1FZZA

The crystal structure of the complex of non-peptidic inhibitor ono-6818 and porcine pancreatic elastase.
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords ELASTASE 1
publication title The crystal structure of the complex of non-peptidic inhibitor of human neutrophil elastase ONO-6818 and porcine pancreatic elastase.
pubmed doi rcsb
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2000-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fzzA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fzzA01
3RM2H 1VZQH 2GCHF 1AGJA 1SI5H 2VIDA 1T8NA 3GY2A 1IQLA 1RXPA 1QBVH 1OP2A 3STJA 1C1WH 1B0EA 4YLQH 4ISNA 3N7OA 1AI8H 3E6PH 1O2HA 1TGTA 1TMUH 2Y81A 3Q3KA 1SFIA 2BD5A 1IOEA 3BTKE 1DE7H 1ZOMA 3D65E 4MG3A 1CHOG 1L1JA 1W8BH 2BD3A 4BAHB 2D2DA 4I32A 1V3XA 1YM0A 3HK6B 1F92A 1SLVB 4Y7BA 4YT7H 1QHRB 7LPRA 1AE5A 5JYIA 4JMYA 4YLUA 1BA8B 2GZ8A 4ISIH 3VB4A 1GVKB 1EPTC 3DFLA 5LPFA 1G3CA 3ZZDA 1XUIA 2FS9A 1KXDA 2PUXB 4AFZA 1P3EA 4F4OC 2A7CA 1MKWK 1TGNA 1RRKA 3Q00A 4X8UH 1GI6A 1W10U 4AG2A 1KTTB 2UWOA 1P06A 3RXEA 1S84A 1JWTA 1J9CH 2A2XH 4J1YA 2OQ5A 5DG6A 2VWOA 3SU4A 5A09A 3I77A 1C1OA 2OBOA 2QYIA 1EAIA 3AASA 3ZZ4A 2R3UA 2KAIA 2BLQA 4GCHG 1V2TT 5FBEA 3A85A 3KQDA 3RM0H 1UMAH 1TNIA 4O3UA 2CHAB 2ESTE 4ABBA 1NS3A 5E8EH 2AYWA 1XVMA 1Z8GA 3NCLA 4B71A 2VIQA 3RC4A 1GMHG 4X2XA 5FCRA 3F9EA 1MUEB 3MOCA 1EPTB 1GJDB 1IQIA 2FO9A 2KAIB 3LC5A 3SJ8A 3FZZA 1WU1A 1ZPZA 1BHXF 1P57B 1P03A 1Z8JB 1HJAB 3S9AA 3SZNA 3TH3H 4GHTA 1SBWA 4BTTB 3M5MA 2FX4A 2H5DA 3I29A 1Y5UT 2TRMA 3F9GA 2A2QH 2HPPH 4K8YA 1UHBB 1SGNE 1XUJA 4MNVA 1C4V2 2Y5FA 4XDEA 2OINA 1P04A 4B76A 1LTOA 3BTGE 4X1RU 2BB4A 3HATH 4I8HA 2PKSB 1HAYB 2P94A 1O5AB 3SV6A 2BTCE 2TGTA 1UK2A 4UE7H 5DGJA 1NN6A 2W5EA 1QTFA 1G32B 5E2PA 1L4DA 2AGEX 3ZVAA 2QXGA 1ESBA 1GGDC 2A4QA 1YF4A 5HM2A 3P95A 4BAMB 2FWWA 1BRCE 1JIRA 1SLUB 4TWWA 5A8YA 2OUAA 2WYGA 2FYQA 3MWIU 3OYPA 1QBOA 2GTBA 2BY6X 4UFGH 2UUYA 1UTKA 1GBTA 3GY3A 1FLEE 4UFEH 3MHWU 3QGNB 4PROA 3GYLB 2BLVA 2ZO3H 2A5IA 1T4UH 1YCPH 3PWCA 3ATIA 4ZXXH 1C5TA 2V0BA 3DHKH 1FY4A 3ZZ5A 4ZHMU 1XMNB 4MNXA 4FUIA 5A0BA 2SGQE 4BAOB 1A5IA 1L2EA 3U1JB 1YC0A 3BEUA 5FX6A 1TPSA 1JOUB 1V2RT 2Q6GA 3SUDA 2NWNA 1GGDB 3T62A 3C27B 3SNCA 2WV5A 1ID5H 1OSSA 2Y82A 3QO6A 4Y8YA 5BPEA 1B0FA 1LMWB 2F91A 2D26C 1ELCA 1BB0B 8LPRA 1QIXB 1TNJA 3U8OH 1NRRH 1S85A 2JETC 2VVUA 2OD3B 2Z9LA 1O2ZA 5FPSA 3GY7A 5FCKA 1O2TA 3NWUA 1GHYH 3QTOH 2PR3A 4NA9H 1GI9B 2JH5D 1GJAB 2BLWA 4B2AA 5FHTA 2G4TA 4GSOA 2V3HH 2BYAX 4Y79A 2P16A 4KP0A 4ABHA 1C4U2 1N6YA 1GBIA 3TK9A 1BQYA 1VITF 1BJUA 4MPWA 2XBWA 1MZAA 4VGCC 2ZCLP 5C1UA 2A4GA 4HGCA 4D7FA 3PWBA 1SVPA 1DS2E 1KTSB 2B7DH 2F9NA 2XC5A 1SHHB 3D49H 1BT7A 2O9QA 1VCPA 1GHBG 1PYTC 4ZROA 1N6XA 2NU0E 3LH1A 3SV8A 1O2GH 3UY9A 4AGKA 2CJIA 1HJ9A 2UWLA 2ZCKP 1BTYA 4E7NA 1QRXA 1Z6JH 5DK1A 2R3YA 5JDUB 1TMBH 1O3OA 1ZR0A 2JETB 1O3LA 2B5TB 3Q76A 4X1SU 3F1SB 4FUCA 3LGUA 1CT4E 2RG3A 1TX7A 1NROH 1YKTA 2ZFPH 1K1OA 1GVLA 3BV9B 1FQ3A 1O37A 1AVWA 2WPKS 2ZPSA 3RUOA 1AU8A 4J2YB 4DGJA 1T8MA 1P02A 4A6LA 1ZGIA 3T28A 3R3GB 1TRNA 2GP9B 4KELA 1K21H 3KNXA 1C2HA 4VGCB 5HXFA 4TYDA 2ZGHA 1ABIH 3A88A 4E06H 7GCHF 2JH6D 1SGCA 1K1JA 3F68H 1UJ1A 3RXVA 4XFQA 1QB6A 4K2YA 4I8GA 1HDTH 2W3KA 1GHWH 4CHAC 1YP9A 1ZMLA 4X0WU 3ATMA 4FUGA 2YNAA 1W0YH 4Q2KA 1XKAC 2AMPA 2C3SA 1Y3UA 4ZKRU 3P17H 5F8ZA 4AORA 3LJOA 3MU5A 1TRMA 1C2GA 4HI3A 5L6NH 5T6DA 2PWXA 3ZZ7A 1FONA 2F9PA 2FPZA 3SV9A 2ZFTA 4UFDH 1GHXH 1YPGH 2VGCC 1FUJA 1K1MA 3A87A 4WMEA 1YYY1 3RXMA 4H42U 3A8BA 1L4ZA 4U2WA 2Z9IA 2VINA 3EA7A 5EOKA 3ZZ3A 4AYVB 5JB8S 1D3QB 1VCWA 3ZZ8A 1C9PA 1OP0A 2A4OA 1EOLA 1WBGB 2TPIZ 1K22H 2AFQB 5LGOA 2IPHA 4ABJA 3KQBA 1AUJA 2HNTE 4WVPE 3S9BA 3FP7E 1ZHRA 4LOYH 1BMLA 1O0DH 4JYVH 1E38B 1VGCB 3V7TA 1P8VC 1G30B 1X7AC 3HPTB 1ESAA 3I78A 1IQKA 2BDCA 1ANDA 3QN7A 2F83A 1EZSC 1WOFA 1XX9A 2SGEE 4RKJB 1DSTA 1HUTH 3TIUA 5L30H 2J95A 1NM6A 1FAXA 1M9UA 4FUFA 1EQ9A 4X2YA 1QGFA 1XXFA 3SNDA 2Q6DA 3SORA 5C2ZA 1UTMA 2ZDMA 4FXGH 1SGPE 1EUFA 1SSXA 3TJUA 1DFPA 1ZHMA 3UNQA 1WCZA 4AZ2B 3DUXH 4BXWA 2PGQB 3ZZ6A 2Z6BD 1SGQE 1T8OA 1Y5BT 1XUHA 2Z9KA 4U32A 4AFUA 2D1JA 2ZTYA 1H9LB 1BUIA 4Y0ZE 3TNTA 1C5OH 3U9AH 2ANYA 2ZKSA 1DY8A 1MH0A 1C2IA 4K3JA 1NFXA 3RXTA 4QT8C 1JBUH 2GMTC 3A89A 3PMJA 2IJOB 1P10A 3RC6A 1DXPA 2AERH 1TOMH 5CHAB 1S0QA 1TOCB 1UVOA 1ANBA 3S0NA 3P92A 1H8DH 2D8WA 1HRTH 1OXGA 1O2WA 4FVBA 1BJVA 2FOAA 1WUNH 1LPKB 1F5RA 1THPB 2SGFE 1YCPM 1QY6A 4LXBH 1UO6A 2AIQA 2DE9A 2ZF0H 1XVOA 2HALA 1GDNA 4KGAA 1OPHB 3GCHC 1G9IE 1TPPA 1S0RA 3SO3A 1O2JA 1GI3A 3L33A 4UD9H 3SOSA 1DT2A 4NWLA 3ZVCA 5TCAA 5GCHF 1IHSH 4K60A 1C5MD 4D9RA 1LVMA 1WQSA 4CRFA 2ZFFH 3UIRA 3AVZA 2NU3E 3M7TA 1C2LA 4A1XA 1QJ6B 3SGBE 1TA6A 3MNBA 4JK6A 4Y76A 1HAPH 2Q1JA 4JYUH 2R0LA 1AB9C 1NTPA 2UUFB 3ZV9A 1O3CA 1PJPA 2VWLA 1KIGH 5AVDA 2FM2A 3TH2H 5JBAS 3GDUA 5L2ZH 2FOMB 2W7SA 1LHDH 1C5YB 4TPYA 1ZPCA 1FPCH 4NIYA 1GBAA 4TWYA 1VJAU 3E16B 1W0ZU 4DVAU 1C1SA 2ZQ2A 1UK4A 4I8JA 1O5CB 1UCYK 2YNBA 2EC9H 4IMZA 2ZHDA 4DIHH 4X8VH 3QZQA 1BBRH 3URCA 1T8LA 3OX7U 1DLKB 1D6RA 1T7CA 1KXEA 2BY9X 1DUAA 4X1PU 1UTJA 4X6MA 2ZZUH 2FI4E 2HOBA 2QF0A 5F8TA 