4OS5A

Crystal structure of urokinase-type plasminogen activator (upa) complexed with bicyclic peptide uk603 (bicyclic 2)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dithiol amino acids can structurally shape and enhance the ligand-binding properties of polypeptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
total genus 56
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os5A01
3SW2B 2PTCE 2GDDA 1O2RA 1C4U2 1ZOMA 2QYIA 5AF9H 5ESBA 1O38A 1NM6A 3MU4A 3SJ8A 1IQGA 1AE5A 5E0JA 1SGYE 1P2QA 3AW0A 1RIWB 1ETTH 1CT4E 1D4PB 3M7QA 2LPRA 4U30A 5CE1A 1C5MD 1ZMJA 3RXTA 1ARCA 1AZ8A 2B8OH 3MFJA 1C5RA 3SQHE 3LJJA 5JBBS 1XUIA 1GJAB 2YNAA 4UONA 1MBQA 2FWWA 3M37A 1UJ1A 1WQSA 1SFIA 1BJVA 4HZHA 1P2OA 4K3JA 1OWIA 2ZHFH 1FDPA 2ZG0H 3F9HA 3ZZ4A 4OS6A 2KAIA 3P8GA 3PB1E 3LKWA 1BTYA 3F1SB 2AGGX 1KDQB 3NZIA 2A5IA 8ESTE 1BRUP 4BXWA 1TBQH 1TX7A 1SVPA 4TWWA 1TALA 4ZKOU 4B2AA 1P2IA 1ID5H 3C27B 2XBYA 1TPSA 3V0XA 1Y5UT 4AOQA 3T2NA 2CJIA 1GHAG 1QJ6B 2GKVE 1QL8A 2AYWA 2FOFA 2HWLB 3IITA 2NU0E 2BD8A 3TJUA 1OKXA 3LDXH 1PYTC 4YLQH 2VWMA 4X8UH 1W0ZU 3TNTA 1GCTB 3SJKA 1XUJA 1W7XH 4WJG2 3T62A 2G5NA 3W95A 4INKA 4D8NA 1GG6C 2XBVA 1XX9A 1GBMA 1TGSZ 5F8TA 1HUTH 3T28A 3BN9A 1LMWB 1QBOA 2W3KA 1OP2A 2QIQA 2ZGXH 3L3TA 2QY0B 3Q76A 5BRRE 5HXFA 2ZHDA 4M7GA 2NU2E 1C5WB 3LGVA 2XC5A 1XUGA 3Q3XA 2HALA 3RC4A 4XBBA 1YPEH 2VWOA 2V3HH 3SNBA 3BTQE 1EZXC 4FUIA 5DG6A 1O3HA 1O3DA 1ZSJA 4K1EA 1G2LA 1SI5H 4YOJA 3RXMA 2R0LA 1PFXC 4WMEA 3ATLA 2FDAA 3UREA 1GI7B 3V13A 3GDVA 3ZV8A 1BHXB 4MPVA 1HDTH 2FI4E 2SGQE 4ABGA 2BY5X 5F8ZA 1GHBF 3ZZDA 5F6MA 2HRVA 2R2MB 3LGYA 3DD2H 3ZVEA 5T6DA 2O8MA 1IAUA 5IYTA 3DA9B 5DGJA 3PMJA 1IQEA 4MPUA 2HNTF 1C5LH 1TRYA 1O3AA 1K1IA 1C9PA 1KDQA 1KY9A 4FU7A 1Z8IB 3ZYDA 1U6QA 5EQRA 1PPCE 2YNBA 1QY6A 2FTMA 1AD8H 1ELDE 1ZPCA 2C93B 2BLWA 2O8UA 2SGPE 4D7GA 2H2ZA 2G55A 3M61U 1DITH 1G37A 1JOUB 1P2KA 4WVPE 3UR9A 2HGTH 5L2ZH 1K22H 4D9RA 3UFAA 4THNH 4BXSA 1WCZA 3F68H 1OP0A 3RU4E 1WSSH 1RTKA 2AGEX 1FN6A 1MBMA 2ZFRH 3PV4A 3SU2A 1BTWA 1J14A 1QB1A 2DE9A 2D8WA 4UEHH 1ZYOA 1NPMA 1PJPA 4MDSA 3V3MA 2QN5T 1Z8GA 2VJ1A 3SN8A 4MNYA 1CO7E 2ESTE 5EPYA 4NCYA 4DVAU 1VZQH 4A7IB 1YPHC 2ZDLA 2QGRA 2C8ZB 1AGJA 3RM0H 1ZTLA 2A7HA 2ANMH 2FESH 2ZWLH 3KHVA 3EGKH 1OOKB 3SU1A 3ZV9A 7ESTE 2OC1A 3BIUH 1OWKA 5FBIA 7GCHF 3PLKA 2OC0A 1HYLA 2RG3A 3KN2A 3M3TA 1ELEE 3BEFB 3P8OA 1NS3A 5A0AE 1GBHA 1O2GH 4FUHA 1NFXA 1TX6A 2CXVA 2W5EA 2IOTA 4MQAA 1BTUA 4AZ2B 3A82A 1HLTH 3PM3A 3SNCA 4CRDA 3BF6H 1CA0C 4VGCB 3MO6A 5FX5A 3RXFA 1GMCF 2J2UA 2ZPSA 1T8OA 2W7SA 1P11E 1MTUA 1YC0A 4YZUA 3S69A 1SGTA 1FAXA 1NRQH 1UTMA 4Z0KA 1C5ZB 4WMFA 4ABEA 1P03A 1FIZA 4BNRA 1P09A 1C5VA 2CF9H 3RMNH 2AFQB 4DJZB 4KTSA 3JZ2B 4DGJA 1T4UH 4X8SH 1O5FH 3GISB 2VH6A 3AVZA 3RXGA 2VIDA 4TY7A 4ISOA 3A85A 1QR3E 2BD9A 1LPKB 1DLEA 1OYQA 3E6PH 1EAIA 1C1UH 2GZ8A 4KELA 1DXWA 1TGNA 1CGIE 3FP8E 3BG4B 2FX6A 3R3GB 4CRAA 4YOIA 1S6FA 3OU0A 2EI8A 1AN1E 1G30B 1RD3B 1TLDA 1O2SA 2Z94A 2R3YA 1TABE 1HAVB 5TCAA 4RKJB 2ZFTA 2UUFB 1GWAA 1SQAA 1GGDB 1KXAA 3DHKH 1Z6JH 1O3JA 4X2XA 2GZ7A 1XVOA 2PSXA 2NU1E 1TNIA 4NZLA 1HGTH 2BOHB 1QURH 1SGQE 5EG4A 1NFWA 1NC6A 2PUQH 3BTFE 2ZU1A 4XBDA 1C1NA 1BJUA 4HTCH 6LPRA 1C2HA 4BAHB 1PPHE 3KQEA 1ELCA 1V2KT 3BTDE 5L30H 1TAWA 3RMOH 2W26A 1E35B 1YCPK 4NIYA 4I8GA 3NPSA 5DK1A 1NRRH 1MCVA 4X2YA 4ABIA 2V3OH 5K0HA 2PTNA 1Y5AT 3GYMA 1AUTC 2Y5FA 2JH0D 4Y0ZE 1TX8A 1ZHPA 4NSYA 2XC4A 3RDZA 1F0RA 2FOGA 3RC5A 1C2LA 3TK5A 1P8VC 3KQBA 1DXPA 2OINA 2RCEA 3U8RH 2XYAA 2TIOA 2ZDAH 2F9OA 1P04A 4ZMAH 3TNSA 4AFUA 1FIWA 1S82A 3ODDA 3UWJH 5CHAC 4I8JA 2A7CA 3OY6U 1SPJA 3URCA 1E37B 1V2PT 1DUEA 1OWEA 2TGPZ 2ZHWH 1ELGA 4UFDH 1ARBA 1B7XB 1HIAB 1KTTB 1O3CA 4IN2A 1SB1H 1G36A 2D26C 3ZZ9A 1DT2A 5J4SA 3LOXA 2BDGA 1WTGH 4ISIH 1MKXK 1TGBA 1VCPA 3MNSA 4ABJA 4AG2A 2CGAA 2THFB 4Y11E 2R0KA 3PO1B 1LPGB 4INLA 1HCGA 6GCHG 2PUXB 1HXEH 1F2SE 4A92A 1DY9A 1TA2A 2FI3E 1C5QA 1O3MA 1O2XA 1ANCA 1IQHA 3VB6A 1YCPM 4ZXYH 4AB8A 4AB9A 1IQIA 1FY4A 1TPAE 5F8XA 2RDLA 1O5AB 2BDIA 4OS4A 1EPTB 2XW9A 1SMFE 5DP7A 3ESTA 1MH0A 1Z1JA 3A7ZA 4O3UA 5GPIB 3VPKA 3GCHB 1ZLRA 1Q31A 2VIQA 2ANYA 2ZDMA 3AASA 1GDNA 1PQ8A 3ZZCA 1A46H 2J92A 1GI6A 1GI4A 1YPHE 1N8OB 1EOLA 2G00A 2OC8A 2BYAX 4ESTE 4KTCA 1D3TB 3SNDA 4D9QA 4X1NU 4DCDA 1AVGH 1BITA 3T26A 1IQLA 1V6DA 2AEIH 1GI2A 3SGBE 1A61H 1XUFA 1L4ZA 1WTHD 5EGMA 4BTIB 1UHBA 2BD5A 1RJXB 3UNRA 1BMMH 2C90B 3MNXA 3A87A 1GMHG 4ZKSU 1C1RA 1BT7A 1N6XA 2OTVA 3GCHC 1PPZA 1QIXB 3LGUA 2ZTXA 1Z8RA 3I77A 1PQ7A 5FAHA 1LVOA 2GTBA 1ZZZA 4ZHLU 4CHAB 3FZDA 1DSUA 3VB4A 2Z9GA 3GCTF 1NTPA 2AIPA 2FLRH 4X1SU 1A0LA 1TQ0B 1NRNH 1HAPH 1YP9A 2QF3A 1C1OA 1TB6H 4MNXA 1PQ5A 3NUMA 2FTLE 2IJOB 2HPPH 2VVVA 2EA3A 2EC9H 1DWBH 2ZO3H 3A83A 3D65E 2BLOA 1P57B 2CN0H 2GMTC 1A5HA 4NSVA 4FU8A 2ZCLP 4ISHH 3E90B 3TK9A 1P12E 1SLUB 2V6NA 3SORA 5HM2A 1GI5A 3BV9B 3SQEE 1CHOG 4NG9H 4Q7YA 3SUGA 3T29A 3GY5A 4JYVH 1L0ZA 2I6SA 1BIOA 1YPJH 4WF8A 2A5KA 2G81E 1AB9B 1K1LA 3FP6E 2FS9A 1BQYA 4U32A 3EQ0H 1O30A 1UK4A 2XC0A 1JWTA 2VIWA 1O32A 2F91A 2TGTA 1O0DH 4UDWH 5T3HA 2FODA 1MZDA 2HLCA 1FI8A 2UWLA 3HK3B 1EP5A 2ZPQA 4IGDA 