1C5PA

Structural basis for selectivity of a small molecule, s1-binding, sub-micromolar inhibitor of urokinase type plasminogen activator
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords PROTEIN (TRYPSIN)
publication title Structural basis for selectivity of a small molecule, S1-binding, submicromolar inhibitor of urokinase-type plasminogen activator.
pubmed doi rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 1999-12-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5pA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1c5pA02
1H9HE 2BD9A 5C1XA 2VWOA 4UD9H 1HAIH 2R2MB 3T25A 2BDAA 1K1PA 1GI8B 4D7FA 4FUEA 1IQNA 4B2AA 1EZXC 1SSXA 1ZSLA 4WXIA 2SNWA 1GI2A 1DS2E 2EA3A 3SQEE 3RC6A 1BUIA 2A5KA 5JYIA 4JZFH 1NPMA 1O2TA 1O5DH 4JZDH 4UE7H 5BRRE 4YO9A 2ZKSA 1OOKB 1WBGB 5T6GA 2WV5A 3D49H 2ZHFH 3KQBA 2BHGA 2ZDLA 4X2XA 4B75A 3ZV8A 2BVRH 4CR5A 1M9UA 4I8JA 1PPCE 2QF3A 5EPYA 2OC7A 2GD4B 2W7UA 3IWMA 2BD8A 1DUEA 2VIWA 4XDEA 2BX4A 2ANWA 3SNEA 1AUTC 3TK6A 2A0QB 4ZKRU 3EAJA 2PSXA 1A7SA 1ZRBA 5LPRA 3OY6U 1LVMA 3RXMA 1F5LA 2VWMA 4A5TS 1UVTH 2H1UA 1G9IE 4X6NA 3UWIA 1A5IA 1OPHB 1UCYK 1GCDA 1O3HA 2XC0A 3VB4A 1UMAH 4X0WU 1O2PA 1N8OB 1DT2A 3BG4C 3GY4A 4YTAA 4YOIA 1BTPA 2PKAB 1IQKA 2GT7A 3BTTE 1C2FA 1O2IA 1C5YB 1WYKA 4YOJA 2XYAA 4CRDA 3MMGA 4WWYA 2FOMB 2CGAA 3DT0H 2P94A 3SJ8A 1AWFH 4KELA 2OD3B 4U32A 3VXEH 3UNQA 1CGJE 1O2WA 5JPMH 1J16A 3CP7A 4NIVA 4AFSA 3ZZ3A 1XMNB 2XBVA 5TCCA 2ZA5A 1NU7B 1GMHG 1YYY1 4HGCA 4JMYA 1E38B 1ANCA 3F9FA 5FX5A 1GHZA 2I6QA 3P92A 5GWZA 5CHAC 1BCUH 2AIPA 2QIQA 4MPUA 5EQRA 2ZU5A 2OC1A 1D3TB 3PLBA 1PPZA 2PV9B 1QTFA 3H7TA 4ZMAH 1EJAA 4NWLA 1F92A 2QXHA 3TNTA 1J8AA 1NN6A 2FLRH 1GHBF 4FVBA 4CR9A 2YNBA 3JZ1B 4DY7B 3BEIB 1EJMA 3V0XA 2OQUA 4OS1A 5E0JA 1XX9A 2J95A 1BIOA 1K9OE 4JZEH 1K1JA 4OS7A 2BY9X 1UK3A 1W14U 1DWEH 3M3SA 2EI8A 4ZHLU 4ABFA 3ZZ6A 2OTVA 1ZPCA 1V3XA 5CE1A 2FI3E 1SVPA 1RXPA 1TBZH 3KCGH 3NKKA 2AS9A 4UFDH 4Q80A 1QA7A 1TX6A 5E8EH 2ZFRH 1JMOH 1V2NT 3GY8A 4DIHH 3A82A 1ABJH 4DW2U 4I8HA 2UUYA 1BTWA 2BDBA 2ZHWH 2QXJA 1SHHB 1GJ4H 4ISIH 3P17H 2GMTB 6CHAC 2GZ7A 3IG6B 2A2XH 4ZKOU 2H9HA 3P8GA 1ELEE 1V2TT 2AIQA 1GJAB 2ZF0H 2A4GA 4ABGA 1QIXB 1F7ZA 3CS7A 2VH0A 1C2JA 3F9HA 1ZHMA 2ZWLH 1QRWA 2FTMA 2ZGHA 2XC5A 1LPGB 1FY4A 1KXBA 1TGSZ 2O8LA 1TQ0B 2Z3EA 4HFPB 2J94A 3T28A 3SUEA 1TALA 1SQOA 2FOBA 4IGDA 1GBDA 2C8YB 3PMJA 1SPJA 1ZMJA 1CHGA 1T8NA 2WPIS 1O3FA 1YPEH 1HAPH 3KEEA 2J34A 1W2KH 1GG6B 1TNLA 5DP4A 3Q76A 1EOJA 2STAE 2ZDMA 5EU8A 1C2GA 1W0YH 4JZ1A 2STBE 2AERH 1P0SH 2A4QA 3ZZ8A 1TBRH 1L4ZA 3O8DA 1UTPA 1F5KU 1FAKH 3VB6A 3D62A 1TOCB 4NA8A 4D76A 3T26A 3QWCH 1QL8A 1EOLA 1N1LA 1O2RA 1GBIA 5F8TA 1AFQB 3M5LA 1AWHB 2YOLA 1D6RA 1SGQE 1DUAA 1D3PB 2KAIB 3MU0A 3O8BA 1ESAA 3UTUH 1ZHPA 1KTTB 1G3BA 1XM1A 1DLEA 1BMLA 2TGPZ 3S69A 1OWKA 3LGTA 2AGGX 4X8UH 3QTVH 1GHYH 4F4OC 1X7AC 1GL1A 1XKAC 4WY3A 1BHXF 2FZZA 1ANBA 1Y5UT 2CF9H 2GCTB 3VGCB 2BM2A 5A8YA 3T2NA 4MNVA 3QGJA 1P09A 4ZROA 2OBOA 1BRCE 1S81A 1AD8H 1BMNH 1D6WA 1S5SA 3EA7A 2FO9A 1GJDB 2XCNA 1GBHA 2DE9A 1A5HA 1KIGH 1NRQH 1DWBH 3ZZDA 2PTNA 3BG8A 3FZDA 2VINA 1IQIA 2BDCA 5FPSA 2JKHA 3ZVEA 1TNGA 2VVVA 3FAOA 1CO7E 4HTCH 1GHXH 1UTOA 3PM3A 1LO6A 1ZHRA 3MO3A 4RSPA 1K2I1 2OUAA 1GJBB 1A0LA 1AGJA 2XWAA 4KKDA 2DE8A 4O97A 2B7DH 1O33A 4INLA 6GCHG 1SGPE 2PKAA 5K7RA 1YGCH 1P03A 3SV2H 3LIWA 3SV6A 3SNAA 3GISB 1EZQA 3AW0A 1XUIA 3BEUA 3ELAH 2R3UA 1BJVA 2D26C 2NU1E 3K9XB 2JETB 5JBCS 1SR5C 3K6YA 1T4UH 3R3GB 4MQAA 2C4FH 1AI8H 3ATLA 3V3MA 1YBWA 4AX9H 3SGAE 5LGOA 3SJKA 1HJAC 4D8NA 4A1TA 1DITH 3VXFH 4IN2A 1RD3B 2UUJB 3UFAA 1NFYA 3UQOA 1TPAE 1ELGA 1TBQH 5FBEA 4ESTE 4DOQA 1O34A 1B5GH 1T8OA 2B5TB 2ZDNA 2FYRA 2P93A 1UHBB 1WSSH 2G8TA 5DP3A 3P8OA 4Y8XA 3M7UA 5C1UA 3BIVH 4LK4A 3BTFE 1P9SA 1EUFA 1ESTA 4SGBE 1Y59T 2B9LA 1KXAA 4ABJA 1NTPA 4YESB 1O3GA 2QV1A 1F0SA 3A7XA 2ZGCA 2C93B 4Y8YA 5C2ZA 3SOSA 4ISLA 1YPMH 2OQ5A 1MAXA 3O8RA 1C2MA 1RTFB 3SW2B 1FI8A 4UDWH 1NFWA 3K65B 5ESBA 2F9OA 1ZTKA 2WPHS 4JZIA 2GMTC 2YNAA 1MZAA 1TONA 3SGBE 2XWBI 1IHTH 3DA9B 2A45B 1TNIA 3FANA 4NG9H 3MHWU 3UNRA 3KN2A 4YM9A 2ANMH 1GCTC 1G3CA 1FY8E 4AN7A 4ABHA 3UR9A 3E8LA 4YZUA 1P01A 4WMEA 1GBKA 4X1QU 5DG6A 5AF9H 1JXPA 1SG8B 3OX7U 2ZU2A 4BANB 1ABIH 2TBSA 3PMAB 3A8CA 3GY3A 3PYHA 5DKMA 2QXGA 5F03A 2VIPA 3BTWE 3DD2H 1E36B 4J1YA 1QY6A 1ELFA 1T8LA 1F0RA 1C1SA 1PQ8A 3PB1E 3KIDU 3S7KB 1GJ6A 2Z94A 1A3EH 1MTNC 3A8AA 1HB0B 4KGAA 2G4UA 4MDSA 3BV9B 1MKXK 4CBNA 3KL6A 1MQ6A 2J92A 4ZH8A 1UTJA 3BG4B 3B8JA 3KQCA 4HI3A 1ZPZA 1ZOMA 4E06H 1JRSA 2ASUB 1BHXB 2FI5E 3MNSA 2A7JA 3A7TA 1DFPA 1HJ8A 1LCYA 3RXEA 2AFQB 4ZXYH 1QB1A 2R0LA 1BTHH 4X1RU 5AFYH 1OWIA 4Z6AH 1L2EA 1DY9A 1G3EA 1BOQA 1TQ7B 2Q6FA 2Z3CA 3F68H 3RXOA 2QC2A 2XBXA 3U8TH 3K2UA 4AYYB 3SUGA 2V3OH 3A89A 3GCHB 3SJIA 2XNIA 1FZZA 5SGAE 2GCHG 4ISOA 4RKOB 1ELTA 3BIUH 5A09A 5B6OA 1C1UH 3G01A 5CHAB 2XCFA 4FUCA 4K8YA 2J2UA 2UWLA 1F2SE 1L1GA 1S6FA 1UCYH 2EI6A 2G52A 2SFAA 1O2ZA 2SNVA 2ZFTA 1OS8A 3W95A 1HAYB 2GCTC 3S9CA 4IMZA 1FV9A 2BD2A 3GY6A 3TH4H 4Y79A 2KAIA 3ZZ5A 2ZFQH 3AAUA 4BAHB 2HVXA 1Y3UA 3ITIA 4IC6A 4Y7BA 1O2UA 5L2ZH 2PUXB 4Y11E 3GCTF 3PV4A 3PROA 