6UH 2A4GA 3RXGA 4NWLA 1O3CA 3UFAA 1EB2A 4CRDA 3VGCC 2F9UA 2ULLA 3Q76A 3RXAA 1UCYK 1TNKA 2FOGA 1L0ZA 3P70B 1NESE 3U28C 1X7AC 1A4WH 3M3VA 2G4UA 4IC6A 1OYQA 5IK2D 1O3NA 2ZWLH 4FU7A 4IW4E 2ZCLP 3SHAH 4X2WA 1NT1A 1QGFA 1EAWA 1SGQE 3BG4B 3VB6A 1LDTT 3DFLA 1WV7H 2C8ZB 2H5DA 1WXRA 4GHTA 3KL6A 2SGPE 3QZRA 1ELDE 1FPHH 4NZLA 4RKJB 4IGDA 4R0IA 1RTLA 2VNTA 4I7YH 1LPGB 2ZGBH 2B9LA 2UUYA 3RC5A 1QJ6B 1WBGB 1O3EA 3PMHB 2A7CA 5EOKA 3MO3A 3EGKH 1QL8A 1F7ZA 4LK4A 1Q3XA 1TALA 5DO4H 1T31A 1O31A 5AF9H 1GHZA 1YKTA 1TGSZ 3PMJA 2GZ7A 3MH5A 1C1NA 4Y7BA 1INCA 3UAIC 2W7UA 2AFQB 4IN1A 4MNXA 3MQKC 1GL0E 1KY9A 1UVTH 1DWEH 1EJAA 1DUAA 2HRVA 5FX5A 1CBWC 1SLWB 1HAHH 4BNRA 2RDEA 1CGHA 2M2AA 3QTVH 2WUCA 4AZ2B 4INKA 1CU1A 1LHDH 1A0JA 4X0WU 4ABGA 1C2IA 3FZZA 1ZMLA 5LPRA 2BM2A 1NU9A 1GMDG 4B74A 3NXPA 4ISLA 5JYIA 4LOYH 2TGAA 1H8IH 1MAYA 1UTLM 1BTUA 1Z8JB 2P94A 3RXJA 3GCTG 1LVOA 1PPBH 2B8OH 3MH7A 1SBWA 3KQDA 2PWXA 5LGOA 1JWTA 1U6QA 1TA6A 2ZDLA 3MTYA 4U01A 4H6TA 2BX3A 1AUJA 2VVCA 1TB6H 5AFYH 4K8YA 2THFB 3RMLH 1UO6A 2YNBA 4MLFB 1DOJA 4JZFH 3RXLA 2L6OA 2R9PA 4ZHMU 1BBRE 3GDUA 3SQHE 3A89A 1VZQH 3URCA 3U1IB 1A1RA 2LP6A 1V2TT 2FIRH 1C1TA 3EDXB 4Q7ZA 5GWZA 4D76A 1XUJA 1FIZA 1QB9A 3BTTE 1IOEA 1XXDA 2EA3A 2FOMB 3GDVA 1OP0A 5KECA 1EP6A 1OWKA 1BMFD 3L33A 2R3UA 4CH2B 2UUFB 4TPYA 1GI9B 4IBLH 4D8NA 2HALA 1ELFA 3UR6A 5GJ4B 5DN6D 1GBKA 1VKYA 1PFXC 1C5RA 2GCTB 2LELA 2G55A 1A2CH 3SUDA 4D7GA 2J34A 2CHAC 1F0SA 2OK5A 1LPKB 3P8GA 1XUFA 2K8IA 3W95A 5DGJA 1KLTA 3QGJA 1E35B 1COWD 1UTQA 1FJSA 5GPIB 1JMOH 2Z94A 2AMDA 2WPDD 4OS1A 3ZZ9A 2GDEH 4NGAH 1ZJKA 2Y81A 2AIPA 1LVBA 1HGTH 1UTOA 1D4PB 1TAWA 2FDAA 3HKIB 3MMGA 3OEHD 1TBZH 4I8GA 1GG6B 1ZSJA 3PB1E 2BQWB 3IWMA 1O35A 4OS7A 1O3MA 2YNAA 3SO3A 2WV4A 1C1OA 3DT0H 3TJVA 2ZCHP 1S6HA 1GI6A 1G9IE 4TWWA 1GGDB 2CMYA 4AOQA 1C5VA 1LQEA 1IQLA 2RDLA 3N7DA 1Q31A 3ELAH 1VCQA 1CO7E 2CK3D 2ZU5A 1GCDA 1P3EA 4FUJA 1YLNA 3SUGA 4HG6A 4I8JA 1AE8H 2A45B 2FLRH 4YOJA 1L4ZA 3H7TA 4AFZA 3SNDA 1RS0A 3F2HA 1K0HA 3VXFH 1HIAB 1OYTH 2P3UB 4AG2A 2R2MB 1C5OH 1ELCA 3A7YA 3FP6E 2I6QA 2OLGA 5T6GA 1IQEA 2WUBA 2ZHFH 1Y5BT 4F48B 3WW7A 3A86A 2CGAA 3CP7A 1DWBH 1UCYE 2IPQX 3QUMP 1WCZA 3A8BA 4ISIH 1TNJA 1L1NA 3PM3A 1YWUA 2SGAA 1GJBB 4FU8A 2KFWA 2F9NA 3F2GA 3SU0A 1C9PA 1RRKA 1F0UA 2F83A 1UVPA 1O38A 1ZOMA 4MG3A 3BTGE 3H09A 1SKYE 3NWUA 1C2LA 4JYVH 1UVOA 4OGXA 1V2VT 4ABFA 3WWFA 1T7CA 2A7HA 3E91A 3WY8A 4JK6A 4K69A 1BMAA 4I8LA 3NKKA 5A09A 