1C5OH 1Y3UA 1Y59T 4NFEA 1VITG 4X1PU 3BTGE 4I7YH 4DY7B 2XCNA 1VGCC 4AFSA 2W3IA 4Y79A 1LHCH 2F3CE 1GJBB 1YLDA 5EXNA 4K1TA 4DIHH 1VITH 2PR3A 3MNCA 3HPTB 4Y76A 4X0WU 1HFDA 3BG8A 7LPRA 1YKTA 1PQAA 1ZHMA 4CBOA 4A6LA 1YPKH 3LGWA 1QFKH 3A89A 4TYDA 2ANKH 1YPMH 1DWCH 1DFPA 1O33A 1ACBE 1MD8A 4TWYA 4ZKNU 2OQUA 5I25A 2LNCA 2GP9B 1A1RA 3DFLA 1EX3A 1LCYA 6ESTA 1DVAH 2SGFE 1AKSB 3A7YA 3RXVA 1P01A 2A4RA 2UWPA 3A8AA 2ZI2H 2Y5HA 4Q7ZA 1BTZA 1FPHH 1W13U 2BQ6B 2PSYA 1WU1A 2PV9B 4ZKRU 1AKSA 1KLIH 3BG4C 1A4WH 1CHGA 3LGIA 2GX4A 2PKAB 2Z3EA 1O2ZA 3TU7H 4NWLA 3TGKE 1O2IA 3H5CB 1GBBA 2CV3A 1HAZB 4AX9H 1K1OA 1EPTA 2BDYA 2G4TA 1UVUH 2FIRH 3QZRA 4X1RU 5H4IB 2Y7ZA 1K9OE 3NCLA 5DPAA 1AO5A 1OYTH 2A4GA 3RU4D 4WMDA 1D3DB 1ETRH 1FPCH 3QGNB 1KXBA 4J1YA 2F9NA 3SV2H 1O5EH 1HAGE 1QBNA 4YESB 3T25A 3S7HB 1SBWA 1QNJA 1CBWC 2WUBA 2GT7A 1MKWH 1HBTH 4XDEA 3MU0A 4VGCC 2ZIQH 3TJOA 1P9SA 5DP4A 3TGIE 1FUJA 2K1QA 1TOCB 3LH1A 3UNSA 4FUDA 2BX4A 2VIPA 4B74A 1C5NH 3D62A 1O2WA 1ZPZA 3URDA 1C1WH 1NFYA 1J9CH 1WQVH 4FVBA 1XMNB 2G5VA 4NIVA 3QX5H 1O3EA 4WXIA 1GVLA 4WH8A 3LONA 1ELBA 2VGCC 3IG6B 1O2KA 3GCNA 2GCHG 3EA9A 4AYVB 4HI3A 1GL1A 3HATH 1E36B 1XUKA 4IMZA 1XKBC 1MAXA 1O2MA 4X6OA 2ZDKA 1EAWA 2FX4A 1SQOA 1GHBG 1ABJH 5JBTA 2BD2A 1LQDB 1SQTA 2ALVA 2STBE 4E7NA 1EJNA 1MTSA 1J8AA 1H8IH 1GMHF 3Q77A 2FOMB 4FU9A 4GUXA 1K28D 3EDXB 1FAKH 3S9AA 2QXGA 1GHWH 4IC6A 2BVRH 3SJ9A 1B0FA 3QK1A 3A7VA 2P8OC 1C5PA 3OX7U 1EAXA 2R9PA 4B2CA 1TIOA 1BOQA 3SNEA 3ATMA 1DICA 1TONA 4JYTA 1S6HA 3ATWA 1GJ8B 1ANBA 1V2MT 3W94A 1AWHB 1UHBB 1UK2A 1SGEE 1EPTC 2J9NA 3SV6A 1JXPA 1NN6A 1ANDA 1UTOA 1YF4A 5IDKA 1FLEE 1O2YA 2BHGA 3SU0A 2ZGHA 1WAYB 2P16A 2H6MA 2VNTA 1P3CA 1V2ST 1ESTA 1PPBH 2HVXA 4FUEA 3PYHA 1TRNA 1PPEE 1C2KA 1ZRKA 3LJOA 4HGCA 3DT0H 2Y7XA 5E0GA 2JH6D 1GHVH 1UO6A 2D1JA 2VWNA 1O3BA 3O8BA 1EQ9A 3ZVDA 1H9HE 1BB0B 1MKWK 4UFFH 1SG8B 1C1SA 1EAUA 1ANEA 4LK4A 2ZTYA 4E05H 5JDUB 4Q2KA 4I32A 1A2CH 1O3IA 3QDZB 1BMNH 5HGGA 3T27A 1SGNE 1EASA 2WPKS 5EQSA 1OWHA 2VU8E 3KCGH 2F9BH 3UWIA 1CGJE 1J17T 3RXQA 3SV7A 3HKJB 2BDAA 1T31A 3M7UA 1ABIH 1HV7A 1O3LA 2PHBA 1TA6A 1QHRB 1VCWA 1H8DH 1SLVB 2A31A 7GCHG 3RU4T 1L1NA 1C5YB 1Z8JB 2BLVA 3MYWA 3LT3A 4NFFA 2FOBA 4KP0A 3WY8A 5A8YA 4CHAC 1CT0E 1JIMA 1FZZA 1WOFA 1S81A 2NU3E 1AFQB 2QXJA 4SGAE 4FUBA 2ILNA 3OYPA 1MKXH 4DOQA 1IQFA 2FYRA 1RGQA 3MO3A 1CQQA 1HAYB 1MZAA 2ODQA 1ZMLA 1O3PB 3SNAA 4ZUHA 1SGPE 2BZ6H 3ZVCA 1CA0B 3LC5A 1ZR0A 3N7OA 1MTNC 4HFPB 1JRSA 1EJAA 5JBAS 1GMCG 1S84A 3UTUH 2QXIA 5I46H 2PWXA 1SOZA 4TPIZ 5C1YA 5A8XA 1VJAU 2A7JA 3BTWE 2Y81A 1YCPH 9ESTA 5SGAE 2GGVB 1P2JA 1C4Y2 1N8OC 1XVMA 1YBWA 1D9IA 3M5NA 1C2GA 2GDEH 1QGFA 2DE8A 1GJ5H 1AB9C 3ZZBA 1DY8A 1MTVA 3RXHA 1UCYE 3BTEE 1O34A 3OSYA 1BMAA 1F5KU 1YLCA 1ESBA 3GY2A 1BRAA 2PKSB 5FPTA 1BTPA 1H9IE 4SGBE 4CREA 2BD7A 1B5GH 3U1JB 2GD4B 3BEUA 1C1VH 4ZROA 4D7FA 4GHTA 3RLYH 1LHGH 1ZHRA 2SGAA 2O8LA 2Z9KA 3UR6A 3M36A 2DUCA 2A2XH 2BD3A 4JZ1A 4GAWA 2ZGBH 2VVCA 2ZDNA 4OS7A 3HKIB 3ITIA 3KNXA 1W10U 1UVPA 2FP7B 4LZ1H 1O5DH 1FJSA 1TNHA 2EI6A 1D3QB 2XBWA 3MHWU 5AVDA 1GBTA 3VB3A 2GCTC 4ABBA 2YOLA 4O9VA 3B23B 1TBZH 4RN6A 3GDSA 3VB7A 2XWBI 1C2DA 2BB4A 2A2QH 1T8MA 2WPLS 3GICB 2TRMA 1S0QA 1BZXE 1LVMA 2BVSH 4BANB 1Q3XA 2Y5GA 3PWBA 2ZKSA 2Z7FE 4XBCA 3ZVBA 1BRBE 2HOBA 4GPGA 1D3PB 3RMLH 5DP6A 3SJIA 3CS0A 5EW1H 1A0JA 5ESTE 2F9PA 2GVFA 5EPNA 4X6MA 2UUJB 3Q3YA 5C2ZA 3SI4H 4PROA 1F5LA 3H7TA 1SHYA 5DP5A 1GBIA 1P3EA 2WV4A 4GVUA 4Z6AH 2C4FH 3QZQA 2Q1JA 2BZAA 4AGKA 1BBRK 1QJ7B 4K2YA 3E3TA 3E0NB 1G3DA 1FY8E 5HYOA 2H9EH 3MH7A 5B6OA 2P95A 4ZHAA 1DANH 1EZSC 2P3TB 3Q00A 3CP7A 3EE0B 1GBAA 4FUGA 2STAE 1ZGIA 2BX3A 3GY3A 1AUJA 1LPZB 5LPFA 4F4OC 4JYUH 1DWEH 1GBFA 5PTPA 1A3BH 4BAKB 1OP8A 1NROH 1HAIH 2C8YB 1YGCH 1LO6A 4J2YB 4NA9H 3B9FH 3ATIA 1UTKA 3E0PB 4NZQA 4Y8ZA 3EYDA 4BAOB 1UK3A 4GSOA 1BBRE 2ZTZA 3MO9A 1AFEH 1LVBA 4RSPA 1TOMH 1A5GH 3A8DA 3K6ZA 3LIWA 1UTJA 1F0SA 1TGCA 1FONA 1T7CA 2ZQ2A 4B2BA 3K9XB 1EUFA 1TRMA 1H4WA 2Q6GA 2A1DB 3H7OA 2Z3CA 5GCHG 1GBLA 1SHHB 2R2WU 1NZQH 2ZFPH 3F9FA 4DW2U 2ZECA 1SLWB 1TGTA 1AHTH 3STJA 4H4FA 4RKOB 3P8NA 1X7AC 2AS9A 4UD9H 1V2OT 2GV7A 2ZGJA 3GDUA 4WH6A 1WBGB 2O9QA 4YT7H 3NWUA 5HMAA 1CA8B 5A2MH 3UQVA 1ZTJA 1QRZA 1FNIA 2CF8H 2BXTH 1O5CB 2IN2A 4BOHA 1HAVA 1C1PA 1E0FD 3STIA 1GI1A 1L1JA 1BBRH 4Y6DA 4AORA 1NRPH 1O2NA 1GI8B 3TITA 4R8TB 3K6YA 2TGAA 3KQDA 3GCTG 3A7WA 3UNQA 1DUAA 4E7RG 1AI8H 1V3XA 1YM0A 3OY5U 5DKMA 5C20A 1G32B 4CRFA 2Z9JA 1O2QA 3RXPA 1MQ5A 4ABHA 4YLUA 5FHTA 2OXSA 1GGDC 2FOAA 1ZJKA 3SHAH 1TPOA 6CHAB 3BTKE 2BMGB 2BY9X 5J4QA 1BHXF 3CS7A 3FANA 3LH3A 1EZUC 5AFZH 2Q6DA 4ZXXH 1GJ6A 1GBCA 1MU8B 1SLXB 4FUFA 4INHA 4R0IA 1JIRA 2FLBH 3GY8A 3PWCA 2JH5D 3ZZ5A 3OTJE 5LPRA 5LH8A 1KSNA 1KIGH 1MU6B 1PYTD 1V2RT 2BM2A 3BTTE 3MNBA 3TPIZ 2FPZA 4A1XA 2H5DA 3BEIB 4H42U 5TCCA 1FY3A 1KLTA 2BTCE 1VJ9U 3MH4A 1FY5A 1O3KA 1LKAA 2ZC9H 1CU1A 2AERH 2ZHEH 3SO3A 1FY1A 3A84A 3VXEH 4YT6H 1P05A 3RXBA 1G3CA 1GBDA 1GBKA 1QRWA 5DJ7A 5AHGH 4FUCA 3HK6B 2FOCA 5CHAB 1RRKA 3MH5A 1C1TA 3VGCB 3TK6A 4MPWA 1HJ8A 5LGOA 3ATKA 2OBQA 1KLJH 1INCA 1ELFA 3SU3A 1QTFA 2A32A 2J4IA 4JK5A 2F83A 1EOJA 