5DPAA 6LPRA 1SGTA 1VGCC 3VB7A 2H9EH 1KYNA 3S7HB 2Q6GA 4IS5A 3E16B 3SO3A 1YPLH 2BQWB 3ENSB 2OP9A 3UY9A 1L1NA 1AMHA 1YCPK 1A0JA 1OWHA 3Q3XA 2PGBB 3I77A 1KXDA 2ZNKH 1KXCA 4ZKSU 1CSOE 1SMFE 1SGNE 3LJJA 2FPZA 4TWWA 2VWNA 1DE7H 1VITF 1MTSA 2FESH 2W7SA 2FX4A 3SU0A 2ALVA 1Q3XA 1O2NA 1IQLA 4H42U 2G51A 4KTCA 1EATA 2G55A 2TIOA 3W94A 3L33A 3MU5A 5A8ZA 4J2YB 3ZZ7A 2M5TA 3UUZA 2B0FA 1MCVA 1TE0A 1DSUA 5J4QA 3M7TA 1GI7B 4AB8A 1O38A 1QBOA 1SLUB 2ZPRA 3U1JB 4FUHA 3SI3H 1K1IA 5JB8S 1O3AA 1TNKA 4BXSA 1QJ7B 4FXGH 2ZEBA 1Z8IB 3HGPA 1EQ9A 1HBTH 1TGCA 2ODYB 1LDTT 2BD5A 1DICA 1XUGA 3Q77A 4LZ4B 2Y7XA 4ZAEA 1TYNA 4X6OA 1A5GH 3RLYH 1O3JA 1K22H 3SU5A 2P8OB 3HKIB 3MO9A 5FXLA 1QL9A 1IQMA 2O8TA 3UNSA 3SU4A 5T3HA 1RJXB 4X2YA 1JRTA 1SLXB 1UHBA 1FIWA 2SGDE 4DVAU 2WPKS 3KF2A 2R0KA 1SGYE 2H5DA 2XRCA 1BTXA 4LZ1H 3O8CA 1IOEA 1RFNA 2C3SA 1KTSB 1PYTD 2F83A 4MNWA 4WF8A 1Z1JA 1HAXB 2LPRA 1Y8TA 1GBLA 2FEQH 2P3FH 3RXSA 1C1NA 4I8LA 4KTSA 3F9GA 3KQEA 1AB9C 1VZQH 1H9LB 4UFGH 1E0FD 2ZDAH 3RU4D 1TPPA 3FP8E 1SGDE 1YPHE 1WU1A 1PPGE 1H8DH 1DXPA 1UVSH 1Q31A 3IITA 4DCDA 1PPFE 3QX5H 5EOKA 3S9AA 2FODA 4IN1A 1JBUH 5DP5A 2ZHDA 3LGVA 1CBWC 2P95A 3MH5A 4XFQA 3QN7A 1EXFA 4RN6A 3RC4A 4A92A 1O35A 2VVUA 3ZVGA 3CENA 1LQDB 3A8BA 4CREA 1NY22 1YP9A 4AFZA 1GI0A 3A7YA 5PTPA 4CBOA 3MO6A 1O31A 3EE0B 1RIWC 2G4TA 2WUBA 3UWJH 1O2XA 5FBIA 1O0DH 3F9EA 3PMBB 2PFEA 1L0ZA 1LVYA 5IYTA 3RM0H 3QLPH 1BITA 3OU0A 2FOGA 1PYTC 5EGMA 3GCHC 1HAOH 2H5CA 3UIRA 1XUFA 1XXDA 5ETXA 1MD7A 8GCHF 4B1TA 1V2MT 3ATWA 2BDHA 1GBJA 1WV7H 4X1NU 1V2JT 1QURH 4AFQA 4IMQA 2B8OH 4X8VH 1HJAB 2FMJA 3U8RH 4YT6H 1F0UA 1UTNA 1J9CH 2BD3A 4GLYA 1LMWB 4O03A 1DOJA 1L1JA 4BAQB 5HYOA 1THPB 3HGNA 1TMBH 3S9BA 7ESTE 2ZGBH 4R8TB 5DP6A 1FPHH 1P05A 2THFB 1KDQB 1P11E 1XUHA 1CT4E 5ABWA 1G3DA 2WV4A 1HAZB 3D23A 2GV7A 4JYVH 4BNRA 1C9TA 1OSSA 2BQ6B 2BLVA 1TA2A 3FVFB 2FOAA 1QB6A 2NU0E 1DSTA 2LNCA 4WMFA 1RTKA 1IQGA 1C1RA 8ESTE 3LGIA 2OCVB 3NWUA 4I31A 4BTIB 3ZVCA 3V7TA 4R0IA 1O2MA 4K5ZA 1UTKA 1VR1H 4MVNA 2DUCA 2SGAA 1CGIE 1MKWK 4O9VA 1ETRH 2FOFA 1CGHA 1SHYA 1TPSA 4NFEA 3TNSA 1UTQA 2QGRA 2NU3E 1NESE 4MLFB 2PUQH 2OXSA 1GHBG 1SBWA 2SGFE 3V12A 5JBTA 1HRTH 3DFLA 4XE4A 3SV9A 1SQTA 4AGKA 2EC9H 1O3IA 1SGFA 4K8BA 3SU1A 4MNXA 1MBQA 2RG3A 4CHAB 1GCTB 5C1YA 1PPBH 3ATIA 3P95A 2ZTYA 5I25A 1AE5A 4MPVA 3TJOA 4WMDA 2Z9JA 1C5XB 5HM2A 3BSQA 3BTEE 1EAUA 1HV7A 1A3BH 4VGCC 1QCPA 2BB4A 3GDVA 4X6PA 2ZCKP 7GCHF 3GICB 2OBQA 4B71A 1A1RA 3A80A 1TGBA 2P8OC 2NU2E 1QHRB 1MTNB 3RXHA 1AVGH 1U6QA 4B2BA 4ABAA 2HWLB 1BRBE 3GCNA 5F8XA 4H6TA 1UK4A 2ZDVH 1BTUA 1RGQA 4F49A 4THNH 1C2DA 2A5IA 3I78A 3RMNH 4NFFA 3PTNA 2ZO3H 1ESBA 5FPYA 1SOZA 1INCA 1S83A 3NZIA 3A83A 2RA3A 3C27B 4I8KA 1CVWH 2ZCHP 3LGWA 4WXVA 3RXQA 1UTLM 1KLIH 2GKVE 3QZRA 2BZ6H 1TWXB 3MNCA 3PLPA 2BMGB 2BOKA 1DPOA 1YPKH 1MUEB 5EPNA 1FY1A 3SGQE 1XUJA 2CHAC 3BN9A 3ZVDA 1P3CA 1WTGH 3R0FA 3LC3A 1O3MA 3GYLB 2HOBA 4BAKB 2FWWA 3TJUA 1TX8A 3RXJA 4FUFA 3N7OA 1FY5A 3EQ0H 1EJNA 2ZCLP 1MKXH 3LGYA 5DJ7A 3E6PH 2AEIH 2Y82A 1C2IA 3OY5U 2VIOA 1GMDF 1FIZA 2BLOA 2F9PA 3SU3A 1FPCH 3OSYA 3TH2H 5DP8A 1LKAA 2ZQ2A 1C5LH 2WINI 2O8WA 2PW8H 1VGCB 3TITA 4AORA 4CRCA 4JYTA 3UPEA 1O5BB 1ARCA 1C5PA 1G2MA 1IAUA 3GOVB 1GI3A 3RXTA 2H9TH 2V3HH 3SNDA 3KQDA 3GDSA 3PTBA 4AOQA 1GJCB 1HXFH 1YPJH 4RKJB 2C90B 1QQ4A 5GCHF 1LHCH 2UWPA 1ELBA 1FXYA 1SOTA 2ZG0H 2G5VA 1GBBA 2ILNA 1NM6A 3P8NA 1K21H 3UOPA 4Q7ZA 1W7XH 2K1QA 4CRFA 3M3VA 2VVCA 2W5EA 1L4DA 1SGEE 4Y71A 2IPHA 1GPZA 1J17T 3U9AH 3A86A 1LKBA 3VPKA 1GI9B 1LPKB 1LPZB 5A2MH 2ZQ1A 4BTTB 2R9PA 3SZNA 4UEHH 2PGQB 4UFFH 1PFXC 1V2WT 4OGXA 2AMDA 4Y0ZE 1G2LA 1UJ1A 2Y81A 1P2OA 3SHAH 2ZHEH 1K28D 1P12E 1GBMA 3LT3A 2VIDA 3C1KA 4DG4A 1NROH 1GMCF 2Z3DA 1TRMA 4Q7XA 5GCHG 1O5EH 9ESTA 4YOGA 1Z1IA 3NXPA 3QO6A 4B2CA 5EXLA 2W3KA 1VJ9U 1FLEE 1TA6A 4ZKNU 4OS2A 3ZVBA 3NK8A 1C5SA 1W7GH 1K1MA 1KDQA 4E7NA 1QQUA 1C5QA 2G81E 5HGGA 1GBTA 3RXLA 2Z6BD 1ZGVA 4GCHF 2F91A 1DWDH 3SBKA 1GJ5H 1SGFG 5F6MA 1NFUA 1AU8A 2PWXA 1H9IE 2GT8A 1P02A 3AW1A 3M36A 1T4VH 4GUXA 1DDJA 1O2GH 3QGNB 3M61U 3RU4T 5TCAA 2ZDKA 1O3KA 1ZPBA 1FQ3A 1C4V2 3P6ZB 3RXCA 1WAYB 4CHAC 1NU9A 2FLBH 2TPIZ 4K1SA 3Q3KA 1BA8B 5T6DA 3EA8A 3A85A 4LXBH 4K1TA 1AB9B 1T8MA 1O37A 3EA9A 1RRKA 7KMEH 2RA0A 5C5NA 4DJZB 3H5CB 1S85A 1OYTH 3TLOA 1S82A 2BVXH 4CRBA 1N6XA 1YKTA 5LH8A 1EPTC 1AO5A 5E0GA 1TOMH 1WCZA 2ZFSA 4UONA 4XSKU 4GSOA 1UTMA 1CBWB 2BLQA 1ANEA 1RS0A 4ZXXH 1NFXA 1TMTH 1AN1E 1DLKB 1MTWA 2EI7A 2F9UA 4FU9A 2BYAX 3SJ9A 2ALPA 1A2CH 2ODPA 1V2VT 1GI4A 3M7QA 3E1XB 4Y76A 2VIVA 3TK9A 5J4SA 1O3BA 5FCRA 2Y5FA 1RIWB 3A84A 3RXVA 3T29A 2BXTH 5JBAS 2QCYA 3NCLA 1GBEA 2RCEA 3SV8A 1B0EA 5A0AE 1SL3A 1UVOA 4CRAA 1GVLA 3RXGA 1Z6JH 3B9FH 1HAVB 5GPIB 1Z8GA 5EXMA 3LH1A 3K6ZA 4UFEH 4X1SU 1XUKA 2A31A 3ZVAA 2GV6A 3BTME 1SC8U 2P3TB 4BAOB 3QK1A 4D9RA 1NS3A 2A2QH 1UVPA 1O5AB 3M5OA 1Y3XA 1V6DA 4U30A 8LPRA 2GVFA 1EB2A 1ZSJA 2WUCA 4MPWA 1C1OA 1OX1A 4YLQH 1ZJDA 2JH0D 1DY8A 5GDSH 1O36A 1CHOF 1FDPA 1GGDB 4BXWA 3E0NB 2GP9B 4ZUHA 1OWDA 3SU6A 1UO6A 3U1IB 1O2YA 5L2YH 2TGDA 1NRRH 3FFGA 3RLWH 1QR3E 2IN2A 3VFEA 2A7CA 4Q7YA 4D9QA 2C8WB 2F9VA 3HPTB 1DX5M 2ZFPH 5T6FA 