1FZZA

The crystal structure of the complex of non-peptidic inhibitor ono-6818 and porcine pancreatic elastase.
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
240
structure length
240
Chain Sequence
VVGGTEAQRNSWPSQISLQYRSGSSWAHTCGGTLIRQNWVMTAAHCVDRELTFRVVVGEHNLNQNDGTEQYVGVQKIVVHPYWNTDDVAAGYDIALLRLAQSVTLNSYVQLGVLPRAGTILANNSPCYITGWGLTRTNGQLAQTLQQAYLPTVDYAICSSSSYWGSTVKNSMVCAGGDGVRSGCQGDSGGPLHCLVNGQYAVHGVTSFVSRLGCNVTRKPTVFTRVSAYISWINNVIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ELASTASE 1
publication title The crystal structure of the complex of non-peptidic inhibitor of human neutrophil elastase ONO-6818 and porcine pancreatic elastase.
pubmed doi rcsb
molecule tags Hydrolase
total genus 61
structure length 240
sequence length 240
ec nomenclature ec 3.4.21.36: Pancreatic elastase.
pdb deposition date 2000-10-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fzzA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1fzzA01
1DLEA 2OC1A 1YPGH 1BHXB 3M7QA 3NKKA 3A82A 1BTHH 2WV4A 3A7TA 1ETSH 3QGJA 3SGBE 1HDTH 5DG6A 2ZECA 1V2KT 4K69A 3S7KB 4FUJA 3OY5U 3HGPA 2BQ7B 2Q6FA 2ZPRA 2DE9A 2FOFA 5H4IB 1C9TA 1KXCA 1Z1JA 2SGFE 1NESE 2Y5FA 4ZKRU 1K22H 1EJAA 3RXSA 3ZZBA 1GHVH 1ESAA 4IC6A 2XTTB 2PV9B 2ZCHP 1C1UH 1IQKA 4XE4A 3RMMH 1UCYK 4YTAA 4VGCB 2BYAX 2H9EH 2C3SA 1K2I1 4UD9H 2BX3A 2BD5A 2QXHA 3NUMA 1VITG 2SGDE 1RGQA 8GCHG 1SLWB 5FHTA 1FZZA 2W26A 1T8MA 2A5AA 3D49H 3V3MA 1OWDA 1RIWB 2ZO3H 4MNYA 3GY8A 1DXPA 1GJ6A 3A89A 2GVFA 1ZR0A 4MQAA 5K7RA 4CRAA 1VITF 1QRXA 4ISOA 1JOUB 2ZHDA 2ODQA 1T4UH 1IQIA 1TMTH 1YPEH 2C8WB 1QL8A 2CF9H 3V13A 3MU8A 3RXQA 3D62A 2R0KA 3K6YA 2WPKS 1GBCA 4NIWA 1MH0A 1OPHB 1HGTH 1Z7KA 2JETB 3UUZA 3JZ2B 4GAWA 4AX9H 4WMFA 5I46H 2Z9KA 1S82A 1LDTT 4CRGA 1YPKH 1W12U 1F7ZA 3SOSA 1GJCB 3BTGE 1MCVA 1ZPCA 2ZTXA 5C20A 3UOUA 4IMZA 5EU8A 2G81E 1C5YB 1AKSA 3F6UH 3ZV9A 1V2WT 1CU1A 4IW4E 3U1IB 1TBQH 3RC4A 1L4ZA 1HFDA 3T62A 5DP9A 5SGAE 5EPNA 1MTWA 1Y3VA 2BDCA 3ZVDA 1H9IE 5DP4A 1X7AC 1OS8A 1EB2A 1BCUH 1K1NA 4Q80A 1FLEE 1ZPBA 1DT2A 2NU0E 2R9PA 4KELA 1GHAF 3O8CA 8LPRA 1LKBA 1HAOH 2P95A 4K8YA 4XFQA 1V6DA 1C5MD 1GWAA 1OWKA 2Z3EA 4HFPB 4K1TA 4IN2A 3VB5A 1GI0A 1A5HA 1YLDA 1DVAH 1G30B 4NIXA 2CN0H 1E38B 1T7CA 3ZVAA 4XBBA 1C2HA 1TNJA 2EA3A 2PKAB 1GMDF 2QXIA 2PWXA 5HMAA 1PFXC 3RXLA 1YLCA 2CJIA 5TJXA 3U1JB 4BAKB 3M36A 1EPTC 2GZ8A 1HIAA 2B8OH 3TGKE 1P02A 1ZPZA 2J4IA 1ZGIA 2FOAA 4GPGA 1P9UA 3PMHB 2G52A 4BAOB 1TBRH 2ZGJA 1W10U 1C2MA 1C5VA 2O8LA 1FN6A 4KKDA 1C5SA 1VCWA 4A5TS 4B1TA 2FM2A 2J38A 2VGCC 3M7UA 4DG4A 1O34A 2G55A 3UREA 3MU1A 4JCNA 1EB1H 2FZZA 4X0WU 2ZGXH 4U32A 1D4PB 1KTSB 2WYJA 3URDA 1GJ9B 2ANYA 3UFAA 2ZWLH 1KLIH 1WUNH 5JBCS 1ELCA 1GBTA 1RFNA 1NFUA 1YPJH 2BDAA 1ABIH 2LNCA 1O3JA 4D7FA 3ZZ7A 5FAHA 1ZOMA 1G9IE 3UWJH 2QF0A 2J94A 2SNWA 1BT7A 3ATIA 2HWLB 3A88A 1UHBA 1A0JA 1TGCA 2ZNKH 3SHAH 1OSSA 1J8AA 2BD4A 2A4GA 1WCZA 1KXDA 2AEIH 4DOQA 1QFKH 4X2VA 1G3DA 3STIA 3SZNA 3PV4A 1AVXA 2F9VA 1ZTJA 2VIPA 4YM9A 2FOBA 4CH8B 4NFFA 1YCPK 1L1JA 2C93B 2A4OA 3SHCH 2ZU3A 3SI4H 2BY9X 2AMQA 3ZZ6A 1NFWA 2W7UA 5FPTA 3A85A 3RXDA 3TGIE 1GBIA 3SU3A 2BLOA 1G3CA 2FO9A 1YPLH 4BXSA 5TCAA 1JXPA 1Z6EA 1O2NA 1C1WH 2CV3A 2J34A 1ZRBA 3MU0A 1B7XB 1WV7H 1O2YA 9LPRA 1GMCF 2RG3A 4DW2U 3Q3KA 2ZDMA 2BD9A 3O8BA 1KYNA 1MTNC 4E7NA 1KXEA 1O3EA 2P8OC 4MPXA 1KDQB 2XBWA 2HALA 1Z8RA 1LPGB 2K1QA 4B2BA 1O2MA 1SGQE 2P16A 2SFAA 3BEIB 2KAIA 1A5GH 4QT8C 2BB4A 4CRDA 2ZU1A 1UCYE 1BHXF 1L1NA 1UVPA 2BD7A 3ATWA 3LGIA 3FP7E 1G2MA 5EW2H 2ILNA 2H9HA 4ABDA 3BTTE 1K1PA 5LGOA 1FXYA 1EAWA 1O38A 2FDAA 1ELVA 1O2OA 1PQ8A 1O5CB 4OS4A 1FY4A 1MCTA 2VIVA 1OP0A 1V2RT 3BTQE 3R0FA 1SBWA 1BITA 4IMQA 3VEQB 2FWWA 5CE1A 1HAIH 3BTME 1SVPA 1SGNE 2B7DH 1GL0E 1PPHE 1C5TA 1TBZH 1MTUA 1NRNH 1DANH 3TNSA 2I6QA 4MVNA 3SBKA 1RTFB 3SO3A 3AAUA 4DGJA 1NFXA 1WAYB 2ZI2H 1XXFA 1OP8A 2V35A 3CS0A 3T25A 2G5NA 1LQEA 2JH0D 1GBLA 1O3AA 4NIYA 1BTUA 1Q2WA 2Z94A 3BN9A 5HYOA 1LHEH 2Y7XA 4FUBA 3QZRA 1FPHH 3OU0A 1HYLA 1NTPA 1AO5A 3L3TA 1O2RA 2AIQA 2WYGA 3A86A 4ZUHA 3TITA 1EATA 2PFEA 4D8NA 2PUQH 3BIVH 2NU3E 1EUFA 2A5KA 1E36B 7GCHF 1XM1A 2BDBA 3RXHA 5GCHG 4SGAE 4MPVA 4XDEA 3TH2H 1TNLA 4NA8A 2IN2A 4ZROA 3UQOA 3UR6A 1FPCH 3PM3A 3MNXA 1AB9C 3PO1C 3A8CA 4FUDA 5J4SA 2ANKH 2XBYA 4AGJA 2BXUH 1D6RA 5PTPA 2F9OA 2FLRH 1OX1A 3MNSA 4JK5A 3RU4E 3GOVB 5C5OA 1SHHB 1CHGA 4FVDA 4B75A 3PWCA 5TCCA 3H5CB 4GHTA 1O3KA 4ESTE 3SU2A 5L6NH 1W13U 1HJAC 4B74A 2ANMH 1SOTA 1BRUP 4AFQA 2ZQ2A 1GDUA 1H1BA 2EI6A 1P04A 1K1OA 2AH4X 3UWIA 1EOLA 4B2CA 1QIXB 2W7SA 2F9BH 4WXVA 3RU4D 5EGMA 2AMDA 2B0FA 3RXJA 3TK6A 1CT0E 1PPZA 3UNRA 2A7HA 1D3TB 2R2MB 5F6MA 3WY8A 1TPSA 2QGRA 5A0AE 4O3UA 4OS1A 1WQVH 2G51A 1W11U 1TRMA 2VH6A 3B23B 1ELBA 2DUCA 1BMLA 2Q1JA 3EQ0H 1SSXA 4A7IB 2SGQE 3O8DA 1FN8A 5AF9H 2A2XH 3ZZ8A 3SGQE 1EAIA 2OLGA 3M61U 2D2DA 4INHA 3TJOA 3MH7A 4CRBA 5F8TA 4K1SA 1TX7A 3SU5A 3MH5A 1RXPA 1O3LA 1S6HA 5FX5A 1GI7B 1ID5H 3A8BA 4HGCA 2BVRH 3BG4B 1YPHC 2C8XB 2GT7A 3A7WA 1O2QA 1V2QT 2ZHQH 4FVBA 4WWYA 3ZZ4A 4TY7A 2XW9A 3PYHA 2ZIQH 1XX9A 1GHXH 2O8WA 3AW0A 5HGGA 1V2LT 4Z0KA 3IWMA 1G3EA 3EAJA 3LGWA 1MD7A 1TYNA 3FAOA 1MBMA 4R0IA 4RSPA 3RXFA 3SUGA 1AQ7A 1OYQA 