4OS5A

Crystal structure of urokinase-type plasminogen activator (upa) complexed with bicyclic peptide uk603 (bicyclic 2)
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
245
structure length
245
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Urokinase-type plasminogen activator
publication title Dithiol amino acids can structurally shape and enhance the ligand-binding properties of polypeptides.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
total genus 56
structure length 245
sequence length 245
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2014-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os5A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4os5A01
1PPZA 3A7ZA 1FNIA 2VWMA 2GD4B 1O5FH 2STAE 5BPEA 1LVYA 4UFGH 3RMLH 1NESE 3TGIE 1A46H 1DS2E 2JH6D 2VWLA 1EAWA 2ZDLA 5HYOA 2AYWA 3MO3A 1MU8B 1WSSH 1EZSC 5EG4A 1C4Y2 1ZMNA 1JIRA 1UVPA 1ELTA 3M61U 3S7KB 1GBKA 1GBTA 4J1YA 1NS3A 4YESB 1GCTC 5LH8A 4NIWA 4YLQH 2FM2A 1XUKA 3E8LA 2VIPA 2H2ZA 1C1MA 3D23A 1SLXB 4BNRA 1XUFA 2AGGX 4ISNA 1O31A 5LGOA 1ABIH 5SGAE 1OWKA 1EP6A 3KEEA 4OS1A 2ZEBA 1EOLA 1JRTA 1K1MA 3LPRA 4IMQA 5JDUB 1XUGA 1CGJE 3MNSA 1F2SE 1EPTC 4Y6DA 1GVZA 3T28A 3PYHA 1C2HA 3SJ9A 3SU3A 3RC5A 3A86A 3ELAH 4MG3A 5F8TA 2AEIH 2O8UA 4NFFA 3RUOA 1C1SA 1OWJA 1IHTH 1HDTH 1RTFB 4X0WU 1MCVA 2QV1A 4Y76A 2Q6GA 5B6OA 4K1TA 4GSOA 5EQQA 5DKMA 3URDA 2J34A 2Q6FA 1EKBB 1BT7A 1A0JA 1C1UH 3PLBA 6GCHF 1O30A 4KKDA 8KME2 2G51A 1KXFA 3F9EA 2OC8A 2CXVA 2ZI2H 1ZGVA 3B9FH 5A09A 4CRDA 3OU0A 2P94A 1F92A 3A85A 4E7NA 1SGYE 3HATH 4GHTA 3C1KA 3BSQA 1P04A 2PV9B 5GXPA 1XXFA 2FOFA 4OS7A 4CH8B 3GYMA 3VFEA 1BMAA 1O5GH 2Y81A 3F9HA 4DT7B 1TWXB 1O3FA 1TNHA 1AU8A 1L1GA 1X7AC 2BDBA 2R0LA 1GJDB 3B8JA 3M3TA 1TBQH 2BD4A 1MKXH 1L0ZA 4K60A 3BTQE 3EE0B 2J94A 2BYAX 4CREA 1GBIA 1T4UH 4JZFH 2AS9A 1HAYB 1ELDE 4JZ1A 1BTZA 1O5DH 1W14U 4ZHMU 2VIOA 3MH5A 3MNCA 3TVJB 3ZZDA 1HXEH 1AB9B 2PGBB 1GDQA 1MCTA 1TLDA 1O39A 1Y3UA 1YCPM 4SGBE 1S0QA 3SORA 1WAYB 1J14A 1TQ0B 3FZDA 3BTEE 2SGQE 4E7RG 1N6XA 1TPSA 3SGQE 5DGJA 4X1NU 1HPGA 1D6WA 2VGCC 1BZXE 3O8CA 3PTNA 5PTPA 1TBZH 1AVGH 5DK1A 1Q3XA 1TOMH 1DSTA 4SGAE 2JETB 2FEQH 2UWOA 1SG8B 3QZRA 1SGFA 5J4SA 1C5TA 1PQ8A 1ETRH 2FI3E 3DHKH 1HAOH 3PMBB 2VVCA 1AWFH 1MH0A 2DE8A 1THRH 4K1SA 1UK3A 3M5OA 3SU4A 2QYIA 4TPIZ 1LDTT 3JZ1B 2FODA 3GCOA 5F8ZA 1G36A 3SU5A 1KDQA 1NN6A 1AVWA 3QUMP 1OSSA 3A87A 2ZDNA 2ZHQH 1KTTB 5FPSA 1MQ5A 3QGNB 1C5WB 1HIAA 1NY22 3GY6A 3BIVH 4U30A 1O5CB 2ZHDA 2FZZA 2K1QA 2G52A 1G3EA 1MTUA 1SR5C 3LT3A 1A7SA 2GZ7A 3RMNH 1KLJH 1CA0C 3T26A 3UQOA 3WY8A 4M7GA 3LGWA 1FPHH 1EX3A 2WYJA 2GZ9A 2PSXA 1YPJH 3A80A 4ZKSU 1LVBA 1O3DA 1DOJA 1F5RA 5HM9A 1W7GH 3SU6A 2P3FH 5FBEA 3UWJH 1UO6A 5DG6A 3ZZ4A 2PLXA 1AB9C 4BTIB 2A0QB 1S6HA 2EEKA 3H5CB 4H6SB 3PWCA 3OSYA 1AD8H 4FXGH 1GG6C 2BZAA 3MU8A 2QAAA 1SHHB 2LPRA 4DVAU 2PTCE 3H7OA 1D4PB 1J15A 1UK4A 2QXHA 1PPCE 3SV9A 2F9NA 1MTWA 1GHVH 5FHTA 1GBLA 5FPYA 3O8DA 1K1IA 2O8TA 3MNBA 3A89A 2A45B 3I77A 2JETC 1FAXA 2G00A 4K1EA 1DUAA 1LCYA 1D3PB 1C1VH 2BVRH 1V2JT 4WH6A 1QQ4A 2W3KA 1P9SA 2ZDMA 4FUBA 1P2IA 1UTJA 3T5FH 4YTAA 1ETTH 4CRGA 3V0XA 3RXUA 1C1WH 2ZGBH 3BIUH 1E34B 1S83A 5ESBA 8GCHG 2IOTA 4JCNA 4YOIA 4QT8C 1ESTA 2BQ6B 4OS6A 1BCUH 1O2ZA 2BQ7B 1UCYK 4B75A 4BOHA 1C5YB 1GJAB 1OYTH 3PO1C 1GMCG 2ZF0H 4B73A 2BY5X 4TWWA 8LPRA 3BF6H 3PMJA 1VCWA 1LPGB 1TMTH 5IDKA 5T6FA 1MAXA 3NZIA 2AFQB 2Z3EA 3OTJE 5AF9H 1MTVA 1Z8IB 2CHAB 3A8BA 1C2DA 4UFEH 1ELBA 1FAKH 2BTCE 3FP7E 1EUFA 1C9PA 4D9RA 1V2WT 4BAHB 1C2KA 2BB4A 1IQHA 1B7XB 1FUJA 2PTNA 2YNAA 1BJVA 1Y5AT 1TOCB 1LVOA 1ETSH 3M5MA 3VB3A 3MU4A 1G32B 3RC4A 3MU5A 5EXNA 3KQBA 2VIWA 4BTUB 1FIWA 1GWAA 2G4UA 2P3UB 3AVZA 1SGTA 1J16A 1XMNB 2Y6TA 5EW1H 5L2YH 2CJIA 1DLKB 1EJNA 3JZ2B 1MAYA 4UDWH 1NRRH 4XSKU 5AFZH 1XKAC 2F83A 2ZU1A 5GPIB 3OY5U 3SJIA 2M5TA 1BHXF 4X8TH 1U6QA 1BITA 2XYAA 3EA9A 1PQ7A 2BD7A 1PYTC 1TALA 2Y7ZA 2ZU4A 1TABE 2BVXH 3DFJA 1P2QA 2P59A 2NU1E 2SGPE 2ZCKP 1NT1A 3Q3KA 1O0DH 2HPPH 5CMXH 2VNTA 1Q31A 3U9AH 2R0KA 5A8XA 3AW1A 4X1SU 1V2TT 2FI4E 1GMCF 1O2UA 4INHA 5EQSA 5T6GA 1UK2A 3MFJA 4NWLA 1ZR0A 2Z3CA 1UTOA 3GY7A 1E0FD 2SGEE 1XVOA 1O2KA 2Z9JA 3BEUA 3AAUA 3LC3A 1O5EH 2TGTA 1W10U 5DP3A 2ZQ2A 2G8TA 4D9QA 2CHAC 2QF3A 2UUFB 1AIXH 3SI4H 3GISB 3RXGA 1K1NA 5AHGH 1UVUH 4XBCA 2H5DA 1BRCE 1XUHA 1HBTH 3M7TA 2BY8X 4I8HA 5AVDA 3UNRA 1DWEH 1SC8U 1Z8RA 2VVVA 1DXPA 3ZZ3A 1GBJA 3A81A 2A5IA 1VITG 4OS2A 5GIBA 1QBVH 4WVPE 2STBE 3GDVA 1EQ9A 2AGEX 1HNEE 5JBTA 1YF4A 4O3TA 3RXRA 5HGGA 4ZAEA 2FOMB 1BOQA 1C5PA 1T7CA 1GHBG 2BD2A 3BTWE 4RKOB 1QB9A 5JB8S 4B71A 2GCTC 1OKXA 1KLIH 2D2DA 1VGCC 3ZZ8A 3P8NA 1N8OB 3ESTA 1ZSJA 1WQVH 1Y3WA 2RCEA 5EPNA 3VB6A 1NFUA 2G5NA 2QC2A 2FOAA 1KLTA 4I31A 1ARBA 1GHYH 1Q2WA 5CHAC 1LHFH 3P92A 2ZECA 3S9BA 3MOCA 2TGPZ 1AO5A 1SPJA 2P16A 3S0NA 2A2XH 4OGXA 1FONA 5DP8A 4ABDA 5JBAS 1SGQE 1O2SA 2RA3A 2WPKS 5TCCA 5I25A 3RP2A 1DWBH 1JMOH 4GUXA 1YPHC 3H7TA 2HVXA 2G81E 2OC1A 1T8MA 1QL7A 2V3HH 1SSXA 3RXLA 1GDUA 1HJ9A 2ODQA 3ZZAA 1FN6A 1SQAA 1TPOA 4CRAA 3A7VA 3VPKA 1V2OT 4Y11E 2Z9LA 1MU6B 4INLA 4JZDH 4BXWA 2LNCA 3TK9A 2XC4A 1W0ZU 3HKJB 2GP9B 5C5OA 5A8YA 4O9VA 