4OS5A

Crystal structure of urokinase-type plasminogen activator (upa) complexed with bicyclic peptide uk603 (bicyclic 2)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title Dithiol amino acids can structurally shape and enhance the ligand-binding properties of polypeptides.
pubmed doi rcsb
source organism Homo sapiens
total genus 56
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os5A01
2WPIS 4SGAE 5JPMH 2CJIA 1P0SH 3U69H 2A0QB 2SGQE 4MDSA 4AG1A 4JZFH 3LGIA 1OP8A 4UFDH 3QTOH 1CSOE 3MNCA 2C4FH 4UDWH 5EGMA 5AFZH 2BDHA 3KHVA 1HAYB 3GCTG 1IQNA 1C1MA 1G37A 4YM9A 1SQAA 4WVPE 5E2PA 1W8BH 3SV2H 1HAOH 4CHAC 1XXDA 1OWEA 1O31A 1TNLA 1IQMA 3S69A 2WUCA 3D49H 1O2ZA 3E8LA 3ODDA 1O39A 4GHTA 2QN5T 2FOHA 1A4WH 1TMBH 3M7UA 1JIMA 1FXYA 3LGWA 3SJ8A 1F7ZA 1A0HB 1O3MA 2OD3B 1BBRK 1QHRB 2GDDA 2BDCA 3GYMA 3BG4C 3BTEE 1P57B 1ZYOA 2ODQA 2ZTZA 2D2DA 5C3NA 1GI1A 2F91A 1AE5A 1THRH 2ZDAH 2PFEA 5FBIA 3P95A 1W13U 1B0EA 2OC8A 2GCTB 4IW4E 1Z6JH 1MTSA 3SUFA 4MQAA 2ZG0H 3L6PA 3M3VA 1BT7A 1QA7A 4K2YA 3QLPH 3LKWA 3SJ9A 3BEFB 2QAAA 1GBAA 3RDZA 5HYOA 1LCYA 1YGCH 3VGCB 1IQHA 1ZHPA 3HK6B 3BF6H 3E91A 3TK5A 5A8YA 1K1LA 1IOEA 3SJOA 1ETSH 4FU7A 1C9TA 5AVDA 1D6RA 1IAUA 1TMTH 5DP4A 2V6NA 1NS3A 1O3KA 1QJ6B 1SOTA 1BRBE 1G2LA 1OS8A 2BDAA 3GY8A 2ANWA 1YKTA 1O2LA 3K9XB 4Y11E 3M35A 1TRNA 1SBWA 3S9AA 2A4OA 1UTQA 1YM0A 2G55A 2RA0A 4UE7H 2ZFSA 1DUEA 2OXSA 3KGPA 2GMTC 3MWIU 3AVZA 1GJ6A 2ZZUH 3QTVH 5AF9H 1B0FA 3RXAA 4TWYA 5DO4H 2AMQA 4Y8YA 3DD2H 4I8HA 3SUGA 1QTFA 2BD7A 1NU9A 1QBNA 2FP7B 1JRSA 1GVZA 1TX7A 1C1PA 2XXLA 6CHAB 8LPRA 1SFIA 2PUXB 3K2UA 1HJAB 1TLDA 1TB6H 3MH4A 3VB4A 4U2WA 4NZQA 1C4V2 2Z7FE 2FOFA 3F9FA 2V3OH 1BOQA 1BJUA 2SGPE 3SU5A 1O2JA 3SU3A 2J34A 3TPIZ 4A1VA 2O9QA 1MAYA 4NZLA 1SGTA 1FPCH 3KQCA 3P8FA 2QXGA 1BTPA 2FS9A 4GPGA 1UO6A 1BTYA 1T8OA 2QCYA 4ISIH 3MU5A 1RIWB 1DWBH 4CRDA 1GHAG 5ESTE 1HXEH 2QXHA 3UR6A 1O3PB 3URCA 2BMGB 1JOUB 4OS4A 1H9LB 2GDEH 4KTCA 3I77A 2VWLA 1BBRE 2Z9LA 4GCHF 2AIPA 1CO7E 1A61H 2UWLA 2ZFQH 1BTHH 1EUFA 3T2NA 1O2VA 2Z6BD 2ANYA 2BZAA 2XCNA 4BAHB 2VNTA 4TPIZ 3V7TA 3ZZ7A 1TRYA 1QJ1B 4H42U 1BCUH 2PTCE 2IOTA 3RU4E 1CHOG 4OS7A 3ELAH 1NFUA 5CHAB 4YOIA 1NRRH 3TH2H 1K1NA 3BTHE 1BRAA 1OWHA 3EA8A 5I25A 2JH5D 2FOMB 2ZKSA 2OTVA 1P3CA 5DP9A 1ELAA 3A80A 5DP5A 3OSYA 1S6HA 1C4Y2 1H9HE 1FMGA 3RXOA 3M5MA 3GY6A 4JZDH 3KN2A 2ZFTA 4GUXA 1G3BA 4J2YB 4ABGA 3V0XA 4AOQA 3BTQE 1EATA 1Y3WA 1GHBF 2ZFRH 1TOCB 2AGIX 1M9UA 3TGIE 2SGEE 1KXDA 3E6PH 1N8OC 2RDLA 5FCRA 1TPAE 1W7XH 1EPTA 3Q3XA 3ZVGA 3I29A 1HJ9A 1HB0B 4MNWA 2R9PA 2QIQA 2AGGX 4GLYA 2FLBH 2P8OB 1Y3UA 3SUDA 4ZXYH 1TFXA 3SHAH 3QZRA 2SGDE 1DS2E 2ZGCA 1S82A 4DT7B 5PTPA 1P2IA 2PHBA 5BRRE 5JDUB 2GCTC 4MTBA 2O8TA 3CENA 1O3FA 1AVGH 2NU1E 2AGEX 1RJXB 3ENSB 1LVMA 2BLOA 1RGQA 1OSSA 3SZNA 4RKOB 1T4UH 1TGBA 1ESAA 1E0FD 3VGCC 3LU9B 2C90B 2BVSH 2FMJA 3RLWH 5CE1A 2BY7X 4U32A 4XDEA 4Y6DA 1E38B 1W12U 1IQJA 1GMHF 2BQWB 3KEEA 4XBBA 4AYVB 4X1PU 1L4ZA 4Y79A 2P93A 3EE0B 2BXUH 2FEQH 2FIRH 2I6QA 2J2UA 2QA9E 3LGYA 2PSXA 1JXPA 4O97A 1BTWA 2HLCA 2Z9IA 5FCKA 5A8ZA 4K8YA 1GJ4H 1KXEA 1SGPE 2FOGA 1C2IA 4HGCA 3HPTB 1C5LH 1F5LA 4CRCA 4JZ1A 1AGJA 1CQQA 2Z9KA 3S9BA 4X6OA 2ZU4A 4HI3A 4I8JA 4NA9H 3RXTA 1GDQA 2EA3A 1QB1A 3ZVEA 2C93B 1DX5M 2HOBA 1VJ9U 2G51A 1S84A 1YCPH 1SLXB 2TPIZ 1GMCF 1C1RA 2IPHA 2FLRH 4I8KA 2TIOA 1K2I1 1O5BB 4I31A 3SU6A 1MTWA 1L1JA 2CN0H 3SQHE 6CHAC 4A1XA 1P2NA 1GHXH 3ZZ9A 1QL7A 1HJAC 1RTFB 4SGBE 1C4U2 1ELBA 3TK9A 2J4IA 2O8MA 4CRBA 3Q77A 2R2WU 1EPTC 4MNYA 1GBFA 4MNVA 2ZU5A 1BTXA 1AUJA 1DSTA 4YESB 5J4QA 1HAPH 3LPRA 1RIWC 2Y5FA 1YLCA 3A8CA 2LPRA 2A5AA 3GYLB 3IG6B 3NZIA 1GBEA 3RMOH 1KY9A 2AH4X 3E0PB 3ZZDA 1N1LA 5T6FA 1GJBB 1C5RA 4R0IA 2B7DH 4X1SU 1QIXB 3ZZ6A 2CV3A 1OXGA 4CBNA 4YLQH 2HNTF 4E06H 3T5FH 5C5NA 4OGYA 3ATKA 4YZUA 1O38A 3SN8A 1ZTJA 2RCEA 1C1UH 4BTUB 2ZEBA 3A7TA 5EU8A 2AMDA 2J95A 3MH6A 1GBLA 4D76A 1G32B 5CHAC 2FOAA 1ZGVA 1ZZZA 2ZECA 1RXPA 1O2GH 1V2PT 1UHBA 1C1QA 1G3CA 2AEIH 2Z3EA 1D6WA 1FV9A 3PLKA 2QGRA 3GCHB 2JETB 3M3TA 1KLTA 1O2YA 3TK6A 1ZSKA 2YNBA 2VWOA 3D62A 5C2ZA 2BY6X 3GCNA 1TA6A 3KCGH 1SGCA 1K1PA 4INHA 1AZ8A 1H1BA 1ARBA 4B2AA 2EEKA 3NK8A 4WMFA 1C5VA 1MU8B 1P01A 5JBCS 3RXEA 2P94A 1SI5H 3BEIB 2BD5A 2Z9GA 3K6ZA 3U8OH 2CXVA 2EI7A 4ABAA 5GIBA 4UFFH 2BVXH 1HAVB 1SOZA 3RXDA 1ELVA 1Z8IB 5K7RA 4JYVH 2XYAA 2PTNA 2WPLS 5FBEA 2BY9X 1C5OH 2BDIA 5JBTA 2D1JA 1TNIA 2P8OC 1O5FH 4HZHA 3UFAA 4K60A 1Y59T 1PQAA 1BMNH 1Y5UT 2LNCA 1IQEA 2VINA 8KME2 1HIAA 3FP8E 2SGFE 2A4RA 3SU1A 1Z1IA 5I46H 3UNRA 1AMHA 3TJOA 2HPPH 1PQ5A 1SG8B 1VITF 2D26C 1LO6A 2BQ6B 2HPQH 2ZCKP 1EAUA 1O3JA 1QB6A 4AORA 5FAHA 1XVMA 3UWJH 3U8TH 1O2PA 1P9UA 1SGYE 4XFQA 2O8UA 1LVBA 5FHTA 1W0ZU 1O2XA 4LK4A 4YT6H 1DWEH 1O3IA 2STBE 4ZKRU 2BXTH 1A5IA 2H9TH 1QCPA 1O2OA 3RLYH 1BTZA 4YOJA 2Q6FA 2Y7XA 3BTWE 1EP5A 1ANCA 3LGTA 1GCDA 1SGQE 1A3EH 1RRKA 4GCHG 1TOMH 2FOCA 3VEQB 5DP6A 3K6YA 1TX6A 4FXGH 2QYIA 1YPMH 4FUCA 3UUZA 1Q3XA 2ZGJA 3SU4A 2A4GA 1VCWA 1N6XA 3A83A 2GX4A 1L0ZA 1LHDH 1HAVA 5DKMA 4DY7B 4DGJA 4X2YA 2VVUA 1SQTA 3SNBA 4ZHMU 1P11E 2XTTB 5FPTA 3WY8A 4XBCA 5JB9S 2R3UA 1XKAC 1CGHA 