3W95A 3UOPA 1C1RA 2R2WU 2VVVA 2WPLS 4B76A 3E3TA 4HTCH 4ABEA 2VWOA 4CBOA 1MQ5A 2C90B 3ZZ9A 2FESH 1O35A 1TB6H 4TPIZ 3TK9A 2W5EA 1ZJKA 1BJUA 1C1TA 1NS3A 1N6XA 4GCHG 4OGYA 4DIIH 2A4RA 2XNIA 4AG2A 1VGCB 1JIMA 3GY4A 3GYMA 1C5UA 4NCYA 3GDVA 3KGPA 4AFSA 1SGDE 1QGFA 1O5DH 1OXGA 1NM6A 2EEKA 1AUJA 4ZHMU 2F83A 2VIQA 1FIZA 3A84A 1GCTB 1GBFA 4FUGA 4GCHF 1YKTA 4NIVA 2HNTF 5L2ZH 1ELFA 1MTVA 1Y3UA 2PKSC 1SOZA 1PJPA 3EA9A 4ABBA 1SC8U 2QIQA 1NO9H 1AKSB 5A09A 3GY3A 4CRCA 1Y3WA 3F9GA 3EGKH 3VB4A 1UJ1A 1ELAA 4FUHA 2OBQA 4MTBA 1P2IA 4X8TH 3Q00A 1GG6C 3NCLA 2ODPA 4K1EA 2Q6GA 3RMLH 1SI5H 2UUKB 2BDYA 3K6ZA 3DA9B 1OKXA 3MNCA 1KXBA 1ZTKA 3BSQA 1QL7A 2VH0A 4JZEH 2HPQH 2HVXA 3QDZB 4X8UH 1GI3A 4YOGA 1BZXE 1OWIA 1NROH 2GCHF 5FBIA 1QJ6B 3RLWH 2ODYB 4INKA 5EOKA 2ZCKP 5C2ZA 4JZ1A 1RRKA 4DT7B 1RTLA 2BLQA 2QA9E 3Q76A 5EG4A 4ZXXH 1DPOA 2ZFRH 2TGTA 4GHQA 2QCYA 1TMBH 1QA0A 1XVOA 1HIAB 1IQJA 1NRRH 2Q6DA 1AFEH 3RXEA 5EQSA 3FZZA 4Y6DA 1O3MA 1P09A 4BAQB 5C1XA 2BZ6H 2NU4E 3KQDA 2ZC9H 1MZAA 5F03A 1SGPE 2GV7A 1QB6A 3KNXA 1W14U 1C4U2 2BY6X 4MNVA 1P10A 3MH6A 1MAYA 3SJIA 2ZFFH 2P3UB 2QF3A 2P94A 4TYDA 1FY5A 4IS5A 3VB7A 3T2NA 3LJJA 1WOFA 4IC5A 1O2XA 1HAGE 3TH4H 1Z8IB 4D9RA 3A8DA 2O8TA 6CHAC 2CMYA 4JMYA 4MLFB 2VVUA 2TPIZ 1C5XB 5IDKA 3M7TA 4ISLA 4OS7A 1BRAA 2Z9GA 1S0RA 2DE8A 4FU8A 3UPEA 1EOJA 1UHBB 3M37A 3S9CA 4AB8A 2BDIA 4CHAC 2FI3E 2IPHA 1O3GA 1SFQB 2ZP0H 3QZQA 3A7XA 1TNKA 1INCA 2FYRA 2HOBA 3PWBA 2PGBB 2XRCA 2AGIX 1GJ5H 3DFLA 1XUHA 3RXKA 4RKOB 1ETRH 4OS6A 2ZU2A 5E0JA 2FOEA 1SGFA 1JIRA 3A87A 1DOJA 1FDPA 1AU8A 2TGPZ 2FOHA 1AZ8A 1QTFA 4UFEH 2ZHWH 3ATMA 2FIRH 1S5SA 3L33A 4TWYA 2V3HH 8GCHF 1AMHA 2C4FH 4I7YH 4JZFH 1ZLRA 1N8OC 3U69H 3VB6A 3TLOA 5EXMA 2ZPQA 2GCTB 1C1SA 1FQ3A 5FPYA 3RXUA 3TIUA 1EKBB 3HGNA 1FY1A 1S0QA 1DY9A 2B5TB 1O33A 1TNIA 2CXVA 1H9LB 1AN1E 2JKHA 1HAXB 3KQBA 3JZ1B 3P6ZB 1THPB 2R3UA 4ABFA 3CENA 4AFZA 1AWFH 1IAUA 3ZYEA 3QTVH 2VWLA 4ABJA 2H1UA 1CO7E 5A2MH 1U6QA 2AS9A 3H7TA 2HGTH 5FX6A 2KAIB 1SLXB 1UCYH 1T8LA 1YCPM 4NZLA 1VCPA 4VGCC 2XC0A 1SL3A 5CHAB 3QN7A 1WBGB 2OD3B 4NZQA 3MI4A 1OOKB 3STJA 2J9NA 1SQOA 3DT0H 2BDHA 5DJ7A 2IJOB 3GCHB 3URCA 2WPJS 1GI1A 2WV5A 2F3CE 3SNDA 1C5ZB 3A7VA 2FOMB 2TBSA 1ANDA 3GCTG 1TPAE 3LONA 1BTPA 1RIWC 2NU2E 3F1SB 1YBWA 2YNAA 1GBBA 3QGNB 1EZUC 2WINI 2H9TH 3SQEE 4WVPE 1PQAA 1GJ7B 3ENSB 2BTCE 1H8IH 1QBNA 5AVDA 7KMEH 2F9UA 1SGFG 1CBWB 1UVTH 3BEUA 1IQHA 1BQYA 1EZSC 1LVMA 1ESTA 3FP6E 1TPPA 1ZSLA 5FXLA 4ZKSU 1J15A 1GHBG 1P06A 3QLPH 2JETC 4K60A 2GDEH 3MHWU 3HPTB 2GMTB 2NU1E 1AUTC 3GYLB 2CF8H 1IQNA 2R3YA 2BLVA 1P57B 4A1TA 1SGTA 1GHZA 2OINA 1AVWA 1GI4A 6ESTA 1GHBF 1P12E 3LIWA 3ZVBA 1O3NA 1QBOA 1TNGA 1V3XA 5A8ZA 5FPSA 1UTLM 2ALVA 1C1OA 1P05A 3SUEA 2VVCA 2Y6TA 3RU4T 3MWIU 3P70B 1C5WB 3LC5A 5A8XA 4A1VA 2BX4A 1O5EH 1C9PA 1GBHA 4LZ4B 3I78A 5FBEA 1EAUA 4XBDA 1T4VH 4ZKOU 3SV7A 1HUTH 3GDUA 4TY6A 3SV2H 1S85A 3SGAE 3RXOA 1SLVB 1S83A 3LGYA 5LPRA 1BB0B 2CGAA 1HCGA 3TJVA 2TGAA 1SQTA 2J2UA 2QXGA 4AG1A 1O30A 2GP9B 1C5PA 1GHYH 2A4QA 1T32A 4BNRA 1DWDH 2ASUB 3M5NA 5EQRA 1NRPH 4H42U 2ZGBH 4YLQH 2BD8A 3EA7A 3BTHE 4NFEA 2PTNA 1HAZB 1CE5A 2ZCLP 4O9VA 1LPZB 1K1IA 2BQWB 4YT6H 2RA0A 3BF6H 1HAYB 1Q31A 1LPKB 4Y7AA 3AASA 1BIOA 3TNTA 4NGAH 3KIDU 3SNAA 4NSYA 3LGUA 1K9OE 5DK1A 4DJZB 2F9PA 3T27A 6LPRA 4ABHA 1N1LA 5EPYA 1O2TA 2Z6BD 5I25A 1KXAA 2P3FH 1O2VA 3LKWA 1QY6A 2GT8A 3SORA 4A92A 2XXLA 4U01A 3P8OA 3F68H 1A7SA 1SG8B 3ATLA 1DUAA 1EPTA 1G3BA 3P8FA 1O2IA 4TPYA 4MG3A 2A2QH 1C1MA 2J92A 3VFEA 1K1MA 4LXBH 1TGSZ 1PPBH 2QY0B 3MU4A 4UEHH 1IHTH 1LVBA 5GPIB 4XSKU 3SNEA 3V0XA 1O32A 2OXSA 2XBVA 3FVFB 2PR3A 1N6YA 1NZQH 1FUJA 4SGBE 1SMFE 1IQLA 1BTXA 3AAVA 1ANBA 1A2CH 3NXPA 2BOHB 3FFGA 2UUYA 2FTMA 1V2TT 1QR3E 3PMBB 4X8SH 2ZDKA 1ANCA 5EXNA 1OWJA 1MKWK 2BVXH 2HNTC 4BTIB 1A3EH 2HRVA 1GI5A 1SLUB 2SNVA 1C5RA 1QRWA 3MNBA 3TK5A 1BUIA 1YCPH 1D9IA 1TLDA 2OTVA 1MU6B 3BEFB 2SGPE 1GBAA 3A7ZA 1FI8A 4AZ2B 1O5AB 2ALPA 3PO1B 2O9QA 3U9AH 1E35B 2H5CA 3K65B 4I31A 2OUAA 2VIDA 1O2ZA 4GVUA 4Y79A 1A1RA 4K2YA 1TRYA 1HNEE 1HJAB 1QJ1B 2ZTZA 3M5MA 1WSSH 3VGCB 1O36A 3ZVCA 1IHSH 2D1JA 1F5KU 2ESTE 2Z9IA 3EDXB 1Z8JB 5DP7A 5C1UA 1GI6A 3HKJB 4ZHAA 1VITH 3A81A 2WPMS 3D65E 3TVJB 2IOTA 1MKXK 2PSXA 4TWWA 1P9SA 3SN8A 2P3TB 3KN2A 2FP7B 4X6OA 5F8ZA 4JYTA 4UFFH 1NT1A 4HZHA 2WUCA 4WY3A 5A0CA 1P0SH 2HNTE 1O5FH 1CA0B 2EI8A 3C27B 1OWHA 2O8UA 4E7RG 5GCHF 1MKWH 3U8TH 1GDQA 1CT2E 4YT7H 2J95A 5DGJA 1HPGA 2VWNA 1GJBB 1VZQH 1Y8TA 1MBQA 1V2NT 3T26A 2TIOA 4CBNA 4Z6AH 4PROA 3A83A 4KTSA 3UTUH 1NRQH 3RXMA 3L6PA 2BXTH 5ESTE 4MPWA 2GKVE 1TIOA 1W0ZU 3GY2A 1EXFA 1ARCA 3RXVA 2STAE 3GCOA 1LTOA 3R3GB 5A0BA 1NRSH 3LH3A 3SUDA 1VJ9U 1GBMA 1CVWH 4NWLA 4M7GA 1FY3A 5JBTA 3S9BA 3Q77A 4MNWA 1OYTH 1QB9A 1T8NA 2YNBA 2GTBA 1QCPA 4DVAU 1GJ4H 1UVSH 1PPGE 2FYQA 1BMAA 5DPAA 2FX6A 1NPMA 3LOXA 4E05H 2OQUA 2XCFA 1O2LA 1E34B 2D26C 3O8RA 2GX4A 1ANEA 1THSH 4H4FA 3H7OA 1XVMA 1ESBA 1V2OT 2ZFPH 2UWLA 1O5BB 1ACBE 1V2VT 1XUGA 4DURA 1PYTC 1KLJH 3A8AA 2ZGHA 1TX6A 1P2QA 2ZKSA 1V2MT 3EA8A 2PSYA 5G4BA 3SV8A 1GI9B 4BAMB 1C2IA 1A4WH 4AORA 1DX5M 4D76A 4IGDA 4ZHLU 4OS2A 2YOLA 1D6WA 1BDAA 2ZDLA 1GGDB 2QXJA 1J9CH 1BTZA 3SJKA 4B2AA 3VPKA 5LPEA 1UK4A 3ZV8A 