1SHYA 3KN2A 1O3BA 4CR5A 2H5CA 1G37A 1O39A 1RIWB 3UFAA 4NZQA 4YESB 1CT0E 1KYNA 1ELFA 2CXVA 1LPGB 1QA7A 1AVGH 3ATWA 3BTWE 2GDDA 1GJ7B 1O2SA 3OTJE 1YPHC 3SHCH 1PPBH 5GPIB 1OS8A 1GJ5H 2GCTC 1C2KA 1UVTH 3VEQB 1WTGH 2G81E 4AGJA 3A7TA 3ESTA 2BDAA 1C2JA 2VWNA 1ETRH 8KME2 3QUMP 1RTFB 1ESTA 1GMCF 1OWKA 1A7SA 2WPHS 3RXOA 2R2MB 1K9OE 1XKBC 4AFSA 2BY7X 1VITH 2UUJB 3MNCA 2WPJS 1PPEE 3ENSB 7ESTE 3PO1B 2OP9A 3SGQE 1MQ6A 4U30A 2J2UA 1KY9A 1PPHE 1SMFE 1N8OB 5EQQA 4WF8A 1DICA 1Y5AT 1Z1JA 1GCTB 2FMJA 3OU0A 1FMGA 2SNVA 2ZU4A 2RA3A 3F9HA 2SNWA 4U01A 1PPGE 1GMDG 5A8ZA 1LHGH 3VXEH 4CBOA 1EB1H 1LHCH 2XRCA 1QQ4A 3A80A 5DP5A 2TGPZ 3M7UA 1GI4A 1W7GH 2J4IA 4K5ZA 3SI3H 1G3EA 1RTKA 4JCNA 4WWYA 4WH8A 3U8TH 4BXSA 3TJOA 3GCTF 1Z6EA 1QNJA 1UVUH 1S82A 2I6QA 1V2UT 4DW2U 1O2MA 4CREA 5C67A 1ACBE 5FPTA 4CH8B 2CGAA 1TBQH 1O38A 2GV7A 1GBFA 1C5RA 1UTLM 2K1QA 3AAUA 1TYNA 2FDAA 2GZ9A 1FY8E 1A5GH 3KHVA 3AW0A 1GHAF 3M3SA 1SOTA 4KKDA 2ODYB 1E35B 1V2JT 3MNXA 2QXIA 2Y6TA 1KDQA 1W13U 1AFQC 1NESE 5FBIA 1AFEH 3VB3A 2A5KA 1O3IA 1HJ8A 1FV9A 1ZMJA 1C5UA 1SQTA 4Y6DA 5EGMA 1W12U 1AD8H 2ZGXH 2Z3CA 4CRGA 4CRAA 4ISLA 1GG6C 2W26A 1KDQB 1SL3A 2ZECA 1T4VH 2VB0A 3PMHB 2CV3A 1EJNA 1Y3WA 4ZXYH 1JRSA 3VB6A 1QQUA 3BG8A 4Q80A 2BD7A 3A7YA 4B73A 4X6NA 1SGIB 5H4IB 1V2QT 4B75A 3RU4E 2BDGA 2XC4A 3VPKA 1EPTA 1Y3VA 2Y80A 2GVFA 4H6TA 4YT6H 3NUMA 3RDZA 1BTZA 1RD3B 1ZSLA 4UONA 3D23A 4ABAA 4IC5A 2XTTB 4X2VA 3LH3A 3FANA 4HFPB 3RMOH 4HZHA 1NY22 4X8SH 1MZDA 2OC7A 1UHBA 1BTPA 2WPLS 1L1NA 3KIDU 1H9HE 2ANWA 3O8CA 1G36A 5T6FA 1Z1IA 1EXFA 4ABFA 2BXUH 1AE8H 1LDTT 1YPEH 5AFZH 2IOTA 1F0SA 1TPOA 2QC2A 5A0CA 3TGIE 4FUJA 1F7ZA 2H2ZA 1WTHD 2PSYA 1GBBA 2VIOA 5C1XA 3KEEA 2O8WA 4OS2A 3OY6U 5K0HA 4GHQA 1EP5A 4I31A 5PTPA 1BTXA 1O2VA 1GI1A 1C5PA 3A86A 4TPIZ 3V13A 1GI8B 2B9LA 4JZDH 1P2OA 1SC8U 3SU3A 1MKXK 4BOHA 3T26A 1C2MA 1OWEA 2P3UB 3CS7A 3MU4A 2VIWA 3M7QA 3ZZBA 1BZXE 1YLCA 1GI5A 4AX9H 1SGTA 2C90B 1PQAA 3M5NA 1F5LA 1MTWA 2BQ7B 1PPZA 4D8NA 2PW8H 4NIWA 4NCYA 2WYJA 3PTBA 5DP4A 5GDSH 4OS6A 3P6ZB 4O3TA 2FODA 3P8GA 3LIWA 1ZGVA 1O3EA 4X2WA 1RFNA 1FXYA 2V6NA 3EAJA 3AW1A 1WSSH 1IQFA 5L2YH 4IS5A 4MDSA 3RXFA 1T32A 4OS5A 3RMMH 1MQ5A 1J8AA 1PQ8A 1CHOF 4O03A 4KTUA 1LO6A 3BTEE 4I7YH 1A0LA 1GBHA 1A46H 3LONA 4WH6A 1QURH 3RXCA 2EA3A 1GI7B 1CA0C 1GHZA 2BVXH 3LOXA 1C1UH 1Z8IB 2F9VA 1QRZA 2PLXA 3Q77A 1C5NH 1PPFE 3QDZB 1GI0A 1NFYA 2H6MA 4CR9A 2EI6A 1O3MA 4K1SA 4NZLA 4I8LA 2VNTA 3JZ2B 2QA9E 3FP8E 4FUEA 4DIIH 4X6PA 1A0JA 3MO6A 1P0SH 2ANKH 4A92A 1YGCH 4MVNA 2BDHA 1HAOH 2VIPA 4ABEA 5GJ4B 2A7HA 4ABIA 1PPCE 5EODA 1NRQH 3P8FA 2C8WB 2BQWB 2GGVB 3S9CA 5CMXH 1IAUA 3RXGA 1BTUA 1B7XB 4BAKB 2RCEA 5EXNA 2HLCA 1MAXA 3PMBB 1TIOA 2FTMA 3MU1A 1CT2E 3PLBA 3BTHE 4A1VA 1UK3A 2Y7ZA 4GCHF 3QZRA 1AKSA 4XBCA 3LGTA 2YOLA 5G4BA 1SGEE 3RXLA 2OC1A 1KLJH 3MFJA 3ZYDA 3PV4A 1H9IE 2AGIX 4KTCA 1EZQA 3TJNA 1LHFH 3RLWH 1TRYA 1CGJE 3UUZA 1J16A 1GMHF 2EI7A 2UWPA 1O31A 1H1BA 4YOJA 3CENA 2BHGA 1CBWC 1Z7KA 1AKSB 1ZTLA 1THRH 3G01A 5EXLA 3TJVA 1MKWH 3O8DA 5TCCA 1ELGA 2ULLA 1CU1A 1DM4B 4CH2B 1A4WH 1BBRE 2HNTF 3H7TA 1ZTJA 5JBTA 3ODDA 3UREA 5HM9A 1GJ9B 1A0HB 4K8BA 4E05H 1HV7A 2QF3A 1O3FA 1C1MA 2STAE 2WV4A 3SUFA 1G2MA 2Y5HA 2VJ1A 3B8JA 1V2OT 1MCTA 3M5LA 3FP6E 5EPNA 2G51A 5IDKA 5GWZA 3MO3A 2GV6A 4BTIB 2VVVA 3BSQA 4NSVA 2VVCA 3GDSA 1J15A 1O35A 1F5KU 1GBEA 1BRUP 2ZHEH 1K1NA 3GICB 4LK4A 1DWCH 3DA9B 3M36A 1RGQA 5EU8A 3ZVDA 2BDIA 1CSOE 2THFB 5I46H 1EB2A 3A7ZA 2BOKA 2OQUA 2ZPRA 1V2PT 1DWBH 2ZFQH 2QXJA 3PYHA 3FAOA 3MTYA 3RXBA 4BANB 4I8KA 1C5VA 3E1XB 1A3BH 2OCVB 1DX5M 1O5DH 1MTUA 1C5WB 1HLTH 1V6DA 1ZHPA 4ZHLU 1LCYA 3QX5H 1QB1A 3PTNA 1S5SA 1DWDH 3V12A 1A5HA 3UOPA 2EI8A 3D62A 5LH8A 2ZNKH 2PKAA 1V2VT 3RXRA 3VGCC 1Y59T 3PM3A 2ZHQH 1K2I1 2PGBB 5T6GA 1O2LA 1IQEA 1MU6B 1DOJA 2FLBH 3LGWA 4ISOA 4CHAB 1S83A 4IBLH 1SQAA 5C3NA 4XE4A 3KL6A 3SU5A 2PKAB 3BN9A 1O2IA 3TU7H 1O30A 1EATA 1YPKH 3EA9A 1NFUA 1RTLA 4IGDA 3ZZ9A 3UQVA 2F9OA 3ZVGA 1BHXB 2XW9A 2AH4X 1QA0A 3SJ9A 1JMOH 1OWHA 2PTNA 2FOFA 4RN6A 2FP7B 4WJG2 3BEFB 2GX4A 4E7RG 2VGCB 5EXMA 2ZDLA 2VIVA 2ZU2A 3A83A 1FY3A 1QL9A 2FESH 2A32A 1TQ7B 4DJZB 3M37A 1QJ1B 4I33A 8GCHG 2PSXA 2OLGA 2G5NA 3E91A 3GYMA 1O2XA 3RXJA 1ZTKA 4Q7XA 9ESTA 2A4RA 1ZYOA 3CP7A 5C1YA 1CHGA 3HKIB 3K6YA 1TMTH 2ZFRH 3BTQE 4XOJA 1O3DA 1P9UA 1GHBF 1XUKA 1C2FA 5LPRA 1YPHE 1THSH 3A7XA 1EKBB 1UVPA 3GOVB 1TGSZ 2FEQH 2G52A 1LKBA 4NFFA 1YPLH 3BIVH 1EASA 1LKAA 2AMQA 1P11E 1O3GA 1O3KA 3SNAA 2BVRH 2ZHFH 2ZU5A 1P9SA 4ESTE 1LHEH 1PQ7A 1E36B 3SW2B 1EJAA 2W3IA 1QL7A 3ZZCA 2G00A 3QWCH 1P2NA 2ZP0H 2FZZA 1NU7B 1HAZB 4BTUB 2GCHG 1IQMA 1AMHA 3ZVFA 4O9VA 1ZJKA 5E2OA 3UPEA 4MPVA 3SJOA 5FAHA 3STIA 1P09A 1NRPH 2BMGB 3TGKE 2A1DB 3GY4A 3GCNA 1AWFH 3RXIA 3E90B 6GCHG 1AIXH 2GMTB 3TNSA 1O34A 3R0FA 1ETTH 1Y3XA 4CRBA 3A7WA 2J38A 1TGBA 1DVAH 2IN2A 1TQ0B 1D3DB 1GJ4H 1Q31A 1D6WA 2ZTZA 1H8IH 3MYWA 4XBDA 2A45B 2NU1E 1GVZA 3SU6A 3KGPA 3M61U 3GISB 5A2MH 1KSNA 1KLIH 1GDUA 4OS7A 1GCDA 3L3TA 1QRWA 7KMEH 4FU9A 2BZ6H 3GCHB 6CHAC 3AAVA 2AGGX 2R2WU 4YM9A 2BDBA 4Y0YE 5C5OA 4D7GA 2Z3EA 1D4PB 1ELEE 1YBWA 1GJBB 3ITIA 1JIMA 1C5ZB 1P2KA 6ESTA 1FY1A 3IITA 