4MNWA 4NGAH 3V7TA 1S83A 1TPPA 1OXGA 1GBJA 3UPEA 1SR5C 3SJOA 5A09A 1QRXA 1Z1IA 5E2OA 3P17H 3BSQA 4X6NA 2ZU4A 3VFEA 2XNIA 1C4V2 2PW8H 1T4VH 3U8OH 1ZMNA 2BXUH 3E16B 2OBOA 1NU7B 4GCHF 1UTPA 2G52A 4JK6A 1EKBB 1W0YH 2WV5A 1O2VA 3LGTA 3PTNA 4LZ4B 4O03A 3GY7A 3M7TA 1THRH 1Y3YA 2IPHA 1Z7KA 2VGCB 1C1MA 3UIRA 4IN1A 5FPYA 4Y7AA 2Q6FA 5GIBA 1QA0A 1TNJA 4OS5A 3PROA 1O5GH 2XBXA 5GXPA 1TMBH 3TIUA 1GJ4H 4NA7A 1RS0A 1KYNA 4ZHMU 1DSTA 1Y3WA 1O2TA 3RMMH 2A5AA 3NXPA 4F49A 4X8TH 4K69A 3PMAB 2JETC 3HGPA 1F7ZA 2J94A 3UUZA 3RLWH 1V2NT 2XRCA 5EU8A 1G3EA 1MAYA 1FMGA 1HPGA 5TJXA 1QL9A 1GL0E 3DUXH 5E2PA 5EXLA 2M5TA 7KMEH 4CH2B 1GI9B 2BVXH 2P94A 2BY6X 3MI4A 4CRCA 4ISNA 2AMDA 2B5TB 2P8OB 2SGDE 1GJ7B 1O3OA 1OS8A 4BTUB 4OS2A 3QTOH 1W2KH 1IQNA 4Q7XA 1C2FA 1XXFA 2SNWA 2WPHS 4I8HA 1AIXH 1G3BA 1Y3VA 2VVUA 5EW2H 2QAAA 1NT1A 1IQMA 1RFNA 1FN8A 4A5TS 2ODPA 2BDCA 2FEQH 2B0FA 2AGIX 3ZZAA 4IW4E 3SV9A 2OUAA 4H6TA 1ELTA 2AMPA 2ZCHP 3QN7A 4YO9A 3A80A 4WWYA 2FZZA 1WUNH 3E1XB 3SZNA 1SFQB 3KIDU 5GCHF 1C2EA 1GMDG 3QTVH 3F6UH 1C5SA 2PGBB 4B71A 2R3UA 2V0BA 2GCHF 2PLXA 3UOUA 2BDBA 3U98H 1SGFG 3ZZ7A 1MTWA 1P06A 2CHAB 3F9EA 1CT2E 1EJMA 1W3CA 1JRTA 2ZCKP 2JKHA 2A4OA 3PLBA 5DP8A 1BTHH 1P2MA 2AH4X 1F92A 1Y5BT 2ODYB 1O36A 3A81A 1AE8H 1K1PA 3A7XA 2C8WB 2ASUB 1DM4B 1ZJDA 4A1VA 1K21H 5JB9S 5A8ZA 1V2WT 1LQEA 3RP2A 3KF2A 4O3TA 1SGFA 1V2TT 4XSKU 1K2I1 2GCTB 3D23A 3BIVH 5L2YH 1N1LA 1ZSKA 2FOHA 1DX5M 3MU8A 5DO4H 3ODFA 1L4DA 1THSH 1GJCB 1O2LA 1PPFE 1C2IA 2BLQA 3TGJE 5C5OA 1P02A 2ZZUH 3QUMP 4WY3A 2F9UA 3TLOA 2AIQA 2WPJS 1ETSH 2A0QB 1J16A 5JYIA 4Y8YA 2PFEA 4Y71A 5T6GA 1Z6EA 2OP9A 5E8EH 3RXAA 1HNEE 4Y8XA 1XM1A 5GDSH 2J95A 1AU8A 1TMUH 1MQ6A 2QV1A 1NESE 3RC6A 4AFZA 5EXMA 4MG3A 3UOPA 3SHCH 2H5CA 4I8KA 2UWOA 4ISLA 5C5NA 4Y0YE 1UTLM 4MVNA 3TH3H 5C1UA 1BDAA 3E91A 3PTBA 3A7TA 2XCFA 1NU9A 2ZP0H 1TNLA 2RA3A 3RM2H 2XTTB 1UVTH 1THPB 4GLYA 4X8VH 1LHDH 1O3GA 1O3FA 1UVOA 1GHYH 1HJ9A 3VB5A 2GT8A 1OSSA 1AY6H 2FOEA 3GYLB 4JZDH 4E06H 2OLGA 2VB0A 1QCPA 1XUHA 2NU4E 3T5FH 1GG6B 2OC7A 3KGPA 4O97A 1W14U 2KAIB 3HGNA 5E0HA 1O39A 1Q2WA 1CGHA 3BTME 4BAMB 4Y7BA 4LOYH 3SOSA 2CMYA 2P59A 4AGJA 1O37A 2Z6BD 3IWMA 2EI7A 3RXJA 4JZFH 2H9TH 3RXDA 1P0SH 3F9GA 1ZPBA 3Q3KA 5FCRA 4BTTB 1TBRH 1CSOE 1F5RA 3V12A 1ZTKA 4BAQB 1G2MA 2B7DH 2ANWA 3AAUA 5JB8S 1T8NA 5C3NA 1O2HA 3RXKA 2PGQB 2J38A 2WYGA 4MNVA 3M3SA 1A3EH 4YTAA 3TH4H 4FVDA 4DIIH 4DG4A 1SSXA 3FVFB 4MPXA 1W12U 1DS2E 2TPIZ 1O2JA 1J15A 1NY22 1SGDE 1W7GH 2ZGCA 1HRTH 3PO1C 3VEQB 2G4UA 1S0RA 3E8LA 1D6WA 3NKKA 2BY8X 3A86A 2SNVA 1QL7A 3MOCA 4IMQA 5GJ4B 1F0UA 3U1IB 5K7RA 1UTQA 1KXEA 4AG1A 2BD4A 4GHQA 5HM9A 1GHZA 1ZRBA 4KKDA 3O8RA 1NRSH 3A8CA 3P8FA 1DWDH 1MMJN 1TFXA 2BQ7B 1KXFA 2WPIS 5LPEA 4NA8A 1GI0A 4IBLH 2WPMS 2ZDVH 4XOJA 2P3UB 4CRGA 1GCDA 2FMJA 1W11U 2WINI 3ZZ8A 1HAHH 3FP7E 1HAXB 5T6FA 3QO6A 3PMBB 2HPQH 4CH8B 1JBUH 2OQ5A 3K2UA 4B73A 1MD7A 4A1TA 1Y8TA 6CHAC 1E34B 1O3NA 3M3VA 4LXBH 5L6NH 1YPLH 1VR1H 1NFUA 3LC3A 3P70B 1RTFB 2QCYA 2XWAA 1GVZA 1RIWC 4YM9A 1XKAC 5DP3A 1AZZA 1Y3XA 3KQCA 2FO9A 1C2JA 1GMDF 1WV7H 4I31A 2FS8A 3MMGA 2ZQ1A 4XE4A 1V2LT 1KTSB 4K1SA 4X6PA 3I29A 4JMYA 1Z71A 1TWXB 1UTNA 3LPRA 3GOVB 3ZZ3A 4CRBA 1T8LA 3S9CA 3TJVA 2TBSA 1SOTA 1FV9A 4NIXA 2ZHQH 8GCHG 3SUFA 5EODA 1HXFH 1QQ4A 4ABAA 1GHXH 3MU1A 1GJDB 2BQWB 2W7UA 1UMAH 2O8TA 2P93A 2JETB 1O31A 4WXVA 1ZSLA 4ZH8A 3UQOA 1SGRE 3M5LA 1ESAA 4QT8C 1C2MA 5AFYH 2ZU3A 3RXSA 2VWLA 3B8JA 4B76A 5ABWA 2GMTB 3RXRA 1C5TA 4TPYA 1HB0B 5FX6A 1BRCE 1UCYH 1K1JA 1UVSH 3VGCC 1DOJA 1BTXA 5JPMH 2A4QA 1GCTC 3GY4A 1IQJA 1IOEA 3U8TH 1B0EA 4JZEH 2ZFQH 1FXYA 3P95A 2VINA 4AFQA 3DFJA 2HNTC 4ABDA 3QLPH 1A5IA 2VIVA 9LPRA 1GI3A 3RXUA 1TYNA 4IS5A 1V2JT 1D6RA 4K5ZA 2PKAA 5JBCS 2ZEBA 4NIWA 4ASHA 3TJNA 3QGJA 1K1MA 4AYYB 3EAJA 1N6YA 3I78A 3P92A 4Y10E 2BOKA 5F03A 1LDTT 2ZFFH 2A45B 1A0HB 1PPGE 1CBWB 1V2QT 4TY6A 2GV6A 1HJAB 2H9HA 1BUIA 1M9UA 5EQQA 1V2VT 2O8WA 1C5UA 1LHFH 2WYJA 2ZNKH 1GDUA 3NK8A 1WYKA 3C1KA 1ORFA 1IHSH 3M5OA 1P2NA 1C1QA 2Y80A 2UUYA 1GBEA 1IQKA 3ENSB 4XFQA 3RXIA 2Y82A 3JZ1B 1S85A 3PMHB 4X2VA 5GWZA 2OD3B 3MU5A 5ETXA 4K8YA 1GHAF 1VCQA 6GCHF 1AQ7A 2Z3DA 3LU9B 4CR9A 1OX1A 1AVXA 3U69H 1ELAA 3R0FA 5BPEA 4B75A 1O2PA 4U2WA 2V35A 1C9TA 1OWDA 1YYY1 4MLFB 1MUEB 1RXPA 1KXDA 3SV8A 1H9LB 1SGIB 4FXGH 2VH0A 2ZU5A 1EB1H 2HNTE 2OCVB 5FPSA 5A0CA 3TH2H 1QQUA 3CENA 1CE5A 5EOKA 1ELVA 3P6ZB 4I8LA 1DLKB 4AN7A 4DURA 3M5MA 2D2DA 2Y6TA 1EZQA 1QJ1B 1LKBA 3PLPA 5CMXH 1H1BA 3L6PA 1UCYK 2P3FH 2ALPA 2QF0A 4UE7H 5FXLA 4JZIA 1DE7H 1P10A 1DDJA 2UUKB 1TE0A 1A7SA 4OGYA 2RA0A 3U9AH 3D49H 1RTLA 3GY6A 1TQ7B 4UFGH 3S7KB 3FFGA 3SGAE 4K8BA 1OPHB 1IHTH 1FQ3A 3SUEA 1KXCA 4K60A 1XXDA 1EP6A 3MWIU 1AVWA 1MCTA 2GZ9A 5G4BA 2XXLA 8LPRA 1BA8B 1F0TA 2FXRA 3AW1A 3TVJB 4OS1A 3G01A 1JMOH 1V2UT 3A88A 3L33A 3EA7A 3O8DA 3RXEA 3BTHE 3ZVGA 2Z9IA 2ZFSA 2QC2A 1SGCA 1NO9H 4ZAEA 4KGAA 4ABFA 1EB2A 1W8BH 2FYQA 4I33A 3ZVFA 1G9IE 3ELAH 2G8TA 2VIOA 3O8CA 2ZPRA 1L1GA 4FUJA 1LHEH 1SL3A 2SFAA 3QWCH 1EXFA 1YPGH 3FZZA 3FAOA 1O2OA 1T32A 2H1UA 3ZYEA 3S9BA 5DP9A 2AMQA 4D76A 3SBKA 2WUCA 1GPZA 1E38B 1QB6A 2PKSC 3K65B 1AMHA 8KME2 5C67A 3ZZ6A 3A8BA 1HJAC 1HIAA 3SU4A 2NWNA 2F9VA 1TNKA 1O35A 2SGEE 1C5XB 1DPOA 1LTOA 1O2UA 3S0NA 3ZVAA 1QB9A 1EATA 3MTYA 1CVWH 2J34A 5FBEA 4CBNA 2I6QA 2Z9LA 1TNGA 4X2WA 4NWKA 1L2EA 2TGDA 3RUOA 3RXOA 1TMTH 4GCHG 1CHOF 1BCUH 5FCKA 1OWJA 3RXCA 3RXLA 2C8XB 4MTBA 2EEKA 1AFQC 4B1TA 5A0BA 2C3SA 4CR5A 8GCHF 1GVKB 2QXHA 1P9UA 4U01A 3GCOA 1ZGVA 4Q80A 3SUDA 3AAVA 3SGQE 2CHAC 2BY7X 2ZA5A 4UFEH 5C1XA 1GDQA 2ULLA 3KEEA 3KL6A 1QA7A 3UY9A 3M35A 1VITF 1MTNB 4KTUA 4X1QU 1VGCB 1HAOH 4DT7B 1BMLA 2QA9E 2G51A 3SU6A 2FM2A 3EA8A 4H6SB 1SC8U 1S5SA 4YOGA 2FI5E 4OGXA 1AWFH 2ZF0H 4IC5A 1O5BB 4JCNA 3SI3H 1K1NA 2BDHA 1LVYA 2ZU2A 1QBVH 1GJ9B 2B9LA 3MH6A 3VXFH 3SU5A