1TOMH 5ESBA 1DLKB 2A5IA 4I8JA 2UWPA 1DWEH 2G4UA 1UTOA 3SV9A 1NY22 2A7JA 2VU8E 1ZHPA 1Y5AT 1SQAA 1NU9A 2FOCA 3B8JA 3KEEA 6GCHG 2Y82A 1V2UT 3W94A 3HK3B 2I6SA 2VNTA 1FNIA 1AFQB 1L2EA 1SR5C 2W3KA 1TA2A 5EW1H 1P01A 5C1YA 4UFDH 1MU8B 1EASA 3I77A 4THNH 3KHVA 1L4DA 3RC6A 3RMOH 3PLPA 1DY8A 1DICA 2R0LA 4DY7B 3BG4C 1D3DB 1TX8A 4F49A 3MOCA 2G5VA 2CHAB 2EI7A 2GD4B 1S6FA 1O3PB 2OC7A 2FPZA 1Z8GA 1ZHRA 4WJG2 2AFQB 4ISHH 2BM2A 1JRTA 3EE0B 1ARBA 1O3IA 2QN5T 1HRTH 4E06H 1PYTD 1P2KA 2Y5HA 2D8WA 2ZFQH 3RXRA 5EQQA 3TJNA 1MMJN 1C1QA 2C8YB 4K3JA 1GBEA 4FUEA 1W7GH 1VGCC 1ZRKA 1SGCA 1C4Y2 2FI4E 1M9UA 1DXWA 4RKJB 4UE7H 1Z6JH 1P03A 1SPJA 3LDXH 4FUIA 1D3QB 4X1QU 2G4TA 3ODDA 1C2FA 2AGGX 5J4QA 2NWNA 1C5QA 4AYYB 3M3VA 1CHOG 2BY7X 1FAKH 3AW1A 4JK6A 2LPRA 4X8VH 3BTEE 3VB3A 1LKAA 4X6PA 2FLBH 1PQ7A 1O3CA 4AYVB 4ISIH 1UVUH 1C2LA 3RC5A 5DKMA 1WTGH 4DCDA 2THFB 1LHCH 3T5FH 1PQ5A 1WQSA 4OGXA 1GVKB 2BD2A 1CHOF 1YPMH 1ZSKA 1HJ9A 1EZXC 3P95A 1NC6A 3NZIA 3ITIA 2W3IA 4FU7A 1THRH 2VIWA 4KP0A 3UIRA 3U8OH 2QC2A 1J14A 1BJVA 3GICB 4GUXA 4ASHA 2BVSH 1TOCB 1AE8H 3TGJE 5BPEA 1A0LA 2XWAA 1HJ8A 3SU4A 1XUIA 2VWMA 3MO6A 1ETTH 2FEQH 3SI3H 2XCNA 1AVGH 3GCNA 5HXFA 4YOIA 1O2UA 4WH8A 2JH6D 2ZZUH 4I32A 3GISB 1LVYA 2O8MA 2BLWA 1RTKA 1B0EA 3BG8A 1D3PB 3P8GA 1AWHB 5C67A 1DDJA 4OS5A 4YESB 4GLYA 3K9XB 1RD3B 2FI5E 4Y8YA 2FODA 3SJ8A 1PPEE 2P93A 1K28D 2FS9A 4UONA 3NWUA 2QAAA 3PB1E 1G2LA 1KY9A 1TALA 1BA8B 2ANWA 1IQFA 1DUEA 4ZKNU 4X2XA 1XKBC 2BOKA 3PLKA 1ELDE 1FMGA 4KGAA 2BY8X 3P17H 1SGIB 1OWEA 1QRZA 1SGEE 1YF4A 1LHGH 3UR9A 1O5GH 1Y59T 2OC8A 3G01A 3OYPA 1O2HA 5C5NA 1O39A 1JWTA 4Y71A 3BTDE 1Q3XA 4XBCA 1GBDA 1O2KA 2WPHS 1SFIA 1MAXA 1LMWB 3RLYH 1O0DH 1BOQA 2V0BA 3OY6U 3DFJA 1PPCE 5GDSH 1E0FD 4X6NA 1DWBH 1EPTB 1FV9A 2G00A 1KTTB 2G8TA 1A61H 2OCVB 4CRFA 1NU7B 5GJ4B 1XMNB 2ZDAH 3DD2H 4O03A 4X1RU 5K0HA 3ZYDA 2ZFTA 1K1LA 3MFJA 1UTQA 1BBRK 1P3EA 5GWZA 4A1XA 4JYUH 1CT4E 2A0QB 4ABIA 2VGCB 5F8XA 4NWKA 1TQ7B 4J2YB 2RDLA 1P2MA 3LT3A 1GHAG 1K21H 1FONA 3P92A 5T6GA 4I8HA 4AN7A 2QV1A 1TWXB 3A7YA 1F5LA 2ZDVH 1AE5A 2ZDNA 3BTWE 1O3DA 4F4OC 1J17T 1AI8H 3LJOA 3UNQA 7LPRA 1UMAH 3SV6A 5T6DA 1QQUA 5LPFA 4AOQA 1GMDG 1BRCE 5E0GA 1GI2A 1ORFA 3GCTF 3VXEH 1EJMA 3RMNH 1TGNA 3U98H 3QWCH 2ZTYA 1XXDA 2BY5X 3CP7A 1UTNA 3I29A 2GCTC 3BTKE 1O3OA 1AHTH 1V2PT 1T8OA 3ZZ3A 1TA6A 1CGHA 2A7CA 2SGAA 3LH1A 2ZFSA 1F92A 1HXEH 4KTUA 5A8YA 1HB0B 3FZDA 1F2SE 1DE7H 1HAVA 1AD8H 3S9AA 1HBTH 3RP2A 1L0ZA 1WTHD 2GZ9A 1P2NA 5BRRE 3KQEA 1DFPA 1ZTLA 1LO6A 1ZZZA 4U30A 4CREA 1Z1IA 1TPOA 4WXIA 1AGJA 4A6LA 2PGQB 3ZVGA 3SNBA 4X2YA 1FIWA 1TQ0B 2OQ5A 3E91A 3OSYA 3RM2H 2Z3DA 2AERH 5CHAC 1EX3A 4FUCA 2M5TA 1BBRH 5CMXH 1UVOA 3E16B 2PTCE 4AGKA 1GHWH 3RXBA 1DWCH 3GCHC 4YZUA 3DHKH 2XBXA 3NPSA 3DUXH 1QURH 3FP8E 1TABE 1ZHMA 1MTNB 2XYAA 3K2UA 2P8OB 4FXGH 1C2KA 2AMPA 3GY6A 1BMMH 4RN6A 3SQHE 1GL1A 1P2JA 1C1NA 1Y5BT 3C1KA 1CBWC 1Y3YA 3BIUH 5IYTA 5E0HA 3ATKA 2C8ZB 1O31A 1C2JA 4NSVA 1C2GA 1QBVH 1YM0A 3PTBA 1GMHG 5AFYH 1L1GA 5JBBS 3MH4A 1CQQA 1ELGA 1S81A 3F9HA 3RXTA 2GMTC 3RXAA 5JB8S 1W0YH 3V7TA 4NA7A 2ZA5A 4X1PU 2HLCA 2VIOA 1TNHA 1K1JA 4MNXA 4R8TB 1GJAB 1QQ4A 2QYIA 3ESTA 4YO9A 4O97A 2XWBI 2HPPH 2GZ7A 1MUEB 1GJDB 3RDZA 5L30H 2BMGB 1GMHF 3MMGA 4CR5A 4IN1A 2V3OH 4ZXYH 3E6PH 7ESTE 1GMCG 5DP6A 1HXFH 3FANA 3QO6A 1TGBA 1LQDB 1HAHH 1P3CA 1O2PA 3SJOA 3RM0H 1Y5UT 1YC0A 2ZPSA 4AFUA 2ZGCA 2V6NA 1E37B 1GI8B 5DP8A 1KLTA 4CR9A 1QL9A 2RA3A 4H6TA 2ZF0H 4Y10E 3V12A 2WUBA 3LU9B 1F0SA 2A31A 1RS0A 1MQ6A 2Z9JA 2BD3A 5E2PA 4Y0ZE 1XUFA 3ZVFA 1BTWA 2Y81A 1F0UA 1W8BH 4WH6A 2BHGA 1RJXB 4ZMAH 1C1VH 1FAXA 1C5OH 1GPZA 2AIPA 3E0PB 2BDGA 3AVZA 3D23A 1IQGA 5ETXA 1DITH 1F0RA 1O2SA 5T6FA 4Y11E 3PROA 3HKIB 1VR1H 5DP3A 1MZDA 3TU7H 3IG6B 1P2OA 4MDSA 3M5LA 5JYIA 2F9NA 1EQ9A 4Q2KA 1AB9B 2P59A 2PLXA 3RXCA 4DIHH 4KTCA 5GIBA 2FMJA 3TH3H 1VCQA 1KXFA 2Z7FE 4JZIA 3N7OA 5FCRA 1GJ8B 3T29A 5HM9A 3MO3A 4ZH8A 9ESTA 8ESTE 4J1YA 1SHYA 1F5RA 1C2EA 2PKAA 1G37A 1CGIE 4WMDA 4K8BA 4I8GA 3PMJA 1IOEA 2AYWA 1ELEE 2UUFB 1O2WA 1QA7A 1HV7A 2SGEE 4LK4A 1PPFE 3T28A 1EP5A 2UUJB 5GXPA 1P8VC 2FOGA 1OP2A 3PLBA 3GY5A 3RUOA 2EC9H 2F91A 7GCHG 4FU9A 3OX7U 5AHGH 3VXFH 2ZG0H 1H4WA 3BV9B 1BBRE 1ABJH 3F9FA 1GBJA 3ZVEA 1TRNA 1C1PA 3SUFA 4O3TA 1WU1A 4Y8ZA 4LOYH 3LC3A 2Y5GA 3RXIA 1BMNH 3MU5A 1Z71A 2VB0A 3E0NB 5E8EH 2OC0A 1DSUA 3EYDA 1YGCH 4X2WA 3KQCA 3SNCA 1C5NH 1O2GH 3ELAH 1VJAU 1H8DH 1YYY1 3QK1A 1GCDA 4I8KA 1UTKA 2GDDA 3U8RH 4INLA 1TAWA 3SU6A 1SB1H 5C3NA 3S0NA 1ZGVA 5JDUB 2GGVB 1ZYOA 1GBKA 1GDNA 1EZQA 1V2ST 3B9FH 2FX4A 3VGCC 1C2DA 1IQEA 1O3BA 1MD8A 1QJ7B 1P11E 3BTFE 4X1SU 1UTPA 4B73A 4YOJA 1HLTH 1A46H 2JH5D 4ABGA 1MKXH 3ZZCA 1WYKA 1W3CA 2Z3CA 2PW8H 1Y3XA 3TJUA 1C4V2 4CH2B 4MPUA 1A5IA 5JBAS 1SGRE 3CS7A 5AFZH 1UO6A 3KF2A 1DSTA 3NK8A 3A80A 4GSOA 4Y7BA 2PKSB 1CA0C 4U2WA 4Y76A 1NN6A 1H9HE 1A3BH 4IBLH 3SU0A 5EODA 2OBOA 3QUMP 2AGEX 4ZAEA 1O3HA 3ODFA 1KDQA 1ZMNA 3QTOH 4I8LA 5JPMH 4UFGH 1GG6B 1XUJA 1LVOA 2VJ1A 2TRMA 2ZU4A 5E2OA 2TGDA 1YP9A 3SU1A 2WPIS 3MTYA 1S84A 4JYVH 2ZU5A 3UY9A 1JMOH 4FUFA 1EP6A 1A0HB 5FCKA 1UK2A 1W2KH 2FS8A 4NA9H 1CA8B 4LZ1H 3KL6A 3S7HB 1UTMA 2H6MA 4ISNA 4Q7ZA 5L2YH 2XC4A 2FXRA 5HM2A 3GDSA 1AIXH 2ZEBA 2BZAA 