1Q2WA 3LGIA 1FDPA 2B8OH 3A84A 3BG4C 3MH4A 4B74A 5GXPA 3SNEA 2BX3A 1TAWA 1AZZA 2ZG0H 2TGAA 4NFEA 1WYKA 4CBNA 3ZVEA 2FOBA 2JKHA 3UWIA 1AB9B 1SLXB 5F8XA 4ZMAH 5J4QA 3ZV8A 1TLDA 2BXTH 3A81A 3ZYEA 2O8UA 4THNH 2P8OC 1O2KA 3K9XB 2XWBI 2WINI 3HGNA 1C5QA 1HAHH 4IW4E 1Y8TA 3QTVH 1TX6A 2QY0B 2P93A 2FLRH 2H1UA 2WPIS 2PV9B 1FI8A 2ZC9H 5LPEA 2Y7XA 1SGFA 2ZGCA 4WY3A 3RXDA 1LQDB 3VB7A 5TJXA 1A3EH 5A8XA 4NGAH 2EEKA 3DFJA 4JZFH 4O97A 1LPZB 1MD8A 1D3TB 4NIVA 1HXEH 3MH5A 1DWEH 1ETSH 1GHVH 3TH4H 2AMDA 2Z9GA 4YZUA 3LC3A 3UR9A 4UDWH 5FPYA 1O5EH 4X1NU 4H6SB 4Y71A 2XCFA 1ELVA 1OYQA 1XUFA 3ZVBA 1TNHA 3RXUA 4ISHH 2ASUB 3EYDA 1OWJA 2AEIH 1OWIA 2A5AA 2ILNA 1C2EA 2GCTB 2ZDVH 3U69H 4A5TS 3HGPA 1F0RA 3NZIA 5ETXA 4AOQA 2F9UA 1K1LA 3P8OA 5DP8A 5JBBS 1OWDA 1LVBA 4MTBA 1GJ8B 3VFEA 1W2KH 1BCUH 4XSKU 1DY9A 1HAVA 1ZSJA 2ZQ1A 1RS0A 4CRCA 1AQ7A 4NA7A 1E34B 2C8YB 4INKA 4INHA 3V0XA 5F03A 3SI4H 2P59A 2QGRA 1SGYE 2J34A 2ZU3A 1CQQA 6GCHF 1GBDA 1MAYA 4IN1A 2XC0A 3M3TA 2C8XB 1AVXA 3KCGH 1KLTA 4FU7A 4UEHH 1MTVA 3GY6A 1HAVB 2XBXA 1LQEA 5DP6A 3H7OA 4MNWA 3VB5A 4WXVA 4XBBA 1ZLRA 1C1RA 1C1QA 1HCGA 3SU0A 3BF6H 2QCYA 3K2UA 1J17T 4ABGA 3U8RH 2VH6A 3M5OA 5ABWA 2ZGJA 2CHAC 1ZRBA 2O8MA 3K65B 4JZEH 2J92A 2QAAA 1GBKA 1DDJA 4K69A 2ZDKA 5EG4A 3EA8A 3FVFB 2O8LA 1FNIA 1G3DA 4K1EA 1K1PA 2R9PA 4ZAEA 4AFQA 1O3NA 1OP8A 1SQOA 1V2WT 3HKJB 1A1RA 2Y5GA 3LT3A 1QB9A 1IHTH 1LVYA 1HJAC 4BNRA 1A61H 2VU8E 1P01A 4KTSA 1EP6A 1AFQB 3O8RA 1UTOA 2I6SA 8ESTE 2FYRA 4FUDA 2TIOA 4NG9H 4DCDA 3E3TA 4ZUHA 4M7GA 1AWHB 3EGKH 1QJ7B 1SR5C 1W14U 5JPMH 3SV7A 3TVJB 1VITG 2ZCHP 3RXHA 1GWAA 3ATKA 2PKSC 1ZZZA 1MBQA 2BD2A 2BY8X 1GG6B 1GPZA 1BMMH 2WUBA 3DT0H 2PHBA 2VWMA 3NPSA 1ZPBA 1GI2A 2Z94A 5DPAA 5ESTE 1UCYH 1DSUA 1K28D 3LGVA 4Z0KA 1WV7H 3TGJE 1T31A 3W95A 4JZ1A 3IWMA 1P2QA 4DOQA 1TFXA 1CGIE 2G4UA 3ZZAA 4Y7AA 1NPMA 3QGJA 1XM1A 4YTAA 1HAIH 1C1PA 2SGAA 1TX8A 1NRSH 4YO9A 1ELBA 1FY5A 3LJJA 2O8TA 2BD9A 1FZZA 1TBZH 2DUCA 1Y3YA 1G2LA 5A0AE 1GMDF 1O5BB 2H9EH 5ESBA 1MMJN 3OSYA 2ALPA 2ZI2H 2HRVA 2XNIA 2BZAA 3P70B 3RU4D 1FPHH 1VJ9U 3SUGA 2ZGBH 2UUKB 3MH7A 2GDEH 7GCHG 1C4Y2 1F0UA 1HB0B 1TB6H 2WUCA 4B2CA 2Z9JA 1OX1A 1LVOA 1SGFG 2H9HA 3E8LA 2ZWLH 2BVSH 4NSYA 1O5GH 1GL1A 3TK6A 1HFDA 1WQVH 2CF9H 4AN7A 1U6QA 4OGYA 1JRTA 1O3AA 5E0GA 3SU2A 4MQAA 3GY5A 1DUEA 1AN1E 3SN8A 1DLEA 2ZEBA 1TALA 1C1NA 2OTVA 2CF8H 1QBNA 1O2NA 3SUEA 1P3CA 4RKOB 2BDYA 1TNGA 1Z71A 1BITA 1UTQA 3PROA 4OS4A 5FX5A 4SGBE 1KXFA 1AZ8A 1BTWA 1GJ6A 2BM2A 1DITH 3GDVA 2ANMH 3BTDE 4X6OA 1NFWA 3A8DA 1V2MT 3FZDA 1EZXC 1TONA 3LGYA 3LKWA 1AHTH 1GBMA 4AB8A 4TY7A 1D3PB 1ARBA 1GBLA 1PYTD 1INCA 4X8TH 2ZDNA 2FOGA 3PLPA 3TITA 3DD2H 2C4FH 3O8BA 1ELAA 1BDAA 5AHGH 5E0JA 3E0PB 1L1GA 1EJMA 2C93B 1PQ5A 2FIRH 3S69A 1N1LA 2XBVA 1CO7E 2CMYA 3P8NA 1CGHA 1CA0B 4Y11E 4Y10E 3A7VA 2GKVE 1HIAA 1ZRKA 4LZ1H 1O32A 3RXKA 3SNBA 2H9TH 1BRAA 2TGDA 1O33A 3UOUA 1HPGA 1O2UA 2W7UA 1NU9A 1FIZA 5JBCS 4YOGA 3UQOA 2F3CE 1UTPA 2DE8A 1V2ST 2FOHA 2ZFSA 1MTSA 4AB9A 1HIAB 1JXPA 2J9NA 4K1TA 5I25A 3M35A 3MMGA 4Q7YA 1C5SA 1AY6H 1V2KT 1FJSA 1ZSKA 2PUQH 4Z6AH 1BRBE 3GY8A 3T5FH 2QV1A 2XYAA 3KQEA 1EAWA 3RMNH 4X1QU 2SFAA 3ATLA 5AF9H 2BD8A 4ZKOU 2G55A 5EW1H 4B1TA 2Z3DA 1O5FH 2XWAA 4AYYB 1EAXA 1D9IA 1A2CH 1O3HA 5GCHG 5GIBA 1O36A 1DPOA 3TPIZ 1BBRK 1KXAA 3LDXH 1CBWB 2ZDAH 1IQJA 3BTME 1TWXB 3EDXB 1QFKH 3NK8A 4DG4A 2BY5X 3F9FA 1HAXB 4TY6A 1EOJA 1P12E 2VH0A 2BQ6B 2ZHWH 1VGCC 3BTTE 5HYOA 2OC8A 1ANEA 2HGTH 1MU8B 1DXWA 2FOEA 2HVXA 1XXDA 1EZUC 1IQHA 1UTNA 1UVSH 4FVDA 3T29A 1YPMH 5F6MA 3LU9B 2A0QB 2GZ7A 1F0TA 4JZIA 4ABDA 3UWJH 3U1IB 2SGDE 5EPYA 4IMQA 2Q6FA 1MKXH 2ZPQA 1C1TA 3E0NB 2CN0H 1ZJDA 3WY8A 1S81A 1MD7A 1K1IA 1TE0A 4FU8A 1IQGA 3MH6A 1AO5A 4ZKNU 3SJKA 2ZIQH 1TGCA 3CS0A 1P2MA 5DKMA 2LNCA 1OYTH 1Q3XA 4YOIA 3RMLH 3Q3YA 2OBQA 2XXLA 1BMNH 5JB9S 2ODPA 2GT8A 1NZQH 4HTCH 1HXFH 2GD4B 5CHAC 3RLYH 4BAQB 4CRDA 4MNYA 2B0FA 3T25A 1VR1H 3RU4T 4GUXA 3GCOA 2FXRA 4NA8A 3HK3B 1SOZA 2NU4E 3KQCA 1OKXA 4GLYA 4MLFB 4NWKA 4INLA 3T2NA 1B5GH 3RP2A 3VGCB 1C5LH 1P05A 4LZ4B 1ELDE 3SJIA 2G5VA 1FIWA 5EW2H 1PFXC 3MU0A 1AUTC 4ZHAA 2A7JA 1EAUA 4OS1A 4Q7ZA 4DY7B 4OGXA 1V2LT 5J4SA 1GMCG 3A8AA 1L0ZA 4Y8ZA 3EE0B 3PMAB 9LPRA 1W3CA 1SLWB 1F2SE 3NXPA 5EQSA 5DO4H 2BX4A 1G3BA 2TBSA 6LPRA 4GVUA 1BTHH 4GAWA 1TA2A 4FUHA 3EQ0H 2LPRA 5HMAA 4FUBA 1CE5A 2FS8A 1MTNC 5DP9A 3BTFE 3RXAA 1TNKA 4JK5A 1C1VH 2V3OH 1HAGE 5DJ7A 1O2QA 4IN2A 4DURA 1O2OA 2BOHB 4UFFH 1ANCA 1HYLA 3MI4A 1TABE 1SGDE 2ALVA 3SU1A 2ZTXA 5DP7A 2JH0D 1GL0E 4A1TA 4A7IB 1SG8B 4R8TB 5C5NA 4SGAE 2STBE 1YLDA 1GJCB 4JYTA 3SBKA 1S6FA 1KXBA 3GCTG 4B2BA 2FI5E 2ODQA 3ELAH 3UR6A 4MPUA 1KXCA 2BLOA 2HPQH 1H4WA 1O3JA 3Q3XA 5B6OA 2C8ZB 3VXFH 5CE1A 3K6ZA 1J14A 1FAKH 1C5XB 3MU8A 3UNRA 3F6UH 1UCYE 4RSPA 4ASHA 3RXSA 1MTNB 3S7HB 2F9BH 1GHAG 1Z8RA 1O2RA 2Z7FE 4AG1A 1RIWC 2FI3E 2OXSA 2HNTC 3LPRA 5DP3A 3SV2H 4D9QA 1W11U 1S6HA 3IG6B 1RJXB 1GBJA 3A82A 5HGGA 4NIXA 1CVWH 1MBMA 2SGPE 1BOQA 2RA0A 3JZ1B 1C9TA 4R0IA 3MNSA 1O2YA 1P2JA 5SGAE 1C2DA 3BIUH 4F49A 2A31A 1ORFA 2WPMS 4ZKSU 2ZU1A 2QIQA 1QR3E 3ODFA 3BEIB 3B9FH 1E0FD 5BRRE 1SPJA 1SFQB 3URDA 1ELTA 2P3TB 2NU2E 3RXPA 3SGAE 1EX3A 2FOCA 5T3HA 2V35A 1BMAA 3PO1C 2P95A 1NO9H 3SQEE 2AIPA 2HWLB 1O2PA 3B23B 1IQNA 2XCNA 1N8OC 1W7XH 1MCVA 1SB1H 1SGRE 1ABJH 1YPJH 1HGTH 1TNLA 6CHAB 1NRNH 4ZH8A 3V3MA 2PFEA 1GCTC 2ZA5A 1E37B 4H4FA 2OC0A 3W94A 4D76A 1DANH 4MPXA 3M3VA 1HNEE 8GCHF 1XUGA 3QLPH 3T27A 1WAYB 1ZMNA 2QXHA 1NT1A 5IYTA 2M5TA 3OY5U 4WMDA 3BG4B 1FN8A 1GDQA 3PLKA 1FN6A 2XBYA 4DT7B 1OOKB 4WMFA 4WXIA 3C1KA 5FXLA 5EQRA 3QK1A 1P2IA 2FTLE 2PTCE 4IC6A 3FFGA 1BIOA 1TPAE 2QN5T 1QL8A 1V2NT 3U98H 5K7RA 1NC6A 1HBTH 2P8OB 1YCPK 1O3PB 1TBRH 1VCQA 1ARCA 2J94A 4Y8XA 3SQHE 3RC5A 3UTUH 3TK5A 2P3FH 2BD4A 3L6PA 2GT7A 3RXQA 3PB1E 5E0HA 3TLOA 3A8CA 2AS9A 1CA8B 2G8TA 2R0KA 3H5CB 3SHAH 3UNSA 1QCPA 2FX6A 3S7KB 2RDLA 1GBCA 3MO9A 4GPGA 5AFYH 3NKKA 5C20A 3KF2A