4Y7BA 3F9GA 5A0AE 2PKSC 1BJVA 2Q1JA 4AN7A 1LKBA 3F1SB 4K1SA 3UIRA 4I8LA 1D9IA 1AE8H 1TQ7B 2DE8A 3A88A 4VGCC 1DLEA 4Q7YA 1V6DA 4A6LA 1QQUA 1NT1A 4ZXXH 1LPKB 1GL1A 2J38A 3DA9B 1XKBC 1NU7B 2ZDVH 1C1WH 1HAGE 4NA7A 1NROH 2J92A 1CT2E 3OTJE 1CT4E 2FODA 2VIVA 4Y8ZA 1GJ8B 3M5LA 3NKKA 1PPBH 3P17H 3UQOA 1KTSB 4K69A 1V2KT 1QL9A 1GJ5H 2P16A 1CT0E 1WYKA 2H6MA 1XUIA 1VJAU 1NTPA 1ZLRA 3DFJA 3STJA 3RC6A 1EZXC 1EZUC 4OS1A 3BV9B 1UTJA 1DY9A 1ANEA 2BLVA 3RU4D 3LGUA 3GCHC 2AFQB 2JETC 2STAE 1SHYA 4NIXA 1OWKA 1GMHG 4FUEA 1Q2WA 5C20A 1HNEE 1T31A 4LOYH 3SJKA 1V2TT 1EAWA 2V35A 1F5KU 1ZMNA 2K1QA 1TNHA 1TQ0B 4AFUA 1O3DA 1ZTKA 3TIUA 1GBBA 3F6UH 3BTGE 4XSKU 2AS9A 2H5CA 1F0SA 1P06A 4BAOB 2A5IA 3JZ1B 4U30A 2TGPZ 2VIDA 3BSQA 3ATWA 3Q3KA 1O3GA 1C2HA 3O8DA 3FAOA 2XBYA 1YPKH 1AY6H 2BDGA 3T29A 2WV4A 3H5CB 1GMCG 2BDYA 4FU9A 2BX3A 3SUEA 2ZIQH 3RMMH 3A7VA 4ABBA 3SV7A 1K21H 1SR5C 3LC5A 1MKWK 1WU1A 2WV5A 1EXFA 2TBSA 4IN2A 4ZH8A 2HWLB 1TE0A 1GBCA 3FP7E 3SOSA 1QB9A 3PTNA 1UVPA 3RXPA 3VB3A 1D4PB 2A7JA 2A1DB 1GGDB 5F8TA 2WPHS 3P70B 3PLPA 4FUDA 3F9HA 2ZC9H 4CH8B 4ZKOU 3A8DA 1GBTA 3GISB 2W3KA 5FPYA 3PWCA 3RXMA 2PGBB 3RXHA 2O8WA 2ZHEH 3TH3H 4D7FA 4X6NA 1QL8A 3RXCA 1EZSC 1G30B 1TNKA 1HAZB 2ZTXA 4X6MA 2B5TB 4TWWA 3QK1A 1LTOA 3U9AH 1T8MA 2DUCA 1AHTH 1F2SE 3LC3A 1LHGH 1UTNA 4CR5A 5DP3A 3RM0H 1C5PA 1SVPA 2H1UA 2GCHF 3PWBA 1BMLA 2G8TA 2JKHA 4M7GA 1QQ4A 3SNAA 1JMOH 3DUXH 2HNTC 1TBZH 2QXJA 1ORFA 2Y81A 3MOCA 2VVCA 1AVXA 5T3HA 2VJ1A 3S7KB 1O34A 3FANA 4ISOA 4DIIH 4DOQA 1ZSJA 3HATH 1O2KA 4Y7AA 8ESTE 1O30A 4J1YA 5B6OA 1QJ7B 2GZ7A 3AAUA 1P02A 3UR9A 2ZO3H 5DP8A 2P3TB 3I78A 5E0GA 1GVKB 1O2NA 3PTBA 4Y0YE 1GI6A 1DDJA 1OYQA 3P92A 1MTVA 4JMYA 1WSSH 4MG3A 4YT7H 3KIDU 4X1NU 5LPEA 1LVYA 1TMUH 3VXEH 1GI5A 2M5TA 3A89A 3BIVH 1D3PB 1XMNB 3R0FA 2ZFPH 1FI8A 1OWDA 2TGDA 1C5ZB 1QGFA 9LPRA 3AW0A 1DITH 2NU4E 2PUQH 2AYWA 4NWKA 2AIQA 1DE7H 3MNSA 2VU8E 3A82A 1AFEH 2Y5GA 1GVLA 2ZGXH 1C2EA 1LPGB 3ZVCA 4IN1A 1MAXA 1UK3A 1Z8GA 3FZZA 3UNQA 4CBOA 1FDPA 1IQLA 2IJOB 1XXFA 3A86A 4B2CA 4JK6A 4B75A 2OQ5A 3UOPA 4FVBA 2ZHDA 1IQIA 1SLWB 1V2QT 1VITG 4INLA 4E05H 1XUFA 1KXBA 2QC2A 3H7OA 1H8DH 1LVOA 1MZAA 1SGEE 1HAXB 4FUBA 4TY6A 3AASA 1QA0A 4FU8A 1SMFE 3BIUH 3SJIA 3QN7A 4KP0A 3ESTA 2FM2A 3ZZ4A 1L4DA 1NN6A 2Y82A 1NRQH 4CRGA 1EJMA 4CR9A 1GMDF 1NY22 3SI3H 1AUTC 1CHGA 1GG6B 3NUMA 2ZGBH 4WH6A 1DANH 1SGNE 1JRTA 1ZRBA 4IS5A 2OC0A 2HGTH 2VH0A 2UUJB 1C5MD 2BLQA 1IQFA 3SU0A 1SGDE 4WMEA 4DCDA 1FIWA 3MU4A 2A5KA 5EXMA 1GHZA 3RP2A 2HRVA 4DURA 1YBWA 4KKDA 3LT3A 2GV6A 1C2JA 2EI6A 4NIYA 4K1TA 2OBQA 2W7SA 1Y5AT 1A0JA 2PR3A 3TH4H 1C5YB 1UCYE 1C2KA 4KTUA 3MNBA 3Q3YA 2GD4B 1TGSZ 3GY4A 2XC4A 4X8UH 4WF8A 4B76A 1QNJA 2SNWA 2ILNA 3GY5A 2HVXA 4BXWA 3MH5A 1T8LA 2UUFB 3VXFH 3O8CA 4BOHA 1X7AC 1DM4B 3MH7A 3A8BA 3EQ0H 1YPEH 1LHCH 3BTFE 4XE4A 1MBMA 1NFXA 2YNAA 5GDSH 4ZHAA 1GGDC 2ZDMA 1G2MA 1KIGH 1GPZA 1ZMLA 3F9EA 1MTUA 4NWLA 2BX4A 4R8TB 2QXIA 2A31A 1MD8A 1NESE 2ZNKH 5C1XA 1J15A 1BB0B 3PMBB 2Y5HA 9ESTA 3MYWA 4O3UA 1MCVA 1D3TB 1MQ5A 4JZEH 5C1UA 2ZHQH 4JCNA 1D3QB 1L1GA 3G01A 1P2KA 4X2VA 2ZU3A 5EODA 1C5UA 1C9PA 4FUFA 1ZPZA 1SL3A 2J94A 1TNJA 2BD3A 1GI8B 2Y80A 1O37A 4X8VH 3LH1A 1HYLA 3LDXH 3ITIA 3BTME 6ESTA 4WH8A 1AIXH 4GHQA 2JH0D 3ZZAA 4B73A 1IQGA 1KSNA 1EX3A 2WYJA 5GCHF 3E3TA 4PROA 1U6QA 3GDUA 1C1VH 1UJ1A 1SGFG 3KQEA 3O8BA 3TNTA 2HALA 2PLXA 1KDQB 1V2OT 1SLVB 2P95A 1Z7KA 1EZQA 4JYTA 1A5GH 1GCTB 5F03A 5BPEA 1UVSH 2XCFA 3Q76A 3VB7A 5TCAA 5A2MH 3ZVBA 1P2MA 1C2GA 3PB1E 4Y76A 4RN6A 1HDTH 3T27A 1O3OA 3PLBA 1ZOMA 2F9BH 4DIHH 4I7YH 1GI0A 1P2QA 2R0KA 1NO9H 2BD9A 1LDTT 2WUBA 4D7GA 1XVOA 2G00A 1ZHMA 1B7XB 1AWHB 3ZZBA 2Y7ZA 1F0UA 3EA7A 6GCHF 4BTIB 1XUGA 3TJNA 2BD4A 1TRMA 1EKBB 5L6NH 3ZVAA 1BITA 4A92A 3N7OA 3SHCH 1YPHC 1F0RA 5HMAA 1WV7H 2QV1A 1ELFA 1KXCA 4MVNA 2GT8A 2W3IA 4WXIA 4F49A 4H4FA 3S7HB 2FI5E 2OLGA 1HJ8A 1O2QA 3CS7A 4NFFA 1EB2A 2I6SA 1VGCB 1O3CA 1SHHB 3CP7A 1GG6C 1L1NA 1L2EA 3M5NA 3MI4A 3PMHB 1S81A 3M5OA 2Z3DA 1WCZA 2Y6TA 3KQDA 1W14U 4ZKNU 2FTLE 2F3CE 1RTKA 1C2LA 2BOKA 1O2SA 3V13A 2B8OH 1AWFH 2OUAA 4GAWA 3L3TA 4X1QU 1LPZB 2ZU2A 3ZVDA 3M3SA 2GCHG 4Q2KA 1O3EA 1FN8A 4UFGH 5DK1A 5GWZA 1YPLH 1K22H 1PQ8A 1PFXC 1O35A 3VB6A 5JB8S 1J9CH 2FESH 3AW1A 1C5XB 2OC1A 2C8XB 1UVOA 3UOUA 3NXPA 3LIWA 1HAHH 3TLOA 3GICB 1ESTA 1WQVH 3RXBA 1LQEA 4K5ZA 1ID5H 3UNSA 1THSH 4FVDA 1A1RA 4K3JA 2V0BA 3MHWU 5JYIA 1G36A 4Y8XA 3GY3A 1HBTH 1J16A 1GBHA 3IWMA 3A7XA 1GI3A 5JBAS 1GWAA 1BBRH 1PYTD 7GCHF 1Z8RA 1YYY1 1NM6A 1S5SA 1W11U 3HGNA 1T8NA 2Z3CA 1EJNA 1LMWB 2KAIB 4I33A 1LHEH 5A8XA 5L2YH 2BDBA 1EP6A 3QDZB 1YC0A 1Z1JA 2A4QA 3SQEE 1P2OA 4Y10E 4B2BA 3LGVA 3T62A 3ZVFA 2ZHWH 1AKSB 1HFDA 2P3FH 4WWYA 1DWDH 1AZZA 3D65E 4THNH 1FY1A 1IQKA 1SSXA 1SB1H 1MTNB 5E0JA 1P3EA 4IGDA 4MPWA 4NIWA 1GI7B 1QRZA 1E35B 1TPOA 1XUJA 1ZJKA 3LOXA 2OQUA 1H4WA 3OX7U 3E90B 4CH2B 1UTKA 4WJG2 1HPGA 1XM1A 2QF3A 1TBQH 1Y3XA 3GDSA 3EAJA 2UUYA 2GTBA 1EAIA 2AERH 1YCPK 1TAWA 1Y5BT 1GMDG 1AO5A 1ZPBA 4WMDA 3AAVA 8GCHF 4K1EA 2XRCA 5ETXA 1TNGA 4QT8C 3RMNH 2FX4A 4MNXA 1ELGA 5DP7A 1A5HA 1AFQB 1ZRKA 1O3HA 1AD8H 7LPRA 1V2UT 1KYNA 1GJ7B 