1TGTA 1J16A 1LCYA 2A45B 5JB9S 4JZDH 3RXGA 1C5LH 4HI3A 1CSOE 1IQMA 3PTNA 4X6MA 1G32B 4K5ZA 5ABWA 4WMEA 1TFXA 3LGTA 1DM4B 1FY8E 4XOJA 4B71A 1EAXA 6GCHF 3SJ9A 1F0TA 1AZZA 1DS2E 2XC5A 1ZSJA 1TMUH 2H5DA 1QNJA 4X1NU 3M5OA 1O2JA 1GVLA 1NFYA 3ZZAA 3IITA 3PMAB 1O3FA 1W7XH 1MTSA 1AY6H 3M35A 4NG9H 4YLUA 1QHRB 3KCGH 3F9EA 4BTTB 1BTYA 1CGJE 1EJNA 1UK3A 2ZQ1A 1TONA 1SGYE 2Y80A 1YPHE 4BANB 4D9QA 1GGDC 1KIGH 3Q3YA 3E1XB 1XKAC 2UWOA 3M3TA 4UDWH 4Q7XA 1T31A 1ELTA 4I33A 6CHAB 1TE0A 3E8LA 3ZZDA 3MYWA 4Y0YE 1JBUH 1O37A 1GVZA 2GCHG 3M3SA 3UQVA 4AB9A 8KME2 2RCEA 2A32A 1KSNA 4WF8A 5B6OA 2H2ZA 4Y8XA 1ZMLA 1B0FA 1UTJA 3P8NA 1FJSA 3Q3XA 1ZMJA 4CHAB 2A1DB 2VINA 2STBE 2ZHEH 3HK6B 4BOHA 1GCTC 4BTUB 2PUXB 3TPIZ 3HATH 5LH8A 1G36A 4Q7YA 2OP9A 1BRBE 1V2JT 4BAHB 1LHDH 3E90B 1AFQC 2BQ6B 2ULLA 1LHFH 2B9LA 5DO4H 3UNSA 2GV6A 1HAVB 1JRSA 3OTJE 1XUKA 5T3HA 2ZHFH 3QX5H 3ZZ5A 3SW2B 2Y7ZA 4D7GA 1HAPH 4H6SB 1ZJDA 2Z9LA 1QB1A 3LPRA 1N8OB 3LGVA 4ABAA 3S69A 3RXPA 3GY7A 5EXLA 3MO9A 2PHBA 2CHAC 2FTLE 4BXWA 5DP5A 1B5GH
chains in the Genus database with same CATH superfamily
1DLEA 2OC1A 1YPGH 1BHXB 3M7QA 3NKKA 3A82A 1BTHH 2WV4A 3A7TA 1ETSH 3QGJA 3SGBE 1HDTH 3WWFA 5DG6A 2ZECA 1V2KT 4K69A 3S7KB 4FUJA 3OY5U 3HGPA 2BQ7B 2Q6FA 2ZPRA 2DE9A 2FOFA 5H4IB 1C9TA 2YMSB 4RT0A 1KXCA 1Z1JA 2SGFE 1NESE 2Y5FA 4ZKRU 1K22H 1EJAA 3RXSA 3ZZBA 1GHVH 1ESAA 4IC6A 2XTTB 2PV9B 2ZCHP 1C1UH 1IQKA 4XE4A 3RMMH 1UCYK 4YTAA 4VGCB 2BYAX 2H9EH 2C3SA 1K2I1 4UD9H 2BX3A 2BD5A 2QXHA 3NUMA 1VITG 2SGDE 1RGQA 8GCHG 1SLWB 5FHTA 1FZZA 2W26A 1T8MA 2A5AA 3D49H 3V3MA 1OWDA 1RIWB 2WZQA 2ZO3H 4MNYA 3GY8A 1DXPA 1GJ6A 3A89A 4P00A 2GVFA 1ZR0A 4MQAA 5K7RA 4CRAA 1VITF 4HG6A 1QRXA 4ISOA 1JOUB 2ZHDA 2ODQA 1T4UH 1IQIA 1TMTH 1YPEH 2C8WB 1QL8A 2CF9H 3V13A 3MU8A 3RXQA 3D62A 2R0KA 3K6YA 2WPKS 5T1VA 1GBCA 4NIWA 1MH0A 1OPHB 1HGTH 1Z7KA 2JETB 3UUZA 3JZ2B 2KCOA 4GAWA 4AX9H 4WMFA 5I46H 2Z9KA 1S82A 1LDTT 4CRGA 3DSPA 1YPKH 1W12U 1F7ZA 3SOSA 1GJCB 3BTGE 1MCVA 1ZPCA 2ZTXA 5C20A 3UOUA 4IMZA 5EU8A 2G81E 1C5YB 1AKSA 3F6UH 5KGOA 3ZV9A 1V2WT 1CU1A 4IW4E 3U1IB 1TBQH 3RC4A 1L4ZA 1HFDA 3T62A 5DP9A 5SGAE 5EPNA 1MTWA 1Y3VA 2BDCA 3ZVDA 1H9IE 5DP4A 1X7AC 1OS8A 1EB2A 1BCUH 1K1NA 4Q80A 5HKKD 1WDIA 1FLEE 1ZPBA 3N7DA 1DT2A 2NU0E 2R9PA 4KELA 1GHAF 3O8CA 8LPRA 1LKBA 1HAOH 2P95A 4K8YA 4XFQA 1V6DA 1C5MD 1GWAA 1OWKA 2Z3EA 4HFPB 4K1TA 4IN2A 3VB5A 1GI0A 1A5HA 1YLDA 1DVAH 1G30B 4NIXA 2CN0H 4Z1MD 1E38B 1T7CA 3ZVAA 4XBBA 1C2HA 1TNJA 2EA3A 5EJ1A 2PKAB 1GMDF 2QXIA 2PWXA 5HMAA 1PFXC 3RXLA 5C17A 4RT1A 3F0OA 1YLCA 2CJIA 5TJXA 3U1JB 4BAKB 3M36A 1EPTC 2GZ8A 1HIAA 2B8OH 3TGKE 1P02A 2J4IA 1ZPZA 1ZGIA 2FOAA 4GPGA 1P9UA 3PMHB 2G52A 4BAOB 1TBRH 2ZGJA 2QF4A 1W10U 1C2MA 1C5VA 3OTPA 2O8LA 3VG8A 1FN6A 4KKDA 1C5SA 1VCWA 4A5TS 4B1TA 2FM2A 2J38A 2VGCC 3M7UA 4DG4A 1O34A 2G55A 3UREA 3MU1A 4JCNA 1EB1H 2FZZA 4X0WU 2ZGXH 4U32A 1D4PB 1KTSB 2WYJA 3URDA 1GJ9B 2ANYA 3UFAA 2ZWLH 1KLIH 1WUNH 5JBCS 1ELCA 1GBTA 1RFNA 1NFUA 1YPJH 2BDAA 1ABIH 2LNCA 1O3JA 1YWUA 5F53A 3ZZ7A 4D7FA 5FAHA 1ZOMA 1G9IE 3UWJH 2QF0A 1E1RD 2J94A 2SNWA 1BT7A 3ATIA 3FOAA 2HWLB 3A88A 1UHBA 1A0JA 1TGCA 2ZNKH 3SHAH 1OSSA 1J8AA 2EQNA 2BD4A 2A4GA 1WCZA 1KXDA 2AEIH 4DOQA 1QFKH 2HLDD 4X2VA 1G3DA 3STIA 3SZNA 3PV4A 1AVXA 2F9VA 1ZTJA 2VIPA 4YM9A 2FOBA 2J5UA 4CH8B 4NFFA 1YCPK 1L1JA 2C93B 2A4OA 3SHCH 4B6EA 2ZU3A 3SI4H 2BY9X 2AMQA 3ZZ6A 1NFWA 2W7UA 1VKYA 5FPTA 3A85A 3RXDA 3TGIE 1GBIA 3SU3A 2BLOA 1G3CA 2FO9A 1YPLH 4BXSA 5TCAA 1JXPA 1Z6EA 1O2NA 1C1WH 2CV3A 2J34A 5CHBA 1ZRBA 3MU0A 1B7XB 1WV7H 1O2YA 9LPRA 1GMCF 2RG3A 4DW2U 3Q3KA 2ZDMA 2BD9A 3O8BA 1KYNA 1MTNC 4E7NA 1FX0B 1KXEA 4RI0A 1O3EA 2P8OC 2XOKD 4MPXA 1KDQB 2XBWA 3DSOA 2HALA 1Z8RA 1LPGB 3H09A 2K1QA 4B2BA 1O2MA 1NBME 1SGQE 2P16A 2SFAA 3BEIB 2KAIA 1A5GH 4QT8C 2BB4A 4CRDA 2ZU1A 1UCYE 1BHXF 1L1NA 1UVPA 2BD7A 3ATWA 3LGIA 3FP7E 1G2MA 5EW2H 2ILNA 2H9HA 4ABDA 3BTTE 1K1PA 2EY4C 5LGOA 1FXYA 1EAWA 1O38A 2FDAA 1ELVA 1O2OA 1PQ8A 1O5CB 4OS4A 1FY4A 1MCTA 2VIVA 1OP0A 1V2RT 3BTQE 3R0FA 1SBWA 1BITA 4IMQA 3VEQB 2WV9A 4OM9A 2FWWA 5CE1A 1HAIH 3BTME 1SVPA 1SGNE 2B7DH 1GL0E 1PPHE 1C5TA 1TBZH 1MTUA 1NRNH 1DANH 3TNSA 5GNDA 2I6QA 4MVNA 3SBKA 1RTFB 3SO3A 3AAUA 4DGJA 1NFXA 1WAYB 2ZI2H 2VBCA 1XXFA 1OP8A 2V35A 3CS0A 3T25A 2G5NA 1LQEA 2JH0D 1GBLA 1O3AA 4NIYA 1BTUA 1Q2WA 2Z94A 3BN9A 5HYOA 1LHEH 2Y7XA 4FUBA 3QZRA 1FPHH 3OU0A 1HYLA 1NTPA 1AO5A 3L3TA 1O2RA 2AIQA 2WYGA 3A86A 4ZUHA 2KCPA 3TITA 1EATA 2PFEA 4D8NA 4YXWD 2PUQH 3BIVH 2NU3E 1EUFA 2A5KA 1E36B 7GCHF 5DSFA 1XM1A 2BDBA 3RXHA 5GCHG 4SGAE 4MPVA 1YLNA 4XDEA 3TH2H 1TNLA 4NA8A 2IN2A 4ZROA 3UQOA 3UR6A 1FPCH 3PM3A 3MNXA 1AB9C 3PO1C 3A8CA 4FUDA 5J4SA 2ANKH 2XBYA 4AGJA 2BXUH 1D6RA 5PTPA 2F9OA 2FLRH 1OX1A 3MNSA 4JK5A 3RU4E 5C94A 3GOVB 3PRDA 5C5OA 1SHHB 1CHGA 4FVDA 4B75A 3PWCA 5TCCA 3H5CB 4GHTA 1O3KA 4ESTE 3SU2A 5L6NH 1W13U 1HJAC 4B74A 2ANMH 1SOTA 1BRUP 4AFQA 2ZQ2A 1GDUA 1H1BA 2JDID 2EI6A 1P04A 1K1OA 2AH4X 3UWIA 1EOLA 4B2CA 1QIXB 2W7SA 2F9BH 4WXVA 3RU4D 5EGMA 2AMDA 2B0FA 3RXJA 3TK6A 1CT0E 1PPZA 3UNRA 2A7HA 1D3TB 2R2MB 5F6MA 3WY8A 1TPSA 2QGRA 5A0AE 4O3UA 4OS1A 1WQVH 2G51A 1W11U 1TRMA 2VH6A 3B23B 1ELBA 2DUCA 3AK5A 1BMLA 2Q1JA 3EQ0H 1SSXA 4A7IB 