1AVXA 1S6FA 2VU8E 1NFYA 1F7ZA 1MKWK 4KTSA 2C8WB 4IW4E 2Y5GA 2IN2A 1O3IA 4FU7A 3DT0H 1GI9B 1FY3A 2BZ6H 1GCTB 4UD9H 4JK6A 1P2MA 4NZLA 1OX1A 1VITF 1EJAA 1TNGA 1IAUA 1FY1A 4IN1A 3MU1A 1P2NA 2WPIS 3F9FA 3RXTA 1WCZA 1Z1IA 2BHGA 4OS5A 2OQUA 1WYKA 2JKHA 2QXIA 2P3TB 5JYIA 1GHBF 2ZKSA 4TPYA 2C4FH 3VB7A 4HGCA 3S7HB 2ULLA 5GWZA 1CA8B 1YGCH 2BLOA 4U32A 1BRAA 1EPTB 2FLRH 4WJG2 1OOKB 3CENA 1SVPA 4NIVA 2D8WA 4O3UA 1SLWB 3FZZA 3CS7A 3ODFA 4B74A 1EZQA 2OTVA 4X1RU 3RM2H 4F4OC 2BD3A 1D3DB 3PWBA 1QRXA 3SU1A 1WQSA 1WV7H 4FUIA 3SV6A 3ZZ7A 3GICB 1O2VA 2OP9A 1GI5A 2BX3A 3FAOA 4CRBA 3MO6A 2R3UA 5F03A 1UCYH 1TRYA 1DT2A 2ZZUH 1JIMA 1WU1A 3RXDA 1GI8B 1RS0A 2AIQA 3U8OH 3W94A 3LJJA 1WUNH 1A3BH 3SQHE 3P95A 2H9TH 4AZ2B 2GX4A 5ESTE 2ODYB 4WH8A 1HAIH 6CHAB 1GJCB 2XC0A 3GCTF 1ELAA 4BAKB 2BY6X 1HJAB 1MQ6A 2R3YA 4AGKA 2HNTE 2XWAA 1CHGA 2B8OH 2NU2E 3M3VA 3HKIB 3GY8A 2BOKA 4NCYA 4Q80A 1TAWA 4XBBA 1V2RT 3P8GA 1O2RA 4NA7A 1NRSH 1YPGH 4I8LA 3ZZCA 1BBRH 2FOHA 1LHGH 4AB8A 5C5NA 1O2NA 2J4IA 1AKSB 1OP0A 1RFNA 2FOBA 4UEHH 3URCA 3ZYEA 1IQKA 2FS8A 3UNSA 1PQ5A 1HAVA 3DFLA 3RM0H 2FOEA 3EQ0H 5I46H 3ZZ9A 4AFZA 3M3SA 1NU9A 2Y82A 1TNLA 3Q76A 2Y5HA 1SQOA 1O2HA 2BD8A 3IG6B 4X8VH 5FX5A 1QHRB 1ZJDA 1SLVB 1V2LT 1GBDA 2WV5A 3BTTE 1QJ1B 4AOQA 2PKAB 1GPZA 3D65E 2FX4A 4ZROA 2J2UA 2A7CA 4Z0KA 2ZPQA 1YPKH 5C20A 4YZUA 2Y5FA 4WWYA 2GMTC 4YT6H 2BXUH 3TJNA 2VGCB 1HFDA 1ZOMA 3A7YA 4ZKRU 1CGHA 4O97A 1NRNH 4NA9H 1H1BA 3F1SB 3OYPA 4LXBH 4X2YA 1OXGA 4X2VA 3BEIB 1K28D 3UOPA 3M36A 3M7QA 3SNAA 3L6PA 6CHAC 4B2CA 3UFAA 5HMAA 3ZVGA 5FXLA 1HJAC 1NU7B 1P01A 1E35B 2Q1JA 2PUQH 4FUHA 3PM3A 1THSH 3OX7U 4Q7ZA 3HPTB 3UY9A 1GJBB 1QURH 2Q6DA 1INCA 1CBWC 2DUCA 2B7DH 4ABHA 4Y8YA 1AN1E 2W7SA 1CGIE 1O2WA 3GYLB 1C5QA 1P2JA 4X2XA 1O3AA 1L2EA 2VWNA 1F0UA 4NIYA 2Z94A 1O3OA 3GDSA 1NZQH 2ZDVH 3SI3H 1GI2A 7KMEH 1CA0B 1CO7E 1TPPA 1UVSH 1O2PA 3L3TA 1P57B 1CU1A 3SUEA 1IQMA 1JXPA 1XX9A 1UVTH 3M5LA 1V2UT 4B76A 2ODPA 1DVAH 1FDPA 4ZHAA 1ZZZA 2ANWA 4MPUA 4GPGA 1JBUH 3SU2A 4MPXA 5DP4A 1KTSB 1VCQA 1GG6B 4XOJA 2ZWLH 4KTCA 5GDSH 3NK8A 4E05H 1J9CH 3RLWH 3NWUA 2C3SA 3K6ZA 4VGCC 1KXAA 3EDXB 4CRFA 2WPHS 1EB1H 4IC6A 4MVNA 2W7UA 3RDZA 9ESTA 2KAIB 1H9IE 2ZFRH 4X2WA 5A8ZA 2Z9GA 1MTNC 2ZU5A 1CHOG 1QBNA 1UTPA 2OINA 1CE5A 1XUJA 3VEQB 3TNTA 3ATLA 4MNWA 1A0LA 2XWBI 3LGVA 1C2IA 4MNVA 2WV4A 1DM4B 2FTLE 3RXJA 1OS8A 4YT7H 3BTHE 1NFWA 1FY4A 2NU0E 2UWLA 4DOQA 4U01A 4ASHA 2CGAA 2B9LA 3UOUA 2GCHG 2VINA 1HAZB 4UONA 3KQDA 2VIQA 3U69H 2BD5A 2NU4E 3F9GA 1S81A 2QN5T 5DP6A 1AMHA 3PO1B 2GV7A 4K3JA 1OWHA 2ANKH 1SGDE 3BG4B 1TNIA 4FUJA 1AQ7A 1SGPE 1Y3YA 3FFGA 5EQRA 2IPHA 3SNDA 3QLPH 1NO9H 1JWTA 1O3MA 2ALPA 4ESTE 1K1JA 2XCFA 3P17H 1YLDA 2WPMS 1DUEA 1TNKA 1T32A 1GMDF 3ZVFA 4IN2A 2HRVA 1EAXA 3SU0A 4DJZB 4Q2KA 4X6OA 4ZMAH 3SV7A 5K0HA 2VH0A 2BY7X 2FS9A 4DW2U 2AH4X 1LPKB 3KF2A 1HLTH 1K1LA 1D3TB 3RXFA 3GDUA 1L4DA 1V2KT 2UWPA 1Z7KA 3SW2B 1PFXC 1GI7B 1EJMA 3QZQA 2HNTF 1IQNA 1P0SH 5EW2H 1ANEA 1C2GA 3CP7A 1Z6EA 1O2GH 3K6YA 1QFKH 1NTPA 1DPOA 2JH0D 3SGAE 3UR6A 3A8DA 3T25A 2V35A 1Y5BT 1W2KH 1IQFA 1H9LB 4AB9A 1CHOF 2Z7FE 1YLCA 2C8XB 3RU4E 1MUEB 3O8BA 1YPLH 3MI4A 2A32A 3P8FA 1O38A 1ORFA 4RKJB 3S9AA 4X8UH 2FP7B 3OY6U 1FMGA 5E0HA 4TYDA 2XC5A 4YOGA 1RTLA 1OYQA 1S85A 2GCHF 1QGFA 1ZRBA 1SGNE 2XBVA 2XXLA 2ZHFH 3TK5A 3A88A 3RXBA 3UUZA 2HPQH 3SJ8A 1GHAF 4YOJA 3VB4A 1VCPA 1DANH 1Z8JB 2FPZA 1LPZB 5E0JA 1ZGIA 5JBBS 1HJ8A 2FLBH 2AERH 3BG4C 3T2NA 3MH4A 1EPTA 1F5LA 2OXSA 4MPVA 1P9UA 1ANBA 2CV3A 2VIVA 3QO6A 1QRWA 1GMHG 5EU8A 2BX4A 1WTGH 2AMDA 2FOGA 1L1NA 1SGFG 2F9VA 2SNVA 3E91A 3SBKA 3LGTA 4NIXA 1K9OE 2H1UA 1SB1H 3ZV9A 1YBWA 1W11U 5E0GA 5T6DA 5JPMH 3UWIA 2XTTB 1F0RA 2FXRA 2B5TB 1P09A 3PROA 3UPEA 3A7WA 2WPLS 1A5IA 4AFSA 3HK3B 2XBYA 3BTME 4WMFA 1RIWC 2Z9IA 1PYTD 3RXSA 4AX9H 1PPEE 4NGAH 3N7OA 3EA8A 5F6MA 5E2PA 2ZTYA 1AFQC 1C2MA 1ZYOA 2ZC9H 2BDGA 5A0AE 1O37A 3ATWA 1N1LA 1FV9A 2AMQA 3RXCA 2GCTB 3TJUA 1WTHD 4RSPA 4K2YA 1VGCB 2QA9E 1DLEA 4AG2A 5EXMA 2OLGA 4TWYA 4D76A 1AI8H 1FY8E 2O8MA 4A92A 1P3CA 4K8YA 2VVUA 1A61H 1SBWA 5DP9A 2IJOB 3A82A 3BTKE 2GT8A 2HNTC 5CHAB 1LQEA 2PWXA 5GJ4B 3NXPA 2J38A 2FTMA 1TX6A 3ITIA 4DCDA 3MO9A 5E8EH 1ZMJA 3HK6B 3L33A 4D8NA 1AKSA 3KQEA 6ESTA 7GCHG 3QN7A 1TX7A 3ZZ5A 3KCGH 2R2WU 1S84A 1AWHB 4X6MA 1NM6A 1Z1JA 5TJXA 4WXIA 1P8VC 1ZSLA 1C4V2 2FOCA 2A2QH 2O8LA 2ZIQH 3GCHC 1BHXB 3BV9B 3NCLA 1UTLM 2ZGXH 1RD3B 1A5HA 1BJUA 2BDYA 1GMHF 1TGNA 1YKTA 2ZCHP 1GJ6A 2ANMH 5JB9S 1KSNA 1XM1A 3RMOH 3UREA 1G3BA 1TONA 4FUFA 4ABEA 3K2UA 4X6NA 4X6PA 1DITH 1GCDA 2ZFTA 3TK6A 3TGJE 2AIPA 4FVDA 3M7UA 3QWCH 4KTUA 4IS5A 3ZVBA 2BD9A 3RXHA 4ZKOU 1D9IA 5ABWA 1GGDC 3MHWU 4GVUA 1YYY1 1QQUA 4TY6A 3TNSA 1O36A 3MH7A 2O8WA 3G01A 2RG3A 3TJVA 1TFXA 3PTBA 1ZPZA 1O3LA 1NRPH 3T27A 2HWLB 1HYLA 1C2JA 1BTWA 4AGJA 2P8OB 1QCPA 4BAOB 2H9HA 5H4IB 1EATA 1GI6A 4MPWA 1P10A 1BTHH 2NWNA 1ELCA 1GVKB 1YPEH 3BTFE 3SV2H 3ZV8A 3GOVB 1G9IE 3M35A 3PMHB 4HI3A 2ZCLP 1C1OA 4DIHH 2A4RA 2FIRH 1SHYA 3QGJA 4YLUA 1HIAB 1LHDH 4K69A 2OUAA 4MLFB 1O2LA 7GCHF 1XVMA 2XBWA 1KYNA 1TA2A 3RXPA 1J8AA 3SZNA 1QA0A 5FX6A 1T31A 1TRMA 3C27B 2VIDA 1THPB 3NKKA 1OWIA 3E1XB 1V2NT 1SQTA 2UUYA 