4OS5A

Crystal structure of urokinase-type plasminogen activator (upa) complexed with bicyclic peptide uk603 (bicyclic 2)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Dithiol amino acids can structurally shape and enhance the ligand-binding properties of polypeptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os5A01
1G3DA 1WQVH 3MFJA 1ELCA 3LJOA 1VGCC 4HZHA 1LPZB 2UWLA 4IN2A 4ZMAH 4ZKOU 1T7CA 3ATKA 1SGRE 1SOTA 3GY8A 1TFXA 2CHAC 2ZFFH 3PMBB 5FBEA 2PKAB 2ZQ1A 2OC0A 1QFKH 4R0IA 1T8NA 3HGPA 3M3VA 4X0WU 8GCHG 3BG4C 4ZKSU 3SQEE 2EC9H 4M7GA 1GMCG 1C9PA 3RDZA 2BLWA 1H4WA 2BY9X 1WV7H 4X6OA 3EDXB 3GDVA 2GVFA 1E35B 1HAPH 1OP0A 2BLOA 2QYIA 2FYRA 1AKSB 3M7TA 5CHAB 4MVNA 2Q6FA 2ZCLP 3M5OA 2PSYA 2H6MA 2BMGB 3SU3A 2NU3E 3P8NA 3VGCC 1GBIA 1HUTH 1UTOA 1XUFA 1O3NA 1GG6C 4FUHA 1GVZA 2CF8H 3M5NA 1ANEA 1EPTA 3A7XA 1AD8H 4BNRA 1CE5A 3L3TA 4BOHA 1TBQH 5EGMA 3CENA 2BDCA 4OS2A 4F49A 2WPMS 3TK5A 2A2XH 3TPIZ 4AYYB 5T6GA 1EJNA 3BTFE 3W94A 1Y59T 4ISIH 1QBOA 4CBOA 4UE7H 1BDAA 1GHZA 1C5TA 1J14A 3RUOA 1BJVA 1A1RA 1G3EA 3RXEA 1C5SA 1EP5A 1C2IA 1MBMA 2PV9B 1SGFA 2EA3A 3KHVA 4J1YA 2A5KA 1C2MA 1MU8B 1TNLA 1FDPA 1MMJN 2ZGXH 4GHQA 2XC0A 2GV7A 1JRSA 2C90B 3TK9A 1GBDA 1ZRKA 3M3TA 3A7VA 1ZTLA 2H2ZA 1HBTH 2R0KA 4J2YB 5FPTA 2IOTA 2P94A 3GY4A 1GJDB 1GHBF 1OP2A 2BD3A 1P3EA 1Y3XA 2AIQA 1O0DH 1L0ZA 4YO9A 3MU1A 4WMEA 1VITG 4AOQA 3R3GB 4IS5A 2ZGHA 1O2PA 1Z71A 1GMDF 3GY5A 1EUFA 2OTVA 3SI4H 3VB5A 1GL1A 3V7TA 2GCTC 3I78A 3L33A 4OS6A 2H5CA 2SGQE 3MU4A 3MU8A 3VB6A 5GJ4B 1XM1A 1DT2A 5FHTA 1XUGA 3S9BA 1PPGE 1H9HE 2BQ7B 1CT4E 2AEIH 1QB9A 1DUEA 3OU0A 4YM9A 5GXPA 1ORFA 3AW1A 1NT1A 2AH4X 3KQCA 1G37A 2ZDVH 5E8EH 3M61U 4H42U 5A0CA 3ZYEA 2G4UA 1EPTC 1IQLA 1DLEA 1JBUH 2Y80A 3QX5H 1AE8H 1ZSJA 1UTPA 4JZFH 1LTOA 1GHWH 4FVBA 3SV7A 1SGPE 2XTTB 1PPFE 2DUCA 1K1OA 1CQQA 5DP3A 1SOZA 2K1QA 2A7JA 4TPYA 2JETC 2J94A 1ZJKA 3PWCA 2O8WA 4IMZA 2QXHA 4ZXXH 3SU2A 4ISOA 4YT6H 1KSNA 4BAHB 4E05H 2ZO3H 1HJAC 2P3FH 1O2QA 1BBRH 1NM6A 2LPRA 3MNSA 3E91A 1KTSB 4E7RG 4GHTA 5DP4A 4CRDA 1YPKH 2H9TH 2J34A 2BDAA 5ETXA 1PPCE 3TJVA 4MLFB 2D2DA 3CS7A 1BZXE 2ZGBH 1D6WA 4DGJA 1AHTH 1O3DA 1UCYH 1T4VH 2F83A 2GTBA 1WCZA 2Z3EA 2ZDMA 3OY6U 3ZZCA 4FU9A 1NFYA 3F9HA 1QGFA 1FNIA 2BDBA 4UFDH 3K6ZA 1BTWA 1O5CB 1L4DA 1MTNC 1HLTH 4ISLA 1MKXK 4K60A 1AGJA 1V2KT 1Q31A 1NESE 3Q76A 3ZV9A 5J4SA 1PPBH 3SW2B 2W26A 1D9IA 1CHGA 2TBSA 3UOPA 4AG1A 1EOLA 3M5LA 3RM2H 4DY7B 4NIYA 4BAOB 1NY22 2ZKSA 3F9GA 4WWYA 1RJXB 4KTUA 3SUDA 4UFEH 4ZH8A 4AN7A 1E37B 2HOBA 4D8NA 5GDSH 2F9NA 3FP7E 2VWOA 1HAXB 4ISHH 1QRZA 1OYTH 3SUEA 3BTGE 3LH1A 1IQEA 1A5IA 1N6XA 2QCYA 1O3MA 1WSSH 3PTBA 1A4WH 5TJXA 3U1JB 1OKXA 4Y7BA 2EI6A 3RXAA 1V6DA 3M35A 2RA0A 4B1TA 4MNVA 6GCHG 1LO6A 1YLDA 1A7SA 1TB6H 2WV5A 1TMBH 1S0RA 3URCA 5ESBA 1Z1JA 3MO6A 1UVUH 7GCHG 4WY3A 1GI3A 4Q7XA 1MKWK 5F8TA 4Y0YE 3SNBA 3MHWU 3GISB 3E0PB 4WVPE 1CA8B 1LKAA 4X2VA 1G3BA 3FFGA 3H5CB 1FJSA 1D4PB 2ZFPH 2YNBA 3ZVFA 2BD4A 1XKAC 1IHSH 5GPIB 4NCYA 1FMGA 3RU4D 4ZKRU 3LPRA 1O5GH 2SNWA 3T29A 1UVTH 4ZROA 2GCHG 1GMCF 1HIAA 1GBTA 1K28D 1P12E 1F5KU 2FS9A 1RRKA 2JH5D 1G2MA 2VWNA 3PM3A 3SUGA 1ZSLA 3SOSA 4NA9H 1GI8B 3TK6A 2Y82A 5A0BA 3FP6E 1O5BB 1GVLA 2BVXH 3MO9A 2OP9A 1IQIA 3OSYA 4UD9H 1O38A 3DFJA 1SQAA 4NWKA 1IQMA 3QTVH 1TNKA 1UO6A 1LDTT 2CXVA 1T8MA 3BTEE 3ZVDA 3GY3A 3PMAB 1DSTA 1O3EA 2BLVA 3RXQA 2QAAA 1N1LA 3A8AA 3DA9B 4DOQA 1QURH 1W11U 1C4V2 5F6MA 1TABE 1Z8IB 1C2JA 1HAOH 3RXMA 1C2LA 3NKKA 1F5RA 2FOHA 3BTDE 3LT3A 1W0ZU 1XUIA 1DANH 1ID5H 1O5EH 4Y8YA 1BRBE 1KXDA 3A7TA 2Z9GA 1ETSH 2SGAA 1WTGH 4A92A 4BANB 1O2HA 4H4FA 1SLVB 2J92A 1TRMA 4NG9H 5H4IB 6ESTA 5GCHG 1QBVH 1MQ5A 1MTVA 3GY6A 4X1SU 2UWPA 2VWLA 2NU2E 1Z8RA 1GPZA 5E2PA 5LH8A 1RXPA 4XOJA 2FP7B 1QRXA 1FY8E 3SI3H 2FX4A 1QL7A 4X2WA 5JB9S 2ZIQH 1YBWA 2GZ8A 5EQQA 1ZMLA 4AFSA 1PPEE 1BRCE 1GBLA 4B2AA 1C5OH 4D7GA 2BQ6B 2PR3A 1VITF 1KIGH 3FZDA 5FPSA 2OBQA 3LGIA 3NK8A 4FUFA 1OWJA 3NPSA 4GCHG 1TA2A 4BTTB 1DLKB 1NFXA 1TPAE 3PO1C 4BTIB 4OGXA 2TGDA 3F1SB 1W10U 3R0FA 5I25A 1FUJA 2ULLA 2FYQA 1FONA 4KTCA 2VIQA 2H9HA 4DCDA 3ZZ5A 1TGCA 1FY4A 1NROH 3RMMH 2AMQA 4WXIA 1ZRBA 3QWCH 3MH4A 4NFEA 1AU8A 1KDQA 2TGTA 5TCCA 3GY2A 3MTYA 1HAZB 4JK6A 2J9NA 2VU8E 1YCPM 4B71A 5IYTA 1O3AA 3KQEA 4BTUB 5DO4H 2BOHB 4VGCC 2BY5X 2Q6GA 2RG3A 2GT8A 2GD4B 3BEIB 3RXOA 1VZQH 3TH2H 4KELA 4ZHAA 1V2PT 1ZMNA 3S7HB 4I8LA 4H6TA 1LVOA 2BZAA 1Z8JB 5AFZH 3VPKA 1OPHB 1UVOA 1XVMA 3AW0A 1E34B 5C1XA 4A7IB 3LGTA 1YP9A 3F9FA 3RXHA 1ZTKA 2ESTE 1C2KA 2B0FA 4X8TH 1O2SA 5DP7A 2PLXA 1C2DA 2V0BA 3SHAH 1FN6A 4BAQB 3B23B 2XBXA 4K1EA 1GI1A 1VGCB 4INLA 5FXLA 2FM2A 2Z94A 1HAVB 1V2ST 3ATMA 1GCTB 1XXFA 1P2QA 2BD8A 1D3TB 1NRNH 1LMWB 4TY7A 1KXEA 3Q77A 1K1PA 1GBHA 1O2LA 1QBNA 2OUAA 2ZGCA 3A88A 1C1UH 1J15A 4U32A 1ZHPA 1AUTC 1IAUA 3AAUA 7ESTE 2HNTE 4AFUA 2TGPZ 1GI7B 2OC1A 2O8MA 2SGDE 8LPRA 3HK6B 1NTPA 1TPOA 1GJCB 1C5QA 1GI4A 1Y3YA 4OS1A 1EAWA 4GAWA 3VGCB 2F9UA 1GWAA 4X8VH 3P70B 2PTNA 1KXCA 6GCHF 1P2MA 4CRCA 1NRRH 1EOJA 3TGKE 1BIOA 1W13U 1TAWA 3A7WA 2W3KA 4YOIA 1PPZA 1O37A 4Q2KA 4DVAU 7GCHF 2PFEA 2Y7XA 1TONA 1HAYB 1KYNA 2B9LA 