4O3UA

Zymogen hgf-beta/met with zymogen activator peptide zap2.3
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
219
structure length
219
Chain Sequence
NIGWMVSLRYRNKHICGGSLIKESWVLTARQCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLVYGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGSTIPEKTSCSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGKVTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/growth factor
molecule keywords Hepatocyte growth factor
publication title An allosteric switch for pro-HGF/Met signaling using zymogen activator peptides.
pubmed doi rcsb
source organism Homo sapiens
total genus 40
structure length 219
sequence length 219
ec nomenclature
pdb deposition date 2013-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4o3uA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4o3uA01
3SJ9A 1GBCA 2D2DA 1K1IA 2BY6X 2Z7FE 6GCHF 1D4PB 4DURA 1LKBA 4BAKB 2W26A 1VCPA 1THPB 1ZTKA 3MNSA 4OS7A 2AMDA 1H8IH 1IHTH 3O8RA 1SGRE 1W0YH 1XUFA 1V2JT 2BD7A 1P9SA 1IQNA 1ETSH 4R8TB 2TGAA 5FPSA 2ZFRH 1CGHA 1NTPA 2VB0A 3BTEE 1FN8A 4X8VH 1O37A 1GI9B 3S7KB 4GPGA 4FUDA 5DO4H 1FUJA 5JBBS 1NU7B 4X6NA 1BHXB 2OQUA 5T6GA 4NIXA 4B71A 2ANKH 3E8LA 2V3HH 2ZU4A 2BLQA 1ELAA 1V2OT 2XC5A 1J9CH 3SJIA 1KY9A 5JPMH 4D7FA 4KTSA 1A5HA 1SG8B 2BMGB 5EXMA 1PQ8A 4ZHAA 2FYRA 2VGCC 3UQOA 1D9IA 2BVRH 2OXSA 1CQQA 1C5TA 3UWJH 1HAXB 3KN2A 2W3IA 2QA9E 1RIWC 2BD3A 2AEIH 3OSYA 2CHAB 1C5PA 1BTPA 1HXEH 4TY6A 9LPRA 1AZ8A 3QGJA 4X1SU 2FOHA 2FO9A 3U69H 3DFLA 3VB7A 1TYNA 1YYY1 2FYQA 1D6WA 1BTWA 5FX6A 1GJAB 4AORA 2HPQH 2AIPA 4YLQH 4FVBA 2HRVA 4HGCA 3MH7A 2PUXB 1GJ8B 3PWCA 2ZP0H 1DANH 2QV1A 2ZU2A 5C67A 1C1RA 4WVPE 3A8BA 3KL6A 3RLYH 3SGBE 1RTFB 1EXFA 1SQOA 2ASUB 2FZZA 2FWWA 1QRXA 3MU0A 4A1XA 3B9FH 1FONA 2GZ9A 1GBBA 1MBMA 1PPZA 2TPIZ 1FN6A 4Y79A 2YNBA 2ZG0H 3MNCA 3E0PB 2ODQA 3URDA 3LONA 1GMCG 1YC0A 5E2PA 1HAOH 4ABJA 3PMJA 1C2GA 1UMAH 2ULLA 3ZZ3A 1AB9C 1BJVA 1EJAA 1ZSJA 3BTHE 3S9BA 1ZJKA 1T8OA 2R0LA 1CT4E 2RG3A 3SNBA 3T29A 1VITG 4UFEH 3S0NA 1P0SH 3BG8A 2PKAB 4GCHF 1TA2A 3SNEA 1HAZB 1JXPA 1HB0B 1IQFA 3RXGA 3CS7A 3URCA 4JYUH 6CHAC 2FP7B 3R3GB 1UK2A 1YF4A 1C1VH 1O2XA 1YCPK 5CE1A 2SNWA 3ODDA 3SN8A 3RM2H 1B7XB 1ZPZA 2IPHA 3UOPA 1SFIA 5HM9A 1W2KH 1Y3VA 5F03A 1W11U 3P6ZB 3UNQA 3PO1C 5FCKA 1F92A 1O3CA 4ZUHA 3V12A 4FUCA 4CBNA 1Y3WA 1TNGA 3HGNA 2VIDA 1TRYA 1C1WH 2HALA 5JBTA 1A7SA 2ODYB 4I8JA 3SORA 2B0FA 1FAXA 3KGPA 1KIGH 1C1NA 3IITA 1PYTD 1O5GH 3RMLH 3SU0A 2GCHG 4FUEA 2VNTA 1QA7A 5IDKA 1V2VT 5F6MA 2BD5A 1OSSA 3LH3A 4IS5A 5FPYA 4X2XA 4BTUB 3RXHA 3T5FH 3A80A 1TX7A 1Z8JB 2SGFE 1F7ZA 2W7UA 1ZRBA 1O5FH 3QDZB 1NESE 2GV7A 1DFPA 2FOFA 2FOBA 1O2QA 3KF2A 4UFDH 4WH6A 2F9UA 3BTME 4YLUA 1JOUB 3P8FA 1ZR0A 1KTTB 4MPWA 3SGAE 5DP4A 3GISB 1WQVH 3LDXH 3A7ZA 1WOFA 2WPKS 4ZKRU 6LPRA 4MDSA 4JYTA 1W7GH 1CT0E 1Z6EA 2XXLA 2B9LA 1LPZB 3V7TA 3BIVH 1KTSB 1SFQB 4B2CA 4A1VA 5AHGH 1C1OA 2J94A 3ZYDA 2C3SA 1EKBB 3S7HB 1SGNE 2K1QA 3M3SA 3MO9A 3ZZ6A 1PQ5A 1CA0B 1OWDA 3H7OA 2UUJB 5A8ZA 1DWBH 2WPJS 3M61U 4Y71A 3RXLA 1P8VC 4BTTB 1PYTC 1O2TA 1M9UA 3GYMA 1GI8B 3VPKA 4B75A 3GY7A 1P3EA 3QX5H 3PMAB 3C27B 3JZ2B 4Y8ZA 3P92A 3LPRA 1Q3XA 4FU9A 1O5BB 1G36A 3STJA 1NC6A 2BDHA 3Q00A 3GY6A 2J4IA 2CJIA 1P2QA 4AYYB 2BY5X 3GYLB 5A0AE 1H9HE 2Y6TA 4ZH8A 2G00A 3U1JB 1ZYOA 1EZQA 3M5MA 4IGDA 2BTCE 3K9XB 3RXCA 1L2EA 3KIDU 2CN0H 1C4V2 2LNCA 4DW2U 2AIQA 1G2LA 1UTNA 3GY2A 3PROA 1HAVA 3F6UH 3VXEH 2B5TB 2Z9GA 4CRAA 1UK3A 2Z3CA 3SV2H 1CGIE 1DVAH 1HAYB 3SJOA 2GVFA 1HLTH 3D62A 3QUMP 1B0EA 1ELTA 1RGQA 3TJOA 4A5TS 4ZMAH 4FUGA 2VIWA 4IN1A 3PMHB 4I33A 2V0BA 1YPHC 2B7DH 2FOMB 3BEIB 4H6TA 7LPRA 1GJDB 3A83A 2UUKB 4LXBH 2VH6A 1TMBH 3ZVDA 2BDBA 3U1IB 2XWAA 4JK5A 1BOQA 1EOLA 1UTQA 2ZGJA 3ZZ4A 1AWFH 3UPEA 2P3UB 1F0TA 1P2OA 2V35A 1Z6JH 4JZEH 3T2NA 1SPJA 1GBDA 2TBSA 4ASHA 2CV3A 3RMOH 2ZO3H 2XYAA 1DS2E 1DPOA 2UWLA 1QJ1B 2ZPQA 4NA8A 1QRWA 1T32A 4ESTE 1FY4A 1J15A 2WPLS 1FI8A 4NZLA 1THSH 1AO5A 1OYQA 4OS5A 2Y81A 3KEEA 1AUJA 3SGQE 1P06A 4K1TA 1TGNA 5L30H 3VB6A 1C5XB 1ZMLA 2FI4E 2HOBA 1K1MA 1FY3A 3A8CA 3A7XA 3A87A 4RSPA 1O3FA 4I7YH 2XWBI 1UTJA 1GDNA 1K22H 2ZU3A 4X6PA 3TGJE 3ZV9A 4X2YA 2JH0D 3BTFE 9ESTA 4J1YA 2KAIB 4AFZA 3QWCH 2FLRH 1S84A 5CHAC 3A82A 2BZ6H 2W5EA 3MH4A 4O3TA 5AVDA 2Q6FA 1ORFA 2ZDMA 1P11E 2VWOA 2HGTH 1O3LA 1QTFA 3MTYA 1CGJE 1FPCH 5A8YA 4WJG2 3UUZA 3NK8A 2ZGXH 3F9GA 3ITIA 1QB9A 2A4RA 2O9QA 4R0IA 2V6NA 1S6HA 1GMDF 3SOSA 3DFJA 4DY7B 1HJAC 4ABAA 1VJ9U 5HMAA 3A7VA 1SR5C 1MU8B 3U8RH 4UEHH 5FBEA 4U32A 5E0HA 4PROA 1SVPA 2XCNA 2GCTB 1YP9A 1CHOG 1O3DA 1HV7A 1LTOA 2Z6BD 3PV4A 1WYKA 4KGAA 1LPKB 3F9EA 4SGBE 2EA3A 1HAHH 1HUTH 4IC5A 4TY7A 4RKOB 1K1NA 3F68H 1C5LH 1O3NA 3ZZBA 1CO7E 3LGYA 3LC3A 5F8XA 4BAHB 4AG2A 2FOAA 2ZF0H 2FPZA 4YZUA 1GG6B 3SV8A 3SZNA 3MNBA 2C8WB 3NUMA 1H8DH 2OP9A 1MTWA 1RFNA 2J34A 3NWUA 1O35A 4X1PU 1QIXB 2ZGBH 1HIAB 4X2VA 2ILNA 1P3CA 4CR9A 2NU3E 4XOJA 4IMQA 5B6OA 1ELVA 1GBJA 1Z1JA 2ZDKA 4VGCB 3BIUH 3RXTA 1LPGB 1O5AB 8KME2 1KLTA 4CREA 1QGFA 5JB9S 2WV4A 1CU1A 1L4ZA 3ZZCA 1SGFA 4B2BA 1UHBA 3VEQB 1GI5A 7ESTE 1OWEA 5I46H 1CBWC 2FLBH 2Q6DA 1A0LA 1TALA 2QXGA 2VVCA 1P2JA 1B0FA 1FZZA 