3W95A 2BLQA 3Q3XA 1MZDA 3RXVA 1KXBA 3DUXH 2H9EH 3GCTG 1QL9A 1MD8A 3RLYH 1A3EH 1D3QB 2DE9A 3UR9A 3PLKA 1SGRE 4Y71A 3E90B 3ZYDA 1Y3XA 1QNJA 1PQAA 4RN6A 5EOKA 1O3NA 4LK4A 3SJKA 9LPRA 4H4FA 1FPCH 1GBHA 3TIUA 2F91A 3UTUH 5HM2A 1FIZA 1H8IH 1Y3VA 4B2AA 1PPBH 1M9UA 2GTBA 1QB6A 2EI8A 4I33A 4MDSA 2KAIA 4ISLA 1A4WH 3A83A 2BLWA 4ZXXH 1AFEH 1YC0A 1A1RA 4I7YH 1S82A 1H8DH 4YO9A 1W12U 1O5BB 1A2CH 2P8OC 4X1QU 3T62A 1HCGA 1QJ7B 3RXAA 2ZO3H 2BDHA 4NFEA 1DY8A 1DICA 3RXEA 1NRQH 1OWDA 1MD7A 2R9PA 2ZFFH 2UUKB 1UTKA 1P02A 1V6DA 1GVLA 1ZJKA 3V12A 1C5OH 1GHWH 1SGIB 2F3CE 3MU0A 2F9OA 2TRMA 4JK5A 4A1TA 4WY3A 4JYTA 3ZZBA 1Z8GA 4UE7H 4CR9A 3EGKH 4PROA 2BLVA 4Q7YA 2GMTB 1C2LA 5IYTA 1AUJA 1MBMA 1F0TA 4KP0A 1HXFH 3SJOA 3V7TA 4HZHA 5C2ZA 1E37B 1ELFA 1O3KA 1TBRH 2GDDA 3PV4A 5JBCS 2B0FA 3V13A 4AYVB 3K65B 2A4GA 3MTYA 3EYDA 2Y7XA 1G3DA 2FMJA 2C90B 2GVFA 2W26A 3RU4T 3GY2A 4O03A 2XNIA 1DDJA 1K22H 1C4U2 1CBWB 4UFFH 1SMFE 4BTTB 4B2BA 3EAJA 1C5LH 2TBSA 1QB1A 1KIGH 1N6YA 4I8JA 1NFXA 3VGCB 3RXMA 1HAPH 3PLPA 5DJ7A 2NU3E 1BUIA 3E3TA 3I78A 3ENSB 1BA8B 3F6UH 1JRSA 1GJ4H 5J4QA 4ZXYH 1OWEA 1V2VT 1O5AB 3SNEA 1BRUP 1CVWH 5CE1A 3S69A 2AGIX 5DP5A 1O34A 1TB6H 2FESH 1ANDA 1KXCA 3BTGE 2OQ5A 3RXQA 1NC6A 1C1QA 3ATMA 1C5VA 1YM0A 1VITH 1ELEE 1TMUH 4FVBA 4ABBA 2QXJA 1EAUA 3KIDU 1DX5M 1ZPBA 2VWOA 1ANCA 2WPJS 4VGCB 2A31A 2ANYA 2ILNA 2G55A 1PPFE 3RXOA 3LOXA 4XDEA 1B5GH 2V6NA 1P2OA 4DGJA 3TU7H 3TPIZ 5C3NA 2QF0A 1CT0E 4A5TS 1GI0A 1T8LA 1MTNB 1MTSA 8ESTE 4LZ1H 4Q7XA 4ZUHA 3GY3A 1UHBB 5C1UA 4GAWA 4I8KA 1HAXB 1K1PA 2GZ8A 1HAHH 1V3XA 2BY9X 1O2YA 4R0IA 1Y5UT 4FU8A 4WF8A 1QA7A 2GDEH 1FQ3A 1O3GA 2WUBA 4XFQA 2EC9H 1SI5H 2A1DB 1CQQA 1C9TA 3R3GB 2SGDE 5AFYH 4DURA 1BRBE 1TGBA 1DFPA 3MNXA 3VGCC 2FYRA 2PGQB 4AFUA 5L2ZH 4JMYA 1MMJN 3IITA 1L1JA 1BTYA 3SQEE 1FXYA 3UIRA 1RJXB 2D1JA 1IOEA 1FN8A 1O32A 1GMDG 2TGDA 3LDXH 1O2XA 4ZKNU 5F8XA 2W3IA 1GI3A 4OS4A 1UJ1A 3SGBE 1YPHE 1V2PT 4FUDA 1C1TA 1GBFA 2J95A 2THFB 5EGMA 3MH6A 1LHCH 1T8OA 1EZUC 1VJ9U 1BTXA 3LGUA 3SV8A 1GJ9B 4XE4A 1O3BA 2GV6A 2VJ1A 1GJ8B 3HGNA 5T3HA 2ZA5A 3KNXA 1HAGE 3FP6E 3KGPA 1FY5A 4B1TA 2VH6A 1EP5A 4ABAA 2OBOA 4UFDH 1E36B 1V2ST 3ODDA 3LGIA 1C1NA 4Y7BA 1QTFA 2CF8H 3T29A 1G30B 2O9QA 2SFAA 3UNQA 3TJOA 1F0SA 4BXSA 3ATIA 4ABFA 1ACBE 1SL3A 1BIOA 4IMZA 3SO3A 1G2MA 4INKA 4CBOA 3LIWA 5C1XA 1AZ8A 1EB2A 1GBAA 1B0EA 2BQWB 1G3CA 2SGAA 3QX5H 4NG9H 1MBQA 4I32A 2ZHWH 3A84A 1SLUB 1MKWH 1ELGA 1UTQA 1LTOA 1BMMH 2CF9H 3LH1A 1VR1H 3TH2H 1CT4E 4BAMB 1A0HB 1O2OA 1E38B 3ZVEA 3RXIA 1BB0B 1GHAG 3FVFB 4FU9A 1EZXC 4H6TA 1GI4A 1O2MA 4I8GA 3RC6A 1XUIA 1P2KA 3MYWA 4NA8A 1DY9A 1YCPK 4K5ZA 2GGVB 1IQIA 1UMAH 2ZFQH 1QL8A 5C1YA 1UVOA 2Y80A 3SHAH 1DWDH 2UUJB 1IQLA 3Q3YA 2F9PA 4K8BA 2YOLA 4ISIH 1XXDA 2A7JA 3TGKE 2ZPRA 1S0RA 2HALA 1UCYE 7LPRA 2GKVE 4J2YB 1LQDB 3AAVA 1AUTC 1C5MD 3RXKA 4DG4A 1K2I1 1TGCA 4Y7AA 2BDCA 1BTPA 2A7HA 1F5KU 4AORA 1RIWB 4CHAB 4A1VA 2YNBA 1YPMH 5LPFA 1ZTLA 3AW0A 1ZTKA 3LC5A 1V2MT 1AFQB 1ESAA 1GL0E 1MZAA 2P95A 3ZZ6A 4ABIA 1O35A 4JZIA 1QR3E 4ZHLU 1AY6H 5A0CA 2SGFE 5EPYA 3LJOA 2ZNKH 3SN8A 1W7XH 3NUMA 3KN2A 3M37A 1BMLA 2HLCA 1BBRE 1C1PA 3U1JB 1C1RA 1DWCH 2A5KA 2EA3A 5LPRA 1ABJH 1QRZA 4LOYH 2ASUB 5L6NH 7ESTE 1XKBC 3DD2H 2VB0A 4IGDA 3LGYA 1C5XB 1VZQH 5DP7A 2ESTE 1O2QA 2FWWA 3SNCA 3DA9B 2PW8H 2Z9KA 3SHCH 4CRCA 2HOBA 1HAVB 1ELVA 1T4VH 1A5GH 2BXTH 2OD3B 2SNWA 1P05A 3GCHB 1GBBA 3CS0A 2W5EA 1FI8A 1ESBA 1GHZA 2ZPSA 1GHXH 3LONA 2ZG0H 4DIIH 3SUFA 2QGRA 1PPHE 5FPTA 4GLYA 1EAIA 3PMAB 1O2IA 1O2TA 4CR5A 3E0NB 5ETXA 5L30H 2PUXB 5TCAA 1P3EA 1RXPA 3I29A 2G4TA 1HGTH 1O3EA 4Y8ZA 3V3MA 2ZFSA 3NPSA 2P93A 1NPMA 2ZDAH 1K21H 2CMYA 3LU9B 1SFQB 1GGDB 3MMGA 1AZZA 1TA6A 4CHAC 1LVMA 2G5VA 3BTDE 2F9UA 4FUCA 1TGTA 1Z6JH 4CBNA 3STIA 2BMGB 1ZMLA 1O3CA 5EODA 1C5ZB 1ZPCA 3ZVCA 4ISOA 3VXEH 2TGAA 5LPEA 1P12E 4U2WA 1NROH 4ABGA 1L4ZA 5K7RA 3BEFB 4Y0YE 4MTBA 1WOFA 1BBRK 1EXFA 1GDNA 1SOZA 1SGEE 2CN0H 4NSYA 2PFEA 3P70B 4AG1A 1FZZA 1IQGA 5FCKA 4Z6AH 2PSYA 2BDAA 1QJ6B 1AHTH 1GL1A 1SFIA 2EI6A 5A0BA 3QTOH 1J17T 2H6MA 3STJA 5E2OA 2FO9A 3U98H 3RMMH 1SOTA 3KL6A 2A4OA 2BOHB 1OP2A 3O8RA 3BG8A 5GCHG 4HTCH 3Q77A 4MNYA 2RDLA 2ZQ1A 4OGYA 2ZU2A 6LPRA 2R2MB 1H9HE 1TYNA 8GCHF 4X8SH 4R8TB 2XCNA 1O3HA 1ARCA 3P6ZB 4WMEA 4LZ4B 1OP8A 2PKAA 3VB5A 1TGSZ 1TNJA 1RGQA 2QCYA 4A7IB 4AFQA 4A1XA 2WUCA 4A6LA 2I6QA 3TH3H 3ZVDA 3GCNA 1V2QT 1TIOA 1GBCA 2I6SA 3AASA 1YP9A 2OBQA 3P8OA 1RRKA 2TIOA 3VXFH 2ZTZA 2FI5E 1G2LA 3SUDA 3D49H 2QY0B 1GBEA 2XRCA 3QK1A 3B23B 1W8BH 4NSVA 1P06A 3TITA 3F68H 2ZFPH 5G4BA 1UHBA 1ZHMA 1G37A 1IHSH 1O3PB 3ATKA 2OCVB 5FCRA 4JZEH 4Y0ZE 1LKBA 2ZGCA 3S9CA 4MQAA 1IQJA 1LKAA 3Q00A 4F49A 4GCHG 1GJ7B 3EA7A 1O33A 4HFPB 1KDQB 1ZLRA 4DY7B 4WMDA 3A7XA 1PPGE 1UTNA 4TY7A 1DSUA 1RTKA 4IBLH 1AGJA 1MKXK 3HGPA 4ABJA 3UQVA 2C8YB 3K9XB 5BRRE 4Y79A 2QXGA 3QTVH 1ZTJA 2V0BA 4BAQB 1BQYA 1S5SA 1TMBH 4ISHH 2ZU3A 3A8CA 4AYYB 1H4WA 4KELA 1HRTH 1TE0A 1T8NA 3TH4H 1QBOA 3SUGA 2A4QA 5GCHF 4IC5A 1C5UA 1YCPH 1K1OA 1FJSA 1B0FA 4NZQA 4JYVH 2RA0A 2PKSB 4E06H 4JYUH 3FP8E 1CT2E 1C5RA 2A5AA 1WBGB 1AE8H 3U8TH 4D7FA 3QDZB 4Y10E 2ZTXA 4Y8XA 1W3CA 3LKWA 2F9BH 1AE5A 2Z3DA 3KHVA 1D6RA 1C5SA 