3MI4A

Bovine trypsin at 0.8 a resolution, non-restrained refinement
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title Bovine trypsin at 0.8 A and role of restraints at ultra-high resolution
rcsb
total genus 56
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2010-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mi4A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3mi4A02
2SGDE 3RMNH 3RXJA 3TU7H 3JZ2B 1XKAC 3T29A 2FOGA 2ANWA 1A61H 4FVDA 4OS4A 3E0PB 2XC4A 3OY6U 4UEHH 2QXJA 4ABIA 4CH2B 2OC7A 3MH7A 3A88A 1IHSH 5LPEA 1LCYA 4ABAA 1BTXA 2VIDA 2SGAA 2Y7ZA 1UVOA 2FI4E 1O3MA 3ZZ7A 2BM2A 4D9QA 1YLDA 1LQEA 1D3PB 1P11E 2BD8A 2NWNA 3BTME 2WV5A 1TBZH 1HAOH 1SI5H 1T31A 2JETB 1DS2E 8LPRA 3PM3A 2D8WA 1C2FA 1JBUH 1ZZZA 5L6NH 2FOCA 2BQ6B 2A31A 1MH0A 5DP6A 1C5SA 3QZQA 4CHAB 2VH6A 4FVBA 4ISHH 1IQLA 3CS7A 3GCTG 1PYTD 3T26A 2ZCKP 3QX5H 1A3EH 1ANBA 5EOKA 1WAYB 1V2RT 2BDIA 1P9UA 2JH0D 1WQVH 2ZDAH 1O2IA 1CA0B 5HYOA 4GCHG 1K1IA 1J15A 1TABE 1ELFA 1A1RA 1UMAH 2BX3A 2BD4A 4I8JA 2OUAA 1C4U2 4HTCH 2H5DA 3UIRA 3SQHE 1S82A 4LOYH 1LPZB 5C5OA 1DPOA 4AYVB 3M61U 1L2EA 3KIDU 2HWLB 4BOHA 3GCHB 4AORA 3TGKE 1FXYA 1OWIA 3K6YA 5J4SA 1NTPA 1GMHG 1EAWA 3MO9A 1DFPA 3P17H 3SJIA 2J2UA 4ISLA 3WY8A 1ZOMA 1KDQA 1OS8A 2ZU2A 1L4ZA 5GIBA 5EQSA 2VU8E 1EAIA 2OCVB 4INKA 1O2PA 1UK2A 1QIXB 2W5EA 3RXVA 1DWDH 2WPHS 3RXSA 1XUJA 1PQ8A 2O9QA 1MKWH 1UO6A 2VVVA 1EX3A 4NIYA 2ALPA 3IITA 1S84A 1E0FD 3HK6B 2H9EH 1HB0B 1TPSA 1E37B 3ZZ6A 1A0JA 4AZ2B 1UVTH 1P8VC 5A2MH 2QCYA 1QR3E 2ANYA 1H1BA 3ZVBA 1J14A 1D3QB 3Q3KA 4RN6A 3TJOA 5AHGH 3SV6A 3GY6A 1BTYA 1OYQA 2FYRA 2FLBH 2WPMS 3EGKH 1KXDA 1SGDE 1AFQB 2Y5FA 3PLPA 4YLUA 1FPHH 4DVAU 1GHWH 4NCYA 3TK9A 2BLQA 1ZJDA 3BEIB 1S6FA 4X6OA 4ABJA 2ZTXA 3SHCH 2BD3A 1T8MA 1RIWC 1GPZA 1UHBA 2TGDA 1Y3YA 3SOSA 1BB0B 1G3CA 1LPGB 3E3TA 1C2GA 1FLEE 1DE7H 2P93A 5GCHG 1TRYA 1O2MA 3SU0A 1TIOA 1BBRE 3TPIZ 1O2VA 1L1GA 4ISIH 1BHXF 2LNCA 1T32A 1XUIA 2KAIA 2P8OC 1O35A 1SLUB 1NRRH 3S9AA 4DY7B 5GXPA 1BA8B 5EW2H 1WBGB 1HAHH 5GWZA 3PWCA 2OC1A 1YP9A 1BJVA 2XWBI 1W2KH 3RXDA 4XDEA 