4KGAA 5L6NH 1UHBA 4AX9H 3BV9B 2Z7FE 2WUCA 1TNGA 4YESB 5EXMA 4NZQA 3B8JA 1C4Y2 5A8XA 1SG8B 1Z7KA 1Z8GA 8ESTE 2YNAA 1ANDA 3RC5A 3VB7A 4ZKNU 2ZCHP 2J4IA 4XBDA 2SFAA 1GJ8B 1O35A 1UVPA 1P03A 2P3UB 1UK2A 2GCHF 4ABHA 4HFPB 3A7YA 3A86A 4B74A 2QIQA 1O2NA 1SGDE 3SGAE 1GGDC 1O39A 2UUJB 2QV1A 2XW9A 1ANCA 1RTFB 2SNVA 2V35A 2F9VA 1GJ4H 3T28A 1ESAA 3GCNA 4AGKA 2FTLE 1SGIB 1HJ9A 3N7OA 1EAIA 2G4TA 3RXSA 1N8OB 1EP6A 2XC4A 2DE8A 2VGCC 3GOVB 4D7FA 3ZYDA 1O2KA 3SBKA 1EB1H 1MTUA 1OXGA 3RXLA 1A3BH 2ASUB 2ZHEH 3PROA 1O2WA 1GBAA 3RMOH 2FOFA 2A32A 3ITIA 2FZZA 3HATH 1JOUB 5L30H 2G5VA 3H7OA 2ZHWH 1ELAA 1GJAB 3BIVH 1GBJA 4XSKU 1ELBA 1GJ7B 2HLCA 1EPTB 1FY5A 1PQAA 4JYVH 1BMAA 2A45B 4ZUHA 5GCHF 4ABGA 1DFPA 4ESTE 2A4QA 3V13A 2QGRA 5GIBA 1RGQA 3ZZ3A 5TCAA 2ZF0H 3GCOA 2JETB 3UWJH 2OQ5A 5DJ7A 2A4RA 1GMHG 1XVOA 3QGJA 2UUFB 1HJAB 1O2JA 1BBRK 3E16B 1PYTC 4FUJA 2ZNKH 3GCHB 3EE0B 1IQFA 5GWZA 4BXSA 3E8LA 5C67A 1OYQA 1GDQA 2O9QA 3AVZA 4MNXA 1NPMA 2WYGA 5E0JA 1O31A 1WU1A 1C2FA 2FOAA 3SJ9A 1Q3XA 1UCYK 2VB0A 4GCHF 1RIWB 5EQRA 4HTCH 5JDUB 3GCTF 2XWBI 1BTHH 2PKAA 2ZU5A 1AFQC 4CH2B 1BTUA 3SV2H 5FBIA 1YPHC 4NIWA 2R3YA 1M9UA 1MH0A 3P8GA 3U69H 3T62A 4A5TS 2BYAX 1G3CA 1MTNB 1AIXH 3SNCA 1L1JA 3ZZBA 1ELGA 7KMEH 3BTWE 4ABIA 1BBRE 4Y0ZE 5BPEA 3SU0A 2ZHQH 1RFNA 2PUXB 4X8UH 4LZ1H 1C1VH 3P17H 1GHXH 1AKSA 2BX4A 3Q00A 3TITA 2W3IA 3A8DA 3Q3XA 1NRQH 1IQNA 1ZZZA 2C8WB 4NSYA 4WXVA 2ZECA 1O32A 1A5GH 3SQHE 1C1TA 1CO7E 3SNEA 3SO3A 2WPKS 1FZZA 1HAHH 1S6HA 1IQHA 1EAUA 1KXAA 2C4FH 4WH6A 3RC6A 1TX6A 3GYMA 4Q7YA 5EW2H 2J2UA 1HJ8A 2P95A 1DWCH 3SNAA 2Z3CA 1K22H 1KLTA 3VXEH 2YOLA 2FTMA 1ZJDA 3A7ZA 1K9OE 1P0SH 1AVGH 5JYIA 1Y5BT 4FUIA 1P2OA 2BY8X 2O8LA 2UUKB 4CH8B 1TGTA 3EA9A 3RMLH 1J17T 4CHAC 1GBBA 1BTXA 2OCVB 1NC6A 5F8XA 3LOXA 3PLBA 5F8ZA 1TNJA 2H9EH 3ELAH 3PLPA 2GT7A 1T4UH 2FI5E 4XBCA 1FIWA 2GMTC 4IC6A 3G01A 1EZQA 1V2VT 1G30B 1S84A 4Q80A 4XE4A 1GI2A 3A82A 3M7UA 1EJMA 1S83A 1TWXB 4IW4E 2QN5T 4LK4A 1LVBA 1CBWB 3SGBE 1TQ7B 1C5RA 4NFFA 1H9IE 4NZLA 2VWMA 1C5PA 3UOUA 3URDA 4U01A 4E7NA 3ZV8A 3U8RH 1FV9A 2ANMH 1ESBA 1HAGE 4CRAA 1ELFA 1V2JT 5CHAC 1LHGH 2HWLB 2Y6TA 3EYDA 4AFQA 3UQOA 4PROA 1MD7A 4UFFH 1SSXA 1P9UA 1FPCH 1DVAH 2ZDLA 3RXDA 1MCTA 4I8JA 4Y11E 1AUJA 1O5FH 3GYLB 1V2WT 1P2NA 3HKJB 3K6YA 1EJAA 3SZNA 4JZ1A 1HRTH 1LVMA 1NU7B 1NRPH 2R3UA 3OY5U 1SL3A 1C5YB 3CP7A 4XBBA 2ALPA 3BF6H 4I8KA 1AO5A 5DP5A 1P06A 1RTKA 1P05A 2Q6DA 4CBNA 1IQJA 1BMLA 2OD3B 4YZUA 2FI3E 1ZGIA 2HGTH 1BA8B 5A0AE 1O2TA 3QZQA 1DXWA 2A31A 3T27A 1DWEH 1JMOH 2GGVB 2VIDA 5DP9A 2R2MB 1TALA 4CRGA 3K2UA 1YPHE 2QF3A 4TWWA 1UTNA 4NWLA 2FXRA 5C2ZA 2ZC9H 3ZVBA 1K1MA 1L1GA 1GDNA 1YPEH 1GI6A 4ASHA 1BJUA 2CJIA 3MNBA 3C27B 5T6DA 1LQEA 4AB9A 1O3CA 1HIAB 4JYUH 1LQDB 2WUBA 1ARBA 1THRH 3UNRA 2Y5HA 3V12A 2THFB 3SNDA 1O2VA 1SQOA 1S0QA 1LHCH 2D8WA 4DIHH 3TNTA 4U30A 2PKSB 3QK1A 3TH3H 3KCGH 9LPRA 1YGCH 1IQGA 4OS7A 1QIXB 1HCGA 3SN8A 1O33A 2FEQH 1GI9B 4X8SH 1C1OA 1FN8A 2FOGA 1YC0A 2VJ1A 1MZAA 3A83A 1BTYA 1DOJA 1RD3B 4I8GA 1TGNA 1MUEB 4VGCB 2PTCE 1O3BA 3E90B 2ZTZA 3GICB 5BRRE 3ENSB 1CU1A 1AZ8A 3E0NB 1GMHF 2C3SA 2OINA 5A2MH 4JZEH 3MWIU 3UQVA 3P6ZB 1QA7A 1THPB 3E1XB 3EA7A 3P95A 3MH5A 1W3CA 2RA3A 4RKJB 4DW2U 1ESTA 1OP8A 5FPYA 1TMUH 3KF2A 5JB8S 1UTLM 1BTPA 3BTHE 3V0XA 1HB0B 4ABAA 2BDIA 5F03A 1HXEH 2VIWA 2HVXA 2VNTA 3ATIA 1TRYA 1UVSH 3RXUA 4DJZB 2Z3DA 1CVWH 1MQ6A 4X6NA 1F7ZA 3HGNA 1OWIA 2FI4E 1AE5A 3PWBA 4HI3A 4JZDH 2AGIX 3RXTA 1DX5M 3TVJB 1G2LA 1BMMH 4MNWA 4R8TB 1FQ3A 4FU7A 1FY3A 3BTME 2V3OH 4INKA 1K1LA 3H7TA 2GZ7A 2NWNA 3LGWA 1IOEA 4IGDA 1O3GA 2A4GA 1HYLA 1WOFA 4K1TA 1GVKB 5EXLA 2A4OA 2F3CE 3RLYH 1GDUA 3TLOA 1WYKA 1HDTH 4XFQA 3SU6A 1BHXF 5E2OA 1ZPZA 5HYOA 1OX1A 5EQSA 1FXYA 2G51A 1D6RA 3T5FH 1ELVA 1F0RA 3RC4A 1FAXA 3RXBA 2GDEH 1ACBE 1KDQB 1P9SA 4ABDA 1L2EA 1Q2WA 5HMAA 1SFQB 1VCQA 1NO9H 1DUAA 1ZTJA 3EGKH 3S0NA 3GCTG 1PQ8A 1W14U 1O2XA 1C5WB 4Q7ZA 1DE7H 3W95A 3QN7A 1XX9A 2VIPA 2F91A 1K21H 8KME2 5C1UA 1C5ZB 2BY7X 1AQ7A 3FAOA 4IMQA 1NFUA 2Z9JA 1UTJA 3BEFB 1YF4A 4UONA 2AMDA 3GY7A 3MMGA 1P2IA 2D26C 3SJ8A 5FX5A 4MG3A 4FUCA 4INHA 1F0UA 1LHEH 4SGAE 3NZIA 2XCNA 3BG8A 3IITA 4U2WA 5EG4A 4O97A 3S9CA 3ZVEA 4IBLH 2KAIB 4Y10E 1GGDB 1WTHD 4NGAH 1AI8H 1QJ6B 1P11E 2QXJA 3KEEA 5C5NA 1L4ZA 1D3PB 2GKVE 1PJPA 1SGCA 1NS3A 2BVRH 4ZXYH 2EI8A 1DXPA 2P93A 4AFZA 4FVDA 5AFYH 2GDDA 4B75A 2ODYB 1T8LA 3KQDA 9ESTA 1EAXA 2VGCB 3GDSA 4YOGA 2ZTXA 3LJJA 1UK4A 2BXUH 3MI4A 4FU8A 1BCUH 5DP6A 1QA0A 1O3KA 4AB8A 1C1RA 1ZLRA 2HRVA 4GLYA 2BDYA 4GVUA 2ZHFH 1SFIA 1HFDA 1O2IA 2R0LA 4CR5A 2ILNA 3T2NA 1MBQA 2CHAB 3LDXH 4Y76A 1UTMA 2CMYA 3HPTB 5T3HA 1C1WH 4ISNA 1P2KA 2F9BH 4WJG2 3BG4B 1D3QB 5AHGH 5DGJA 1JRTA 1VJAU 1ZOMA 1J9CH 2EI7A 3SGQE 1FAKH 1XXDA 1TPPA 1C1QA 2GZ9A 1UHBB 1HAIH 2BZ6H 1BMNH 1V2QT 2PSXA 3LONA 4RKOB 4FXGH 5AVDA 2VVVA 3ZZAA 3A84A 4TYDA 1GG6B 2TPIZ 3ZZDA 1S5SA 3OX7U 2VVCA 2BD9A 2ZU2A 2ZP0H 1HAVA 1SVPA 1GHAG 4BXWA 1YYY1 4ABFA 4WH8A 3LGUA 2NU4E 1JWTA 4TWYA 6CHAC 3ODDA 1CT2E 2ALVA 1QR3E 5JBBS 2Q1JA 3O8BA 5FX6A 3ATWA 2R2WU 2BD7A 2ZTYA 2D1JA 3BTKE 2BVSH 2SGFE 3M5MA 2ANKH 2DE9A 3ZVCA 1SHYA 1NN6A 