1GJ5H 4NWKA 4X1PU 1ZSKA 1IQEA 2ZDKA 3E16B 2FDAA 1KXDA 2BVSH 2D26C 1ZHRA 1W0YH 3E6PH 2ZHEH 3IWMA 1KY9A 2PR3A 3A8AA 3BN9A 2J9NA 1VJAU 4H42U 2EI7A 1KXEA 3D62A 4KGAA 4THNH 3FANA 1TPAE 3TLOA 2ZGHA 1HB0B 5EXLA 2FX6A 1FLEE 1BDAA 1C2EA 4BANB 2C8ZB 3A7TA 2XW9A 4FUGA 1CSOE 3LH3A 2ZGJA 1ZHPA 2HGTH 4AN7A 1UTMA 3KQCA 2JH5D 2V3OH 3R0FA 1EOJA 4XBDA 1P11E 4GCHF 4ZH8A 1ZRKA 4MNXA 1BMNH 1O2JA 1TQ7B 1O3JA 1Z71A 1DXWA 1QIXB 4CH2B 2ALVA 2XBXA 1GI1A 1BTUA 3E0PB 1Y8TA 3GY5A 2H5CA 2QIQA 2J92A 1GBMA 3PB1E 2C93B 3M5NA 2WINI 3ZVAA 5DPAA 5C67A 2FYQA 3SNBA 1C5NH 1SGCA 1TRNA 1N8OC 1DE7H 1OPHB 4D7GA 3U1IB 2AMPA 2TPIZ 2PHBA 3SOSA 2OC0A 1LMWB 4WXVA 1EASA 3MWIU 1LO6A 2PKSC 1ID5H 1Y59T 1QY6A 1C2FA 2BM2A 5FAHA 5A2MH 3GY4A 5HXFA 4YM9A 1PJPA 1HUTH 1LHEH 2Z6BD 2BDIA 4FUEA 2GT7A 2ZP0H 6GCHG 1P03A 3U8RH 5DO4H 2WYGA 1JOUB 4GHQA 1HV7A 1TX8A 3RU4D 1W13U 5FBIA 2OC7A
chains in the Genus database with same CATH superfamily
1PPZA 3A7ZA 1FNIA 2VWMA 2GD4B 1O5FH 2STAE 5BPEA 1LVYA 4UFGH 3RMLH 1NBMD 1NESE 3TGIE 1A46H 1DS2E 2JH6D 2VWLA 1EAWA 2ZDLA 3KYFA 2AYWA 3MO3A 5HYOA 1MU8B 4TT3D 1WSSH 1EZSC 5EG4A 1C4Y2 1ZMNA 3F2HA 1JIRA 5KEDA 1UVPA 1ELTA 3M61U 3S7KB 1GBKA 1GBTA 4J1YA 1NS3A 4YESB 1GCTC 5LH8A 4NIWA 4YLQH 2FM2A 1XUKA 3E8LA 2KCAA 2VIPA 2H2ZA 1C1MA 3D23A 1SLXB 4BNRA 1XUFA 2AGGX 4ISNA 1O31A 5LGOA 1ABIH 5SGAE 1OWKA 1EP6A 3KEEA 4OS1A 2ZEBA 1EOLA 1JRTA 1K1MA 3LPRA 4IMQA 4FOUC 5JDUB 1E1QD 1XUGA 1CGJE 2IJD1 3MNSA 1F2SE 1EPTC 4Y6DA 1GVZA 3T28A 3PYHA 1C2HA 3SJ9A 3SU3A 3RC5A 3A86A 3ELAH 4MG3A 5F8TA 2AEIH 2O8UA 4NFFA 3RUOA 1C1SA 1OWJA 1IHTH 1HDTH 1RTFB 4X0WU 1MCVA 2QV1A 3SYJA 4Y76A 2Q6GA 5B6OA 4K1TA 4GSOA 5EQQA 5DKMA 3URDA 2J34A 2Q6FA 1EKBB 1BT7A 2LP6A 1A0JA 1C1UH 3PLBA 6GCHF 1O30A 3OEED 4KKDA 8KME2 2G51A 1KXFA 3F9EA 2OC8A 2CXVA 2ZI2H 1ZGVA 3B9FH 5A09A 4CRDA 3OU0A 5KGOA 2P94A 1F92A 3A85A 4E7NA 1SGYE 3HATH 4GHTA 3C1KA 3BSQA 1P04A 2PV9B 5GXPA 1XXFA 2FOFA 4OS7A 4CH8B 3GYMA 3VFEA 1BMAA 4FETA 5B6LA 1O5GH 2Y81A 3F9HA 5GNDA 4DT7B 3PV5A 1TWXB 1O3FA 1TNHA 1AU8A 1L1GA 1X7AC 2BDBA 2R0LA 1GJDB 3B8JA 3M3TA 2KR7A 1TBQH 2BD4A 1MKXH 1L0ZA 4K60A 3BTQE 3EE0B 2J94A 2BYAX 4CREA 1GBIA 1T4UH 4JZFH 2AS9A 1HAYB 1ELDE 4JZ1A 1BTZA 1O5DH 1W14U 2JDID 4ZHMU 2VIOA 3MH5A 3MNCA 3TVJB 3ZZDA 1HXEH 1AB9B 2PGBB 1GDQA 1MCTA 1TLDA 1O39A 1Y3UA 1YCPM 4SGBE 1S0QA 3SORA 1WAYB 1J14A 1TQ0B 3FZDA 3BTEE 2SGQE 4E7RG 1N6XA 1TPSA 3SGQE 5DGJA 4HG6A 4X1NU 1HPGA 1D6WA 2VGCC 1BZXE 3O8CA 3PTNA 5PTPA 2CK3D 5EJZA 1TBZH 1AVGH 4B6FA 5DK1A 1Q3XA 1TOMH 1DSTA 4SGAE 2JETB 2FEQH 3KQ5A 2UWOA 1SG8B 2XNDD 3QZRA 1SGFA 5J4SA 1C5TA 1PQ8A 1ETRH 2FI3E 3DHKH 1HAOH 3PMBB 2VVCA 1AWFH 1MH0A 2DE8A 1THRH 4K1SA 1UK3A 3M5OA 3SU4A 2QYIA 4TPIZ 1LDTT 3JZ1B 2FODA 3GCOA 5F8ZA 1G36A 3SU5A 1KDQA 1NN6A 1AVWA 3QUMP 1VKYA 1OSSA 3A87A 2ZDNA 2ZHQH 1KTTB 5FPSA 1MQ5A 3QGNB 1C5WB 2K8IA 1HIAA 1NY22 3GY6A 3BIVH 4U30A 1O5CB 2ZHDA 2FZZA 2K1QA 2G52A 1G3EA 1MTUA 1SR5C 3LT3A 1A7SA 2GZ7A 3RMNH 1KLJH 1CA0C 3T26A 3UQOA 3WY8A 4M7GA 3LGWA 1FPHH 1EX3A 2WYJA 2GZ9A 2PSXA 1YPJH 3A80A 4ZKSU 1LVBA 1O3DA 1DOJA 1F5RA 5HM9A 1W7GH 3SU6A 2P3FH 5HIZA 5FBEA 3UWJH 1UO6A 5DG6A 3ZZ4A 2PLXA 1OHHD 1AB9C 4BTIB 1EFRD 2A0QB 1S6HA 2EEKA 3H5CB 4H6SB 3PWCA 3OSYA 1AD8H 3W1EA 4FXGH 1GG6C 2BZAA 3MU8A 3F0PA 2QAAA 1SHHB 2LPRA 4DVAU 2PTCE 3H7OA 1D4PB 1J15A 1UK4A 2QXHA 1PPCE 3SV9A 2F9NA 1MTWA 1GHVH 5FHTA 1GBLA 5FPYA 3O8DA 1K1IA 2O8TA 3MNBA 3A89A 2L6OA 2A45B 3I77A 2JETC 1FAXA 2G00A 4K1EA 1DUAA 1LCYA 1D3PB 1C1VH 2BVRH 1V2JT 4WH6A 1QQ4A 2W3KA 1P9SA 2ZDMA 4FUBA 1P2IA 1UTJA 3T5FH 4YTAA 1ETTH 4CRGA 3V0XA 3RXUA 1C1WH 2QF5A 2ZGBH 3BIUH 1E34B 1S83A 5ESBA 8GCHG 2IOTA 4JCNA 4YOIA 4QT8C 1ESTA 2BQ6B 4OS6A 3UB0A 1BCUH 1O2ZA 2BQ7B 1UCYK 4B75A 4BOHA 1C5YB 1GJAB 4RT0A 1OYTH 3PO1C 1GMCG 2ZF0H 4B73A 2BY5X 5CHBA 4TWWA 8LPRA 3BF6H 3PMJA 1VCWA 1LPGB 1TMTH 5IDKA 5T6FA 1MAXA 3NZIA 2AFQB 2Z3EA 3OTJE 5AF9H 1MTVA 1Z8IB 2CHAB 3A8BA 1C2DA 4UFEH 1ELBA 1FAKH 2BTCE 3FP7E 1EUFA 1C9PA 4D9RA 1V2WT 4BAHB 1C2KA 2BB4A 1IQHA 1B7XB 1FUJA 2PTNA 2YNAA 1BJVA 1Y5AT 1TOCB 1LVOA 1ETSH 3M5MA 3VB3A 3MU4A 1G32B 3RC4A 3MU5A 5EXNA 3KQBA 2VIWA 4BTUB 1FIWA 1GWAA 2G4UA 2P3UB 3AVZA 1SGTA 1J16A 1XMNB 2Y6TA 5EW1H 4RI0A 5L2YH 2CJIA 1DLKB 1EJNA 3JZ2B 1MAYA 4UDWH 1NRRH 4XSKU 5AFZH 1XKAC 2F83A 2ZU1A 5GPIB 3OY5U 3SJIA 2M5TA 1BHXF 4X8TH 4Q4LA 1U6QA 1BITA 2XYAA 3EA9A 1PQ7A 2BD7A 1PYTC 1E1RD 1TALA 2Y7ZA 2ZU4A 1TABE 1COWD 2BVXH 3DFJA 1P2QA 2P59A 2NU1E 2SGPE 2ZCKP 1NT1A 3Q3KA 1O0DH 2HPPH 5CMXH 2VNTA 3F2GA 1Q31A 3U9AH 2R0KA 4TSFD 5A8XA 3AW1A 4X1SU 1V2TT 2FI4E 1GMCF 1O2UA 4INHA 5EQSA 5T6GA 1UK2A 3MFJA 4NWLA 1ZR0A 2Z3CA 1UTOA 3GY7A 1E0FD 2SGEE 1XVOA 1O2KA 2Z9JA 3BEUA 3AAUA 3LC3A 1O5EH 2TGTA 1W10U 5DP3A 2ZQ2A 2G8TA 4D9QA 5HKKD 2CHAC 2QF3A 2UUFB 1AIXH 3SI4H 3GISB 3RXGA 1K1NA 5AHGH 1UVUH 4XBCA 2H5DA 1BRCE 1XUHA 1HBTH 3U28C 3M7TA 2BY8X 4I8HA 5AVDA 3UNRA 1DWEH 1SC8U 1Z8RA 2VVVA 1DXPA 3ZZ3A 1GBJA 3A81A 2A5IA 4ACAA 2WPDD 1VITG 4OS2A 5GIBA 1QBVH 4WVPE 2STBE 3GDVA 1EQ9A 2AGEX 1HNEE 5JBTA 1YF4A 4O3TA 3RXRA 5HGGA 4ZAEA 2FOMB 1BOQA 1C5PA 1T7CA 1GHBG 2BD2A 3BTWE 4RKOB 1QB9A 5JB8S 1YLNA 4B71A 3FN8A 2GCTC 1OKXA 1KLIH 2D2DA 1VGCC 3ZZ8A 