3FANA 4LZ4B 3SUGA 1GJBB 4AGKA 2PV9B 1GBKA 2ZDLA 4XE4A 1HJ9A 2ZPRA 3FZZA 3TJNA 1TQ0B 1PQ7A 2ANYA 3RXKA 1XUIA 4I8LA 4GHTA 1C5QA 2AGGX 1S81A 5BRRE 3M7UA 2ANMH 1O3KA 4D8NA 3Q76A 4MVNA 1LHEH 4MG3A 5LPEA 4KKDA 1BTUA 2H5CA 2FOEA 3SU5A 2H9HA 1YLCA 2P8OC 4U30A 4NWKA 2FI5E 3SU1A 2FX4A 4O3UA 3P17H 4DCDA 3HGPA 4UDWH 2Y82A 3E90B 5FPTA 4RN6A 1YBWA 2A5KA 1VCWA 3GCHB 5DP5A 1RD3B 1CVWH 1YPKH 2VVVA 1V2KT 4CRCA 1HPGA 4WXIA 1GVLA 3I77A 2QF3A 3PLPA 4MPXA 5J4QA 2TGTA 1IHSH 2BQ7B 2Z9LA 3MNXA 5FAHA 3RDZA 4E06H 1D3TB 3TGKE 2BD9A 3UFAA 4X0WU 2Y80A 1F5LA 8GCHG 1MBQA 4DIIH 3SQEE 1MCVA 1UTMA 4BXSA 5HXFA 1EB1H 3TNSA 4VGCC 1ZGVA 4MNWA 1UCYH 1XUKA 2OCVB 2Y7XA 1KXAA 4UE7H 1O31A 2OC7A 2J92A 2FTMA 2P16A 3U9AH 5T6DA 1Q2WA 1NROH 2EEKA 2G5VA 5C20A 1TPOA 2OBQA 1BTHH 1SGQE 1BHXF 4NZQA 2QAAA 4GVUA 4K1EA 2ZI2H 1AUTC 3MU4A 2PTCE 1DT2A 5DP8A 3T26A 1AE5A 1SI5H 5FX5A 3FAOA 4DJZB 2BDCA 3VB5A 4HI3A 2IN2A 1O5EH 4Y11E 2A32A 2NU4E 1UVTH 4Y8YA 3RXFA 4I8KA 2BB4A 5EPYA 5C1XA 1K9OE 3QGNB 2OBOA 2G5NA 1G3BA 2ALVA 2NU0E 1KLJH 1A0JA 4JYVH 4D76A 2ZHWH 4NIWA 4Q2KA 3TLOA 3VGCB 1O3EA 5JYIA 5L2YH 5L2ZH 2W7SA 1C5SA 3I78A 2QXIA 1QFKH 4OGXA 3AASA 1O36A 3MU1A 4K69A 1NRQH 1TMUH 2LPRA 1GCDA 2ZPSA 3GCTF 4A1TA 1NFUA 3WY8A 1LQDB 3TJVA 1SGDE 1TBRH 1O2RA 2A2QH 1DY9A 1GJCB 3JZ1B 1E35B 1DY8A 1QQ4A 8ESTE 4MTBA 3UR6A 1XUHA 1P2MA 2GT7A 3QLPH 3Q3YA 2GTBA 1TNKA 2BVXH 3GCNA 1FLEE 2WV5A 3M7TA 2M5TA 2ZHFH 1AE8H 5A0BA 2FDAA 2AGIX 3BTDE 1GHBG 2G51A 3TH2H 2CGAA 4ZKSU 4KP0A 1OP0A 1UCYE 2G4UA 1C1QA 5CMXH 1QB6A 3OX7U 2AH4X 1TX8A 1TNLA 1HJ8A 1SGTA 2O8UA 3AW1A 1LHGH 1YGCH 2OC8A 1JMOH 3TJUA 7KMEH 4ISLA 2UWPA 1P2KA 1Z8IB 1AKSA 1ZSLA 1PPHE 1S82A 1AU8A 1GI2A 2A4OA 2GT8A 1AN1E 1GGDC 1Y5BT 3RM0H 5EQSA 5EODA 2ZTYA 4JK6A 2ZEBA 1O2PA 1MTSA 1Y3UA 1MCTA 3NZIA 2F9VA 4XBCA 1OP8A 2PW8H 4Y7AA 3UR9A 1SGPE 2P59A 1DITH 4XFQA 3MYWA 3D65E 1EX3A 3P8GA 4Q80A 3SI4H 3HATH 3ZYEA 4THNH 3S9CA 1N6YA 3EDXB 1GBLA 1JIRA 1UVOA 3MO6A 1GHAF 3SO3A 2THFB 3U8OH 4DG4A 7GCHF 4ISNA 3O8DA 4FUFA 3TITA 1FIWA 2BHGA 3QZQA 3M3VA 1VZQH 3SNDA 1GMHF 2ZGCA 1BZXE 2A7JA 1AFEH 1EB2A 2XBVA 4H42U 1Y59T 4CHAB 1G9IE 1BTZA 1O34A 1Z8RA 2ZGHA 4INHA 1QL8A 4QT8C 1C5RA 3RP2A 2ZFFH 1MKXH 4HFPB 4WH8A 3SI3H 3ATKA 3KQCA 3ZV8A 1F0UA 3BF6H 2BM2A 4YOJA 2JETB 1TOMH 2UUFB 1L1JA 1S0QA 2I6SA 2C8YB 5EGMA 1O3HA 3MH5A 1PPEE 5IYTA 1BRCE 4RKJB 4WMDA 2BLWA 2CHAC 1V3XA 3D23A 3Q3KA 4IBLH 1FY1A 3RXQA 2ZHDA 1NRPH 2B8OH 3PTNA 2D8WA 3DD2H 2WYGA 3SJ8A 1QHRB 2FESH 5GCHF 3F9FA 1GL1A 1HAVB 1O0DH 5ESTE 4ZHLU 4YOGA 3K65B 1EASA 4KTUA 1DXWA 4NA9H 1EAUA 1SLWB 4D7GA 1H9LB 1AWHB 3SQHE 1KXDA 1GJ4H 1C2IA 3BTGE 4YOIA 5H4IB 3OY5U 3UREA 1CA8B 3BTWE 1VJAU 2ZECA 1JBUH 2F83A 1VR1H 1WUNH 2PWXA 1DWEH 1ESAA 2ZQ2A 3E1XB 3PLKA 2OD3B 3SU2A 3LGUA 3GY8A 3EAJA 1YPGH 1PQAA 4YO9A 4FVDA 4H6SB 3T28A 2C8XB 1A3BH 5BPEA 2VIOA 3BEFB 4JCNA 1BJUA 1C5ZB 4X2WA 1P05A 3TPIZ 1GI6A 2A4QA 2HPPH 2QN5T 1P2NA 1L1NA 4MNXA 2H2ZA 1S0RA 2OINA 2BD4A 5EXNA 1QBNA 3E0NB 3RXEA 5TCAA 1C2JA 1TB6H 2ODPA 2WYJA 2Z9JA 2ZC9H 3ATLA 3U8TH 3M3TA 1PPGE 4K8YA 2ZZUH 1GI3A 2G4TA 3G01A 2A4GA 3KQDA 5ESBA 1RJXB 1ZOMA 2Z3DA 2O8LA 1YM0A 1IQJA 3VB3A 2BYAX 2EI7A 4MPVA 3L33A 1MD8A 2GP9B 1GHYH 5AF9H 1A61H 1TNJA 2G52A 3DT0H 4O03A 4YM9A 1C5WB 2ZTXA 1TBZH 3UY9A 6GCHG 1UTOA 1XXFA 5JBAS 5A0CA 1O30A 1NRRH 4K2YA 1KLIH 5TJXA 2VWNA 4XDEA 4NGAH 1NFXA 5T6FA 3BG4B 2XCFA 4I8HA 1KXFA 3QN7A 1XXDA 1EPTB 3QTOH 1F5RA 3P70B 1NRSH 1NZQH 1DSUA 4MLFB 1ESBA 2BDAA 3EA8A 1RTKA 5FHTA 1O33A 1DM4B 4AZ2B 4Z6AH 3EE0B 1SLUB 1EOJA 3SU3A 1W12U 2HLCA 1C2LA 4FXGH 1O5DH 1BB0B 1BIOA 3DA9B 5EPNA 1UO6A 5TCCA 4ZAEA 1H1BA 4D9QA 2A2XH 3ZZ7A 3CENA 3S9AA 1ESTA 3V0XA 3V3MA 3HK3B 4TWYA 5PTPA 1V2QT 4F4OC 1K1OA 1GBEA 1LVBA 5F8TA 4MPUA 1A5GH 5LPRA 3FVFB 3TK9A 2F3CE 3A8DA 1QA0A 3R0FA 1K28D 1VGCB 3BSQA 1UVUH 5GPIB 1V2UT 1BMLA 1UHBB 4F49A 1CA0C 2BX3A 4WWYA 5EOKA 2TIOA 5EW1H 1CT2E 2DE8A 1LO6A 1ARBA 1L1GA 2BD8A 1VCQA 1TGCA 2D1JA 3RLWH 4GUXA 1OWHA 4NA7A 2GDEH 1P57B 4AFSA 2PKSB 1PPFE 1C5YB 1OWKA 3A7YA 1ANCA 4IMZA 1N8OB 4K8BA 4CBOA 1EZUC 3M5NA 2RDLA 2GGVB 1O2WA 2SGQE 1GBIA 3QZRA 3ZZDA 4ZHMU 5K0HA 2YOLA 2RA3A 3BG4C 7GCHG 1GHAG 1INCA 1EP5A 1O3BA 1BRUP 2PFEA 1C1TA 2Z94A 1EPTC 2ZQ1A 3ATWA 3BTTE 3OU0A 5FXLA 3HKIB 1GBAA 1BMAA 3W94A 1C2MA 4GCHG 3T27A 1LHCH 3FFGA 2C93B 1MUEB 1O3IA 5E2OA 1K21H 2VIQA 1AQ7A 1KDQA 1AFQB 1V2ST 1Y5UT 5GIBA 4NWLA 3KNXA 2A31A 4ABBA 3U98H 1GI1A 1SLVB 1W13U 3A8AA 2AMPA 1XM1A 1AGJA 1IQIA 1DX5M 3TGIE 1O2HA 1TE0A 5K7RA 2QYIA 1MAXA 4GSOA 3SU4A 1YPEH 3TK5A 2OQ5A 2RCEA 1SQTA 1GL0E 2Y5HA 2Z9IA 1GI0A 1ETTH 1NN6A 1O2GH 1CSOE 1O39A 1S6FA 4CR5A 1UJ1A 2V3OH 3RC6A 3A7WA 1GCTB 1LVMA 2GKVE 6ESTA 1MZDA 1HAPH 4AGJA 3SUFA 1SHHB 1NT1A 1NPMA 1OWJA 2VIPA 4BAMB 1Z1IA 2STBE 3A89A 3E3TA 4O97A 3RXMA 5LH8A 3MOCA 3MU8A 1P2IA 1ELFA 4MNYA 5DP3A 4AB8A 1C5MD 2QIQA 1UTPA 4Y76A 3FZDA 1C1UH 3AW0A 1FJSA 2EI6A 1ZMJA 3SV9A 5E0JA 2OUAA 1V2LT 2GMTB 1P02A 2XTTB 1E37B 3OY6U 1DICA 1DWCH 2BDIA 2A7HA 4CH8B 1HAGE 3LJOA 2BOHB 1MTNB 3RU4E 4ZXXH 3O8BA 1YPJH 1AIXH 1BBRH 1K2I1 1DUEA 4NIYA 2ZFSA 1HXFH 3ATMA 1S5SA 3SNCA 1C2FA 2ESTE 4CH2B 2BDYA 2GCTC 2A0QB 3SV7A 5DK1A 1CHGA 2JH6D 1SGEE 1EAXA 2J95A 3MWIU 4AFQA 4INLA 