2V0BA 3RXPA 4XBBA 2BY6X 3MU4A 1B0FA 1WUNH 2OINA 1NT1A 3UOUA 3MH4A 2HLCA 3MNXA 3M3TA 1ZGIA 3MH6A 1HAHH 3A81A 3GCTG 4GVUA 1FAXA 5C20A 1GDNA 1GHAF 2BTCE 1GHVH 1BMAA 3U8OH 3DFJA 3VEQB 3NUMA 2FP7B 4BOHA 3A7WA 1TPOA 1T32A 1O2KA 2Z9LA 5JBBS 1AUJA 1HYLA 5HXFA 2Q1JA 3KHVA 1EP5A 2PHBA 1D9IA 1V2LT 2UUKB 1XXFA 1JIRA 2V6NA 1YLDA 4Y7AA 3KNXA 1ELCA 4ABEA 4VGCB 2FIRH 1VITH 4WVPE 1ZRKA 1MTVA 2J9NA 1VITG 1V2KT 1WQSA 2Y80A 1QB9A 1XVMA 2J38A 1C9PA 1O5CB 2WPJS 1HIAB 2BD4A 4ABDA 1Z6EA 1MH0A 1ZYOA 1CA0C 3H7OA 1MKWH 2H2ZA 3EDXB 3E91A 1O3DA 2EEKA 1C5OH 3A88A 1V2ST 1MU6B 5FHTA 4PROA 1EZSC 2D2DA 3HKJB 3QDZB 4I7YH 5F8ZA 1IQEA 1V2RT 3T27A 1XVOA 2ZIQH 1BTZA 1GJ9B 4TYDA 4FVDA 5GXPA 1P8VC 3WY8A 3MYWA 3ZZ9A 4IC5A 2BOHB 3RXRA 1B7XB 1CT0E 5G4BA 2FOCA 1D3DB 5EQQA 1BMMH 1GVZA 1LVOA 4Q2KA 3UREA 1OXGA 4D7GA 1BDAA 1LTOA 2BVSH 5L6NH 2FX6A 3Q00A 1ZR0A 1AZ8A 3SUDA 2BX3A 3ODFA 1ZMNA 4K60A 4NGAH 3RP2A 5A8XA 2JH5D 3MI4A 2CHAB 1O2JA 2TRMA 4Y0YE 2WPMS 2PKSC 4AB9A 2F3CE 2AGEX 5DO4H 1TABE 2IOTA 2QYIA 1SFQB 3FZZA 1P04A 1EX3A 1PPHE 4A1XA 1O3CA 4X8TH 7LPRA 5C67A 1QNJA 1P9UA 2VIQA 4KP0A 1P2NA 1ORFA 1O3OA 1C4Y2 2GX4A 1ZSKA 4FUIA 4MNYA 4B74A 1ZMLA 2GZ9A 1AKSB 2BY5X 2FI4E 3MFJA 4OS4A 1LHEH 5LPEA 5DGJA 2BY8X 4DGJA 5C3NA 1FNIA 1GMHF 1NRPH 2ZFFH 2CN0H 2ZGJA 1Y5BT 1IQJA 3A7ZA 2XTTB 1YPGH 1MU8B 2P3UB 2Z9KA 1NRSH 1P2JA 2WYGA 4KTUA 1QL7A 3LONA 2A4RA 1FY3A 4TY6A 1T31A 4QT8C 4K2YA 2A5AA 1PQAA 1C1TA 3PO1C 1D3QB 2FDAA 2PSYA 3LH3A 4E7RG 4TWYA 2ZZUH 1A4WH 3Q3YA 1TRNA 4ISHH 3RXFA 2GZ8A 1OP0A 1EASA 3HK3B 1O2VA 2UUFB 5FCKA 2OLGA 1WQVH 4GAWA 3RM2H 2ESTE 1SGIB 4Y10E 1THSH 2JH6D 1TNJA 2VGCC 5FX6A 4BAMB 5HM9A 4U2WA 2P16A 2PLXA 1GHWH 3TJVA 1GI5A 1ELDE 1HLTH 2P59A 1HAVA 3PWBA 3PMHB 3EYDA 1Z71A 1KLJH 2HRVA 4JYUH 4H6SB 1V2OT 4X8SH 1MAYA 1O2LA 4AZ2B 4NIYA 3VB3A 1GGDC 1O2OA 1P2KA 2BXUH 1AVXA 1HJ9A 2BD7A 1O3EA 3LDXH 8GCHG 1A46H 3PLKA 2BDIA 2XW9A 2Y7ZA 3A7VA 1OKXA 3GCOA 1ETTH 3QZQA 3SV7A 1C5ZB 3A8DA 2WPLS 3BTHE 1TGNA 1CE5A 1HCGA 5TJXA 1BBRK 1QJ6B 3SNBA 2FS9A 4K3JA 2C8ZB 5FAHA 1OWEA 1TNHA 2VNTA 5DP7A 4X2WA 3STJA 1P57B 3LC5A 1O2SA 5I46H 1WTHD 1QA0A 2IJOB 2QY0B 3QUMP 2Y5HA 3RMLH 4IBLH 2VU8E 5GIBA 1KXEA 1JWTA 4ABBA 3TGIE 2FTLE 1C5RA 2R3YA 3V13A 4A7IB 3TPIZ 5A0CA 1W3CA 3RXBA 2Q6DA 2TGAA 1C1WH 2AYWA 3GDUA 1A61H 3TH3H 2UWOA 1ZTLA 4A6LA 1C5NH 3BTGE 2NWNA 3ZZAA 1C4U2 1C5WB 1Y3WA 1AIXH 1TMUH 2FYQA 1EPTB 1Y3YA 3I29A 3MU8A 1Y5AT 2ODQA 5EW2H 3LJOA 3JZ2B 4NZQA 1DM4B 1GJ8B 5FPTA 1CT2E 3MNBA 4YT7H 2V35A 1Z7KA 2ZTXA 1G30B 1GBFA 1MTUA 1VJAU 4INKA 1JIMA 1UK2A 1GI6A 1JOUB 2CMYA 2HPQH 1F5RA 4Y8ZA 1E37B 2FS8A 1TAWA 5A0BA 5JDUB 1ZZZA 1C2LA 1PPEE 2FXRA 5E0HA 1HIAA 4I32A 2O9QA 2GTBA 1O39A 3D65E 7GCHG 2QAAA 1QBVH 1MMJN 1GWAA 3VB5A 5AFZH 4I33A 3TU7H 2NU4E 3SQHE 4NIWA 1THRH 3BTQE 2VB0A 3ZYEA 5CMXH 1P2IA 2ZPQA 4OGYA 1Q2WA 1J15A 3RDZA 3CS0A 4WH6A 1E34B 1BRAA 2QA9E 2SGQE 4JK5A 1C5UA 2Z7FE 2CF8H 4X6MA 4X2VA 2D1JA 5DK1A 2AH4X 3B23B 4CH2B 3BEFB 2QN5T 1ID5H 1QFKH 2SGPE 3U69H 4I8GA 1LHDH 1LHFH 1V2PT 3MU1A 4HZHA 1G37A 1GBAA 2BZAA 3SORA 3MH7A 1DXWA 3AASA 2Y6TA 2CJIA 3QTOH 4DIIH 5BPEA 3F6UH 3OYPA 1VCQA 3HATH 2GDDA 4NSYA 4NA7A 5IDKA 4OS5A 3PWCA 2H6MA 4BTUB 3EGKH 6GCHF 3GY2A 9LPRA 3ATKA 3ATMA 1CA8B 3GY7A 1KY9A 3ESTA 3U98H 1ELVA 1AHTH 3ODDA 3ZYDA 2HNTC 2FOHA 1SLWB 2ZHQH 2XBYA 1N8OC 1ZTJA 3SI4H 1AKSA 1ACBE 1FMGA 4DURA 1YLCA 5H4IB 1GDUA 4NIXA 1OP8A 1A0HB 1MBMA 2TGTA 2GDEH 5DP9A 1GMDG 4ASHA 2ULLA 2ANYA 1C5VA 3ZZ4A 1W12U 1MCTA 4WH8A 3SN8A 1ZJKA 2VH6A 1YF4A 1YM0A 1HNEE 4Y6DA 1EZUC 2C8XB 1E35B 1C1MA 4YLUA 3RMMH 1WOFA 3FP6E 1OWJA 3T62A 1QGFA 3M5MA 4NA9H 1IQHA 1V2QT 3BF6H 1YCPM 3UQVA 1SB1H 5EG4A 1AQ7A 1FONA 3SNCA 3SUFA 3RU4E 1TRYA 1P3EA 1S84A 4DT7B 1HGTH 1YCPH 3DHKH 3RMOH 1C2KA 1MD8A 4H4FA 1ELAA 1W10U 2BY7X 1C5TA 1O2HA 2W3IA 5EQSA 1CQQA 2OC0A 2BLWA 1CA0B 1K1NA 1K1OA 3SHCH 1GI1A 3ZZBA 2W26A 1TX7A 1EAXA 1NO9H 4GPGA 4M7GA 1HFDA 1BJUA 3TJNA 3ZV9A 1GDQA 4INHA 4XOJA 4ISNA 4TPYA 2XXLA 3HK6B 1P06A 4K69A 3TIUA 1TB6H 5EW1H 3ZVFA 5ESTE 2CV3A 3P8FA 1BQYA 1GVKB 1SFIA 1GBCA 3A87A 1HPGA 1W0ZU 2XC4A 5L30H 2ZU4A 2AGIX 1O3NA 2ZTZA 1GMCG 1QRZA 1XKBC 3RXIA 2F9BH 3L6PA 1AFEH 2PKSB 1BTYA 2A32A 1TFXA 2ZU3A 1MQ5A 1FN8A 1HDTH 4NSVA 2WYJA 2AMQA 2OC8A 4K1EA 4Z0KA 3NPSA 1CU1A 2I6SA 4GCHG 1YPHC 1BB0B 5E2OA 2ZGXH 2A4OA 2Z9IA 3E0PB 3LGUA 3L3TA 1P2QA 1C5MD 1W8BH 1UVUH 2VJ1A 1C2EA 4SGAE 1PQ5A 1O2QA 2A7HA 4FU8A 1S0RA 3STIA 1AE8H 1OYQA 4CRGA 4OS6A 1GG6C 1QJ1B 2BQ7B 4MG3A 1H1BA 2GCHF 4AYVB 1S0QA 3LPRA 1EPTA 4A1VA 2D8WA 2ANKH 1NC6A 1Z8JB 2BDGA 1LHGH 1AY6H 1Z8RA 1O32A 4JK6A 1PQ7A 1VCWA 1EAWA 1QRXA 3GY5A 3M5NA 2QF0A 1TGTA 1RTLA 1G36A 3PO1B 3URCA 2ZU1A 2G5NA 1LQEA 5GJ4B 4B76A 2ZI2H 3LKWA 1SLVB 3TK5A 1SGCA 2XBWA 4U01A 1AFQC 3KGPA 1O3LA 1FUJA 3OTJE 1LVBA 3DUXH 1OP2A 3SU2A 4TY7A 4B73A 1TIOA 1G32B 2HNTF 1Y3VA 2CXVA 3URDA 4FU7A 1H8IH 2HPPH 1VCPA 2VGCB 1J14A 3MOCA 1BT7A 1HAGE 5AVDA 2BDYA 5EODA 2FOEA 2VWLA 1ZLRA 1KSNA 5AHGH 2ZPSA 3FP7E 3AAVA 1UCYE 3MWIU 4LOYH 1D4PB 1V2UT 5HMAA 3VGCC 2ZECA 4CH8B 1EB1H 1O30A 3E3TA 3M35A 1S6HA 1GJ7B 1ANDA 1HXEH 3RXUA 1O5GH 2O8UA 5LPFA 2ZP0H 1KXFA 4FUJA 1H4WA 4GHTA 3M37A 2O8MA 3BTKE 