2SGQE 3O8DA 1FN8A 5AF9H 2A2XH 3ZZ8A 3SGQE 1EAIA 2OLGA 3M61U 2D2DA 4INHA 3TJOA 3MH7A 4CRBA 5F8TA 4K1SA 1TX7A 3SU5A 3MH5A 4AC9A 1RXPA 1O3LA 1S6HA 5FX5A 1GI7B 1ID5H 3A8BA 4HGCA 2V3MA 2BVRH 3BG4B 1YPHC 2C8XB 2GT7A 3A7WA 1O2QA 1V2QT 2ZHQH 4FVBA 4WWYA 3ZZ4A 4TY7A 2XW9A 3PYHA 2ZIQH 1XX9A 1GHXH 2O8WA 3AW0A 5HGGA 2M2AA 1V2LT 4Z0KA 3IWMA 1G3EA 3EAJA 3LGWA 1MD7A 1TYNA 3FAOA 1MBMA 4R0IA 4RSPA 3RXFA 3SUGA 1AQ7A 1OYQA 3W95A 3UOPA 1C1RA 2R2WU 2VVVA 2WPLS 4B76A 3E3TA 4HTCH 4ABEA 2VWOA 4CBOA 1MQ5A 2C90B 3ZZ9A 2FESH 1O35A 1TB6H 4TPIZ 3TK9A 2W5EA 1ZJKA 1BJUA 1C1TA 1NS3A 1N6XA 4GCHG 4OGYA 4DIIH 2A4RA 2XNIA 4AG2A 1VGCB 1JIMA 3GY4A 3GYMA 1C5UA 4NCYA 3GDVA 3KGPA 4AFSA 1SGDE 1QGFA 1O5DH 1OXGA 1NM6A 2EEKA 1AUJA 4ZHMU 2WPDD 2F83A 2VIQA 1FIZA 3A84A 1GCTB 1GBFA 4FUGA 4GCHF 1YKTA 4NIVA 2HNTF 5L2ZH 1ELFA 1MTVA 1Y3UA 1SQRA 2PKSC 1SOZA 5KEDA 1PJPA 3EA9A 4ABBA 1SC8U 2QIQA 1NO9H 1AKSB 5A09A 3GY3A 4CRCA 1Y3WA 3F9GA 3EGKH 4ACAA 3VB4A 1UJ1A 1ELAA 4FUHA 2OBQA 4MTBA 4XD7D 1P2IA 4X8TH 4DT4A 3Q00A 1GG6C 2QF5A 3NCLA 2ODPA 4K1EA 2KCAA 2Q6GA 3RMLH 1SI5H 2UUKB 2BDYA 3K6ZA 3DA9B 1OKXA 3MNCA 1KXBA 1ZTKA 3BSQA 1QL7A 2VH0A 4JZEH 2HPQH 2HVXA 2J98A 3F2GA 3QDZB 4X8UH 1GI3A 4YOGA 1BZXE 1OWIA 1NROH 2GCHF 5FBIA 1QJ6B 3RLWH 2ODYB 4INKA 5EOKA 2ZCKP 5C2ZA 5EJLA 4JZ1A 1RRKA 2GJGA 4DT7B 1RTLA 2BLQA 2QA9E 3Q76A 5EG4A 4ZXXH 1DPOA 2ZFRH 2TGTA 4GHQA 2QCYA 1TMBH 1QA0A 1XVOA 1HIAB 1IQJA 1NRRH 3OFND 2Q6DA 5EIYA 1AFEH 3RXEA 5EQSA 3FZZA 4Y6DA 1O3MA 1P09A 4BAQB 5C1XA 2BZ6H 2NU4E 3KQDA 2ZC9H 1MZAA 5F03A 1SGPE 2GV7A 1QB6A 3KNXA 1W14U 3PV2A 1C4U2 2BY6X 2V7QD 4MNVA 5IK2D 1P10A 2KM0A 3MH6A 1MAYA 3SJIA 2ZFFH 2P3UB 2QF3A 2P94A 4TYDA 1FY5A 4IS5A 3VB7A 3T2NA 3LJJA 1WOFA 4IC5A 1O2XA 1HAGE 3TH4H 1Z8IB 4D9RA 3A8DA 2O8TA 6CHAC 2CMYA 4JMYA 4MLFB 2VVUA 2TPIZ 1C5XB 5IDKA 3M7TA 4ISLA 4OS7A 1BRAA 2Z9GA 1S0RA 2DE8A 4FU8A 3UPEA 1EOJA 1UHBB 3M37A 3S9CA 4AB8A 2BDIA 4CHAC 2FI3E 2IPHA 1O3GA 1SFQB 2ZP0H 3QZQA 3A7XA 1TNKA 1INCA 2FYRA 2HOBA 3PWBA 2PGBB 2XRCA 2AGIX 1GJ5H 3DFLA 1XUHA 3RXKA 3PRBA 4RKOB 1ETRH 4OS6A 2ZU2A 5E0JA 2FOEA 1SGFA 1JIRA 3A87A 1DOJA 1FDPA 1AU8A 2TGPZ 2FOHA 1AZ8A 1QTFA 4UFEH 2ZHWH 3ATMA 2FIRH 1S5SA 3L33A 4TWYA 2RDEA 2V3HH 8GCHF 1AMHA 2C4FH 4I7YH 4JZFH 1ZLRA 1N8OC 4F48B 3U69H 3VB6A 3TLOA 5EXMA 3OAAD 2ZPQA 2GCTB 1C1SA 1FQ3A 1H8ED 5FPYA 3RXUA 3TIUA 1EKBB 3HGNA 1FY1A 1S0QA 1DY9A 2B5TB 1O33A 1TNIA 2CXVA 1H9LB 1AN1E 2JKHA 1HAXB 3KQBA 3JZ1B 3P6ZB 1THPB 2R3UA 4ABFA 3CENA 4AFZA 1AWFH 2YMSC 1IAUA 3ZYEA 3QTVH 2VWLA 4ABJA 2H1UA 4I86A 1CO7E 5A2MH 1U6QA 2AS9A 3H7TA 2HGTH 5FX6A 2KAIB 1SLXB 1UCYH 1T8LA 1YCPM 4NZLA 1VCPA 4VGCC 2XC0A 1SL3A 5CHAB 3QN7A 1WBGB 2OD3B 4NZQA 3MI4A 1OOKB 3STJA 2J9NA 1SQOA 3DT0H 2BDHA 5DJ7A 2IJOB 3GCHB 3URCA 2WPJS 1GI1A 2WV5A 2F3CE 3SNDA 1C5ZB 3A7VA 2FOMB 2TBSA 1ANDA 3GCTG 1TPAE 3LONA 1BTPA 1RIWC 2NU2E 3F1SB 1YBWA 2YNAA 1GBBA 3QGNB 1EZUC 2WINI 2H9TH 3SQEE 4WVPE 1PQAA 1GJ7B 3ENSB 2BTCE 1H8IH 1QBNA 5AVDA 7KMEH 2F9UA 4ASUD 1SGFG 5HIYA 1CBWB 1UVTH 3BEUA 1IQHA 1BQYA 1EZSC 1LVMA 1ESTA 3FP6E 1TPPA 1ZSLA 5FXLA 4ZKSU 1J15A 1GHBG 1P06A 3QLPH 2JETC 4K60A 2GDEH 3MHWU 3HPTB 2GMTB 2NU1E 1AUTC 3GYLB 2CF8H 1IQNA 2R3YA 2BLVA 1P57B 4A1TA 1SGTA 1GHZA 2OINA 1AVWA 1GI4A 6ESTA 1GHBF 1P12E 3LIWA 3ZVBA 4ZCNA 1O3NA 2CK3D 1QBOA 1TNGA 1V3XA 5A8ZA 5FPSA 1UTLM 2ALVA 1C1OA 1P05A 3SUEA 2VVCA 2Y6TA 3RU4T 3MWIU 3P70B 1C5WB 3LC5A 5A8XA 4A1VA 2BX4A 1O5EH 1C9PA 2YMSD 1GBHA 4LZ4B 3I78A 5FBEA 1EAUA 4XBDA 1T4VH 4ZKOU 3SV7A 1HUTH 3GDUA 4TY6A 3SV2H 1S85A 3SGAE 3RXOA 1SLVB 1S83A 3LGYA 5LPRA 1BB0B 2CGAA 1HCGA 3TJVA 3NRLA 2TGAA 3MQKC 1SQTA 2J2UA 2QXGA 4AG1A 1O30A 2GP9B 1C5PA 1GHYH 2KCYA 2A4QA 1T32A 4BNRA 1DWDH 1K0HA 2ASUB 3M5NA 5EQRA 1NRPH 3KYGA 4H42U 2ZGBH 4YLQH 2BD8A 3EA7A 3BTHE 4NFEA 2PTNA 1HAZB 1CE5A 2ZCLP 4O9VA 1LPZB 1K1IA 2BQWB 4YT6H 2RA0A 3BF6H 1HAYB 1Q31A 1LPKB 4Y7AA 3AASA 1BIOA 3TNTA 4NGAH 3KIDU 3SNAA 4NSYA 3LGUA 1K9OE 5DK1A 1EFRD 4DJZB 3UB0A 2F9PA 3T27A 6LPRA 4ABHA 1N1LA 5EPYA 1O2TA 2Z6BD 5I25A 1KXAA 2P3FH 1O2VA 3LKWA 1QY6A 2GT8A 3SORA 4A92A 2XXLA 4U01A 3P8OA 3F68H 1A7SA 1SG8B 3ATLA 1DUAA 1EPTA 1G3BA 3P8FA 1O2IA 4TPYA 4MG3A 2A2QH 1C1MA 2J92A 3VFEA 3OE7D 1K1MA 4LXBH 1TGSZ 1PPBH 2QY0B 3MU4A 4UEHH 1IHTH 1LVBA 5GPIB 4XSKU 3SNEA 3V0XA 1O32A 2OXSA 2XBVA 3FVFB 2PR3A 1N6YA 1NZQH 1FUJA 4SGBE 1SMFE 1IQLA 1BTXA 3AAVA 1ANBA 1A2CH 3NXPA 2BOHB 3FFGA 2UUYA 2FTMA 1V2TT 1QR3E 3PMBB 3OEHD 4X8SH 2ZDKA 1ANCA 5EXNA 1OWJA 1MKWK 2BVXH 2HNTC 4BTIB 1YY3A 1A3EH 2HRVA 1GI5A 1SLUB 2SNVA 1C5RA 1QRWA 1KMHB 1NBMD 3MNBA 3TK5A 1BUIA 1YCPH 1D9IA 1TLDA 1MU6B 2OTVA 3BEFB 2SGPE 1GBAA 3A7ZA 1FI8A 4AZ2B 1O5AB 2ALPA 3PO1B 2O9QA 2LP6A 3U9AH 1E35B 2H5CA 3K65B 4I31A 2OUAA 2VIDA 1O2ZA 4GVUA 4Y79A 1A1RA 4K2YA 1TRYA 1HNEE 1HJAB 1QJ1B 2ZTZA 3M5MA 1WSSH 3VGCB 1O36A 3ZVCA 1IHSH 2D1JA 1F5KU 2ESTE 2Z9IA 3EDXB 1Z8JB 5DP7A 5C1UA 1GI6A 3HKJB 4ZHAA 1VITH 3A81A 2WPMS 3D65E 3W1EA 3TVJB 2IOTA 1MKXK 2PSXA 4TWWA 1P9SA 3SN8A 2P3TB 3KN2A 2FP7B 4X6OA 5F8ZA 4JYTA 4UFFH 1NT1A 4HZHA 2WUCA 4WY3A 5A0CA 4B6FA 1P0SH 2HNTE 5DN6D 1O5FH 2J98B 1CA0B 2EI8A 3C27B 1OWHA 2O8UA 4E7RG 3KYFA 5GCHF 1MKWH 3U8TH 1GDQA 1CT2E 4YT7H 2J95A 5DGJA 1HPGA 2VWNA 1GJBB 1VZQH 