1A0HB 2ZFTA 4U01A 2VINA 1ETRH 3LC5A 1EP6A 2O8MA 1LVOA 3T25A 1ZMNA 2A5IA 3SNAA 3VXFH 3GDVA 4M7GA 1NM6A 1L4DA 1C4U2 1QJ6B 2BQ6B 1DSTA 2ZFPH 1QL7A 1GG6C 4LZ1H 1SB1H 2PSXA 2SGDE 2FS8A 4INKA 1MMJN 1RTLA 5E8EH 1B5GH 1Z7KA 2UWOA 1ARCA 3H7TA 4ZXYH 2NU1E 2JKHA 2PGQB 2WPMS 2VWLA 2PR3A 2ZU5A 4ABDA 1GHXH 2BLVA 2P93A 1SMFE 3SHCH 1X7AC 1T8NA 4YESB 1K1PA 2IJOB 1IOEA 3UIRA 5FCRA 1FMGA 2VGCB 3RUOA 1FQ3A 1QY6A 2VWMA 3AVZA 1HGTH 4IC6A 2R2MB 3ZZ9A 1O3PB 3QO6A 3BN9A 2FX6A 1MH0A 5GDSH 1JWTA 1AKSB 1TGBA 2ZU1A 3FP8E 2EI8A 1H9IE 1RIWB 1O2JA 2FTLE 1WCZA 1J17T 3IG6B 1RRKA 2WINI 2HWLB 5T3HA 4CRBA 1SOTA 4B74A 2ZKSA 4E05H 2J2UA 1WAYB 3BTQE 4HZHA 3PB1E 2OC1A 1GJ6A 3A7TA 1T4UH 4AFUA 1ANBA 3RXSA 1Z8GA 1HNEE 3FP7E 1MQ6A 3PTBA 3UQVA 1BBRE 3V13A 3MHWU 4JZ1A 3QK1A 5DPAA 1GJ7B 2DUCA 2SGEE 1Y5AT 4AG1A 4ABFA 2VU8E 1MTVA 4DOQA 1C2DA 4CRDA 1KXEA 2XC4A 3F1SB 4OS6A 4UONA 2SNVA 1TGTA 3M5OA 4WF8A 5GJ4B 5C5OA 2BDGA 2AFQB 1FY8E 1G3DA 1QURH 3RXUA 4NFFA 1ZGIA 1C9TA 1W10U 1AHTH 3GCHC 2AS9A 2YNAA 5EU8A 2OLGA 4B2AA 2ZDVH 1AB9B 1V2NT 1SC8U 2QXHA 3L6PA 1D3PB 1ELDE 1ACBE 1FPHH 4ISIH 2PGBB 3DHKH 3EQ0H 1YCPH 1UTKA 1LKAA 1O2SA 2UUYA 4UFGH 6CHAB 4JMYA 1AVWA 1DWDH 2H5DA 2OC0A 3MH6A 4AOQA 2AGEX 1C1MA 1TNIA 2AERH 1OKXA 2AMQA 2EC9H 4K5ZA 1IQKA 1FDPA 4I31A 2GZ8A 1LVYA 1J16A 3GICB 4ABGA 2WPIS 4B73A 1A46H 1TPAE 1SHYA 1MD7A 2TRMA 5EXLA 2ANWA 3PO1B 4ZKNU 2SGAA 2A7CA 1GMDG 1GPZA 1O2NA 1UCYK 3E16B 2I6QA 2XBWA 5DP6A 4DIHH 1CE5A 3KQEA 1OS8A 4Y0ZE 1V6DA 4AX9H 1P9UA 3UOUA 2FXRA 3LU9B 5AFYH 2GDDA 3GDUA 1GVKB 3SW2B 1THRH 1XVOA 2FOGA 1PPBH 1ZTJA 2Y5FA 2H6MA 1V2MT 2VJ1A 5DP9A 5LGOA 1H4WA 2SGPE 3M37A 3SBKA 1V2WT 3P8NA 2P3FH 2ZDNA 3ZVBA 3Q77A 1T31A 1NU9A 2AYWA 2XBYA 3IWMA 2C8ZB 4Q7XA 1ZPCA 3VGCC 1D3DB 1UVSH 1F0RA 4FUHA 2P94A 1G3EA 2C90B 2CMYA 5JB8S 4TPYA 3RU4T 4JZDH 3TNTA 1E36B 3MMGA 3RXBA 2Q1JA 3PM3A 3MI4A 1SLXB 1WV7H 3EA7A 1WU1A 3UTUH 5LPFA 1V2TT 4FU7A 1NY22 5HM2A 3BEUA 1UTLM 1DOJA 2WUCA 1GBMA 3VFEA 8LPRA 1SSXA 4MQAA 4BXWA 2QF0A 3RXIA 1W7XH 3OYPA 1XKBC 1CHOF 1SGCA 3PWBA 2D26C 2BD2A 1PPCE 5G4BA 1MTUA 1O2UA 2F9OA 5C5NA 1XMNB 2DE9A 5A09A 1YPLH 1MKWH 1EAWA 1ANEA 3M36A 1TAWA 5SGAE 3A84A 3BV9B 3MU5A 4I8GA 1TBQH 3KHVA 3LGVA 2G81E 2JH5D 1XX9A 1BTYA 3KQBA 1O2LA 4BANB 3HK6B 4GLYA 1IQMA 1O3AA 4BNRA 1C2EA 1S85A 1FXYA 4AB9A 4KELA 1TFXA 5EW2H 1WQSA 3CP7A 1E38B 1O2VA 2STAE 1OWIA 1V2PT 1F2SE 3UNSA 2Y5GA 3RXOA 1SGYE 3RXAA 1GI7B 3TIUA 3TK6A 2BVSH 1EQ9A 1GBHA 2A1DB 1A5IA 1ABIH 1MU6B 1ANDA 5DGJA 4D9RA 1TQ7B 3RXDA 1V2RT 5JBCS 3MFJA 1O3JA 5AFZH 1GWAA 3EYDA 2ZCKP 2PSYA 4FU8A 1G3CA 2XBXA 1U6QA 3NXPA 5EQQA 1NRNH 4X6MA 1HYLA 1KXBA 2P3TB 4IN2A 1Y8TA 1TRNA 1TIOA 3NCLA 4FUBA 3TVJB 4CRGA 1P10A 4NCYA 1YPHE 4OS1A 1RS0A 1O2ZA 1G37A 3A86A 4CHAC 3TH4H 3A88A 1BQYA 4GHQA 2R2WU 4JZFH 4K1SA 3K6ZA 3A81A 1C5OH 1TPSA 4TYDA 1JRTA 1XUJA 4HTCH 2WUBA 1J8AA 3B23B 2XW9A 3LIWA 4LK4A 4XBBA 4YT6H 1SBWA 1GJ9B 1MQ5A 1TOCB 1GHZA 3T62A 4E7RG 2G8TA 3CS0A 4X6OA 4ZROA 1GDUA 1MKXK 2PKAA 1E34B 2JETC 1ABJH 4BAQB 4K3JA 1HRTH 5GXPA 1IQEA 1MAYA 3PLBA 3RC5A 1AY6H 1TGSZ 2H9TH 1BRAA 3F9HA 1N6XA 1BTXA 1BA8B 3RMMH 1DLKB 4OS4A 2WPHS 1GHVH 3BTKE 1A1RA 4DGJA 3LGWA 1MKWK 2ZHQH 1C5VA 4KTCA 2HNTF 1LCYA 4TPIZ 3GOVB 3W95A 1O2IA 4TWWA 2FEQH 5CHAB 1C1SA 1JRSA 3GDSA 1XVMA 1BDAA 8GCHF 4Q7ZA 1TX6A 1KDQB 2ZCLP 4X8TH 5C1UA 2W3KA 1D6RA 2F91A 1GDQA 4O9VA 1ZJDA 2Q6GA 4SGAE 2R0KA 1F5KU 4X8SH 3GCTG 3DUXH 1TWXB 1EATA 1T4VH 5ABWA 2ZA5A 1UVPA 1BT7A 2ALPA 1AZZA 1O3GA 1T8LA 3TU7H 1GJ5H 1HJAB 2FS9A 1NFYA 1TABE 1GBTA 1KSNA 2FOCA 3E6PH 1BCUH 1GBFA 3KCGH 4BTIB 1OXGA 1AI8H 4Z0KA 5ETXA 1HDTH 3OTJE 1QR3E 1KYNA 4X1RU 1OOKB 3L3TA 1OX1A 2HNTE 4B1TA 4BOHA 3PYHA 1BITA 4OGYA 1QJ7B 3ENSB 4WY3A 5JDUB 3GY4A 2BLOA 2FIRH 3SU6A 2ZWLH 4Y8XA 1W3CA 4NIVA 4Y10E 1W14U 2G55A 1ZZZA 1HBTH 1S83A 1O3OA 2H1UA 1FAKH 5GWZA 1HFDA 3AAVA 3NKKA 5J4SA 4YT7H 2ZHEH 3LT3A 5I25A 1BUIA 3M5LA 3ZZ8A 1EJMA 1O2OA 2CF8H 4GAWA 4X8UH 4E7NA 1DXPA 1OPHB 1BRBE 4XBDA 1W8BH 1C2KA 5L6NH 1FIZA 3ODFA 4DVAU 1BMMH 2R9PA 2ZNKH 2O8WA 3GY3A 2F9BH 1A4WH 2BOKA 1TA6A 1O32A 1CBWB 1C1PA 1XUGA 2GD4B 2BXUH 2GV6A 2PUQH 3ELAH 1IAUA 3RXPA 1NFWA 3MO3A 2QGRA 3ZZ5A 3N7OA 1ZHRA 4ISHH 1DUAA 5DG6A 2VIVA 3AAUA 1LMWB 3P95A 4CRFA 2CXVA 1LQEA 4ABIA 3E91A 2GZ7A 3ZVFA 1O2MA 1A3EH 1GMHG 1IQGA 4UD9H 1A2CH 2FI3E 1GHBF 2BY7X 3ESTA 1LHFH 4BAOB 1K1JA 4OS2A 1DLEA 1E0FD 3STIA 3ZVCA 2Z9KA 1ID5H 1VITH 1EZXC 1QCPA 1BMNH 3LH1A 5F8ZA 3LJJA 4K60A 2F9NA 2BY8X 3VB4A 1C4Y2 2ZTZA 2XNIA 2P8OB 4ZKOU 1NS3A 2R3UA 1AVXA 3I29A 1EPTA 3A85A 1C5UA 1G2MA 1UK4A 1OP2A 1P03A 4Y0YE 2OTVA 1ZHPA 1ZLRA 3ZVEA 4I32A 2PTNA 1J14A 1P04A 4LOYH 1TLDA 1D3QB 1G30B 1YCPM 3ZZAA 1QBOA 2HNTC 1XKAC 3H5CB 1O2KA 4B76A 1EZSC 1C9PA 2FODA 2VH0A 3NPSA 2SFAA 2NWNA 3GY5A 1VGCC 1RXPA 5DP7A 3HKJB 5GCHG 4X1NU 5EQRA 5A8XA 4AYVB 1O5CB 2BX4A 3QTVH 4ABHA 1KXCA 2RA0A 1AVGH 1ZSKA 3O8CA 5DKMA 2FM2A 4A92A 1GMCF 1T7CA 1NO9H 3ZVAA 2F9PA 1GHWH 3PMBB 3B8JA 1FNIA 3SJKA 1P01A 5HYOA 4YTAA 3RXRA 4NFEA 3LGIA 5A2MH 4A6LA 2QCYA 3SHAH 1VITF 4J2YB 1P12E 2CF9H 2ZCHP 2Y7ZA 2FMJA 1SGIB 5EG4A 3M7QA 2PKSC 5DJ7A 1G32B 3P8OA 2H9EH 3LOXA 4AN7A 1N8OC 1IQHA 2J9NA 1Y3YA 1ZRKA 3EA9A 2ZIQH 3S69A 1GI4A 1EUFA 2ZFQH 