1MAYA 1O2YA 1OS8A 5LGOA 1ELDE 2QA9E 3TJOA 3RXGA 3UR9A 3JZ1B 1O34A 3A87A 1JXPA 2AGGX 4O3TA 3K9XB 2PUQH 3UNSA 2FMJA 4I32A 4IC5A 5DK1A 1X7AC 3SU1A 2Y7ZA 3NUMA 2ZPSA 3KN2A 3RU4E 1CGIE 3KNXA 2XYAA 1AB9C 3SU5A 4F4OC 1F5LA 2F9OA 3RXJA 3I77A 1SLWB 2F9PA 2FOEA 1C9TA 2I6SA 2OC7A 3SJKA 4B2BA 5E0HA 1C1MA 1SBWA 1W12U 5FAHA 4Y8ZA 1ZGVA 1CA0C 1G9IE 2WPIS 1P57B 2GCTB 1EQ9A 1W8BH 3VXFH 3F68H 1YM0A 2P8OC 4A6LA 1TBZH 1O3IA 2RCEA 1DITH 2BD2A 1YPGH 2OQUA 2A2QH 4X1PU 1BUIA 4CHAB 1SGYE 3UTUH 3STIA 1FIZA 3SV8A 4KP0A 1BT7A 2B8OH 3MO3A 1PQ7A 2A7CA 2GX4A 2H5DA 4NA7A 2BM2A 1ETRH 3LIWA 1ZSKA 3UFAA 2ZZUH 1P01A 3M3SA 1DDJA 2GMTB 1DSUA 1A0JA 1MCVA 1GCTC 1O3PB 1SI5H 3O8RA 1OOKB 1QB6A 1KXBA 3GDUA 1EZUC 5CE1A 4YOJA 4MNYA 3LH3A 4D9RA 1C4U2 1TBRH 2XRCA 4E06H 4FUDA 3A8BA 4ZHMU 4WF8A 4THNH 2QF0A 1CHOG 1P8VC 2XWAA 3ZVAA 1A46H 1A2CH 2V6NA 1Y3VA 1LVYA 1B0FA 2HALA 2ZPRA 2JKHA 1SB1H 1QQ4A 2A0QB 2XXLA 2ZQ2A 4A1TA 3SU4A 1O2ZA 1Y5AT 1SC8U 4YTAA 1HGTH 3BTQE 4MDSA 3UREA 1N6YA 3FP8E 4ABEA 1LPGB 2OXSA 3TIUA 3LGVA 3LKWA 1O2OA 2BOKA 4O3UA 4K1SA 5EXNA 2WPLS 3MYWA 5FCRA 3A85A 4AGJA 3QDZB 4FUGA 4JCNA 3PV4A 1ZPCA 4K2YA 1OWKA 1NZQH 2A5AA 4K8YA 3BN9A 2Z9LA 4RN6A 1GHVH 5A8ZA 2ZPQA 3QTOH 4MQAA 1K1JA 1THSH 1F92A 4H6SB 1DM4B 1H8DH 1AZZA 1C5UA 1OWEA 1GBCA 1GCDA 3WY8A 3ODFA 3E6PH 1RS0A 1UCYE 4CRFA 3SJOA 4K5ZA 4DURA 1AWHB 1HXFH 1J8AA 2A5IA 1QL9A 3KGPA 3FVFB 3O8DA 5EW1H 1YCPH 3UPEA 3DHKH 1LCYA 1TGBA 2C8XB 4A1VA 2G8TA 3SORA 4LXBH 3ZZ4A 5C20A 1TX8A 1BB0B 4GPGA 1VCPA 1SHHB 1C5NH 2PW8H 1MTWA 1O2MA 1QJ1B 2AERH 2ANWA 1N8OC 3RM0H 4AYVB 2OBOA 1TE0A 3RXPA 1ELTA 1A5HA 1QTFA 1L1NA 1YLCA 2BXTH 2QXIA 2VINA 3DFLA 5ESTE 3RXVA 1G36A 3PB1E 3STJA 4QT8C 3K65B 2XNIA 1PPHE 2OLGA 4UDWH 1ABIH 5JBCS 5B6OA 1PFXC 1WAYB 3QUMP 3RXRA 1TIOA 2P3TB 3Q3YA 2Z9IA 3PLKA 3MNCA 3NWUA 2ZU4A 1JIMA 4AORA 2IJOB 3EA8A 1XUKA 4MPWA 1NRSH 1W7XH 3VB3A 2H1UA 1V2UT 3VB4A 4X1RU 5L2ZH 5ABWA 2C8ZB 1GHYH 3EQ0H 1TNIA 3JZ2B 1BQYA 1H9LB 4NA8A 5LPEA 1GBFA 1ZR0A 1DY8A 3S69A 3EAJA 1T8OA 1K1NA 2Y5GA 2A1DB 1LHFH 4FUEA 4K8BA 1ELEE 2Y5FA 5DKMA 1H8IH 3MOCA 1V2RT 1V2LT 1F0TA 1S85A 1SR5C 1QHRB 2ODPA 1VITH 2G00A 3GCHC 1TOMH 2BTCE 2B5TB 2AGEX 1GHAF 5PTPA 1V2OT 1UJ1A 1OSSA 3MH7A 1NU9A 3A80A 1DY9A 1UMAH 4CR9A 2STBE 3TJNA 3LC3A 2P16A 4X2XA 1MZDA 3HKIB 1RIWC 2FX6A 1O3FA 2FWWA 2TRMA 3QZRA 2FODA 1W0YH 3RU4T 1SPJA 4Y8XA 5E0GA 1QL8A 5I46H 4UFGH 2HNTF 2EEKA 5J4QA 4Z6AH 1K2I1 1C5VA 1S81A 3MU5A 3OTJE 3SUFA 3LU9B 2AS9A 1INCA 4I33A 3KL6A 5HM2A 3TGJE 2AMPA 2HPPH 1EATA 3UR6A 5EU8A 3C1KA 1ANBA 4GSOA 1SLUB 2VVUA 3T25A 3MU0A 3OYPA 3M7QA 1V3XA 1FPHH 2IN2A 4X6PA 2VH6A 4MPUA 5AF9H 2FLRH 1EZSC 4JZIA 2NU0E 5EPNA 2CF9H 3U8TH 3T26A 1ABJH 1U6QA 1NFWA 4X1NU 3D65E 3PTNA 5HXFA 2GP9B 1C5MD 2CN0H 4CREA 1EXFA 1OWHA 1SGQE 2CGAA 3ZZ8A 2J38A 1TOCB 4X6MA 1C1SA 3PO1B 3O8CA 4NIXA 2FIRH 3D23A 1B5GH 5IDKA 3U1IB 2G81E 2VH0A 5C3NA 1V2NT 4Y6DA 4TY6A 1O2GH 3E3TA 2QY0B 2W5EA 5JPMH 3D49H 4ABJA 4B2CA 2O8TA 1YPJH 1HV7A 1SGEE 1O3LA 2G52A 2JH6D 4NSVA 4CRBA 1VCWA 4MPXA 3SJIA 1Z6EA 3U9AH 2FDAA 1QRWA 2BB4A 2ZFQH 3I29A 1O5AB 3Q3KA 3BTTE 1EASA 8GCHF 2WPHS 4DG4A 3KQBA 1CHOF 2WYJA 2GV6A 3F9EA 1P02A 1CBWC 2HPQH 4Z0KA 1KLJH 1FLEE 1YKTA 1F2SE 1P09A 3A8CA 5HM9A 1BTZA 4WMFA 5EODA 3P92A 1CSOE 2NU1E 3U98H 1V2TT 2ZA5A 3TGIE 5DPAA 2TIOA 3UUZA 2ZDAH 4O9VA 1TRNA 1AWFH 3BSQA 1LPKB 1IHTH 3QLPH 2B7DH 1O3JA 3DUXH 4GUXA 3TH4H 1GBKA 1C2GA 1J16A 2HNTC 5A09A 3M36A 1AVWA 3AASA 1TNHA 1ZYOA 2ZDNA 3RXCA 1MKXH 1ZHRA 3QO6A 1QNJA 1LKBA 2RDLA 3NCLA 2C8YB 1GBEA 2ZDKA 4HGCA 1B0EA 2ZCKP 1GJ5H 4KKDA 4ZHLU 2V3HH 1MU6B 2BHGA 7LPRA 4ZAEA 3RMNH 3ESTA 1BHXB 3HK3B 1GL0E 2FOMB 3MH6A 1DICA 3NXPA 2PHBA 1FY1A 1Z6JH 1TA6A 2PGBB 3P8OA 2FPZA 3RP2A 3FANA 3FZZA 2ZGJA 3F6UH 1Y3UA 1C2HA 1GI0A 3DD2H 4Y7AA 1BOQA 3RXKA 1O36A 1SGFG 3KIDU 2FOBA 5SGAE 5A8YA 1E38B 4MPVA 1SMFE 2UWOA 1XMNB 1O3HA 1SGTA 6CHAB 2BY6X 4LOYH 2ZU1A 3DT0H 2W7SA 2WPJS 4MTBA 1AFEH 2XC5A 1MKWH 3P8FA 3CS0A 1E0FD 2PKSC 1C5XB 3TNSA 4KTSA 1UK3A 4YLQH 1KY9A 1O30A 4OS4A 3SV6A 1C1NA 1W7GH 2BDGA 1EB2A 1JIRA 1A61H 4ABBA 4Y71A 2FOCA 1A0HB 4I7YH 3S9AA 4B76A 1AB9B 3ZZ9A 1AN1E 1GI5A 1DS2E 3PMHB 3ZVGA 1TPSA 4BAMB 1QY6A 2FESH 3SV9A 6LPRA 3VFEA 1CA0B 1XKBC 1GHBG 3LC5A 1C2EA 3V3MA 1IQKA 1AY6H 1HNEE 1UTQA 1VR1H 1Y8TA 1FI8A 1XUHA 4X2YA 3UIRA 4JMYA 4O03A 1XUJA 2VIVA 1KLIH 5T6FA 4OS5A 2BQWB 4DIIH 1GMDG 3D62A 1P10A 1WQSA 2P8OB 2J95A 4JK5A 3A89A 1GBMA 1C1PA 2ZFTA 1TQ0B 4X1QU 1QCPA 1CGHA 1TLDA 2BDHA 2ZHDA 1BRAA 1TGSZ 1G32B 2FS8A 2ZWLH 2AFQB 3IG6B 4IN1A 3S7KB 1WBGB 4AG2A 2LNCA 2G5NA 2KAIA 1A3EH 4XDEA 1Z1IA 1O2UA 2ZG0H 2Z6BD 1QB1A 1RTLA 1DWBH 3UY9A 4I31A 1KTTB 4NIVA 4K69A 3UWIA 3RXIA 2QXGA 2ZFSA 4TPIZ 4OGYA 2XBVA 2XBWA 1TYNA 2Y81A 1YPLH 2STAE 5EPYA 1T32A 1MAXA 1EX3A 1GJ6A 1ZPBA 5JBTA 3TJUA 1MTSA 1YPMH 2G55A 4A1XA 3AAVA 2QC2A 3U8OH 1H1BA 1UTKA 1T31A 3ZZ6A 1PQ5A 2AYWA 2ANYA 4YT7H 1QQUA 3RXFA 1C5LH 1TX7A 1E36B 1DPOA 1W2KH 3UNQA 3BIUH 1HPGA 4FUBA 1D3DB 4WMDA 3VEQB 2M5TA 5EOKA 5K0HA 1O3OA 2CV3A 1VJ9U 3SHCH 2I6QA 1SQTA 2A7HA 2ZU3A 5C5OA 1AFQB 5HGGA 4D9QA 1WUNH 4DT7B 2W7UA 1ARCA 1ZHMA 2WINI 2PGQB 1S6FA 2TGAA 1PYTD 1EKBB 1P04A 2SGPE 1SGNE 4Y79A 3TU7H 1Y3WA 5LPRA 1OWDA 3L6PA 2BX3A 2XCFA 2O8UA 1LHDH 1QJ7B 2ZEBA 2UUYA 1CGJE 1ETTH 2BD5A 2C93B 1CT0E 1ZMJA 1Y5UT 3A81A 3MNXA 1AVXA 4RSPA 5L2YH 1GJBB 5DP8A 1P3CA 4SGBE 1KXFA 3ATLA 1O2RA 2WV4A 1GJ9B 2SGEE 2AIPA 3LGYA 1YCPK 4K3JA 1S82A 3PYHA 3B9FH 1AMHA 2Z9KA 4LZ4B 3IWMA 4I8HA 5K7RA 1K1IA 2FO9A 1BRUP 2VIOA 1A0LA 1P2JA 2FLBH 2P59A 3ZZ7A 2BLQA 1MD8A 2ZFRH 4YLUA 4D76A 3BEUA 3PMJA 5DG6A 4JYTA 2OC8A 1SLXB 2ODQA 4UEHH 1O5DH 4BAKB 5CMXH 1EZXC 1TMTH 5C1YA 1DWDH 1V2MT 3QGNB 2XBYA 5LPFA 1BITA 1B7XB 3M37A 4B73A 2PWXA 5G4BA 3RLWH 2ZI2H 5FCKA 1F0SA 2R9PA 2IPHA 4AZ2B 5JBAS 2JH0D