1OWIA 2CF8H 5A09A 1E36B 1GCTC 3SGAE 1XX9A 2VVVA 2ZI2H 2PW8H 1GBMA 4ABEA 1CU1A 2NWNA 1TGTA 1LHFH 3RXGA 5J4SA 1GHBG 3MU8A 1K1OA 4E7NA 1CA0B 4KTSA 1GHWH 1WUNH 3PO1B 2R2MB 3RC5A 4UEHH 1PYTC 4DVAU 1UK4A 3QO6A 4H6TA 3SGQE 3SNEA 4UONA 1C2DA 3BTTE 2GVFA 4AFSA 5C1YA 1O2WA 5IDKA 1Y3YA 1HLTH 2UWPA 3QWCH 1YPGH 4ASHA 4TYDA 3B8JA 2ZCHP 1V2MT 2A32A 1TABE 3TGKE 2FYRA 1S0QA 1KTTB 1KXAA 2XNIA 4D9QA 3SI4H 1UTMA 3KNXA 4IC6A 3ZZ8A 1MD7A 2ZDLA 2Q6GA 2RG3A 2SGAA 1K1MA 1OP0A 4INKA 1V2ST 2FOBA 3E0NB 1C2FA 3UY9A 3UQVA 3A81A 1VGCC 1ANDA 2BD2A 1O5AB 4X2XA 1TPSA 4DJZB 3MO6A 1XUHA 1PJPA 1TX8A 4X8TH 1ABJH 1O2UA 3U1JB 1ZSLA 1PPZA 3ODFA 5FXLA 3PROA 5FX6A 2PSYA 1DSUA 2VIPA 4ESTE 1ABIH 4I32A 2ASUB 1RFNA 3B9FH 2A7HA 1PPCE 2W7UA 3MU1A 4ZKSU 5TJXA 5EW1H 3H7TA 1QRXA 5HXFA 1G3DA 1CBWB 3SW2B 3SBKA 3DFLA 1CVWH 3V3MA 4Q80A 2VWMA 1ESBA 2YOLA 2VIOA 2C3SA 3RXVA 2EI8A 2FI3E 1TPPA 1BDAA 1MH0A 3RXUA 3DHKH 1TWXB 1J8AA 5GCHG 2CGAA 1P04A 4NGAH 1KLIH 3ATLA 4BANB 1YF4A 3EDXB 3MO9A 2VIQA 1N8OB 1SFQB 2ALPA 2GZ9A 2A2XH 2F83A 1C2MA 3A7WA 1AU8A 2ZF0H 4FUHA 3W94A 2PGQB 2O8LA 4ZMAH 5K0HA 3RC4A 2WPKS 1AN1E 1FJSA 5ESBA 5E2OA 2OBOA 1ELDE 2JH6D 2TRMA 1BZXE 1SLUB 2TGAA 4AZ2B 4ABFA 1Z8JB 1O3NA 6GCHG 3NPSA 3IITA 4Z6AH 1AB9B 1BRCE 1O3LA 2FO9A 5LH8A 1MTNC 5T6DA 3R3GB 3MFJA 2H9HA 1C5TA 1UVUH 2BD8A 3TJVA 1TGCA 1Y3VA 2H2ZA 1HGTH 1EAXA 1OX1A 1Y8TA 3A84A 1ETRH 1A3BH 4CREA 1UTOA 2SFAA 1NFYA 1UCYK 3RXFA 3Q00A 3E16B 3RXLA 3TVJB 2F9UA 1FY5A 2FOEA 1FY8E 5DGJA 3SNDA 4D8NA 4KGAA 2G52A 3TJUA 1V2NT 1AFQC 2ZP0H 2ODYB 1ZPCA 3PMJA 1DY8A 1YCPM 1O3AA 3LH3A 2ZU1A 3QGJA 1K1JA 4AGKA 1BQYA 5EQQA 2FWWA 1SGRE 1FNIA 3BTDE 1TA2A 2GKVE 5DJ7A 2RA3A 1ZGIA 3TGJE 1C1OA 1ZTLA 2FDAA 3QX5H 1CA0C 3PMAB 2G5NA 1FAXA 4ZHLU 1ARCA 3PO1C 2FXRA 3UREA 2C8ZB 1DUAA 1TIOA 1CE5A 5LPRA 1MKXK 3FVFB 3UTUH 4A7IB 3B23B 1PPEE 2UWOA 1P03A 3GY7A 1W3CA 1ELEE 1ETTH 2XBXA 2A7CA 1EPTB 1P2JA 5AHGH 4O9VA 2FS8A 3JZ2B 1O5DH 2BY8X 3RUOA 1QFKH 2F9NA 5T6GA 1O5GH 2BTCE 4WY3A 3U1IB 3W95A 3PYHA 4ZAEA 5F8XA 1WTGH 1OKXA 1FUJA 3ATIA 1B5GH 3RXIA 1FQ3A 1Z6EA 3RXRA 1LQDB 2GT7A 3EGKH 7GCHG 3DT0H 1ELCA 4JYUH 3VPKA 4AG2A 3SV8A 3GCOA 4DW2U 3HK3B 1V2JT 1QR3E 1GI9B 5EW2H 2OC7A 5TCCA 1G3EA 2VH6A 3UWIA 2ESTE 1OYTH 1THPB 3RXQA 1TBRH 3T26A 4FUJA 4ABJA 1PPHE 3P6ZB 2ZPSA 2HNTE 3ZZ3A 1CBWC 1DXPA 2A2QH 1DT2A 2NU0E 1CGIE 2ZQ2A 4AGJA 2BHGA 1DFPA 2EC9H 1WBGB 3HKJB 2VIWA 1RD3B 2C8YB 1O2IA 2ZHFH 1SGFA 4YOGA 3A7ZA 3U8RH 1F92A 2NU2E 1C5NH 1O0DH 1S85A 1BUIA 2GGVB 1VCPA 1H8IH 1SQOA 1V3XA 2ANMH 1UMAH 8GCHG 1QURH 3ZYDA 4ABHA 1ZHRA 3C27B 4MPUA 2FYQA 3K65B 1EOJA 4JZIA 1H9IE 3VFEA 4AFZA 4B71A 1YP9A 2XBWA 2BVRH 1DWCH 1JIRA 1NC6A 5EXLA 1FLEE 1DOJA 1LKAA 4OS2A 4YLUA 1E37B 1O2RA 3M7QA 3M7TA 4AX9H 5G4BA 2Z94A 3E1XB 2F9OA 4Q7XA 4LZ4B 1OOKB 4BAKB 4CRAA 3A87A 3QZQA 5F6MA 1TYNA 5HGGA 2ZTYA 1AVWA 1P12E 1FY3A 3BEUA 1HAIH 4NIVA 1V2VT 4YTAA 1BMAA 1NRPH 3SNCA 3TITA 1WTHD 1F5RA 1PPGE 1GJDB 1BHXF 2CF9H 1GL0E 3M61U 1AB9C 1CGJE 2G5VA 4KELA 1V2RT 2XBVA 4Y71A 2B0FA 2CHAB 5C67A 1O3BA 3URDA 1KXFA 1QRWA 3OYPA 1XUKA 1UTPA 4AYYB 4BNRA 3BN9A 1EQ9A 5EPYA 1A0LA 2PKAB 1ZJDA 1OP2A 3T28A 3O8RA 2QY0B 5EXNA 3VB5A 1QBOA 4ZUHA 2BYAX 1WQSA 1ACBE 4NFEA 2VGCB 1BIOA 4Y0ZE 5EPNA 3GDVA 2BLWA 3GCTF 1K28D 3ZV8A 5C5OA 4X0WU 2P3UB 2ANKH 1P10A 2F9VA 1UHBB 1HV7A 5GPIB 4OS6A 3OY6U 3ZV9A 2XW9A 2DE9A 3SGBE 4OS5A 4MPVA 5FPSA 4MLFB 1MMJN 1RTLA 2ZDNA 5A0CA 2ZPQA 1S0RA 1SPJA 2R3YA 1FN6A 4TY7A 1G9IE 4Q7ZA 5AFYH 2WINI 1T32A 1FY4A 2VB0A 1O33A 3F68H 4IMQA 1GBIA 2WYGA 1DICA 4K8BA 2PKSB 3FFGA 5A0BA 5H4IB 1SGIB 3S0NA 5CMXH 1YPJH 2ULLA 2BB4A 3KL6A 3SO3A 2A45B 4NSYA 1IHSH 4VGCB 1DLKB 2D8WA 4A1TA 1WAYB 2VWNA 4DG4A 2NU3E 1KLJH 1BTUA 1W7GH 2G4TA 1O32A 2ZQ1A 2THFB 1MQ6A 1ELTA 3PM3A 1FZZA 1NZQH 1HIAB 1IHTH 1W2KH 2BZ6H 2H9EH 3SORA 5IYTA 2BM2A 2ODPA 2PKAA 2WPMS 3SV6A 1D3DB 4NG9H 2BY5X 4O3TA 1V2WT 4GVUA 1ANBA 1J14A 2WPJS 2FPZA 1O36A 2G81E 4BAMB 3FZDA 1PPFE 1GHYH 2XC0A 3M37A 2PV9B 1RS0A 3T25A 1GJAB 4ABIA 4TPYA 3LJOA 3LJJA 1AI8H 1BHXB 1KDQA 3OU0A 5F8ZA 1TONA 4IBLH 4E7RG 6LPRA 1O5EH 5L30H 3ZYEA 1A2CH 1TGNA 1GHVH 2ZPRA 3MTYA 5GJ4B 1AQ7A 1F0TA 3EYDA 1YLDA 1C1SA 1K9OE 4AB8A 2ZFFH 2B9LA 2GV7A 1VCQA 2FX6A 3P8OA 1HUTH 1ZMJA 1EASA 1INCA 2UUKB 2FTMA 3MNXA 5EQRA 3EA9A 1OPHB 2GP9B 4IC5A 2H5DA 4I8GA 1CA8B 1FPHH 1DVAH 4XBDA 3P8GA 5EQSA 1DPOA 4HTCH 3RXKA 2J9NA 1GBKA 1GI2A 5JBBS 4CHAB 1T7CA 1ZR0A 2R0LA 1GBJA 2P59A 4X1RU 2BQ7B 3RMLH 1BA8B 2TGTA 1GJCB 1GDNA 1NFWA 1GHAF 5EOKA 2IN2A 2QF0A 2BOHB 3SU2A 1PQ7A 3NWUA 3STIA 3A7YA 1V2LT 7ESTE 4BXSA 1C5WB 1GBDA 3BTKE 1P8VC 5FX5A 3BG4B 3RXJA 1GDUA 1UK2A 1FONA 4UFEH 4ISNA 1JBUH 4U01A 1MKWH 1VZQH 1UTLM 3RU4T 3NCLA 1UVTH 3MMGA 1C5SA 1FIZA 4LXBH 1CHOF 2XC5A 3HGPA 1YPHE 2CHAC 4IMZA 2GZ8A 2V3HH 3ATMA 4NSVA 4NA8A 3SV9A 4ABDA 2Q6DA 4MPXA 4RKJB 5E8EH 4LZ1H 4JK5A 3TNSA 1O2HA 3MO3A 1EJAA 1GJ9B 5ABWA 4ISLA 2ZDKA 3M36A 2FI4E 2VGCC 3KQBA 3CS0A 1W0YH 2OINA 3GY2A 1Q31A 4O03A 3ZZCA 3BG8A 2ALVA 3QGNB 2W5EA 1A7SA 1S83A 2CMYA 1EOLA 2PWXA 4CRFA 3P8NA 1NPMA 1FAKH 1C1TA 2AMPA 1DXWA 5SGAE 2ZWLH 1OWJA 2W26A 3LONA 2XWAA 3PV4A 4ZROA 1SC8U 1MZDA 3QUMP 1P9SA 1UCYH 3MU0A 4OGXA 5LGOA 2Z9JA 4B1TA 1P05A 1O2TA 3V12A 1O5CB 2GMTB 1NRNH 4NCYA 1BMMH 4WXVA 1JWTA 1VR1H 4A5TS 1C5QA 1N6YA 2FZZA 1WOFA 3UPEA 1A46H 3U98H 1O2MA 1MU6B 2OCVB 4FUGA 1BRUP 4X6PA 2ZA5A 4X2WA 4X8SH 3L33A 2KAIA 5HM2A 2SNVA 2G4UA 1MUEB 1EB1H 3C1KA 4RSPA 3GOVB 1Z71A 5GXPA 3HKIB 4FUIA 2OP9A 1TALA 4D9RA 4AB9A 1HCGA 3A8AA 1AKSA 3ZZ5A 1HXFH 4BTTB 5EG4A 1J17T 1W10U 4F4OC 5L2ZH 1MKXH 1K1IA 4GSOA 2F9PA 1C1NA 4UD9H 1MCTA 1S6FA 1E34B 3RXSA 1NRSH 5E0HA 3RM2H 5LPFA 4XOJA 2XWBI 4Z0KA 4AFQA 1GI4A 2ZCLP 3FP6E 1VITH 2ZGHA 5DG6A 2C8WB 1QY6A 1QBVH 4H6SB 4ISHH 3TU7H 3S9CA 3D23A 4HFPB 4YO9A 5DPAA 5HM9A 4B74A 1T4VH 3A85A 1HRTH 4BAQB 1MBQA 3OY5U 7KMEH 1P09A 3KF2A