2Z3CA 2Z7FE 4AYVB 2NWNA 1SGEE 2D1JA 1C5YB 1ID5H 4KTCA 4FUHA 2P16A 3ZVGA 2VGCC 1CE5A 3P8NA 4Y6DA 3GCNA 2BYAX 3GYLB 3MNXA 2XBYA 2R0LA 2VIDA 1AIXH 1A0HB 1EJNA 5FCKA 4AN7A 3PWCA 3VGCB 1QHRB 1T8NA 2SNVA 5TCAA 4XSKU 1PPHE 1Z6JH 1KTTB 9LPRA 2J97A 1THRH 3RMOH 1D3QB 1XKBC 2SGDE 1C5QA 1NBMD 4A7IB 5A8YA 4Y10E 4CHAC 1F92A 1T8LA 1JBUH 1MKWK 2KCOA 3T29A 1WU1A 2Z3EA 2EI7A 2QXIA 2ZDVH 3ZV9A 3SQEE 4CRBA 3H7OA 2ZDAH 1G3CA 1C2DA 1GJ9B 1W10U 2V3OH 3AW1A 1O36A 4K60A 3VXEH 1E36B 4HI3A 1FN6A 1FUJA 1EAUA 2FXRA 2QF3A 1SHYA 3MU4A 5E0GA 3UUZA 1BZXE 1G3EA 4AGKA 3KNXA 1ZHMA 2BZAA 2C3SA 2IJOB 1DX5M 3A7VA 1MD7A 2QAAA 2XXLA 3DHKH 1MAXA 3GS9A 3D23A 1CA8B 1SFQB 5JBTA 4U32A 3U8TH 2VINA 2XNIA 1MTSA 1XUKA 2R2WU 5JDUB 4BAHB 3WWBA 1FQ3A 1N6XA 1VCPA 1XMNB 4H6SB 3K6ZA 2PP6A 5EU8A 4LXBH 2IOTA 2RG3A 4NA7A 5F03A 1CBWB 5KEDA 4MPVA 2QF0A 4DY7B 8GCHF 1QRWA 2PUQH 1YPEH 4YT6H 4YZUA 1A3BH 1V2JT 3E3TA 3RXBA 5FAHA 1OWEA 5T6DA 4XBDA 1FX0B 1C5LH 1WYKA 3SBKA 1G2LA 1BTYA 1BCUH 1Z6EA 3T25A 1NU7B 1BDAA 3P8FA 2PTCE 1Y5UT 4ABIA 3F9GA 4UDWH 4ZMAH 2W26A 1LVYA 4Q63A 4Z0KA 3FVFB 1AVWA 4XRNA 4O97A 1O2GH 5G4BA 4GVUA 1C1MA 1DLKB 2Z3DA 2VIWA 1TGTA 2BQ6B 3ATKA 1SHHB 1TMBH 2ASUB 1F5RA 3UPEA 1FNIA 2AH4X 1QFKH 1G2MA 2PHBA 3BF6H 5C2ZA 2A32A 2KM0A 3F9FA 2VWNA 5CDFE 2VWMA 1MTUA 2CV3A 2GT8A 4XOJA 4GCHF 1SLXB 1J14A 3ZYDA 4D9QA 1PQAA 5J4SA 1SQTA 1NY22 4DOQA 1QY6A 1UTKA 1EUFA 2OTVA 3M5MA 3D62A 1GDQA 2CXVA 1WOFA 2ZF0H 4FUEA 3V12A 2WYGA 2ZECA 5JBBS 4BAQB 4WH8A 3A84A 2P8OC 4KKDA 3ZZ3A 3TJNA 1V2QT 4JYUH 4B2CA 1KXEA 2V3MA 1SG8B 1GMHG 1O2HA 1C1RA 1E34B 2R0KA 2Z9JA 3OYPA 2FODA 2UUJB 2A0QB 3GY8A 2FM2A 1ZTLA 1DY9A 2GCTC 1AKSB 5F8XA 5HYOA 1O3DA 2QY0B 2CHAB 2JH5D 4UONA 3TK9A 1D9IA 1XVOA 1P2MA 1WUNH 4MTBA 4P00A 5C1UA 3ZZCA 4YXWD 2NU3E 3LGWA 3RMNH 2QV1A 4WMEA 4M9FA 1K1JA 1SOZA 5DKMA 1Y5AT 3URDA 1QURH 1SR5C 2OD3B 2PGQB 1EPTA 1QRZA 1CA0C 4NFEA 4AG1A 2NU1E 1MTNC 2AYWA 3OFND 4CREA 4HTCH 2ZFSA 4AORA 4I8KA 4AB9A 1GI2A 1GG6C 4BTIB 2O9QA 1ANBA 3V0XA 1DM4B 1QA0A 1YYY1 3DSPA 3L3TA 4XBBA 1H8ED 4GCHG 2HPQH 1TRMA 5BPEA 1HPGA 4A92A 2FOEA 2P3FH 1THSH 1PJPA 1GGDC 5LPEA 1GBEA 4ISNA 2O8TA 1NRPH 2ZG0H 4AGJA 2BDAA 3ZVFA 2TGPZ 2A5IA 1ZYOA 3H5CB 5LH8A 2GDDA 2UWPA 1SOTA 3QX5H 2ZKSA 1W14U 1ANEA 3T62A 2OXSA 4AB8A 4AFQA 3N7EA 1GI5A 3LOXA 1OWJA 3UIRA 4TPIZ 3STIA 1IQGA 1FPCH 1GBBA 3OEED 1FV9A 1W0JD 1HB0B 1GCTC 3GCOA 3ZIAD 2CN0H 2ZZUH 1SGYE 1RGQA 3IG6B 3O8BA 3A8AA 1HLTH 1GHAG 3TJUA 3AK5A 