chains in the Genus database with same CATH superfamily
3RM2H 1VZQH 2GCHF 1AGJA 1SI5H 2VIDA 1T8NA 3GY2A 1IQLA 1RXPA 1KMHB 1QBVH 1OP2A 3STJA 1C1WH 1B0EA 4YLQH 4ISNA 3N7OA 1AI8H 3E6PH 1O2HA 1TGTA 1TMUH 2Y81A 3Q3KA 1SFIA 2BD5A 1IOEA 3BTKE 1DE7H 1ZOMA 3D65E 4MG3A 5F53A 1CHOG 1L1JA 1W8BH 3F2HA 2BD3A 4BAHB 2D2DA 4I32A 1V3XA 1YM0A 3HK6B 1F92A 1SLVB 4Y7BA 4YT7H 1QHRB 7LPRA 1AE5A 5JYIA 4JMYA 4YLUA 1BA8B 1W0JD 2GZ8A 4ISIH 3VB4A 1GVKB 1EPTC 3DFLA 5LPFA 1G3CA 3ZIAD 3ZZDA 1XUIA 2FS9A 2IJD1 1KXDA 2PUXB 3OEHD 4AFZA 1P3EA 4F4OC 2A7CA 1MKWK 1TGNA 1RRKA 3Q00A 4X8UH 1GI6A 1W10U 4AG2A 1KTTB 2UWOA 1P06A 3RXEA 1S84A 1JWTA 1J9CH 2A2XH 4J1YA 2OQ5A 5DG6A 2YMSD 2VWOA 3SYJA 3SU4A 5A09A 3I77A 1C1OA 2OBOA 2QYIA 1EAIA 3AASA 3ZZ4A 2R3UA 2KAIA 3WW7A 2BLQA 4GCHG 1V2TT 5FBEA 3A85A 3KQDA 3RM0H 1UMAH 1TNIA 4O3UA 2CHAB 2ESTE 4ABBA 1NS3A 5E8EH 2AYWA 1XVMA 1Z8GA 3NCLA 4B71A 2VIQA 3RC4A 1GMHG 4X2XA 5FCRA 3F9EA 1MUEB 3MOCA 1EPTB 1GJDB 1IQIA 2FO9A 2KAIB 3LC5A 5DSFA 3SJ8A 3FZZA 1WU1A 1ZPZA 2KM0A 1BHXF 1P57B 1P03A 1Z8JB 1HJAB 3S9AA 3SZNA 3TH3H 4GHTA 1SBWA 4BTTB 3M5MA 2FX4A 2H5DA 3I29A 1Y5UT 2TRMA 3F9GA 2A2QH 2HPPH 4HG6A 2W6ID 4K8YA 1UHBB 1SGNE 1XUJA 4MNVA 1C4V2 2Y5FA 4XDEA 2OINA 1P04A 4B76A 1LTOA 3BTGE 4X1RU 2BB4A 3HATH 4I8HA 2PKSB 1HAYB 2P94A 1O5AB 3SV6A 2BTCE 2TGTA 1UK2A 4UE7H 5DGJA 1NN6A 2W5EA 1QTFA 1G32B 5E2PA 1L4DA 2AGEX 3ZVAA 5C94A 2QXGA 1ESBA 1GGDC 5C17A 2A4QA 1YF4A 5HM2A 3P95A 4BAMB 2FWWA 1BRCE 1JIRA 1SLUB 4TWWA 5A8YA 2OUAA 2WYGA 2FYQA 3MWIU 3OYPA 1QBOA 2GTBA 2BY6X 4UFGH 2UUYA 1UTKA 1GBTA 3GY3A 1FLEE 4UFEH 4XRNA 3MHWU 3QGNB 4PROA 3GYLB 2BLVA 2ZO3H 2A5IA 1T4UH 1YCPH 3PWCA 3ATIA 4ZXXH 1C5TA 2V0BA 3DHKH 1FY4A 4TT3D 3ZZ5A 4ZHMU 1XMNB 4MNXA 4FUIA 5A0BA 2SGQE 4BAOB 1A5IA 1L2EA 3U1JB 1YC0A 3BEUA 5FX6A 1TPSA 1JOUB 1V2RT 2Q6GA 3SUDA 2NWNA 1GGDB 2HLDD 3T62A 3C27B 3SNCA 5EJZA 2WV5A 1ID5H 1OSSA 2Y82A 3QO6A 4Y8YA 5BPEA 1B0FA 1LMWB 2F91A 2D26C 2EY4C 1ELCA 1BB0B 8LPRA 1QIXB 1TNJA 3U8OH 1NRRH 1S85A 2JETC 2VVUA 2OD3B 2Z9LA 1O2ZA 5FPSA 3GY7A 5FCKA 1O2TA 3NWUA 1GHYH 3QTOH 2PR3A 4NA9H 1GI9B 2JH5D 1GJAB 2BLWA 4B2AA 5FHTA 2G4TA 4GSOA 2V3HH 2BYAX 4Y79A 2P16A 4KP0A 4ABHA 1C4U2 1N6YA 1GBIA 3TK9A 1BQYA 1VITF 1BJUA 3FOAA 3EE7A 4MPWA 2XBWA 1MZAA 3N7DA 4VGCC 2ZCLP 5C1UA 2A4GA 4HGCA 4D7FA 3PWBA 1NBME 1SVPA 1DS2E 1KTSB 2B7DH 2F9NA 2XC5A 1SHHB 3D49H 1BT7A 2O9QA 1VCPA 1GHBG 1PYTC 4ZROA 1N6XA 2NU0E 3LH1A 3SV8A 1O2GH 3UY9A 4AGKA 2CJIA 1HJ9A 3AK5A 2UWLA 2ZCKP 1BTYA 4E7NA 1QRXA 1Z6JH 5DK1A 2HVYB 2R3YA 4ASUD 1TMBH 5JDUB 1O3OA 1ZR0A 2JETB 1O3LA 2B5TB 3Q76A 4X1SU 3F1SB 4FUCA 3LGUA 1CT4E 2RG3A 1TX7A 1NROH 1YKTA 2ZFPH 3OE7D 2RDEA 1K1OA 2KX4A 1GVLA 1SKYE 3BV9B 1FQ3A 3UB0A 1O37A 1AVWA 2WPKS 2KCAA 2ZPSA 3RUOA 1AU8A 4J2YB 4DGJA 1T8MA 3OFND 1P02A 4A6LA 1ZGIA 3T28A 3R3GB 1TRNA 2GP9B 4KELA 1K21H 3KNXA 1C2HA 4VGCB 5HXFA 4TYDA 2ZGHA 1ABIH 3A88A 4E06H 7GCHF 2JH6D 3FKSD 1SGCA 1K1JA 3F68H 1UJ1A 3RXVA 4XFQA 1QB6A 4K2YA 4I8GA 1HDTH 2W3KA 1GHWH 2WV9A 4CHAC 1YP9A 1ZMLA 4X0WU 3ATMA 4FUGA 2YNAA 1W0YH 4Q2KA 1XKAC 2AMPA 2C3SA 1Y3UA 4ZKRU 3P17H 5F8ZA 4AORA 3LJOA 3MU5A 1TRMA 1C2GA 4HI3A 5L6NH 5T6DA 2PWXA 3ZZ7A 1FONA 2F9PA 2FPZA 3SV9A 2ZFTA 4UFDH 1GHXH 1YPGH 2VGCC 1FUJA 1K1MA 3A87A 4WMEA 1YYY1 3UAIC 3RXMA 4H42U 3A8BA 1L4ZA 4U2WA 2Z9IA 2K0QA 2VINA 3EA7A 5EOKA 3ZZ3A 4AYVB 5JB8S 1D3QB 1VCWA 3ZZ8A 1C9PA 1OP0A 2A4OA 1EOLA 1WBGB 2TPIZ 1K22H 2AFQB 5LGOA 2IPHA 4ABJA 3KQBA 1AUJA 2HNTE 4WVPE 3S9BA 3FP7E 1ZHRA 4LOYH 1BMLA 1O0DH 4JYVH 1E38B 1VGCB 3V7TA 1P8VC 1G30B 1X7AC 3HPTB 1ESAA 3I78A 1IQKA 2BDCA 1ANDA 3QN7A 2F83A 1EZSC 1WOFA 1XX9A 2SGEE 4RKJB 1DSTA 1HUTH 3TIUA 5L30H 2J95A 1NM6A 1FAXA 1M9UA 3DSPA 4FUFA 1EQ9A 4X2YA 1QGFA 1XXFA 3SNDA 2Q6DA 1VKYA 3SORA 5C2ZA 1UTMA 2ZDMA 4FXGH 1SGPE 1EUFA 1SSXA 3TJUA 1DFPA 1ZHMA 3UNQA 1WCZA 4AZ2B 3DUXH 4BXWA 2PGQB 3ZZ6A 2Z6BD 1SGQE 1T8OA 1Y5BT 1XUHA 2Z9KA 4U32A 4AFUA 2D1JA 2ZTYA 1H9LB 1BUIA 4Y0ZE 3TNTA 1C5OH 3PV5A 3U9AH 2ANYA 2ZKSA 1DY8A 1MH0A 1C2IA 4K3JA 1NFXA 3RXTA 4QT8C 1JBUH 2GMTC 3A89A 3PMJA 2IJOB 1P10A 3RC6A 1DXPA 2AERH 1TOMH 1UW7A 1S0QA 5CHAB 1TOCB 5KECA 1UVOA 1ANBA 3S0NA 4DT4A 3P92A 1H8DH 2D8WA 1HRTH 1OXGA 1O2WA 4FVBA 1BJVA 2FOAA 1WUNH 1LPKB 1F5RA 1THPB 1YY3A 2SGFE 1YCPM 1QY6A 4LXBH 1UO6A 5IK2D 2AIQA 2OK5A 2DE9A 2ZF0H 1XVOA 2HALA 1GDNA 4KGAA 1OPHB 3GCHC 1G9IE 1TPPA 1S0RA 3SO3A 1O2JA 1GI3A 3L33A 