chains in the Genus database with same CATH superfamily
2WPIS 4SGAE 5JPMH 2CJIA 1P0SH 3U69H 2A0QB 2SGQE 4MDSA 4AG1A 4JZFH 3LGIA 1OP8A 4UFDH 3QTOH 1CSOE 3MNCA 2C4FH 4UDWH 2OK5A 5EGMA 5AFZH 2BDHA 3KHVA 1NBME 1HAYB 3GCTG 1IQNA 1C1MA 1G37A 4YM9A 1SQAA 4WVPE 5E2PA 1W8BH 3SV2H 1HAOH 4CHAC 1XXDA 1OWEA 3OFND 1O31A 1TNLA 1IQMA 3S69A 2WUCA 3D49H 1O2ZA 3E8LA 3ODDA 1O39A 4GHTA 2QN5T 2FOHA 1A4WH 1TMBH 3M7UA 1JIMA 1FXYA 3LGWA 3SJ8A 1F7ZA 1A0HB 1O3MA 2OD3B 1BBRK 1QHRB 2GDDA 2BDCA 3GYMA 3BG4C 3BTEE 1P57B 1ZYOA 2ODQA 2ZTZA 2D2DA 5C3NA 1GI1A 2F91A 1AE5A 1THRH 2ZDAH 2KM0A 2PFEA 5FBIA 3P95A 1W13U 1B0EA 2OC8A 2GCTB 4IW4E 1Z6JH 1MTSA 3SUFA 4MQAA 2ZG0H 3L6PA 3M3VA 1BT7A 1QA7A 5EIYA 4K2YA 3QLPH 3LKWA 3SJ9A 3BEFB 2QAAA 1GBAA 3RDZA 5HYOA 1LCYA 1YGCH 3VGCB 1IQHA 1ZHPA 3HK6B 3BF6H 3E91A 2XOKD 3TK5A 5A8YA 1K1LA 1IOEA 3SJOA 1ETSH 4FU7A 1C9TA 5AVDA 1D6RA 1IAUA 3DSOA 1TMTH 5DP4A 3FN8A 4Q63A 2V6NA 1NS3A 1O3KA 1QJ6B 1SOTA 1BRBE 1G2LA 1OS8A 2BDAA 3GY8A 2ANWA 1YKTA 1O2LA 3K9XB 4Y11E 3CNRA 3M35A 1TRNA 1SBWA 2K0QA 3S9AA 2V7QD 2A4OA 3KYFA 3OAAD 1UTQA 1YM0A 2G55A 2RA0A 4UE7H 2ZFSA 1DUEA 2OXSA 3KGPA 1BMFD 2GMTC 3MWIU 3AVZA 1GJ6A 2ZZUH 3QTVH 5AF9H 1B0FA 3RXAA 4TWYA 5DO4H 2AMQA 4Y8YA 3DD2H 4I8HA 3SUGA 1QTFA 2BD7A 1NU9A 1QBNA 2FP7B 1JRSA 1GVZA 1TX7A 1C1PA 2XXLA 6CHAB 8LPRA 1SFIA 2PUXB 3K2UA 1HJAB 1TLDA 1TB6H 3MH4A 3VB4A 4U2WA 4NZQA 1C4V2 2Z7FE 2FOFA 3F9FA 2V3OH 2JDID 1BOQA 1BJUA 2SGPE 3SU5A 1O2JA 3SU3A 2J34A 3TPIZ 4A1VA 2O9QA 1MAYA 4NZLA 1SGTA 1FPCH 3KQCA 5CDFE 3P8FA 2QXGA 1BTPA 2FS9A 4GPGA 1UO6A 1BTYA 1T8OA 2QCYA 2VBCA 4ISIH 3MU5A 1RIWB 1DWBH 4CRDA 1GHAG 5ESTE 1HXEH 2QXHA 3UR6A 1O3PB 3URCA 2BMGB 1JOUB 5IK2D 4OS4A 1H9LB 2GDEH 4KTCA 3DSPA 3I77A 2VWLA 1BBRE 2Z9LA 4GCHF 2AIPA 1CO7E 1A61H 2UWLA 2ZFQH 5KGOA 1BTHH 1EUFA 3T2NA 1O2VA 2Z6BD 2ANYA 2BZAA 2XCNA 4BAHB 2VNTA 4TPIZ 4XRNA 3V7TA 3ZZ7A 1TRYA 1QJ1B 4H42U 1BCUH 2PTCE 2IOTA 5EJLA 1CHOG 3RU4E 4OS7A 3ELAH 1NFUA 5CHAB 4YOIA 1NRRH 3TH2H 1K1NA 3BTHE 4F55A 1BRAA 1OWHA 3EA8A 5I25A 2JH5D 2FOMB 2ZKSA 2OTVA 1P3CA 5DP9A 1ELAA 3A80A 5DP5A 3OSYA 1S6HA 1C4Y2 1H9HE 1YY3A 1FMGA 3RXOA 3M5MA 3GY6A 4JZDH 3KN2A 1YWUA 2ZFTA 4GUXA 1G3BA 4J2YB 4ABGA 3V0XA 4AOQA 3BTQE 1EATA 1Y3WA 1GHBF 2ZFRH 1TOCB 2AGIX 2YMSD 1M9UA 3TGIE 2SGEE 1KXDA 3E6PH 1N8OC 2RDLA 5FCRA 1TPAE 1W7XH 1EPTA 3Q3XA 3ZVGA 3I29A 1HJ9A 1HB0B 2WV9A 2R9PA 4MNWA 2QIQA 2AGGX 4GLYA 2FLBH 2P8OB 1Y3UA 3SUDA 3FOAA 4ZXYH 1TFXA 3SHAH 3QZRA 3U28C 2SGDE 4XD7D 1DS2E 2ZGCA 1S82A 4DT7B 5PTPA 2IPQX 1P2IA 2PHBA 5BRRE 5JDUB 1QZ8A 2GCTC 4MTBA 2O8TA 3CENA 1O3FA 1AVGH 2AGEX 2NU1E 1RJXB 3ENSB 1LVMA 2BLOA 1RGQA 1OSSA 2KCOA 3SZNA 4RKOB 1T4UH 1TGBA 1ESAA 1E0FD 3VGCC 3LU9B 2C90B 2BVSH 2FMJA 3RLWH 5CE1A 2BY7X 4U32A 4XDEA 2HLDD 4Y6DA 1E38B 1W12U 1IQJA 1GMHF 2BQWB 3KEEA 4XBBA 4AYVB 4X1PU 1L4ZA 4Y79A 3FO8D 2WPDD 2P93A 3EE0B 4ACBA 2BXUH 2JJ1D 2FEQH 2FIRH 2I6QA 2J2UA 2QA9E 4AC9A 3LGYA 2PSXA 1JXPA 4O97A 1BTWA 2HLCA 2Z9IA 5FCKA 5A8ZA 4K8YA 1GJ4H 1KXEA 1SGPE 2FOGA 1C2IA 4HGCA 3HPTB 1C5LH 1F5LA 4CRCA 4JZ1A 1AGJA 1CQQA 2Z9KA 3S9BA 3SYJA 4X6OA 2ZU4A 4HI3A 4I8JA 4NA9H 2RFKC 3RXTA 1GDQA 2EA3A 1QB1A 1E79D 3ZVEA 2C93B 1DX5M 2HOBA 1VJ9U 2G51A 4Q4LA 1S84A 1YCPH 1SLXB 2TPIZ 1GMCF 1C1RA 2IPHA 2FLRH 4I8KA 2TIOA 1K2I1 5T1VA 1O5BB 4I31A 3SU6A 1MTWA 1L1JA 2CN0H 3SQHE 6CHAC 4A1XA 1P2NA 1GHXH 3ZZ9A 1QL7A 1HJAC 1RTFB 4SGBE 1C4U2 1ELBA 3TK9A 2J4IA 2O8MA 4CRBA 3Q77A 2R2WU 1EPTC 4MNYA 4F48B 1GBFA 4MNVA 2ZU5A 3N99A 1BTXA 1AUJA 1DSTA 4YESB 5J4QA 1HAPH 3LPRA 1RIWC 2Y5FA 1YLCA 3A8CA 2LPRA 2A5AA 3GYLB 3IG6B 3NZIA 1GBEA 3RMOH 1KY9A 2AH4X 3E0PB 3ZZDA 1N1LA 2QF5A 5T6FA 1GJBB 1C5RA 4R0IA 2B7DH 4X1SU 1QIXB 3ZZ6A 2CV3A 1OXGA 4CBNA 4YLQH 2HNTF 4E06H 3KQ5A 3T5FH 5C5NA 4OGYA 3ATKA 4YZUA 1O38A 3SN8A 1ZTJA 2RCEA 1C1UH 3W1EA 4BTUB 2ZEBA 3A7TA 5EU8A 2AMDA 2J95A 3MH6A 1GBLA 4D76A 1G32B 5CHAC 2FOAA 1ZGVA 1ZZZA 4P02A 2ZECA 1RXPA 1O2GH 1V2PT 1UHBA 1C1QA 1G3CA 2AEIH 2Z3EA 1D6WA 1FV9A 3PLKA 2QGRA 3GCHB 3PV5A 2JETB 3M3TA 1KLTA 1O2YA 3TK6A 1ZSKA 2YNBA 2VWOA 3D62A 5C2ZA 2BY6X 3GCNA 1TA6A 3KCGH 1SGCA 1K1PA 4INHA 1AZ8A 1H1BA 1ARBA 1S6LA 2EEKA 3NK8A 4WMFA 4B2AA 1C5VA 1MU8B 1P01A 5JBCS 3RXEA 5B6LA 2P94A 1SI5H 3BEIB 2BD5A 2Z9GA 3K6ZA 3U8OH 2CXVA 2EI7A 4ABAA 5HIZA 5GIBA 4UFFH 2BVXH 1HAVB 1SOZA 3RXDA 4ZCNA 1ELVA 1Z8IB 5K7RA 4JYVH 2XYAA 2PTNA 2WPLS 5FBEA 2BY9X 1C5OH 2BDIA 5JBTA 2D1JA 1TNIA 2P8OC 1O5FH 4HZHA 3UFAA 4K60A 1Y59T 