3DA9B 3SHCH 1GI7B 2AERH 3LDXH 3DSGA 4CRGA 1GJCB 3SJOA 3KQ5A 1B5GH 4IMZA 5A0AE 2WPLS 2NU4E 2Y80A 5EQQA 4DG4A 3L6PA 2A7JA 4YT7H 1HAYB 1E1RD 2EI6A 2BDHA 2Z9KA 1O5BB 1TIOA 4MNYA 3PMBB 2QXJA 1SGPE 1HJ9A 4CR9A 1TNGA 1ZRBA 3MHWU 1O32A 4Y11E 2RA0A 2VGCB 5PTPA 4A1TA 1C2GA 1L1GA 1O2QA 1BIOA 4BTTB 1XVMA 1LCYA 1NS3A 5C1XA 1CHGA 1Z1IA 3RXUA 1FY3A 3RXPA 3BTHE 4NIWA 1TOCB 1O2YA 4HZHA 5EW2H 1V3XA 2AGGX 4KGAA 4ZXXH 4U2WA 4IS5A 3SGBE 1TX8A 2STAE 1DWDH 3SORA 3LGIA 3TIUA 1MCVA 1L4DA 1KLJH 3GY5A 1GJDB 1V2PT 1XKAC 2WPIS 4AX9H 4JZDH 1GI3A 2G51A 2BDCA 1P2NA 1W7XH 1BTPA 1BITA 1O5CB 1QL9A 1MCTA 3FP7E 2BY5X 1O30A 1O5DH 4DJZB 3RXIA 1O2PA 1GHVH 2BY7X 3N7OA 4LZ1H 1SB1H 3RXRA 7GCHF 1TNLA 5I25A 4CHAB 4D9RA 3E0PB 4YOGA 2PSXA 4ISHH 3I78A 3S9CA 1BTWA 2J5UA 1CSOE 1MZDA 1MZAA 3NK8A 1ANCA 1GBMA 1V2UT 4GLYA 1DITH 2BTCE 3M7UA 5BRRE 1EB1H 1OWIA 2ZFTA 3OTPA 1QBOA 3SU6A 3SGAE 1SLVB 4IC5A 5DP6A 1O3LA 2ZFFH 5EW1H 3SNAA 1PYTC 2L74A 5FL7D 3HGPA 1HV7A 1RFNA 3HGNA 2C90B 1CT4E 2V0BA 3MI4A 4CR5A 1CGIE 1NRNH 1P05A 1C1WH 1PYTD 3RM0H 2PTNA 1CHOF 4B71A 3U98H 1JRSA 5J4QA 2PKAA 1TPOA 1TMTH 3ZV8A 3FP8E 1ZPBA 2BVSH 3K6YA 4JYTA 5HIZA 1OHHD 1TGCA 4YLQH 3STJA 1B0EA 3LONA 4OS2A 1K28D 1YPKH 3A8CA 3A87A 5K7RA 1LMWB 1T8MA 1P2QA 8LPRA 1EZXC 3ZYEA 2Y82A 1TE0A 5DSFA 2ZGCA 5HGGA 2BY8X 2HNTF 2ZCKP 1O34A 2ZPRA 3KQEA 5FBEA 3TPIZ 5GDSH 2P93A 3KGPA 1YC0A 1HFDA 1W8BH 2UUKB 5E2PA 2A2QH 1AVXA 4F4OC 3NZIA 2ZA5A 5FX6A 4B1TA 2BDGA 1LKAA 3OY5U 1O2OA 4KTUA 1KMHB 3A83A 2OC7A 1L1JA 1DVAH 5GNDA 1CT2E 4ABHA 2ZHEH 1ESTA 4I33A 3UWIA 3E0NB 4F55A 2D26C 1Y3XA 1ZRKA 1O3AA 3KEEA 1PQ7A 3GICB 1GHWH 3MYWA 3HK6B 4PROA 2XNDD 2ZC9H 1C2HA 2ZIQH 1FI8A 2WPHS 1GI8B 5EXLA 3A85A 1NBME 2ZFQH 1PPZA 2FP7B 3HATH 4ZKSU 3PTBA 4WJG2 3E16B 2BOHB 1O3KA 2GCHF 3BEFB 1EZSC 3LJOA 1HAOH 1W13U 2J98B 2FEQH 1LHEH 3PTNA 1QA7A 5C0UA 3SU3A 2WSSD 3EQ0H 3SUFA 1DFPA 2EQNA 1T4UH 2P8OB 4H42U 5E8EH 3SJIA 5F6MA 2AS9A 2PR3A 1UTPA 3GCHC 1DPOA 4ISOA 2BY9X 2QE7D 1C5WB 1LPZB 3VPKA 1A5HA 1LTOA 2BQ7B 3AAVA 1AWFH 1TA2A 3B23B 3HPTB 1V2OT 4NIVA 1P06A 2WHXA 3EA7A 3OY6U 2XW9A 3UOPA 1MH0A 1RTFB 3BTME 4FXGH 2A4RA 3B9FH 4JZ1A 5EJLA 3OX7U 3RDZA 1TNHA 3CNRA 1EXFA 2ILNA 1C1VH 1WQSA 1CGJE 2XRCA 4DIHH 3E8LA 1YLDA 1E38B 1Z1JA 1C1PA 2FOFA 2Z9IA 2GV6A 3SN8A 1S82A 1MKXH 4A1VA 1BMMH 1MU6B 1SGCA 5DG6A 1SGFA 4ACBA 1CA0B 3QN7A 3SU2A 1Y3VA 1KDQB 1MTNB 4TWYA 4BTUB 2KCYA 2GT7A 1YM0A 3KN2A 4K1EA 1SGNE 1QR3E 1Y3UA 1HAXB 1UVSH 