1C1VH 2HNTE 4ZHMU 4GHQA 1EP6A 1FN6A 2AMPA 3TGKE 5JB9S 1DANH 1HUTH 3F1SB 1P10A 5E2PA 4XBDA 1YC0A 4FUGA 3BTDE 4NZLA 1O3PB 4IW4E 1C1PA 3T5FH 2J4IA 2PTCE 2QXIA 1W11U 4AFUA 4FUDA 5K0HA 3S0NA 3TGJE 1DVAH 2HGTH 2G00A 1AVWA 3SJOA 4AG2A 1DWCH 2RDLA 1C2HA 2F9NA 1CHOG 5EXNA 3ZZCA 4O3TA 6ESTA 1TLDA 4MPXA 4JCNA 1SI5H 2JETC 2Z9GA 3E90B 4NWKA 1NZQH 3TVJB 4WJG2 1SGRE 3P70B 4NCYA 6CHAB 1EKBB 1AZZA 1EAIA 3LOXA 1C1QA 3AVZA 1PJPA 3UR6A 4MTBA 1F0TA 1P2MA 1FJSA 1K1LA 1MZDA 3RXAA 1W13U 5C5OA 4AGJA 4XBCA 1BZXE 1QBNA 4O3UA 4FUBA 3RXDA 3MTYA 3GYMA 4ABIA 2A1DB 2Y5GA 1ARBA 1BBRH 1KLTA 3RC5A 4TPIZ 3RUOA 1GHAG 8KME2 1BBRE 4ZHAA 1IQFA 4X1PU 1ETSH 2GGVB 1T7CA 2R2WU 2HALA 3LU9B 4E05H 1GL0E 4AG1A 1IHSH 2ZC9H 1NRNH 2SGEE 1N6YA 1O5FH 1SQAA 2PR3A 2FM2A 1BRUP 3RXKA
chains in the Genus database with same CATH superfamily
3OEHD 1H9HE 2BD9A 5C1XA 2VWOA 4UD9H 1HAIH 2R2MB 3T25A 2BDAA 1K1PA 1GI8B 4D7FA 4FUEA 1IQNA 4B2AA 1EZXC 1SSXA 1EFRD 1ZSLA 4WXIA 2SNWA 1GI2A 2RFKC 1DS2E 2EA3A 3SQEE 3RC6A 1BUIA 2A5KA 1H8HD 5JYIA 4JZFH 1NPMA 1O2TA 1O5DH 4JZDH 4UE7H 5BRRE 2W6ID 4YO9A 2ZKSA 1OOKB 1S6LA 1WBGB 5T6GA 2WV5A 3D49H 2ZHFH 3KQBA 2BHGA 2ZDLA 4X2XA 4B75A 3ZV8A 2BVRH 4CR5A 1M9UA 4I8JA 1PPCE 2QF3A 5EPYA 2OC7A 2GD4B 2W7UA 3IWMA 2BD8A 2CK3D 1DUEA 2YMSD 2VIWA 4XDEA 2BX4A 2ANWA 3SNEA 1AUTC 3TK6A 2A0QB 2JDID 3EAJA 4ZKRU 2PSXA 1A7SA 1ZRBA 5LPRA 3OY6U 1LVMA 3RXMA 1F5LA 2VWMA 4A5TS 1UVTH 2V7QD 3W1EA 2H1UA 1G9IE 4X6NA 3UWIA 1A5IA 1OPHB 1UCYK 1GCDA 1O3HA 2XC0A 3VB4A 1UMAH 2QE7D 4X0WU 1O2PA 1N8OB 1DT2A 3BG4C 3GY4A 4YTAA 4YOIA 1BTPA 2PKAB 1IQKA 2GT7A 3BTTE 1C2FA 1O2IA 1C5YB 1WYKA 4YOJA 2XYAA 4CRDA 3MMGA 4WWYA 2FOMB 2CGAA 3DT0H 2P94A 3SJ8A 1AWFH 4KELA 2OD3B 4U32A 3VXEH 3UNQA 1CGJE 1O2WA 5JPMH 1J16A 3CP7A 4NIVA 4AFSA 3ZZ3A 1XMNB 2XBVA 5TCCA 2ZA5A 1NU7B 1GMHG 1YYY1 4HGCA 4JMYA 1E38B 1ANCA 3F9FA 5FX5A 1GHZA 2I6QA 3P92A 5GWZA 5CHAC 4I86A 2YMSC 5IK2D 1BCUH 2AIPA 2QIQA 4MPUA 5EQRA 2ZU5A 2OC1A 1D3TB 3PLBA 1PPZA 2PV9B 1QTFA 3H7TA 4ZMAH 1EJAA 1SQRA 4NWLA 1F92A 2QXHA 3TNTA 1J8AA 1NN6A 2FLRH 1GHBF 4FVBA 4CR9A 2YNBA 3JZ1B 4DY7B 3BEIB 1EJMA 3V0XA 2OQUA 4OS1A 4OM9A 5E0JA 1XX9A 2J95A 1BIOA 1K9OE 4JZEH 1K1JA 4OS7A 2BY9X 1UK3A 1W14U 1DWEH 3M3SA 2EI8A 4ZHLU 4ABFA 3ZZ6A 2OTVA 1ZPCA 1V3XA 5CE1A 2FI3E 1SVPA 1RXPA 1TBZH 3KCGH 3NKKA 2AS9A 4UFDH 4Q80A 1QA7A 1TX6A 5E8EH 2ZFRH 1JMOH 1V2NT 3GY8A 4DIHH 4RT0A 3A82A 1ABJH 4DW2U 4I8HA 2UUYA 1BTWA 2BDBA 2ZHWH 2QXJA 1SHHB 1GJ4H 4ISIH 3P17H 2GMTB 6CHAC 2GZ7A 3IG6B 2A2XH 4ZKOU 2JIZD 2H9HA 3P8GA 1ELEE 1V2TT 2AIQA 1GJAB 2ZF0H 2A4GA 4ABGA 1QIXB 1F7ZA 3CS7A 2VH0A 1C2JA 3F9HA 1ZHMA 1E1QD 2ZWLH 1QRWA 2FTMA 2ZGHA 2XC5A 1LPGB 1FY4A 1KXBA 1TGSZ 2O8LA 1TQ0B 2Z3EA 3H09A 4HFPB 2J94A 3T28A 3SUEA 1TALA 1SQOA 2FOBA 4IGDA 1GBDA 2C8YB 3PMJA 1SPJA 5C0UA 1ZMJA 1CHGA 1T8NA 1H8ED 2WPIS 1O3FA 1YPEH 1HAPH 3KEEA 2J34A 1W2KH 1GG6B 1TNLA 5DP4A 3Q76A 1EOJA 2STAE 2ZDMA 5EU8A 1C2GA 1W0YH 4JZ1A 2STBE 3FKSD 2AERH 1P0SH 2A4QA 5GNDA 3ZZ8A 1TBRH 1L4ZA 3O8DA 1UTPA 1F5KU 1FAKH 3VB6A 3D62A 1TOCB 4NA8A 4D76A 3T26A 3QWCH 3OFND 1QL8A 1EOLA 1N1LA 1O2RA 1GBIA 5F8TA 1AFQB 3PRDA 3M5LA 1AWHB 2YOLA 1D6RA 1SGQE 1DUAA 1D3PB 2KAIB 3MU0A 3O8BA 1ESAA 3UTUH 2WSSD 1ZHPA 1KTTB 1G3BA 1XM1A 1DLEA 1BMLA 2TGPZ 3S69A 1OWKA 3LGTA 4Q4LA 2AGGX 4X8UH 3QTVH 4B6EA 1GHYH 4F4OC 1COWD 1X7AC 1GL1A 1XKAC 4WY3A 1BHXF 2FZZA 4TSFD 1ANBA 1Y5UT 2CF9H 2GCTB 3VGCB 2BM2A 5A8YA 3T2NA 4MNVA 3QGJA 1P09A 4ZROA 2OBOA 1BRCE 1S81A 1AD8H 1BMNH 1D6WA 1S5SA 3EA7A 2FO9A 1GJDB 2XCNA 1GBHA 2DE9A 1A5HA 1KIGH 1NRQH 1DWBH 3ZZDA 2PTNA 3BG8A 3FZDA 2VINA 1IQIA 2BDCA 5FPSA 2JKHA 3ZVEA 1TNGA 2VVVA 3FAOA 1CO7E 4HTCH 1GHXH 1UTOA 3PM3A 1LO6A 1ZHRA 3MO3A 4RSPA 1K2I1 4ZCNA 2OUAA 1GJBB 1A0LA 1AGJA 2XWAA 4KKDA 2DE8A 4O97A 2B7DH 1O33A 4INLA 6GCHG 1SGPE 2PKAA 5K7RA 1YGCH 1P03A 3SV2H 3LIWA 4YXWD 3SV6A 3SNAA 3GISB 1EZQA 3AW0A 1XUIA 3BEUA 3ELAH 2R3UA 1BJVA 2D26C 2NU1E 3K9XB 2JETB 5JBCS 1SR5C 3K6YA 1T4UH 3R3GB 4MQAA 2C4FH 4FOUC 1AI8H 3ATLA 3V3MA 1YBWA 4AX9H 3SGAE 5LGOA 3SJKA 1HJAC 4D8NA 4A1TA 1DITH 3VXFH 4IN2A 1RD3B 2UUJB 3UFAA 1NFYA 3UQOA 1TPAE 1ELGA 1TBQH 5FBEA 4ESTE 4DOQA 1O34A 3PV2A 1B5GH 1QZ8A 1T8OA 2B5TB 2ZDNA 2FYRA 2P93A 1UHBB 1WSSH 2G8TA 5DP3A 3P8OA 4Y8XA 3M7UA 5C1UA 3BIVH 4LK4A 3F3BA 3BTFE 1P9SA 1EUFA 1ESTA 4SGBE 1Y59T 2B9LA 1KXAA 4ABJA 1NTPA 4YESB 1O3GA 2QV1A 1F0SA 3A7XA 2ZGCA 2C93B 4Y8YA 5C2ZA 3SOSA 4ISLA 1YPMH 2OQ5A 1MAXA 3O8RA 1C2MA 1RTFB 3SW2B 1FI8A 4UDWH 1NFWA 3K65B 5ESBA 2F9OA 1ZTKA 2WPHS 4JZIA 2GMTC 2YNAA 1MZAA 1TONA 3SGBE 2XWBI 1IHTH 3DA9B 2A45B 1TNIA 3FANA 4NG9H 3MHWU 3UNRA 2L74A 3KN2A 4YM9A 2ANMH 1GCTC 1G3CA 1FY8E 2WPDD 4AN7A 4ABHA 3UR9A 3E8LA 4YZUA 1P01A 4WMEA 1GBKA 4X1QU 5DG6A 5AF9H 1JXPA 1SG8B 3OX7U 2ZU2A 4BANB 1ABIH 2TBSA 3PMAB 3A8CA 3GY3A 3PYHA 5DKMA 2QXGA 5F03A 2VIPA 3BTWE 3DD2H 1E36B 4J1YA 1QY6A 3CNRA 1ELFA 1T8LA 1F0RA 1C1SA 1PQ8A 3PB1E 3KIDU 3S7KB 1GJ6A 2J97A 1E79D 2Z94A 1A3EH 1MTNC 3A8AA 1HB0B 4KGAA 2G4UA 4MDSA 3BV9B 1MKXK 4CBNA 3KL6A 1MQ6A 2J92A 3F2GA 4ZH8A 5B6LA 1UTJA 3BG4B 3B8JA 3KQCA 4HI3A 1ZPZA 3ZIAD 1ZOMA 4E06H 1JRSA 2ASUB 1BHXB 2FI5E 3MNSA 2A7JA 3A7TA 1DFPA 