1PQAA 1BMNH 1Y5UT 2LNCA 1IQEA 2VINA 8KME2 1HIAA 3FP8E 2SGFE 2A4RA 3SU1A 1Z1IA 5I46H 3UNRA 4HG6A 1AMHA 3TJOA 2HPPH 1PQ5A 1SG8B 1VITF 2D26C 1LO6A 2BQ6B 2HPQH 2KCYA 2ZCKP 1EAUA 1O3JA 1QB6A 4AORA 5FAHA 1XVMA 3UWJH 3U8TH 1O2PA 1UW7A 1P9UA 1SGYE 4XFQA 3VG8A 2O8UA 3MQKC 1LVBA 5FHTA 1W0ZU 1O2XA 4LK4A 4YT6H 1DWEH 1O3IA 2STBE 2RDEA 4ZKRU 2BXTH 1A5IA 2H9TH 1QCPA 1O2OA 3RLYH 1BTZA 4YOJA 2KR7A 2Q6FA 2Y7XA 3BTWE 1EP5A 1ANCA 3LGTA 1GCDA 1SGQE 1A3EH 1RRKA 4GCHG 4TT3D 1TOMH 2FOCA 3VEQB 5DP6A 3K6YA 1TX6A 4FXGH 2QYIA 1YPMH 4FUCA 3UUZA 1Q3XA 2ZGJA 5C0UA 3SU4A 2A4GA 1VCWA 1N6XA 3A83A 2GX4A 1L0ZA 1LHDH 1HAVA 5DKMA 4DY7B 4DGJA 4X2YA 2VVUA 1SQTA 3SNBA 4ZHMU 1P11E 2XTTB 5FPTA 3WY8A 4XBCA 5JB9S 2R3UA 1XKAC 1CGHA 4Y7BA 5DSFA 3F9GA 5A0AE 2PKSC 1BJVA 2Q1JA 4AN7A 1LKBA 3F1SB 4K1SA 1H8ED 3UIRA 4I8LA 1D9IA 1AE8H 1TQ7B 2DE8A 3EE7A 3NRLA 3A88A 4VGCC 1DLEA 4Q7YA 1V6DA 4A6LA 3N7DA 1QQUA 1NT1A 4ZXXH 1LPKB 1GL1A 2J38A 3DA9B 1XKBC 1NU7B 2ZDVH 1C1WH 1HAGE 4NA7A 1NROH 2J92A 1CT2E 3OTJE 1CT4E 2FODA 2VIVA 4Y8ZA 1GJ8B 3M5LA 3NKKA 1PPBH 3P17H 3UQOA 1KTSB 4K69A 1V2KT 1QL9A 2PP6A 1GJ5H 2P16A 1CT0E 1WYKA 2H6MA 1XUIA 1VJAU 1NTPA 1ZLRA 3DFJA 3STJA 3RC6A 1EZXC 2KZ4A 1EZUC 4OS1A 3BV9B 3F0OA 1UTJA 1DY9A 1ANEA 2BLVA 3RU4D 3LGUA 3GCHC 2AFQB 2JETC 2STAE 1SHYA 4NIXA 1OWKA 1GMHG 4FUEA 1Q2WA 5C20A 1HNEE 1T31A 4LOYH 2F4LA 3SJKA 1V2TT 1EAWA 2V35A 1F5KU 1ZMNA 2K1QA 1TNHA 1TQ0B 4AFUA 1O3DA 1ZTKA 3TIUA 1GBBA 3F6UH 3BTGE 4XSKU 2AS9A 2H5CA 1F0SA 1P06A 4BAOB 2A5IA 3JZ1B 4U30A 2TGPZ 2VIDA 3BSQA 3ATWA 3Q3KA 3WWFA 1O3GA 1C2HA 3O8DA 3FAOA 2XBYA 1YPKH 1AY6H 2BDGA 3T29A 5KEDA 2WV4A 3H5CB 1GMCG 1SQRA 2BDYA 4FU9A 2BX3A 3SUEA 2ZIQH 3RMMH 3A7VA 4ABBA 3SV7A 1K21H 1SR5C 3LC5A 1MKWK 1WU1A 4FETA 2WV5A 1EXFA 1H8HD 2TBSA 4IN2A 4ZH8A 2HWLB 2LELA 1TE0A 1GBCA 3FP7E 3SOSA 1QB9A 3PTNA 1UVPA 3RXPA 3VB3A 1D4PB 2A7JA 2A1DB 1GGDB 4M9FA 5F8TA 2WPHS 3P70B 3PLPA 4FUDA 2V3MA 3F9HA 2ZC9H 4CH8B 4ZKOU 3A8DA 1GBTA 3GISB 5EJ1A 2W3KA 5FPYA 3PWCA 3RXMA 2PGBB 3RXHA 2O8WA 2ZHEH 4TSFD 3TH3H 4D7FA 4X6NA 1QL8A 3RXCA 1EZSC 1G30B 1TNKA 1HAZB 2ZTXA 4X6MA 2B5TB 4TWWA 3QK1A 1LTOA 3U9AH 1T8MA 2DUCA 1AHTH 1F2SE 3LC3A 1LHGH 1UTNA 4CR5A 5DP3A 3RM0H 1C5PA 1SVPA 2H1UA 2GCHF 3PWBA 1BMLA 4RT0A 2G8TA 2JKHA 4M7GA 1QQ4A 3SNAA 1JMOH 3DUXH 2HNTC 1TBZH 2QXJA 1ORFA 2Y81A 3MOCA 2VVCA 1AVXA 5T3HA 3H09A 2VJ1A 3S7KB 1O34A 3FANA 4ISOA 4DIIH 4DOQA 1ZSJA 3HATH 3UAIC 1O2KA 4Y7AA 8ESTE 1O30A 4J1YA 5B6OA 1QJ7B 2GZ7A 3AAUA 1P02A 3UR9A 2ZO3H 5DP8A 2P3TB 3I78A 5E0GA 1GVKB 1O2NA 3PTBA 4Y0YE 1GI6A 1DDJA 1OYQA 3P92A 1MTVA 4JMYA 1WSSH 4MG3A 4YT7H 3KIDU 4X1NU 5LPEA 1LVYA 1TMUH 3VXEH 1GI5A 3FKSD 2M5TA 3A89A 3BIVH 1D3PB 1XMNB 3R0FA 2ZFPH 1FI8A 1OWDA 2TGDA 1C5ZB 1QGFA 9LPRA 3SZEA 3AW0A 1DITH 2NU4E 2PUQH 2AYWA 4NWKA 2AIQA 1DE7H 3MNSA 2VU8E 2HVYB 3A82A 1AFEH 1E1QD 2Y5GA 1GVLA 2WSSD 2J5UA 1C2EA 1LPGB 2ZGXH 4ACAA 3ZVCA 4IN1A 1MAXA 1UK3A 1Z8GA 3FZZA 3UNQA 4CBOA 1FDPA 1IQLA 2IJOB 1XXFA 2JIZD 3A86A 4B2CA 4JK6A 4B75A 2OQ5A 3F3BA 3UOPA 4FVBA 2ZHDA 1IQIA 1SLWB 1V2QT 1VITG 4INLA 4E05H 1XUFA 1KXBA 2QC2A 3H7OA 1H8DH 1LVOA 1MZAA 1SGEE 1HAXB 4FUBA 4TY6A 3AASA 1QA0A 4FU8A 1SMFE 3BIUH 3SJIA 3QN7A 4KP0A 3ESTA 2FM2A 3ZZ4A 1L4DA 1NN6A 2Y82A 1NRQH 4CRGA 1EJMA 4CR9A 1GMDF 1NY22 3SI3H 1AUTC 1CHGA 1GG6B 3NUMA 2ZGBH 4WH6A 1DANH 1SGNE 1JRTA 1ZRBA 4IS5A 2OC0A 2HGTH 2VH0A 2UUJB 1C5MD 1W0KD 2BLQA 1IQFA 3SU0A 1SGDE 4WMEA 4DCDA 1FIWA 3MU4A 2A5KA 5EXMA 1GHZA 3RP2A 2HRVA 3KYGA 4DURA 3UB0A 1YBWA 4KKDA 2M2AA 3LT3A 2GV6A 1C2JA 2EI6A 4NIYA 4K1TA 3WW7A 2OBQA 2W7SA 1Y5AT 1A0JA 2PR3A 3TH4H 1C5YB 1UCYE 1C2KA 4KTUA 3MNBA 3Q3YA 2GD4B 1TGSZ 3GY4A 2XC4A 4X8UH 4WF8A 4B76A 1QNJA 2SNWA 2ILNA 3GY5A 2HVXA 4BXWA 3MH5A 1T8LA 2UUFB 3VXFH 3O8CA 4BOHA 1X7AC 1DM4B 3MH7A 3A8BA 3EQ0H 1YPEH 1LHCH 3BTFE 4XE4A 1MBMA 1NFXA 2YNAA 5GDSH 2K8IA 4ZHAA 1GGDC 2ZDMA 1G2MA 1KIGH 1GPZA 1ZMLA 3F9EA 1MTUA 4NWLA 2BX4A 4R8TB 2QXIA 4YXWD 2A31A 1MD8A 1NESE 2ZNKH 5C1XA 1J15A 1BB0B 3PMBB 2Y5HA 9ESTA 3MYWA 4O3UA 1MCVA 1D3TB 1MQ5A 1W0JD 5C17A 4JZEH 5C1UA 2ZHQH 4JCNA 1D3QB 1L1GA 3F0PA 3G01A 1P2KA 4X2VA 5GNDA 2ZU3A 5EODA 1C5UA 1C9PA 4FUFA 2J97A 1ZPZA 1SL3A 2J94A 1TNJA 2BD3A 1GI8B 2Y80A 1O37A 4X8VH 3LH1A 1HYLA 3LDXH 3ITIA 3BTME 6ESTA 4WH8A 1AIXH 4GHQA 2JH0D 3ZZAA 4B73A 1IQGA 1KSNA 1EX3A 2WYJA 5GCHF 3E3TA 4PROA 1U6QA 3GDUA 1C1VH 1UJ1A 1SGFG 3KQEA 3O8BA 3TNTA 2HALA 2PLXA 2AHME 1KDQB 1V2OT 1SLVB 2P95A 1Z7KA 1EZQA 4JYTA 1A5GH 1GCTB 5F03A 5BPEA 1UVSH 2XCFA 3Q76A 3VB7A 5TCAA 5A2MH 3ZVBA 1P2MA 1C2GA 3PB1E 4Y76A 4RN6A 1HDTH 3T27A 1O3OA 3PLBA 1ZOMA 2F9BH 4DIHH 4I7YH 1GI0A 1P2QA 2R0KA 1NO9H 2BD9A 1LDTT 2WUBA 4D7GA 1XVOA 2G00A 1ZHMA 1B7XB 1AWHB 3ZZBA 2Y7ZA 1F0UA 3EA7A 6GCHF 4BTIB 1XUGA 3TJNA 2BD4A 1TRMA 1EKBB 5L6NH 3ZVAA 1BITA 4A92A 5CHBA 3N7OA 3SHCH 1YPHC 1F0RA 5HMAA 1WV7H 2QV1A 1ELFA 1KXCA 4MVNA 2GT8A 2W3IA 4WXIA 4F49A 4H4FA 3S7HB 2FI5E 2OLGA 1HJ8A 1O2QA 3CS7A 4B6EA 4NFFA 1EB2A 2I6SA 1VGCB 1O3CA 1SHHB 3CP7A 2KCPA 1GG6C 1L1NA 1L2EA 3M5NA 3MI4A 2IJD1 3PMHB 1S81A 3M5OA 2Z3DA 1WCZA 2Y6TA 3KQDA 1W14U 1SKYE 4ZKNU 2FTLE 2F3CE 1RTKA 3F2HA 1C2LA 2BOKA 1O2SA 3V13A 