chains in the Genus database with same CATH superfamily
3SW2B 2PTCE 2GDDA 1O2RA 5C17A 1C4U2 1ZOMA 2QYIA 5AF9H 5ESBA 1O38A 1NM6A 3MU4A 3SJ8A 1IQGA 1AE5A 5E0JA 1SGYE 1P2QA 3AW0A 1RIWB 1ETTH 1CT4E 1D4PB 3M7QA 2LPRA 4U30A 5CE1A 1C5MD 1ZMJA 3RXTA 1ARCA 1AZ8A 2B8OH 3MFJA 1C5RA 3SQHE 3LJJA 5JBBS 1XUIA 1GJAB 2YNAA 4UONA 1MBQA 2FWWA 3M37A 1UJ1A 1WQSA 1SFIA 1BJVA 4HZHA 1P2OA 4K3JA 1OWIA 2ZHFH 1FDPA 2ZG0H 3F9HA 3ZZ4A 4OS6A 2KAIA 3P8GA 3PB1E 3LKWA 1BTYA 3F1SB 2AGGX 1KDQB 3NZIA 2A5IA 8ESTE 1BRUP 4BXWA 1TBQH 1TX7A 1SVPA 4TWWA 1TALA 4ZKOU 4B2AA 1P2IA 1ID5H 3C27B 2XBYA 2L74A 1TPSA 3V0XA 1Y5UT 4AOQA 3T2NA 2CJIA 1GHAG 1QJ6B 2GKVE 1QL8A 2AYWA 2FOFA 2HWLB 3IITA 2NU0E 2BD8A 3TJUA 1OKXA 3LDXH 1PYTC 4YLQH 2VWMA 4X8UH 1W0ZU 3TNTA 1GCTB 3SJKA 1XUJA 1W7XH 4WJG2 3T62A 2G5NA 3W95A 4INKA 4D8NA 1GG6C 2XBVA 1XX9A 1GBMA 1TGSZ 5F8TA 1HUTH 3T28A 3BN9A 1KMHB 1LMWB 1QBOA 2W3KA 1OP2A 2QIQA 2ZGXH 3L3TA 2EY4C 2QY0B 3Q76A 5BRRE 5HXFA 2ZHDA 4M7GA 2NU2E 1C5WB 3LGVA 2XC5A 1XUGA 3Q3XA 2WSSD 2HALA 3RC4A 4XBBA 1YPEH 2VWOA 2V3HH 3SNBA 5HKKD 3BTQE 1EZXC 4FUIA 5DG6A 1O3HA 1O3DA 4F55A 1ZSJA 4K1EA 1G2LA 1SI5H 4YOJA 3RXMA 2R0LA 1PFXC 4WMEA 3ATLA 2FDAA 3UREA 1GI7B 3V13A 3GDVA 3ZV8A 1BHXB 4MPVA 1HDTH 2FI4E 2SGQE 4ABGA 2BY5X 5F8ZA 1GHBF 3ZZDA 5F6MA 2HRVA 2OK5A 2R2MB 3LGYA 3DD2H 3ZVEA 5T6DA 2O8MA 1IAUA 5IYTA 3DA9B 5DGJA 3PMJA 1IQEA 4MPUA 2HNTF 5KECA 1C5LH 1TRYA 1O3AA 1K1IA 1C9PA 1KDQA 1KY9A 4FU7A 1Z8IB 1FX0B 3ZYDA 1U6QA 5EQRA 1PPCE 2YNBA 1QY6A 2FTMA 1AD8H 1ELDE 1ZPCA 2C93B 2BLWA 2O8UA 2SGPE 4D7GA 2H2ZA 2G55A 3M61U 1DITH 1G37A 1JOUB 1P2KA 4WVPE 3UR9A 2HGTH 5L2ZH 1K22H 4D9RA 3UFAA 4THNH 4BXSA 1WCZA 3F68H 1W0KD 1OP0A 3RU4E 1WSSH 1RTKA 2AGEX 1FN6A 1MBMA 2ZFRH 3PV4A 3SU2A 1BTWA 1J14A 1QB1A 2DE9A 2D8WA 4UEHH 4XRNA 1ZYOA 1NPMA 1PJPA 4MDSA 2HLDD 3V3MA 2QN5T 1Z8GA 2VJ1A 3SN8A 4MNYA 1CO7E 2ESTE 5EPYA 4NCYA 4DVAU 1VZQH 4A7IB 1YPHC 2ZDLA 2QGRA 2C8ZB 1AGJA 3RM0H 1ZTLA 2A7HA 2ANMH 2FESH 2ZWLH 3KHVA 3EGKH 2WZQA 1OOKB 3SU1A 3ZV9A 7ESTE 2OC1A 3DCLA 3BIUH 1OWKA 5FBIA 7GCHF 3PLKA 2OC0A 1HYLA 2RG3A 3KN2A 3M3TA 1ELEE 3BEFB 3P8OA 1NS3A 5A0AE 1GBHA 1O2GH 4FUHA 1NFXA 1TX6A 2CXVA 2W5EA 3EE7A 2IOTA 4MQAA 1BTUA 3FKSD 4AZ2B 3A82A 1HLTH 3PM3A 3SNCA 4CRDA 3BF6H 1CA0C 4VGCB 3MO6A 5FX5A 3RXFA 1GMCF 2J2UA 2ZPSA 1T8OA 2W7SA 1P11E 1MTUA 2JJ2D 1YC0A 2KZ4A 4YZUA 1SGTA 3S69A 1FAXA 1NRQH 1UTMA 4Z0KA 1C5ZB 4WMFA 4ABEA 1P03A 1FIZA 4BNRA 1P09A 1C5VA 4RI0A 2CF9H 3RMNH 2AFQB 4DJZB 4KTSA 3JZ2B 3DSGA 4DGJA 1T4UH 4X8SH 1O5FH 3GISB 2VH6A 3AVZA 3RXGA 2VIDA 2CK3D 4TY7A 4ISOA 3A85A 1QR3E 2BD9A 1LPKB 2K8IA 1DLEA 1OYQA 3E6PH 1EAIA 1C1UH 2GZ8A 2KR7A 4KELA 1DXWA 1TGNA 1CGIE 3FP8E 3BG4B 2FX6A 3R3GB 4CRAA 4YOIA 1S6FA 3OU0A 2EI8A 3DSPA 1AN1E 1G30B 1RD3B 1TLDA 1O2SA 2Z94A 2R3YA 1TABE 1HAVB 5TCAA 4RKJB 2ZFTA 2UUFB 4ACAA 1GWAA 1SQAA 1GGDB 2LELA 1KXAA 3DHKH 1Z6JH 1O3JA 4X2XA 2GZ7A 1XVOA 2PSXA 2NU1E 1TNIA 4NZLA 1HGTH 2BOHB 2M2AA 1QURH 1SGQE 5EG4A 1NFWA 5HIZA 1NC6A 2PUQH 3BTFE 2ZU1A 4XBDA 1C1NA 2KX4A 1BJUA 4HTCH 6LPRA 1C2HA 4BAHB 1PPHE 3KQEA 1ELCA 1V2KT 1EFRD 3BTDE 5L30H 1TAWA 3RMOH 2W26A 1E35B 1YCPK 4NIYA 4I8GA 3NPSA 5DK1A 1NRRH 1MCVA 4X2YA 4ABIA 2V3OH 5K0HA 2PTNA 1Y5AT 3GYMA 1AUTC 2JH0D 2Y5FA 4Y0ZE 3ZIAD 1TX8A 1ZHPA 2WHXA 2XC4A 4NSYA 3RDZA 1F0RA 2FOGA 3RC5A 1C2LA 3TK5A 1P8VC 3KQBA 1DXPA 4P02A 2OINA 2RCEA 3U8RH 2TIOA 2XYAA 2ZDAH 2F9OA 2YMSD 1P04A 4ZMAH 3TNSA 4AFUA 1FIWA 1S82A 3ODDA 3UWJH 5CHAC 4I8JA 1E79D 2A7CA 3OY6U 1SPJA 3URCA 1E37B 1BMFD 1V2PT 1DUEA 1OWEA 2TGPZ 2ZHWH 2GJGA 1ELGA 4UFDH 1ARBA 1B7XB 1HIAB 1KTTB 1O3CA 4IN2A 1SB1H 3W1EA 1G36A 2D26C 3ZZ9A 1DT2A 5J4SA 3LOXA 2BDGA 1WTGH 4ISIH 1MKXK 1TGBA 1VCPA 3MNSA 4ABJA 4AG2A 2K0QA 2CGAA 2THFB 4Y11E 2R0KA 3PO1B 1LPGB 4INLA 1HCGA 6GCHG 2PUXB 1HXEH 1F2SE 4A92A 1DY9A 1TA2A 2FI3E 1C5QA 1O3MA 1O2XA 1ANCA 1IQHA 3VB6A 1YCPM 4ZXYH 4AB8A 4AB9A 1IQIA 1FY4A 1TPAE 5F8XA 2RDLA 1O5AB 2PP6A 2BDIA 4OS4A 1EPTB 2XW9A 1SMFE 5DP7A 3ESTA 1MH0A 1Z1JA 3A7ZA 4O3UA 1W0JD 5GPIB 3VPKA 3GCHB 1ZLRA 1Q31A 3WW7A 2VIQA 2ANYA 2ZDMA 3AASA 1GDNA 1PQ8A 2QF4A 3ZZCA 1A46H 2J92A 1GI6A 1GI4A 1YPHE 1N8OB 1EOLA 2G00A 2OC8A 2BYAX 4ESTE 4KTCA 1D3TB 3SNDA 4D9QA 4X1NU 4DCDA 1AVGH 1BITA 3T26A 1YLNA 1IQLA 3WWBA 1V6DA 2AEIH 1GI2A 3U28C 3SGBE 1A61H 1XUFA 1L4ZA 1WTHD 5EGMA 1SKYE 4BTIB 1UHBA 2BD5A 1RJXB 3UNRA 1BMMH 2C90B 3MQKC 3MNXA 3A87A 1GMHG 4ZKSU 1C1RA 1BT7A 1N6XA 2OTVA 3GCHC 1PPZA 1QIXB 3LGUA 