1HJ8A 1LCYA 3RXEA 2AFQB 4ZXYH 1QB1A 2R0LA 1BTHH 4X1RU 5AFYH 1OWIA 4Z6AH 1L2EA 1DY9A 1G3EA 1BOQA 1TQ7B 2Q6FA 2Z3CA 3F68H 5DSFA 2QC2A 3RXOA 2XBXA 3U8TH 3K2UA 4AYYB 3SUGA 2V3OH 3A89A 3GCHB 3SJIA 2XNIA 1FZZA 5SGAE 2GCHG 4ISOA 4RKOB 1ELTA 3BIUH 5A09A 5B6OA 1C1UH 3G01A 5CHAB 2XCFA 4FUCA 4K8YA 2J2UA 2XNDD 2UWLA 1F2SE 1L1GA 1S6FA 1UCYH 2EI6A 2YMSB 2G52A 2SFAA 1O2ZA 2SNVA 2ZFTA 5CDFE 4ACAA 1OS8A 3W95A 1HAYB 2GCTC 3S9CA 4IMZA 1FV9A 2BD2A 3GY6A 3TH4H 4Y79A 2KAIA 3ZZ5A 2ZFQH 3AAUA 2KCAA 4BAHB 3OEED 2HVXA 4AC9A 1Y3UA 3ITIA 4XRNA 4IC6A 4Y7BA 1O2UA 5L2ZH 2PUXB 4Y11E 3GCTF 3PV4A 3PROA 5DPAA 6LPRA 1SGTA 1VGCC 3VB7A 2H9EH 1KYNA 3S7HB 2Q6GA 4IS5A 3E16B 3OE7D 3SO3A 1YPLH 2BQWB 3ENSB 2OP9A 3UY9A 3PV5A 1L1NA 1AMHA 1YCPK 1A0JA 1OWHA 3Q3XA 2PGBB 3I77A 1KXDA 2PP6A 2ZNKH 1KXCA 4ZKSU 1CSOE 1SMFE 1SGNE 1VKYA 3LJJA 4RI0A 2FPZA 4TWWA 2VWNA 1DE7H 1VITF 1MTSA 2FESH 2W7SA 2FX4A 3SU0A 2ALVA 1Q3XA 1O2NA 1IQLA 4H42U 2G51A 4KTCA 1EATA 2G55A 2TIOA 3W94A 3L33A 3MU5A 5A8ZA 4J2YB 3ZZ7A 2M5TA 5T1VA 3UUZA 2B0FA 1MCVA 1TE0A 1DSUA 5J4QA 3M7TA 1GI7B 4AB8A 1O38A 1QBOA 1SLUB 2ZPRA 3U1JB 4FUHA 3SI3H 1K1IA 5JB8S 1O3AA 1TNKA 4BXSA 1QJ7B 4FXGH 2ZEBA 1Z8IB 3HGPA 1EQ9A 1HBTH 1TGCA 2EY4C 2ODYB 1LDTT 2BD5A 1DICA 1XUGA 3Q77A 4LZ4B 2Y7XA 4ZAEA 1TYNA 4X6OA 1A5GH 3SZEA 3RLYH 1O3JA 1K22H 3SU5A 2P8OB 3HKIB 3MO9A 5FXLA 1QL9A 1IQMA 2O8TA 3UNSA 3SU4A 1YY3A 5T3HA 1RJXB 4X2YA 1JRTA 1SLXB 1UHBA 1FIWA 2SGDE 4DVAU 2WPKS 3KF2A 2R0KA 1SGYE 2H5DA 2XRCA 1BTXA 4LZ1H 3O8CA 1IOEA 1RFNA 2C3SA 1KTSB 1PYTD 2F83A 4MNWA 4WF8A 2WV9A 1Z1JA 1HAXB 2LPRA 1Y8TA 1GBLA 2FEQH 2P3FH 3RXSA 1C1NA 4I8LA 4KTSA 3F9GA 3KQEA 3F0OA 1AB9C 3FN8A 1VZQH 1H9LB 4UFGH 1E0FD 2ZDAH 3RU4D 1TPPA 3FP8E 1SGDE 1YPHE 1WU1A 1PPGE 1H8DH 1DXPA 1UVSH 1Q31A 3IITA 4DCDA 1PPFE 3QX5H 1NBMD 5EOKA 3S9AA 2FODA 4IN1A 1JBUH 3PRBA 5DP5A 2ZHDA 3LGVA 1CBWC 2P95A 3MH5A 4XFQA 3QN7A 1EXFA 4RN6A 3RC4A 1KMHB 4A92A 1O35A 2VVUA 3ZVGA 3CENA 1LQDB 3A8BA 4CREA 3KYGA 1NY22 1YP9A 3GS9A 4AFZA 1GI0A 3A7YA 5PTPA 4CBOA 3MO6A 1O31A 3EE0B 4ACBA 1RIWC 2G4TA 2WUBA 3UWJH 1O2XA 5FBIA 1O0DH 3F9EA 2EQNA 3PMBB 2PFEA 1L0ZA 1LVYA 3SYJA 5IYTA 3RM0H 3QLPH 3N7EA 1BITA 3OU0A 2FOGA 1PYTC 5EGMA 3GCHC 1HAOH 2H5CA 3UIRA 3F2FA 1XUFA 1XXDA 5ETXA 1MD7A 2AHME 8GCHF 4B1TA 1V2MT 3ATWA 2BDHA 1GBJA 1WV7H 4X1NU 1V2JT 1QURH 4AFQA 4IMQA 2B8OH 4X8VH 1SKYE 1HJAB 2FMJA 3U8RH 4YT6H 1F0UA 2KCPA 1UTNA 1J9CH 2BD3A 2KCYA 4GLYA 1LMWB 4O03A 1DOJA 1L1JA 4BAQB 5HYOA 1THPB 3HGNA 1TMBH 3S9BA 7ESTE 2ZGBH 4R8TB 5DP6A 1FPHH 1P05A 2THFB 1KDQB 1P11E 1XUHA 1CT4E 5ABWA 1G3DA 2WV4A 1HAZB 3D23A 2GV7A 4JYVH 4BNRA 1C9TA 1OSSA 2BQ6B 2BLVA 1TA2A 3FVFB 2FOAA 1QB6A 2NU0E 5EJ1A 1DSTA 2LNCA 4WMFA 4XD7D 1RTKA 1IQGA 1C1RA 8ESTE 3LGIA 2OCVB 3NWUA 4I31A 4BTIB 3ZVCA 2J5UA 3V7TA 4R0IA 1O2MA 4K5ZA 1UTKA 1VR1H 2OK5A 4MVNA 2DUCA 2SGAA 2V3MA 1W0KD 1CGIE 1MKWK 4O9VA 1ETRH 2FOFA 1CGHA 1SHYA 1TPSA 4NFEA 3TNSA 1UTQA 2QGRA 2NU3E 1NESE 4MLFB 2PUQH 2OXSA 4Z1MD 1GHBG 1SBWA 2SGFE 3V12A 5JBTA 1HRTH 3DFLA 4XE4A 3SV9A 1SQTA 4AGKA 2EC9H 1O3IA 1SGFA 4K8BA 3SU1A 4MNXA 1MBQA 2RG3A 4CHAB 1GCTB 5C1YA 1PPBH 3ATIA 3P95A 2ZTYA 5I25A 1AE5A 4MPVA 3TJOA 4WMDA 2Z9JA 1C5XB 5HM2A 3BSQA 3BTEE 1EAUA 1HV7A 1A3BH 4VGCC 1QCPA 2BB4A 3GDVA 4X6PA 1UW7A 2ZCKP 7GCHF 3GICB 2OBQA 4B71A 1A1RA 3A80A 1TGBA 2P8OC 2NU2E 1QHRB 1MTNB 3RXHA 1AVGH 1U6QA 4B2BA 4ABAA 2HWLB 4TT3D 1BRBE 3GCNA 5F8XA 4H6TA 1UK4A 2ZDVH 1BTUA 1MABB 3FO8D 1RGQA 4F49A 4THNH 1C2DA 2A5IA 3I78A 2JJ1D 2L6OA 3RMNH 4NFFA 3PTNA 2ZO3H 1ESBA 5FPYA 1SOZA 1INCA 1S83A 3NZIA 3A83A 2RA3A 3C27B 4I8KA 1CVWH 2W6JD 2ZCHP 3LGWA 4WXVA 3RXQA 1UTLM 1KLIH 2GKVE 3QZRA 2BZ6H 1OHHD 1TWXB 3MNCA 3PLPA 2BMGB 2BOKA 1DPOA 1YPKH 2F43B 1MUEB 5EPNA 1FY1A 5EIYA 3SGQE 1XUJA 2CHAC 3BN9A 3ZVDA 1P3CA 1WTGH 3R0FA 3LC3A 1O3MA 3GYLB 2HOBA 4BAKB 2FWWA 3TJUA 1TX8A 3RXJA 4FUFA 3N7OA 1FY5A 3EQ0H 1EJNA 2ZCLP 1MKXH 3LGYA 5DJ7A 3E6PH 2HLDD 2AEIH 2Y82A 1C2IA 2KM0A 3OY5U 2VIOA 1GMDF 1FIZA 2BLOA 2F9PA 3SU3A 1FPCH 3OSYA 3TH2H 5DP8A 1LKAA 2ZQ2A 1C5LH 2WINI 2O8WA 2PW8H 1VGCB 3TITA 4AORA 4CRCA 4JYTA 3UPEA 1O5BB 1ARCA 1C5PA 1G2MA 1IAUA 3GOVB 1GI3A 3RXTA 2H9TH 2V3HH 3SNDA 3KQDA 3GDSA 3PTBA 4AOQA 1GJCB 5EJZA 1HXFH 1YPJH 4RKJB 2C90B 1QQ4A 5GCHF 5HIYA 1LHCH 2UWPA 1ELBA 1FXYA 1SOTA 2ZG0H 2G5VA 1GBBA 2ILNA 1NM6A 3P8NA 1K21H 3UOPA 4Q7ZA 1W7XH 2K1QA 4CRFA 3M3VA 2LP6A 2VVCA 2W5EA 1L4DA 1SGEE 4Y71A 2IPHA 1GPZA 1J17T 3DSPA 3U9AH 3A86A 1LKBA 3VPKA 1GI9B 1LPKB 1LPZB 5A2MH 2ZQ1A 4BTTB 2R9PA 3SZNA 4UEHH 2PGQB 4UFFH 1PFXC 1V2WT 4OGXA 2AMDA 4Y0ZE 1G2LA 1UJ1A 2Y81A 1P2OA 3SHAH 2ZHEH 4DT4A 1K28D 1P12E 1GBMA 3LT3A 2VIDA 3C1KA 4DG4A 1NROH 1GMCF 2Z3DA 1TRMA 4Q7XA 5GCHG 1O5EH 9ESTA 1NBME 4YOGA 1Z1IA 3NXPA 3QO6A 4B2CA 5EXLA 2W3KA 1VJ9U 1FLEE 1TA6A 4ZKNU 3MQKC 4OS2A 3ZVBA 3NK8A 1C5SA 1W7GH 1K1MA 1KDQA 4E7NA 1QQUA 1C5QA 2G81E 5HGGA 1GBTA 3RXLA 2Z6BD 1ZGVA 4GCHF 2F91A 1DWDH 3SBKA 1GJ5H 1SGFG 5F6MA 1NFUA 1AU8A 2PWXA 1H9IE 2GT8A 1P02A 3AW1A 3M36A 1T4VH 4GUXA 1DDJA 1O2GH 3QGNB 3M61U 3RU4T 5TCAA 2ZDKA 1O3KA 1ZPBA 1FQ3A 1C4V2 3P6ZB 3RXCA 1WAYB 4CHAC 1NU9A 2FLBH 2TPIZ 4K1SA 3Q3KA 1BA8B 5T6DA 3EA8A 3A85A 4LXBH 4K1TA 