5HGGA 1QL9A 2BY9X 1QBVH 1MZAA 4UFFH 1JIMA 3ZVGA 2KAIA 1AMHA 4Q7YA 4Y7BA 2VVUA 1K1LA 4FUJA 2PHBA 3SUDA 1AFQC 3SV6A 2BQWB 2TGDA 4NSVA 2R3YA 2GCHF 2C4FH 2XRCA 3LKWA 1ELGA 3UNRA 3RU4D 3EGKH 1WTGH 4NSYA 2A5AA 2P95A 1Z71A 1DDJA 1HAIH 3RXJA 1AD8H 3SUEA 1FV9A 4JZIA 4Y6DA 3RMNH 1ELCA 3C1KA 1O2YA 2PLXA 3K2UA 1L0ZA 1O38A 3RXVA 4IW4E 2QXJA 3M35A 1HCGA 1QNJA 1SL3A 2BZAA 1N1LA 3FP6E 2GX4A 2HVXA 1TONA 1TRMA 1Y3XA 1LHDH 3D49H 2ZDAH 5C1YA 1ELBA 1PFXC 1QB1A 1GCTC 2Z3EA 2IOTA 1EJNA 3K6YA 1O3MA 3Q3XA 1F0SA 1YKTA 4XSKU 1YPMH 2QC2A 1W0ZU 1SQAA 1Q31A 1HIAA 1WBGB 2J38A 1SGFG 2NU2E 4X1QU 1OYTH 2XC0A 3HPTB 2A45B 4WMFA 1TPPA 3GCOA 5C2ZA 1DE7H 1FY5A 4U2WA 1GVZA 2TGPZ 4WMEA 1ZPBA 3ATIA 1C5NH 1PJPA 1EAIA 2GMTC 4ABEA 4DT7B 5C3NA 4NG9H 4MNVA 3LGTA 1QQUA 1IQLA 5FBIA 1MTNC 3RC4A 2O8TA 3UWIA 1T8MA 4A7IB 1YLDA 5E0GA 3TH3H 1WSSH 2BXTH 1P09A 1ELEE 1TMTH 1C2HA 4ISOA 1ZHMA 1LDTT 1ZTLA 1GGDB 2QY0B 1QRZA 4H4FA 4WXVA 1WTHD 4FUIA 1SOZA 1TNHA 1BBRK
chains in the Genus database with same CATH superfamily
4RT1A 3SJ9A 1GBCA 2D2DA 1K1IA 2BY6X 2Z7FE 6GCHF 1D4PB 4DURA 1LKBA 4BAKB 2W26A 1VCPA 1THPB 1ZTKA 3MNSA 4OS7A 2AMDA 1H8IH 1IHTH 2KX4A 3O8RA 1SGRE 1W0YH 1XUFA 1V2JT 2BD7A 1P9SA 1IQNA 1ETSH 4R8TB 2TGAA 5FPSA 2ZFRH 1CGHA 1NTPA 2VB0A 3BTEE 1FN8A 4X8VH 1O37A 1GI9B 3S7KB 4GPGA 4FUDA 4B6EA 5DO4H 1FUJA 5JBBS 1NU7B 4X6NA 1BHXB 2OQUA 5T6GA 4NIXA 4B71A 2ANKH 2LP6A 3E8LA 2V3HH 2ZU4A 2BLQA 1ELAA 1V2OT 2XC5A 1J9CH 3SJIA 1KY9A 5JPMH 4D7FA 4KTSA 1A5HA 1SG8B 2BMGB 5EXMA 1PQ8A 4ZHAA 2FYRA 2KCOA 2VGCC 3UQOA 1D9IA 2BVRH 2OXSA 1CQQA 5KGOA 1C5TA 3UWJH 1HAXB 3KN2A 2W3IA 2QA9E 5EJ1A 1RIWC 2BD3A 2AEIH 3OSYA 2CHAB 1C5PA 1BTPA 1HXEH 4TY6A 3OEHD 9LPRA 1AZ8A 3QGJA 3WWBA 4X1SU 2FOHA 2FO9A 3U69H 3DSGA 3DFLA 3VB7A 1TYNA 1YYY1 2FYQA 1D6WA 1BTWA 5FX6A 1GJAB 4AORA 2HPQH 2AIPA 4YLQH 2J98A 4FVBA 2HRVA 4HGCA 4XRNA 3MH7A 2PUXB 1GJ8B 3PWCA 2ZP0H 1DANH 2QV1A 2ZU2A 5C67A 1C1RA 4WVPE 3A8BA 3KL6A 3RLYH 3SGBE 1RTFB 1EXFA 1SQOA 2FZZA 2FWWA 2ASUB 1QRXA 3MU0A 4A1XA 3B9FH 1FONA 2GZ9A 1GBBA 1MBMA 1PPZA 2TPIZ 1FN6A 4Y79A 2YNBA 2ZG0H 3MNCA 3E0PB 2ODQA 3URDA 1YY3A 3LONA 1GMCG 1YC0A 5E2PA 1HAOH 4ABJA 3PMJA 1C2GA 1UMAH 2ULLA 3ZZ3A 1AB9C 1BJVA 1EJAA 1ZSJA 3BTHE 3S9BA 1ZJKA 1T8OA 2R0LA 1CT4E 2RG3A 3SNBA 3T29A 1VITG 4UFEH 3S0NA 1P0SH 3BG8A 2PKAB 4GCHF 1TA2A 3SNEA 1HAZB 3F0PA 1JXPA 1HB0B 1IQFA 3RXGA 3CS7A 3URCA 4JYUH 6CHAC 2FP7B 3R3GB 1UK2A 1YF4A 1C1VH 1O2XA 1YCPK 5CE1A 2SNWA 3ODDA 3SN8A 3RM2H 1B7XB 1ZPZA 2IPHA 3UOPA 1SFIA 5HM9A 1W2KH 3FN8A 1Y3VA 5F03A 1W11U 3P6ZB 1NBME 3UNQA 3PO1C 5FCKA 1F92A 1O3CA 4ZUHA 3V12A 4FUCA 4CBNA 1Y3WA 1TNGA 3HGNA 2VIDA 1TRYA 1C1WH 2HALA 5JBTA 1A7SA 2ODYB 4I8JA 3SORA 2B0FA 1FAXA 3KGPA 1KIGH 1C1NA 2JDID 2XOKD 3IITA 1PYTD 1O5GH 4Q63A 3RMLH 3SU0A 2GCHG 4FUEA 2VNTA 1QA7A 5IDKA 2K0QA 1V2VT 5F6MA 2BD5A 1NBMD 1OSSA 3LH3A 4IS5A 5FPYA 4X2XA 4BTUB 3RXHA 3T5FH 3A80A 1TX7A 1Z8JB 2SGFE 1F7ZA 2W7UA 1ZRBA 1O5FH 3QDZB 1NESE 2GV7A 1DFPA 2FOFA 2FOBA 1O2QA 3KF2A 4UFDH 4WH6A 2F9UA 3BTME 4YLUA 1JOUB 3P8FA 1ZR0A 1KTTB 4MPWA 3SGAE 5DP4A 3GISB 1WQVH 3LDXH 3A7ZA 2YMSD 1WOFA 4ACBA 5HIZA 2WPKS 4ZKRU 6LPRA 4MDSA 4JYTA 1W7GH 1CT0E 1Z6EA 2XXLA 2B9LA 1LPZB 3V7TA 3BIVH 1KTSB 1SFQB 4B2CA 4A1VA 5AHGH 1C1OA 2J94A 3ZYDA 2C3SA 1EKBB 3S7HB 1SGNE 2K1QA 3M3SA 3MO9A 3ZZ6A 1PQ5A 1CA0B 1OWDA 3H7OA 2UUJB 5A8ZA 1DWBH 2WPJS 3M61U 4Y71A 3RXLA 1P8VC 4BTTB 1PYTC 1O2TA 1M9UA 3GYMA 1GI8B 3VPKA 4B75A 3GY7A 1P3EA 3QX5H 3PMAB 3C27B 3JZ2B 4Y8ZA 3P92A 3LPRA 1Q3XA 4FU9A 1O5BB 1G36A 2WV9A 3STJA 1NC6A 2BDHA 3Q00A 3GY6A 2J4IA 2CJIA 1P2QA 4AYYB 2BY5X 3GYLB 5A0AE 1H9HE 2Y6TA 4ZH8A 2G00A 3U1JB 1ZYOA 1EZQA 3M5MA 4IGDA 2BTCE 3K9XB 3RXCA 1L2EA 3EE7A 3KIDU 2CN0H 1C4V2 2LNCA 4DW2U 2AIQA 1G2LA 1UTNA 3GY2A 3PROA 1HAVA 3F6UH 3VXEH 2B5TB 2Z9GA 4CRAA 1UK3A 2Z3CA 3SV2H 1CGIE 2YMSC 1DVAH 1COWD 1HAYB 3SJOA 2OK5A 2GVFA 1HLTH 5C0TA 3D62A 3QUMP 1B0EA 1ELTA 1RGQA 3TJOA 4A5TS 1H8ED 4ZMAH 4FUGA 2VIWA 4IN1A 3PMHB 4I33A 2V0BA 1YPHC 2B7DH 3DSOA 2FOMB 3BEIB 4H6TA 7LPRA 1GJDB 3A83A 2UUKB 4LXBH 2VH6A 1TMBH 3ZVDA 2BDBA 3U1IB 2XWAA 4JK5A 1BOQA 1EOLA 1UTQA 2ZGJA 3ZZ4A 1AWFH 3UPEA 2P3UB 1F0TA 1P2OA 2V35A 1Z6JH 4JZEH 3T2NA 2L6OA 1SPJA 1GBDA 2TBSA 4ASHA 2CV3A 3GS9A 3RMOH 2ZO3H 2XYAA 1DS2E 1DPOA 2UWLA 1QJ1B 2J5UA 2ZPQA 4NA8A 1QRWA 1T32A 4ESTE 1FY4A 1J15A 2WPLS 1FI8A 1WXRA 4NZLA 1THSH 1AO5A 1OYQA 4OS5A 2Y81A 3KEEA 1AUJA 3SGQE 1P06A 4K1TA 1TGNA 5L30H 3VB6A 1C5XB 1ZMLA 2FI4E 2HOBA 1K1MA 1FY3A 3A8CA 3A7XA 3A87A 4RSPA 1O3FA 4I7YH 2XWBI 4RT0A 1UTJA 1GDNA 1K22H 2ZU3A 4X6PA 3TGJE 3ZV9A 4X2YA 2JH0D 3BTFE 9ESTA 4J1YA 2KAIB 4AFZA 3QWCH 2FLRH 1S84A 5CHAC 3A82A 2BZ6H 2W5EA 3MH4A 4O3TA 5AVDA 2Q6FA 2LELA 1ORFA 2ZDMA 1P11E 2VWOA 2HGTH 2KCYA 3KYGA 1O3LA 1QTFA 3MTYA 3N7EA 1CGJE 1FPCH 5A8YA 4WJG2 2EY4C 3UUZA 3NK8A 2ZGXH 3F9GA 3ITIA 1QB9A 2A4RA 2O9QA 4R0IA 2V6NA 1S6HA 1GMDF 3SOSA 3DFJA 4DY7B 1HJAC 5F53A 4ABAA 3KYFA 1VJ9U 5HMAA 3A7VA 1SR5C 1MU8B 3U8RH 4UEHH 5FBEA 4U32A 5E0HA 4PROA 1SVPA 2XCNA 2GCTB 1YP9A 1CHOG 1O3DA 1HV7A 1LTOA 2Z6BD 3PV4A 1WYKA 4KGAA 1LPKB 5FL7D 3F9EA 4SGBE 2EA3A 1HAHH 1HUTH 4I86A 4IC5A 4TY7A 4RKOB 1K1NA 2JJ2D 3F68H 1C5LH 1O3NA 3ZZBA 1CO7E 3LGYA 