1RIWC 3FOAA 2VWLA 1BTHH 1BRUP 2BB4A 2G5NA 4ABBA 4A6LA 2GCHG 3SW2B 6ESTA 1UMAH 4FUGA 2KAIB 1UW7A 1DT2A 3JZ1B 3ODDA 1KLIH 1DY8A 2XBWA 4B75A 5CHAB 1P2IA 2EY4C 2B7DH 1P04A 5EG4A 3DD2H 1ZZZA 1IHSH 1WTHD 3LH3A 4FVDA 5EPNA 1O2TA 3EYDA 1FMGA 3BG8A 2CF9H 2D8WA 2OBQA 1NTPA 2GZ8A 3TITA 1GCTB 4Q7YA 3PV5A 2VB0A 2TRMA 3ATWA 1W12U 1XUIA 3M5NA 1K1LA 1SMFE 1UK2A 3PO1C 1VGCC 5GIBA 1SSXA 4JZEH 1TWXB 2OQUA 5C17A 2A2XH 3TK6A 1VITF 2BLQA 2ZU4A 3BEUA 4NZQA 3TNSA 1O5GH 2G00A 1RJXB 1GJ8B 2FI4E 1KIGH 1DS2E 1O2LA 3MU8A 1UTMA 2BD8A 3RLWH 2VJ1A 4J2YB 1C5ZB 1JIRA 2A4OA 3GY4A 1ZMJA 4K3JA 3T5FH 4RT1A 1GBTA 3P17H 1HBTH 1W11U 2C8YB 4XDEA 1GJ7B 4I8HA 1EATA 1DSUA 2RCEA 4X1SU 3V3MA 4BAKB 2Q6FA 3KYGA 3OU0A 4TY6A 2GMTC 3F9EA 4CRFA 1F0RA 4XFQA 5DP7A 1FY1A 3GY3A 1ARCA 1Z8GA 3FN8A 1A61H 1AO5A 1IHTH 1GMCF 4NFFA 2F9OA 1GBLA 3SJ9A 4K2YA 3NPSA 2Z9GA 3ZVEA 2WZQA 2FWWA 3RXHA 2A5AA 3BEIB 2ZNKH 4MQAA 4ABJA 1ZTJA 1O39A 4WWYA 2HGTH 5C5NA 1PPGE 4DCDA 2F9PA 3RMMH 2CF8H 1GHBF 3UNQA 2QN5T 1C4V2 1BOQA 3GOVB 1N6YA 3G01A 5DJ7A 1FDPA 4DT4A 1D3TB 5JBCS 4GAWA 2HNTE 1LO6A 3HK3B 5T1VA 3U8OH 1WSSH 2Z9LA 2V3HH 3SOSA 1EAXA 1ELAA 3SI3H 1SGDE 1BTZA 3K65B 1P09A 3GYMA 2I6SA 2FS9A 2R3YA 4UD9H 3ZVCA 1O3JA 2O8MA 1DANH 2QIQA 2VIVA 2V7QD 3MU0A 2K0QA 3UWJH 3A81A 2ZHWH 1TNIA 5C1YA 3F2FA 3EE0B 1FY5A 1HIAA 2WINI 1ORFA 4O03A 2QCYA 3A7TA 1O3HA 1Z71A 5ETXA 3SV2H 1W3CA 1T4VH 2F43B 1MTVA 4E7RG 1IQFA 2VU8E 3LIWA 2TIOA 5A8XA 4RT0A 2G8TA 3RXOA 2XBVA 4H4FA 4CBOA 1PPFE 3CENA 4OGYA 2DUCA 1C5SA 2TBSA 1BRCE 4ABDA 4ZROA 3A7XA 1YLCA 3A82A 5DP3A 1HUTH 3RP2A 5IYTA 3RXQA 3ZVBA 1ETRH 2HVYB 1D3DB 4Y71A 2VBCA 2PGBB 5F8ZA 2B0FA 1C1QA 2BDBA 2TPIZ 1LHFH 4HFPB 1J16A 3I77A 5KGOA 1O33A 1TX7A 1MTWA 1UJ1A 5A0CA 1G36A 3PLBA 5EJ1A 3ODFA 2OCVB 1F2SE 1BA8B 1SPJA 3MO9A 2J38A 2XCNA 2BDYA 5L2YH 2TGTA 1P9UA 5E0JA 3Q77A 4MNVA 2ZGHA 1ANDA 3TH3H 2F4LA 4ZXYH 3SJ8A 3U9AH 1VITH 2PSYA 4XE4A 4YESB 3PYHA 5FXLA 4ASUD 3ATMA 1YPGH 1EP5A 4Q4LA 1RD3B 1SFIA 1HAPH 2OC8A 4NG9H 2BY6X 3E1XB 1V2WT 2AEIH 1YGCH 4YM9A 6GCHF 4INHA 3U1JB 2QXGA 1BHXF 2BOKA 2FO9A 5HIYA 4OS5A 1O2RA 3ZZDA 1EQ9A 1NFYA 2WPJS 1IQKA 2IJD1 1HXEH 1VR1H 3B8JA 3MWIU 2BD9A 1YY3A 2ZGJA 1OXGA 3SNEA 4B6FA 1TBRH 2WPKS 3GCHB 1CT0E 3VEQB 1NROH 3V13A 8GCHG 1ZMNA 5EPYA 3DSOA 2WV9A 2ZPQA 1BQYA 3LJJA 2ZDMA 4E06H 4UEHH 1HYLA 1P10A 2ZU1A 1DSTA 1S83A 4HGCA 1QCPA 4RSPA 1S81A 2HVXA 4FUCA 3UOUA 1H9IE 4M7GA 4YLUA 1RXPA 1YPJH 1P2JA 4RI0A 1O2XA 4Y0ZE 4Y76A 