3P8NA 1N8OB 3ESTA 1ZSJA 1WQVH 5EIYA 1Y3WA 2RCEA 5EPNA 3VB6A 1NFUA 2G5NA 2QC2A 2FOAA 1KLTA 4I31A 1ARBA 1GHYH 1Q2WA 5CHAC 1LHFH 3P92A 2ZECA 3S9BA 3MOCA 2TGPZ 1AO5A 1SPJA 2P16A 3S0NA 2A2XH 4OGXA 1FONA 5DP8A 4ABDA 5EJ1A 1S6LA 5JBAS 1SGQE 1O2SA 2RA3A 2WPKS 5TCCA 5I25A 3RP2A 1DWBH 1JMOH 4GUXA 1YPHC 3H7TA 3AK5A 2HVXA 2G81E 2OC1A 1T8MA 1QL7A 2V3HH 1SSXA 3RXLA 1GDUA 3NRLA 1HJ9A 2ODQA 3ZZAA 1FN6A 1SQAA 1TPOA 4CRAA 3A7VA 3VPKA 1V2OT 4Y11E 2Z9LA 1MU6B 4INLA 4JZDH 4BXWA 4F55A 2LNCA 3TK9A 2XC4A 1W0ZU 3HKJB 2GP9B 5C5OA 5A8YA 4O9VA 1AVXA 1S6FA 2VU8E 1NFYA 1F7ZA 1MKWK 4KTSA 2C8WB 4IW4E 2Y5GA 2IN2A 1O3IA 4FU7A 3DT0H 1GI9B 1FY3A 2BZ6H 1GCTB 4UD9H 4JK6A 1P2MA 3SZEA 4NZLA 1OX1A 2HLDD 1VITF 1EJAA 1TNGA 1IAUA 4YXWD 1FY1A 4IN1A 3MU1A 1P2NA 2KFWA 2WPIS 3F9FA 3RXTA 1WCZA 1Z1IA 2BHGA 4OS5A 2LELA 2OQUA 1WYKA 2JKHA 2QXIA 2P3TB 5JYIA 1GHBF 2ZKSA 4TPYA 2C4FH 3VB7A 4HGCA 3S7HB 2ULLA 5GWZA 1CA8B 1YGCH 2BLOA 4U32A 1BRAA 1EPTB 2FLRH 4WJG2 1OOKB 3CENA 1SVPA 4NIVA 2D8WA 4O3UA 1SLWB 2M2AA 3FZZA 3CS7A 3ODFA 4B74A 1EZQA 2OTVA 4X1RU 2J98B 3RM2H 4F4OC 2BD3A 1D3DB 3PWBA 1QRXA 3SU1A 1WQSA 1WV7H 4FUIA 3SV6A 3ZZ7A 3GICB 1O2VA 2OP9A 1GI5A 2BX3A 3FAOA 4CRBA 3MO6A 2R3UA 5F03A 1UCYH 1TRYA 1DT2A 2ZZUH 1JIMA 1WU1A 3RXDA 1GI8B 1RS0A 2AIQA 3U8OH 3W94A 3LJJA 1WUNH 2KM0A 1A3BH 3SQHE 3P95A 2H9TH 4AZ2B 2GX4A 5ESTE 2ODYB 4WH8A 1HAIH 6CHAB 1GJCB 2XC0A 3GCTF 1ELAA 4BAKB 2BY6X 1HJAB 1MQ6A 2R3YA 4AGKA 2HNTE 2XWAA 1CHGA 2B8OH 2NU2E 3M3VA 2VBCA 3HKIB 3GY8A 2BOKA 4NCYA 4Q80A 1TAWA 4XBBA 1SQRA 1V2RT 3P8GA 1O2RA 4NA7A 1NRSH 1YPGH 4I8LA 3ZZCA 1BBRH 2FOHA 1LHGH 4AB8A 5C5NA 1O2NA 2J4IA 1W0JD 1AKSB 1OP0A 1RFNA 2FOBA 4UEHH 3URCA 3ZYEA 3EE7A 1IQKA 2FS8A 3UNSA 1PQ5A 1HAVA 3DFLA 3RM0H 2FOEA 3PRDA 3EQ0H 5I46H 3ZZ9A 4AFZA 3M3SA 1NU9A 2Y82A 1TNLA 3Q76A 2Y5HA 1SQOA 1O2HA 2BD8A 3IG6B 4X8VH 5FX5A 1QHRB 1ZJDA 1SLVB 1V2LT 1GBDA 2WV5A 3BTTE 1QJ1B 4AOQA 2PKAB 1GPZA 3D65E 2FX4A 4ZROA 2J2UA 2A7CA 4Z0KA 2ZPQA 1YPKH 5C20A 4YZUA 2Y5FA 4WWYA 2GMTC 4YT6H 2BXUH 3TJNA 2VGCB 5F53A 1HFDA 1ZOMA 3A7YA 4ZKRU 1CGHA 4O97A 1NRNH 4NA9H 1H1BA 1H8ED 3F1SB 3OYPA 4LXBH 4X2YA 5DSFA 5EJLA 1OXGA 4X2VA 3BEIB 2RFKC 1K28D 3UOPA 3M36A 3M7QA 3SNAA 3L6PA 6CHAC 4B2CA 3UFAA 5HMAA 3ZVGA 5FXLA 1HJAC 1NU7B 1P01A 1BMFD 1E35B 2Q1JA 2PUQH 4FUHA 3PM3A 1THSH 3OX7U 4Q7ZA 3HPTB 3UY9A 1GJBB 1QURH 2Q6DA 1INCA 4F48B 1CBWC 2DUCA 2B7DH 4ABHA 4Y8YA 1AN1E 2W7SA 1CGIE 1O2WA 3GYLB 1C5QA 1P2JA 4X2XA 1O3AA 1L2EA 2VWNA 1F0UA 4NIYA 2Z94A 1O3OA 3GDSA 1NZQH 2ZDVH 3SI3H 1GI2A 7KMEH 1CA0B 1CO7E 1TPPA 2L74A 1UVSH 1O2PA 3L3TA 1P57B 1CU1A 3SUEA 1IQMA 1JXPA 1XX9A 1UVTH 3M5LA 1V2UT 4B76A 2ODPA 1DVAH 1FDPA 4ZHAA 1ZZZA 2ANWA 4MPUA 4GPGA 1JBUH 3SU2A 4MPXA 5DP4A 1KTSB 1VCQA 1GG6B 2EQNA 4XOJA 2ZWLH 4KTCA 5GDSH 3NK8A 4E05H 5CDFE 1J9CH 3RLWH 3NWUA 2C3SA 3K6ZA 4VGCC 1KXAA 3EDXB 4CRFA 2WPHS 2WV9A 1EB1H 4IC6A 4MVNA 4B6EA 2W7UA 3RDZA 9ESTA 2KAIB 1H9IE 2ZFRH 4X2WA 5A8ZA 2Z9GA 1MTNC 2ZU5A 4AC9A 2QF4A 1CHOG 1QBNA 1UTPA 2OINA 1CE5A 1XUJA 3VEQB 3TNTA 3ATLA 4MNWA 1A0LA 2XWBI 3LGVA 1C2IA 4MNVA 2WV4A 1DM4B 2FTLE 3RXJA 1OS8A 4YT7H 3BTHE 1NFWA 1FY4A 2NU0E 2UWLA 3F3BA 4DOQA 4U01A 4ASHA 2CGAA 2B9LA 3UOUA 2GCHG 2VINA 1HAZB 4UONA 3KQDA 2VIQA 3U69H 2BD5A 2NU4E 3F9GA 1S81A 2QN5T 5DP6A 1AMHA 3PO1B 2GV7A 4K3JA 1OWHA 2ANKH 1SGDE 3BG4B 1TNIA 4FUJA 1AQ7A 1SGPE 1Y3YA 3FFGA 5EQRA 2IPHA 3SNDA 3QLPH 1NO9H 1JWTA 1O3MA 2ALPA 4ESTE 1K1JA 2XCFA 3P17H 1YLDA 2WPMS 1DUEA 1TNKA 1T32A 1GMDF 3ZVFA 4IN2A 2HRVA 1EAXA 3SU0A 4DJZB 4Q2KA 4X6OA 4ZMAH 3SV7A 5K0HA 2VH0A 2BY7X 2FS9A 4DW2U 2AH4X 1LPKB 3KF2A 1HLTH 1K1LA 3PRBA 1D3TB 3RXFA 3GDUA 1L4DA 1V2KT 2UWPA 1Z7KA 3SW2B 1PFXC 1GI7B 1EJMA 3QZQA 2HNTF 1IQNA 1P0SH 5EW2H 1ANEA 1C2GA 3CP7A 1Z6EA 1O2GH 3K6YA 1QFKH 1NTPA 1DPOA 2JH0D 3SGAE 3UR6A 3A8DA 3T25A 2V35A 1Y5BT 2YMSB 1W2KH 1IQFA 1H9LB 4AB9A 1CHOF 2Z7FE 2JIZD 1YLCA 2C8XB 3OEHD 3RU4E 1MUEB 3O8BA 2WHXA 1YPLH 3MI4A 2A32A 3P8FA 1O38A 1ORFA 4RKJB 3S9AA 4X8UH 2FP7B 3OY6U 1FMGA 1NBME 5E0HA 4TYDA 2XC5A 2V3MA 4YOGA 1RTLA 1OYQA 1S85A 2GCHF 1QGFA 1ZRBA 2KZ4A 1SGNE 2XBVA 2HVYB 2XXLA 2ZHFH 3TK5A 3A88A 3RXBA 3UUZA 5HIYA 2HPQH 3SJ8A 1GHAF 4YOJA 3VB4A 1VCPA 1DANH 1Z8JB 2FPZA 1LPZB 3PV2A 1ZGIA 5E0JA 5JBBS 1HJ8A 2FLBH 2AERH 3BG4C 3T2NA 3MH4A 1EPTA 1F5LA 2OXSA 4MPVA 1P9UA 1ANBA 2CV3A 2VIVA 3QO6A 1QRWA 1GMHG 5EU8A 2BX4A 1WTGH 2AMDA 2FOGA 1L1NA 1SGFG 4M9FA 2F9VA 2SNVA 3E91A 3SBKA 3LGTA 4NIXA 1K9OE 2H1UA 1SB1H 3ZV9A 1YBWA 1W11U 5E0GA 5T6DA 3FOAA 3UWIA 2XTTB 5JPMH 1F0RA 2FXRA 2B5TB 5C94A 1P09A 3PROA 3UPEA 3A7WA 2WPLS 1A5IA 4AFSA 3HK3B 2XBYA 3BTME 4WMFA 1RIWC 2Z9IA 1PYTD 3RXSA 4AX9H 1PPEE 4NGAH 3N7OA 3EA8A 5F6MA 5E2PA 2ZTYA 1AFQC 1C2MA 1ZYOA 2ZC9H 2BDGA 1YWUA 5A0AE 1O37A 3ATWA 1N1LA 1FV9A 2AMQA 2V7QD 3RXCA 2GCTB 2YMSC 3TJUA 1WTHD 4RSPA 4K2YA 1VGCB 2QA9E 1DLEA 4AG2A 5EXMA 2OLGA 4TWYA 4D76A 1AI8H 1FY8E 2O8MA 4A92A 1P3CA 4K8YA 2VVUA 1A61H 1SBWA 5DP9A 2IJOB 3A82A 3BTKE 2GT8A 2HNTC 5CHAB 1LQEA 2PWXA 5GJ4B 3NXPA 2J38A 2FTMA 1TX6A 3ITIA 4DCDA 3MO9A 5E8EH 3ZIAD 1ZMJA 3HK6B 3L33A 4D8NA 1AKSA 3KQEA 6ESTA 7GCHG 3QN7A 1TX7A 3ZZ5A 3KCGH 2R2WU 1S84A 1AWHB 3DSOA 4X6MA 1NM6A 1Z1JA 5TJXA 