1AB9B 1T8MA 1O37A 3EA9A 1RRKA 7KMEH 2RA0A 5C5NA 4DJZB 2M2AA 3H5CB 1S85A 1OYTH 3TLOA 1S82A 2BVXH 4CRBA 1N6XA 1YKTA 5LH8A 1EPTC 2IPQX 1AO5A 5E0GA 1TOMH 1WCZA 5DN6D 2ZFSA 4UONA 2LELA 4XSKU 4GSOA 1UTMA 1CBWB 2BLQA 1ANEA 1FX0B 1RS0A 4ZXXH 3VG8A 3FOAA 1NFXA 1TMTH 1AN1E 1DLKB 1MTWA 2EI7A 2F9UA 4FU9A 2BYAX 2IJD1 3SJ9A 2ALPA 1A2CH 2ODPA 1V2VT 1GI4A 3M7QA 3E1XB 4Y76A 2VIVA 3TK9A 4B6FA 3NRLA 5J4SA 1O3BA 5FCRA 2Y5FA 1RIWB 3A84A 3RXVA 3T29A 2BXTH 3DSOA 5JBAS 2QCYA 3NCLA 1GBEA 2RCEA 3SV8A 1B0EA 5A0AE 1SL3A 1UVOA 4CRAA 1GVLA 3RXGA 1Z6JH 3B9FH 1HAVB 3DSGA 5GPIB 1Z8GA 5EXMA 3LH1A 3K6ZA 4UFEH 4X1SU 1XUKA 2A31A 3ZVAA 2GV6A 3BTME 1SC8U 2P3TB 4BAOB 3QK1A 3F2HA 4D9RA 1NS3A 2A2QH 1UVPA 1O5AB 3M5OA 1Y3XA 1V6DA 4U30A 8LPRA 2GVFA 4F48B 1EB2A 1ZSJA 2WUCA 4MPWA 1C1OA 1OX1A 4YLQH 1ZJDA 2JH0D 1DY8A 5GDSH 1O36A 2QF5A 1CHOF 2JJ2D 1FDPA 1GGDB 4BXWA 3E0NB 2GP9B 4ZUHA 1OWDA 3SU6A 1UO6A 3U1IB 1O2YA 5L2YH 2TGDA 1NRRH 3FFGA 3RLWH 1QR3E 2IN2A 3VFEA 2A7CA 4Q7YA 4D9QA 2C8WB 2F9VA 3HPTB 1DX5M 2ZFPH 5T6FA 2V0BA 3RXPA 4FETA 4XBBA 2BY6X 3MU4A 1B0FA 1WUNH 2OINA 1NT1A 3UOUA 3MH4A 2HLCA 3MNXA 3M3TA 1ZGIA 3MH6A 1HAHH 3A81A 3GCTG 4GVUA 3EE7A 1FAXA 5C20A 1GDNA 1GHAF 2BTCE 1GHVH 1BMAA 3U8OH 3DFJA 3VEQB 3NUMA 2J98B 2FP7B 4BOHA 3A7WA 1TPOA 1T32A 1O2KA 2Z9LA 5JBBS 1AUJA 1HYLA 5HXFA 2Q1JA 3KHVA 1EP5A 1D9IA 2PHBA 1V2LT 2UUKB 1XXFA 1JIRA 1YWUA 2V6NA 1YLDA 4Y7AA 3KNXA 5F53A 1ELCA 4ABEA 4VGCB 2FIRH 1VITH 4WVPE 1ZRKA 1MTVA 2J9NA 3DCLA 1VITG 1V2KT 1WQSA 2Y80A 1QB9A 1XVMA 2J38A 1C9PA 1O5CB 2WPJS 1HIAB 2BD4A 4RT1A 4ABDA 1Z6EA 1MH0A 1ZYOA 1CA0C 5KEDA 3H7OA 1MKWH 2H2ZA 3EDXB 3E91A 1O3DA 2EEKA 2QF4A 1C5OH 3A88A 1V2ST 3UB0A 1MU6B 5FHTA 4PROA 1EZSC 2D2DA 3HKJB 3QDZB 4I7YH 5F8ZA 3OAAD 1IQEA 1V2RT 3T27A 1XVOA 2ZIQH 1BTZA 1GJ9B 3F0PA 4TYDA 4FVDA 5GXPA 1P8VC 1W0JD 5HKKD 3WY8A 3MYWA 3ZZ9A 4IC5A 3N7DA 2BOHB 3RXRA 1B7XB 1CT0E 5G4BA 2FOCA 1D3DB 3WWFA 5EQQA 1BMMH 1GVZA 1LVOA 4Q2KA 3UREA 1OXGA 4D7GA 1BDAA 1LTOA 2BVSH 5L6NH 2FX6A 3Q00A 1ZR0A 1AZ8A 3SUDA 2BX3A 3ODFA 1BMFD 1ZMNA 4K60A 4NGAH 3RP2A 5A8XA 2JH5D 3MI4A 2CHAB 1WDIA 1O2JA 2TRMA 4Y0YE 2WPMS 2PKSC 4AB9A 2F3CE 4M9FA 2AGEX 5DO4H 1TABE 2IOTA 2QYIA 1SFQB 3FZZA 1P04A 1EX3A 1PPHE 4A1XA 1O3CA 4X8TH 7LPRA 5C67A 1QNJA 1P9UA 2VIQA 4KP0A 1P2NA 1ORFA 1O3OA 1C4Y2 2GX4A 1ZSKA 4FUIA 4MNYA 4B74A 3KQ5A 1ZMLA 2GZ9A 1AKSB 2BY5X 2FI4E 3MFJA 2XOKD 4OS4A 1LHEH 5LPEA 5C17A 5DGJA 2BY8X 4DGJA 5C3NA 1FNIA 1GMHF 1NRPH 2ZFFH 2CN0H 2ZGJA 1Y5BT 1IQJA 3A7ZA 2XTTB 1YPGH 1MU8B 2P3UB 2Z9KA 1NRSH 1P2JA 2WYGA 4KTUA 1QL7A 3LONA 2A4RA 1FY3A 4TY6A 1T31A 4QT8C 4K2YA 2A5AA 1PQAA 1C1TA 3PO1C 1D3QB 2FDAA 2PSYA 3LH3A 4E7RG 4TWYA 2ZZUH 1A4WH 3KYFA 3Q3YA 1TRNA 4ISHH 3RXFA 2GZ8A 1OP0A 1EASA 3HK3B 1O2VA 2UUFB 5FCKA 2OLGA 1WQVH 4GAWA 3RM2H 2ESTE 1SGIB 4Y10E 1THSH 2JH6D 1TNJA 2VGCC 5FX6A 4BAMB 5HM9A 4U2WA 2P16A 2PLXA 1GHWH 3TJVA 1GI5A 1ELDE 1HLTH 2P59A 4ASUD 1HAVA 3PWBA 3PMHB 3EYDA 1Z71A 1KLJH 2HRVA 4JYUH 4H6SB 1V2OT 4X8SH 1MAYA 1O2LA 4AZ2B 4NIYA 3VB3A 1GGDC 1O2OA 1P2KA 2BXUH 1AVXA 1HJ9A 2BD7A 1O3EA 3LDXH 8GCHG 1A46H 3PLKA 2BDIA 2XW9A 2Y7ZA 3A7VA 1OKXA 2RDEA 3GCOA 1ETTH 3QZQA 3SV7A 1C5ZB 3A8DA 2WPLS 3BTHE 1TGNA 1CE5A 1HCGA 5TJXA 1BBRK 1QJ6B 3SNBA 2FS9A 4K3JA 2C8ZB 5KECA 5FAHA 1OWEA 1TNHA 2VNTA 5DP7A 4X2WA 1WXRA 3STJA 1P57B 3LC5A 1O2SA 5I46H 1WTHD 1QA0A 2IJOB 2QY0B 3QUMP 2Y5HA 3RMLH 4IBLH 2VU8E 5GIBA 1KXEA 1JWTA 4ABBA 3TGIE 2FTLE 1C5RA 2R3YA 3V13A 4A7IB 3TPIZ 5A0CA 1W3CA 3RXBA 2Q6DA 2TGAA 1C1WH 2AYWA 3GDUA 1A61H 3TH3H 2UWOA 1ZTLA 4A6LA 1C5NH 3BTGE 2NWNA 3ZZAA 1C4U2 1C5WB 1Y3WA 1AIXH 2VBCA 1TMUH 2FYQA 1EPTB 1Y3YA 3I29A 3MU8A 1Y5AT 2J98A 2ODQA 5EW2H 3LJOA 3JZ2B 4NZQA 1DM4B 1GJ8B 5FPTA 1CT2E 3MNBA 4YT7H 2V35A 1Z7KA 2ZTXA 1G30B 1GBFA 1MTUA 1VJAU 4INKA 1JIMA 1UK2A 1GI6A 1JOUB 2CMYA 2HPQH 1F5RA 4Y8ZA 2K8IA 1E37B 2FS8A 1TAWA 5A0BA 5JDUB 1ZZZA 1C2LA 1PPEE 2FXRA 5E0HA 1HIAA 4I32A 2O9QA 2GTBA 1O39A 3D65E 7GCHG 2KR7A 2QAAA 1QBVH 1MMJN 4HG6A 1GWAA 3VB5A 5AFZH 4I33A 3TU7H 2WHXA 2NU4E 3SQHE 4NIWA 1THRH 3BTQE 2VB0A 3WWBA 3ZYEA 5CMXH 1P2IA 2ZPQA 4OGYA 1Q2WA 1J15A 3RDZA 3CS0A 4WH6A 1E34B 1BRAA 2QA9E 2SGQE 4JK5A 1C5UA 2Z7FE 2CF8H 4X6MA 4X2VA 2D1JA 5DK1A 2AH4X 3B23B 4CH2B 3BEFB 2QN5T 1ID5H 1QFKH 2SGPE 3U69H 4I8GA 1LHDH 1LHFH 1V2PT 3MU1A 4HZHA 1G37A 1GBAA 2BZAA 3SORA 3MH7A 1DXWA 3AASA 2Y6TA 2CJIA 4P00A 3QTOH 4DIIH 5BPEA 3F6UH 3OYPA 1VCQA 3HATH 2GDDA 4NSYA 4NA7A 5IDKA 4OS5A 3PWCA 2H6MA 4BTUB 3EGKH 6GCHF 3GY2A 9LPRA 3ATKA 3ATMA 1CA8B 3GY7A 1KY9A 3ESTA 3U98H 1ELVA 1AHTH 3ODDA 3ZYDA 2HNTC 2FOHA 1SLWB 2ZHQH 2XBYA 1N8OC 1ZTJA 3SI4H 1AKSA 1ACBE 1FMGA 4DURA 1YLCA 5H4IB 1GDUA 4NIXA 1OP8A 1A0HB 1MBMA 2TGTA 2GDEH 3AK5A 5DP9A 1GMDG 4ASHA 2ULLA 2HVYB 2ANYA 1C5VA 3ZZ4A 1W12U 1MCTA 4WH8A 3SN8A 1ZJKA 2VH6A 1YF4A 1YM0A 1HNEE 4Y6DA 1EZUC 2C8XB 1E35B 1C1MA 4YLUA 2GJGA 3RMMH 1WOFA 3FP6E 1OWJA 3T62A 1QGFA 3M5MA 4NA9H 1IQHA 1V2QT 3BF6H 1YCPM 3UQVA 1SB1H 1YLNA 5EG4A 1AQ7A 1FONA 3SNCA 3SUFA 3RU4E 1TRYA 1P3EA 1S84A 4Q63A 4DT7B 1HGTH 1YCPH 2K0QA 3DHKH 3RMOH 1C2KA 1MD8A 4H4FA 1ELAA 1W10U 2BY7X 1C5TA 1O2HA 2W3IA 5EQSA 1CQQA 2OC0A 2BLWA 1CA0B 1K1NA 1K1OA 