3LC3A 5F8XA 4BAHB 4AG2A 2FOAA 2ZF0H 2KFWA 2FPZA 4RI0A 4YZUA 1GG6B 3SV8A 3SZNA 3MNBA 2C8WB 3NUMA 1H8DH 1MTWA 1RFNA 2J34A 2OP9A 3NWUA 1O35A 4X1PU 1QIXB 2ZGBH 1HIAB 4X2VA 1S6LA 2ILNA 1P3CA 4CR9A 2NU3E 4XOJA 4IMQA 5B6OA 1ELVA 1GBJA 1Z1JA 2ZDKA 4VGCB 3BIUH 3RXTA 1LPGB 2JIZD 1O5AB 8KME2 1KLTA 4CREA 1QGFA 5JB9S 2WV4A 1CU1A 1L4ZA 3ZZCA 1SGFA 4B2BA 1UHBA 3VEQB 1GI5A 7ESTE 1OWEA 5I46H 1CBWC 2FLBH 2Q6DA 1A0LA 1TALA 2QXGA 2VVCA 1P2JA 1B0FA 1FZZA 1QZ8A 3FANA 4LZ4B 3SUGA 1GJBB 4AGKA 2PV9B 1GBKA 2ZDLA 4XE4A 1HJ9A 2ZPRA 3FZZA 3TJNA 1TQ0B 1PQ7A 2ANYA 3RXKA 2PP6A 1XUIA 4I8LA 4GHTA 1C5QA 2AGGX 1S81A 5BRRE 3M7UA 2ANMH 1O3KA 4D8NA 3Q76A 4MVNA 1LHEH 2QE7D 4MG3A 5LPEA 5HIYA 4KKDA 1BTUA 2H5CA 2XNDD 2FOEA 3SU5A 2H9HA 1YLCA 2P8OC 4U30A 4NWKA 2FI5E 3SU1A 2FX4A 4O3UA 3P17H 4DCDA 3HGPA 4UDWH 2Y82A 3E90B 5FPTA 4RN6A 1YBWA 2A5KA 4DT4A 1VCWA 3GCHB 5DP5A 1RD3B 1CVWH 1YPKH 2V3MA 2VVVA 1V2KT 4CRCA 1HPGA 4WXIA 1GVLA 3I77A 2QF3A 3PLPA 4MPXA 5J4QA 2TGTA 1IHSH 2BQ7B 2Z9LA 3MNXA 5FAHA 3RDZA 4E06H 1D3TB 3TGKE 2BD9A 3UFAA 2WSSD 4X0WU 2Y80A 1F5LA 3WWFA 1MBQA 8GCHG 4DIIH 3SQEE 1MCVA 1UTMA 4BXSA 5HXFA 1EB1H 3TNSA 1E1QD 4VGCC 1ZGVA 4MNWA 1UCYH 1XUKA 2OCVB 2Y7XA 1KXAA 4UE7H 1O31A 2OC7A 2J92A 2FTMA 2P16A 3U9AH 5T6DA 1Q2WA 1BMFD 1NROH 2EEKA 2G5VA 5C20A 1TPOA 2J98B 2OBQA 1BTHH 1SGQE 1BHXF 4NZQA 2QAAA 4GVUA 4K1EA 2ZI2H 1AUTC 3MU4A 2PTCE 1DT2A 5DP8A 3T26A 1AE5A 1SI5H 5KECA 5FX5A 3FAOA 3FOAA 4DJZB 2BDCA 3VB5A 4HI3A 2IN2A 1O5EH 4Y11E 2A32A 2KM0A 2NU4E 1UVTH 4Y8YA 3RXFA 4I8KA 2BB4A 5EPYA 5C1XA 1K9OE 3QGNB 2OBOA 2G5NA 1G3BA 2ALVA 2NU0E 1KLJH 1A0JA 4JYVH 4D76A 2ZHWH 4NIWA 4Q2KA 3TLOA 3VGCB 3PV5A 1O3EA 5JYIA 5L2YH 5L2ZH 2W7SA 1C5SA 3I78A 2QXIA 1QFKH 4OGXA 3AASA 1O36A 3MU1A 4K69A 1NRQH 1TMUH 2LPRA 1GCDA 2ZPSA 3GCTF 4A1TA 1NFUA 3WY8A 1LQDB 3TJVA 1SGDE 1TBRH 1O2RA 2A2QH 1DY9A 1GJCB 3JZ1B 1E35B 1DY8A 1QQ4A 8ESTE 4MTBA 4FOUC 3UR6A 1XUHA 1P2MA 2GT7A 3QLPH 3Q3YA 2GTBA 1TNKA 2BVXH 5HKKD 3GCNA 1FLEE 2WV5A 3M7TA 2M5TA 5DN6D 2ZHFH 1AE8H 5A0BA 2FDAA 2AGIX 3BTDE 1GHBG 2G51A 3TH2H 2CGAA 4ZKSU 4KP0A 1OP0A 1UCYE 1WDIA 2G4UA 1C1QA 5CMXH 1QB6A 3OX7U 2AH4X 1TX8A 1TNLA 1HJ8A 1SGTA 2O8UA 3AW1A 1LHGH 1YGCH 2OC8A 1JMOH 3TJUA 7KMEH 4ISLA 2UWPA 1P2KA 1Z8IB 1AKSA 1ZSLA 1PPHE 1S82A 1AU8A 1GI2A 2A4OA 2GT8A 1AN1E 1GGDC 1Y5BT 3RM0H 5EQSA 5EODA 2ZTYA 4JK6A 2ZEBA 1O2PA 1MTSA 1Y3UA 1MCTA 3NZIA 2F9VA 4XBCA 1OP8A 2PW8H 4Y7AA 3UR9A 1SGPE 5EJLA 2P59A 1DITH 4XFQA 3MYWA 3D65E 1EX3A 3P8GA 2KZ4A 1SQRA 4Q80A 3SI4H 3HATH 3ZYEA 4THNH 3S9CA 1H8HD 1N6YA 3EDXB 1GBLA 1JIRA 1UVOA 3MO6A 1GHAF 3SO3A 2THFB 3U8OH 4DG4A 7GCHF 4ISNA 3O8DA 4FUFA 3TITA 1FIWA 2BHGA 3QZQA 3M3VA 1VZQH 3SNDA 1GMHF 2ZGCA 1BZXE 3ZIAD 2A7JA 1AFEH 1EB2A 2XBVA 4H42U 3O8CA 1Y59T 4CHAB 1G9IE 1BTZA 1O34A 1Z8RA 2HVYB 2ZGHA 4INHA 1QL8A 4QT8C 1C5RA 3RP2A 2ZFFH 1MKXH 4HFPB 4WH8A 3PV2A 3SI3H 3UB0A 5C0UA 3ATKA 3KQCA 3ZV8A 1F0UA 3BF6H 2BM2A 4YOJA 2JETB 1TOMH 2UUFB 1L1JA 1S0QA 2I6SA 2C8YB 5EGMA 1O3HA 3MH5A 1PPEE 5IYTA 1BRCE 4RKJB 4WMDA 2BLWA 2CHAC 1V3XA 3D23A 3Q3KA 4IBLH 3U28C 1FY1A 3RXQA 2ZHDA 1NRPH 2B8OH 3PTNA 2D8WA 3DD2H 2WYGA 3SJ8A 1QHRB 2FESH 5GCHF 3F9FA 1GL1A 1HAVB 1O0DH 5ESTE 4ZHLU 4YOGA 3K65B 2QF5A 1EASA 4KTUA 1DXWA 4NA9H 1EAUA 1SLWB 4D7GA 1H9LB 1AWHB 3SQHE 1KXDA 1GJ4H 1C2IA 3BTGE 4YOIA 5H4IB 3OY5U 3UREA 1CA8B 3BTWE 1VJAU 2ZECA 1JBUH 2F83A 1VR1H 1WUNH 2PWXA 1DWEH 1ESAA 2ZQ2A 3E1XB 3PLKA 2OD3B 3SU2A 3LGUA 3GY8A 3EAJA 1YPGH 1PQAA 4YO9A 4FVDA 4H6SB 3T28A 3MQKC 2C8XB 1A3BH 5BPEA 2VIOA 3BEFB 4JCNA 1BJUA 1C5ZB 4X2WA 1P05A 3TPIZ 1GI6A 2A4QA 2HPPH 2QN5T 1P2NA 1L1NA 4MNXA 2H2ZA 1S0RA 2OINA 2BD4A 5EXNA 1QBNA 3E0NB 3RXEA 5TCAA 1C2JA 1TB6H 2ODPA 2WYJA 2Z9JA 2ZC9H 3ATLA 3U8TH 3M3TA 1PPGE 4K8YA 2ZZUH 1GI3A 2G4TA 3G01A 5GNDA 2A4GA 3KQDA 5ESBA 1RJXB 2EQNA 1ZOMA 2Z3DA 2O8LA 1YM0A 1IQJA 3VB3A 2BYAX 2EI7A 4MPVA 3L33A 2JJ1D 1MD8A 2IJD1 2GP9B 1GHYH 5AF9H 1A61H 1TNJA 2G52A 3DT0H 4O03A 4YM9A 1C5WB 2ZTXA 1TBZH 3UY9A 6GCHG 1UTOA 1XXFA 5JBAS 5A0CA 1O30A 1NRRH 4K2YA 1KLIH 5TJXA 2VWNA 4XDEA 4NGAH 1NFXA 5T6FA 3BG4B 2XCFA 4I8HA 1KXFA 3QN7A 1XXDA 1EPTB 3QTOH 1F5RA 3P70B 1NRSH 1NZQH 1DSUA 2WPDD 4MLFB 1ESBA 3OTPA 2BDAA 3EA8A 1RTKA 5FHTA 1O33A 3F2FA 1DM4B 4AZ2B 4Z6AH 3EE0B 1SLUB 1EOJA 3SU3A 1W12U 2HLCA 1C2LA 4FXGH 1O5DH 5KEDA 1BB0B 1BIOA 3DA9B 5EPNA 1UO6A 5TCCA 4ZAEA 1H1BA 3DSPA 4D9QA 2A2XH 3ZZ7A 3CENA 3S9AA 1ESTA 3V0XA 3V3MA 3HK3B 4TWYA 5PTPA 1V2QT 4F4OC 2KR7A 1K1OA 2K8IA 1GBEA 1LVBA 5F8TA 4MPUA 5CHBA 1A5GH 5LPRA 3FVFB 3TK9A 2F3CE 3A8DA 1QA0A 1OHHD 3R0FA 1K28D 1VGCB 3BSQA 1UVUH 5GPIB 1V2UT 1BMLA 1UHBB 2AHME 1CA0C 4F49A 2BX3A 4WWYA 5EOKA 2TIOA 5EW1H 1CT2E 2DE8A 1LO6A 2HLDD 1ARBA 1L1GA 2BD8A 1VCQA 1TGCA 2D1JA 3RLWH 4GUXA 1OWHA 4NA7A 3WW7A 4M9FA 2GDEH 1P57B 4AFSA 2PKSB 4TSFD 1PPFE 1SKYE 1C5YB 1OWKA 3A7YA 1ANCA 4IMZA 1N8OB 4K8BA 4CBOA 1EZUC 3M5NA 2RDLA 2GGVB 1O2WA 2SGQE 1GBIA 3QZRA 3ZZDA 4ZHMU 5K0HA 2YOLA 2RA3A 3BG4C 7GCHG 1YLNA 1GHAG 1INCA 1EP5A 1O3BA 3PRBA 1BRUP 2PFEA 1C1TA 2Z94A 1EPTC 2ZQ1A 3ATWA 3BTTE 3OU0A 5FXLA 3HKIB 1GBAA 1BMAA 3W94A 1C2MA 4GCHG 3T27A 1LHCH 3FFGA 2C93B 1MUEB 1O3IA 5E2OA 1K21H 2VIQA 1AQ7A 1KDQA 1AFQB 1V2ST 1Y5UT 5GIBA 4NWLA 