4UD9H 3SOSA 1DT2A 4NWLA 3ZVCA 5TCAA 2WSSD 5GCHF 1IHSH 1YLNA 1C5MD 4K60A 1LVMA 4D9RA 1WQSA 4CRFA 2ZFFH 3UIRA 3AVZA 2NU3E 3M7TA 1C2LA 4A1XA 1QJ6B 3SGBE 1TA6A 3MNBA 4JK6A 4Y76A 1HAPH 2Q1JA 4JYUH 2R0LA 1AB9C 1NTPA 2UUFB 3ZV9A 1O3CA 1PJPA 2VWLA 1KIGH 5AVDA 2FM2A 3TH2H 5JBAS 3GDUA 5L2ZH 2FOMB 2W7SA 1LHDH 1C5YB 4TPYA 1ZPCA 1FPCH 4NIYA 1GBAA 4TWYA 1VJAU 3E16B 1W0ZU 4DVAU 1C1SA 2ZQ2A 1UK4A 4I8JA 1O5CB 1UCYK 2YNBA 2EC9H 4IMZA 2ZHDA 4DIHH 4X8VH 1EFRD 3QZQA 1BBRH 3URCA 3W1EA 1T8LA 3OX7U 1DLKB 1D6RA 1T7CA 1KXEA 2BY9X 1DUAA 4X1PU 1UTJA 4X6MA 2ZZUH 2VBCA 2FI4E 2HOBA 2QF0A 5F8TA 1SHYA 3KN2A 1O3BA 4CR5A 2H5CA 1G37A 1O39A 1RIWB 3UFAA 4NZQA 4YESB 1CT0E 1KYNA 1ELFA 2CXVA 1LPGB 1QA7A 2F43B 1AVGH 3ATWA 3BTWE 2GDDA 1GJ7B 1O2SA 3OTJE 1YPHC 3SHCH 1PPBH 5GPIB 1OS8A 1GJ5H 3F2FA 2GCTC 1C2KA 1UVTH 3VEQB 1WTGH 2G81E 3PRBA 4AGJA 3A7TA 3ESTA 2BDAA 1C2JA 2VWNA 1ETRH 8KME2 2LELA 3QUMP 1RTFB 1ESTA 1GMCF 1OHHD 1OWKA 1A7SA 2WPHS 2WZQA 3KYFA 3RXOA 4FOUC 2KZ4A 1K9OE 1XKBC 2R2MB 4AFSA 2BY7X 1VITH 2UUJB 3MNCA 2WPJS 1PPEE 3ENSB 7ESTE 2KR7A 3PO1B 2OP9A 2L6OA 3SGQE 1MQ6A 4U30A 2J2UA 1KY9A 1PPHE 1SMFE 1N8OB 5EQQA 4WF8A 1DICA 1Y5AT 1Z1JA 4Q4LA 1GCTB 2FMJA 3OU0A 1FMGA 2SNVA 2ZU4A 2RA3A 3F9HA 2SNWA 4U01A 1PPGE 1GMDG 5A8ZA 1LHGH 3VXEH 4CBOA 1EB1H 1LHCH 2XRCA 1QQ4A 3A80A 2JJ1D 2J97A 5DP5A 2TGPZ 3M7UA 1GI4A 1W7GH 2J4IA 4K5ZA 3SI3H 1G3EA 1RTKA 4JCNA 4WWYA 4WH8A 3U8TH 4BXSA 3TJOA 3GCTF 1Z6EA 1QNJA 1UVUH 1S82A 2I6QA 1V2UT 4DW2U 1O2MA 4CREA 5C67A 1ACBE 5FPTA 4CH8B 2CGAA 1TBQH 1O38A 2GV7A 1GBFA 1C5RA 1UTLM 2K1QA 4TSFD 3AAUA 1TYNA 2FDAA 2GZ9A 1FY8E 1A5GH 3KHVA 3MQKC 3AW0A 1GHAF 3M3SA 1SOTA 4KKDA 2ODYB 1E35B 1V2JT 1K0HA 3MNXA 2QXIA 2Y6TA 1KDQA 1W13U 1AFQC 1NESE 2WHXA 5FBIA 1AFEH 3VB3A 2A5KA 1O3IA 1HJ8A 1FV9A 1ZMJA 1C5UA 1SQTA 4Y6DA 4FETA 5EGMA 1W12U 1AD8H 2ZGXH 2Z3CA 4CRGA 4CRAA 4ISLA 1GG6C 2W26A 1KDQB 1SL3A 2ZECA 1T4VH 2VB0A 3PMHB 2CV3A 1EJNA 1Y3WA 4ZXYH 1JRSA 3VB6A 1QQUA 3BG8A 4Q80A 2BD7A 3A7YA 4B73A 4X6NA 1SGIB 5H4IB 1V2QT 3F2GA 4B75A 3RU4E 2BDGA 2XC4A 3VPKA 1EPTA 1Y3VA 1E1QD 2Y80A 2GVFA 4H6TA 4YT6H 3NUMA 4F55A 3RDZA 1BTZA 4ACBA 1RD3B 1ZSLA 4UONA 3D23A 4ABAA 4IC5A 2XTTB 4X2VA 3LH3A 3FANA 4HFPB 3RMOH 4HZHA 1NY22 2JJ2D 4X8SH 1MZDA 2OC7A 1UHBA 1BTPA 2WPLS 1L1NA 3KIDU 1H9HE 2ANWA 3O8CA 1G36A 5T6FA 1Z1IA 1EXFA 4ABFA 2BXUH 1AE8H 1BMFD 1LDTT 1YPEH 5AFZH 2IOTA 1F0SA 1TPOA 2QC2A 5A0CA 3TGIE 4FUJA 1F7ZA 2H2ZA 1WTHD 2PSYA 3VG8A 1GBBA 4ZCNA 2VIOA 5C1XA 3KEEA 2O8WA 4OS2A 3OY6U 5K0HA 4GHQA 2YMSC 1EP5A 4I31A 5PTPA 1BTXA 1O2VA 1GI1A 1C5PA 3A86A 4TPIZ 3V13A 1GI8B 2B9LA 4JZDH 1P2OA 1SC8U 3SU3A 1MKXK 4BOHA 3T26A 1FX0B 3FO8D 1C2MA 1OWEA 2P3UB 3CS7A 3MU4A 2VIWA 3M7QA 3ZZBA 1BZXE 1YLCA 3H09A 1GI5A 4AX9H 1SGTA 2C90B 1PQAA 3M5NA 1F5LA 1MTWA 2BQ7B 1PPZA 5B6LA 4D8NA 2PW8H 4NIWA 4NCYA 2WYJA 3PTBA 5DP4A 5GDSH 4Z1MD 4OS6A 3P6ZB 4O3TA 2FODA 3P8GA 3LIWA 1ZGVA 1O3EA 4X2WA 1RFNA 1FXYA 2V6NA 1W0KD 3EAJA 3AW1A 1WSSH 1IQFA 5L2YH 4IS5A 4MDSA 3RXFA 1T32A 4OS5A 3RMMH 1MQ5A 1J8AA 1COWD 1PQ8A 2YMSB 1CHOF 4O03A 4KTUA 1LO6A 3BTEE 4I7YH 1A0LA 1GBHA 1A46H 3LONA 4WH6A 5EJ1A 1QURH 3RXCA 2EA3A 1GI7B 3OAAD 1CA0C 1GHZA 2BVXH 3LOXA 1C1UH 1Z8IB 2F9VA 1QRZA 2PLXA 3Q77A 1C5NH 1PPFE 3QDZB 1GI0A 1NFYA 2H6MA 4CR9A 2EI6A 1O3MA 4K1SA 4NZLA 4I8LA 2VNTA 3JZ2B 2QA9E 3FP8E 4FUEA 4DIIH 4X6PA 1A0JA 3MO6A 1P0SH 2ANKH 4A92A 1YGCH 4MVNA 2BDHA 1HAOH 2VIPA 4ABEA 5GJ4B 2A7HA 4ABIA 1PPCE 5EODA 1NRQH 3P8FA 2C8WB 2BQWB 2GGVB 3S9CA 5CMXH 1IAUA 3N99A 4RT1A 3RXGA 1BTUA 1B7XB 4BAKB 2RCEA 5EXNA 2HLCA 1MAXA 3PMBB 1TIOA 2FTMA 3MU1A 1E79D 1CT2E 2WPDD 3PLBA 3BTHE 4A1VA 1UK3A 2Y7ZA 4GCHF 3QZRA 2F4LA 1AKSA 4XBCA 3LGTA 2YOLA 5G4BA 1SGEE 3RXLA 2OC1A 1KLJH 3MFJA 3ZYDA 3PV4A 1H9IE 2AGIX 4KTCA 1EZQA 2AHME 3TJNA 1LHFH 3RLWH 1TRYA 1CGJE 3UUZA 1J16A 1GMHF 2EI7A 2UWPA 1O31A 1H1BA 4YOJA 3CENA 2BHGA 1CBWC 1Z7KA 1AKSB 1ZTLA 1THRH 3G01A 5EXLA 5T1VA 3TJVA 1MKWH 3O8DA 5TCCA 2KFWA 1ELGA 2ULLA 1CU1A 1DM4B 4CH2B 1A4WH 2KCPA 1BBRE 2V3MA 2HNTF 3H7TA 1ZTJA 5JBTA 3ODDA 3UREA 2QF5A 1GJ9B 1A0HB 4K8BA 5HIZA 4E05H 5HM9A 1HV7A 2QF3A 5CHBA 4YXWD 1O3FA 1C1MA 1YWUA 2STAE 2WV4A 3SUFA 1G2MA 2Y5HA 2VJ1A 3B8JA 1V2OT 1MCTA 3M5LA 3FP6E 5EPNA 2G51A 5IDKA 5GWZA 3MO3A 2GV6A 4BTIB 2VVVA 3BSQA 4NSVA 2VVCA 3GDSA 1J15A 1O35A 1F5KU 1GBEA 1BRUP 2ZHEH 1K1NA 3GICB 4LK4A 2EQNA 1DWCH 3DA9B 3PV2A 5KGOA 3M36A 1RGQA 5EU8A 3ZVDA 2BDIA 1CSOE 2THFB 5I46H 1EB2A 3A7ZA 2BOKA 2OQUA 2ZPRA 1V2PT 1DWBH 2ZFQH 2QXJA 3PYHA 3FAOA 1QZ8A 3MTYA 3RXBA 4BANB 1S6LA 4I8KA 1C5VA 3E1XB 1A3BH 2OCVB 1DX5M 1O5DH 1MTUA 1C5WB 1NBMD 1HLTH 1V6DA 1ZHPA 4ZHLU 1LCYA 3QX5H 1QB1A 3PTNA 1S5SA 1DWDH 3V12A 1A5HA 3UOPA 2EI8A 3D62A 4F48B 5LH8A 2ZNKH 2PKAA 1V2VT 3RXRA 3VGCC 1Y59T 3PM3A 2ZHQH 1K2I1 2PGBB 5T6GA 2GJGA 1O2LA 1IQEA 1MU6B 1DOJA 2FLBH 3LGWA 4ISOA 4CHAB 1S83A 4IBLH 4RT0A 1SQAA 5C3NA 4XE4A 3KL6A 3SU5A 2PKAB 3BN9A 1O2IA 3TU7H 1O30A 1EATA 1YPKH 3NRLA 3EA9A 1NFUA 1RTLA 4IGDA 3ZZ9A 3UQVA 2F9OA 3ZVGA 1BHXB 2XW9A 2AH4X 3FN8A 1QA0A 3SJ9A 2V7QD 1JMOH 1OWHA 2PTNA 2FOFA 4RN6A 2FP7B 4WJG2 3BEFB 2GX4A 4E7RG 2VGCB 5EXMA 2ZDLA 2VIVA 2ZU2A 3A83A 1FY3A 1QL9A 2FESH 