chains in the Genus database with same CATH superfamily
1G3DA 1WQVH 2WHXA 3MFJA 1ELCA 3LJOA 1VGCC 4HZHA 1LPZB 2UWLA 4IN2A 4ZMAH 4ZKOU 1T7CA 3ATKA 1SGRE 1SOTA 3GY8A 1TFXA 2CHAC 1SQRA 2ZFFH 3PMBB 5FBEA 2PKAB 2ZQ1A 2OC0A 1QFKH 4R0IA 1T8NA 3HGPA 3M3VA 4X0WU 8GCHG 3BG4C 4ZKSU 3SQEE 2EC9H 4M7GA 1GMCG 1C9PA 3RDZA 2BLWA 1H4WA 2BY9X 1WV7H 4X6OA 3EDXB 3GDVA 2GVFA 1E35B 2OK5A 1HAPH 1OP0A 2BLOA 2QYIA 2FYRA 1S6LA 1AKSB 3M7TA 5CHAB 4MVNA 2Q6FA 2ZCLP 3M5OA 2PSYA 2H6MA 2BMGB 3SU3A 2NU3E 2J98B 3P8NA 3VGCC 1GBIA 1HUTH 1UTOA 1XUFA 1O3NA 1GG6C 4FUHA 1GVZA 2CF8H 3M5NA 1ANEA 1EPTA 3A7XA 3SZEA 4F55A 1AD8H 5DSFA 4BNRA 1CE5A 3L3TA 3ZIAD 4BOHA 1TBQH 5EGMA 3CENA 2BDCA 4OS2A 4F49A 2WPMS 3TK5A 2A2XH 3TPIZ 4AYYB 5T6GA 1EJNA 3BTFE 3W94A 1Y59T 4ISIH 1QBOA 4CBOA 4UE7H 1BDAA 1GHZA 1C5TA 1J14A 3RUOA 1BJVA 1A1RA 1G3EA 3RXEA 1C5SA 1EP5A 1C2IA 1MBMA 2PV9B 1SGFA 2EA3A 3KHVA 4J1YA 2A5KA 1C2MA 1MU8B 1TNLA 1FDPA 1MMJN 2ZGXH 2JDID 4GHQA 2L6OA 2XC0A 2GV7A 1JRSA 2C90B 3TK9A 1GBDA 1ZRKA 3M3TA 3A7VA 1ZTLA 2H2ZA 1HBTH 2R0KA 4J2YB 5FPTA 2IOTA 2P94A 3GY4A 1GJDB 1GHBF 1OP2A 2BD3A 1P3EA 1Y3XA 2AIQA 1O0DH 1L0ZA 4YO9A 3MU1A 4WMEA 1VITG 3UB0A 4AOQA 3R3GB 3GS9A 4IS5A 2ZGHA 1O2PA 1Z71A 1GMDF 3GY5A 1EUFA 2OTVA 3SI4H 3VB5A 1GL1A 3V7TA 2GCTC 3I78A 3L33A 4OS6A 1K0HA 2H5CA 2SGQE 3MU4A 3MU8A 3VB6A 5GJ4B 4P00A 1XM1A 1DT2A 5FHTA 1XUGA 3S9BA 1PPGE 1H9HE 2BQ7B 1CT4E 2AEIH 1QB9A 1DUEA 3OU0A 4YM9A 4DT4A 5GXPA 1ORFA 3AW1A 1NT1A 2AH4X 3KQCA 1G37A 2ZDVH 5E8EH 1YWUA 3M61U 4H42U 5A0CA 3ZYEA 2G4UA 1EPTC 1IQLA 1DLEA 1JBUH 2Y80A 3QX5H 1AE8H 1ZSJA 1UTPA 4JZFH 1LTOA 1GHWH 4FVBA 3SV7A 1SGPE 2XTTB 1PPFE 2DUCA 1K1OA 1CQQA 5DP3A 1SOZA 2K1QA 2A7JA 4TPYA 2JETC 2J94A 1ZJKA 3PWCA 2O8WA 4IMZA 2QXHA 4ZXXH 3SU2A 4ISOA 4YT6H 1KSNA 2KR7A 4BAHB 5C0UA 5KECA 4E05H 2ZO3H 1HJAC 2P3FH 1NBME 2IJD1 1O2QA 1BBRH 1NM6A 2LPRA 3MNSA 3E91A 1KTSB 4E7RG 4GHTA 3WWFA 5DP4A 4CRDA 1YPKH 4B6FA 2H9TH 2J34A 2BDAA 5ETXA 1PPCE 3TJVA 4MLFB 2D2DA 3CS7A 1BZXE 2ZGBH 1D6WA 4DGJA 1AHTH 1O3DA 1UCYH 1T4VH 2F83A 2GTBA 1WCZA 2Z3EA 2ZDMA 3OY6U 3ZZCA 4FU9A 1NFYA 3F9HA 1QGFA 1FNIA 2BDBA 4UFDH 3K6ZA 1BTWA 1O5CB 1L4DA 1MTNC 1HLTH 4ISLA 1MKXK 1E1RD 4K60A 1AGJA 1V2KT 1Q31A 1NESE 1YY3A 3Q76A 3ZV9A 5J4SA 1PPBH 3SW2B 2W26A 1D9IA 1CHGA 2TBSA 3UOPA 4AG1A 1EOLA 3M5LA 3RM2H 4DY7B 4NIYA 4BAOB 1NY22 2ZKSA 5EJZA 3F9GA 4WWYA 1RJXB 4KTUA 3SUDA 4UFEH 4ZH8A 4AN7A 4FETA 1E37B 2HOBA 4D8NA 5GDSH 2F9NA 3FP7E 2VWOA 1HAXB 3DSGA 4ISHH 1QRZA 1OYTH 3SUEA 3BTGE 3LH1A 1IQEA 1A5IA 1N6XA 4I86A 2QCYA 1O3MA 1WSSH 3PTBA 1A4WH 5TJXA 3U1JB 1OKXA 4Y7BA 2EI6A 3RXAA 1V6DA 3M35A 2RA0A 4B1TA 4MNVA 6GCHG 1LO6A 1YLDA 1A7SA 1TB6H 2WV5A 1TMBH 4RT1A 1S0RA 3URCA 5ESBA 1Z1JA 3MO6A 1UVUH 2JJ2D 7GCHG 3DCLA 4WY3A 1GI3A 4Q7XA 1MKWK 5F8TA 4Y0YE 3SNBA 3MHWU 3F0PA 3PV2A 3GISB 2V3MA 3E0PB 4WVPE 1CA8B 1LKAA 4X2VA 1G3BA 1H8HD 3FFGA 3H5CB 1FJSA 1D4PB 2ZFPH 2YNBA 3ZVFA 2BD4A 1XKAC 1IHSH 4P02A 4ZCNA 5GPIB 4NCYA 1FMGA 3RU4D 4ZKRU 3LPRA 1O5GH 2SNWA 3T29A 1UVTH 4ZROA 2GCHG 1GMCF 1HIAA 1GBTA 1K28D 1P12E 1F5KU 2FS9A 1RRKA 2JH5D 1G2MA 2VWNA 3PM3A 3SUGA 1ZSLA 1YLNA 3SOSA 4NA9H 1GI8B 3TK6A 2Y82A 5A0BA 3FP6E 1O5BB 1GVLA 2BVXH 3MO9A 2OP9A 1IQIA 3OSYA 4UD9H 1O38A 3DFJA 1SQAA 4NWKA 1IQMA 3QTVH 1TNKA 1UO6A 1LDTT 5KEDA 2CXVA 1T8MA 3BTEE 3ZVDA 3GY3A 3PMAB 1DSTA 1O3EA 2BLVA 3RXQA 2QAAA 1N1LA 3A8AA 3DA9B 5KGOA 4DOQA 1QURH 1W11U 1C4V2 5FL7D 5F6MA 4Q63A 1TABE 1Z8IB 1C2JA 1HAOH 3RXMA 1C2LA 3NKKA 1F5RA 2FOHA 3BTDE 3LT3A 1W0ZU 1XUIA 1DANH 1ID5H 1O5EH 4Y8YA 1BRBE 1KXDA 3A7TA 2Z9GA 1ETSH 2SGAA 1WTGH 4A92A 4BANB 1O2HA 2W6JD 4H4FA 1SLVB 2J92A 1TRMA 4NG9H 5H4IB 6ESTA 5GCHG 1QBVH 1MQ5A 1MTVA 3GY6A 4X1SU 2UWPA 2VWLA 2NU2E 1Z8RA 1GPZA 5E2PA 5LH8A 1RXPA 4XOJA 2FP7B 3FKSD 1QRXA 1FY8E 2W6ID 3SI3H 2FX4A 1QL7A 4X2WA 5JB9S 2XOKD 2ZIQH 1YBWA 2GZ8A 5EQQA 1ZMLA 4AFSA 1PPEE 1BRCE 1GBLA 4B2AA 1C5OH 4D7GA 2PP6A 2BQ6B 2PR3A 1VITF 1KIGH 3FZDA 5FPSA 2OBQA 3LGIA 3NK8A 4FUFA 1OWJA 3NPSA 4GCHG 1TA2A 4BTTB 1DLKB 1NFXA 1TPAE 3PO1C 4BTIB 4OGXA 2TGDA 3F1SB 1W10U 3N99A 3R0FA 5I25A 1FUJA 2ULLA 2FYQA 1FONA 4KTCA 2VIQA 2H9HA 4DCDA 2WZQA 3ZZ5A 1TGCA 1FY4A 1NROH 3RMMH 2AMQA 4WXIA 1ZRBA 3QWCH 3MH4A 4NFEA 1AU8A 1KDQA 2TGTA 5TCCA 3GY2A 3MTYA 1HAZB 4JK6A 2J9NA 2VU8E 1YCPM 4B71A 5IYTA 1O3AA 3KQEA 4BTUB 5DO4H 2BOHB 4VGCC 2BY5X 2Q6GA 2RG3A 2GT8A 2GD4B 3BEIB 3RXOA 1VZQH 4ACBA 3TH2H 4KELA 4ZHAA 1V2PT 1ZMNA 3S7HB 4I8LA 4H6TA 1LVOA 2BZAA 1Z8JB 4XRNA 5AFZH 3VPKA 1OPHB 