3KNXA 2A31A 4ABBA 3U98H 1GI1A 1SLVB 1W13U 3A8AA 2AMPA 1XM1A 1K0HA 1AGJA 1IQIA 1DX5M 3TGIE 1O2HA 4F55A 1TE0A 5K7RA 2QYIA 1MAXA 4GSOA 3SU4A 1MABB 1YPEH 3TK5A 2OQ5A 2RCEA 1SQTA 1W0JD 1GL0E 2Y5HA 2Z9IA 1GI0A 2J97A 1ETTH 1NN6A 1O2GH 1CSOE 1O39A 1S6FA 4CR5A 1UJ1A 2V3OH 3CNRA 3RC6A 3A7WA 1GCTB 1LVMA 2GKVE 6ESTA 1MZDA 4YXWD 1HAPH 4AGJA 3AK5A 3SUFA 1SHHB 1NT1A 1NPMA 1OWJA 2VIPA 2RFKC 4BAMB 1Z1IA 2STBE 1UW7A 3A89A 3E3TA 4O97A 3RXMA 5LH8A 3MOCA 3MU8A 1P2IA 1ELFA 4MNYA 5DP3A 4AB8A 1C5MD 2QIQA 1UTPA 4Y76A 3FZDA 1C1UH 3AW0A 1FJSA 2EI6A 1ZMJA 3SV9A 5E0JA 2OUAA 1V2LT 2GMTB 1P02A 2XTTB 1E37B 3OY6U 1DICA 1DWCH 2BDIA 2A7HA 4CH8B 1HAGE 3LJOA 2BOHB 1MTNB 3RU4E 4ZXXH 3O8BA 1YPJH 1AIXH 4ASUD 1BBRH 1K2I1 1DUEA 4NIYA 2ZFSA 1HXFH 3ATMA 1S5SA 3SNCA 1C2FA 2ESTE 1VKYA 4CH2B 2BDYA 2GCTC 2A0QB 3SV7A 5DK1A 1FX0B 1CHGA 2JH6D 1SGEE 1EAXA 2J95A 3MWIU 4AFQA 4INLA 1A0HB 2ZFTA 4U01A 2VINA 1ETRH 3LC5A 1EP6A 2O8MA 1LVOA 3T25A 1ZMNA 2A5IA 3SNAA 3VXFH 3GDVA 4M7GA 1NM6A 1L4DA 1C4U2 1QJ6B 2BQ6B 1DSTA 2ZFPH 4B6FA 1QL7A 1GG6C 4LZ1H 1SB1H 2PSXA 2SGDE 2FS8A 3DCLA 4INKA 1MMJN 1RTLA 5E8EH 1B5GH 1Z7KA 2UWOA 1ARCA 3H7TA 4ZXYH 2NU1E 2JKHA 2PGQB 2WPMS 4AC9A 2VWLA 2PR3A 2ZU5A 4ABDA 1GHXH 2BLVA 2P93A 1SMFE 3SHCH 1X7AC 4P02A 1T8NA 4YESB 1K1PA 2IJOB 1IOEA 3UIRA 5FCRA 1FMGA 2VGCB 3RUOA 1FQ3A 1QY6A 2VWMA 1E79D 3AVZA 1HGTH 4IC6A 2R2MB 3ZZ9A 1O3PB 3SYJA 3QO6A 3BN9A 2FX6A 1MH0A 5GDSH 1JWTA 5B6LA 1AKSB 1TGBA 2ZU1A 3FP8E 3FKSD 2EI8A 1H9IE 1RIWB 1O2JA 2FTLE 1WCZA 1J17T 3IG6B 1RRKA 2WINI 2HWLB 5T3HA 4CRBA 1SOTA 4B74A 3F3BA 2ZKSA 4E05H 2J2UA 1WAYB 3BTQE 4HZHA 3PB1E 2OC1A 1GJ6A 3A7TA 1T4UH 4AFUA 1ANBA 3RXSA 1Z8GA 1HNEE 3FP7E 1MQ6A 3PTBA 3UQVA 1BBRE 3V13A 3MHWU 4JZ1A 3QK1A 5DPAA 1GJ7B 2DUCA 2SGEE 1Y5AT 4AG1A 4ZCNA 4ABFA 2VU8E 1MTVA 4DOQA 1C2DA 4CRDA 1KXEA 2XC4A 3F1SB 4OS6A 4UONA 2SNVA 1TGTA 3M5OA 4WF8A 5GJ4B 5C5OA 2BDGA 2AFQB 1FY8E 1G3DA 1QURH 3RXUA 4Q4LA 4NFFA 1ZGIA 1C9TA 1W10U 1AHTH 3GCHC 3OEED 2AS9A 2YNAA 5EU8A 5C94A 2OLGA 4B2AA 2ZDVH 1AB9B 1V2NT 1SC8U 2QXHA 3L6PA 1D3PB 1ELDE 1ACBE 5CDFE 1FPHH 4ISIH 2PGBB 3DHKH 3EQ0H 1YCPH 1UTKA 1LKAA 1O2SA 2UUYA 4UFGH 6CHAB 4JMYA 1AVWA 1DWDH 2H5DA 2OC0A 2RDEA 3MH6A 4AOQA 2AGEX 1C1MA 1TNIA 2AERH 1OKXA 2AMQA 2EC9H 4K5ZA 1IQKA 1FDPA 4I31A 2GZ8A 1LVYA 1J16A 3GICB 4ABGA 2WPIS 4B73A 1A46H 1TPAE 1SHYA 1MD7A 2TRMA 5EXLA 2ANWA 3PO1B 4ZKNU 2SGAA 2A7CA 1GMDG 1GPZA 1O2NA 1UCYK 3E16B 2I6QA 2XBWA 2L74A 5DP6A 4DIHH 4XD7D 1CE5A 3KQEA 1OS8A 4Y0ZE 1V6DA 3UAIC 4AX9H 1P9UA 3UOUA 2FXRA 3LU9B 5AFYH 2GDDA 3GDUA 1GVKB 3SW2B 1THRH 1XVOA 2FOGA 1PPBH 1ZTJA 2Y5FA 2H6MA 1V2MT 2VJ1A 5DP9A 5LGOA 1H4WA 2SGPE 3M37A 3SBKA 1V2WT 3P8NA 2P3FH 2ZDNA 3ZVBA 3Q77A 1T31A 1NU9A 2AYWA 2XBYA 3IWMA 2C8ZB 4Q7XA 1ZPCA 3VGCC 1D3DB 1UVSH 1F0RA 4FUHA 1G3EA 2C90B 2CMYA 2P94A 5JB8S 4TPYA 3RU4T 4JZDH 3TNTA 4FETA 1E36B 3MMGA 3RXBA 2Q1JA 3PM3A 3MI4A 1SLXB 2WHXA 1WV7H 2CK3D 3EA7A 1WU1A 3UTUH 5LPFA 4Z1MD 1V2TT 4FU7A 1NY22 5HM2A 3BEUA 1UTLM 1DOJA 2WUCA 1GBMA 3VFEA 8LPRA 1SSXA 4MQAA 4BXWA 2QF0A 3RXIA 1W7XH 3OYPA 1XKBC 1CHOF 1SGCA 3PWBA 2D26C 2BD2A 1PPCE 5G4BA 1MTUA 1O2UA 2QF4A 2F9OA 5C5NA 1XMNB 2DE9A 5A09A 1YPLH 1MKWH 1EAWA 1ANEA 3M36A 1TAWA 5SGAE 3A84A 3BV9B 3MU5A 4I8GA 1TBQH 2V7QD 3KHVA 3LGVA 2G81E 2JH5D 1XX9A 1BTYA 3KQBA 1O2LA 4BANB 3HK6B 4GLYA 1IQMA 1O3AA 4BNRA 1C2EA 1S85A 1FXYA 4AB9A 4KELA 1TFXA 5EW2H 1E1RD 1WQSA 3CP7A 1E38B 1O2VA 2STAE 1OWIA 1V2PT 1F2SE 3UNSA 2Y5GA 3RXOA 1SGYE 3RXAA 1GI7B 3TIUA 3TK6A 2BVSH 1EQ9A 1GBHA 2A1DB 1A5IA 3F2HA 1ABIH 1MU6B 1ANDA 5DGJA 4D9RA 1TQ7B 3RXDA 1V2RT 5IK2D 3F0OA 2KCAA 5JBCS 3MFJA 1O3JA 5AFZH 1GWAA 3EYDA 2YMSB 2ZCKP 2PSYA 4FU8A 1G3CA 2XBXA 1U6QA 3NXPA 5EQQA 3VG8A 1NRNH 2W6JD 4X6MA 1HYLA 1KXBA 2P3TB 4IN2A 1Y8TA 1TRNA 1TIOA 3NCLA 4FUBA 3TVJB 4CRGA 1P10A 4NCYA 1YPHE 4OS1A 1RS0A 1O2ZA 1G37A 3A86A 4CHAC 3OAAD 3TH4H 3A88A 1BQYA 4GHQA 2R2WU 4JZFH 4K1SA 3K6ZA 3A81A 1C5OH 1TPSA 4TYDA 1JRTA 1XUJA 4HTCH 2WUBA 1J8AA 3B23B 2XW9A 3LIWA 4LK4A 4XBBA 4YT6H 1SBWA 1GJ9B 1MQ5A 1TOCB 1GHZA 3T62A 4E7RG 2G8TA 3CS0A 4X6OA 4ZROA 1GDUA 1MKXK 2JETC 1E34B 2PKAA 1ABJH 4BAQB 4K3JA 1HRTH 5GXPA 1IQEA 1MAYA 3PLBA 3RC5A 5EJZA 1AY6H 1TGSZ 2H9TH 1BRAA 2M2AA 3F9HA 1N6XA 1BTXA 1BA8B 3RMMH 1DLKB 4OS4A 2WPHS 1GHVH 3BTKE 1A1RA 4DGJA 3LGWA 1MKWK 2ZHQH 1C5VA 4KTCA 2HNTF 1LCYA 4TPIZ 3GOVB 3W95A 1O2IA 4TWWA 2FEQH 5CHAB 1C1SA 1JRSA 3GDSA 1XVMA 1BDAA 8GCHF 4Q7ZA 1TX6A 1KDQB 2ZCLP 4X8TH 5C1UA 2W3KA 3H09A 4F48B 1D6RA 2F91A 1GDQA 4O9VA 1ZJDA 2Q6GA 4SGAE 2R0KA 1F5KU 4X8SH 3GCTG 3DUXH 1TWXB 1EATA 1T4VH 5ABWA 2IPQX 2ZA5A 1UVPA 1BT7A 2ALPA 1AZZA 1O3GA 1T8LA 3TU7H 1GJ5H 1HJAB 2FS9A 3N7DA 1NFYA 1TABE 1GBTA 1KSNA 2FOCA 3E6PH 1BCUH 1GBFA 3KCGH 4BTIB 1OXGA 1AI8H 4Z0KA 5ETXA 1EFRD 1HDTH 3OTJE 4ACAA 1QR3E 1KYNA 4X1RU 1OOKB 3L3TA 1OX1A 2HNTE 4B1TA 4BOHA 3PYHA 1BITA 4OGYA 1QJ7B 3ENSB 4WY3A 5JDUB 3GY4A 2BLOA 2FIRH 3SU6A 2ZWLH 4Y8XA 1W3CA 4NIVA 4Y10E 1W14U 2G55A 1ZZZA 1HBTH 1S83A 1O3OA 2H1UA 1FAKH 5GWZA 1HFDA 3AAVA 3NKKA 5J4SA 4YT7H 2ZHEH 3LT3A 5I25A 2F43B 1BUIA 3M5LA 3ZZ8A 1EJMA 1O2OA 2CF8H 4GAWA 4X8UH 4E7NA 1DXPA 1OPHB 1BRBE 4XBDA 1W8BH 1C2KA 5L6NH 1FIZA 3ODFA 4DVAU 1BMMH 2R9PA 2ZNKH 