4WXIA 1P8VC 1ZSLA 1W0KD 1C4V2 2FOCA 3H09A 2A2QH 2O8LA 2ZIQH 3GCHC 1BHXB 3BV9B 3NCLA 1UTLM 2ZGXH 1RD3B 1A5HA 1BJUA 2BDYA 1GMHF 1TGNA 1YKTA 2ZCHP 1GJ6A 2ANMH 5JB9S 1KSNA 1XM1A 3RMOH 3UREA 1G3BA 1TONA 4FUFA 4ABEA 3K2UA 4X6NA 4X6PA 1DITH 1GCDA 2ZFTA 3TK6A 3TGJE 2AIPA 2F43B 4FVDA 3M7UA 3QWCH 4KTUA 4IS5A 3ZVBA 2KCOA 2BD9A 3RXHA 4ZKOU 1D9IA 2J97A 5ABWA 1GGDC 3MHWU 4GVUA 1YYY1 1QQUA 4TY6A 3TNSA 1O36A 3MH7A 2O8WA 3G01A 2RG3A 3TJVA 1TFXA 3PTBA 1ZPZA 1O3LA 1NRPH 3T27A 2HWLB 1HYLA 1C2JA 1BTWA 4AGJA 2P8OB 1QCPA 4BAOB 2H9HA 5H4IB 1EATA 1GI6A 2WSSD 4MPWA 1P10A 1BTHH 2NWNA 1ELCA 1GVKB 1YPEH 3BTFE 3SV2H 3ZV8A 3GOVB 3WWFA 1G9IE 3M35A 3PMHB 4HI3A 2ZCLP 1C1OA 4DIHH 2XOKD 3CNRA 2A4RA 2FIRH 1SHYA 3QGJA 4YLUA 1HIAB 1LHDH 4K69A 2OUAA 4MLFB 1O2LA 7GCHF 1XVMA 2XBWA 1KYNA 1TA2A 3RXPA 1J8AA 3SZNA 1QA0A 5FX6A 1T31A 1TRMA 3C27B 2VIDA 1THPB 3NKKA 1OWIA 3E1XB 1V2NT 1SQTA 2UUYA 3W95A 2BLQA 3Q3XA 1MZDA 3RXVA 1KXBA 3DUXH 2H9EH 3GCTG 1QL9A 1MD8A 3RLYH 1A3EH 1D3QB 2DE9A 3UR9A 3PLKA 3FO8D 1SGRE 4Y71A 3E90B 3ZYDA 1Y3XA 1QNJA 4I86A 1PQAA 4RN6A 5EOKA 1O3NA 4LK4A 3SJKA 9LPRA 4H4FA 1FPCH 1GBHA 3TIUA 2F91A 3UTUH 3DSGA 5HM2A 1FIZA 1H8IH 1Y3VA 4B2AA 1PPBH 1M9UA 2GTBA 1QB6A 2EI8A 4I33A 2WZQA 4MDSA 2KAIA 4ISLA 1A4WH 3A83A 2BLWA 4ZXXH 1AFEH 1YC0A 1A1RA 4I7YH 1FX0B 1S82A 1H8DH 4YO9A 1W12U 1O5BB 3WWBA 1A2CH 2P8OC 4X1QU 3T62A 1HCGA 1QJ7B 3RXAA 2ZO3H 2BDHA 4NFEA 1DY8A 1DICA 3RXEA 1NRQH 1OWDA 1MD7A 2R9PA 2ZFFH 2UUKB 1UTKA 1P02A 1V6DA 1GVLA 1ZJKA 3V12A 1C5OH 1GHWH 1SGIB 2F3CE 3MU0A 2F9OA 2TRMA 4JK5A 4A1TA 3VG8A 4WY3A 4JYTA 3ZZBA 1Z8GA 4UE7H 4CR9A 3EGKH 4PROA 2BLVA 4Q7YA 2GMTB 1C2LA 5IYTA 1AUJA 1MBMA 1F0TA 4KP0A 1HXFH 3SJOA 3V7TA 1QZ8A 4HZHA 5C2ZA 1E37B 1ELFA 1O3KA 1TBRH 2GDDA 4DT4A 3PV4A 5JBCS 2B0FA 3V13A 4AYVB 3K65B 2A4GA 3MTYA 3EYDA 2Y7XA 1G3DA 2FMJA 2C90B 2GVFA 2W26A 3RU4T 3GY2A 4O03A 2XNIA 1DDJA 1K22H 1C4U2 1CBWB 4UFFH 1SMFE 2J5UA 4BTTB 4B2BA 3EAJA 1C5LH 2TBSA 1QB1A 1KIGH 1N6YA 4I8JA 1NFXA 3VGCB 3RXMA 1HAPH 3PLPA 2RDEA 5DJ7A 2NU3E 1BUIA 3E3TA 3I78A 3ENSB 1BA8B 3F6UH 1JRSA 4RT1A 1GJ4H 5J4QA 4ZXYH 1OWEA 1V2VT 1O5AB 3SNEA 1BRUP 1CVWH 5CE1A 3S69A 2AGIX 1MABB 4XRNA 1O34A 1TB6H 2FESH 5DP5A 1ANDA 1KXCA 3BTGE 2OQ5A 3RXQA 1NC6A 1C1QA 3ATMA 3GS9A 1C5VA 1YM0A 1VITH 1ELEE 1TMUH 4FVBA 4ABBA 1H8HD 2QXJA 1EAUA 3KIDU 1DX5M 1ZPBA 2VWOA 1ANCA 2WPJS 2JJ1D 4VGCB 2A31A 2ANYA 2ILNA 2G55A 1PPFE 3RXOA 3LOXA 4XDEA 1B5GH 2V6NA 4P02A 2KCYA 1P2OA 1UW7A 4DGJA 4XD7D 3TU7H 3TPIZ 5C3NA 2QF0A 1CT0E 5T1VA 4A5TS 1GI0A 1T8LA 1MTNB 1MTSA 8ESTE 4LZ1H 4Q7XA 4ZUHA 3GY3A 1UHBB 5C1UA 4GAWA 4I8KA 1HAXB 1K1PA 2GZ8A 1HAHH 1V3XA 2BY9X 1O2YA 4R0IA 1Y5UT 4FU8A 4WF8A 1QA7A 2GDEH 1FQ3A 1O3GA 2WUBA 4XFQA 2EC9H 1SI5H 2A1DB 1CQQA 1C9TA 3R3GB 2SGDE 4ASUD 5AFYH 4DURA 1BRBE 1TGBA 1DFPA 3MNXA 3VGCC 2FYRA 2PGQB 4AFUA 5L2ZH 4JMYA 1MMJN 3IITA 1L1JA 2PP6A 1BTYA 3SQEE 1FXYA 3UIRA 1RJXB 2D1JA 1IOEA 1FN8A 1O32A 1GMDG 2TGDA 3LDXH 1O2XA 4ZKNU 5F8XA 2W3IA 1GI3A 4OS4A 1UJ1A 3SGBE 1YPHE 1V2PT 4FUDA 1C1TA 1GBFA 2J95A 2THFB 2F4LA 3MH6A 5EGMA 4Z1MD 1LHCH 2AHME 1T8OA 1EZUC 1VJ9U 1BTXA 3LGUA 3SV8A 1GJ9B 4XE4A 1O3BA 2GV6A 2VJ1A 1GJ8B 3HGNA 5T3HA 2ZA5A 3KNXA 1HAGE 5IK2D 3FP6E 3KGPA 1FY5A 4B1TA 2VH6A 4ZCNA 1EP5A 4ABAA 2OBOA 3KYGA 4UFDH 1E36B 1V2ST 3ODDA 3LGIA 1C1NA 4Y7BA 1QTFA 2CF8H 3T29A 1G30B 2O9QA 2SFAA 3UNQA 3TJOA 1F0SA 4BXSA 3ATIA 4ABFA 1ACBE 1SL3A 1BIOA 4IMZA 3SO3A 1G2MA 4INKA 4CBOA 3LIWA 5C1XA 1AZ8A 1EB2A 1GBAA 1B0EA 2BQWB 1G3CA 2SGAA 3QX5H 4NG9H 1MBQA 3OFND 4I32A 2ZHWH 3A84A 1SLUB 1MKWH 1ELGA 1UTQA 1LTOA 1BMMH 2CF9H 3LH1A 1VR1H 3TH2H 4ACBA 1CT4E 4BAMB 1A0HB 1O2OA 3F0OA 1E38B 3ZVEA 3RXIA 1BB0B 1GHAG 3FVFB 4FU9A 1EZXC 4H6TA 1GI4A 1O2MA 4I8GA 3RC6A 1XUIA 1P2KA 3MYWA 4NA8A 1DY9A 1YCPK 4K5ZA 2GGVB 1IQIA 1UMAH 2ZFQH 1QL8A 5C1YA 1UVOA 2Y80A 3SHAH 1DWDH 2UUJB 1IQLA 3MQKC 3Q3YA 2F9PA 4K8BA 5C0UA 2YOLA 4ISIH 1XXDA 2A7JA 3TGKE 2ZPRA 1S0RA 2HALA 1UCYE 7LPRA 2GKVE 4J2YB 1LQDB 3AAVA 1AUTC 1C5MD 3RXKA 4DG4A 1K2I1 1TGCA 3OE7D 4Y7AA 2BDCA 1BTPA 2A7HA 1F5KU 4AORA 1RIWB 4CHAB 4A1VA 2YNBA 1YPMH 5LPFA 1ZTLA 3AW0A 1ZTKA 3LC5A 1V2MT 1AFQB 1ESAA 1GL0E 1MZAA 2P95A 3ZZ6A 4ABIA 1O35A 4JZIA 1QR3E 4ZHLU 1AY6H 5A0CA 2SGFE 5EPYA 3LJOA 2ZNKH 3SN8A 1W7XH 3NUMA 3KN2A 3M37A 1BMLA 2HLCA 1BBRE 1C1PA 3U1JB 1C1RA 1DWCH 2A5KA 2EA3A 5LPRA 1KMHB 1ABJH 1QRZA 4LOYH 2ASUB 5L6NH 7ESTE 1XKBC 3DD2H 2VB0A 4IGDA 3LGYA 1C5XB 1VZQH 5DP7A 2ESTE 1O2QA 2FWWA 3SNCA 3DA9B 5C0TA 2KX4A 2PW8H 2Z9KA 2K0QA 3SHCH 4CRCA 2HOBA 1HAVB 1ELVA 1T4VH 1A5GH 2BXTH 2OD3B 2SNWA 1P05A 3GCHB 1GBBA 3CS0A 2W5EA 1FI8A 1ESBA 1GHZA 2ZPSA 1GHXH 3LONA 2ZG0H 4DIIH 3SUFA 2QGRA 1PPHE 5FPTA 4GLYA 1EAIA 3PMAB 1O2IA 1O2TA 4CR5A 2J98A 2W6JD 3E0NB 2YMSD 5ETXA 5L30H 2PUXB 5TCAA 1P3EA 1RXPA 3I29A 2G4TA 1HGTH 1O3EA 4Y8ZA 3V3MA 2ZFSA 3NPSA 2P93A 4P00A 1E79D 1NPMA 2ZDAH 1K21H 2CMYA 3LU9B 1SFQB 1GGDB 3MMGA 1AZZA 1TA6A 4CHAC 1LVMA 2G5VA 3BTDE 2F9UA 4FUCA 1TGTA 1Z6JH 4CBNA 1WXRA 3STIA 2BMGB 1ZMLA 1O3CA 5EODA 1C5ZB 1ZPCA 3ZVCA 4ISOA 3VXEH 2TGAA 5LPEA 1P12E 3FKSD 4U2WA 1NROH 4ABGA 1L4ZA 5K7RA 3BEFB 4Y0YE 4MTBA 1WOFA 5DN6D 1BBRK 1EXFA 1GDNA 1SOZA 1SGEE 2CN0H 4NSYA 2PFEA 