2ZTXA 1Z8RA 3I77A 1PQ7A 2KCAA 5FAHA 1LVOA 2GTBA 1ZZZA 4ZHLU 4CHAB 3FZDA 1DSUA 3VB4A 2Z9GA 3GCTF 1NTPA 2AIPA 2FLRH 4X1SU 1A0LA 1TQ0B 1NRNH 1HAPH 1YP9A 2QF3A 1C1OA 1TB6H 4MNXA 1PQ5A 3NUMA 2FTLE 2IJOB 2HPPH 2VVVA 2EA3A 2EC9H 1DWBH 2ZO3H 4ASUD 3A83A 3D65E 2BLOA 1P57B 2CN0H 2GMTC 4TT3D 3OEED 1A5HA 4NSVA 4FU8A 2ZCLP 4ISHH 3E90B 3TK9A 1P12E 1SLUB 2V6NA 3SORA 5HM2A 3OFND 1GI5A 3BV9B 3SQEE 1CHOG 4NG9H 4Q7YA 3SUGA 3T29A 3GY5A 4JYVH 1L0ZA 2I6SA 1BIOA 1YPJH 4WF8A 2A5KA 2G81E 1AB9B 1K1LA 3FP6E 2FS9A 1BQYA 4U32A 3EQ0H 1O30A 1UK4A 2XC0A 1JWTA 2VIWA 3F2HA 1O32A 2F91A 1H8HD 2TGTA 1O0DH 4UDWH 5T3HA 2FODA 1MZDA 2HLCA 1FI8A 5EJLA 2UWLA 3HK3B 1EP5A 2ZPQA 4IGDA 1C5OH 1Y3UA 1Y59T 4NFEA 1VITG 4X1PU 3BTGE 4I7YH 4DY7B 2XCNA 1VGCC 4AFSA 2W3IA 4Y79A 1LHCH 2F3CE 1GJBB 1YLDA 5EXNA 4K1TA 4DIHH 1VITH 2PR3A 3MNCA 3HPTB 4Y76A 4X0WU 1HFDA 3BG8A 7LPRA 1YKTA 1PQAA 1ZHMA 4CBOA 4A6LA 1YPKH 3LGWA 1QFKH 3A89A 4TYDA 2ANKH 1YPMH 1DWCH 1DFPA 1O33A 1ACBE 1MD8A 4TWYA 4ZKNU 5KEDA 2OQUA 5I25A 2LNCA 3FOAA 2GP9B 1A1RA 3DFLA 1EX3A 1LCYA 6ESTA 1DVAH 2SGFE 1AKSB 3A7YA 3RXVA 1P01A 2A4RA 2UWPA 3A8AA 2ZI2H 2Y5HA 4Q7ZA 1BTZA 1FPHH 1W13U 2BQ6B 2PSYA 1WU1A 2PV9B 2JJ1D 4ZKRU 1AKSA 1KLIH 3BG4C 1A4WH 1CHGA 3LGIA 2GX4A 2PKAB 2Z3EA 1O2ZA 3TU7H 4NWLA 3TGKE 1O2IA 3H5CB 1GBBA 2CV3A 1HAZB 4AX9H 3PV2A 1K1OA 1EPTA 2BDYA 2G4TA 1UVUH 2FIRH 3QZRA 4X1RU 5H4IB 2Y7ZA 1K9OE 3AK5A 3NCLA 5DPAA 1AO5A 1OYTH 2A4GA 3RU4D 2J5UA 4WMDA 1D3DB 1ETRH 1FPCH 3QGNB 1KXBA 4J1YA 2F9NA 3SV2H 1O5EH 1HAGE 1QBNA 4YESB 3T25A 3S7HB 1SBWA 1QNJA 1CBWC 2WUBA 1NBMD 2GT7A 1MKWH 1HBTH 4XDEA 3MU0A 4VGCC 2ZIQH 3TJOA 1P9SA 5DP4A 3TGIE 1FUJA 2K1QA 1TOCB 3LH1A 3UNSA 4FUDA 2QF5A 2BX4A 2VIPA 4B74A 1C5NH 3D62A 1O2WA 1ZPZA 3URDA 5EJ1A 1C1WH 1NFYA 5KGOA 1J9CH 1WQVH 4FVBA 1COWD 1XMNB 2G5VA 4NIVA 4B6FA 3QX5H 1O3EA 4WXIA 1GVLA 4WH8A 3LONA 1ELBA 2VGCC 3IG6B 1O2KA 3GCNA 2GCHG 3EA9A 4ACBA 4AYVB 4HI3A 1GL1A 3HATH 1E36B 1XUKA 4IMZA 1XKBC 1MAXA 1O2MA 4X6OA 2J98A 2ZDKA 1EAWA 2FX4A 1SQOA 1GHBG 1ABJH 5JBTA 2BD2A 1LQDB 2IPQX 1SQTA 2ALVA 2STBE 4E7NA 1EJNA 1MTSA 1J8AA 1H8IH 1GMHF 3Q77A 2FOMB 2J98B 4FU9A 4GUXA 1K28D 3EDXB 3F2FA 1FAKH 5C0TA 3S9AA 5IK2D 1E1QD 2QXGA 1GHWH 4IC6A 2BVRH 3SJ9A 1B0FA 3QK1A 3A7VA 2P8OC 1C5PA 3OX7U 1EAXA 2R9PA 4B2CA 1TIOA 1BOQA 3SNEA 3ATMA 1DICA 1TONA 4JYTA 1S6HA 3ATWA 1GJ8B 1ANBA 1V2MT 3W94A 1AWHB 1UHBB 1UK2A 1SGEE 1EPTC 2J9NA 3SV6A 1JXPA 1NN6A 1ANDA 1UTOA 1YF4A 5IDKA 1FLEE 1O2YA 2BHGA 3SU0A 2ZGHA 4AC9A 1WAYB 2P16A 2H6MA 2VNTA 1P3CA 1V2ST 1ESTA 1PPBH 2HVXA 4FUEA 5GNDA 3PYHA 1TRNA 1PPEE 1C2KA 1ZRKA 3LJOA 4HGCA 3DT0H 2Y7XA 5E0GA 2JH6D 1GHVH 1UO6A 2D1JA 1O3BA 2VWNA 3O8BA 1EQ9A 3ZVDA 1H9HE 1BB0B 1MKWK 1YWUA 4UFFH 1SG8B 1C1SA 1EAUA 1ANEA 4LK4A 2ZTYA 4E05H 5JDUB 4Q2KA 4I32A 1A2CH 1O3IA 3QDZB 1BMNH 5HGGA 1K0HA 3T27A 1SGNE 3OAAD 1EASA 2WPKS 5EQSA 1OWHA 2VU8E 3KCGH 2F9BH 4RT0A 3UWIA 1CGJE 1J17T 3RXQA 3SV7A 3HKJB 2BDAA 1T31A 3M7UA 1ABIH 1HV7A 1O3LA 2PHBA 1TA6A 1QHRB 1VCWA 1H8DH 1SLVB 2A31A 7GCHG 3RU4T 1L1NA 1C5YB 1Z8JB 2BLVA 3MYWA 3LT3A 4NFFA 2FOBA 4KP0A 3WY8A 5A8YA 2IJD1 4CHAC 1CT0E 1JIMA 1FZZA 1WOFA 1S81A 2NU3E 1AFQB 2QXJA 4SGAE 4FUBA 2ILNA 3OYPA 1MKXH 4DOQA 1IQFA 2FYRA 1RGQA 3MO3A 1CQQA 1HAYB 1MZAA 2ODQA 1ZMLA 1O3PB 3SNAA 4ZUHA 1SGPE 2BZ6H 3ZVCA 2WV9A 1CA0B 3LC5A 1ZR0A 3N7OA 1MTNC 4HFPB 1JRSA 1EJAA 5JBAS 1GMCG 1S84A 3UTUH 2QXIA 3KYFA 5I46H 2PWXA 1YY3A 3N99A 1SOZA 4TPIZ 5C1YA 5A8XA 1VJAU 2A7JA 3BTWE 2Y81A 1YCPH 9ESTA 5SGAE 2GGVB 1P2JA 1C4Y2 1N8OC 1XVMA 1YBWA 1D9IA 3M5NA 1C2GA 2GDEH 1QGFA 2DE8A 1GJ5H 1AB9C 3ZZBA 1DY8A 1MTVA 1NBME 1UCYE 3BTEE 1O34A 3RXHA 3OSYA 1BMAA 1F5KU 1YLCA 1ESBA 3GY2A 1BRAA 5DSFA 2PKSB 5FPTA 1BTPA 1H9IE 4SGBE 4CREA 2BD7A 1B5GH 3U1JB 2GD4B 3BEUA 1C1VH 4ZROA 2HVYB 4D7FA 4GHTA 3RLYH 1LHGH 1ZHRA 2SGAA 2O8LA 2V3MA 2Z9KA 3UR6A 3M36A 2DUCA 2A2XH 2BD3A 4JZ1A 4GAWA 2ZGBH 4F48B 2VVCA 2ZDNA 4OS7A 3HKIB 3ITIA 3KNXA 1W10U 1UVPA 2FP7B 4LZ1H 1O5DH 1FJSA 1TNHA 2EI6A 1D3QB 2XBWA 3MHWU 5AVDA 1GBTA 3VB3A 2GCTC 4ABBA 2YOLA 4O9VA 3B23B 1TBZH 4RN6A 3GDSA 3VB7A 2XWBI 1C2DA 2BB4A 2A2QH 1T8MA 2WPLS 3GICB 5C0UA 2TRMA 1S0QA 1BZXE 1LVMA 2BVSH 4BANB 1Q3XA 2Y5GA 3PWBA 2ZKSA 2Z7FE 4XBCA 3ZVBA 1BRBE 2HOBA 4GPGA 1D3PB 3RMLH 5DP6A 3SJIA 3CS0A 5EW1H 1A0JA 5ESTE 2F9PA 2GVFA 3F0PA 5EPNA 1VKYA 4X6MA 2UUJB 3Q3YA 5C2ZA 3SI4H 4PROA 1F5LA 3H7TA 1SHYA 5DP5A 1GBIA 1P3EA 2WV4A 4GVUA 4Z6AH 2C4FH 3QZQA 2Q1JA 2BZAA 4AGKA 1BBRK 1QJ7B 4K2YA 3E3TA 3E0NB 1G3DA 1FY8E 5HYOA 2H9EH 3MH7A 5EIYA 5B6OA 2P95A 4ZHAA 5T1VA 1DANH 1EZSC 2P3TB 3Q00A 3CP7A 3EE0B 1GBAA 4FUGA 2STAE 1ZGIA 2BX3A 3GY3A 1AUJA 1LPZB 5LPFA 4F4OC 1SQRA 4JYUH 1DWEH 1GBFA 5PTPA 5CDFE 1A3BH 3FO8D 4BAKB 1OP8A 1NROH 1HAIH 2C8YB 1YGCH 1LO6A 4J2YB 4NA9H 3B9FH 3ATIA 1UTKA 3E0PB 4NZQA 2RDEA 4Y8ZA 3EYDA 4BAOB 1UK3A 4GSOA 1BBRE 2ZTZA 3MO9A 1AFEH 1LVBA 2F4LA 4RSPA 1TOMH 1A5GH 3A8DA 3K6ZA 3LIWA 1UTJA 1F0SA 1TGCA 1FONA 1T7CA 2ZQ2A 4B2BA 3K9XB 1EUFA 1TRMA 1H4WA 2Q6GA 2A1DB 3H7OA 2Z3CA 5GCHG 1GBLA 1SHHB 2R2WU 1NZQH 2ZFPH 3F9FA 4DW2U 2ZECA 1SLWB 1TGTA 1AHTH 3STJA 4H4FA 4RKOB 3P8NA 1X7AC 2AS9A 4UD9H 1V2OT 2GV7A 2ZGJA 