3GISB 4WMFA 2JH0D 2ALPA 1FAXA 4Y7AA 1S6FA 3SNBA 1UTJA 2FZZA 3P6ZB 1O3GA 2FTMA 4Q80A 1BJUA 1HJAC 1YP9A 4WXVA 1BRBE 1M9UA 1RIWB 1UHBB 1TGNA 4NA9H 1DICA 1P57B 4BAOB 3VB5A 1O3BA 4OS6A 5AVDA 1WTGH 2XYAA 4X6PA 1C2MA 1SQOA 6GCHG 3F0PA 3JZ2B 2W5EA 3P95A 5SGAE 2OC1A 1LKBA 1C5MD 3BV9B 5JB9S 2W6JD 3UNRA 1NN6A 1QB1A 1PQ5A 3KYFA 1TMUH 3AASA 3RXEA 3CS7A 1UK3A 4ZH8A 3LGTA 3ZZ6A 5CHAC 2HOBA 4FUFA 3PMAB 2NU2E 2BD4A 4X8TH 1JOUB 1IQJA 2XCFA 2ZU3A 1DXWA 1EKBB 1C1SA 1O2JA 2QF5A 3ZZBA 1JIMA 2DE8A 1TRNA 5FPSA 4CBNA 1MMJN 4DT7B 4KTSA 2XC0A 3ZZ5A 5AHGH 1K22H 1HDTH 1SLUB 4NCYA 4NSYA 5FPYA 5DK1A 4X1PU 1IQMA 1SQRA 2PW8H 3SNCA 5L6NH 1XM1A 4WMDA 3RXMA 3PO1B 1VGCB 1J8AA 3ENSB 3MH4A 1AB9B 1OOKB 4BOHA 3ATLA 1GI0A 2SGQE 4BXWA 2Y5GA 1NO9H 1YPHC 5F8TA 2XOKD 1HNEE 1BHXB 2HLDD 1THPB 3LC3A 3EA8A 1QNJA 4UFDH 1MU8B 1P01A 4AC9A 1C5TA 1GVZA 1AHTH 1AUTC 1YBWA 3M7QA 5JB8S 3MU1A 1NC6A 1QJ7B 2ALVA 1O2WA 1MQ6A 1EAIA 1QB6A 1UK4A 1O3IA 3ZZ4A 7ESTE 1A3EH 2EC9H 5C20A 4O3UA 2XWBI 4X1QU 1GJ4H 1O2NA 2XC4A 2GMTB 3MNBA 2H5CA 4BAMB 1AKSA 4SGBE 2JETB 1MQ5A 4I31A 2KR7A 4B2BA 2FOAA 1K1NA 3VFEA 2O8LA 2VIOA 4UE7H 1MABB 1ZLRA 2PKSC 1K2I1 2A31A 3P8OA 2BDIA 1NFUA 1NZQH 3M3SA 1TPPA 2QXHA 3LC5A 2O8WA 3PV4A 3KQBA 1FZZA 4ZAEA 2H2ZA 1SGFG 1TLDA 1GVKB 1SL3A 1GJAB 4ZHLU 3RXSA 3TGIE 3GY6A 1KXDA 1O3PB 2PLXA 1C5NH 4QT8C 1V2RT 2F3CE 1FN8A 2JJ2D 5C94A 1A46H 2H6MA 1NRSH 1Y59T 1AN1E 2BVRH 1H9LB 4WF8A 1MKXK 2BVXH 1AE5A 2ODPA 6CHAC 3KQCA 1ACBE 1EOJA 2P3TB 1S85A 2ZHDA 2ODQA 5H4IB 3BIVH 3MNSA 1NFXA 1W2KH 3BN9A 3OTJE 1D6WA 3D49H 4AFUA 3FANA 2B5TB 1AGJA 1C4Y2 1V2NT 1GVLA 1ZGIA 2ESTE 1BT7A 1P03A 1GMDF 4B73A 4UFGH 3CS0A 2RA3A 3O8CA 1FY4A 1ZR0A 3KHVA 3A7ZA 1H9HE 2HPPH 1S0QA 1GDNA 1SGTA 1VJAU 2YOLA 5JBAS 3GCTF 1SC8U 2ZDKA 2Y7ZA 1BB0B 1ZSKA 4DVAU 3KF2A
chains in the Genus database with same CATH topology
2FS8A 1E37B 1O37A 5ESBA 1DDJA 1SGRE 4INLA 1D6RA 1AFEH 1ETTH 2V35A 2XBXA 1TX6A 1XX9A 1BBRH 3AVZA 1WAYB 4X8UH 3LH1A 1A0LA 1J17T 2G5VA 3M3TA 5T3HA 1GDUA 2J4IA 4NIXA 2FOCA 3MOCA 2GX4A 2QA9E 3SV7A 1G3DA 3PLKA 1B7XB 1LHGH 1EX3A 1TBQH 1IQIA 1EPTC 2G52A 7GCHG 9ESTA 1YCPM 4IMQA 2BXUH 4THNH 2C8WB 4AYYB 1MD8A 2OINA 1GBDA 1OS8A 4OS4A 2W7SA 1TONA 2A4QA 3RXFA 4Y8ZA 1NFWA 1F0TA 2Y6TA 1AWHB 1FIWA 1JXPA 3DFJA 5EQSA 1BTXA 3S69A 3OSYA 4JZIA 4X6OA 3FFGA 2FI5E 1YPLH 8KME2 1V2LT 1HRTH 5E2OA 1TYNA 1EZUC 1ZPCA 2LPRA 2G4TA 4ZUHA 4ZKOU 3M5OA 2BD7A 1GWAA 4ASHA 4A1XA 3SV6A 4WH6A 4JMYA 