2B8OH 1AWFH 2OUAA 4GAWA 3L3TA 4X1QU 1LPZB 2ZU2A 3ZVDA 3M3SA 2GCHG 4Q2KA 1O3EA 1FN8A 4UFGH 5DK1A 5GWZA 1YPLH 1K22H 1PQ8A 1PFXC 1O35A 3VB6A 5JB8S 1J9CH 2FESH 3AW1A 1C5XB 2OC1A 2C8XB 1UVOA 1WXRA 3UOUA 3NXPA 3LIWA 1HAHH 3PV2A 3TLOA 3GICB 1ESTA 1WQVH 3RXBA 1LQEA 4K5ZA 1ID5H 3UNSA 1THSH 4FVDA 1A1RA 4K3JA 2V0BA 3MHWU 5JYIA 1G36A 4Y8XA 3GY3A 1HBTH 1J16A 1GBHA 3IWMA 3A7XA 1GI3A 5JBAS 1GWAA 1BBRH 1PYTD 7GCHF 1Z8RA 1YYY1 1NM6A 1S5SA 1W11U 3HGNA 1T8NA 2Z3CA 5C0TA 1EJNA 1LMWB 2KAIB 4I33A 1LHEH 5A8XA 5L2YH 2BDBA 1EP6A 3QDZB 1YC0A 1Z1JA 2A4QA 3SQEE 1P2OA 4Y10E 4B2BA 3LGVA 3T62A 3ZVFA 2ZHWH 1AKSB 1HFDA 2P3FH 4WWYA 1DWDH 1AZZA 3D65E 4THNH 1FY1A 1IQKA 1SSXA 1SB1H 1MTNB 5E0JA 1P3EA 4IGDA 4MPWA 4NIWA 1GI7B 1QRZA 1E35B 1TPOA 1XUJA 1ZJKA 3LOXA 2OQUA 1H4WA 3OX7U 3E90B 4CH2B 1UTKA 4WJG2 1HPGA 1XM1A 2QF3A 1TBQH 1Y3XA 3GDSA 3EAJA 2UUYA 2GTBA 1EAIA 2AERH 1YCPK 1TAWA 1Y5BT 1GMDG 1AO5A 1ZPBA 3PRDA 4WMDA 3AAVA 8GCHF 4K1EA 2XRCA 5ETXA 1TNGA 4QT8C 3RMNH 2FX4A 4MNXA 1ELGA 5DP7A 1A5HA 1AFQB 1ZRKA 1O3HA 1AD8H 7LPRA 1V2UT 1KYNA 1GJ7B 1OWIA 2CF8H 5A09A 1E36B 1GCTC 3SGAE 1XX9A 2VVVA 2ZI2H 2PW8H 1GBMA 4ABEA 1CU1A 2NWNA 1TGTA 1LHFH 3RXGA 5J4SA 1GHBG 3MU8A 1K1OA 2WHXA 4E7NA 1CA0B 4KTSA 1GHWH 5KECA 1WUNH 3PO1B 2R2MB 3RC5A 4UEHH 1PYTC 4DVAU 1UK4A 3QO6A 4H6TA 3SGQE 3SNEA 4UONA 1C2DA 3BTTE 2GVFA 4AFSA 5C1YA 3OEED 1O2WA 5IDKA 1Y3YA 3F2FA 3WWBA 1HLTH 2UWPA 3QWCH 2EQNA 1YPGH 4ASHA 4TYDA 3B8JA 2ZCHP 5FL7D 1V2MT 2A32A 1TABE 3TGKE 2FYRA 1S0QA 1KTTB 1KXAA 2XNIA 4D9QA 3SI4H 1UTMA 3KNXA 4IC6A 3ZZ8A 1MD7A 2ZDLA 2Q6GA 2RG3A 2SGAA 1K1MA 1OP0A 4INKA 1V2ST 2FOBA 3E0NB 1C2FA 3UY9A 3UQVA 1YLNA 3A81A 1VGCC 1ANDA 2BD2A 1O5AB 4X2XA 1TPSA 4DJZB 3MO6A 1XUHA 1PJPA 1TX8A 4X8TH 1ABJH 1O2UA 3U1JB 1ZSLA 1PPZA 3ODFA 5FXLA 3PROA 5FX6A 2PSYA 1DSUA 2VIPA 3GS9A 4ESTE 1ABIH 4I32A 2ASUB 1RFNA 3B9FH 2A7HA 1PPCE 2W7UA 3MU1A 4ZKSU 5TJXA 5EW1H 3H7TA 1QRXA 5HXFA 1G3DA 1CBWB 3SW2B 3SBKA 3DFLA 1CVWH 3V3MA 5C94A 4Q80A 2VWMA 1ESBA 2YOLA 2VIOA 2C3SA 3RXVA 2EI8A 2FI3E 5DN6D 1TPPA 1BDAA 1MH0A 3RXUA 3DHKH 1TWXB 1J8AA 5GCHG 2CGAA 1P04A 4NGAH 1KLIH 3ATLA 4BANB 1YF4A 3EDXB 3MO9A 2J98B 2VIQA 1N8OB 1SFQB 2ALPA 2GZ9A 2A2XH 2F83A 1C2MA 3A7WA 4DT4A 1AU8A 2ZF0H 4FUHA 3W94A 2PGQB 2O8LA 4ZMAH 5K0HA 3RC4A 2WPKS 1AN1E 1FJSA 5ESBA 5E2OA 2OBOA 1ELDE 2JH6D 2TRMA 1BZXE 1SLUB 2TGAA 4AZ2B 4ABFA 1Z8JB 1O3NA 2QE7D 6GCHG 3NPSA 3IITA 4Z6AH 1AB9B 1BRCE 1O3LA 2FO9A 5LH8A 1MTNC 5T6DA 3R3GB 3MFJA 2H9HA 1C5TA 1UVUH 2BD8A 2WZQA 3TJVA 1TGCA 1Y3VA 2H2ZA 1HGTH 1EAXA 1OX1A 1Y8TA 3A84A 1ETRH 1A3BH 4CREA 1UTOA 2SFAA 1NFYA 1UCYK 3RXFA 3Q00A 3E16B 3RXLA 3TVJB 2F9UA 1FY5A 2FOEA 1K0HA 1FY8E 5DGJA 3SNDA 4D8NA 1EFRD 4KGAA 2G52A 3TJUA 1V2NT 1AFQC 2ZP0H 2ODYB 1ZPCA 3PMJA 1DY8A 1YCPM 1O3AA 3LH3A 2ZU1A 3QGJA 1K1JA 4AGKA 1BQYA 5EQQA 2FWWA 3OEHD 1SGRE 2YMSB 4ASUD 1FNIA 3BTDE 1TA2A 2J98A 2GKVE 5DJ7A 2RA3A 1ZGIA 3TGJE 1C1OA 1ZTLA 2FDAA 3QX5H 1CA0C 2KX4A 3PMAB 2G5NA 1FAXA 4ZHLU 1ARCA 3PO1C 2FXRA 3UREA 2C8ZB 1DUAA 1TIOA 1CE5A 5LPRA 1MKXK 3FVFB 3UTUH 4A7IB 3B23B 1PPEE 2UWOA 1P03A 3GY7A 1W3CA 1ELEE 1ETTH 2XBXA 2A7CA 1EPTB 1P2JA 5AHGH 4O9VA 2FS8A 3JZ2B 1O5DH 2BY8X 3RUOA 4RT1A 1QFKH 2F9NA 5T6GA 5HKKD 1O5GH 2BTCE 4WY3A 3U1IB 3W95A 3PYHA 4ZAEA 2QF4A 1WTGH 5F8XA 1OKXA 1FUJA 1OHHD 3ATIA 1B5GH 3RXIA 1FQ3A 1Z6EA 3RXRA 1LQDB 2GT7A 3EGKH 3OTPA 3DT0H 7GCHG 1ELCA 4JYUH 3VPKA 4AG2A 3SV8A 3GCOA 4DW2U 3HK3B 1V2JT 1QR3E 1GI9B 5EW2H 2OC7A 5TCCA 1G3EA 2VH6A 3UWIA 2ESTE 1OYTH 1THPB 3RXQA 1TBRH 3T26A 4FUJA 4ABJA 1PPHE 2GJGA 3P6ZB 2ZPSA 2HNTE 3ZZ3A 1CBWC 1DXPA 2A2QH 1DT2A 2NU0E 1CGIE 2ZQ2A 4AGJA 2BHGA 1DFPA 2EC9H 1WBGB 3HKJB 2VIWA 1RD3B 2C8YB 1O2IA 2ZHFH 1SGFA 4YOGA 3A7ZA 3U8RH 1F92A 2NU2E 1C5NH 1O0DH 1S85A 1BUIA 2GGVB 1VCPA 1H8IH 1SQOA 1V3XA 2ANMH 1UMAH 8GCHG 1QURH 3ZYDA 4ABHA 1ZHRA 3C27B 4MPUA 2FYQA 3K65B 1EOJA 4JZIA 1H9IE 3VFEA 4AFZA 4B71A 1YP9A 2XBWA 2BVRH 1DWCH 1JIRA 1NC6A 4I86A 5EXLA 1FLEE 1DOJA 1LKAA 4OS2A 4YLUA 1E37B 1O2RA 3M7QA 3M7TA 4AX9H 5G4BA 2Z94A 3E1XB 2F9OA 4Q7XA 4P00A 4LZ4B 1OOKB 4BAKB 4CRAA 3A87A 3QZQA 5F6MA 1TYNA 5HGGA 2ZTYA 1AVWA 1P12E 1FY3A 3BEUA 1HAIH 4NIVA 1V2VT 1WDIA 4YTAA 1BMAA 1NRPH 3SNCA 3TITA 1WTHD 1F5RA 4RI0A 1PPGE 1GJDB 1BHXF 2CF9H 1GL0E 3M61U 1AB9C 1CGJE 2G5VA 4KELA 1V2RT 2XBVA 4Y71A 2B0FA 2CHAB 5C67A 1O3BA 3URDA 1KXFA 1QRWA 3OYPA 1XUKA 1UTPA 4AYYB 4BNRA 3BN9A 1EQ9A 5EPYA 1A0LA 2PKAB 1ZJDA 1OP2A 3T28A 3O8RA 2QY0B 5EXNA 3VB5A 2JJ2D 1QBOA 4ZUHA 2BYAX 1WQSA 1ACBE 4NFEA 2VGCB 1BIOA 2F43B 4Y0ZE 5EPNA 3DSGA 3GDVA 2BLWA 3GCTF 1K28D 3ZV8A 5C5OA 4X0WU 2P3UB 2ANKH 1P10A 2F9VA 1UHBB 1VKYA 1HV7A 5GPIB 4OS6A 3OY6U 3ZV9A 2XW9A 2YMSC 2DE9A 3SGBE 4OS5A 4MPVA 5FPSA 4MLFB 1MMJN 1RTLA 2ZDNA 5A0CA 2ZPQA 1S0RA 1SPJA 2R3YA 1FN6A 2W6ID 4TY7A 1MABB 1G9IE 4Q7ZA 5AFYH 2WINI 1T32A 1FY4A 2VB0A 1O33A 3F68H 3OE7D 4IMQA 1GBIA 2WYGA 1DICA 2W6JD 4K8BA 2PKSB 2XNDD 2KCAA 3FFGA 5A0BA 5H4IB 3N7EA 1SGIB 3S0NA 5CMXH 1YPJH 2ULLA 2BB4A 3KL6A 3SO3A 2A45B 4NSYA 1IHSH 4VGCB 1DLKB 2D8WA 4A1TA 1WAYB 2VWNA 4DG4A 2NU3E 1KLJH 1BTUA 1W7GH 2G4TA 1O32A 2ZQ1A 2THFB 1MQ6A 1ELTA 3PM3A 1FZZA 1NZQH 