3GDUA 4WH6A 3SYJA 1WBGB 2O9QA 4YT7H 3NWUA 5HMAA 2RFKC 1CA8B 4YXWD 5A2MH 3UQVA 4OM9A 1ZTJA 1QRZA 1FNIA 2CF8H 2BXTH 1O5CB 3KYGA 2IN2A 4BOHA 1HAVA 1C1PA 1E0FD 3STIA 1GI1A 1L1JA 3GS9A 1BBRH 4Y6DA 4AORA 1NRPH 1O2NA 1GI8B 5CHBA 3TITA 4R8TB 3K6YA 2TGAA 3KQDA 3GCTG 3A7WA 3UNQA 1DUAA 4E7RG 1AI8H 1V3XA 1YM0A 3OY5U 5DKMA 5C20A 1G32B 4CRFA 2Z9JA 1O2QA 3RXPA 1MQ5A 4ABHA 4YLUA 5FHTA 2OXSA 1GGDC 2FOAA 1ZJKA 3PRBA 3SHAH 1TPOA 6CHAB 3BTKE 2BMGB 2BY9X 5J4QA 1BHXF 4P00A 3CS7A 3FANA 3LH3A 1EZUC 5AFZH 2Q6DA 5FL7D 4ZXXH 1GJ6A 4B6EA 1GBCA 1MU8B 2JDID 1SLXB 4FUFA 4INHA 4R0IA 1JIRA 2FLBH 3GY8A 3PWCA 2JH5D 3ZZ5A 3OTJE 5LPRA 4XD7D 5LH8A 1KSNA 1KIGH 1MU6B 1PYTD 1V2RT 2BM2A 3BTTE 3MNBA 3TPIZ 2FPZA 4A1XA 2H5DA 3BEIB 4H42U 5TCCA 1FY3A 1KLTA 2BTCE 5DN6D 2WPDD 1VJ9U 3MH4A 1FY5A 1O3KA 1LKAA 2ZC9H 1CU1A 2AERH 2XNDD 2ZHEH 3SO3A 1FY1A 3A84A 3VXEH 4YT6H 1P05A 3PV5A 4FOUC 4TSFD 3RXBA 1G3CA 1GBDA 1GBKA 1QRWA 5DJ7A 5AHGH 4FUCA 3HK6B 2FOCA 5CHAB 1RRKA 3MH5A 1C1TA 3VGCB 3TK6A 4MPWA 1HJ8A 5LGOA 3ATKA 2OBQA 1KLJH 1INCA 1ELFA 3SU3A 1QTFA 2A32A 2J4IA 4JK5A 2F83A 1EOJA 4MNWA 4NGAH 3V7TA 1S83A 1TPPA 1OXGA 1GBJA 3UPEA 1SR5C 3SJOA 5A09A 1QRXA 2KCYA 1Z1IA 5E2OA 3P17H 3BSQA 2V7QD 4X6NA 2ZU4A 3VFEA 2XNIA 1C4V2 2PW8H 1T4VH 3H09A 3U8OH 1ZMNA 2BXUH 3E16B 2OBOA 1NU7B 4GCHF 1UTPA 2G52A 4JK6A 1EKBB 1W0YH 3N7DA 2WV5A 1O2VA 3LGTA 3PTNA 4LZ4B 4HG6A 4O03A 3GY7A 3M7TA 1THRH 1Y3YA 2IPHA 1Z7KA 2VGCB 1C1MA 3UIRA 4IN1A 5FPYA 4Y7AA 2Q6FA 5GIBA 1QA0A 1TNJA 4OS5A 3PROA 1O5GH 2XBXA 5GXPA 1TMBH 1WXRA 3TIUA 1GJ4H 4NA7A 1RS0A 1KYNA 4ZHMU 1DSTA 1Y3WA 1O2TA 3RMMH 2A5AA 3NXPA 4F49A 4X8TH 4K69A 3PMAB 2JETC 3HGPA 1F7ZA 2J94A 3KQ5A 2L6OA 3RLWH 3UUZA 1V2NT 2XRCA 4ZCNA 5EU8A 1G3EA 1MAYA 1FMGA 1HPGA 5TJXA 1QL9A 1GL0E 3DUXH 5E2PA 5EXLA 2AHME 2M5TA 7KMEH 4CH2B 1GI9B 2BVXH 2P94A 2BY6X 3MI4A 4CRCA 4ISNA 2AMDA 2B5TB 2P8OB 2SGDE 1GJ7B 1O3OA 1OS8A 4BTUB 4OS2A 3QTOH 1W2KH 1IQNA 4Q7XA 1C2FA 1XXFA 2SNWA 2WPHS 4I8HA 1AIXH 1G3BA 1Y3VA 2VVUA 5EW2H 2QAAA 1NT1A 1IQMA 1RFNA 1FN8A 4A5TS 2ODPA 2BDCA 2FEQH 2B0FA 2AGIX 3ZZAA 4IW4E 3SV9A 2OUAA 4H6TA 1ELTA 2AMPA 2ZCHP 3QN7A 4YO9A 3A80A 4WWYA 2FZZA 1WUNH 3E1XB 3SZNA 1SFQB 3KIDU 5GCHF 1C2EA 1GMDG 3QTVH 3F6UH 1C5SA 2PGBB 4B71A 2R3UA 2V0BA 2GCHF 2PLXA 3UOUA 2BDBA 3U98H 1SGFG 3ZZ7A 1MTWA 1P06A 2CHAB 3F9EA 1CT2E 1EJMA 1W3CA 1JRTA 2ZCKP 2JKHA 2A4OA 3PLBA 5DP8A 1BTHH 1P2MA 2AH4X 1F92A 1Y5BT 2ODYB 1O36A 3A81A 1AE8H 2J97A 1K1PA 3A7XA 2C8WB 2ASUB 1DM4B 1ZJDA 4A1VA 1K21H 5JB9S 5A8ZA 1V2WT 1LQEA 3RP2A 3KF2A 4O3TA 1SGFA 1V2TT 4XSKU 1K2I1 2GCTB 3D23A 3BIVH 3UB0A 5L2YH 1N1LA 1ZSKA 2FOHA 1DX5M 3MU8A 5DO4H 3ODFA 1L4DA 1THSH 1GJCB 1O2LA 1PPFE 1C2IA 2BLQA 3TGJE 5C5OA 1P02A 2ZZUH 3QUMP 4WY3A 2F9UA 3TLOA 2AIQA 2WPJS 2KFWA 1ETSH 3F2GA 2A0QB 1J16A 3UAIC 5JYIA 4Y8YA 2PFEA 4Y71A 5T6GA 1Z6EA 2OP9A 5E8EH 3RXAA 1HNEE 4Y8XA 1XM1A 5GDSH 2J95A 1AU8A 1TMUH 1MQ6A 2QV1A 4FETA 1NESE 3RC6A 4AFZA 3CNRA 5EXMA 4MG3A 3UOPA 3SHCH 2H5CA 4I8KA 2UWOA 5EJZA 4ISLA 5C5NA 4Y0YE 1UTLM 4MVNA 3TH3H 5C1UA 1BDAA 2F43B 3E91A 3PTBA 3A7TA 2XCFA 1NU9A 2ZP0H 1TNLA 2RA3A 3RM2H 2XTTB 1UVTH 1THPB 4GLYA 4X8VH 1LHDH 1O3GA 1O3FA 3OEHD 1UVOA 1GHYH 1HJ9A 3VB5A 2GT8A 1OSSA 1AY6H 2FOEA 3GYLB 4JZDH 1E1RD 4E06H 2OLGA 2VB0A 1QCPA 1XUHA 2NU4E 3T5FH 1GG6B 2OC7A 3KGPA 4O97A 1W14U 2KAIB 3HGNA 5E0HA 1O39A 1Q2WA 1CGHA 3BTME 4BAMB 4Y7BA 4LOYH 3SOSA 2CMYA 2P59A 4AGJA 1O37A 2Z6BD 3IWMA 2EI7A 2LP6A 3RXJA 4JZFH 4I86A 2H9TH 3RXDA 1P0SH 3F9GA 1ZPBA 2QE7D 3Q3KA 5FCRA 4BTTB 1TBRH 1CSOE 1F5RA 3V12A 1ZTKA 4BAQB 1G2MA 2B7DH 2ANWA 3AAUA 5JB8S 1T8NA 5C3NA 1O2HA 3RXKA 2PGQB 2J38A 2WYGA 4MNVA 3M3SA 1A3EH 4YTAA 3TH4H 4FVDA 4DIIH 4DG4A 2KCPA 1SSXA 3FVFB 4MPXA 1W12U 1DS2E 2TPIZ 1O2JA 1J15A 1NY22 1SGDE 1W7GH 2ZGCA 1HRTH 3PO1C 3VEQB 2G4UA 1S0RA 3E8LA 1D6WA 3NKKA 2BY8X 3A86A 4Q4LA 2SNVA 1QL7A 3MOCA 5F53A 4IMQA 3WWFA 5GJ4B 1F0UA 3U1IB 5K7RA 1UTQA 1KXEA 4AG1A 2BD4A 4GHQA 5HM9A 1GHZA 1ZRBA 4KKDA 3O8RA 1NRSH 3A8CA 3P8FA 1DWDH 1MMJN 1TFXA 2BQ7B 1KXFA 2WPIS 5LPEA 4NA8A 1GI0A 5B6LA 4IBLH 2WPMS 2ZDVH 4XOJA 2P3UB 4CRGA 1GCDA 2FMJA 1W11U 4M9FA 2WINI 2YMSC 3ZZ8A 1HAHH 3FP7E 1HAXB 1QZ8A 5T6FA 3QO6A 3PMBB 2HPQH 4CH8B 1JBUH 5HIYA 2OQ5A 3K2UA 4B73A 1MD7A 4A1TA 1Y8TA 6CHAC 1E34B 1O3NA 3M3VA 4LXBH 5L6NH 1YPLH 1VR1H 1NFUA 3LC3A 3P70B 1RTFB 2QCYA 2XWAA 1GVZA 1RIWC 4YM9A 1XKAC 5DP3A 1AZZA 1Y3XA 3KQCA 2FO9A 1C2JA 1GMDF 1WV7H 4I31A 2FS8A 1MABB 3MMGA 2ZQ1A 4XE4A 1V2LT 1KTSB 4K1SA 4X6PA 3I29A 4JMYA 1Z71A 1TWXB 1UTNA 3LPRA 3GOVB 3ZZ3A 4CRBA 1T8LA 3S9CA 3TJVA 2TBSA 1SOTA 1OHHD 1FV9A 4NIXA 2ZHQH 8GCHG 3SUFA 5EODA 1HXFH 1QQ4A 4ABAA 1GHXH 3MU1A 1GJDB 2BQWB 2W7UA 1UMAH 2O8TA 2P93A 2JETB 1O31A 4WXVA 1ZSLA 4ZH8A 3UQOA 1SGRE 3M5LA 1ESAA 4QT8C 1C2MA 5AFYH 2ZU3A 3RXSA 2VWLA 3B8JA 4B76A 5ABWA 2GMTB 3RXRA 1C5TA 4TPYA 1HB0B 5FX6A 1BRCE 1UCYH 1K1JA 1UVSH 3VGCC 1DOJA 1BTXA 5JPMH 2A4QA 1GCTC 3GY4A 1IQJA 1IOEA 3U8TH 1B0EA 4JZEH 1H8ED 2ZFQH 1FXYA 3P95A 2VINA 4AFQA 3DFJA 4RT1A 2HNTC 4ABDA 3QLPH 1A5IA 2VIVA 9LPRA 1GI3A 3RXUA 1TYNA 4IS5A 1V2JT 1D6RA 4K5ZA 2PKAA 5JBCS 2ZEBA 4NIWA 4ASHA 3TJNA 3QGJA 1K1MA 4AYYB 3EAJA 