3SHCH 1GI1A 3ZZBA 2WZQA 2KFWA 2W26A 1TX7A 1EAXA 1NO9H 4GPGA 4M7GA 1HFDA 1BJUA 3TJNA 5HIZA 3ZV9A 1GDQA 2KZ4A 4INHA 4XOJA 4ISNA 4TPYA 2XXLA 3HK6B 1P06A 4K69A 3TIUA 1TB6H 5EW1H 3ZVFA 3OTPA 5ESTE 2CV3A 3P8FA 1BQYA 1GVKB 1SFIA 1GBCA 3A87A 1HPGA 1W0ZU 2XC4A 5L30H 2ZU4A 2AGIX 1O3NA 2ZTZA 1GMCG 1QRZA 1XKBC 3U28C 3RXIA 2F9BH 3L6PA 1AFEH 2PKSB 1BTYA 2A32A 1TFXA 2ZU3A 1MQ5A 1FN8A 3N99A 1HDTH 4NSVA 2WYJA 2AMQA 2OC8A 4K1EA 4Z0KA 3NPSA 1CU1A 2I6SA 4GCHG 1YPHC 1BB0B 5E2OA 2ZGXH 2A4OA 2Z9IA 3E0PB 3LGUA 3L3TA 1P2QA 1C5MD 1W8BH 5C0TA 1UVUH 2VJ1A 1C2EA 4SGAE 1PQ5A 1O2QA 2A7HA 4FU8A 1S0RA 3STIA 1AE8H 1OYQA 4CRGA 4OS6A 1GG6C 1QJ1B 2BQ7B 4MG3A 1H1BA 2GCHF 4AYVB 1S0QA 3LPRA 1EPTA 4A1VA 2D8WA 2ANKH 1NC6A 1Z8JB 2BDGA 1LHGH 1AY6H 1Z8RA 1O32A 4JK6A 1PQ7A 1VCWA 1EAWA 1QRXA 3GY5A 3M5NA 2QF0A 1TGTA 1RTLA 2KX4A 1G36A 3PO1B 3URCA 2ZU1A 2G5NA 1LQEA 5GJ4B 4B76A 2ZI2H 4P02A 3LKWA 1SLVB 3TK5A 1SGCA 2XBWA 4U01A 1AFQC 3KGPA 1O3LA 1FUJA 3OTJE 1LVBA 3DUXH 1OP2A 3SU2A 4TY7A 4B73A 1TIOA 1G32B 2HNTF 1Y3VA 2CXVA 3URDA 4FU7A 1H8IH 2HPPH 1VCPA 2VGCB 1J14A 3MOCA 1BT7A 3WW7A 1HAGE 5AVDA 2BDYA 5EODA 2FOEA 2VWLA 1ZLRA 1KSNA 5AHGH 2ZPSA 3FP7E 3AAVA 1UCYE 3MWIU 4LOYH 5KGOA 1D4PB 1V2UT 5HMAA 3VGCC 2KCOA 2ZECA 4CH8B 1EB1H 1O30A 3E3TA 3M35A 1S6HA 1GJ7B 1ANDA 5EJLA 1HXEH 3RXUA 1O5GH 2O8UA 5LPFA 2ZP0H 1KXFA 4FUJA 1H4WA 4GHTA 3M37A 2O8MA 3BTKE 1C1VH 2HNTE 4ZHMU 4GHQA 1EP6A 1FN6A 2AMPA 3TGKE 5FL7D 5JB9S 1DANH 1HUTH 3F1SB 1P10A 5E2PA 4XBDA 1YC0A 4FUGA 3BTDE 4NZLA 1O3PB 4IW4E 1C1PA 1E1RD 3T5FH 2J4IA 2PTCE 2QXIA 1W11U 4AFUA 4FUDA 5K0HA 3S0NA 4F55A 3TGJE 1DVAH 2HGTH 2G00A 1AVWA 3SJOA 4AG2A 1DWCH 2RDLA 1C2HA 2F9NA 1CHOG 5EXNA 3ZZCA 4O3TA 6ESTA 1TLDA 4MPXA 4JCNA 1SI5H 2JETC 5C94A 2Z9GA 3E90B 4NWKA 1NZQH 3TVJB 4WJG2 1SGRE 3P70B 4NCYA 6CHAB 1EKBB 1AZZA 1EAIA 3LOXA 1C1QA 3AVZA 1PJPA 3UR6A 4MTBA 1F0TA 1P2MA 1FJSA 1K1LA 1MZDA 3RXAA 1W13U 5C5OA 4AGJA 4XBCA 1BZXE 1QBNA 4O3UA 4FUBA 3RXDA 3MTYA 3GYMA 4ABIA 2A1DB 2Y5GA 1ARBA 1K0HA 1BBRH 1KLTA 3RC5A 4TPIZ 3RUOA 1GHAG 5CHBA 8KME2 1BBRE 4ZHAA 1IQFA 4X1PU 1ETSH 2GGVB 1T7CA 3UAIC 2F4LA 2R2WU 2HALA 3LU9B 4E05H 1GL0E 4AG1A 1IHSH 2ZC9H 1NRNH 2SGEE 1N6YA 1O5FH 1SQAA 2PR3A 2FM2A 1BRUP 3RXKA
chains in the Genus database with same CATH topology
1H9HE 2BD9A 5C1XA 2VWOA 4UD9H 1HAIH 2R2MB 3T25A 2BDAA 1K1PA 1GI8B 4D7FA 4FUEA 1IQNA 4B2AA 1EZXC 1SSXA 1ZSLA 4WXIA 2SNWA 1GI2A 1DS2E 2EA3A 3SQEE 3RC6A 1BUIA 2A5KA 5JYIA 4JZFH 1NPMA 1O2TA 1O5DH 4JZDH 4UE7H 5BRRE 4YO9A 2ZKSA 1OOKB 1WBGB 5T6GA 2WV5A 3D49H 2ZHFH 3KQBA 2BHGA 2ZDLA 4X2XA 4B75A 3ZV8A 2BVRH 4CR5A 1M9UA 4I8JA 1PPCE 2QF3A 5EPYA 2OC7A 2GD4B 2W7UA 3IWMA 2BD8A 1DUEA 2VIWA 4XDEA 2BX4A 2ANWA 3SNEA 1AUTC 3TK6A 2A0QB 4ZKRU 3EAJA 2PSXA 1A7SA 1ZRBA 5LPRA 3OY6U 1LVMA 3RXMA 1F5LA 2VWMA 4A5TS 1UVTH 2H1UA 1G9IE 4X6NA 3UWIA 1A5IA 1OPHB 1UCYK 1GCDA 1O3HA 2XC0A 3VB4A 1UMAH 4X0WU 1O2PA 1N8OB 1DT2A 3BG4C 3GY4A 4YTAA 4YOIA 1BTPA 2PKAB 1IQKA 2GT7A 3BTTE 1C2FA 1O2IA 1C5YB 1WYKA 4YOJA 2XYAA 4CRDA 3MMGA 4WWYA 2FOMB 2CGAA 3DT0H 2P94A 3SJ8A 1AWFH 4KELA 2OD3B 4U32A 3VXEH 3UNQA 1CGJE 1O2WA 5JPMH 1J16A 3CP7A 4NIVA 4AFSA 3ZZ3A 1XMNB 2XBVA 5TCCA 2ZA5A 1NU7B 1GMHG 1YYY1 4HGCA 4JMYA 1E38B 1ANCA 3F9FA 5FX5A 1GHZA 2I6QA 3P92A 5GWZA 5CHAC 1BCUH 2AIPA 2QIQA 4MPUA 5EQRA 2ZU5A 2OC1A 1D3TB 3PLBA 1PPZA 2PV9B 1QTFA 3H7TA 4ZMAH 1EJAA 4NWLA 1F92A 2QXHA 3TNTA 1J8AA 1NN6A 2FLRH 1GHBF 4FVBA 4CR9A 2YNBA 3JZ1B 4DY7B 3BEIB 1EJMA 3V0XA 2OQUA 4OS1A 5E0JA 1XX9A 2J95A 1BIOA 1K9OE 4JZEH 1K1JA 4OS7A 2BY9X 1UK3A 1W14U 1DWEH 3M3SA 2EI8A 4ZHLU 4ABFA 3ZZ6A 2OTVA 1ZPCA 1V3XA 5CE1A 2FI3E 1SVPA 1RXPA 1TBZH 3KCGH 3NKKA 2AS9A 4UFDH 4Q80A 1QA7A 1TX6A 5E8EH 2ZFRH 1JMOH 1V2NT 3GY8A 4DIHH 3A82A 1ABJH 4DW2U 4I8HA 2UUYA 1BTWA 2BDBA 2ZHWH 2QXJA 1SHHB 1GJ4H 4ISIH 3P17H 2GMTB 6CHAC 2GZ7A 3IG6B 2A2XH 4ZKOU 2H9HA 3P8GA 1ELEE 1V2TT 2AIQA 1GJAB 2ZF0H 2A4GA 4ABGA 1QIXB 1F7ZA 3CS7A 2VH0A 1C2JA 3F9HA 1ZHMA 2ZWLH 1QRWA 2FTMA 2ZGHA 2XC5A 1LPGB 1FY4A 1KXBA 1TGSZ 2O8LA 1TQ0B 2Z3EA 4HFPB 2J94A 3T28A 3SUEA 1TALA 1SQOA 2FOBA 4IGDA 1GBDA 2C8YB 3PMJA 1SPJA 1ZMJA 1CHGA 1T8NA 2WPIS 1O3FA 1YPEH 1HAPH 3KEEA 2J34A 1W2KH 1GG6B 1TNLA 5DP4A 3Q76A 1EOJA 2STAE 2ZDMA 5EU8A 1C2GA 1W0YH 4JZ1A 2STBE 2AERH 1P0SH 2A4QA 3ZZ8A 1TBRH 1L4ZA 3O8DA 1UTPA 1F5KU 1FAKH 3VB6A 3D62A 1TOCB 4NA8A 4D76A 3T26A 3QWCH 1QL8A 1EOLA 1N1LA 1O2RA 1GBIA 5F8TA 1AFQB 3M5LA 1AWHB 2YOLA 1D6RA 1SGQE 1DUAA 1D3PB 2KAIB 3MU0A 3O8BA 1ESAA 3UTUH 1ZHPA 1KTTB 1G3BA 1XM1A 1DLEA 1BMLA 2TGPZ 3S69A 1OWKA 3LGTA 2AGGX 4X8UH 3QTVH 1GHYH 4F4OC 1X7AC 1GL1A 1XKAC 4WY3A 1BHXF 2FZZA 1ANBA 1Y5UT 2CF9H 2GCTB 3VGCB 2BM2A 5A8YA 3T2NA 4MNVA 3QGJA 1P09A 4ZROA 2OBOA 1BRCE 1S81A 1AD8H 1BMNH 1D6WA 1S5SA 3EA7A 2FO9A 1GJDB 2XCNA 1GBHA 2DE9A 1A5HA 1KIGH 1NRQH 1DWBH 3ZZDA 2PTNA 3BG8A 3FZDA 2VINA 1IQIA 2BDCA 5FPSA 2JKHA 3ZVEA 1TNGA 2VVVA 3FAOA 1CO7E 4HTCH 1GHXH 1UTOA 3PM3A 1LO6A 1ZHRA 3MO3A 4RSPA 1K2I1 2OUAA 1GJBB 1A0LA 1AGJA 2XWAA 4KKDA 2DE8A 4O97A 2B7DH 1O33A 4INLA 6GCHG 1SGPE 2PKAA 5K7RA 1YGCH 1P03A 3SV2H 3LIWA 3SV6A 3SNAA 3GISB 1EZQA 3AW0A 1XUIA 3BEUA 3ELAH 2R3UA 1BJVA 2D26C 2NU1E 