2A32A 1TQ7B 4DJZB 3M37A 1QJ1B 4I33A 8GCHG 2PSXA 2OLGA 2G5NA 3E91A 3GYMA 1O2XA 3RXJA 1ZTKA 4Q7XA 9ESTA 2A4RA 1ZYOA 3CP7A 5C1YA 1CHGA 3HKIB 2CK3D 3K6YA 1TMTH 2ZFRH 3BTQE 4XOJA 1O3DA 1P9UA 1GHBF 1XUKA 1C2FA 5LPRA 1YPHE 1THSH 3A7XA 1EKBB 1UVPA 3GOVB 1TGSZ 3WWFA 2FEQH 2G52A 1LKBA 4NFFA 1YPLH 3BIVH 2M2AA 1EASA 1LKAA 2AMQA 1P11E 1O3GA 1O3KA 3SNAA 2BVRH 2ZHFH 2L74A 2ZU5A 1P9SA 4ESTE 1LHEH 1PQ7A 1E36B 3SW2B 1EJAA 2W3IA 1QL7A 3ZZCA 2G00A 3QWCH 1P2NA 2ZP0H 2FZZA 1NU7B 1HAZB 4BTUB 2GCHG 1IQMA 1AMHA 3ZVFA 4O9VA 1ZJKA 5E2OA 3UPEA 4MPVA 3SJOA 5FAHA 3STIA 1P09A 1NRPH 2BMGB 3TGKE 2A1DB 3GY4A 4OM9A 3GCNA 1AWFH 3RXIA 3E90B 6GCHG 1AIXH 2GMTB 3TNSA 1O34A 3R0FA 1ETTH 1Y3XA 4P02A 4CRBA 3A7WA 2J38A 1TGBA 1DVAH 2IN2A 1TQ0B 1D3DB 1GJ4H 1Q31A 1D6WA 2ZTZA 1H8IH 3KYGA 3MYWA 4XBDA 2A45B 2NU1E 4B6EA 1GVZA 3SU6A 1SQRA 3KGPA 3M61U 3GISB 5A2MH 5EIYA 1KSNA 1KLIH 1GDUA 4OS7A 1GCDA 3L3TA 5KEDA 1QRWA 7KMEH 4FU9A 2BZ6H 3GCHB 6CHAC 2KCOA 3AAVA 2AGGX 2R2WU 4YM9A 2BDBA 4Y0YE 5C5OA 4D7GA 2Z3EA 1D4PB 1ELEE 1YBWA 1GJBB 3ITIA 1JIMA 1C5ZB 1P2KA 6ESTA 1FY1A 3IITA 1Q2WA 3F0PA 1FDPA 3LGIA 3PRDA 2B8OH 3A84A 3BG4C 3MH4A 4B74A 5GXPA 3SNEA 2BX3A 1TAWA 1AZZA 2ZG0H 2TGAA 4NFEA 1WYKA 4CBNA 3ZVEA 2FOBA 2JKHA 3UWIA 2LP6A 1AB9B 1SLXB 5F8XA 4ZMAH 5J4QA 3ZV8A 1TLDA 2BXTH 3A81A 3ZYEA 2O8UA 4THNH 2P8OC 1O2KA 3K9XB 4Q63A 2XWBI 2WINI 3HGNA 1C5QA 1HAHH 4IW4E 1Y8TA 3QTVH 1TX6A 2QY0B 3KQ5A 2P93A 2FLRH 2H1UA 2WPIS 2PV9B 1FI8A 2ZC9H 5LPEA 2Y7XA 1SGFA 2ZGCA 4WY3A 3RXDA 1LQDB 3VB7A 5TJXA 1A3EH 5A8XA 4NGAH 2EEKA 3DFJA 4JZFH 4O97A 1LPZB 2QE7D 1MD8A 1D3TB 4NIVA 1HXEH 3MH5A 3SZEA 1DWEH 1ETSH 1GHVH 3TH4H 2AMDA 2Z9GA 4YZUA 3LC3A 3UR9A 4UDWH 5FPYA 1O5EH 4X1NU 1H8ED 4H6SB 4Y71A 2XCFA 2KCYA 1ELVA 1OYQA 1XUFA 3ZVBA 1TNHA 3RXUA 4XD7D 4ISHH 2ASUB 3EYDA 1OWJA 2AEIH 1OWIA 2A5AA 2K8IA 2ILNA 1C2EA 2GCTB 2ZDVH 3U69H 4A5TS 3HGPA 1F0RA 3NZIA 5ETXA 4AOQA 2F9UA 1K1LA 3P8OA 5DP8A 5JBBS 1OWDA 1LVBA 4MTBA 1GJ8B 3VFEA 1W2KH 1BCUH 4XSKU 1DY9A 1HAVA 1ZSJA 2ZQ1A 1RS0A 2J98A 4CRCA 1AQ7A 4NA7A 1E34B 2C8YB 4INKA 4INHA 3V0XA 5F03A 3SI4H 2P59A 2QGRA 1SGYE 2J34A 2ZU3A 1CQQA 6GCHF 1GBDA 1MAYA 4IN1A 2XC0A 3M3TA 2C8XB 1AVXA 3KCGH 1KLTA 4FU7A 4UEHH 1MTVA 3GY6A 1HAVB 2XBXA 2J98B 1LQEA 5DP6A 3H7OA 4MNWA 3VB5A 4WXVA 4XBBA 1ZLRA 1C1RA 1C1QA 1HCGA 3SU0A 3BF6H 2QCYA 3K2UA 1J17T 4ABGA 3U8RH 2VH6A 3M5OA 5ABWA 2ZGJA 2CHAC 1ZRBA 2O8MA 3K65B 4JZEH 2J92A 2QAAA 1GBKA 1DDJA 4K69A 2ZDKA 5EG4A 3EA8A 3FVFB 2O8LA 1FNIA 1G3DA 4K1EA 1K1PA 2R9PA 4ZAEA 3N7EA 4AFQA 1O3NA 1OP8A 1SQOA 1V2WT 3HKJB 1A1RA 2Y5GA 3LT3A 1QB9A 1IHTH 1LVYA 1HJAC 4BNRA 1A61H 2VU8E 1P01A 4KTSA 2IPQX 1EP6A 1AFQB 3O8RA 1UTOA 2I6SA 8ESTE 5C0UA 2FYRA 4FUDA 2TIOA 4NG9H 4DCDA 3E3TA 4ZUHA 4M7GA 1AWHB 3EGKH 1QJ7B 1SR5C 1W14U 5JPMH 3SV7A 3TVJB 1VITG 2ZCHP 3RXHA 1GWAA 3ATKA 2PKSC 1ZZZA 1MBQA 2BD2A 2BY8X 1GG6B 1GPZA 1BMMH 2WUBA 1H8HD 3DT0H 2PHBA 2VWMA 3NPSA 1ZPBA 1GI2A 2Z94A 5DPAA 5ESTE 1UCYH 1DSUA 1K28D 3LGVA 4Z0KA 1WV7H 3TGJE 1T31A 3W95A 4JZ1A 3IWMA 1P2QA 4DOQA 1TFXA 1CGIE 2G4UA 3ZZAA 4Y7AA 1NPMA 3QGJA 1XM1A 4YTAA 1HAIH 1C1PA 2SGAA 3U28C 1TX8A 1NRSH 2W6JD 4YO9A 1ELBA 1FY5A 3LJJA 2O8TA 2BD9A 1FZZA 1TBZH 2DUCA 1Y3YA 1G2LA 5A0AE 1GMDF 1O5BB 2H9EH 5ESBA 1MMJN 3OSYA 2ALPA 5FL7D 2ZI2H 2HRVA 2XNIA 2BZAA 3P70B 3RU4D 1FPHH 1VJ9U 3SUGA 2ZGBH 2UUKB 3MH7A 2GDEH 7GCHG 1C4Y2 1F0UA 1HB0B 1TB6H 2WUCA 4B2CA 2Z9JA 1OX1A 1LVOA 1SGFG 2H9HA 3E8LA 2ZWLH 4AC9A 2BVSH 4NSYA 1O5GH 1GL1A 3TK6A 1HFDA 1WQVH 2CF9H 4AN7A 1U6QA 4OGYA 1JRTA 1O3AA 5E0GA 3SU2A 4MQAA 3GY5A 1DUEA 1AN1E 3SN8A 1DLEA 2ZEBA 1TALA 1C1NA 2OTVA 2CF8H 1QBNA 1O2NA 3SUEA 1P3CA 4RKOB 2BDYA 1TNGA 1Z71A 1BITA 1UTQA 3PROA 4OS4A 5FX5A 4SGBE 1KXFA 1AZ8A 1BTWA 1GJ6A 2BM2A 1DITH 3GDVA 2ANMH 3BTDE 4X6OA 1NFWA 3A8DA 1V2MT 3FZDA 1EZXC 1TONA 3LGYA 3LKWA 1AHTH 1GBMA 4AB8A 4TY7A 1D3PB 1ARBA 1GBLA 1PYTD 1INCA 4X8TH 2ZDNA 2FOGA 3F0OA 3PLPA 3TITA 3DD2H 2C4FH 3O8BA 1ELAA 1BDAA 5AHGH 5E0JA 3E0PB 1L1GA 1EJMA 2C93B 1PQ5A 2FIRH 3S69A 1N1LA 2XBVA 1CO7E 2CMYA 3P8NA 1CGHA 1CA0B 4Y11E 4Y10E 2JIZD 3A7VA 2GKVE 1HIAA 1ZRKA 4LZ1H 1O32A 3RXKA 3SNBA 2H9TH 1BRAA 2TGDA 1O33A 3GS9A 3UOUA 1HPGA 1O2UA 2W7UA 1NU9A 1FIZA 5JBCS 4YOGA 3UQOA 2F3CE 1UTPA 2DE8A 1V2ST 2FOHA 2ZFSA 1MTSA 4AB9A 1HIAB 1JXPA 2J9NA 4K1TA 5I25A 3M35A 3MMGA 4Q7YA 1C5SA 1AY6H 1V2KT 1FJSA 1ZSKA 2PUQH 4RI0A 4Z6AH 1BRBE 3GY8A 3T5FH 2QV1A 1MABB 3F3BA 2XYAA 3KQEA 1EAWA 3RMNH 4X1QU 2SFAA 3ATLA 5AF9H 2BD8A 4ZKOU 2G55A 5EW1H 4B1TA 2Z3DA 1O5FH 2XWAA 4AYYB 1EAXA 1WXRA 1D9IA 1A2CH 1O3HA 5GCHG 2XOKD 5GIBA 1O36A 5HKKD 1DPOA 3TPIZ 1BBRK 1KXAA 3LDXH 1CBWB 2ZDAH 3DSGA 1IQJA 3BTME 1TWXB 3EDXB 1QFKH 3NK8A 4DG4A 2BY5X 3F9FA 3DSOA 1HAXB 4TY6A 1EOJA 1P12E 2VH0A 2BQ6B 2ZHWH 1VGCC 3BTTE 5HYOA 2OC8A 1ANEA 2HGTH 1MU8B 1DXWA 2FOEA 2HVXA 1XXDA 1EZUC 1IQHA 1UTNA 1UVSH 4FVDA 3T29A 1YPMH 5F6MA 3LU9B 2A0QB 2GZ7A 1F0TA 4JZIA 4ABDA 3UWJH 3U1IB 2SGDE 5EPYA 4IMQA 2Q6FA 1MKXH 2ZPQA 4B6FA 1C1TA 3E0NB 2CN0H 1ZJDA 3WY8A 1S81A 1MD7A 1K1IA 1TE0A 4FU8A 1IQGA 3MH6A 1AO5A 2QF4A 4ZKNU 2RFKC 3SJKA 2ZIQH 2JDID 1TGCA 3OTPA 3CS0A 1P2MA 5DKMA 2LNCA 1OYTH 1Q3XA 3DCLA 4YOIA 3RMLH 3Q3YA 