3P70B 4AG1A 1FZZA 1IQGA 5FCKA 4Z6AH 2PSYA 2QE7D 2BDAA 1QJ6B 1AHTH 1K0HA 1GL1A 1SFIA 2EI6A 5A0BA 3QTOH 4OM9A 1J17T 2H6MA 3STJA 5E2OA 2FO9A 3U98H 3RMMH 1SOTA 3KL6A 2A4OA 2BOHB 1OP2A 3O8RA 3BG8A 5GCHG 4HTCH 3Q77A 2W6ID 4MNYA 3DCLA 2RDLA 2ZQ1A 4OGYA 2ZU2A 6LPRA 2R2MB 1H9HE 1TYNA 2GJGA 8GCHF 2JJ2D 4X8SH 4R8TB 2XCNA 1O3HA 1ARCA 3P6ZB 4WMEA 4LZ4B 1OP8A 2PKAA 3VB5A 1TGSZ 1TNJA 1RGQA 2QCYA 4A7IB 4AFQA 4A1XA 3N99A 2WUCA 4Q63A 4A6LA 2I6QA 3TH3H 3ZVDA 3GCNA 1V2QT 1TIOA 1GBCA 2I6SA 3AASA 1YP9A 2OBQA 3P8OA 1RRKA 2TIOA 3VXFH 2ZTZA 2FI5E 1G2LA 3SUDA 3D49H 2QY0B 1GBEA 2XRCA 3QK1A 3B23B 1W8BH 4NSVA 1P06A 3TITA 3F68H 2ZFPH 5G4BA 1UHBA 1ZHMA 1G37A 3UAIC 1IHSH 1O3PB 3ATKA 2OCVB 5FCRA 4JZEH 4Y0ZE 1LKBA 2ZGCA 3S9CA 4MQAA 1IQJA 1LKAA 3Q00A 4F49A 4GCHG 1GJ7B 3EA7A 1O33A 4HFPB 1KDQB 1ZLRA 4DY7B 4WMDA 3A7XA 1PPGE 1UTNA 3OTPA 4TY7A 1DSUA 1RTKA 4IBLH 1AGJA 1MKXK 3HGPA 3N7EA 4ABJA 3UQVA 3WW7A 2C8YB 3K9XB 5BRRE 4Y79A 2QXGA 3QTVH 1ZTJA 2V0BA 2EY4C 4BAQB 1BQYA 1S5SA 1TMBH 3DSPA 4ISHH 2ZU3A 1WDIA 3A8CA 4AYYB 1H4WA 4KELA 1HRTH 1TE0A 5FL7D 1T8NA 3TH4H 1QBOA 3SUGA 2A4QA 5GCHF 4IC5A 1C5UA 1YCPH 1K1OA 1FJSA 1B0FA 2KCPA 4NZQA 4JYVH 2RA0A 2PKSB 4E06H 4JYUH 3FP8E 1CT2E 1C5RA 2A5AA 1WBGB 1AE8H 3U8TH 4D7FA 3QDZB 4Y10E 2ZTXA 4Y8XA 1W3CA 3LKWA 2F9BH 1AE5A 2Z3DA 3KHVA 1D6RA 1C5SA 1GJ5H 4NWKA 4X1PU 1ZSKA 1IQEA 2ZDKA 3E16B 2FDAA 1KXDA 2BVSH 2D26C 1ZHRA 1W0YH 3E6PH 2ZHEH 3IWMA 1KY9A 1SKYE 2PR3A 3A8AA 2OK5A 3BN9A 2J9NA 1VJAU 4H42U 2EI7A 1KXEA 3D62A 4KGAA 4THNH 3FANA 1TPAE 3TLOA 2ZGHA 1HB0B 5EXLA 2FX6A 1FLEE 1YY3A 1BDAA 1C2EA 4BANB 2C8ZB 3A7TA 2XW9A 4FUGA 1CSOE 3LH3A 2ZGJA 1ZHPA 2HGTH 4AN7A 1UTMA 3KQCA 2JH5D 2V3OH 3R0FA 1EOJA 4XBDA 1P11E 4GCHF 4ZH8A 1ZRKA 4MNXA 1BMNH 1O2JA 1TQ7B 1O3JA 1Z71A 1DXWA 1QIXB 4CH2B 2ALVA 2XBXA 1GI1A 1BTUA 3E0PB 5C17A 5KECA 1Y8TA 3GY5A 2H5CA 3OAAD 2QIQA 2J92A 1GBMA 3PB1E 2C93B 3M5NA 2WINI 3ZVAA 5DPAA 5C67A 2FYQA 3SNBA 1C5NH 1SGCA 1TRNA 1N8OC 1DE7H 1OPHB 4D7GA 3U1IB 2AMPA 2TPIZ 2PHBA 3SOSA 2OC0A 1LMWB 3F2FA 4WXVA 1EASA 3MWIU 3N7DA 1LO6A 2PKSC 1ID5H 1Y59T 1QY6A 1C2FA 2BM2A 2IPQX 5A2MH 5FAHA 3GY4A 5HXFA 4YM9A 1PJPA 1HUTH 1LHEH 2Z6BD 2BDIA 4FUEA 2GT7A 2ZP0H 6GCHG 1P03A 3U8RH 5DO4H 2WYGA 1JOUB 4GHQA 1HV7A 1TX8A 3RU4D 1W13U 5FBIA 2OC7A
chains in the Genus database with same CATH topology
1PPZA 3A7ZA 1FNIA 2VWMA 2GD4B 1O5FH 2STAE 5BPEA 1LVYA 4UFGH 3RMLH 1NESE 3TGIE 1A46H 1DS2E 2JH6D 2VWLA 1EAWA 2ZDLA 5HYOA 2AYWA 3MO3A 1MU8B 1WSSH 1EZSC 5EG4A 1C4Y2 1ZMNA 1JIRA 1UVPA 1ELTA 3M61U 3S7KB 1GBKA 1GBTA 4J1YA 1NS3A 4YESB 1GCTC 5LH8A 4NIWA 4YLQH 2FM2A 1XUKA 3E8LA 2VIPA 2H2ZA 1C1MA 3D23A 1SLXB 4BNRA 1XUFA 2AGGX 4ISNA 1O31A 5LGOA 1ABIH 5SGAE 1OWKA 1EP6A 3KEEA 4OS1A 2ZEBA 1EOLA 1JRTA 1K1MA 3LPRA 4IMQA 5JDUB 1XUGA 1CGJE 3MNSA 1F2SE 1EPTC 4Y6DA 1GVZA 3T28A 3PYHA 1C2HA 3SJ9A 3SU3A 3RC5A 3A86A 3ELAH 4MG3A 5F8TA 2AEIH 2O8UA 4NFFA 3RUOA 1C1SA 1OWJA 1IHTH 1HDTH 1RTFB 4X0WU 1MCVA 2QV1A 4Y76A 2Q6GA 5B6OA 4K1TA 4GSOA 5EQQA 5DKMA 3URDA 2J34A 2Q6FA 1EKBB 1BT7A 1A0JA 1C1UH 3PLBA 6GCHF 1O30A 4KKDA 8KME2 2G51A 1KXFA 3F9EA 2OC8A 2CXVA 2ZI2H 1ZGVA 3B9FH 5A09A 4CRDA 3OU0A 2P94A 1F92A 3A85A 4E7NA 1SGYE 3HATH 4GHTA 3C1KA 3BSQA 1P04A 2PV9B 5GXPA 1XXFA 2FOFA 4OS7A 4CH8B 3GYMA 3VFEA 1BMAA 1O5GH 2Y81A 3F9HA 4DT7B 1TWXB 1O3FA 1TNHA 1AU8A 1L1GA 1X7AC 2BDBA 2R0LA 1GJDB 3B8JA 3M3TA 1TBQH 2BD4A 1MKXH 1L0ZA 4K60A 3BTQE 3EE0B 2J94A 2BYAX 4CREA 1GBIA 1T4UH 4JZFH 2AS9A 1HAYB 1ELDE 4JZ1A 1BTZA 1O5DH 1W14U 4ZHMU 2VIOA 3MH5A 3MNCA 3TVJB 3ZZDA 1HXEH 1AB9B 2PGBB 1GDQA 1MCTA 1TLDA 1O39A 1Y3UA 1YCPM 4SGBE 1S0QA 3SORA 1WAYB 1J14A 1TQ0B 3FZDA 3BTEE 2SGQE 4E7RG 1N6XA 1TPSA 3SGQE 5DGJA 4X1NU 1HPGA 1D6WA 2VGCC 1BZXE 3O8CA 3PTNA 5PTPA 1TBZH 1AVGH 5DK1A 1Q3XA 1TOMH 1DSTA 4SGAE 2JETB 2FEQH 2UWOA 1SG8B 3QZRA 1SGFA 5J4SA 1C5TA 1PQ8A 1ETRH 2FI3E 3DHKH 1HAOH 3PMBB 2VVCA 1AWFH 1MH0A 2DE8A 1THRH 4K1SA 1UK3A 3M5OA 3SU4A 2QYIA 4TPIZ 1LDTT 3JZ1B 2FODA 3GCOA 5F8ZA 1G36A 3SU5A 1KDQA 1NN6A 1AVWA 3QUMP 1OSSA 3A87A 2ZDNA 2ZHQH 1KTTB 5FPSA 1MQ5A 3QGNB 1C5WB 1HIAA 1NY22 3GY6A 3BIVH 4U30A 1O5CB 2ZHDA 2FZZA 2K1QA 2G52A 1G3EA 1MTUA 1SR5C 3LT3A 1A7SA 2GZ7A 3RMNH 1KLJH 1CA0C 3T26A 3UQOA 3WY8A 4M7GA 3LGWA 1FPHH 1EX3A 2WYJA 2GZ9A 2PSXA 1YPJH 3A80A 4ZKSU 1LVBA 1O3DA 1DOJA 1F5RA 5HM9A 1W7GH 3SU6A 2P3FH 5FBEA 3UWJH 1UO6A 5DG6A 3ZZ4A 2PLXA 1AB9C 4BTIB 2A0QB 1S6HA 2EEKA 3H5CB 4H6SB 3PWCA 3OSYA 1AD8H 4FXGH 1GG6C 2BZAA 3MU8A 2QAAA 1SHHB 2LPRA 4DVAU 2PTCE 3H7OA 1D4PB 1J15A 1UK4A 2QXHA 1PPCE 3SV9A 2F9NA 1MTWA 1GHVH 5FHTA 1GBLA 5FPYA 3O8DA 1K1IA 2O8TA 3MNBA 3A89A 2A45B 3I77A 2JETC 1FAXA 2G00A 4K1EA 1DUAA 1LCYA 1D3PB 1C1VH 2BVRH 1V2JT 4WH6A 1QQ4A 2W3KA 1P9SA 2ZDMA 4FUBA 1P2IA 1UTJA 3T5FH 4YTAA 1ETTH 4CRGA 3V0XA 3RXUA 1C1WH 2ZGBH 3BIUH 1E34B 1S83A 5ESBA 8GCHG 2IOTA 4JCNA 4YOIA 4QT8C 1ESTA 2BQ6B 4OS6A 1BCUH 1O2ZA 2BQ7B 1UCYK 4B75A 4BOHA 1C5YB 1GJAB 1OYTH 3PO1C 1GMCG 2ZF0H 4B73A 2BY5X 4TWWA 8LPRA 3BF6H 3PMJA 1VCWA 1LPGB 1TMTH 5IDKA 5T6FA 1MAXA 3NZIA 2AFQB 2Z3EA 3OTJE 5AF9H 1MTVA 1Z8IB 2CHAB 3A8BA 1C2DA 4UFEH 1ELBA 1FAKH 2BTCE 3FP7E 1EUFA 1C9PA 4D9RA 1V2WT 4BAHB 1C2KA 2BB4A 1IQHA 