1UVOA 1XVMA 3AW0A 1E34B 5C1XA 2WSSD 4A7IB 3LGTA 1YP9A 3F9FA 3RXHA 1ZTKA 2ESTE 1C2KA 2B0FA 4X8TH 1O2SA 5DP7A 2PLXA 1C2DA 2V0BA 3SHAH 1FN6A 4BAQB 3B23B 2XBXA 4K1EA 1GI1A 1VGCB 4INLA 5FXLA 2FM2A 2Z94A 1HAVB 1V2ST 3ATMA 3N7EA 1GCTB 1XXFA 1P2QA 2BD8A 1D3TB 1NRNH 1LMWB 1QZ8A 4TY7A 1KXEA 3Q77A 1K1PA 1GBHA 1O2LA 1QBNA 2OUAA 2ZGCA 3A88A 1C1UH 1FX0B 1J15A 4U32A 2KFWA 1ZHPA 1AUTC 1IAUA 3AAUA 5CDFE 7ESTE 3OEHD 2HNTE 4AFUA 2TGPZ 1GI7B 2OC1A 2O8MA 2SGDE 8LPRA 3HK6B 1NTPA 1TPOA 1GJCB 1C5QA 1GI4A 1Y3YA 4OS1A 1EAWA 4GAWA 3VGCB 2F9UA 1GWAA 2HLDD 4X8VH 5F53A 3P70B 2PTNA 1KXCA 6GCHF 1P2MA 4CRCA 1NRRH 1EOJA 3TGKE 1BIOA 1W13U 1TAWA 3A7WA 2W3KA 4YOIA 1PPZA 1O37A 4Q2KA 4DVAU 7GCHF 2PFEA 2Y7XA 1TONA 1HAYB 1KYNA 2B9LA 4KGAA 5L6NH 1UHBA 3NRLA 4AX9H 3BV9B 2Z7FE 2WUCA 1TNGA 4YESB 5EXMA 4NZQA 3B8JA 1C4Y2 5A8XA 1SG8B 1Z7KA 1Z8GA 2KCPA 8ESTE 2YNAA 1ANDA 3RC5A 3VB7A 4ZKNU 2ZCHP 2J4IA 4XBDA 2SFAA 1GJ8B 1O35A 1UVPA 1P03A 2P3UB 1UK2A 2GCHF 4ABHA 4HFPB 3A7YA 3A86A 4B74A 2QIQA 1O2NA 1SGDE 3SGAE 1GGDC 1O39A 2UUJB 2QV1A 2XW9A 1ANCA 1RTFB 2SNVA 2V35A 2F9VA 1GJ4H 5C17A 3T28A 1ESAA 3GCNA 4AGKA 2FTLE 1SGIB 1HJ9A 3N7OA 1EAIA 2G4TA 5T1VA 3RXSA 1N8OB 3W1EA 1EP6A 2XC4A 2DE8A 2VGCC 3GOVB 4D7FA 3ZYDA 2M2AA 1O2KA 3SBKA 1EB1H 1MTUA 2KCYA 1OXGA 3RXLA 1A3BH 2ASUB 5HKKD 2ZHEH 3PROA 1O2WA 1GBAA 3RMOH 2FOFA 2A32A 3ITIA 2FZZA 3HATH 1JOUB 5L30H 2G5VA 3H7OA 2ZHWH 1ELAA 1GJAB 3BIVH 1GBJA 4XSKU 1ELBA 1GJ7B 2HLCA 1EPTB 1FY5A 1PQAA 4JYVH 1BMAA 2A45B 4ZUHA 5GCHF 4ABGA 1DFPA 4ESTE 2A4QA 3V13A 2QGRA 5GIBA 1RGQA 3ZZ3A 5TCAA 2ZF0H 2F43B 3GCOA 2JETB 3UWJH 2OQ5A 5DJ7A 2A4RA 1GMHG 1XVOA 4F48B 3QGJA 2UUFB 2JIZD 1HJAB 1O2JA 1BBRK 3E16B 1PYTC 4FUJA 2ZNKH 3GCHB 2YMSC 3EE0B 1IQFA 5GWZA 4BXSA 3E8LA 5C67A 1OYQA 1GDQA 2O9QA 3AVZA 4MNXA 1NPMA 2WYGA 5E0JA 1O31A 1WU1A 3WWBA 1C2FA 2FOAA 3SJ9A 1Q3XA 1UCYK 2VB0A 4GCHF 1RIWB 5EQRA 4HTCH 5JDUB 3GCTF 2RFKC 2XWBI 1BTHH 2PKAA 2ZU5A 1AFQC 4CH2B 1BTUA 3SV2H 5FBIA 1YPHC 4NIWA 2R3YA 1M9UA 1MH0A 3P8GA 3U69H 3T62A 4A5TS 2BYAX 1G3CA 1MTNB 1AIXH 3SNCA 1L1JA 3ZZBA 1ELGA 7KMEH 3BTWE 4ABIA 1BBRE 4Y0ZE 5BPEA 3SU0A 5EJLA 2ZHQH 1RFNA 2PUXB 4X8UH 4LZ1H 1C1VH 3P17H 1GHXH 1AKSA 2BX4A 3Q00A 3TITA 2W3IA 3A8DA 3Q3XA 1NRQH 1IQNA 1ZZZA 2C8WB 2J98A 4NSYA 4WXVA 2ZECA 1O32A 1A5GH 3SQHE 1C1TA 1EFRD 1CO7E 3SNEA 3SO3A 2WPKS 1FZZA 1HAHH 1S6HA 1IQHA 1EAUA 1KXAA 2C4FH 4WH6A 3RC6A 1TX6A 3GYMA 4Q7YA 5EW2H 2J2UA 1HJ8A 2P95A 4Z1MD 1DWCH 3SNAA 2Z3CA 2J5UA 2K0QA 1K22H 1KLTA 3VXEH 2YOLA 2FTMA 1ZJDA 3A7ZA 1K9OE 3FOAA 1P0SH 1AVGH 5JYIA 1Y5BT 4FUIA 1P2OA 2BY8X 2O8LA 2UUKB 4CH8B 1TGTA 3EA9A 3RMLH 1J17T 4CHAC 1GBBA 1BTXA 2OCVB 1NC6A 5F8XA 3LOXA 3PLBA 5F8ZA 1TNJA 2H9EH 2LP6A 3ELAH 3PLPA 1BMFD 2GT7A 5HIYA 1T4UH 2FI5E 4XBCA 1FIWA 2GMTC 4IC6A 3G01A 1EZQA 1V2VT 1G30B 1S84A 4Q80A 4XE4A 2KX4A 1GI2A 3A82A 3M7UA 1EJMA 1S83A 1TWXB 4IW4E 2QN5T 4LK4A 1LVBA 1CBWB 3SGBE 1TQ7B 1C5RA 4NFFA 1H9IE 4NZLA 3FN8A 2VWMA 1C5PA 3UOUA 3URDA 4U01A 4E7NA 3ZV8A 3U8RH 1FV9A 2ANMH 1ESBA 1HAGE 4CRAA 1ELFA 3DSOA 1V2JT 5CHAC 1LHGH 2HWLB 2Y6TA 3EYDA 4AFQA 3UQOA 1OHHD 4PROA 1MD7A 1VKYA 4UFFH 1SSXA 1P9UA 1FPCH 1DVAH 2ZDLA 3RXDA 1MCTA 4I8JA 4Y11E 1AUJA 1O5FH 3GYLB 1V2WT 1P2NA 3HKJB 3K6YA 1EJAA 3SZNA 4JZ1A 1HRTH 1LVMA 1NU7B 1NRPH 2R3UA 3OY5U 1SL3A 1C5YB 3CP7A 4XBBA 2ALPA 3BF6H 4I8KA 1AO5A 5DP5A 1P06A 1RTKA 1P05A 2Q6DA 4CBNA 1IQJA 4Q4LA 2KZ4A 1BMLA 2OD3B 5IK2D 4YZUA 2FI3E 1ZGIA 2HGTH 1BA8B 5A0AE 1O2TA 3QZQA 1DXWA 2A31A 3T27A 1DWEH 1JMOH 2GGVB 2VIDA 5DP9A 2R2MB 1TALA 4CRGA 3K2UA 1YPHE 2QF3A 4TWWA 1UTNA 4NWLA 2FXRA 5C2ZA 2ZC9H 3ZVBA 2AHME 1K1MA 1L1GA 1GDNA 1YPEH 1GI6A 4ASHA 1KMHB 1BJUA 2CJIA 3AK5A 3MNBA 3C27B 5T6DA 1LQEA 4AB9A 1O3CA 1HIAB 4JYUH 1LQDB 4AC9A 2WUBA 1ARBA 1THRH 3UNRA 2Y5HA 3V12A 2THFB 3SNDA 1O2VA 4ACAA 1SQOA 1S0QA 1LHCH 2D8WA 4DIHH 3TNTA 4U30A 2PKSB 3QK1A 3TH3H 3KCGH 3PRBA 9LPRA 1YGCH 1IQGA 4OS7A 1QIXB 1HCGA 3SN8A 1O33A 2FEQH 1COWD 1GI9B 4X8SH 1C1OA 1FN8A 2FOGA 1YC0A 4ASUD 2VJ1A 1MZAA 3A83A 1BTYA 1DOJA 1RD3B 4I8GA 1W0JD 1TGNA 1MUEB 4VGCB 2PTCE 1O3BA 3E90B 2ZTZA 3GICB 5BRRE 3ENSB 1CU1A 1AZ8A 3E0NB 1GMHF 2C3SA 2OINA 5A2MH 4JZEH 3MWIU 3UQVA 3P6ZB 1QA7A 1THPB 3E1XB 5C0TA 3EA7A 3P95A 3MH5A 1W3CA 2RA3A 4RKJB 4DW2U 1ESTA 1OP8A 3F2HA 5FPYA 1TMUH 3KF2A 5JB8S 1UTLM 1BTPA 3BTHE 3V0XA 1HB0B 4ABAA 2BDIA 5F03A 1HXEH 2VIWA 3OFND 2HVXA 2VNTA 3ATIA 1TRYA 1UVSH 3RXUA 4DJZB 2Z3DA 1CVWH 5GNDA 1MQ6A 4X6NA 1F7ZA 3HGNA 3KYGA 3FO8D 1OWIA 2FI4E 1AE5A 3PWBA 4HI3A 4JZDH 2AGIX 3RXTA 1DX5M 3TVJB 2K8IA 1G2LA 1BMMH 4MNWA 4R8TB 1FQ3A 4FU7A 2VBCA 1FY3A 3BTME 2V3OH 4INKA 1K1LA 3H7TA 2GZ7A 2NWNA 3LGWA 1IOEA 4IGDA 1O3GA 2A4GA 2F4LA 1HYLA 1WOFA 4K1TA 1GVKB 5EXLA 2A4OA 2F3CE 3RLYH 1GDUA 2WPDD 3TLOA 1WYKA 1HDTH 4XFQA 3SU6A 1BHXF 5E2OA 1ZPZA 5HYOA 1OX1A 5EQSA 1FXYA 2G51A 1D6RA 4TT3D 3T5FH 1ELVA 1F0RA 3RC4A 1FAXA 3RXBA 2GDEH 1ACBE 1KDQB 1P9SA 4ABDA 1L2EA 1Q2WA 5HMAA 1SFQB 1VCQA 1NO9H 1DUAA 1ZTJA 3EGKH 3S0NA 3GCTG 1PQ8A 1W14U 3OAAD 1O2XA 1C5WB 4Q7ZA 1DE7H 3H09A 3W95A 3F0OA 3QN7A 1XX9A 2VIPA 2F91A 1K21H 8KME2 5C1UA 1C5ZB 2BY7X 1AQ7A 3FAOA 4IMQA 1NFUA 2Z9JA 