1HIAB 1IHTH 1W2KH 2BZ6H 2H9EH 3SORA 2EY4C 5IYTA 2BM2A 2ODPA 2PKAA 2WPMS 3SV6A 1D3DB 4NG9H 2BY5X 4O3TA 5EJZA 1V2WT 4GVUA 1ANBA 1J14A 2WPJS 2FPZA 1O36A 2G81E 4BAMB 1E1RD 3FZDA 1PPFE 1GHYH 2XC0A 3M37A 2KFWA 2LP6A 2PV9B 1RS0A 3T25A 1GJAB 4ABIA 4TPYA 3LJOA 3LJJA 1AI8H 1BHXB 1KDQA 3OU0A 5F8ZA 1TONA 4IBLH 4E7RG 6LPRA 1O5EH 5L30H 3ZYEA 1A2CH 1TGNA 1GHVH 2ZPRA 3MTYA 5GJ4B 1AQ7A 1F0TA 3EYDA 1YLDA 1C1SA 1FX0B 1K9OE 4AB8A 2ZFFH 2B9LA 2GV7A 1VCQA 2FX6A 3P8OA 1HUTH 1ZMJA 1EASA 1INCA 2UUKB 2FTMA 3MNXA 5EQRA 3EA9A 1OPHB 2GP9B 4IC5A 2H5DA 4I8GA 1NBMD 1CA8B 1FPHH 1DVAH 4XBDA 3P8GA 5EQSA 1DPOA 4HTCH 3RXKA 2J9NA 1GBKA 1GI2A 5JBBS 4CHAB 1T7CA 1ZR0A 2R0LA 1GBJA 2P59A 4X1RU 2BQ7B 3RMLH 1BA8B 2TGTA 1GJCB 5F53A 3PRBA 1GDNA 1NFWA 1GHAF 5EOKA 2IN2A 2QF0A 2BOHB 3SU2A 1PQ7A 2L74A 3NWUA 3STIA 3A7YA 1V2LT 7ESTE 4BXSA 1C5WB 1GBDA 3BTKE 1P8VC 1KMHB 5FX5A 3BG4B 3RXJA 4FOUC 1GDUA 1UK2A 1FONA 4UFEH 4ISNA 1JBUH 4U01A 1MKWH 1VZQH 1UTLM 3RU4T 3NCLA 1UVTH 4Z1MD 3MMGA 1C5SA 1FIZA 4LXBH 1CHOF 2XC5A 3HGPA 1YPHE 2CHAC 4IMZA 2GZ8A 2V3HH 3ATMA 4NSVA 4NA8A 3SV9A 4ABDA 2Q6DA 4MPXA 4RKJB 5E8EH 4LZ1H 4JK5A 3TNSA 1O2HA 2L6OA 3MO3A 1EJAA 3ZIAD 1GJ9B 5ABWA 4ISLA 2ZDKA 3M36A 2FI4E 2VGCC 3KQBA 3CS0A 1W0YH 2OINA 3GY2A 1Q31A 4O03A 3ZZCA 3BG8A 2ALVA 3QGNB 2W5EA 1A7SA 1S83A 2CMYA 1EOLA 2PWXA 4CRFA 3P8NA 1NPMA 1FAKH 1C1TA 2AMPA 1DXWA 5SGAE 2ZWLH 1OWJA 2W26A 3LONA 2XWAA 3PV4A 4ZROA 1SC8U 1COWD 1MZDA 1P9SA 1UCYH 3DCLA 3MU0A 3QUMP 4OGXA 5LGOA 2Z9JA 4B1TA 1P05A 1O2TA 3V12A 1O5CB 2GMTB 1NRNH 4NCYA 1BMMH 4WXVA 1JWTA 1VR1H 4A5TS 1C5QA 1N6YA 2FZZA 1WOFA 3UPEA 1A46H 3U98H 1O2MA 1MU6B 2OCVB 4FUGA 1BRUP 4X6PA 2ZA5A 4X2WA 4X8SH 3L33A 2KAIA 5HM2A 2SNVA 2G4UA 2CK3D 1MUEB 1EB1H 3C1KA 4RSPA 3GOVB 1Z71A 5GXPA 3HKIB 4FUIA 2OP9A 1TALA 4D9RA 4AB9A 1HCGA 3A8AA 1AKSA 3ZZ5A 1HXFH 4BTTB 5EG4A 1J17T 1W10U 4F4OC 5L2ZH 3AK5A 1MKXH 3F2GA 1K1IA 4GSOA 2F9PA 5HIYA 1C1NA 4UD9H 1MCTA 1S6FA 1E34B 3RXSA 1NRSH 5E0HA 3RM2H 4B6FA 5LPFA 4XOJA 2XWBI 4Z0KA 4AFQA 1GI4A 2ZCLP 3FP6E 1VITH 2ZGHA 5DG6A 2C8WB 1QY6A 1QBVH 4H6SB 4ISHH 3TU7H 3S9CA 3D23A 4HFPB 4YO9A 4OM9A 5DPAA 5HM9A 4B74A 1T4VH 3A85A 1HRTH 4BAQB 1MBQA 3OY5U 7KMEH 1P09A 3KF2A
chains in the Genus database with same CATH topology
2WPIS 4SGAE 5JPMH 2CJIA 1P0SH 3U69H 2A0QB 2SGQE 4MDSA 4AG1A 4JZFH 3LGIA 1OP8A 4UFDH 3QTOH 1CSOE 3MNCA 2C4FH 4UDWH 5EGMA 5AFZH 2BDHA 3KHVA 1HAYB 3GCTG 1IQNA 1C1MA 1G37A 4YM9A 1SQAA 4WVPE 5E2PA 1W8BH 3SV2H 1HAOH 4CHAC 1XXDA 1OWEA 1O31A 1TNLA 1IQMA 3S69A 2WUCA 3D49H 1O2ZA 3E8LA 3ODDA 1O39A 4GHTA 2QN5T 2FOHA 1A4WH 1TMBH 3M7UA 1JIMA 1FXYA 3LGWA 3SJ8A 1F7ZA 1A0HB 1O3MA 2OD3B 1BBRK 1QHRB 2GDDA 2BDCA 3GYMA 3BG4C 3BTEE 1P57B 1ZYOA 2ODQA 2ZTZA 2D2DA 5C3NA 1GI1A 2F91A 1AE5A 1THRH 2ZDAH 2PFEA 5FBIA 3P95A 1W13U 1B0EA 2OC8A 2GCTB 4IW4E 1Z6JH 1MTSA 3SUFA 4MQAA 2ZG0H 3L6PA 3M3VA 1BT7A 1QA7A 4K2YA 3QLPH 3LKWA 3SJ9A 3BEFB 2QAAA 1GBAA 3RDZA 5HYOA 1LCYA 1YGCH 3VGCB 1IQHA 1ZHPA 3HK6B 3BF6H 3E91A 3TK5A 5A8YA 1K1LA 1IOEA 3SJOA 1ETSH 4FU7A 1C9TA 5AVDA 1D6RA 1IAUA 1TMTH 5DP4A 2V6NA 1NS3A 1O3KA 1QJ6B 1SOTA 1BRBE 1G2LA 1OS8A 2BDAA 3GY8A 2ANWA 1YKTA 1O2LA 3K9XB 4Y11E 3M35A 1TRNA 1SBWA 3S9AA 2A4OA 1UTQA 1YM0A 2G55A 2RA0A 4UE7H 2ZFSA 1DUEA 2OXSA 3KGPA 2GMTC 3MWIU 3AVZA 1GJ6A 2ZZUH 3QTVH 5AF9H 1B0FA 3RXAA 4TWYA 5DO4H 2AMQA 4Y8YA 3DD2H 4I8HA 3SUGA 1QTFA 2BD7A 1NU9A 1QBNA 2FP7B 1JRSA 1GVZA 1TX7A 1C1PA 2XXLA 6CHAB 8LPRA 1SFIA 2PUXB 3K2UA 1HJAB 1TLDA 1TB6H 3MH4A 3VB4A 4U2WA 4NZQA 1C4V2 2Z7FE 2FOFA 3F9FA 2V3OH 1BOQA 1BJUA 2SGPE 3SU5A 1O2JA 3SU3A 2J34A 3TPIZ 4A1VA 2O9QA 1MAYA 4NZLA 1SGTA 1FPCH 3KQCA 3P8FA 2QXGA 1BTPA 2FS9A 4GPGA 1UO6A 1BTYA 1T8OA 2QCYA 4ISIH 3MU5A 1RIWB 1DWBH 4CRDA 1GHAG 5ESTE 1HXEH 2QXHA 3UR6A 1O3PB 3URCA 2BMGB 1JOUB 4OS4A 1H9LB 2GDEH 4KTCA 3I77A 2VWLA 1BBRE 2Z9LA 4GCHF 2AIPA 1CO7E 1A61H 2UWLA 2ZFQH 1BTHH 1EUFA 3T2NA 1O2VA 2Z6BD 2ANYA 2BZAA 2XCNA 4BAHB 2VNTA 4TPIZ 3V7TA 3ZZ7A 1TRYA 1QJ1B 4H42U 1BCUH 2PTCE 2IOTA 3RU4E 1CHOG 4OS7A 3ELAH 1NFUA 5CHAB 4YOIA 1NRRH 3TH2H 1K1NA 3BTHE 1BRAA 1OWHA 3EA8A 5I25A 2JH5D 2FOMB 2ZKSA 2OTVA 1P3CA 5DP9A 1ELAA 3A80A 5DP5A 3OSYA 1S6HA 1C4Y2 1H9HE 1FMGA 3RXOA 3M5MA 3GY6A 4JZDH 3KN2A 2ZFTA 4GUXA 1G3BA 4J2YB 4ABGA 3V0XA 4AOQA 3BTQE 1EATA 1Y3WA 1GHBF 2ZFRH 1TOCB 2AGIX 1M9UA 3TGIE 2SGEE 1KXDA 3E6PH 1N8OC 2RDLA 5FCRA 1TPAE 1W7XH 1EPTA 3Q3XA 3ZVGA 3I29A 1HJ9A 1HB0B 4MNWA 2R9PA 2QIQA 2AGGX 4GLYA 2FLBH 2P8OB 1Y3UA 3SUDA 4ZXYH 1TFXA 3SHAH 3QZRA 2SGDE 1DS2E 2ZGCA 1S82A 4DT7B 5PTPA 1P2IA 2PHBA 5BRRE 5JDUB 2GCTC 4MTBA 2O8TA 3CENA 1O3FA 1AVGH 2NU1E 2AGEX 1RJXB 3ENSB 1LVMA 2BLOA 1RGQA 1OSSA 3SZNA 4RKOB 1T4UH 1TGBA 1ESAA 1E0FD 3VGCC 3LU9B 2C90B 2BVSH 2FMJA 3RLWH 5CE1A 2BY7X 4U32A 4XDEA 4Y6DA 1E38B 1W12U 1IQJA 1GMHF 2BQWB 3KEEA 4XBBA 4AYVB 4X1PU 1L4ZA 4Y79A 2P93A 3EE0B 2BXUH 2FEQH 2FIRH 2I6QA 2J2UA 2QA9E 3LGYA 2PSXA 1JXPA 4O97A 1BTWA 2HLCA 2Z9IA 5FCKA 5A8ZA 4K8YA 1GJ4H 1KXEA 1SGPE 2FOGA 1C2IA 4HGCA 3HPTB 1C5LH 1F5LA 4CRCA 4JZ1A 1AGJA 1CQQA 2Z9KA 3S9BA 4X6OA 2ZU4A 4HI3A 4I8JA 4NA9H 3RXTA 1GDQA 2EA3A 1QB1A 3ZVEA 2C93B 1DX5M 2HOBA 1VJ9U 2G51A 