4P02A 1Y8TA 1MBQA 1V2NT 3T26A 4F55A 2TIOA 4CBNA 4Z6AH 4PROA 3A83A 4KTSA 3UTUH 1NRQH 3RXMA 3L6PA 2BXTH 5ESTE 4MPWA 2GKVE 1TIOA 1W0ZU 3GY2A 1EXFA 1ARCA 3RXVA 2STAE 3GCOA 1LTOA 3R3GB 5A0BA 1NRSH 3LH3A 2PP6A 3SUDA 1VJ9U 1GBMA 1CVWH 4NWLA 4M7GA 1FY3A 5JBTA 3S9BA 3Q77A 4MNWA 1OYTH 1QB9A 1T8NA 2YNBA 2GTBA 1W0JD 1QCPA 4DVAU 1GJ4H 1UVSH 1PPGE 2FYQA 1BMAA 5DPAA 2FX6A 1NPMA 3LOXA 4E05H 2OQUA 5HIZA 4XRNA 3F2FA 2XCFA 1O2LA 1E34B 2D26C 3O8RA 2GX4A 1QZ8A 1ANEA 1THSH 4H4FA 3H7OA 1XVMA 1ESBA 1V2OT 2ZFPH 2UWLA 1O5BB 1ACBE 1V2VT 3F2HA 1XUGA 4DURA 2W6ID 1PYTC 1KLJH 3A8AA 2ZGHA 1TX6A 1P2QA 2ZKSA 1V2MT 3WW7A 1H8HD 2PSYA 3EA8A 4Q4LA 5G4BA 3SV8A 1GI9B 4BAMB 1C2IA 1A4WH 4AORA 1DX5M 4D76A 4IGDA 4ZHLU 4OS2A 2YOLA 1D6WA 1BDAA 2ZDLA 1GGDB 2QXJA 1J9CH 3EE7A 1BTZA 3SJKA 4B2AA 3VPKA 5LPEA 1UK4A 3ZV8A 1TOMH 5ESBA 1DLKB 2A5IA 4I8JA 2UWPA 1DWEH 2G4UA 1UTOA 3SV9A 2L74A 1NY22 2A7JA 2VU8E 2F4LA 1ZHPA 1Y5AT 1SQAA 1NU9A 3GS9A 2FOCA 3B8JA 3KEEA 6GCHG 2Y82A 1V2UT 3W94A 3HK3B 2I6SA 2VNTA 1FNIA 1AFQB 1L2EA 1SR5C 2QE7D 2W3KA 3FO8D 1TA2A 5EW1H 1P01A 5C1YA 4UFDH 1MU8B 1EASA 3I77A 4THNH 3KHVA 1L4DA 3RC6A 3RMOH 3PLPA 1DY8A 1DICA 2KZ4A 2R0LA 2WSSD 4DY7B 3BG4C 1D3DB 1TX8A 4F49A 3MOCA 2G5VA 2CHAB 2EI7A 2GD4B 1S6FA 1O3PB 2OC7A 2FPZA 1Z8GA 1ZHRA 4WJG2 2AFQB 4ISHH 2BM2A 1JRTA 3EE0B 1ARBA 1O3IA 2QN5T 1HRTH 4E06H 1PYTD 1P2KA 2Y5HA 2D8WA 2ZFQH 3RXRA 5EQQA 3TJNA 1MMJN 1C1QA 2C8YB 4K3JA 1GBEA 4FUEA 1W7GH 1VGCC 1ZRKA 1SGCA 1C4Y2 2FI4E 1M9UA 1DXWA 4RKJB 4UE7H 1Z6JH 1P03A 1SPJA 3LDXH 4FUIA 1D3QB 4X1QU 2G4TA 3ODDA 1C2FA 2AGGX 5J4QA 2NWNA 1C5QA 4AYYB 3M3VA 1CHOG 2BY7X 1FAKH 3AW1A 4JK6A 2LPRA 4X8VH 3BTEE 3VB3A 1LKAA 4X6PA 2FLBH 1PQ7A 1O3CA 4AYVB 4ISIH 1UVUH 1C2LA 3RC5A 5DKMA 1WTGH 4DCDA 2THFB 1LHCH 3T5FH 1PQ5A 3DSGA 1WQSA 4OGXA 1GVKB 2BD2A 1CHOF 1YPMH 1ZSKA 1HJ9A 4ACBA 1EZXC 3P95A 1NC6A 3UAIC 3NZIA 3ITIA 2W3IA 4FU7A 1THRH 2VIWA 2K0QA 4KP0A 3UIRA 3U8OH 2QC2A 1J14A 1BJVA 3GICB 4GUXA 4ASHA 2BVSH 1TOCB 1AE8H 3TGJE 5BPEA 1A0LA 2XWAA 1HJ8A 3SU4A 1XUIA 2VWMA 3MO6A 1ETTH 2FEQH 3SI3H 2XCNA 1AVGH 3GCNA 5HXFA 4YOIA 1O2UA 4WH8A 2JH6D 2ZZUH 4I32A 3GISB 1LVYA 2O8MA 2BLWA 1RTKA 1B0EA 3BG8A 1D3PB 3P8GA 1AWHB 5C67A 1DDJA 4OS5A 4YESB 4GLYA 3K9XB 1RD3B 2FI5E 4Y8YA 2FODA 3SJ8A 1PPEE 2P93A 1K28D 2FS9A 4UONA 3NWUA 2QAAA 3PB1E 1G2LA 1KY9A 1TALA 1BA8B 2ANWA 1IQFA 1DUEA 4ZKNU 4X2XA 1XKBC 2BOKA 3PLKA 1ELDE 1FMGA 4KGAA 2BY8X 3P17H 1SGIB 1OWEA 1QRZA 1SGEE 5FL7D 1YF4A 1LHGH 3UR9A 1O5GH 1Y59T 2OC8A 3G01A 3OYPA 1O2HA 5C5NA 1O39A 3SYJA 1JWTA 4Y71A 3BTDE 1Q3XA 4XBCA 1GBDA 1O2KA 2WPHS 1SFIA 1MAXA 1LMWB 3RLYH 1O0DH 1BOQA 2V0BA 3OY6U 3DFJA 1PPCE 5GDSH 1E0FD 1WXRA 4X6NA 3N99A 1DWBH 1EPTB 1FV9A 2G00A 1KTTB 2G8TA 1A61H 2OCVB 4CRFA 1NU7B 5GJ4B 5CDFE 1XMNB 2ZDAH 3DD2H 4O03A 4X1RU 5K0HA 3ZYDA 2AHME 2ZFTA 1K1LA 3MFJA 1UTQA 1BBRK 1P3EA 5GWZA 4A1XA 4JYUH 1CT4E 2KFWA 2A0QB 4ABIA 2VGCB 5F8XA 5B6LA 4NWKA 1TQ7B 4J2YB 2RDLA 1P2MA 3LT3A 1GHAG 1K21H 1FONA 3P92A 5T6GA 4I8HA 4AN7A 2QV1A 1TWXB 2OK5A 3A7YA 1F5LA 2ZDVH 1AE5A 2ZDNA 3BTWE 1O3DA 4F4OC 3FN8A 3KQ5A 1J17T 1AI8H 3LJOA 3UNQA 7LPRA 1UMAH 3SV6A 5T6DA 1QQUA 5LPFA 4AOQA 1GMDG 1BRCE 5E0GA 1GI2A 1ORFA 3GCTF 3VXEH 1EJMA 3RMNH 1TGNA 3U98H 2IPQX 3QWCH 4FETA 2ZTYA 1XXDA 2BY5X 3CP7A 1UTNA 3I29A 2GCTC 3BTKE 1O3OA 1AHTH 1V2PT 1T8OA 3ZZ3A 1TA6A 1CGHA 2A7CA 2SGAA 3LH1A 2ZFSA 1F92A 1HXEH 4KTUA 5A8YA 1HB0B 3FZDA 1F2SE 1DE7H 1HAVA 1AD8H 3S9AA 1HBTH 3RP2A 1L0ZA 1WTHD 2GZ9A 1P2NA 5BRRE 3KQEA 1DFPA 1ZTLA 1LO6A 1ZZZA 3CNRA 4U30A 4CREA 1Z1IA 1TPOA 4WXIA 1AGJA 4A6LA 2PGQB 3ZVGA 3SNBA 4X2YA 1FIWA 1TQ0B 1BMFD 2OQ5A 3E91A 3OSYA 3RM2H 2Z3DA 2AERH 5CHAC 1EX3A 4FUCA 2M5TA 1BBRH 5CMXH 1UVOA 3E16B 2PTCE 4AGKA 1GHWH 3RXBA 1DWCH 3GCHC 4YZUA 3DHKH 2XBXA 3NPSA 3DUXH 1QURH 3FP8E 1TABE 1ZHMA 1MTNB 2XYAA 3K2UA 2KR7A 2P8OB 4FXGH 1C2KA 2AMPA 3GY6A 1BMMH 4RN6A 3SQHE 1GL1A 2LELA 1P2JA 1C1NA 1OHHD 1Y5BT 3C1KA 1CBWC 1Y3YA 3BIUH 5IYTA 5E0HA 3ATKA 1E1QD 2C8ZB 1O31A 1C2JA 4NSVA 1C2GA 1QBVH 1YM0A 3PTBA 1GMHG 5AFYH 1L1GA 5JBBS 3MH4A 1CQQA 1ELGA 1S81A 3F9HA 3RXTA 2GMTC 3RXAA 5JB8S 1W0YH 3V7TA 4NA7A 2ZA5A 4X1PU 2HLCA 2VIOA 1TNHA 1K1JA 4MNXA 4R8TB 1GJAB 1QQ4A 2QYIA 3ESTA 4YO9A 4O97A 2XWBI 3WWBA 2F43B 2HPPH 2GZ7A 1MUEB 1GJDB 2WHXA 3RDZA 5L30H 2BMGB 1GMHF 3MMGA 4CR5A 4IN1A 2V3OH 5KECA 4ZXYH 3E6PH 7ESTE 1GMCG 4FOUC 5DP6A 1HXFH 3FANA 3QO6A 1TGBA 1LQDB 1HAHH 1P3CA 1O2PA 3SJOA 3RM0H 1Y5UT 1YC0A 2ZPSA 1COWD 4AFUA 2ZGCA 2V6NA 1E37B 1GI8B 5DP8A 1KLTA 4CR9A 2L6OA 1QL9A 2RA3A 4H6TA 2ZF0H 4Y10E 3V12A 2WUBA 3LU9B 1F0SA 2A31A 1RS0A 1MQ6A 2HVYB 2Z9JA 2BD3A 5E2PA 4Y0ZE 1XUFA 3ZVFA 1BTWA 2Y81A 1F0UA 1W8BH 4WH6A 2BHGA 1RJXB 4ZMAH 1C1VH 1FAXA 1C5OH 1GPZA 2AIPA 3E0PB 2BDGA 3AVZA 3D23A 1IQGA 5ETXA 1DITH 1F0RA 1O2SA 5T6FA 4Y11E 3PROA 3HKIB 1VR1H 5DP3A 1MZDA 3TU7H 3IG6B 1P2OA 4MDSA 3M5LA 5JYIA 2F9NA 1EQ9A 4Q2KA 1AB9B 3U28C 2KX4A 2P59A 2PLXA 3RXCA 4DIHH 4KTCA 5GIBA 2FMJA 3TH3H 1VCQA 1KXFA 2Z7FE 1SKYE 4JZIA 3N7OA 5FCRA 5EJZA 1GJ8B 3T29A 5HM9A 3MO3A 4ZH8A 9ESTA 8ESTE 4J1YA 1SHYA 1F5RA 1C2EA 2PKAA 1W0KD 1G37A 1CGIE 4WMDA 4K8BA 3SZEA 2K8IA 4I8GA 3PMJA 1IOEA 2AYWA 1ELEE 2UUFB 1O2WA 1QA7A 1HV7A 2SGEE 4LK4A 1PPFE 3T28A 1EP5A 2UUJB 