1UTJA 3BEFB 1YF4A 4UONA 2AMDA 3GY7A 2WV9A 3MMGA 1P2IA 3PV5A 2D26C 3SJ8A 5FX5A 4MG3A 4FUCA 4INHA 4OM9A 1F0UA 1LHEH 4SGAE 3NZIA 2XCNA 3BG8A 3IITA 4U2WA 5EG4A 4O97A 3S9CA 3ZVEA 4IBLH 2KAIB 4Y10E 1GGDB 1WTHD 4M9FA 4NGAH 1AI8H 1QJ6B 1P11E 2QXJA 3KEEA 5C5NA 1L4ZA 1D3PB 2GKVE 1PJPA 1SGCA 1NS3A 2BVRH 4ZXYH 3UAIC 2EI8A 1DXPA 2P93A 4AFZA 4FVDA 5AFYH 2GDDA 4B75A 2ODYB 1T8LA 3KQDA 9ESTA 1EAXA 2VGCB 3GDSA 4YOGA 2ZTXA 3LJJA 1UK4A 2BXUH 3MI4A 4FU8A 1BCUH 5DP6A 1QA0A 1O3KA 4AB8A 1C1RA 1ZLRA 2QF5A 2HRVA 4GLYA 2BDYA 4GVUA 3KYFA 2ZHFH 1SFIA 1HFDA 1O2IA 2R0LA 4CR5A 2ILNA 3T2NA 1MBQA 2CHAB 3LDXH 4Y76A 1UTMA 2CMYA 3HPTB 4RI0A 5T3HA 5DN6D 1C1WH 4ISNA 1P2KA 2F9BH 2EQNA 4WJG2 3BG4B 1D3QB 5AHGH 5DGJA 1JRTA 1VJAU 2LELA 1ZOMA 1J9CH 2EI7A 3OTPA 2RDEA 3SGQE 1FAKH 1SKYE 1XXDA 2QE7D 1TPPA 3MQKC 1C1QA 2GZ9A 1UHBB 1HAIH 2BZ6H 1BMNH 1V2QT 1NBMD 2PSXA 3LONA 4RKOB 1WXRA 4FXGH 5AVDA 2VVVA 3ZZAA 3A84A 4TYDA 1GG6B 2TPIZ 3ZZDA 1S5SA 3OX7U 2VVCA 1MABB 2BD9A 2ZU2A 2ZP0H 1HAVA 1SVPA 1GHAG 4BXWA 1YYY1 4ABFA 4WH8A 3LGUA 2NU4E 1JWTA 4TWYA 6CHAC 3ODDA 1CT2E 2ALVA 1QR3E 5JBBS 2Q1JA 3O8BA 5FX6A 3ATWA 2R2WU 2BD7A 2ZTYA 2D1JA 3BTKE 2BVSH 2SGFE 3M5MA 2ANKH 2DE9A 3ZVCA 1SHYA 1NN6A 1MAYA 1O2YA 1OS8A 5LGOA 1ELDE 2QA9E 3TJOA 3RXGA 3UR9A 3JZ1B 1O34A 3A87A 1JXPA 2AGGX 4O3TA 3K9XB 2PUQH 3UNSA 2FMJA 4I32A 4IC5A 5DK1A 1X7AC 3PRDA 3SU1A 2Y7ZA 3NUMA 2ZPSA 3KN2A 3RU4E 3EE7A 1CGIE 3KNXA 2XYAA 1AB9C 3SU5A 4F4OC 1F5LA 2F9OA 3RXJA 3I77A 1SLWB 2F9PA 2FOEA 1C9TA 2I6SA 2OC7A 3SJKA 4B2BA 5E0HA 1C1MA 1SBWA 1W12U 5FAHA 4Y8ZA 1ZGVA 1CA0C 1G9IE 2WPIS 1P57B 2GCTB 1EQ9A 1W8BH 3VXFH 3F68H 1YM0A 2P8OC 4A6LA 1TBZH 1O3IA 2RCEA 1DITH 2BD2A 1YPGH 2OQUA 2A2QH 4X1PU 1BUIA 4CHAB 3N7DA 1SGYE 3UTUH 3STIA 1FIZA 3SV8A 4KP0A 1BT7A 2B8OH 3MO3A 3KQ5A 1PQ7A 2A7CA 2GX4A 2H5DA 4NA7A 2BM2A 1ETRH 3LIWA 1ZSKA 3UFAA 2ZZUH 1UW7A 1P01A 3M3SA 1DDJA 2GMTB 1DSUA 1A0JA 2IPQX 1MCVA 1GCTC 1O3PB 1SI5H 3O8RA 1OOKB 1QB6A 1KXBA 1E1QD 3GDUA 1EZUC 5CE1A 4YOJA 4MNYA 3LH3A 4D9RA 1C4U2 1TBRH 2XRCA 4E06H 4FUDA 3A8BA 4ZHMU 4WF8A 4THNH 2QF0A 1CHOG 1P8VC 2XWAA 3ZVAA 1A46H 1A2CH 2V6NA 1Y3VA 1LVYA 1B0FA 2HALA 2ZPRA 2JKHA 1SB1H 3CNRA 1QQ4A 2A0QB 2XXLA 2ZQ2A 4A1TA 3SU4A 1O2ZA 1Y5AT 1SC8U 2QF4A 4YTAA 1HGTH 3BTQE 4MDSA 3UREA 1N6YA 3FP8E 4ABEA 1LPGB 2OXSA 3TIUA 3LGVA 3LKWA 1O2OA 2BOKA 4O3UA 4K1SA 5EXNA 2WPLS 3MYWA 5FCRA 3A85A 4AGJA 3QDZB 4FUGA 4JCNA 3PV4A 1ZPCA 4K2YA 1OWKA 1NZQH 2A5AA 4K8YA 3BN9A 2Z9LA 4RN6A 1GHVH 5A8ZA 2ZPQA 3QTOH 4MQAA 1K1JA 1THSH 1F92A 4H6SB 1DM4B 1H8DH 1AZZA 1C5UA 1OWEA 1GBCA 1GCDA 3WY8A 3ODFA 3E6PH 1RS0A 1UCYE 4CRFA 3SJOA 4K5ZA 4DURA 1AWHB 1HXFH 1J8AA 2A5IA 1QL9A 3KGPA 3FVFB 3O8DA 5EW1H 1YCPH 3UPEA 3DHKH 1LCYA 2XNDD 1TGBA 2V7QD 2C8XB 4A1VA 2G8TA 3SORA 4LXBH 3ZZ4A 5C20A 1TX8A 1BB0B 4GPGA 1VCPA 1SHHB 1C5NH 2PW8H 1MTWA 1O2MA 1QJ1B 2AERH 2ANWA 1N8OC 3RM0H 4AYVB 2OBOA 1TE0A 3RXPA 1ELTA 1A5HA 1QTFA 1L1NA 1YLCA 2BXTH 2QXIA 2VINA 3DFLA 5ESTE 3F2FA 3RXVA 1G36A 3PB1E 3STJA 4QT8C 3K65B 2XNIA 4B6EA 1PPHE 2OLGA 4UDWH 1ABIH 5JBCS 5B6OA 1PFXC 1WAYB 3QUMP 3RXRA 1TIOA 2P3TB 3Q3YA 2Z9IA 3PLKA 3MNCA 3NWUA 2ZU4A 1JIMA 4AORA 2IJOB 3EA8A 1XUKA 2GJGA 4MPWA 1NRSH 1W7XH 3VB3A 2H1UA 1V2UT 3VB4A 4X1RU 5L2ZH 5ABWA 2C8ZB 1GHYH 3EQ0H 1TNIA 3JZ2B 1BQYA 1H9LB 3DSPA 4NA8A 5LPEA 5CHBA 1GBFA 1ZR0A 1DY8A 3S69A 3EAJA 1T8OA 1K1NA 2Y5GA 2A1DB 1LHFH 4FUEA 4K8BA 1ELEE 2Y5FA 5DKMA 1H8IH 3MOCA 1V2RT 1V2LT 1F0TA 1S85A 1SR5C 1QHRB 2ODPA 1VITH 2G00A 3GCHC 1TOMH 2BTCE 2B5TB 2AGEX 1GHAF 5PTPA 1V2OT 2KCOA 1UJ1A 1OSSA 3MH7A 1NU9A 3A80A 1DY9A 1UMAH 4CR9A 2STBE 3TJNA 3LC3A 2P16A 4X2XA 1MZDA 3HKIB 1RIWC 2FX6A 1O3FA 2FWWA 2TRMA 3QZRA 2FODA 1W0YH 3RU4T 1SPJA 4Y8XA 5E0GA 1QL8A 5I46H 4UFGH 2HNTF 3OE7D 2EEKA 5J4QA 4Z6AH 1K2I1 1C5VA 1S81A 3MU5A 3OTJE 3SUFA 3LU9B 2AS9A 1INCA 4I33A 3KL6A 5HM2A 3TGJE 2AMPA 2HPPH 1EATA 3UR6A 5EU8A 3C1KA 1ANBA 4GSOA 1SLUB 2VVUA 3T25A 3MU0A 3OYPA 3M7QA 1V3XA 1W0KD 1FPHH 2IN2A 4X6PA 2VH6A 4MPUA 5AF9H 2FLRH 1EZSC 4JZIA 2NU0E 5EPNA 2CF9H 3F3BA 3U8TH 3T26A 1ABJH 1U6QA 1NFWA 4X1NU 3D65E 3PTNA 5HXFA 2GP9B 1C5MD 2CN0H 4CREA 1EXFA 1OWHA 4YXWD 1SGQE 2CGAA 3ZZ8A 3SYJA 2J38A 1TOCB 4X6MA 1C1SA 3PO1B 3O8CA 4NIXA 2FIRH 3D23A 1B5GH 5IDKA 3U1IB 2G81E 2VH0A 5C3NA 1V2NT 4Y6DA 3F2GA 4TY6A 1O2GH 3E3TA 2QY0B 2W5EA 5JPMH 3D49H 4ABJA 4B2CA 2O8TA 1YPJH 1HV7A 1SGEE 1O3LA 2G52A 2JH6D 4NSVA 4CRBA 1VCWA 4MPXA 3SJIA 1Z6EA 3U9AH 2FDAA 1QRWA 2BB4A 2ZFQH 3I29A 1O5AB 3Q3KA 3BTTE 1EASA 8GCHF 2WPHS 5EIYA 4DG4A 3KQBA 1CHOF 3WW7A 2KM0A 2GV6A 2WYJA 3F9EA 1P02A 1CBWC 2HPQH 4Z0KA 1KLJH 1FLEE 1YKTA 1F2SE 1P09A 3A8CA 5HM9A 1BTZA 4WMFA 5EODA 3P92A 1CSOE 2NU1E 3U98H 1V2TT 2EY4C 2ZA5A 3TGIE 5DPAA 2TIOA 3UUZA 2ZDAH 4O9VA 1TRNA 1AWFH 3BSQA 4TSFD 1LPKB 1IHTH 3QLPH 2B7DH 1O3JA 3DUXH 4GUXA 3TH4H 1GBKA 1C2GA 1J16A 2CK3D 2HNTC 5A09A 3M36A 1AVWA 3AASA 1TNHA 1ZYOA 2ZDNA 3RXCA 1MKXH 1ZHRA 3QO6A 1QNJA 1LKBA 2RDLA 3NCLA 2C8YB 1GBEA 2ZDKA 4HGCA 1B0EA 2ZCKP 1GJ5H 4KKDA 4ZHLU 2V3HH 1MU6B 2BHGA 7LPRA 4ZAEA 3RMNH 3ESTA 1BHXB 3HK3B 1GL0E 2FOMB 3MH6A 1DICA 3NXPA 2PHBA 1FY1A 1Z6JH 1TA6A 2PGBB 3P8OA 2FPZA 