1N6YA 3I78A 3P92A 4Y10E 2BOKA 5F03A 1LDTT 2ZFFH 2A45B 1A0HB 2YMSB 3NRLA 1PPGE 1CBWB 1V2QT 4TY6A 2GV6A 1HJAB 2H9HA 1BUIA 1M9UA 5EQQA 1V2VT 2O8WA 1C5UA 1LHFH 2WYJA 2ZNKH 1GDUA 3NK8A 1WYKA 3C1KA 1ORFA 1IHSH 3M5OA 1P2NA 1C1QA 2Y80A 2UUYA 1GBEA 1IQKA 3FN8A 3ENSB 4XFQA 3RXIA 2Y82A 3JZ1B 1S85A 3PMHB 4X2VA 5GWZA 2OD3B 3MU5A 5ETXA 4K8YA 1GHAF 1VCQA 6GCHF 1AQ7A 2Z3DA 3LU9B 4CR9A 1OX1A 1AVXA 3U69H 1ELAA 3R0FA 5BPEA 4B75A 3PRDA 1O2PA 3OE7D 4U2WA 2V35A 1C9TA 1OWDA 3SZEA 1UW7A 1YYY1 4MLFB 1MUEB 1RXPA 1KXDA 3SV8A 1H9LB 1SGIB 4FXGH 2VH0A 2ZU5A 1EB1H 2HNTE 2OCVB 5FPSA 5A0CA 3TH2H 1QQUA 3CENA 1CE5A 5EOKA 1ELVA 3P6ZB 4I8LA 1DLKB 4AN7A 4DURA 3M5MA 3N7EA 2KM0A 2D2DA 2Y6TA 1EZQA 1QJ1B 1LKBA 3PLPA 5CMXH 1H1BA 3L6PA 1UCYK 2P3FH 2ALPA 2QF0A 4UE7H 5FXLA 4JZIA 1DE7H 1P10A 1DDJA 2UUKB 1TE0A 1A7SA 4OGYA 2RA0A 3U9AH 3D49H 1RTLA 3GY6A 1TQ7B 2XOKD 4UFGH 3S7KB 3FFGA 3SGAE 4K8BA 1OPHB 1IHTH 1FQ3A 3SUEA 4Z1MD 1KXCA 4K60A 1XXDA 1EP6A 3MWIU 1AVWA 1MCTA 2GZ9A 3F3BA 5G4BA 3DSOA 2XXLA 8LPRA 1BA8B 1F0TA 2FXRA 3AW1A 3TVJB 4OS1A 3G01A 1JMOH 1V2UT 3A88A 3L33A 3EA7A 3O8DA 3RXEA 3BTHE 3ZVGA 2Z9IA 2ZFSA 2QC2A 1SGCA 2W6JD 1NO9H 4ZAEA 4KGAA 2KCOA 4ABFA 1EB2A 1W8BH 2FYQA 4I33A 3ZVFA 1G9IE 3ELAH 2G8TA 2VIOA 3O8CA 2ZPRA 1L1GA 4FUJA 1LHEH 1SL3A 2SFAA 3QWCH 1EXFA 1YPGH 3FZZA 3FAOA 1O2OA 1T32A 2H1UA 3ZYEA 3S9BA 5DP9A 2AMQA 4D76A 3SBKA 2WUCA 1GPZA 1E38B 1QB6A 2PKSC 3K65B 1AMHA 8KME2 5C67A 3ZZ6A 3A8BA 1HJAC 1HIAA 3SU4A 2NWNA 2F9VA 1TNKA 1O35A 2JIZD 2SGEE 1C5XB 1DPOA 1LTOA 1O2UA 3S0NA 3ZVAA 1QB9A 1EATA 3MTYA 1CVWH 2J34A 5FBEA 4CBNA 2I6QA 4DT4A 2Z9LA 1TNGA 4X2WA 4NWKA 1L2EA 3OTPA 2TGDA 3RUOA 3RXOA 1TMTH 4GCHG 1CHOF 1BCUH 5FCKA 1OWJA 3RXCA 3RXLA 2C8XB 4MTBA 1S6LA 3VG8A 2EEKA 1AFQC 3F0OA 4B1TA 5A0BA 2C3SA 4CR5A 8GCHF 1GVKB 2QXHA 1P9UA 4U01A 3GCOA 4Q63A 1ZGVA 4Q80A 3SUDA 3AAVA 3SGQE 2CHAC 2BY7X 2ZA5A 4UFEH 5C1XA 5C94A 1GDQA 2ULLA 3KEEA 3KL6A 1QA7A 2VBCA 3UY9A 3M35A 1VITF 1MTNB 4KTUA 4X1QU 1VGCB 1WDIA 1HAOH 4DT7B 1BMLA 2QA9E 2G51A 3SU6A 2FM2A 3EA8A 4H6SB 1SC8U 1S5SA 2W6ID 4YOGA 2EQNA 2FI5E 4OGXA 1AWFH 2ZF0H 4IC5A 1O5BB 4JCNA 3SI3H 1K1NA 2BDHA 1LVYA 2ZU2A 1QBVH 1GJ9B 2B9LA 3MH6A 3VXFH 3SU5A
chains in the Genus database with same CATH topology
3SW2B 2PTCE 2GDDA 1O2RA 1C4U2 1ZOMA 2QYIA 5AF9H 5ESBA 1O38A 1NM6A 3MU4A 3SJ8A 1IQGA 1AE5A 5E0JA 1SGYE 1P2QA 3AW0A 1RIWB 1ETTH 1CT4E 1D4PB 3M7QA 2LPRA 4U30A 5CE1A 1C5MD 1ZMJA 3RXTA 1ARCA 1AZ8A 2B8OH 3MFJA 1C5RA 3SQHE 3LJJA 5JBBS 1XUIA 1GJAB 2YNAA 4UONA 1MBQA 2FWWA 3M37A 1UJ1A 1WQSA 1SFIA 1BJVA 4HZHA 1P2OA 4K3JA 1OWIA 2ZHFH 1FDPA 2ZG0H 3F9HA 3ZZ4A 4OS6A 2KAIA 3P8GA 3PB1E 3LKWA 1BTYA 3F1SB 2AGGX 1KDQB 3NZIA 2A5IA 8ESTE 1BRUP 4BXWA 1TBQH 1TX7A 1SVPA 4TWWA 1TALA 4ZKOU 4B2AA 1P2IA 1ID5H 3C27B 2XBYA 1TPSA 3V0XA 1Y5UT 4AOQA 3T2NA 2CJIA 1GHAG 1QJ6B 2GKVE 1QL8A 2AYWA 2FOFA 2HWLB 3IITA 2NU0E 2BD8A 3TJUA 1OKXA 3LDXH 1PYTC 4YLQH 2VWMA 4X8UH 1W0ZU 3TNTA 1GCTB 3SJKA 1XUJA 1W7XH 4WJG2 3T62A 2G5NA 3W95A 4INKA 4D8NA 1GG6C 2XBVA 1XX9A 1GBMA 1TGSZ 5F8TA 1HUTH 3T28A 3BN9A 1LMWB 1QBOA 2W3KA 1OP2A 2QIQA 2ZGXH 3L3TA 2QY0B 3Q76A 5BRRE 5HXFA 2ZHDA 4M7GA 2NU2E 1C5WB 3LGVA 2XC5A 1XUGA 3Q3XA 2HALA 3RC4A 4XBBA 1YPEH 2VWOA 2V3HH 3SNBA 3BTQE 1EZXC 4FUIA 5DG6A 1O3HA 1O3DA 1ZSJA 4K1EA 1G2LA 1SI5H 4YOJA 3RXMA 2R0LA 1PFXC 4WMEA 3ATLA 2FDAA 3UREA 1GI7B 3V13A 3GDVA 3ZV8A 1BHXB 4MPVA 1HDTH 2FI4E 2SGQE 4ABGA 2BY5X 5F8ZA 1GHBF 3ZZDA 5F6MA 2HRVA 2R2MB 3LGYA 3DD2H 3ZVEA 5T6DA 2O8MA 1IAUA 5IYTA 3DA9B 5DGJA 3PMJA 1IQEA 4MPUA 2HNTF 1C5LH 1TRYA 1O3AA 1K1IA 1C9PA 1KDQA 1KY9A 4FU7A 1Z8IB 3ZYDA 1U6QA 5EQRA 1PPCE 2YNBA 1QY6A 2FTMA 1AD8H 1ELDE 1ZPCA 2C93B 2BLWA 2O8UA 2SGPE 4D7GA 2H2ZA 2G55A 3M61U 1DITH 1G37A 1JOUB 1P2KA 4WVPE 3UR9A 2HGTH 5L2ZH 1K22H 4D9RA 3UFAA 4THNH 4BXSA 1WCZA 3F68H 1OP0A 3RU4E 1WSSH 1RTKA 2AGEX 1FN6A 1MBMA 2ZFRH 3PV4A 3SU2A 1BTWA 1J14A 1QB1A 2DE9A 2D8WA 4UEHH 1ZYOA 1NPMA 1PJPA 4MDSA 3V3MA 2QN5T 1Z8GA 2VJ1A 3SN8A 4MNYA 1CO7E 2ESTE 5EPYA 4NCYA 4DVAU 1VZQH 4A7IB 1YPHC 2ZDLA 2QGRA 2C8ZB 1AGJA 3RM0H 1ZTLA 2A7HA 2ANMH 2FESH 2ZWLH 3KHVA 3EGKH 1OOKB 3SU1A 3ZV9A 7ESTE 2OC1A 3BIUH 1OWKA 5FBIA 7GCHF 3PLKA 2OC0A 1HYLA 2RG3A 3KN2A 3M3TA 1ELEE 3BEFB 3P8OA 1NS3A 5A0AE 1GBHA 1O2GH 4FUHA 1NFXA 1TX6A 2CXVA 2W5EA 2IOTA 4MQAA 1BTUA 4AZ2B 3A82A 1HLTH 3PM3A 3SNCA 4CRDA 3BF6H 1CA0C 4VGCB 3MO6A 5FX5A 3RXFA 1GMCF 2J2UA 2ZPSA 1T8OA 2W7SA 1P11E 1MTUA 1YC0A 4YZUA 3S69A 1SGTA 1FAXA 1NRQH 1UTMA 4Z0KA 1C5ZB 4WMFA 4ABEA 1P03A 1FIZA 4BNRA 1P09A 1C5VA 2CF9H 3RMNH 2AFQB 4DJZB 4KTSA 3JZ2B 4DGJA 1T4UH 4X8SH 1O5FH 3GISB 2VH6A 3AVZA 3RXGA 2VIDA 4TY7A 4ISOA 3A85A 1QR3E 2BD9A 1LPKB 1DLEA 1OYQA 3E6PH 1EAIA 1C1UH 2GZ8A 4KELA 1DXWA 1TGNA 1CGIE 3FP8E 3BG4B 2FX6A 3R3GB 4CRAA 4YOIA 1S6FA 3OU0A 2EI8A 1AN1E 1G30B 1RD3B 1TLDA 1O2SA 2Z94A 2R3YA 1TABE 1HAVB 5TCAA 4RKJB 2ZFTA 2UUFB 1GWAA 1SQAA 1GGDB 1KXAA 3DHKH 1Z6JH 1O3JA 4X2XA 2GZ7A 1XVOA 2PSXA 2NU1E 1TNIA 4NZLA 1HGTH 2BOHB 1QURH 1SGQE 5EG4A 1NFWA 1NC6A 2PUQH 3BTFE 2ZU1A 4XBDA 1C1NA 1BJUA 4HTCH 6LPRA 1C2HA 4BAHB 1PPHE 3KQEA 1ELCA 1V2KT 3BTDE 5L30H 1TAWA 3RMOH 2W26A 