2O8WA 3GY3A 2F9BH 1A4WH 2BOKA 1TA6A 1O32A 1CBWB 1C1PA 1XUGA 2GD4B 2BXUH 2GV6A 2PUQH 3ELAH 1IAUA 3RXPA 1NFWA 3MO3A 2QGRA 3ZZ5A 3N7OA 1ZHRA 4ISHH 1DUAA 5DG6A 2VIVA 3AAUA 1LMWB 3P95A 4CRFA 4TT3D 2CXVA 1LQEA 4ABIA 3E91A 2GZ7A 3ZVFA 1O2MA 1A3EH 1GMHG 1IQGA 4UD9H 1A2CH 2FI3E 1GHBF 2BY7X 3ESTA 1LHFH 4BAOB 1K1JA 4OS2A 1DLEA 1E0FD 2WZQA 3STIA 3ZVCA 2Z9KA 1ID5H 1VITH 1EZXC 1QCPA 1BMNH 3LH1A 5F8ZA 2VBCA 3LJJA 4K60A 2F9NA 2BY8X 3VB4A 1C4Y2 2ZTZA 5C17A 2XNIA 2P8OB 4ZKOU 1NS3A 2KCPA 2R3UA 1AVXA 3I29A 1EPTA 3A85A 3F2GA 1C5UA 1G2MA 1UK4A 1OP2A 1P03A 4Y0YE 2OTVA 1ZHPA 1ZLRA 3ZVEA 4I32A 2PTNA 1J14A 3NRLA 5EIYA 1P04A 4LOYH 1TLDA 1D3QB 1G30B 1YCPM 3ZZAA 1QBOA 2HNTC 1XKAC 3FO8D 3H5CB 1O2KA 4B76A 1EZSC 1YWUA 1C9PA 2FODA 2VH0A 3NPSA 2SFAA 2NWNA 3GY5A 1VGCC 1RXPA 5DP7A 3HKJB 5GCHG 4X1NU 5EQRA 5A8XA 4AYVB 1O5CB 2BX4A 3QTVH 4ABHA 1KXCA 2RA0A 1AVGH 1ZSKA 3N99A 5DKMA 2FM2A 4A92A 1GMCF 1T7CA 1NO9H 3ZVAA 3OE7D 2F9PA 1GHWH 3PMBB 3SZEA 3B8JA 1FNIA 3OFND 1P01A 3SJKA 5HYOA 4YTAA 3RXRA 4NFEA 3LGIA 5A2MH 4A6LA 2QCYA 3SHAH 1VITF 4J2YB 1P12E 2CF9H 2ZCHP 2Y7ZA 2FMJA 1SGIB 5EG4A 3M7QA 2PKSC 5DJ7A 1G32B 3P8OA 2H9EH 3LOXA 4AN7A 1N8OC 1IQHA 2J9NA 1Y3YA 1ZRKA 3EA9A 2ZIQH 3S69A 1GI4A 1EUFA 2ZFQH 5HGGA 1QL9A 2BY9X 1QBVH 1MZAA 4UFFH 1JIMA 3ZVGA 2KAIA 1AMHA 4Q7YA 2W6ID 4Y7BA 2VVUA 1K1LA 4FUJA 2PHBA 3SUDA 1AFQC 3SV6A 2BQWB 2TGDA 1KMHB 4NSVA 2R3YA 2GCHF 2C4FH 2XRCA 3LKWA 1ELGA 3UNRA 3RU4D 3EGKH 1WTGH 4NSYA 2A5AA 2P95A 1Z71A 1DDJA 1HAIH 3RXJA 1AD8H 3SUEA 1FV9A 4JZIA 4Y6DA 3RMNH 1ELCA 3C1KA 1O2YA 2PLXA 3K2UA 1L0ZA 1O38A 3RXVA 4IW4E 2QXJA 3M35A 1HCGA 1QNJA 1SL3A 2BZAA 3W1EA 1N1LA 3FP6E 2GX4A 2HVXA 1TONA 1TRMA 3KQ5A 1Y3XA 1LHDH 3D49H 2ZDAH 5C1YA 1ELBA 1PFXC 1QB1A 1GCTC 2Z3EA 2IOTA 1EJNA 3K6YA 3PRDA 1O3MA 3Q3XA 1F0SA 1YKTA 4XSKU 1YPMH 2QC2A 1W0ZU 1SQAA 4HG6A 1Q31A 1HIAA 1WBGB 2GJGA 2J38A 4OM9A 1SGFG 2NU2E 4X1QU 1OYTH 2XC0A 3HPTB 2A45B 4WMFA 1TPPA 3GCOA 5C2ZA 1DE7H 1FY5A 4U2WA 1GVZA 2TGPZ 4WMEA 1ZPBA 3ATIA 1C5NH 1PJPA 1EAIA 2GMTC 4ABEA 4DT7B 5C3NA 4NG9H 4MNVA 3LGTA 1QQUA 1IQLA 2F4LA 5FBIA 1MTNC 3RC4A 2O8TA 3UWIA 1T8MA 4A7IB 1YLDA 5E0GA 4P00A 3TH3H 1WSSH 2BXTH 1W0KD 1P09A 1ELEE 1TMTH 1C2HA 5T1VA 4ISOA 1ZHMA 1LDTT 1ZTLA 1GGDB 2QY0B 1QRZA 4H4FA 4WXVA 1WTHD 4FUIA 1SOZA 5DSFA 1TNHA 1BBRK
chains in the Genus database with same CATH topology
3SJ9A 1GBCA 2D2DA 1K1IA 2BY6X 2Z7FE 6GCHF 1D4PB 4DURA 1LKBA 4BAKB 2W26A 1VCPA 1THPB 1ZTKA 3MNSA 4OS7A 2AMDA 1H8IH 1IHTH 3O8RA 1SGRE 1W0YH 1XUFA 1V2JT 2BD7A 1P9SA 1IQNA 1ETSH 4R8TB 2TGAA 5FPSA 2ZFRH 1CGHA 1NTPA 2VB0A 3BTEE 1FN8A 4X8VH 1O37A 1GI9B 3S7KB 4GPGA 4FUDA 5DO4H 1FUJA 5JBBS 1NU7B 4X6NA 1BHXB 2OQUA 5T6GA 4NIXA 4B71A 2ANKH 3E8LA 2V3HH 2ZU4A 2BLQA 1ELAA 1V2OT 2XC5A 1J9CH 3SJIA 1KY9A 5JPMH 4D7FA 4KTSA 1A5HA 1SG8B 2BMGB 5EXMA 1PQ8A 4ZHAA 2FYRA 2VGCC 3UQOA 1D9IA 2BVRH 2OXSA 1CQQA 1C5TA 3UWJH 1HAXB 3KN2A 2W3IA 2QA9E 1RIWC 2BD3A 2AEIH 3OSYA 2CHAB 1C5PA 1BTPA 1HXEH 4TY6A 9LPRA 1AZ8A 3QGJA 4X1SU 2FOHA 2FO9A 3U69H 3DFLA 3VB7A 1TYNA 1YYY1 2FYQA 1D6WA 1BTWA 5FX6A 1GJAB 4AORA 2HPQH 2AIPA 4YLQH 4FVBA 2HRVA 4HGCA 3MH7A 2PUXB 1GJ8B 3PWCA 2ZP0H 1DANH 2QV1A 2ZU2A 5C67A 1C1RA 4WVPE 3A8BA 3KL6A 3RLYH 3SGBE 1RTFB 1EXFA 1SQOA 2ASUB 2FZZA 2FWWA 1QRXA 3MU0A 4A1XA 3B9FH 1FONA 2GZ9A 1GBBA 1MBMA 1PPZA 2TPIZ 1FN6A 4Y79A 2YNBA 2ZG0H 3MNCA 3E0PB 2ODQA 3URDA 3LONA 1GMCG 1YC0A 5E2PA 1HAOH 4ABJA 3PMJA 1C2GA 1UMAH 2ULLA 3ZZ3A 1AB9C 1BJVA 1EJAA 1ZSJA 3BTHE 3S9BA 1ZJKA 1T8OA 2R0LA 1CT4E 2RG3A 3SNBA 3T29A 1VITG 4UFEH 3S0NA 1P0SH 3BG8A 2PKAB 4GCHF 1TA2A 3SNEA 1HAZB 1JXPA 1HB0B 1IQFA 3RXGA 3CS7A 3URCA 4JYUH 6CHAC 2FP7B 3R3GB 1UK2A 1YF4A 1C1VH 1O2XA 1YCPK 5CE1A 2SNWA 3ODDA 3SN8A 3RM2H 1B7XB 1ZPZA 2IPHA 3UOPA 1SFIA 5HM9A 1W2KH 1Y3VA 5F03A 1W11U 3P6ZB 3UNQA 3PO1C 5FCKA 1F92A 1O3CA 4ZUHA 3V12A 4FUCA 4CBNA 1Y3WA 1TNGA 3HGNA 2VIDA 1TRYA 1C1WH 2HALA 5JBTA 1A7SA 2ODYB 4I8JA 3SORA 2B0FA 1FAXA 3KGPA 1KIGH 1C1NA 3IITA 1PYTD 1O5GH 3RMLH 3SU0A 2GCHG 4FUEA 2VNTA 1QA7A 5IDKA 1V2VT 5F6MA 2BD5A 1OSSA 3LH3A 4IS5A 5FPYA 4X2XA 4BTUB 3RXHA 3T5FH 3A80A 1TX7A 1Z8JB 2SGFE 1F7ZA 2W7UA 1ZRBA 1O5FH 3QDZB 1NESE 2GV7A 1DFPA 2FOFA 2FOBA 1O2QA 3KF2A 4UFDH 4WH6A 2F9UA 3BTME 4YLUA 1JOUB 3P8FA 1ZR0A 1KTTB 4MPWA 3SGAE 5DP4A 3GISB 1WQVH 3LDXH 3A7ZA 1WOFA 2WPKS 4ZKRU 6LPRA 4MDSA 4JYTA 1W7GH 1CT0E 1Z6EA 2XXLA 2B9LA 1LPZB 3V7TA 3BIVH 1KTSB 1SFQB 4B2CA 4A1VA 5AHGH 1C1OA 2J94A 3ZYDA 2C3SA 1EKBB 3S7HB 1SGNE 2K1QA 3M3SA 3MO9A 3ZZ6A 1PQ5A 1CA0B 1OWDA 3H7OA 2UUJB 5A8ZA 1DWBH 2WPJS 3M61U 4Y71A 3RXLA 1P8VC 4BTTB 1PYTC 1O2TA 1M9UA 3GYMA 1GI8B 3VPKA 4B75A 3GY7A 1P3EA 3QX5H 3PMAB 3C27B 3JZ2B 4Y8ZA 3P92A 3LPRA 1Q3XA 4FU9A 1O5BB 1G36A 3STJA 1NC6A 2BDHA 3Q00A 3GY6A 2J4IA 2CJIA 1P2QA 4AYYB 2BY5X 3GYLB 5A0AE 1H9HE 2Y6TA 4ZH8A 2G00A 3U1JB 1ZYOA 1EZQA 3M5MA 4IGDA 2BTCE 3K9XB 3RXCA 1L2EA 3KIDU 2CN0H 1C4V2 2LNCA 4DW2U 2AIQA 1G2LA 1UTNA 3GY2A 3PROA 1HAVA 3F6UH 3VXEH 2B5TB 2Z9GA 4CRAA 1UK3A 2Z3CA 3SV2H 1CGIE 1DVAH 1HAYB 3SJOA 2GVFA 1HLTH 3D62A 3QUMP 1B0EA 1ELTA 1RGQA 3TJOA 4A5TS 4ZMAH 4FUGA 2VIWA 4IN1A 3PMHB 4I33A 2V0BA 1YPHC 2B7DH 2FOMB 3BEIB 4H6TA 7LPRA 1GJDB 3A83A 2UUKB 4LXBH 2VH6A 