1S84A 1YCPH 1SLXB 2TPIZ 1GMCF 1C1RA 2IPHA 2FLRH 4I8KA 2TIOA 1K2I1 1O5BB 4I31A 3SU6A 1MTWA 1L1JA 2CN0H 3SQHE 6CHAC 4A1XA 1P2NA 1GHXH 3ZZ9A 1QL7A 1HJAC 1RTFB 4SGBE 1C4U2 1ELBA 3TK9A 2J4IA 2O8MA 4CRBA 3Q77A 2R2WU 1EPTC 4MNYA 1GBFA 4MNVA 2ZU5A 1BTXA 1AUJA 1DSTA 4YESB 5J4QA 1HAPH 3LPRA 1RIWC 2Y5FA 1YLCA 3A8CA 2LPRA 2A5AA 3GYLB 3IG6B 3NZIA 1GBEA 3RMOH 1KY9A 2AH4X 3E0PB 3ZZDA 1N1LA 5T6FA 1GJBB 1C5RA 4R0IA 2B7DH 4X1SU 1QIXB 3ZZ6A 2CV3A 1OXGA 4CBNA 4YLQH 2HNTF 4E06H 3T5FH 5C5NA 4OGYA 3ATKA 4YZUA 1O38A 3SN8A 1ZTJA 2RCEA 1C1UH 4BTUB 2ZEBA 3A7TA 5EU8A 2AMDA 2J95A 3MH6A 1GBLA 4D76A 1G32B 5CHAC 2FOAA 1ZGVA 1ZZZA 2ZECA 1RXPA 1O2GH 1V2PT 1UHBA 1C1QA 1G3CA 2AEIH 2Z3EA 1D6WA 1FV9A 3PLKA 2QGRA 3GCHB 2JETB 3M3TA 1KLTA 1O2YA 3TK6A 1ZSKA 2YNBA 2VWOA 3D62A 5C2ZA 2BY6X 3GCNA 1TA6A 3KCGH 1SGCA 1K1PA 4INHA 1AZ8A 1H1BA 1ARBA 4B2AA 2EEKA 3NK8A 4WMFA 1C5VA 1MU8B 1P01A 5JBCS 3RXEA 2P94A 1SI5H 3BEIB 2BD5A 2Z9GA 3K6ZA 3U8OH 2CXVA 2EI7A 4ABAA 5GIBA 4UFFH 2BVXH 1HAVB 1SOZA 3RXDA 1ELVA 1Z8IB 5K7RA 4JYVH 2XYAA 2PTNA 2WPLS 5FBEA 2BY9X 1C5OH 2BDIA 5JBTA 2D1JA 1TNIA 2P8OC 1O5FH 4HZHA 3UFAA 4K60A 1Y59T 1PQAA 1BMNH 1Y5UT 2LNCA 1IQEA 2VINA 8KME2 1HIAA 3FP8E 2SGFE 2A4RA 3SU1A 1Z1IA 5I46H 3UNRA 1AMHA 3TJOA 2HPPH 1PQ5A 1SG8B 1VITF 2D26C 1LO6A 2BQ6B 2HPQH 2ZCKP 1EAUA 1O3JA 1QB6A 4AORA 5FAHA 1XVMA 3UWJH 3U8TH 1O2PA 1P9UA 1SGYE 4XFQA 2O8UA 1LVBA 5FHTA 1W0ZU 1O2XA 4LK4A 4YT6H 1DWEH 1O3IA 2STBE 4ZKRU 2BXTH 1A5IA 2H9TH 1QCPA 1O2OA 3RLYH 1BTZA 4YOJA 2Q6FA 2Y7XA 3BTWE 1EP5A 1ANCA 3LGTA 1GCDA 1SGQE 1A3EH 1RRKA 4GCHG 1TOMH 2FOCA 3VEQB 5DP6A 3K6YA 1TX6A 4FXGH 2QYIA 1YPMH 4FUCA 3UUZA 1Q3XA 2ZGJA 3SU4A 2A4GA 1VCWA 1N6XA 3A83A 2GX4A 1L0ZA 1LHDH 1HAVA 5DKMA 4DY7B 4DGJA 4X2YA 2VVUA 1SQTA 3SNBA 4ZHMU 1P11E 2XTTB 5FPTA 3WY8A 4XBCA 5JB9S 2R3UA 1XKAC 1CGHA 4Y7BA 3F9GA 5A0AE 2PKSC 1BJVA 2Q1JA 4AN7A 1LKBA 3F1SB 4K1SA 3UIRA 4I8LA 1D9IA 1AE8H 1TQ7B 2DE8A 3A88A 4VGCC 1DLEA 4Q7YA 1V6DA 4A6LA 1QQUA 1NT1A 4ZXXH 1LPKB 1GL1A 2J38A 3DA9B 1XKBC 1NU7B 2ZDVH 1C1WH 1HAGE 4NA7A 1NROH 2J92A 1CT2E 3OTJE 1CT4E 2FODA 2VIVA 4Y8ZA 1GJ8B 3M5LA 3NKKA 1PPBH 3P17H 3UQOA 1KTSB 4K69A 1V2KT 1QL9A 1GJ5H 2P16A 1CT0E 1WYKA 2H6MA 1XUIA 1VJAU 1NTPA 1ZLRA 3DFJA 3STJA 3RC6A 1EZXC 1EZUC 4OS1A 3BV9B 1UTJA 1DY9A 1ANEA 2BLVA 3RU4D 3LGUA 3GCHC 2AFQB 2JETC 2STAE 1SHYA 4NIXA 1OWKA 1GMHG 4FUEA 1Q2WA 5C20A 1HNEE 1T31A 4LOYH 3SJKA 1V2TT 1EAWA 2V35A 1F5KU 1ZMNA 2K1QA 1TNHA 1TQ0B 4AFUA 1O3DA 1ZTKA 3TIUA 1GBBA 3F6UH 3BTGE 4XSKU 2AS9A 2H5CA 1F0SA 1P06A 4BAOB 2A5IA 3JZ1B 4U30A 2TGPZ 2VIDA 3BSQA 3ATWA 3Q3KA 1O3GA 1C2HA 3O8DA 3FAOA 2XBYA 1YPKH 1AY6H 2BDGA 3T29A 2WV4A 3H5CB 1GMCG 2BDYA 4FU9A 2BX3A 3SUEA 2ZIQH 3RMMH 3A7VA 4ABBA 3SV7A 1K21H 1SR5C 3LC5A 1MKWK 1WU1A 2WV5A 1EXFA 2TBSA 4IN2A 4ZH8A 2HWLB 1TE0A 1GBCA 3FP7E 3SOSA 1QB9A 3PTNA 1UVPA 3RXPA 3VB3A 1D4PB 2A7JA 2A1DB 1GGDB 5F8TA 2WPHS 3P70B 3PLPA 4FUDA 3F9HA 2ZC9H 4CH8B 4ZKOU 3A8DA 1GBTA 3GISB 2W3KA 5FPYA 3PWCA 3RXMA 2PGBB 3RXHA 2O8WA 2ZHEH 3TH3H 4D7FA 4X6NA 1QL8A 3RXCA 1EZSC 1G30B 1TNKA 1HAZB 2ZTXA 4X6MA 2B5TB 4TWWA 3QK1A 1LTOA 3U9AH 1T8MA 2DUCA 1AHTH 1F2SE 3LC3A 1LHGH 1UTNA 4CR5A 5DP3A 3RM0H 1C5PA 1SVPA 2H1UA 2GCHF 3PWBA 1BMLA 2G8TA 2JKHA 4M7GA 1QQ4A 3SNAA 1JMOH 3DUXH 2HNTC 1TBZH 2QXJA 1ORFA 2Y81A 3MOCA 2VVCA 1AVXA 5T3HA 2VJ1A 3S7KB 1O34A 3FANA 4ISOA 4DIIH 4DOQA 1ZSJA 3HATH 1O2KA 4Y7AA 8ESTE 1O30A 4J1YA 5B6OA 1QJ7B 2GZ7A 3AAUA 1P02A 3UR9A 2ZO3H 5DP8A 2P3TB 3I78A 5E0GA 1GVKB 1O2NA 3PTBA 4Y0YE 1GI6A 1DDJA 1OYQA 3P92A 1MTVA 4JMYA 1WSSH 4MG3A 4YT7H 3KIDU 4X1NU 5LPEA 1LVYA 1TMUH 3VXEH 1GI5A 2M5TA 3A89A 3BIVH 1D3PB 1XMNB 3R0FA 2ZFPH 1FI8A 1OWDA 2TGDA 1C5ZB 1QGFA 9LPRA 3AW0A 1DITH 2NU4E 2PUQH 2AYWA 4NWKA 2AIQA 1DE7H 3MNSA 2VU8E 3A82A 1AFEH 2Y5GA 1GVLA 2ZGXH 1C2EA 1LPGB 3ZVCA 4IN1A 1MAXA 1UK3A 1Z8GA 3FZZA 3UNQA 4CBOA 1FDPA 1IQLA 2IJOB 1XXFA 3A86A 4B2CA 4JK6A 4B75A 2OQ5A 3UOPA 4FVBA 2ZHDA 1IQIA 1SLWB 1V2QT 1VITG 4INLA 4E05H 1XUFA 1KXBA 2QC2A 3H7OA 1H8DH 1LVOA 1MZAA 1SGEE 1HAXB 4FUBA 4TY6A 3AASA 1QA0A 4FU8A 1SMFE 3BIUH 3SJIA 3QN7A 4KP0A 3ESTA 2FM2A 3ZZ4A 1L4DA 1NN6A 2Y82A 1NRQH 4CRGA 1EJMA 4CR9A 1GMDF 1NY22 3SI3H 1AUTC 1CHGA 1GG6B 3NUMA 2ZGBH 4WH6A 1DANH 1SGNE 1JRTA 1ZRBA 4IS5A 2OC0A 2HGTH 2VH0A 2UUJB 1C5MD 2BLQA 1IQFA 3SU0A 1SGDE 4WMEA 4DCDA 1FIWA 3MU4A 2A5KA 5EXMA 1GHZA 3RP2A 2HRVA 4DURA 1YBWA 4KKDA 3LT3A 2GV6A 1C2JA 2EI6A 4NIYA 4K1TA 2OBQA 2W7SA 1Y5AT 1A0JA 2PR3A 3TH4H 1C5YB 1UCYE 1C2KA 4KTUA 3MNBA 3Q3YA 2GD4B 1TGSZ 3GY4A 2XC4A 4X8UH 4WF8A 4B76A 1QNJA 2SNWA 2ILNA 3GY5A 2HVXA 4BXWA 3MH5A 1T8LA 2UUFB 3VXFH 3O8CA 4BOHA 1X7AC 1DM4B 3MH7A 3A8BA 3EQ0H 1YPEH 1LHCH 3BTFE 4XE4A 1MBMA 1NFXA 2YNAA 5GDSH 4ZHAA 1GGDC 2ZDMA 1G2MA 1KIGH 1GPZA 1ZMLA 3F9EA 1MTUA 4NWLA 2BX4A 4R8TB 2QXIA 2A31A 1MD8A 1NESE 2ZNKH 5C1XA 1J15A 1BB0B 3PMBB 2Y5HA 9ESTA 3MYWA 4O3UA 1MCVA 1D3TB 1MQ5A 4JZEH 5C1UA 2ZHQH 4JCNA 1D3QB 1L1GA 3G01A 1P2KA 4X2VA 2ZU3A 5EODA 1C5UA 1C9PA 4FUFA 1ZPZA 1SL3A 2J94A 1TNJA 2BD3A 1GI8B 2Y80A 1O37A 4X8VH 3LH1A 1HYLA 3LDXH 3ITIA 3BTME 6ESTA 4WH8A 1AIXH 4GHQA 2JH0D 3ZZAA 4B73A 1IQGA 1KSNA 1EX3A 2WYJA