3M5LA 2Z6BD 1QJ1B 3A88A 2HLCA 5FHTA 1GL1A 1AVGH 3DUXH 2IPHA 1K1MA 2ZQ1A 1CHOG 3RC6A 2ZI2H 1IAUA 2FLBH 1XUHA 5IDKA 2OC0A 2BLOA 7LPRA 4X2XA 1YCPH 1LVMA 2EI8A 1N8OB 1TABE 5FCRA 3S0NA 1GJ6A 1OWHA 2STBE 8ESTE 2GZ9A 3T26A 4JCNA 1PQ8A 4J1YA 4ABAA 1NRRH 1QQUA 2H1UA 3RM2H 2WPMS 3MNCA 2AGEX 5CE1A 3ZVAA 4RKOB 1TRYA 2FYQA 2C8XB 5EODA 3S9BA 1ESAA 3O8RA 4Q7XA 2ZHQH 3T2NA 1EZQA 2NU0E 1Q2WA 3K9XB 5TCCA 1P9SA 1ZTKA 3RU4D 2Q6GA 1FY8E 2BZ6H 3MFJA 3BTKE 3SV8A 1CVWH 2IN2A 1Y3WA 3U8RH 1HJAB 2CJIA 5DP8A 1UCYH 3HKJB 2J92A 2ANKH 3VB7A 1IQHA 1GBIA 4YOIA 1L2EA 1C5XB 3PLPA 1ELEE 1HAVB 5EGMA 1AU8A 1C2KA 1SI5H 1ELBA 3LU9B 2F91A 1FAKH 1S5SA 2J9NA 3UNSA 2ZGXH 1HCGA 5EXNA 2FTLE 3AW0A 3LT3A 3VB4A 4WVPE 4CRAA 4GPGA 3AAUA 1GI1A 1AD8H 4ABEA 2BMGB 5T6FA 1C2EA 1C1UH 1O5FH 2C93B 5LPFA 2XWAA 3EAJA 1H4WA 1QQ4A 4TY7A 3Q3YA 1HJ8A 1ELGA 1AI8H 2SFAA 1HAZB 2ANYA 3TGJE 1K1IA 3GDSA 5ESTE 3T28A 5ABWA 1C2JA 1P02A 2A1DB 4MNWA 1ETSH 1V2ST 3A80A 4MPWA 4Z6AH 1P8VC 5L2ZH 2FOHA 4NIYA 1HXFH 1MBMA 3RLYH 4K1SA 1MBQA 3SZNA 1AB9C 1F5LA 1V6DA 3F1SB 3M35A 1ABJH 3TGKE 4TYDA 2FOBA 5TJXA 1D3PB 1SVPA 1OPHB 1FXYA 2TGDA 2AMQA 4E05H 4FVBA 1S0RA 5JPMH 1DUEA 2HWLB 2BX4A 2VWOA 2G81E 4O9VA 4X2YA 3TJOA 2PV9B 3T27A 2GGVB 2SGEE 3UQOA 3M7TA 1V2MT 1H8DH 1JRTA 1NPMA 2P95A 4GSOA 2JETC 2BHGA 7KMEH 1AFQB 3FAOA 2PKSB 3BTQE 4ESTE 2H9TH 3SU5A 1ZSLA 1KYNA 4ZHAA 1KXCA 5A8ZA 5E0HA 1CQQA 1ZJDA 1TFXA 1KDQA 1KXFA 1N1LA 3LPRA 3S9AA 3KCGH 2Y5FA 4NWKA 2OUAA 3F68H 3LGYA 5C5OA 1QTFA 2H9HA 3RXVA 1HAVA 3C27B 4MPUA 1QIXB 1RTKA 4VGCC 1GBFA 1GBAA 1P0SH 1O0DH 4X1NU 1B0FA 3NUMA 5C3NA 3KIDU 4MVNA 2ZO3H 3Q3KA 1TQ0B 3E90B 2ANWA 4B2AA 3R0FA 2KAIA 1KXBA 1A7SA 1VITG 2ZTYA 6CHAB 2FI3E 4RN6A 2JH6D 4FU9A 3RUOA 1OX1A 2UWOA 3QTOH 2ZQ2A 2ZP0H 3BTEE 1O2UA 1BMLA 4UFEH 5AFZH 3TH4H 5DPAA 3RU4T 2QC2A 4DIIH 3F9HA 1EOLA 2BLWA 2QGRA 1AZ8A 1K1PA 2XTTB 1V2KT 1LQDB 1Y3YA 3BG4C 1K9OE 2Q1JA 5HM2A 1W7GH 3K2UA 4IN2A 4YO9A 1GMCG 1WQVH 1EJMA 1YPHE 1S84A 3U69H 1KSNA 4YTAA 3LKWA 2DE9A 2WV5A 2FX6A 2GVFA 1NRQH 1P2KA 3SU1A 2FPZA 1GI4A 2PUXB 3EA9A 1TPSA 1O2ZA 4B76A 3UY9A 1BJVA 3S7HB 4GUXA 1GHBG 3C1KA 3SU4A 4E7NA 4CRCA 1EPTB 1PPCE 1QL7A 3Q3XA 4F49A 4LZ4B 3QK1A 4GHQA 2GV7A 3ZVDA 3QGNB 1AZZA 3RXTA 1OP2A 4NA8A 2J2UA 4JK5A 1G3BA 3BTWE 2ZPSA 3TU7H 4DGJA 1GMHF 5A2MH 3TNTA 1DLEA 4A5TS 4DW2U 1P12E 2VVVA 3RC4A 5GCHF 1O2MA 1ZPZA 2GTBA 1AQ7A 3BTDE 1BMNH 4X8VH 3SV9A 4K1TA 4Y8YA 3TVJB 1Y8TA 2AMPA 5FPTA 1TGBA 5HMAA 