1E35B 1YCPK 4NIYA 4I8GA 3NPSA 5DK1A 1NRRH 1MCVA 4X2YA 4ABIA 2V3OH 5K0HA 2PTNA 1Y5AT 3GYMA 1AUTC 2Y5FA 2JH0D 4Y0ZE 1TX8A 1ZHPA 4NSYA 2XC4A 3RDZA 1F0RA 2FOGA 3RC5A 1C2LA 3TK5A 1P8VC 3KQBA 1DXPA 2OINA 2RCEA 3U8RH 2XYAA 2TIOA 2ZDAH 2F9OA 1P04A 4ZMAH 3TNSA 4AFUA 1FIWA 1S82A 3ODDA 3UWJH 5CHAC 4I8JA 2A7CA 3OY6U 1SPJA 3URCA 1E37B 1V2PT 1DUEA 1OWEA 2TGPZ 2ZHWH 1ELGA 4UFDH 1ARBA 1B7XB 1HIAB 1KTTB 1O3CA 4IN2A 1SB1H 1G36A 2D26C 3ZZ9A 1DT2A 5J4SA 3LOXA 2BDGA 1WTGH 4ISIH 1MKXK 1TGBA 1VCPA 3MNSA 4ABJA 4AG2A 2CGAA 2THFB 4Y11E 2R0KA 3PO1B 1LPGB 4INLA 1HCGA 6GCHG 2PUXB 1HXEH 1F2SE 4A92A 1DY9A 1TA2A 2FI3E 1C5QA 1O3MA 1O2XA 1ANCA 1IQHA 3VB6A 1YCPM 4ZXYH 4AB8A 4AB9A 1IQIA 1FY4A 1TPAE 5F8XA 2RDLA 1O5AB 2BDIA 4OS4A 1EPTB 2XW9A 1SMFE 5DP7A 3ESTA 1MH0A 1Z1JA 3A7ZA 4O3UA 5GPIB 3VPKA 3GCHB 1ZLRA 1Q31A 2VIQA 2ANYA 2ZDMA 3AASA 1GDNA 1PQ8A 3ZZCA 1A46H 2J92A 1GI6A 1GI4A 1YPHE 1N8OB 1EOLA 2G00A 2OC8A 2BYAX 4ESTE 4KTCA 1D3TB 3SNDA 4D9QA 4X1NU 4DCDA 1AVGH 1BITA 3T26A 1IQLA 1V6DA 2AEIH 1GI2A 3SGBE 1A61H 1XUFA 1L4ZA 1WTHD 5EGMA 4BTIB 1UHBA 2BD5A 1RJXB 3UNRA 1BMMH 2C90B 3MNXA 3A87A 1GMHG 4ZKSU 1C1RA 1BT7A 1N6XA 2OTVA 3GCHC 1PPZA 1QIXB 3LGUA 2ZTXA 1Z8RA 3I77A 1PQ7A 5FAHA 1LVOA 2GTBA 1ZZZA 4ZHLU 4CHAB 3FZDA 1DSUA 3VB4A 2Z9GA 3GCTF 1NTPA 2AIPA 2FLRH 4X1SU 1A0LA 1TQ0B 1NRNH 1HAPH 1YP9A 2QF3A 1C1OA 1TB6H 4MNXA 1PQ5A 3NUMA 2FTLE 2IJOB 2HPPH 2VVVA 2EA3A 2EC9H 1DWBH 2ZO3H 3A83A 3D65E 2BLOA 1P57B 2CN0H 2GMTC 1A5HA 4NSVA 4FU8A 2ZCLP 4ISHH 3E90B 3TK9A 1P12E 1SLUB 2V6NA 3SORA 5HM2A 1GI5A 3BV9B 3SQEE 1CHOG 4NG9H 4Q7YA 3SUGA 3T29A 3GY5A 4JYVH 1L0ZA 2I6SA 1BIOA 1YPJH 4WF8A 2A5KA 2G81E 1AB9B 1K1LA 3FP6E 2FS9A 1BQYA 4U32A 3EQ0H 1O30A 1UK4A 2XC0A 1JWTA 2VIWA 1O32A 2F91A 2TGTA 1O0DH 4UDWH 5T3HA 2FODA 1MZDA 2HLCA 1FI8A 2UWLA 3HK3B 1EP5A 2ZPQA 4IGDA 1C5OH 1Y3UA 1Y59T 4NFEA 1VITG 4X1PU 3BTGE 4I7YH 4DY7B 2XCNA 1VGCC 4AFSA 2W3IA 4Y79A 1LHCH 2F3CE 1GJBB 1YLDA 5EXNA 4K1TA 4DIHH 1VITH 2PR3A 3MNCA 3HPTB 4Y76A 4X0WU 1HFDA 3BG8A 7LPRA 1YKTA 1PQAA 1ZHMA 4CBOA 4A6LA 1YPKH 3LGWA 1QFKH 3A89A 4TYDA 2ANKH 1YPMH 1DWCH 1DFPA 1O33A 1ACBE 1MD8A 4TWYA 4ZKNU 2OQUA 5I25A 2LNCA 2GP9B 1A1RA 3DFLA 1EX3A 1LCYA 6ESTA 1DVAH 2SGFE 1AKSB 3A7YA 3RXVA 1P01A 2A4RA 2UWPA 3A8AA 2ZI2H 2Y5HA 4Q7ZA 1BTZA 1FPHH 1W13U 2BQ6B 2PSYA 1WU1A 2PV9B 4ZKRU 1AKSA 1KLIH 3BG4C 1A4WH 1CHGA 3LGIA 2GX4A 2PKAB 2Z3EA 1O2ZA 3TU7H 4NWLA 3TGKE 1O2IA 3H5CB 1GBBA 2CV3A 1HAZB 4AX9H 1K1OA 1EPTA 2BDYA 2G4TA 1UVUH 2FIRH 3QZRA 4X1RU 5H4IB 2Y7ZA 1K9OE 3NCLA 5DPAA 1AO5A 1OYTH 2A4GA 3RU4D 4WMDA 1D3DB 1ETRH 1FPCH 3QGNB 1KXBA 4J1YA 2F9NA 3SV2H 1O5EH 1HAGE 1QBNA 4YESB 3T25A 3S7HB 1SBWA 1QNJA 1CBWC 2WUBA 2GT7A 1MKWH 1HBTH 4XDEA 3MU0A 4VGCC 2ZIQH 3TJOA 1P9SA 5DP4A 3TGIE 1FUJA 2K1QA 1TOCB 3LH1A 3UNSA 4FUDA 2BX4A 2VIPA 4B74A 1C5NH 3D62A 1O2WA 1ZPZA 3URDA 1C1WH 1NFYA 1J9CH 1WQVH 4FVBA 1XMNB 2G5VA 4NIVA 3QX5H 1O3EA 4WXIA 1GVLA 4WH8A 3LONA 1ELBA 2VGCC 3IG6B 1O2KA 3GCNA 2GCHG 3EA9A 4AYVB 4HI3A 1GL1A 3HATH 1E36B 1XUKA 4IMZA 1XKBC 1MAXA 1O2MA 4X6OA 2ZDKA 1EAWA 2FX4A 1SQOA 1GHBG 1ABJH 5JBTA 2BD2A 1LQDB 1SQTA 2ALVA 2STBE 4E7NA 1EJNA 1MTSA 1J8AA 1H8IH 1GMHF 3Q77A 2FOMB 4FU9A 4GUXA 1K28D 3EDXB 1FAKH 3S9AA 2QXGA 1GHWH 4IC6A 2BVRH 3SJ9A 1B0FA 3QK1A 3A7VA 2P8OC 1C5PA 3OX7U 1EAXA 2R9PA 4B2CA 1TIOA 1BOQA 3SNEA 3ATMA 1DICA 1TONA 4JYTA 1S6HA 3ATWA 1GJ8B 1ANBA 1V2MT 3W94A 1AWHB 1UHBB 1UK2A 1SGEE 1EPTC 2J9NA 3SV6A 1JXPA 1NN6A 1ANDA 1UTOA 1YF4A 5IDKA 1FLEE 1O2YA 2BHGA 3SU0A 2ZGHA 1WAYB 2P16A 2H6MA 2VNTA 1P3CA 1V2ST 1ESTA 1PPBH 2HVXA 4FUEA 3PYHA 1TRNA 1PPEE 1C2KA 1ZRKA 3LJOA 4HGCA 3DT0H 2Y7XA 5E0GA 2JH6D 1GHVH 1UO6A 2D1JA 2VWNA 1O3BA 3O8BA 1EQ9A 3ZVDA 1H9HE 1BB0B 1MKWK 4UFFH 1SG8B 1C1SA 1EAUA 1ANEA 4LK4A 2ZTYA 4E05H 5JDUB 4Q2KA 4I32A 1A2CH 1O3IA 3QDZB 1BMNH 5HGGA 3T27A 1SGNE 1EASA 2WPKS 5EQSA 1OWHA 2VU8E 3KCGH 2F9BH 3UWIA 1CGJE 1J17T 3RXQA 3SV7A 3HKJB 2BDAA 1T31A 3M7UA 1ABIH 1HV7A 1O3LA 2PHBA 1TA6A 1QHRB 1VCWA 1H8DH 1SLVB 2A31A 7GCHG 3RU4T 1L1NA 1C5YB 1Z8JB 2BLVA 3MYWA 3LT3A 4NFFA 2FOBA 4KP0A 3WY8A 5A8YA 4CHAC 1CT0E 1JIMA 1FZZA 1WOFA 1S81A 2NU3E 1AFQB 2QXJA 4SGAE 4FUBA 2ILNA 3OYPA 1MKXH 4DOQA 1IQFA 2FYRA 1RGQA 3MO3A 1CQQA 1HAYB 1MZAA 2ODQA 1ZMLA 1O3PB 3SNAA 4ZUHA 1SGPE 2BZ6H 3ZVCA 1CA0B 3LC5A 1ZR0A 3N7OA 1MTNC 4HFPB 1JRSA 1EJAA 5JBAS 1GMCG 1S84A 3UTUH 2QXIA 5I46H 2PWXA 1SOZA 4TPIZ 5C1YA 5A8XA 1VJAU 2A7JA 3BTWE 2Y81A 1YCPH 9ESTA 5SGAE 2GGVB 1P2JA 1C4Y2 1N8OC 1XVMA 1YBWA 1D9IA 3M5NA 1C2GA 2GDEH 1QGFA 2DE8A 1GJ5H 1AB9C 3ZZBA 1DY8A 1MTVA 3RXHA 1UCYE 3BTEE 1O34A 3OSYA 1BMAA 1F5KU 1YLCA 1ESBA 3GY2A 1BRAA 2PKSB 5FPTA 1BTPA 1H9IE 4SGBE 4CREA 2BD7A 1B5GH 3U1JB 2GD4B 3BEUA 1C1VH 4ZROA 4D7FA 4GHTA 3RLYH 1LHGH 1ZHRA 2SGAA 2O8LA 2Z9KA 3UR6A 3M36A 2DUCA 2A2XH 2BD3A 4JZ1A 4GAWA 2ZGBH 2VVCA 2ZDNA 4OS7A 3HKIB 3ITIA 3KNXA 1W10U 1UVPA 2FP7B 4LZ1H 1O5DH 1FJSA 1TNHA 2EI6A 1D3QB 2XBWA 3MHWU 5AVDA 1GBTA 3VB3A 2GCTC 4ABBA 2YOLA 4O9VA 3B23B 1TBZH 4RN6A 3GDSA 3VB7A 2XWBI 1C2DA 2BB4A 2A2QH 1T8MA 2WPLS 3GICB 2TRMA 1S0QA 1BZXE 1LVMA 2BVSH 4BANB 1Q3XA 2Y5GA 3PWBA 2ZKSA 2Z7FE 4XBCA 3ZVBA 1BRBE 2HOBA