3RP2A 3FANA 3FZZA 2ZGJA 3F6UH 1Y3UA 1C2HA 1GI0A 3DD2H 4Y7AA 1BOQA 3RXKA 1O36A 1SGFG 3KIDU 2FOBA 5SGAE 2HVYB 5A8YA 1E38B 4MPVA 1SMFE 2UWOA 1XMNB 1O3HA 1SGTA 6CHAB 2BY6X 4LOYH 2ZU1A 3DT0H 2W7SA 1H8ED 2WPJS 4MTBA 1AFEH 2XC5A 1MKWH 3P8FA 3CS0A 5EJ1A 4RT0A 1E0FD 2PKSC 1C5XB 3TNSA 4KTSA 1UK3A 4YLQH 1KY9A 1O30A 4OS4A 3SV6A 1C1NA 1W7GH 2BDGA 1EB2A 1JIRA 1A61H 4ABBA 4Y71A 2FOCA 1A0HB 4I7YH 1WDIA 3S9AA 4B76A 1AB9B 3ZZ9A 4HG6A 1AN1E 1GI5A 1DS2E 3PMHB 3ZVGA 1TPSA 4BAMB 1QY6A 2FESH 3SV9A 6LPRA 3VFEA 1CA0B 1XKBC 1GHBG 3LC5A 5B6LA 1C2EA 3V3MA 1IQKA 1AY6H 1HNEE 1UTQA 1VR1H 1Y8TA 1FI8A 1XUHA 4X2YA 3UIRA 4JMYA 4O03A 1XUJA 2VIVA 1KLIH 5T6FA 4OS5A 2BQWB 4DIIH 1GMDG 3D62A 1P10A 1WQSA 2P8OB 2J95A 4JK5A 3A89A 1GBMA 1C1PA 2ZFTA 1TQ0B 4X1QU 1QCPA 1CGHA 1TLDA 2BDHA 2ZHDA 1BRAA 5C94A 1TGSZ 1G32B 2FS8A 2ZWLH 2AFQB 3IG6B 4IN1A 3S7KB 1WBGB 4AG2A 2LNCA 2G5NA 2KAIA 1A3EH 4XDEA 1Z1IA 1O2UA 2ZG0H 2Z6BD 1QB1A 1RTLA 1DWBH 3UY9A 4I31A 1KTTB 4NIVA 4K69A 3UWIA 3RXIA 2QXGA 2ZFSA 4TPIZ 4OGYA 2XBVA 2XBWA 1TYNA 2Y81A 1YPLH 2STAE 2KCAA 1T32A 5EPYA 3U28C 1MAXA 1EX3A 1GJ6A 1ZPBA 3VG8A 5JBTA 3TJUA 1MTSA 1YPMH 2G55A 4A1XA 3AAVA 4XD7D 2QC2A 3U8OH 1H1BA 1UTKA 1T31A 3ZZ6A 2YMSB 1PQ5A 2AYWA 2ANYA 4YT7H 1QQUA 3RXFA 1C5LH 1TX7A 1E36B 1DPOA 1W2KH 3UNQA 3BIUH 1HPGA 4FUBA 1D3DB 4WMDA 3VEQB 2M5TA 5EOKA 5K0HA 1O3OA 2CV3A 1VJ9U 3SHCH 2I6QA 1SQTA 2A7HA 2ZU3A 5C5OA 1AFQB 5HGGA 4D9QA 1WUNH 4DT7B 2W7UA 1ARCA 1ZHMA 2WINI 2PGQB 1S6FA 2TGAA 2L74A 3OEED 1PYTD 1EKBB 1P04A 2SGPE 1SGNE 4Y79A 2YMSD 3TU7H 1Y3WA 5LPRA 1OWDA 1E79D 2BX3A 3L6PA 2XCFA 1LHDH 2O8UA 1QJ7B 2ZEBA 2UUYA 1CGJE 1ETTH 2BD5A 2C93B 1CT0E 1ZMJA 1Y5UT 3A81A 3MNXA 1AVXA 4RSPA 5L2YH 1GJBB 5DP8A 1P3CA 4SGBE 1KXFA 3ATLA 1O2RA 2WV4A 1GJ9B 2SGEE 2AIPA 3LGYA 1YCPK 4K3JA 1S82A 3PYHA 3B9FH 1AMHA 2Z9KA 4LZ4B 3IWMA 4I8HA 5K7RA 1K1IA 2FO9A 1BRUP 2VIOA 1A0LA 1P2JA 2FLBH 2P59A 3ZZ7A 2BLQA 1MD8A 2ZFRH 2JJ1D 4YLUA 4D76A 3BEUA 3PMJA 5DG6A 5HIZA 4FOUC 4JYTA 2OC8A 1SLXB 2ODQA 4UEHH 2J97A 1O5DH 4BAKB 5CMXH 1EZXC 1TMTH 5C1YA 1DWDH 1V2MT 3QGNB 2XBYA 5LPFA 1BITA 1B7XB 3M37A 4B73A 2PWXA 5G4BA 3RLWH 2ZI2H 5FCKA 1F0SA 2R9PA 2IPHA 4AZ2B 5JBAS 2JH0D
chains in the Genus database with same CATH topology
1G3DA 1WQVH 3MFJA 1ELCA 3LJOA 1VGCC 4HZHA 1LPZB 2UWLA 4IN2A 4ZMAH 4ZKOU 1T7CA 3ATKA 1SGRE 1SOTA 3GY8A 1TFXA 2CHAC 2ZFFH 3PMBB 5FBEA 2PKAB 2ZQ1A 2OC0A 1QFKH 4R0IA 1T8NA 3HGPA 3M3VA 4X0WU 8GCHG 3BG4C 4ZKSU 3SQEE 2EC9H 4M7GA 1GMCG 1C9PA 3RDZA 2BLWA 1H4WA 2BY9X 1WV7H 4X6OA 3EDXB 3GDVA 2GVFA 1E35B 1HAPH 1OP0A 2BLOA 2QYIA 2FYRA 1AKSB 3M7TA 5CHAB 4MVNA 2Q6FA 2ZCLP 3M5OA 2PSYA 2H6MA 2BMGB 3SU3A 2NU3E 3P8NA 3VGCC 1GBIA 1HUTH 1UTOA 1XUFA 1O3NA 1GG6C 4FUHA 1GVZA 2CF8H 3M5NA 1ANEA 1EPTA 3A7XA 1AD8H 4BNRA 1CE5A 3L3TA 4BOHA 1TBQH 5EGMA 3CENA 2BDCA 4OS2A 4F49A 2WPMS 3TK5A 2A2XH 3TPIZ 4AYYB 5T6GA 1EJNA 3BTFE 3W94A 1Y59T 4ISIH 1QBOA 4CBOA 4UE7H 1BDAA 1GHZA 1C5TA 1J14A 3RUOA 1BJVA 1A1RA 1G3EA 3RXEA 1C5SA 1EP5A 1C2IA 1MBMA 2PV9B 1SGFA 2EA3A 3KHVA 4J1YA 2A5KA 1C2MA 1MU8B 1TNLA 1FDPA 1MMJN 2ZGXH 4GHQA 2XC0A 2GV7A 1JRSA 2C90B 3TK9A 1GBDA 1ZRKA 3M3TA 3A7VA 1ZTLA 2H2ZA 1HBTH 2R0KA 4J2YB 5FPTA 2IOTA 2P94A 3GY4A 1GJDB 1GHBF 1OP2A 2BD3A 1P3EA 1Y3XA 2AIQA 1O0DH 1L0ZA 4YO9A 3MU1A 4WMEA 1VITG 4AOQA 3R3GB 4IS5A 2ZGHA 1O2PA 1Z71A 1GMDF 3GY5A 1EUFA 2OTVA 3SI4H 3VB5A 1GL1A 3V7TA 2GCTC 3I78A 3L33A 4OS6A 2H5CA 2SGQE 3MU4A 3MU8A 3VB6A 5GJ4B 1XM1A 1DT2A 5FHTA 1XUGA 3S9BA 1PPGE 1H9HE 2BQ7B 1CT4E 2AEIH 1QB9A 1DUEA 3OU0A 4YM9A 5GXPA 1ORFA 3AW1A 1NT1A 2AH4X 3KQCA 1G37A 2ZDVH 5E8EH 3M61U 4H42U 5A0CA 3ZYEA 2G4UA 1EPTC 1IQLA 1DLEA 1JBUH 2Y80A 3QX5H 1AE8H 1ZSJA 1UTPA 4JZFH 1LTOA 1GHWH 4FVBA 3SV7A 1SGPE 2XTTB 1PPFE 2DUCA 1K1OA 1CQQA 5DP3A 1SOZA 2K1QA 2A7JA 4TPYA 2JETC 2J94A 1ZJKA 3PWCA 2O8WA 4IMZA 2QXHA 4ZXXH 3SU2A 4ISOA 4YT6H 1KSNA 4BAHB 4E05H 2ZO3H 1HJAC 2P3FH 1O2QA 1BBRH 1NM6A 2LPRA 3MNSA 3E91A 1KTSB 4E7RG 4GHTA 5DP4A 4CRDA 1YPKH 2H9TH 2J34A 2BDAA 5ETXA 1PPCE 3TJVA 4MLFB 2D2DA 3CS7A 1BZXE 2ZGBH 1D6WA 4DGJA 1AHTH 1O3DA 1UCYH 1T4VH 2F83A 2GTBA 1WCZA 2Z3EA 2ZDMA 3OY6U 3ZZCA 4FU9A 1NFYA 3F9HA 1QGFA 1FNIA 2BDBA 4UFDH 3K6ZA 1BTWA 1O5CB 1L4DA 1MTNC 1HLTH 4ISLA 1MKXK 4K60A 1AGJA 1V2KT 1Q31A 1NESE 3Q76A 3ZV9A 5J4SA 1PPBH 3SW2B 2W26A 1D9IA 1CHGA 2TBSA 3UOPA 4AG1A 1EOLA 3M5LA 3RM2H 4DY7B 4NIYA 4BAOB 1NY22 2ZKSA 3F9GA 4WWYA 1RJXB 4KTUA 3SUDA 4UFEH 4ZH8A 4AN7A 1E37B 2HOBA 4D8NA 5GDSH 2F9NA 3FP7E 2VWOA 1HAXB 4ISHH 1QRZA 1OYTH 3SUEA 3BTGE 3LH1A 1IQEA 1A5IA 1N6XA 2QCYA 1O3MA 1WSSH 3PTBA 1A4WH 5TJXA 3U1JB 1OKXA 4Y7BA 2EI6A 3RXAA 1V6DA 3M35A 2RA0A 4B1TA 4MNVA 6GCHG 1LO6A 1YLDA 1A7SA 1TB6H 2WV5A 1TMBH 1S0RA 3URCA 5ESBA 1Z1JA 3MO6A 1UVUH 7GCHG 4WY3A 1GI3A 4Q7XA 1MKWK 5F8TA 4Y0YE 3SNBA 3MHWU 3GISB 3E0PB 4WVPE 1CA8B 1LKAA 4X2VA 1G3BA 3FFGA 3H5CB 1FJSA 1D4PB 2ZFPH 2YNBA 3ZVFA 2BD4A 1XKAC 1IHSH 5GPIB 4NCYA 1FMGA 3RU4D 4ZKRU 3LPRA 1O5GH 2SNWA 3T29A 1UVTH 4ZROA 2GCHG 1GMCF 1HIAA 1GBTA 1K28D 1P12E 1F5KU 2FS9A 1RRKA 2JH5D 1G2MA 2VWNA 3PM3A 3SUGA 1ZSLA 3SOSA 4NA9H 1GI8B 3TK6A 2Y82A 5A0BA 3FP6E 1O5BB 1GVLA 2BVXH 3MO9A 