2BD5A 1G30B 5EXMA 1O2VA 2BLVA 1T8OA 4MPXA 2VVUA 3A7WA 1ABIH 2GP9B 4FUBA 2C4FH 1UTNA 3Q00A 2GD4B 3O8DA 5A0BA 1O5AB 2J94A 1FONA 1QBNA 3M36A 1VJ9U 3UQVA 1ZHPA 1HAIH 2SNWA 1VCWA 1ESBA 1N8OC 2W3IA 3PROA 4O3TA 1A5GH 1ELTA 2FMJA 2WYJA 3GY7A 4DURA 3ZZ7A 2OQ5A 1OKXA 4FUIA 4WXIA 4XBCA 1MUEB 3UTUH 4X6NA 6LPRA 1K1OA 3UR9A 1G32B 3SJKA 1GBHA 1QBVH 3ZZAA 1SQAA 2BXTH 5K0HA 3ZZ8A 1AY6H 3BSQA 2VIPA 2FESH 2EEKA 4Q2KA 4X6MA 1O3FA 5C67A 4X1RU 3MH6A 1BRAA 3TLOA 2F9BH 2K1QA 1K21H 5GCHG 1UVUH 4ZKRU 4KP0A 4I32A 2ANMH 3P92A 3PWBA 1ZGVA 5DP4A 2OBOA 1H1BA 1P2OA 2O8UA 3TK5A 4BXSA 1MKWH 1GHAF 2VIQA 1KXAA 3SI4H 3UREA 2JKHA 3QDZB 3QZQA 1GBCA 1O2KA 5L30H 5HM9A 1T32A 1YF4A 1C2FA 1C5PA 2FX4A 1J9CH 3FZDA 2P59A 2LNCA 1HAGE 1A5IA 4R8TB 1C4U2 2FYRA 1G37A 4NSVA 3E6PH 4CH8B 1BBRK 1J15A 1AMHA 1Z8IB 1GJ5H 4K5ZA 1O2IA 4ZKNU 4Y79A 2F9VA 3GY2A 3I29A 3RXCA 1DXPA 4AFSA 1DE7H 3A8DA 1C9TA 2HNTC 4FUDA 5GXPA 1GHXH 3TH2H 2D2DA 4BANB 1NM6A 1GPZA 4SGAE 1SGIB 3LGUA 1FLEE 2GKVE 2PFEA 4UFFH 5HXFA 2QYIA 1P11E 2ZEBA 3ATIA 3ITIA 4K8BA 3S7KB 1E0FD 2ZU2A 4KELA 1C5UA 1O3OA 1XUGA 2OP9A 4X8SH 1ARBA 2Y7XA 3V7TA 3QLPH 1LHCH 1TQ7B 2H9EH 1P3CA 4X2VA 2XC5A 4Y8XA 2V6NA 2M5TA 3NCLA 5DP9A 2ZTZA 2AGIX 1GHYH 2PKAB 2ODYB 1Z7KA 2J95A 1ELVA 3MO6A 1F5KU 3RU4E 3ESTA 3IITA 3RXDA 5I46H 1OP8A 1Z8RA 3BTFE 5EQRA 1EASA 1KTSB 1QRXA 3R3GB 3QO6A 3D65E 3MU5A 3M61U 1AFQC 1YCPK 2A5KA 5B6OA 1O5EH 1W0YH 1W0ZU 4D7FA 1IQNA 2BD3A 5CMXH 1TPAE 1OWDA 2AIQA 4U30A 2ZTXA 3RXKA 1GBJA 1OSSA 1ZHRA 3QWCH 3SGQE 4WY3A 2ZFRH 2W3KA 1O2SA 5FBIA 4Y0YE 2Y5HA 1TOMH 3W94A 2VH6A 3LGVA 1XXFA 1UHBA 3M37A 2ZDNA 4VGCB 2Q6DA 1YPMH 1DWCH 2UWLA 2VH0A 2ZFPH 2BD2A 2SGFE 1PPEE 5DP5A 3VB3A 4MDSA 1BUIA 3BIUH 3SUEA 3F6UH 2A4GA 3RXGA 4NWLA 1O3CA 3UFAA 1EB2A 4CRDA 3VGCC 2F9UA 2ULLA 3Q76A 3RXAA 1UCYK 1TNKA 2FOGA 1L0ZA 3P70B 1NESE 1X7AC 1A4WH 3M3VA 2G4UA 4IC6A 1OYQA 1O3NA 2ZWLH 4FU7A 4IW4E 2ZCLP 3SHAH 4X2WA 1NT1A 1QGFA 1EAWA 1SGQE 3BG4B 3VB6A 1LDTT 3DFLA 1WV7H 2C8ZB 2H5DA 4GHTA 3KL6A 2SGPE 3QZRA 1ELDE 1FPHH 4NZLA 4RKJB 4IGDA 4R0IA 1RTLA 2VNTA 4I7YH 1LPGB 2ZGBH 2B9LA 2UUYA 3RC5A 1QJ6B 1WBGB 1O3EA 3PMHB 2A7CA 5EOKA 3MO3A 3EGKH 1QL8A 1F7ZA 4LK4A 1Q3XA 1TALA 5DO4H 1T31A 1O31A 5AF9H 1GHZA 1YKTA 1TGSZ 3PMJA 2GZ7A 3MH5A 1C1NA 4Y7BA 1INCA 2W7UA 2AFQB 4IN1A 4MNXA 1GL0E 1KY9A 1UVTH 1DWEH 1EJAA 1DUAA 2HRVA 5FX5A 1CBWC 1SLWB 1HAHH 4BNRA 3QTVH 1CGHA 2WUCA 4AZ2B 4INKA 1CU1A 1LHDH 1A0JA 4X0WU 4ABGA 1C2IA 3FZZA 1ZMLA 