5GXPA 1P8VC 2FOGA 1OP2A 3PLBA 3GY5A 4TT3D 3RUOA 1S6LA 2EC9H 2F91A 4FU9A 7GCHG 3OX7U 5AHGH 3VXFH 2ZG0H 1H4WA 3BV9B 5C0TA 1BBRE 3FKSD 1E79D 1ABJH 3F9FA 1GBJA 3ZVEA 1TRNA 1C1PA 3SUFA 4O3TA 1WU1A 4Y8ZA 4LOYH 3LC3A 2Y5GA 3RXIA 1BMNH 3MU5A 1Z71A 2VB0A 3E0NB 5E8EH 2OC0A 1DSUA 3EYDA 1YGCH 4X2WA 3KQCA 3SNCA 1C5NH 1O2GH 3ELAH 1VJAU 1H8DH 1YYY1 3QK1A 1GCDA 4I8KA 1UTKA 2GDDA 3U8RH 4INLA 1TAWA 3SU6A 1SB1H 3DCLA 5C3NA 3S0NA 1ZGVA 5JDUB 2GGVB 1ZYOA 1GBKA 2RFKC 1GDNA 1EZQA 1V2ST 3B9FH 2FX4A 3VGCC 4TSFD 1C2DA 1IQEA 1O3BA 1MD8A 1QJ7B 1P11E 2W6JD 3BTFE 4X1SU 1UTPA 4B73A 4YOJA 1HLTH 1A46H 2JH5D 4ABGA 1MKXH 3ZZCA 1WYKA 1W3CA 2Z3CA 2PW8H 1Y3XA 3TJUA 1C4V2 4CH2B 4MPUA 1A5IA 3OEED 5JBAS 1SGRE 3CS7A 5AFZH 1UO6A 3KF2A 1DSTA 3NK8A 2IJD1 3A80A 4GSOA 4Y7BA 2PKSB 1CA0C 4U2WA 4Y76A 1NN6A 1H9HE 1A3BH 4IBLH 3SU0A 5EODA 2OBOA 3QUMP 2AGEX 4ZAEA 1O3HA 3ODFA 1KDQA 1ZMNA 3QTOH 4I8LA 5JPMH 4UFGH 1GG6B 1XUJA 1LVOA 2VJ1A 2TRMA 2ZU4A 2JJ1D 5E2OA 2TGDA 1YP9A 3SU1A 2WPIS 3MTYA 1S84A 4JYVH 2ZU5A 4Q63A 3UY9A 1JMOH 4FUFA 1EP6A 1A0HB 5FCKA 1UK2A 1W2KH 2FS8A 4NA9H 1CA8B 4LZ1H 3KL6A 3S7HB 1UTMA 2H6MA 4ISNA 4Q7ZA 5L2YH 2XC4A 2FXRA 5HM2A 3GDSA 1AIXH 2ZEBA 2BZAA 1TGTA 1J16A 1LCYA 2A45B 5JB9S 4JZDH 3RXGA 1C5LH 4HI3A 1CSOE 1IQMA 3PTNA 4X6MA 1G32B 2XNDD 4K5ZA 5ABWA 4WMEA 1TFXA 3LGTA 1DM4B 1FY8E 4XOJA 4B71A 2J97A 1EAXA 6GCHF 3SJ9A 1F0TA 1MABB 3F0PA 1AZZA 1DS2E 2XC5A 1ZSJA 1TMUH 2H5DA 1QNJA 4X1NU 3M5OA 3F3BA 1O2JA 1GVLA 2JJ2D 1NFYA 3ZZAA 3IITA 3PMAB 1O3FA 1W7XH 1MTSA 1AY6H 3PV5A 2JIZD 3M35A 4NG9H 4YLUA 1QHRB 3KCGH 3F9EA 4BTTB 1BTYA 1CGJE 1EJNA 1UK3A 2ZQ1A 1TONA 1SGYE 2Y80A 1YPHE 4BANB 4D9QA 1GGDC 1KIGH 3Q3YA 3E1XB 3ZIAD 1XKAC 2UWOA 3M3TA 4UDWH 4Q7XA 1T31A 1ELTA 4I33A 6CHAB 1TE0A 5C0UA 3E8LA 3ZZDA 3MYWA 4Y0YE 1JBUH 1O37A 1GVZA 2GCHG 3M3SA 3UQVA 4AB9A 8KME2 2RCEA 1UW7A 2A32A 1KSNA 4WF8A 5B6OA 2H2ZA 4Y8XA 1ZMLA 1B0FA 1UTJA 3P8NA 1FJSA 3Q3XA 1ZMJA 4CHAB 2A1DB 2VINA 4M9FA 2STBE 2ZHEH 3HK6B 4BOHA 1GCTC 4BTUB 2PUXB 3TPIZ 3HATH 5LH8A 1G36A 4Q7YA 2OP9A 1BRBE 1V2JT 4BAHB 1LHDH 3E90B 1AFQC 2BQ6B 2ULLA 1LHFH 2B9LA 5DO4H 3UNSA 2GV6A 1HAVB 1JRSA 3OTJE 1XUKA 5T3HA 2ZHFH 3QX5H 3ZZ5A 3SW2B 2Y7ZA 4D7GA 1HAPH 4H6SB 1ZJDA 2Z9LA 1QB1A 3LPRA 1N8OB 3LGVA 4ABAA 3S69A 3RXPA 3GY7A 5EXLA 3MO9A 3N7EA 2PHBA 2CHAC 2FTLE 4BXWA 5DP5A 1B5GH
chains in the Genus database with same CATH topology
1DLEA 2OC1A 1YPGH 1BHXB 3M7QA 3NKKA 3A82A 1BTHH 2WV4A 3A7TA 1ETSH 3QGJA 3SGBE 1HDTH 5DG6A 2ZECA 1V2KT 4K69A 3S7KB 4FUJA 3OY5U 3HGPA 2BQ7B 2Q6FA 2ZPRA 2DE9A 2FOFA 5H4IB 1C9TA 1KXCA 1Z1JA 2SGFE 1NESE 2Y5FA 4ZKRU 1K22H 1EJAA 3RXSA 3ZZBA 1GHVH 1ESAA 4IC6A 2XTTB 2PV9B 2ZCHP 1C1UH 1IQKA 4XE4A 3RMMH 1UCYK 4YTAA 4VGCB 2BYAX 2H9EH 2C3SA 1K2I1 4UD9H 2BX3A 2BD5A 2QXHA 3NUMA 1VITG 2SGDE 1RGQA 8GCHG 1SLWB 5FHTA 1FZZA 2W26A 1T8MA 2A5AA 3D49H 3V3MA 1OWDA 1RIWB 2ZO3H 4MNYA 3GY8A 1DXPA 1GJ6A 3A89A 2GVFA 1ZR0A 4MQAA 5K7RA 4CRAA 1VITF 1QRXA 4ISOA 1JOUB 2ZHDA 2ODQA 1T4UH 1IQIA 1TMTH 1YPEH 2C8WB 1QL8A 2CF9H 3V13A 3MU8A 3RXQA 3D62A 2R0KA 3K6YA 2WPKS 1GBCA 4NIWA 1MH0A 1OPHB 1HGTH 1Z7KA 2JETB 3UUZA 3JZ2B 4GAWA 4AX9H 4WMFA 5I46H 2Z9KA 1S82A 1LDTT 4CRGA 1YPKH 1W12U 1F7ZA 3SOSA 1GJCB 3BTGE 1MCVA 1ZPCA 2ZTXA 5C20A 3UOUA 4IMZA 5EU8A 2G81E 1C5YB 1AKSA 3F6UH 3ZV9A 1V2WT 1CU1A 4IW4E 3U1IB 1TBQH 3RC4A 1L4ZA 1HFDA 3T62A 5DP9A 5SGAE 5EPNA 1MTWA 1Y3VA 2BDCA 3ZVDA 1H9IE 5DP4A 1X7AC 1OS8A 1EB2A 1BCUH 1K1NA 4Q80A 1FLEE 1ZPBA 1DT2A 2NU0E 2R9PA 4KELA 1GHAF 3O8CA 8LPRA 1LKBA 1HAOH 2P95A 4K8YA 4XFQA 1V6DA 1C5MD 1GWAA 1OWKA 2Z3EA 4HFPB 4K1TA 4IN2A 3VB5A 1GI0A 1A5HA 1YLDA 1DVAH 1G30B 4NIXA 2CN0H 1E38B 1T7CA 3ZVAA 4XBBA 1C2HA 1TNJA 2EA3A 2PKAB 1GMDF 2QXIA 2PWXA 5HMAA 1PFXC 3RXLA 1YLCA 2CJIA 5TJXA 3U1JB 4BAKB 3M36A 1EPTC 2GZ8A 1HIAA 2B8OH 3TGKE 1P02A 1ZPZA 2J4IA 1ZGIA 2FOAA 4GPGA 1P9UA 3PMHB 2G52A 4BAOB 1TBRH 2ZGJA 1W10U 1C2MA 1C5VA 2O8LA 1FN6A 4KKDA 1C5SA 1VCWA 4A5TS 4B1TA 2FM2A 2J38A 2VGCC 3M7UA 4DG4A 1O34A 2G55A 3UREA 3MU1A 4JCNA 1EB1H 2FZZA 4X0WU 2ZGXH 4U32A 1D4PB 1KTSB 2WYJA 3URDA 1GJ9B 2ANYA 3UFAA 2ZWLH 1KLIH 1WUNH 5JBCS 1ELCA 1GBTA 1RFNA 1NFUA 1YPJH 2BDAA 1ABIH 2LNCA 1O3JA 4D7FA 3ZZ7A 5FAHA 1ZOMA 1G9IE 3UWJH 2QF0A 2J94A 2SNWA 1BT7A 3ATIA 2HWLB 3A88A 1UHBA 1A0JA 1TGCA 2ZNKH 3SHAH 1OSSA 1J8AA 2BD4A 2A4GA 1WCZA 1KXDA 2AEIH 4DOQA 1QFKH 4X2VA 1G3DA 3STIA 3SZNA 3PV4A 1AVXA 2F9VA 1ZTJA 2VIPA 4YM9A 2FOBA 4CH8B 4NFFA 1YCPK 1L1JA 2C93B 2A4OA 3SHCH 2ZU3A 3SI4H 2BY9X 2AMQA 3ZZ6A 1NFWA 2W7UA 5FPTA 3A85A 3RXDA 3TGIE 1GBIA 3SU3A 2BLOA 1G3CA 2FO9A 1YPLH 4BXSA 5TCAA 1JXPA 1Z6EA 1O2NA 1C1WH 2CV3A 2J34A 1ZRBA 3MU0A 1B7XB 1WV7H 1O2YA 9LPRA 1GMCF 2RG3A 4DW2U 3Q3KA 2ZDMA 2BD9A 3O8BA 1KYNA 1MTNC 4E7NA 1KXEA 1O3EA 2P8OC 4MPXA 1KDQB 2XBWA 2HALA 1Z8RA 1LPGB 2K1QA 4B2BA 1O2MA 1SGQE 2P16A 2SFAA 3BEIB 2KAIA 1A5GH 4QT8C 2BB4A 4CRDA 2ZU1A 1UCYE 1BHXF 1L1NA 1UVPA 2BD7A 3ATWA 3LGIA 3FP7E 1G2MA 5EW2H 2ILNA 2H9HA 4ABDA 3BTTE 1K1PA 5LGOA 1FXYA 1EAWA 1O38A 2FDAA 1ELVA 1O2OA 1PQ8A 1O5CB 4OS4A 1FY4A 1MCTA 2VIVA 1OP0A 1V2RT 3BTQE 3R0FA 1SBWA 1BITA 4IMQA 3VEQB 2FWWA 5CE1A 1HAIH 3BTME 1SVPA 1SGNE 2B7DH 1GL0E 1PPHE 1C5TA 1TBZH 1MTUA 1NRNH 1DANH 3TNSA 2I6QA 4MVNA 