2OP9A 1IQIA 3OSYA 4UD9H 1O38A 3DFJA 1SQAA 4NWKA 1IQMA 3QTVH 1TNKA 1UO6A 1LDTT 2CXVA 1T8MA 3BTEE 3ZVDA 3GY3A 3PMAB 1DSTA 1O3EA 2BLVA 3RXQA 2QAAA 1N1LA 3A8AA 3DA9B 4DOQA 1QURH 1W11U 1C4V2 5F6MA 1TABE 1Z8IB 1C2JA 1HAOH 3RXMA 1C2LA 3NKKA 1F5RA 2FOHA 3BTDE 3LT3A 1W0ZU 1XUIA 1DANH 1ID5H 1O5EH 4Y8YA 1BRBE 1KXDA 3A7TA 2Z9GA 1ETSH 2SGAA 1WTGH 4A92A 4BANB 1O2HA 4H4FA 1SLVB 2J92A 1TRMA 4NG9H 5H4IB 6ESTA 5GCHG 1QBVH 1MQ5A 1MTVA 3GY6A 4X1SU 2UWPA 2VWLA 2NU2E 1Z8RA 1GPZA 5E2PA 5LH8A 1RXPA 4XOJA 2FP7B 1QRXA 1FY8E 3SI3H 2FX4A 1QL7A 4X2WA 5JB9S 2ZIQH 1YBWA 2GZ8A 5EQQA 1ZMLA 4AFSA 1PPEE 1BRCE 1GBLA 4B2AA 1C5OH 4D7GA 2BQ6B 2PR3A 1VITF 1KIGH 3FZDA 5FPSA 2OBQA 3LGIA 3NK8A 4FUFA 1OWJA 3NPSA 4GCHG 1TA2A 4BTTB 1DLKB 1NFXA 1TPAE 3PO1C 4BTIB 4OGXA 2TGDA 3F1SB 1W10U 3R0FA 5I25A 1FUJA 2ULLA 2FYQA 1FONA 4KTCA 2VIQA 2H9HA 4DCDA 3ZZ5A 1TGCA 1FY4A 1NROH 3RMMH 2AMQA 4WXIA 1ZRBA 3QWCH 3MH4A 4NFEA 1AU8A 1KDQA 2TGTA 5TCCA 3GY2A 3MTYA 1HAZB 4JK6A 2J9NA 2VU8E 1YCPM 4B71A 5IYTA 1O3AA 3KQEA 4BTUB 5DO4H 2BOHB 4VGCC 2BY5X 2Q6GA 2RG3A 2GT8A 2GD4B 3BEIB 3RXOA 1VZQH 3TH2H 4KELA 4ZHAA 1V2PT 1ZMNA 3S7HB 4I8LA 4H6TA 1LVOA 2BZAA 1Z8JB 5AFZH 3VPKA 1OPHB 1UVOA 1XVMA 3AW0A 1E34B 5C1XA 4A7IB 3LGTA 1YP9A 3F9FA 3RXHA 1ZTKA 2ESTE 1C2KA 2B0FA 4X8TH 1O2SA 5DP7A 2PLXA 1C2DA 2V0BA 3SHAH 1FN6A 4BAQB 3B23B 2XBXA 4K1EA 1GI1A 1VGCB 4INLA 5FXLA 2FM2A 2Z94A 1HAVB 1V2ST 3ATMA 1GCTB 1XXFA 1P2QA 2BD8A 1D3TB 1NRNH 1LMWB 4TY7A 1KXEA 3Q77A 1K1PA 1GBHA 1O2LA 1QBNA 2OUAA 2ZGCA 3A88A 1C1UH 1J15A 4U32A 1ZHPA 1AUTC 1IAUA 3AAUA 7ESTE 2HNTE 4AFUA 2TGPZ 1GI7B 2OC1A 2O8MA 2SGDE 8LPRA 3HK6B 1NTPA 1TPOA 1GJCB 1C5QA 1GI4A 1Y3YA 4OS1A 1EAWA 4GAWA 3VGCB 2F9UA 1GWAA 4X8VH 3P70B 2PTNA 1KXCA 6GCHF 1P2MA 4CRCA 1NRRH 1EOJA 3TGKE 1BIOA 1W13U 1TAWA 3A7WA 2W3KA 4YOIA 1PPZA 1O37A 4Q2KA 4DVAU 7GCHF 2PFEA 2Y7XA 1TONA 1HAYB 1KYNA 2B9LA 4KGAA 5L6NH 1UHBA 4AX9H 3BV9B 2Z7FE 2WUCA 1TNGA 4YESB 5EXMA 4NZQA 3B8JA 1C4Y2 5A8XA 1SG8B 1Z7KA 1Z8GA 8ESTE 2YNAA 1ANDA 3RC5A 3VB7A 4ZKNU 2ZCHP 2J4IA 4XBDA 2SFAA 1GJ8B 1O35A 1UVPA 1P03A 2P3UB 1UK2A 2GCHF 4ABHA 4HFPB 3A7YA 3A86A 4B74A 2QIQA 1O2NA 1SGDE 3SGAE 1GGDC 1O39A 2UUJB 2QV1A 2XW9A 1ANCA 1RTFB 2SNVA 2V35A 2F9VA 1GJ4H 3T28A 1ESAA 3GCNA 4AGKA 2FTLE 1SGIB 1HJ9A 3N7OA 1EAIA 2G4TA 3RXSA 1N8OB 1EP6A 2XC4A 2DE8A 2VGCC 3GOVB 4D7FA 3ZYDA 1O2KA 3SBKA 1EB1H 1MTUA 1OXGA 3RXLA 1A3BH 2ASUB 2ZHEH 3PROA 1O2WA 1GBAA 3RMOH 2FOFA 2A32A 3ITIA 2FZZA 3HATH 1JOUB 5L30H 2G5VA 3H7OA 2ZHWH 1ELAA 1GJAB 3BIVH 1GBJA 4XSKU 1ELBA 1GJ7B 2HLCA 1EPTB 1FY5A 1PQAA 4JYVH 1BMAA 2A45B 4ZUHA 5GCHF 4ABGA 1DFPA 4ESTE 2A4QA 3V13A 2QGRA 5GIBA 1RGQA 3ZZ3A 5TCAA 2ZF0H 3GCOA 2JETB 3UWJH 2OQ5A 5DJ7A 2A4RA 1GMHG 1XVOA 3QGJA 2UUFB 1HJAB 1O2JA 1BBRK 3E16B 1PYTC 4FUJA 2ZNKH 3GCHB 3EE0B 1IQFA 5GWZA 4BXSA 3E8LA 5C67A 1OYQA 1GDQA 2O9QA 3AVZA 4MNXA 1NPMA 2WYGA 5E0JA 1O31A 1WU1A 1C2FA 2FOAA 3SJ9A 1Q3XA 1UCYK 2VB0A 4GCHF 1RIWB 5EQRA 4HTCH 5JDUB 3GCTF 2XWBI 1BTHH 2PKAA 2ZU5A 1AFQC 4CH2B 1BTUA 3SV2H 5FBIA 1YPHC 4NIWA 2R3YA 1M9UA 1MH0A 3P8GA 3U69H 3T62A 4A5TS 2BYAX 1G3CA 1MTNB 1AIXH 3SNCA 1L1JA 3ZZBA 1ELGA 7KMEH 3BTWE 4ABIA 1BBRE 4Y0ZE 5BPEA 3SU0A 2ZHQH 1RFNA 2PUXB 4X8UH 4LZ1H 1C1VH 3P17H 1GHXH 1AKSA 2BX4A 3Q00A 3TITA 2W3IA 3A8DA 3Q3XA 1NRQH 1IQNA 1ZZZA 2C8WB 4NSYA 4WXVA 2ZECA 1O32A 1A5GH 3SQHE 1C1TA 1CO7E 3SNEA 3SO3A 2WPKS 1FZZA 1HAHH 1S6HA 1IQHA 1EAUA 1KXAA 2C4FH 4WH6A 3RC6A 1TX6A 3GYMA 4Q7YA 5EW2H 2J2UA 1HJ8A 2P95A 1DWCH 3SNAA 2Z3CA 1K22H 1KLTA 3VXEH 2YOLA 2FTMA 1ZJDA 3A7ZA 1K9OE 1P0SH 1AVGH 5JYIA 1Y5BT 4FUIA 1P2OA 2BY8X 2O8LA 2UUKB 4CH8B 1TGTA 3EA9A 3RMLH 1J17T 4CHAC 1GBBA 1BTXA 2OCVB 1NC6A 5F8XA 3LOXA 3PLBA 5F8ZA 1TNJA 2H9EH 3ELAH 3PLPA 2GT7A 1T4UH 2FI5E 4XBCA 1FIWA 2GMTC 4IC6A 3G01A 1EZQA 1V2VT 1G30B 1S84A 4Q80A 4XE4A 1GI2A 3A82A 3M7UA 1EJMA 1S83A 1TWXB 4IW4E 2QN5T 4LK4A 1LVBA 1CBWB 3SGBE 1TQ7B 1C5RA 4NFFA 1H9IE 4NZLA 2VWMA 1C5PA 3UOUA 3URDA 4U01A 4E7NA 3ZV8A 3U8RH 1FV9A 2ANMH 1ESBA 1HAGE 4CRAA 1ELFA 1V2JT 5CHAC 1LHGH 2HWLB 2Y6TA 3EYDA 4AFQA 3UQOA 4PROA 1MD7A 4UFFH 1SSXA 1P9UA 1FPCH 1DVAH 2ZDLA 3RXDA 1MCTA 4I8JA 4Y11E 1AUJA 1O5FH 3GYLB 1V2WT 1P2NA 3HKJB 3K6YA 1EJAA 3SZNA 4JZ1A 1HRTH 1LVMA 1NU7B 1NRPH 2R3UA 3OY5U 1SL3A 1C5YB 3CP7A 4XBBA 2ALPA 3BF6H 4I8KA 1AO5A 5DP5A 1P06A 1RTKA 1P05A 2Q6DA 4CBNA 1IQJA 1BMLA 2OD3B 4YZUA 2FI3E 1ZGIA 2HGTH 1BA8B 5A0AE 1O2TA 3QZQA 1DXWA 2A31A 3T27A 1DWEH 1JMOH 2GGVB 2VIDA 5DP9A 2R2MB 1TALA 4CRGA 3K2UA 1YPHE 2QF3A 4TWWA 1UTNA 4NWLA 2FXRA 5C2ZA 2ZC9H 3ZVBA 1K1MA 1L1GA 1GDNA 1YPEH 1GI6A 4ASHA 1BJUA 2CJIA 3MNBA 3C27B 5T6DA 1LQEA 4AB9A 1O3CA 1HIAB 4JYUH 1LQDB 2WUBA 1ARBA 1THRH 3UNRA 2Y5HA 3V12A 2THFB 3SNDA 1O2VA 1SQOA 1S0QA 1LHCH 2D8WA 4DIHH 3TNTA 4U30A 2PKSB 3QK1A 3TH3H 3KCGH 9LPRA 1YGCH 1IQGA 4OS7A 1QIXB 1HCGA 3SN8A 1O33A 2FEQH 1GI9B 4X8SH 1C1OA 1FN8A 2FOGA 1YC0A 2VJ1A 1MZAA 3A83A 1BTYA 1DOJA 1RD3B 4I8GA 1TGNA 1MUEB 4VGCB 2PTCE 1O3BA 3E90B 2ZTZA 3GICB 5BRRE 3ENSB 1CU1A 1AZ8A 3E0NB 1GMHF 2C3SA 2OINA 5A2MH 4JZEH 3MWIU 3UQVA 3P6ZB 1QA7A 1THPB 3E1XB 3EA7A 3P95A 3MH5A 1W3CA 2RA3A 4RKJB 4DW2U 1ESTA