3K9XB 2JETB 5JBCS 1SR5C 3K6YA 1T4UH 3R3GB 4MQAA 2C4FH 1AI8H 3ATLA 3V3MA 1YBWA 4AX9H 3SGAE 5LGOA 3SJKA 1HJAC 4D8NA 4A1TA 1DITH 3VXFH 4IN2A 1RD3B 2UUJB 3UFAA 1NFYA 3UQOA 1TPAE 1ELGA 1TBQH 5FBEA 4ESTE 4DOQA 1O34A 1B5GH 1T8OA 2B5TB 2ZDNA 2FYRA 2P93A 1UHBB 1WSSH 2G8TA 5DP3A 3P8OA 4Y8XA 3M7UA 5C1UA 3BIVH 4LK4A 3BTFE 1P9SA 1EUFA 1ESTA 4SGBE 1Y59T 2B9LA 1KXAA 4ABJA 1NTPA 4YESB 1O3GA 2QV1A 1F0SA 3A7XA 2ZGCA 2C93B 4Y8YA 5C2ZA 3SOSA 4ISLA 1YPMH 2OQ5A 1MAXA 3O8RA 1C2MA 1RTFB 3SW2B 1FI8A 4UDWH 1NFWA 3K65B 5ESBA 2F9OA 1ZTKA 2WPHS 4JZIA 2GMTC 2YNAA 1MZAA 1TONA 3SGBE 2XWBI 1IHTH 3DA9B 2A45B 1TNIA 3FANA 4NG9H 3MHWU 3UNRA 3KN2A 4YM9A 2ANMH 1GCTC 1G3CA 1FY8E 4AN7A 4ABHA 3UR9A 3E8LA 4YZUA 1P01A 4WMEA 1GBKA 4X1QU 5DG6A 5AF9H 1JXPA 1SG8B 3OX7U 2ZU2A 4BANB 1ABIH 2TBSA 3PMAB 3A8CA 3GY3A 3PYHA 5DKMA 2QXGA 5F03A 2VIPA 3BTWE 3DD2H 1E36B 4J1YA 1QY6A 1ELFA 1T8LA 1F0RA 1C1SA 1PQ8A 3PB1E 3KIDU 3S7KB 1GJ6A 2Z94A 1A3EH 1MTNC 3A8AA 1HB0B 4KGAA 2G4UA 4MDSA 3BV9B 1MKXK 4CBNA 3KL6A 1MQ6A 2J92A 4ZH8A 1UTJA 3BG4B 3B8JA 3KQCA 4HI3A 1ZPZA 1ZOMA 4E06H 1JRSA 2ASUB 1BHXB 2FI5E 3MNSA 2A7JA 3A7TA 1DFPA 1HJ8A 1LCYA 3RXEA 2AFQB 4ZXYH 1QB1A 2R0LA 1BTHH 4X1RU 5AFYH 1OWIA 4Z6AH 1L2EA 1DY9A 1G3EA 1BOQA 1TQ7B 2Q6FA 2Z3CA 3F68H 3RXOA 2QC2A 2XBXA 3U8TH 3K2UA 4AYYB 3SUGA 2V3OH 3A89A 3GCHB 3SJIA 2XNIA 1FZZA 5SGAE 2GCHG 4ISOA 4RKOB 1ELTA 3BIUH 5A09A 5B6OA 1C1UH 3G01A 5CHAB 2XCFA 4FUCA 4K8YA 2J2UA 2UWLA 1F2SE 1L1GA 1S6FA 1UCYH 2EI6A 2G52A 2SFAA 1O2ZA 2SNVA 2ZFTA 1OS8A 3W95A 1HAYB 2GCTC 3S9CA 4IMZA 1FV9A 2BD2A 3GY6A 3TH4H 4Y79A 2KAIA 3ZZ5A 2ZFQH 3AAUA 4BAHB 2HVXA 1Y3UA 3ITIA 4IC6A 4Y7BA 1O2UA 5L2ZH 2PUXB 4Y11E 3GCTF 3PV4A 3PROA 5DPAA 6LPRA 1SGTA 1VGCC 3VB7A 2H9EH 1KYNA 3S7HB 2Q6GA 4IS5A 3E16B 3SO3A 1YPLH 2BQWB 3ENSB 2OP9A 3UY9A 1L1NA 1AMHA 1YCPK 1A0JA 1OWHA 3Q3XA 2PGBB 3I77A 1KXDA 2ZNKH 1KXCA 4ZKSU 1CSOE 1SMFE 1SGNE 3LJJA 2FPZA 4TWWA 2VWNA 1DE7H 1VITF 1MTSA 2FESH 2W7SA 2FX4A 3SU0A 2ALVA 1Q3XA 1O2NA 1IQLA 4H42U 2G51A 4KTCA 1EATA 2G55A 2TIOA 3W94A 3L33A 3MU5A 5A8ZA 4J2YB 3ZZ7A 2M5TA 3UUZA 2B0FA 1MCVA 1TE0A 1DSUA 5J4QA 3M7TA 1GI7B 4AB8A 1O38A 1QBOA 1SLUB 2ZPRA 3U1JB 4FUHA 3SI3H 1K1IA 5JB8S 1O3AA 1TNKA 4BXSA 1QJ7B 4FXGH 2ZEBA 1Z8IB 3HGPA 1EQ9A 1HBTH 1TGCA 2ODYB 1LDTT 2BD5A 1DICA 1XUGA 3Q77A 4LZ4B 2Y7XA 4ZAEA 1TYNA 4X6OA 1A5GH 3RLYH 1O3JA 1K22H 3SU5A 2P8OB 3HKIB 3MO9A 5FXLA 1QL9A 1IQMA 2O8TA 3UNSA 3SU4A 5T3HA 1RJXB 4X2YA 1JRTA 1SLXB 1UHBA 1FIWA 2SGDE 4DVAU 2WPKS 3KF2A 2R0KA 1SGYE 2H5DA 2XRCA 1BTXA 4LZ1H 3O8CA 1IOEA 1RFNA 2C3SA 1KTSB 1PYTD 2F83A 4MNWA 4WF8A 1Z1JA 1HAXB 2LPRA 1Y8TA 1GBLA 2FEQH 2P3FH 3RXSA 1C1NA 4I8LA 4KTSA 3F9GA 3KQEA 1AB9C 1VZQH 1H9LB 4UFGH 1E0FD 2ZDAH 3RU4D 1TPPA 3FP8E 1SGDE 1YPHE 1WU1A 1PPGE 1H8DH 1DXPA 1UVSH 1Q31A 3IITA 4DCDA 1PPFE 3QX5H 5EOKA 3S9AA 2FODA 4IN1A 1JBUH 5DP5A 2ZHDA 3LGVA 1CBWC 2P95A 3MH5A 4XFQA 3QN7A 1EXFA 4RN6A 3RC4A 4A92A 1O35A 2VVUA 3ZVGA 3CENA 1LQDB 3A8BA 4CREA 1NY22 1YP9A 4AFZA 1GI0A 3A7YA 5PTPA 4CBOA 3MO6A 1O31A 3EE0B 1RIWC 2G4TA 2WUBA 3UWJH 1O2XA 5FBIA 1O0DH 3F9EA 3PMBB 2PFEA 1L0ZA 1LVYA 5IYTA 3RM0H 3QLPH 1BITA 3OU0A 2FOGA 1PYTC 5EGMA 3GCHC 1HAOH 2H5CA 3UIRA 1XUFA 1XXDA 5ETXA 1MD7A 8GCHF 4B1TA 1V2MT 3ATWA 2BDHA 1GBJA 1WV7H 4X1NU 1V2JT 1QURH 4AFQA 4IMQA 2B8OH 4X8VH 1HJAB 2FMJA 3U8RH 4YT6H 1F0UA 1UTNA 1J9CH 2BD3A 4GLYA 1LMWB 4O03A 1DOJA 1L1JA 4BAQB 5HYOA 1THPB 3HGNA 1TMBH 3S9BA 7ESTE 2ZGBH 4R8TB 5DP6A 1FPHH 1P05A 2THFB 1KDQB 1P11E 1XUHA 1CT4E 5ABWA 1G3DA 2WV4A 1HAZB 3D23A 2GV7A 4JYVH 4BNRA 1C9TA 1OSSA 2BQ6B 2BLVA 1TA2A 3FVFB 2FOAA 1QB6A 2NU0E 1DSTA 2LNCA 4WMFA 1RTKA 1IQGA 1C1RA 8ESTE 3LGIA 2OCVB 3NWUA 4I31A 4BTIB 3ZVCA 3V7TA 4R0IA 1O2MA 4K5ZA 1UTKA 1VR1H 4MVNA 2DUCA 2SGAA 1CGIE 1MKWK 4O9VA 1ETRH 2FOFA 1CGHA 1SHYA 1TPSA 4NFEA 3TNSA 1UTQA 2QGRA 2NU3E 1NESE 4MLFB 2PUQH 2OXSA 1GHBG 1SBWA 2SGFE 3V12A 5JBTA 1HRTH 3DFLA 4XE4A 3SV9A 1SQTA 4AGKA 2EC9H 1O3IA 1SGFA 4K8BA 3SU1A 4MNXA 1MBQA 2RG3A 4CHAB 1GCTB 5C1YA 1PPBH 3ATIA 3P95A 2ZTYA 5I25A 1AE5A 4MPVA 3TJOA 4WMDA 2Z9JA 1C5XB 5HM2A 3BSQA 3BTEE 1EAUA 1HV7A 1A3BH 4VGCC 1QCPA 2BB4A 3GDVA 4X6PA 2ZCKP 7GCHF 3GICB 2OBQA 4B71A 1A1RA 3A80A 1TGBA 2P8OC 2NU2E 1QHRB 1MTNB 3RXHA 1AVGH 1U6QA 4B2BA 4ABAA 2HWLB 1BRBE 3GCNA 5F8XA 4H6TA 1UK4A 2ZDVH 1BTUA 1RGQA 4F49A 4THNH 1C2DA 2A5IA 3I78A 3RMNH 4NFFA 3PTNA 2ZO3H 1ESBA 5FPYA 1SOZA 1INCA 1S83A 3NZIA 3A83A 2RA3A 3C27B 4I8KA 1CVWH 2ZCHP 3LGWA 4WXVA 3RXQA 1UTLM 1KLIH 2GKVE 3QZRA 2BZ6H 1TWXB 3MNCA 3PLPA 2BMGB 2BOKA 1DPOA 1YPKH 1MUEB 5EPNA 1FY1A 3SGQE 1XUJA 2CHAC 3BN9A 3ZVDA 1P3CA 1WTGH 3R0FA 3LC3A 1O3MA 3GYLB 2HOBA 4BAKB 2FWWA 3TJUA 1TX8A 3RXJA 4FUFA 3N7OA 1FY5A 3EQ0H 1EJNA 2ZCLP 1MKXH 3LGYA 5DJ7A 3E6PH 2AEIH 2Y82A 1C2IA 3OY5U 2VIOA 1GMDF 1FIZA 2BLOA 2F9PA 3SU3A 1FPCH 3OSYA 3TH2H 5DP8A 1LKAA 2ZQ2A 1C5LH 2WINI 2O8WA 2PW8H 1VGCB 3TITA 4AORA 4CRCA 4JYTA 3UPEA 1O5BB 1ARCA 1C5PA 1G2MA 1IAUA 3GOVB 1GI3A 3RXTA 2H9TH 2V3HH 3SNDA 3KQDA 3GDSA 3PTBA 4AOQA 1GJCB 1HXFH 1YPJH 4RKJB 2C90B 1QQ4A 5GCHF 1LHCH 2UWPA 1ELBA 1FXYA 1SOTA 2ZG0H 2G5VA 1GBBA 2ILNA 1NM6A 3P8NA 1K21H 3UOPA 4Q7ZA 1W7XH 2K1QA 4CRFA 3M3VA