1B7XB 1FUJA 2PTNA 2YNAA 1BJVA 1Y5AT 1TOCB 1LVOA 1ETSH 3M5MA 3VB3A 3MU4A 1G32B 3RC4A 3MU5A 5EXNA 3KQBA 2VIWA 4BTUB 1FIWA 1GWAA 2G4UA 2P3UB 3AVZA 1SGTA 1J16A 1XMNB 2Y6TA 5EW1H 5L2YH 2CJIA 1DLKB 1EJNA 3JZ2B 1MAYA 4UDWH 1NRRH 4XSKU 5AFZH 1XKAC 2F83A 2ZU1A 5GPIB 3OY5U 3SJIA 2M5TA 1BHXF 4X8TH 1U6QA 1BITA 2XYAA 3EA9A 1PQ7A 2BD7A 1PYTC 1TALA 2Y7ZA 2ZU4A 1TABE 2BVXH 3DFJA 1P2QA 2P59A 2NU1E 2SGPE 2ZCKP 1NT1A 3Q3KA 1O0DH 2HPPH 5CMXH 2VNTA 1Q31A 3U9AH 2R0KA 5A8XA 3AW1A 4X1SU 1V2TT 2FI4E 1GMCF 1O2UA 4INHA 5EQSA 5T6GA 1UK2A 3MFJA 4NWLA 1ZR0A 2Z3CA 1UTOA 3GY7A 1E0FD 2SGEE 1XVOA 1O2KA 2Z9JA 3BEUA 3AAUA 3LC3A 1O5EH 2TGTA 1W10U 5DP3A 2ZQ2A 2G8TA 4D9QA 2CHAC 2QF3A 2UUFB 1AIXH 3SI4H 3GISB 3RXGA 1K1NA 5AHGH 1UVUH 4XBCA 2H5DA 1BRCE 1XUHA 1HBTH 3M7TA 2BY8X 4I8HA 5AVDA 3UNRA 1DWEH 1SC8U 1Z8RA 2VVVA 1DXPA 3ZZ3A 1GBJA 3A81A 2A5IA 1VITG 4OS2A 5GIBA 1QBVH 4WVPE 2STBE 3GDVA 1EQ9A 2AGEX 1HNEE 5JBTA 1YF4A 4O3TA 3RXRA 5HGGA 4ZAEA 2FOMB 1BOQA 1C5PA 1T7CA 1GHBG 2BD2A 3BTWE 4RKOB 1QB9A 5JB8S 4B71A 2GCTC 1OKXA 1KLIH 2D2DA 1VGCC 3ZZ8A 3P8NA 1N8OB 3ESTA 1ZSJA 1WQVH 1Y3WA 2RCEA 5EPNA 3VB6A 1NFUA 2G5NA 2QC2A 2FOAA 1KLTA 4I31A 1ARBA 1GHYH 1Q2WA 5CHAC 1LHFH 3P92A 2ZECA 3S9BA 3MOCA 2TGPZ 1AO5A 1SPJA 2P16A 3S0NA 2A2XH 4OGXA 1FONA 5DP8A 4ABDA 5JBAS 1SGQE 1O2SA 2RA3A 2WPKS 5TCCA 5I25A 3RP2A 1DWBH 1JMOH 4GUXA 1YPHC 3H7TA 2HVXA 2G81E 2OC1A 1T8MA 1QL7A 2V3HH 1SSXA 3RXLA 1GDUA 1HJ9A 2ODQA 3ZZAA 1FN6A 1SQAA 1TPOA 4CRAA 3A7VA 3VPKA 1V2OT 4Y11E 2Z9LA 1MU6B 4INLA 4JZDH 4BXWA 2LNCA 3TK9A 2XC4A 1W0ZU 3HKJB 2GP9B 5C5OA 5A8YA 4O9VA 1AVXA 1S6FA 2VU8E 1NFYA 1F7ZA 1MKWK 4KTSA 2C8WB 4IW4E 2Y5GA 2IN2A 1O3IA 4FU7A 3DT0H 1GI9B 1FY3A 2BZ6H 1GCTB 4UD9H 4JK6A 1P2MA 4NZLA 1OX1A 1VITF 1EJAA 1TNGA 1IAUA 1FY1A 4IN1A 3MU1A 1P2NA 2WPIS 3F9FA 3RXTA 1WCZA 1Z1IA 2BHGA 4OS5A 2OQUA 1WYKA 2JKHA 2QXIA 2P3TB 5JYIA 1GHBF 2ZKSA 4TPYA 2C4FH 3VB7A 4HGCA 3S7HB 2ULLA 5GWZA 1CA8B 1YGCH 2BLOA 4U32A 1BRAA 1EPTB 2FLRH 4WJG2 1OOKB 3CENA 1SVPA 4NIVA 2D8WA 4O3UA 1SLWB 3FZZA 3CS7A 3ODFA 4B74A 1EZQA 2OTVA 4X1RU 3RM2H 4F4OC 2BD3A 1D3DB 3PWBA 1QRXA 3SU1A 1WQSA 1WV7H 4FUIA 3SV6A 3ZZ7A 3GICB 1O2VA 2OP9A 1GI5A 2BX3A 3FAOA 4CRBA 3MO6A 2R3UA 5F03A 1UCYH 1TRYA 1DT2A 2ZZUH 1JIMA 1WU1A 3RXDA 1GI8B 1RS0A 2AIQA 3U8OH 3W94A 3LJJA 1WUNH 1A3BH 3SQHE 3P95A 2H9TH 4AZ2B 2GX4A 5ESTE 2ODYB 4WH8A 1HAIH 6CHAB 1GJCB 2XC0A 3GCTF 1ELAA 4BAKB 2BY6X 1HJAB 1MQ6A 2R3YA 4AGKA 2HNTE 2XWAA 1CHGA 2B8OH 2NU2E 3M3VA 3HKIB 3GY8A 2BOKA 4NCYA 4Q80A 1TAWA 4XBBA 1V2RT 3P8GA 1O2RA 4NA7A 1NRSH 1YPGH 4I8LA 3ZZCA 1BBRH 2FOHA 1LHGH 4AB8A 5C5NA 1O2NA 2J4IA 1AKSB 1OP0A 1RFNA 2FOBA 4UEHH 3URCA 3ZYEA 1IQKA 2FS8A 3UNSA 1PQ5A 1HAVA 3DFLA 3RM0H 2FOEA 3EQ0H 5I46H 3ZZ9A 4AFZA 3M3SA 1NU9A 2Y82A 1TNLA 3Q76A 2Y5HA 1SQOA 1O2HA 2BD8A 3IG6B 4X8VH 5FX5A 1QHRB 1ZJDA 1SLVB 1V2LT 1GBDA 2WV5A 3BTTE 1QJ1B 4AOQA 2PKAB 1GPZA 3D65E 2FX4A 4ZROA 2J2UA 2A7CA 4Z0KA 2ZPQA 1YPKH 5C20A 4YZUA 2Y5FA 4WWYA 2GMTC 4YT6H 2BXUH 3TJNA 2VGCB 1HFDA 1ZOMA 3A7YA 4ZKRU 1CGHA 4O97A 1NRNH 4NA9H 1H1BA 3F1SB 3OYPA 4LXBH 4X2YA 1OXGA 4X2VA 3BEIB 1K28D 3UOPA 3M36A 3M7QA 3SNAA 3L6PA 6CHAC 4B2CA 3UFAA 5HMAA 3ZVGA 5FXLA 1HJAC 1NU7B 1P01A 1E35B 2Q1JA 2PUQH 4FUHA 3PM3A 1THSH 3OX7U 4Q7ZA 3HPTB 3UY9A 1GJBB 1QURH 2Q6DA 1INCA 1CBWC 2DUCA 2B7DH 4ABHA 4Y8YA 1AN1E 2W7SA 1CGIE 1O2WA 3GYLB 1C5QA 1P2JA 4X2XA 1O3AA 1L2EA 2VWNA 1F0UA 4NIYA 2Z94A 1O3OA 3GDSA 1NZQH 2ZDVH 3SI3H 1GI2A 7KMEH 1CA0B 1CO7E 1TPPA 1UVSH 1O2PA 3L3TA 1P57B 1CU1A 3SUEA 1IQMA 1JXPA 1XX9A 1UVTH 3M5LA 1V2UT 4B76A 2ODPA 1DVAH 1FDPA 4ZHAA 1ZZZA 2ANWA 4MPUA 4GPGA 1JBUH 3SU2A 4MPXA 5DP4A 1KTSB 1VCQA 1GG6B 4XOJA 2ZWLH 4KTCA 5GDSH 3NK8A 4E05H 1J9CH 3RLWH 3NWUA 2C3SA 3K6ZA 4VGCC 1KXAA 3EDXB 4CRFA 2WPHS 1EB1H 4IC6A 4MVNA 2W7UA 3RDZA 9ESTA 2KAIB 1H9IE 2ZFRH 4X2WA 5A8ZA 2Z9GA 1MTNC 2ZU5A 1CHOG 1QBNA 1UTPA 2OINA 1CE5A 1XUJA 3VEQB 3TNTA 3ATLA 4MNWA 1A0LA 2XWBI 3LGVA 1C2IA 4MNVA 2WV4A 1DM4B 2FTLE 3RXJA 1OS8A 4YT7H 3BTHE 1NFWA 1FY4A 2NU0E 2UWLA 4DOQA 4U01A 4ASHA 2CGAA 2B9LA 3UOUA 2GCHG 2VINA 1HAZB 4UONA 3KQDA 2VIQA 3U69H 2BD5A 2NU4E 3F9GA 1S81A 2QN5T 5DP6A 1AMHA 3PO1B 2GV7A 4K3JA 1OWHA 2ANKH 1SGDE 3BG4B 1TNIA 4FUJA 1AQ7A 1SGPE 1Y3YA 3FFGA 5EQRA 2IPHA 3SNDA 3QLPH 1NO9H 1JWTA 1O3MA 2ALPA 4ESTE 1K1JA 2XCFA 3P17H 1YLDA 2WPMS 1DUEA 1TNKA 1T32A 1GMDF 3ZVFA 4IN2A 2HRVA 1EAXA 3SU0A 4DJZB 4Q2KA 4X6OA 4ZMAH 3SV7A 5K0HA 2VH0A 2BY7X 2FS9A 4DW2U 2AH4X 1LPKB 3KF2A 1HLTH 1K1LA 1D3TB 3RXFA 3GDUA 1L4DA 1V2KT 2UWPA 1Z7KA 3SW2B 1PFXC 1GI7B 1EJMA 3QZQA 2HNTF 1IQNA 1P0SH 5EW2H 1ANEA 1C2GA 3CP7A 1Z6EA 1O2GH 3K6YA 1QFKH 1NTPA 1DPOA 2JH0D 3SGAE 3UR6A 3A8DA 3T25A 2V35A 1Y5BT 1W2KH 1IQFA 1H9LB 4AB9A 1CHOF 2Z7FE 1YLCA 2C8XB 3RU4E 1MUEB 3O8BA 1YPLH 3MI4A 2A32A 3P8FA 1O38A 1ORFA 4RKJB 3S9AA 4X8UH 2FP7B 3OY6U 1FMGA 5E0HA 4TYDA 2XC5A 4YOGA 1RTLA 1OYQA 1S85A 2GCHF 1QGFA 1ZRBA 1SGNE 2XBVA 2XXLA 2ZHFH 3TK5A 3A88A 3RXBA 3UUZA 2HPQH 3SJ8A 1GHAF 4YOJA 3VB4A 1VCPA 1DANH 1Z8JB 2FPZA 1LPZB 5E0JA 1ZGIA 5JBBS 1HJ8A 2FLBH 2AERH 3BG4C 3T2NA 3MH4A 1EPTA 1F5LA 2OXSA 4MPVA 1P9UA 1ANBA 2CV3A 2VIVA 3QO6A 1QRWA 1GMHG 5EU8A 2BX4A 1WTGH 2AMDA 2FOGA 1L1NA