2OBQA 2XXLA 1BMNH 5JB9S 2ODPA 2GT8A 1NZQH 4HTCH 1HXFH 2PP6A 2GD4B 5CHAC 3RLYH 4BAQB 4CRDA 4MNYA 2B0FA 3T25A 1VR1H 3RU4T 4GUXA 3GCOA 2FXRA 4NA8A 3HK3B 1SOZA 2NU4E 3KQCA 1OKXA 4GLYA 4MLFB 4NWKA 4INLA 3T2NA 1B5GH 3RP2A 3VGCB 5C0TA 5CDFE 1C5LH 1P05A 4LZ4B 1ELDE 3SJIA 2G5VA 1FIWA 5HIYA 5EW2H 4ACAA 1PFXC 3MU0A 1AUTC 4ZHAA 2A7JA 1EAUA 4OS1A 4Q7ZA 4DY7B 4OGXA 1V2LT 5J4SA 1GMCG 3A8AA 1L0ZA 5DN6D 4Y8ZA 3EE0B 3PMAB 9LPRA 1W3CA 1SLWB 1F2SE 3NXPA 5EQSA 5DO4H 2BX4A 1G3BA 2TBSA 3OEED 6LPRA 4GVUA 1BTHH 4GAWA 1TA2A 4FUHA 3EQ0H 2LPRA 5HMAA 4FUBA 1CE5A 2FS8A 4I86A 1MTNC 5DP9A 3BTFE 3CNRA 3RXAA 1TNKA 4JK5A 1C1VH 2V3OH 1HAGE 5DJ7A 1O2QA 4IN2A 4DURA 1O2OA 2BOHB 4UFFH 1ANCA 1HYLA 3MI4A 1TABE 1SGDE 2ALVA 3SU1A 2ZTXA 5DP7A 2JH0D 1GL0E 4A1TA 4A7IB 1SG8B 4R8TB 5C5NA 4SGAE 2STBE 1YLDA 1GJCB 4JYTA 3SBKA 1S6FA 1KXBA 3GCTG 4B2BA 2FI5E 2ODQA 3ELAH 3UR6A 4MPUA 1KXCA 2BLOA 2HPQH 1H4WA 1O3JA 3Q3XA 5B6OA 2C8ZB 3VXFH 5CE1A 3K6ZA 1J14A 1FAKH 1C5XB 3MU8A 1WDIA 3UNRA 3F6UH 1UCYE 4RSPA 4ASHA 3RXSA 1MTNB 3S7HB 2F9BH 1GHAG 1Z8RA 1O2RA 2Z7FE 4AG1A 1RIWC 2FI3E 2OXSA 2HNTC 3LPRA 5DP3A 3SV2H 5GNDA 4D9QA 1W11U 1S6HA 3IG6B 1RJXB 1GBJA 3A82A 5HGGA 4NIXA 1CVWH 1MBMA 2SGPE 1BOQA 2RA0A 3JZ1B 1C9TA 4R0IA 3MNSA 1O2YA 1P2JA 5SGAE 2J5UA 1C2DA 3BIUH 4F49A 2A31A 1ORFA 2WPMS 4ZKSU 2ZU1A 2QIQA 1QR3E 3ODFA 3BEIB 5EJLA 3B9FH 1E0FD 5BRRE 1SPJA 1SFQB 3URDA 1ELTA 2P3TB 2NU2E 3RXPA 3SGAE 1EX3A 2FOCA 5T3HA 2V35A 1BMAA 3PO1C 2P95A 1NO9H 3SQEE 2AIPA 2HWLB 1O2PA 3B23B 1IQNA 2XCNA 1N8OC 1W7XH 1MCVA 1SB1H 1SGRE 1ABJH 1YPJH 1HGTH 1TNLA 6CHAB 1NRNH 4ZH8A 3V3MA 2PFEA 1GCTC 2ZA5A 1E37B 1E1RD 4H4FA 2OC0A 3W94A 4D76A 1DANH 4MPXA 3M3VA 1HNEE 8GCHF 1XUGA 3QLPH 3T27A 2XNDD 1WAYB 1ZMNA 2QXHA 1NT1A 5IYTA 2M5TA 3OY5U 4WMDA 3BG4B 1FN8A 1GDQA 3PLKA 1FN6A 2XBYA 4DT7B 1OOKB 4WMFA 4WXIA 3C1KA 5FXLA 5EQRA 3QK1A 1P2IA 2FTLE 2PTCE 4M9FA 4IC6A 3FFGA 1BIOA 1TPAE 2QN5T 1QL8A 1V2NT 3U98H 5K7RA 1NC6A 1HBTH 2P8OB 1YCPK 1O3PB 1TBRH 1VCQA 1ARCA 2J94A 4Y8XA 3SQHE 3RC5A 3UTUH 3TK5A 2P3FH 2BD4A 3L6PA 2GT7A 3RXQA 3PB1E 5E0HA 3TLOA 3A8CA 2AS9A 3WWBA 1CA8B 2G8TA 2R0KA 3H5CB 4P00A 3SHAH 3UNSA 1QCPA 2FX6A 3S7KB 2RDLA 1GBCA 3MO9A 4GPGA 5AFYH 3NKKA 5C20A 3KF2A
chains in the Genus database with same CATH topology
3RM2H 1VZQH 2GCHF 1AGJA 1SI5H 2VIDA 1T8NA 3GY2A 1IQLA 1RXPA 1QBVH 1OP2A 3STJA 1C1WH 1B0EA 4YLQH 4ISNA 3N7OA 1AI8H 3E6PH 1O2HA 1TGTA 1TMUH 2Y81A 3Q3KA 1SFIA 2BD5A 1IOEA 3BTKE 1DE7H 1ZOMA 3D65E 4MG3A 1CHOG 1L1JA 1W8BH 2BD3A 4BAHB 2D2DA 4I32A 1V3XA 1YM0A 3HK6B 1F92A 1SLVB 4Y7BA 4YT7H 1QHRB 7LPRA 1AE5A 5JYIA 4JMYA 4YLUA 1BA8B 2GZ8A 4ISIH 3VB4A 1GVKB 1EPTC 3DFLA 5LPFA 1G3CA 3ZZDA 1XUIA 2FS9A 1KXDA 2PUXB 4AFZA 1P3EA 4F4OC 2A7CA 1MKWK 1TGNA 1RRKA 3Q00A 4X8UH 1GI6A 1W10U 4AG2A 1KTTB 2UWOA 1P06A 3RXEA 1S84A 1JWTA 1J9CH 2A2XH 4J1YA 2OQ5A 5DG6A 2VWOA 3SU4A 5A09A 3I77A 1C1OA 2OBOA 2QYIA 1EAIA 3AASA 3ZZ4A 2R3UA 2KAIA 2BLQA 4GCHG 1V2TT 5FBEA 3A85A 3KQDA 3RM0H 1UMAH 1TNIA 4O3UA 2CHAB 2ESTE 4ABBA 1NS3A 5E8EH 2AYWA 1XVMA 1Z8GA 3NCLA 4B71A 2VIQA 3RC4A 1GMHG 4X2XA 5FCRA 3F9EA 1MUEB 3MOCA 1EPTB 1GJDB 1IQIA 2FO9A 2KAIB 3LC5A 3SJ8A 3FZZA 1WU1A 1ZPZA 1BHXF 1P57B 1P03A 1Z8JB 1HJAB 3S9AA 3SZNA 3TH3H 4GHTA 1SBWA 4BTTB 3M5MA 2FX4A 2H5DA 3I29A 1Y5UT 2TRMA 3F9GA 2A2QH 2HPPH 4K8YA 1UHBB 1SGNE 1XUJA 4MNVA 1C4V2 2Y5FA 4XDEA 2OINA 1P04A 4B76A 1LTOA 3BTGE 4X1RU 2BB4A 3HATH 4I8HA 2PKSB 1HAYB 2P94A 1O5AB 3SV6A 2BTCE 2TGTA 1UK2A 4UE7H 5DGJA 1NN6A 2W5EA 1QTFA 1G32B 5E2PA 1L4DA 2AGEX 3ZVAA 2QXGA 1ESBA 1GGDC 2A4QA 1YF4A 5HM2A 3P95A 4BAMB 2FWWA 1BRCE 1JIRA 1SLUB 4TWWA 5A8YA 2OUAA 2WYGA 2FYQA 3MWIU 3OYPA 1QBOA 2GTBA 2BY6X 4UFGH 2UUYA 1UTKA 1GBTA 3GY3A 1FLEE 4UFEH 3MHWU 3QGNB 4PROA 3GYLB 2BLVA 2ZO3H 2A5IA 1T4UH 1YCPH 3PWCA 3ATIA 4ZXXH 1C5TA 2V0BA 3DHKH 1FY4A 3ZZ5A 4ZHMU 1XMNB 4MNXA 4FUIA 5A0BA 2SGQE 4BAOB 1A5IA 1L2EA 3U1JB 1YC0A 3BEUA 5FX6A 1TPSA 1JOUB 1V2RT 2Q6GA 3SUDA 2NWNA 1GGDB 3T62A 3C27B 3SNCA 2WV5A 1ID5H 1OSSA 2Y82A 3QO6A 4Y8YA 5BPEA 1B0FA 1LMWB 2F91A 2D26C 1ELCA 1BB0B 8LPRA 1QIXB 1TNJA 3U8OH 1NRRH 1S85A 2JETC 2VVUA 2OD3B 2Z9LA 1O2ZA 5FPSA 3GY7A 5FCKA 1O2TA 3NWUA 1GHYH 3QTOH 2PR3A 4NA9H 1GI9B 2JH5D 1GJAB 2BLWA 4B2AA 5FHTA 2G4TA 4GSOA 2V3HH 2BYAX 4Y79A 2P16A 4KP0A 4ABHA 1C4U2 1N6YA 1GBIA 3TK9A 1BQYA 1VITF 1BJUA 4MPWA 2XBWA 1MZAA 4VGCC 2ZCLP 5C1UA 2A4GA 4HGCA 4D7FA 3PWBA 1SVPA 1DS2E 1KTSB 2B7DH 2F9NA 2XC5A 1SHHB 3D49H 1BT7A 2O9QA 1VCPA 1GHBG 1PYTC 4ZROA 1N6XA 2NU0E 3LH1A 3SV8A 1O2GH 3UY9A 4AGKA 2CJIA 1HJ9A 2UWLA 2ZCKP 1BTYA 4E7NA 1QRXA 1Z6JH 5DK1A 2R3YA 5JDUB 1TMBH 1O3OA 1ZR0A 2JETB 1O3LA 2B5TB 3Q76A 4X1SU 3F1SB 4FUCA 3LGUA 1CT4E 2RG3A 1TX7A 1NROH 1YKTA 2ZFPH 1K1OA 1GVLA 3BV9B 1FQ3A 1O37A 1AVWA 2WPKS 2ZPSA 3RUOA 1AU8A 4J2YB 4DGJA 1T8MA 1P02A 4A6LA 1ZGIA 3T28A 3R3GB 1TRNA 2GP9B 4KELA 1K21H 3KNXA 1C2HA 4VGCB 5HXFA 4TYDA 2ZGHA 1ABIH 3A88A 4E06H 7GCHF 2JH6D 1SGCA 1K1JA 3F68H 1UJ1A 3RXVA 4XFQA 1QB6A 4K2YA 4I8GA 1HDTH 2W3KA 1GHWH 4CHAC 1YP9A 1ZMLA 4X0WU 3ATMA 4FUGA 2YNAA 1W0YH 4Q2KA 1XKAC 2AMPA 2C3SA 1Y3UA 4ZKRU 3P17H 5F8ZA 4AORA 3LJOA 3MU5A 1TRMA 1C2GA 4HI3A 5L6NH 5T6DA 