1TMBH 3ZVDA 2BDBA 3U1IB 2XWAA 4JK5A 1BOQA 1EOLA 1UTQA 2ZGJA 3ZZ4A 1AWFH 3UPEA 2P3UB 1F0TA 1P2OA 2V35A 1Z6JH 4JZEH 3T2NA 1SPJA 1GBDA 2TBSA 4ASHA 2CV3A 3RMOH 2ZO3H 2XYAA 1DS2E 1DPOA 2UWLA 1QJ1B 2ZPQA 4NA8A 1QRWA 1T32A 4ESTE 1FY4A 1J15A 2WPLS 1FI8A 4NZLA 1THSH 1AO5A 1OYQA 4OS5A 2Y81A 3KEEA 1AUJA 3SGQE 1P06A 4K1TA 1TGNA 5L30H 3VB6A 1C5XB 1ZMLA 2FI4E 2HOBA 1K1MA 1FY3A 3A8CA 3A7XA 3A87A 4RSPA 1O3FA 4I7YH 2XWBI 1UTJA 1GDNA 1K22H 2ZU3A 4X6PA 3TGJE 3ZV9A 4X2YA 2JH0D 3BTFE 9ESTA 4J1YA 2KAIB 4AFZA 3QWCH 2FLRH 1S84A 5CHAC 3A82A 2BZ6H 2W5EA 3MH4A 4O3TA 5AVDA 2Q6FA 1ORFA 2ZDMA 1P11E 2VWOA 2HGTH 1O3LA 1QTFA 3MTYA 1CGJE 1FPCH 5A8YA 4WJG2 3UUZA 3NK8A 2ZGXH 3F9GA 3ITIA 1QB9A 2A4RA 2O9QA 4R0IA 2V6NA 1S6HA 1GMDF 3SOSA 3DFJA 4DY7B 1HJAC 4ABAA 1VJ9U 5HMAA 3A7VA 1SR5C 1MU8B 3U8RH 4UEHH 5FBEA 4U32A 5E0HA 4PROA 1SVPA 2XCNA 2GCTB 1YP9A 1CHOG 1O3DA 1HV7A 1LTOA 2Z6BD 3PV4A 1WYKA 4KGAA 1LPKB 3F9EA 4SGBE 2EA3A 1HAHH 1HUTH 4IC5A 4TY7A 4RKOB 1K1NA 3F68H 1C5LH 1O3NA 3ZZBA 1CO7E 3LGYA 3LC3A 5F8XA 4BAHB 4AG2A 2FOAA 2ZF0H 2FPZA 4YZUA 1GG6B 3SV8A 3SZNA 3MNBA 2C8WB 3NUMA 1H8DH 2OP9A 1MTWA 1RFNA 2J34A 3NWUA 1O35A 4X1PU 1QIXB 2ZGBH 1HIAB 4X2VA 2ILNA 1P3CA 4CR9A 2NU3E 4XOJA 4IMQA 5B6OA 1ELVA 1GBJA 1Z1JA 2ZDKA 4VGCB 3BIUH 3RXTA 1LPGB 1O5AB 8KME2 1KLTA 4CREA 1QGFA 5JB9S 2WV4A 1CU1A 1L4ZA 3ZZCA 1SGFA 4B2BA 1UHBA 3VEQB 1GI5A 7ESTE 1OWEA 5I46H 1CBWC 2FLBH 2Q6DA 1A0LA 1TALA 2QXGA 2VVCA 1P2JA 1B0FA 1FZZA 3FANA 4LZ4B 3SUGA 1GJBB 4AGKA 2PV9B 1GBKA 2ZDLA 4XE4A 1HJ9A 2ZPRA 3FZZA 3TJNA 1TQ0B 1PQ7A 2ANYA 3RXKA 1XUIA 4I8LA 4GHTA 1C5QA 2AGGX 1S81A 5BRRE 3M7UA 2ANMH 1O3KA 4D8NA 3Q76A 4MVNA 1LHEH 4MG3A 5LPEA 4KKDA 1BTUA 2H5CA 2FOEA 3SU5A 2H9HA 1YLCA 2P8OC 4U30A 4NWKA 2FI5E 3SU1A 2FX4A 4O3UA 3P17H 4DCDA 3HGPA 4UDWH 2Y82A 3E90B 5FPTA 4RN6A 1YBWA 2A5KA 1VCWA 3GCHB 5DP5A 1RD3B 1CVWH 1YPKH 2VVVA 1V2KT 4CRCA 1HPGA 4WXIA 1GVLA 3I77A 2QF3A 3PLPA 4MPXA 5J4QA 2TGTA 1IHSH 2BQ7B 2Z9LA 3MNXA 5FAHA 3RDZA 4E06H 1D3TB 3TGKE 2BD9A 3UFAA 4X0WU 2Y80A 1F5LA 8GCHG 1MBQA 4DIIH 3SQEE 1MCVA 1UTMA 4BXSA 5HXFA 1EB1H 3TNSA 4VGCC 1ZGVA 4MNWA 1UCYH 1XUKA 2OCVB 2Y7XA 1KXAA 4UE7H 1O31A 2OC7A 2J92A 2FTMA 2P16A 3U9AH 5T6DA 1Q2WA 1NROH 2EEKA 2G5VA 5C20A 1TPOA 2OBQA 1BTHH 1SGQE 1BHXF 4NZQA 2QAAA 4GVUA 4K1EA 2ZI2H 1AUTC 3MU4A 2PTCE 1DT2A 5DP8A 3T26A 1AE5A 1SI5H 5FX5A 3FAOA 4DJZB 2BDCA 3VB5A 4HI3A 2IN2A 1O5EH 4Y11E 2A32A 2NU4E 1UVTH 4Y8YA 3RXFA 4I8KA 2BB4A 5EPYA 5C1XA 1K9OE 3QGNB 2OBOA 2G5NA 1G3BA 2ALVA 2NU0E 1KLJH 1A0JA 4JYVH 4D76A 2ZHWH 4NIWA 4Q2KA 3TLOA 3VGCB 1O3EA 5JYIA 5L2YH 5L2ZH 2W7SA 1C5SA 3I78A 2QXIA 1QFKH 4OGXA 3AASA 1O36A 3MU1A 4K69A 1NRQH 1TMUH 2LPRA 1GCDA 2ZPSA 3GCTF 4A1TA 1NFUA 3WY8A 1LQDB 3TJVA 1SGDE 1TBRH 1O2RA 2A2QH 1DY9A 1GJCB 3JZ1B 1E35B 1DY8A 1QQ4A 8ESTE 4MTBA 3UR6A 1XUHA 1P2MA 2GT7A 3QLPH 3Q3YA 2GTBA 1TNKA 2BVXH 3GCNA 1FLEE 2WV5A 3M7TA 2M5TA 2ZHFH 1AE8H 5A0BA 2FDAA 2AGIX 3BTDE 1GHBG 2G51A 3TH2H 2CGAA 4ZKSU 4KP0A 1OP0A 1UCYE 2G4UA 1C1QA 5CMXH 1QB6A 3OX7U 2AH4X 1TX8A 1TNLA 1HJ8A 1SGTA 2O8UA 3AW1A 1LHGH 1YGCH 2OC8A 1JMOH 3TJUA 7KMEH 4ISLA 2UWPA 1P2KA 1Z8IB 1AKSA 1ZSLA 1PPHE 1S82A 1AU8A 1GI2A 2A4OA 2GT8A 1AN1E 1GGDC 1Y5BT 3RM0H 5EQSA 5EODA 2ZTYA 4JK6A 2ZEBA 1O2PA 1MTSA 1Y3UA 1MCTA 3NZIA 2F9VA 4XBCA 1OP8A 2PW8H 4Y7AA 3UR9A 1SGPE 2P59A 1DITH 4XFQA 3MYWA 3D65E 1EX3A 3P8GA 4Q80A 3SI4H 3HATH 3ZYEA 4THNH 3S9CA 1N6YA 3EDXB 1GBLA 1JIRA 1UVOA 3MO6A 1GHAF 3SO3A 2THFB 3U8OH 4DG4A 7GCHF 4ISNA 3O8DA 4FUFA 3TITA 1FIWA 2BHGA 3QZQA 3M3VA 1VZQH 3SNDA 1GMHF 2ZGCA 1BZXE 2A7JA 1AFEH 1EB2A 2XBVA 4H42U 1Y59T 4CHAB 1G9IE 1BTZA 1O34A 1Z8RA 2ZGHA 4INHA 1QL8A 4QT8C 1C5RA 3RP2A 2ZFFH 1MKXH 4HFPB 4WH8A 3SI3H 3ATKA 3KQCA 3ZV8A 1F0UA 3BF6H 2BM2A 4YOJA 2JETB 1TOMH 2UUFB 1L1JA 1S0QA 2I6SA 2C8YB 5EGMA 1O3HA 3MH5A 1PPEE 5IYTA 1BRCE 4RKJB 4WMDA 2BLWA 2CHAC 1V3XA 3D23A 3Q3KA 4IBLH 1FY1A 3RXQA 2ZHDA 1NRPH 2B8OH 3PTNA 2D8WA 3DD2H 2WYGA 3SJ8A 1QHRB 2FESH 5GCHF 3F9FA 1GL1A 1HAVB 1O0DH 5ESTE 4ZHLU 4YOGA 3K65B 1EASA 4KTUA 1DXWA 4NA9H 1EAUA 1SLWB 4D7GA 1H9LB 1AWHB 3SQHE 1KXDA 1GJ4H 1C2IA 3BTGE 4YOIA 5H4IB 3OY5U 3UREA 1CA8B 3BTWE 1VJAU 2ZECA 1JBUH 2F83A 1VR1H 1WUNH 2PWXA 1DWEH 1ESAA 2ZQ2A 3E1XB 3PLKA 2OD3B 3SU2A 3LGUA 3GY8A 3EAJA 1YPGH 1PQAA 4YO9A 4FVDA 4H6SB 3T28A 2C8XB 1A3BH 5BPEA 2VIOA 3BEFB 4JCNA 1BJUA 1C5ZB 4X2WA 1P05A 3TPIZ 1GI6A 2A4QA 2HPPH 2QN5T 1P2NA 1L1NA 4MNXA 2H2ZA 1S0RA 2OINA 2BD4A 5EXNA 1QBNA 3E0NB 3RXEA 5TCAA 1C2JA 1TB6H 2ODPA 2WYJA 2Z9JA 2ZC9H 3ATLA 3U8TH 3M3TA 1PPGE 4K8YA 2ZZUH 1GI3A 2G4TA 3G01A 2A4GA 3KQDA 5ESBA 1RJXB 1ZOMA 2Z3DA 2O8LA 1YM0A 1IQJA 3VB3A 2BYAX 2EI7A 4MPVA 3L33A 1MD8A 2GP9B 1GHYH 5AF9H 1A61H 1TNJA 2G52A 3DT0H 4O03A 4YM9A 1C5WB 2ZTXA 1TBZH 3UY9A 6GCHG 1UTOA 1XXFA 5JBAS 5A0CA 1O30A 1NRRH 4K2YA 1KLIH 5TJXA 2VWNA 4XDEA 4NGAH 1NFXA 5T6FA 3BG4B 2XCFA 4I8HA 1KXFA 3QN7A 1XXDA 1EPTB 3QTOH 1F5RA 3P70B 1NRSH 1NZQH 1DSUA 4MLFB 1ESBA 2BDAA 3EA8A 1RTKA 5FHTA 1O33A 1DM4B 4AZ2B 4Z6AH 3EE0B 1SLUB 1EOJA 3SU3A 1W12U 2HLCA 1C2LA 4FXGH 1O5DH 1BB0B 1BIOA 3DA9B 5EPNA 1UO6A 5TCCA 4ZAEA 1H1BA 4D9QA 2A2XH 3ZZ7A 3CENA 3S9AA 1ESTA 3V0XA 3V3MA 3HK3B 4TWYA 5PTPA 1V2QT 4F4OC 1K1OA 1GBEA