3SBKA 1RTFB 3SO3A 3AAUA 4DGJA 1NFXA 1WAYB 2ZI2H 1XXFA 1OP8A 2V35A 3CS0A 3T25A 2G5NA 1LQEA 2JH0D 1GBLA 1O3AA 4NIYA 1BTUA 1Q2WA 2Z94A 3BN9A 5HYOA 1LHEH 2Y7XA 4FUBA 3QZRA 1FPHH 3OU0A 1HYLA 1NTPA 1AO5A 3L3TA 1O2RA 2AIQA 2WYGA 3A86A 4ZUHA 3TITA 1EATA 2PFEA 4D8NA 2PUQH 3BIVH 2NU3E 1EUFA 2A5KA 1E36B 7GCHF 1XM1A 2BDBA 3RXHA 5GCHG 4SGAE 4MPVA 4XDEA 3TH2H 1TNLA 4NA8A 2IN2A 4ZROA 3UQOA 3UR6A 1FPCH 3PM3A 3MNXA 1AB9C 3PO1C 3A8CA 4FUDA 5J4SA 2ANKH 2XBYA 4AGJA 2BXUH 1D6RA 5PTPA 2F9OA 2FLRH 1OX1A 3MNSA 4JK5A 3RU4E 3GOVB 5C5OA 1SHHB 1CHGA 4FVDA 4B75A 3PWCA 5TCCA 3H5CB 4GHTA 1O3KA 4ESTE 3SU2A 5L6NH 1W13U 1HJAC 4B74A 2ANMH 1SOTA 1BRUP 4AFQA 2ZQ2A 1GDUA 1H1BA 2EI6A 1P04A 1K1OA 2AH4X 3UWIA 1EOLA 4B2CA 1QIXB 2W7SA 2F9BH 4WXVA 3RU4D 5EGMA 2AMDA 2B0FA 3RXJA 3TK6A 1CT0E 1PPZA 3UNRA 2A7HA 1D3TB 2R2MB 5F6MA 3WY8A 1TPSA 2QGRA 5A0AE 4O3UA 4OS1A 1WQVH 2G51A 1W11U 1TRMA 2VH6A 3B23B 1ELBA 2DUCA 1BMLA 2Q1JA 3EQ0H 1SSXA 4A7IB 2SGQE 3O8DA 1FN8A 5AF9H 2A2XH 3ZZ8A 3SGQE 1EAIA 2OLGA 3M61U 2D2DA 4INHA 3TJOA 3MH7A 4CRBA 5F8TA 4K1SA 1TX7A 3SU5A 3MH5A 1RXPA 1O3LA 1S6HA 5FX5A 1GI7B 1ID5H 3A8BA 4HGCA 2BVRH 3BG4B 1YPHC 2C8XB 2GT7A 3A7WA 1O2QA 1V2QT 2ZHQH 4FVBA 4WWYA 3ZZ4A 4TY7A 2XW9A 3PYHA 2ZIQH 1XX9A 1GHXH 2O8WA 3AW0A 5HGGA 1V2LT 4Z0KA 3IWMA 1G3EA 3EAJA 3LGWA 1MD7A 1TYNA 3FAOA 1MBMA 4R0IA 4RSPA 3RXFA 3SUGA 1AQ7A 1OYQA 3W95A 3UOPA 1C1RA 2R2WU 2VVVA 2WPLS 4B76A 3E3TA 4HTCH 4ABEA 2VWOA 4CBOA 1MQ5A 2C90B 3ZZ9A 2FESH 1O35A 1TB6H 4TPIZ 3TK9A 2W5EA 1ZJKA 1BJUA 1C1TA 1NS3A 1N6XA 4GCHG 4OGYA 4DIIH 2A4RA 2XNIA 4AG2A 1VGCB 1JIMA 3GY4A 3GYMA 1C5UA 4NCYA 3GDVA 3KGPA 4AFSA 1SGDE 1QGFA 1O5DH 1OXGA 1NM6A 2EEKA 1AUJA 4ZHMU 2F83A 2VIQA 1FIZA 3A84A 1GCTB 1GBFA 4FUGA 4GCHF 1YKTA 4NIVA 2HNTF 5L2ZH 1ELFA 1MTVA 1Y3UA 2PKSC 1SOZA 1PJPA 3EA9A 4ABBA 1SC8U 2QIQA 1NO9H 1AKSB 5A09A 3GY3A 4CRCA 1Y3WA 3F9GA 3EGKH 3VB4A 1UJ1A 1ELAA 4FUHA 2OBQA 4MTBA 1P2IA 4X8TH 3Q00A 1GG6C 3NCLA 2ODPA 4K1EA 2Q6GA 3RMLH 1SI5H 2UUKB 2BDYA 3K6ZA 3DA9B 1OKXA 3MNCA 1KXBA 1ZTKA 3BSQA 1QL7A 2VH0A 4JZEH 2HPQH 2HVXA 3QDZB 4X8UH 1GI3A 4YOGA 1BZXE 1OWIA 1NROH 2GCHF 5FBIA 1QJ6B 3RLWH 2ODYB 4INKA 5EOKA 2ZCKP 5C2ZA 4JZ1A 1RRKA 4DT7B 1RTLA 2BLQA 2QA9E 3Q76A 5EG4A 4ZXXH 1DPOA 2ZFRH 2TGTA 4GHQA 2QCYA 1TMBH 1QA0A 1XVOA 1HIAB 1IQJA 1NRRH 2Q6DA 1AFEH 3RXEA 5EQSA 3FZZA 4Y6DA 1O3MA 1P09A 4BAQB 5C1XA 2BZ6H 2NU4E 3KQDA 2ZC9H 1MZAA 5F03A 1SGPE 2GV7A 1QB6A 3KNXA 1W14U 1C4U2 2BY6X 4MNVA 1P10A 3MH6A 1MAYA 3SJIA 2ZFFH 2P3UB 2QF3A 2P94A 4TYDA 1FY5A 4IS5A 3VB7A 3T2NA 3LJJA 1WOFA 4IC5A 1O2XA 1HAGE 3TH4H 1Z8IB 4D9RA 3A8DA 2O8TA 6CHAC 2CMYA 4JMYA 4MLFB 2VVUA 2TPIZ 1C5XB 5IDKA 3M7TA 4ISLA 4OS7A 1BRAA 2Z9GA 1S0RA 2DE8A 4FU8A 3UPEA 1EOJA 1UHBB 3M37A 3S9CA 4AB8A 2BDIA 4CHAC 2FI3E 2IPHA 1O3GA 1SFQB 2ZP0H 3QZQA 3A7XA 1TNKA 1INCA 2FYRA 2HOBA 3PWBA 2PGBB 2XRCA 2AGIX 1GJ5H 3DFLA 1XUHA 3RXKA 4RKOB 1ETRH 4OS6A 2ZU2A 5E0JA 2FOEA 1SGFA 1JIRA 3A87A 1DOJA 1FDPA 1AU8A 2TGPZ 2FOHA 1AZ8A 1QTFA 4UFEH 2ZHWH 3ATMA 2FIRH 1S5SA 3L33A 4TWYA 2V3HH 8GCHF 1AMHA 2C4FH 4I7YH 4JZFH 1ZLRA 1N8OC 3U69H 3VB6A 3TLOA 5EXMA 2ZPQA 2GCTB 1C1SA 1FQ3A 5FPYA 3RXUA 3TIUA 1EKBB 3HGNA 1FY1A 1S0QA 1DY9A 2B5TB 1O33A 1TNIA 2CXVA 1H9LB 1AN1E 2JKHA 1HAXB 3KQBA 3JZ1B 3P6ZB 1THPB 2R3UA 4ABFA 3CENA 4AFZA 1AWFH 1IAUA 3ZYEA 3QTVH 2VWLA 4ABJA 2H1UA 1CO7E 5A2MH 1U6QA 2AS9A 3H7TA 2HGTH 5FX6A 2KAIB 1SLXB 1UCYH 1T8LA 1YCPM 4NZLA 1VCPA 4VGCC 2XC0A 1SL3A 5CHAB 3QN7A 1WBGB 2OD3B 4NZQA 3MI4A 1OOKB 3STJA 2J9NA 1SQOA 3DT0H 2BDHA 5DJ7A 2IJOB 3GCHB 3URCA 2WPJS 1GI1A 2WV5A 2F3CE 3SNDA 1C5ZB 3A7VA 2FOMB 2TBSA 1ANDA 3GCTG 1TPAE 3LONA 1BTPA 1RIWC 2NU2E 3F1SB 1YBWA 2YNAA 1GBBA 3QGNB 1EZUC 2WINI 2H9TH 3SQEE 4WVPE 1PQAA 1GJ7B 3ENSB 2BTCE 1H8IH 1QBNA 5AVDA 7KMEH 2F9UA 1SGFG 1CBWB 1UVTH 3BEUA 1IQHA 1BQYA 1EZSC 1LVMA 1ESTA 3FP6E 1TPPA 1ZSLA 5FXLA 4ZKSU 1J15A 1GHBG 1P06A 3QLPH 2JETC 4K60A 2GDEH 3MHWU 3HPTB 2GMTB 2NU1E 1AUTC 3GYLB 2CF8H 1IQNA 2R3YA 2BLVA 1P57B 4A1TA 1SGTA 1GHZA 2OINA 1AVWA 1GI4A 6ESTA 1GHBF 1P12E 3LIWA 3ZVBA 1O3NA 1QBOA 1TNGA 1V3XA 5A8ZA 5FPSA 1UTLM 2ALVA 1C1OA 1P05A 3SUEA 2VVCA 2Y6TA 3RU4T 3MWIU 3P70B 1C5WB 3LC5A 5A8XA 4A1VA 2BX4A 1O5EH 1C9PA 1GBHA 4LZ4B 3I78A 5FBEA 1EAUA 4XBDA 1T4VH 4ZKOU 3SV7A 1HUTH 3GDUA 4TY6A 3SV2H 1S85A 3SGAE 3RXOA 1SLVB 1S83A 3LGYA 5LPRA 1BB0B 2CGAA 1HCGA 3TJVA 2TGAA 1SQTA 2J2UA 2QXGA 4AG1A 1O30A 2GP9B 1C5PA 1GHYH 2A4QA 1T32A 4BNRA 1DWDH 2ASUB 3M5NA 5EQRA 1NRPH 4H42U 2ZGBH 4YLQH 2BD8A 3EA7A 3BTHE 4NFEA 2PTNA 1HAZB 1CE5A 2ZCLP 4O9VA 1LPZB 1K1IA 2BQWB 4YT6H 2RA0A 3BF6H 1HAYB 1Q31A 1LPKB 4Y7AA 3AASA 1BIOA 3TNTA 4NGAH 3KIDU 3SNAA 4NSYA 3LGUA 1K9OE 5DK1A 4DJZB 2F9PA 3T27A 6LPRA 4ABHA 1N1LA 5EPYA 1O2TA 2Z6BD 5I25A 1KXAA 2P3FH 1O2VA 3LKWA 1QY6A 2GT8A 3SORA 4A92A 2XXLA 4U01A 3P8OA 3F68H 1A7SA 1SG8B 3ATLA 1DUAA 1EPTA 1G3BA 3P8FA 1O2IA 4TPYA 4MG3A 2A2QH 1C1MA 2J92A 3VFEA 1K1MA 4LXBH 1TGSZ 1PPBH 2QY0B 3MU4A 4UEHH 1IHTH 1LVBA 5GPIB 4XSKU 3SNEA 3V0XA 1O32A 2OXSA 2XBVA 3FVFB 2PR3A 1N6YA 1NZQH 1FUJA 4SGBE 1SMFE 1IQLA 1BTXA 3AAVA 1ANBA 1A2CH 3NXPA 2BOHB 3FFGA 2UUYA 2FTMA 1V2TT 1QR3E 3PMBB 4X8SH 2ZDKA 1ANCA 5EXNA 1OWJA 1MKWK 2BVXH 2HNTC 4BTIB 1A3EH 2HRVA 1GI5A 1SLU