2PWXA 3ZZ7A 1FONA 2F9PA 2FPZA 3SV9A 2ZFTA 4UFDH 1GHXH 1YPGH 2VGCC 1FUJA 1K1MA 3A87A 4WMEA 1YYY1 3RXMA 4H42U 3A8BA 1L4ZA 4U2WA 2Z9IA 2VINA 3EA7A 5EOKA 3ZZ3A 4AYVB 5JB8S 1D3QB 1VCWA 3ZZ8A 1C9PA 1OP0A 2A4OA 1EOLA 1WBGB 2TPIZ 1K22H 2AFQB 5LGOA 2IPHA 4ABJA 3KQBA 1AUJA 2HNTE 4WVPE 3S9BA 3FP7E 1ZHRA 4LOYH 1BMLA 1O0DH 4JYVH 1E38B 1VGCB 3V7TA 1P8VC 1G30B 1X7AC 3HPTB 1ESAA 3I78A 1IQKA 2BDCA 1ANDA 3QN7A 2F83A 1EZSC 1WOFA 1XX9A 2SGEE 4RKJB 1DSTA 1HUTH 3TIUA 5L30H 2J95A 1NM6A 1FAXA 1M9UA 4FUFA 1EQ9A 4X2YA 1QGFA 1XXFA 3SNDA 2Q6DA 3SORA 5C2ZA 1UTMA 2ZDMA 4FXGH 1SGPE 1EUFA 1SSXA 3TJUA 1DFPA 1ZHMA 3UNQA 1WCZA 4AZ2B 3DUXH 4BXWA 2PGQB 3ZZ6A 2Z6BD 1SGQE 1T8OA 1Y5BT 1XUHA 2Z9KA 4U32A 4AFUA 2D1JA 2ZTYA 1H9LB 1BUIA 4Y0ZE 3TNTA 1C5OH 3U9AH 2ANYA 2ZKSA 1DY8A 1MH0A 1C2IA 4K3JA 1NFXA 3RXTA 4QT8C 1JBUH 2GMTC 3A89A 3PMJA 2IJOB 1P10A 3RC6A 1DXPA 2AERH 1TOMH 5CHAB 1S0QA 1TOCB 1UVOA 1ANBA 3S0NA 3P92A 1H8DH 2D8WA 1HRTH 1OXGA 1O2WA 4FVBA 1BJVA 2FOAA 1WUNH 1LPKB 1F5RA 1THPB 2SGFE 1YCPM 1QY6A 4LXBH 1UO6A 2AIQA 2DE9A 2ZF0H 1XVOA 2HALA 1GDNA 4KGAA 1OPHB 3GCHC 1G9IE 1TPPA 1S0RA 3SO3A 1O2JA 1GI3A 3L33A 4UD9H 3SOSA 1DT2A 4NWLA 3ZVCA 5TCAA 5GCHF 1IHSH 4K60A 1C5MD 4D9RA 1LVMA 1WQSA 4CRFA 2ZFFH 3UIRA 3AVZA 2NU3E 3M7TA 1C2LA 4A1XA 1QJ6B 3SGBE 1TA6A 3MNBA 4JK6A 4Y76A 1HAPH 2Q1JA 4JYUH 2R0LA 1AB9C 1NTPA 2UUFB 3ZV9A 1O3CA 1PJPA 2VWLA 1KIGH 5AVDA 2FM2A 3TH2H 5JBAS 3GDUA 5L2ZH 2FOMB 2W7SA 1LHDH 1C5YB 4TPYA 1ZPCA 1FPCH 4NIYA 1GBAA 4TWYA 1VJAU 3E16B 1W0ZU 4DVAU 1C1SA 2ZQ2A 1UK4A 4I8JA 1O5CB 1UCYK 2YNBA 2EC9H 4IMZA 2ZHDA 4DIHH 4X8VH 3QZQA 1BBRH 3URCA 1T8LA 3OX7U 1DLKB 1D6RA 1T7CA 1KXEA 2BY9X 1DUAA 4X1PU 1UTJA 4X6MA 2ZZUH 2FI4E 2HOBA 2QF0A 5F8TA 1SHYA 3KN2A 1O3BA 4CR5A 2H5CA 1G37A 1O39A 1RIWB 3UFAA 4NZQA 4YESB 1CT0E 1KYNA 1ELFA 2CXVA 1LPGB 1QA7A 1AVGH 3ATWA 3BTWE 2GDDA 1GJ7B 1O2SA 3OTJE 1YPHC 3SHCH 1PPBH 5GPIB 1OS8A 1GJ5H 2GCTC 1C2KA 1UVTH 3VEQB 1WTGH 2G81E 4AGJA 3A7TA 3ESTA 2BDAA 1C2JA 2VWNA 1ETRH 8KME2 3QUMP 1RTFB 1ESTA 1GMCF 1OWKA 1A7SA 2WPHS 3RXOA 2R2MB 1K9OE 1XKBC 4AFSA 2BY7X 1VITH 2UUJB 3MNCA 2WPJS 1PPEE 3ENSB 7ESTE 3PO1B 2OP9A 3SGQE 1MQ6A 4U30A 2J2UA 1KY9A 1PPHE 1SMFE 1N8OB 5EQQA 4WF8A 1DICA 1Y5AT 1Z1JA 1GCTB 2FMJA 3OU0A 1FMGA 2SNVA 2ZU4A 2RA3A 3F9HA 2SNWA 4U01A 1PPGE 1GMDG 5A8ZA 1LHGH 3VXEH 4CBOA 1EB1H 1LHCH 2XRCA 1QQ4A 3A80A 5DP5A 2TGPZ 3M7UA 1GI4A 1W7GH 2J4IA 4K5ZA 3SI3H 1G3EA 1RTKA 4JCNA 4WWYA 4WH8A 3U8TH 4BXSA 3TJOA 3GCTF 1Z6EA 1QNJA 1UVUH 1S82A 2I6QA 1V2UT 4DW2U 1O2MA 4CREA 5C67A 1ACBE 5FPTA 4CH8B 2CGAA 1TBQH 1O38A 2GV7A 1GBFA 1C5RA 1UTLM 2K1QA 3AAUA 1TYNA 2FDAA 2GZ9A 1FY8E 1A5GH 3KHVA 3AW0A 1GHAF 3M3SA 1SOTA 4KKDA 2ODYB 1E35B 1V2JT 3MNXA 2QXIA 2Y6TA 1KDQA 1W13U 1AFQC 1NESE 5FBIA 1AFEH 3VB3A 2A5KA 1O3IA 1HJ8A 1FV9A 1ZMJA 1C5UA 1SQTA 4Y6DA 5EGMA 1W12U 1AD8H 2ZGXH 2Z3CA 4CRGA 4CRAA 4ISLA 1GG6C 2W26A 1KDQB 1SL3A 2ZECA 1T4VH 2VB0A 3PMHB 2CV3A 1EJNA 1Y3WA 4ZXYH 1JRSA 3VB6A 1QQUA 3BG8A 4Q80A 2BD7A 3A7YA 4B73A 4X6NA 1SGIB 5H4IB 1V2QT 4B75A 3RU4E 2BDGA 2XC4A 3VPKA 1EPTA 1Y3VA 2Y80A 2GVFA 4H6TA 4YT6H 3NUMA 3RDZA 1BTZA 1RD3B 1ZSLA 4UONA 3D23A 4ABAA 4IC5A 2XTTB 4X2VA 3LH3A 3FANA 4HFPB 3RMOH 4HZHA 1NY22 4X8SH 1MZDA 2OC7A 1UHBA 1BTPA 2WPLS 1L1NA 3KIDU 1H9HE 2ANWA 3O8CA 1G36A 5T6FA 1Z1IA 1EXFA 4ABFA 2BXUH 1AE8H 1LDTT 1YPEH 5AFZH 2IOTA 1F0SA 1TPOA 2QC2A 5A0CA 3TGIE 4FUJA 1F7ZA 2H2ZA 1WTHD 2PSYA 1GBBA 2VIOA 5C1XA 3KEEA 2O8WA 4OS2A 3OY6U 5K0HA 4GHQA 1EP5A 4I31A 5PTPA 1BTXA 1O2VA 1GI1A 1C5PA 3A86A 4TPIZ 3V13A 1GI8B 2B9LA 4JZDH 1P2OA 1SC8U 3SU3A 1MKXK 4BOHA 3T26A 1C2MA 1OWEA 2P3UB 3CS7A 3MU4A 2VIWA 3M7QA 3ZZBA 1BZXE 1YLCA 1GI5A 4AX9H 1SGTA 2C90B 1PQAA 3M5NA 1F5LA 1MTWA 2BQ7B 1PPZA 4D8NA 2PW8H 4NIWA 4NCYA 2WYJA 3PTBA 5DP4A 5GDSH 4OS6A 3P6ZB 4O3TA 2FODA 3P8GA 3LIWA 1ZGVA 1O3EA 4X2WA 1RFNA 1FXYA 2V6NA 3EAJA 3AW1A 1WSSH 1IQFA 5L2YH 4IS5A 4MDSA 3RXFA 1T32A 4OS5A 3RMMH 1MQ5A 1J8AA 1PQ8A 1CHOF 4O03A 4KTUA 1LO6A 3BTEE 4I7YH 1A0LA 1GBHA 1A46H 3LONA 4WH6A 1QURH 3RXCA 2EA3A 1GI7B 1CA0C 1GHZA 2BVXH 3LOXA 1C1UH 1Z8IB 2F9VA 1QRZA 2PLXA 3Q77A 1C5NH 1PPFE 3QDZB 1GI0A 1NFYA 2H6MA 4CR9A 2EI6A 1O3MA 4K1SA 4NZLA 4I8LA 2VNTA 3JZ2B 2QA9E 3FP8E 4FUEA 4DIIH 4X6PA 1A0JA 3MO6A 1P0SH 2ANKH 4A92A 1YGCH 4MVNA 2BDHA 1HAOH 2VIPA 4ABEA 5GJ4B 2A7HA 4ABIA 1PPCE 5EODA 1NRQH 3P8FA 2C8WB 2BQWB 2GGVB 3S9CA 5CMXH 1IAUA 3RXGA 1BTUA 1B7XB 4BAKB 2RCEA 5EXNA 2HLCA 1MAXA 3PMBB 1TIOA 2FTMA 3MU1A 1CT2E 3PLBA 3BTHE 4A1VA 1UK3A 2Y7ZA 4GCHF 3QZRA 1AKSA 4XBCA 3LGTA 2YOLA 5G4BA 1SGEE 3RXLA 2OC1A 1KLJH 3MFJA 3ZYDA 3PV4A 1H9IE 2AGIX 4KTCA 1EZQA 3TJNA 1LHFH 3RLWH 1TRYA 1CGJE 3UUZA 1J16A 1GMHF 2EI7A 2UWPA 1O31A 1H1BA 4YOJA 3CENA 2BHGA 1CBWC 1Z7KA 1AKSB 1ZTLA 1THRH 3G01A 5EXLA 3TJVA 1MKWH 3O8DA 5TCCA 1ELGA 2ULLA 1CU1A 1DM4B 4CH2B 1A4WH 1BBRE 2HNTF 3H7TA 1ZTJA 5JBTA 3ODDA 3UREA 5HM9A 1GJ9B 1A0HB 4K8BA 4E05H 1HV7A 2QF3A 1O3FA 1C1MA 2STAE 2WV4A 3SUFA 1G2MA 2Y5HA 2VJ1A 3B8JA 1V2OT 1MCTA 3M5LA 3FP6E 5EPNA 2G51A 5IDKA 5GWZA 3MO3A 2GV6A 4BTIB 2VVVA 3BSQA 4NSVA 2VVCA 3GDSA 1J15A 1O35A 1F5KU 1GBEA 1BRUP 2ZHEH 1K1NA 3GICB 4LK4A 1DWCH 3DA9B 3M36A 1RGQA 5EU8A