5LPRA 2BM2A 1NU9A 1GMDG 4B74A 3NXPA 4ISLA 5JYIA 4LOYH 2TGAA 1H8IH 1MAYA 1UTLM 1BTUA 1Z8JB 2P94A 3RXJA 3GCTG 1LVOA 1PPBH 2B8OH 3MH7A 1SBWA 3KQDA 2PWXA 5LGOA 1JWTA 1U6QA 1TA6A 2ZDLA 3MTYA 4U01A 4H6TA 2BX3A 1AUJA 2VVCA 1TB6H 5AFYH 4K8YA 2THFB 3RMLH 1UO6A 2YNBA 4MLFB 1DOJA 4JZFH 3RXLA 2R9PA 4ZHMU 1BBRE 3GDUA 3SQHE 3A89A 1VZQH 3URCA 3U1IB 1A1RA 1V2TT 2FIRH 1C1TA 3EDXB 4Q7ZA 5GWZA 4D76A 1XUJA 1FIZA 1QB9A 3BTTE 1IOEA 1XXDA 2EA3A 2FOMB 3GDVA 1OP0A 1EP6A 1OWKA 3L33A 2R3UA 4CH2B 2UUFB 4TPYA 1GI9B 4IBLH 4D8NA 2HALA 1ELFA 3UR6A 5GJ4B 1GBKA 1PFXC 1C5RA 2GCTB 2G55A 1A2CH 3SUDA 4D7GA 2J34A 2CHAC 1F0SA 1LPKB 3P8GA 1XUFA 3W95A 5DGJA 1KLTA 3QGJA 1E35B 1UTQA 1FJSA 5GPIB 1JMOH 2Z94A 2AMDA 4OS1A 3ZZ9A 2GDEH 4NGAH 1ZJKA 2Y81A 2AIPA 1LVBA 1HGTH 1UTOA 1D4PB 1TAWA 2FDAA 3HKIB 3MMGA 1TBZH 4I8GA 1GG6B 1ZSJA 3PB1E 2BQWB 3IWMA 1O35A 4OS7A 1O3MA 2YNAA 3SO3A 2WV4A 1C1OA 3DT0H 3TJVA 2ZCHP 1S6HA 1GI6A 1G9IE 4TWWA 1GGDB 2CMYA 4AOQA 1C5VA 1LQEA 1IQLA 2RDLA 1Q31A 3ELAH 1VCQA 1CO7E 2ZU5A 1GCDA 1P3EA 4FUJA 3SUGA 4I8JA 1AE8H 2A45B 2FLRH 4YOJA 1L4ZA 3H7TA 4AFZA 3SNDA 1RS0A 3VXFH 1HIAB 1OYTH 2P3UB 4AG2A 2R2MB 1C5OH 1ELCA 3A7YA 3FP6E 2I6QA 2OLGA 5T6GA 1IQEA 2WUBA 2ZHFH 1Y5BT 3A86A 2CGAA 3CP7A 1DWBH 1UCYE 3QUMP 1WCZA 3A8BA 4ISIH 1TNJA 1L1NA 3PM3A 2SGAA 1GJBB 4FU8A 2F9NA 3SU0A 1C9PA 1RRKA 1F0UA 2F83A 1UVPA 1O38A 1ZOMA 4MG3A 3BTGE 3NWUA 1C2LA 4JYVH 1UVOA 4OGXA 1V2VT 4ABFA 1T7CA 2A7HA 3E91A 3WY8A 4JK6A 4K69A 1BMAA 4I8LA 3NKKA 5A09A 2Z3CA 2Z7FE 4AYVB 2NWNA 1SGEE 2D1JA 1C5YB 1ID5H 4KTCA 4FUHA 2P16A 3ZVGA 2VGCC 1CE5A 3P8NA 4Y6DA 3GCNA 2BYAX 3GYLB 3MNXA 2XBYA 2R0LA 2VIDA 1AIXH 1A0HB 1EJNA 5FCKA 4AN7A 3PWCA 3VGCB 1QHRB 1T8NA 2SNVA 5TCAA 4XSKU 1PPHE 1Z6JH 1KTTB 9LPRA 1THRH 3RMOH 1D3QB 1XKBC 2SGDE 1C5QA 4A7IB 5A8YA 4Y10E 4CHAC 1F92A 1T8LA 1JBUH 1MKWK 3T29A 1WU1A 2Z3EA 2EI7A 2QXIA 2ZDVH 3ZV9A 3SQEE 4CRBA 3H7OA 2ZDAH 1G3CA 1C2DA 1GJ9B 1W10U 2V3OH 3AW1A 1O36A 4K60A 3VXEH 1E36B 4HI3A 1FN6A 1FUJA 1EAUA 2FXRA 2QF3A 1SHYA 3MU4A 5E0GA 3UUZA 1BZXE 1G3EA 4AGKA 3KNXA 1ZHMA 2BZAA 2C3SA 2IJOB 1DX5M 3A7VA 1MD7A 2QAAA 2XXLA 3DHKH 1MAXA 3D23A 1CA8B 1SFQB 5JBTA 4U32A 3U8TH 2VINA 2XNIA 1MTSA 1XUKA 2R2WU 5JDUB 4BAHB 1FQ3A 1N6XA 1VCPA 1XMNB 4H6SB 3K6ZA 5EU8A 4LXBH 2IOTA 2RG3A 4NA7A 5F03A 1CBWB 4MPVA 2QF0A 4DY7B 8GCHF 1QRWA 2PUQH 1YPEH 4YT6H 4YZUA 1A3BH 1V2JT 3E3TA 3RXBA 5FAHA 1OWEA 5T6DA 4XBDA 1C5LH 1WYKA 3SBKA 1G2LA 1BTYA 1BCUH 1Z6EA 3T25A