1O3JA 1C9TA 3H5CB 4XSKU 3KF2A 1THRH 3RC5A 4IBLH 2O8MA 4CR9A 5JBTA 3M36A 3GY7A 2WPLS 4ABBA 3BTDE 1YGCH 4HI3A 3IG6B 4NZLA 1TB6H 1L4DA 1SR5C 1HLTH 1MD8A 1AVXA 4MPXA 4JYVH 5GPIB 1YPJH 1J8AA 3S7KB 3KGPA 3PO1B 4O3TA 1ZPCA 3ATWA 3HPTB 2XTTB 1HJ8A 3BN9A 1LVMA 3NWUA 1XXFA 1AY6H 1Z8IB 1RIWB 1T4UH 2AMQA 2BX4A 4MNYA 5LPFA 5A09A 4ABHA 1SGFA 1GI6A 3ZZ4A 2QV1A 3PMJA 5CE1A 4WMEA 5C1YA 1W8BH 3GY3A 5C20A 1O2HA 1VCQA 2WUCA 2VH0A 1IQFA 1VJAU 3RXEA 1NRPH 3ZYDA 4YM9A 1O32A 1KY9A 1INCA 4CRBA 1J9CH 2BY8X 4KKDA 1O2UA 1TONA 1IQEA 5E0GA 4MPWA 1WSSH 2PHBA 2BXUH 5ABWA 1D4PB 2K1QA 1C2KA 3K65B 2FEQH 4JZDH 3SUDA 4UFGH 1PPBH 5FBIA 4A6LA 2AFQB 1G30B 1Z8RA 1ZGIA 2J38A 5DP5A 2V3HH 3SNAA 1GDQA 8ESTE 3GDSA 2F9PA 2ZNKH 3RMMH 3A8CA 1O3EA 2PGBB 3ODFA 1O2XA 1TQ0B 1THPB 3FP6E 3SNBA 2ZGXH 2PSXA 2FZZA 3HATH 1K9OE 5DO4H 2Y81A 4Y6DA 1GJ5H 2ZFSA 1CT2E 1W3CA 4WH8A 1O3IA 4JCNA 4E06H 2VJ1A 1TA2A 4D7GA 3RMOH 4YLQH 1F5LA 3F9HA 5ESBA 8GCHG 4DIHH 1QCPA 1QJ1B 1THSH 1SLWB 1XXDA 1HAIH 2HGTH 1FN6A 2ANMH 3LT3A 3LGTA 4BAKB 3SUFA 2QXHA 3LONA 3MU8A 1Y5BT 3NK8A 2VVUA 1ETSH 2ZGCA 1YC0A 1YPEH 3MOCA 4NWLA 1ZPBA 1MQ6A 2QGRA 1GL0E 3QTVH 4H42U 3SW2B 1GI4A 1F7ZA 5DP3A 1DUEA 1QBVH 5C1XA 5LPRA 1RFNA 1PQ7A 1TX6A 1CBWB 4I8GA 4FUFA 4AFSA 1BMLA 4NZQA 2VIOA 6ESTA 2P3FH 4X8VH 2SNWA 2F9OA 1ELCA 1S5SA 1V2PT 4KP0A 4FUJA 1LO6A 3G01A 1NY22 2P3TB 3HKJB 3EA8A 2AGIX 1C5UA 1LHDH 1PQAA 1BUIA 5EW1H 3JZ1B 3KQCA 1JWTA 1TNKA 1ORFA 4CRGA 2BD2A 1CO7E 3BG4B 3I29A 5EXNA 2ZU1A 4Y76A 1CU1A 1K2I1 3Q77A 3MNBA 3ENSB 1O37A 4UD9H 3MO3A 1W0ZU 5A0CA 1SHYA 4DG4A 4ZMAH 2F9UA 1AZZA 1Y3UA 1LPKB 1MTWA 1GJBB 3U69H 1TBQH 3UR6A 2AS9A 4FUBA 3STJA 1VCWA 5F6MA 1PYTC 2CHAC 4H6TA 1Y8TA 2WPIS 2FMJA 2H5CA 6CHAB 1VGCC 5FPYA 1ZLRA 4SGBE 4TYDA 1LKAA 5I46H 1S6HA 5DP9A 1GHXH 1C2EA 2FX6A 3NUMA 4NGAH 1XX9A 1B7XB 1RTKA 1A0HB 3C27B 1OP0A 1V2WT 1K1LA 2F3CE 1AKSA 4FUHA 3EAJA 3K9XB 1A7SA 1VZQH 1YKTA 1AHTH 1GHAG 2OINA 4UDWH 1TA6A 1GJAB 1GI3A 1QA0A 4MPUA 1ANCA 1GG6C 1S0RA 1QBOA 3ATKA 2TPIZ 1AN1E 3T62A 1EOLA 1DUAA 1GBFA 1KTSB 1OYTH 2YNBA 3BTWE 2QF3A 1SVPA 1KLJH 3TLOA 3T2NA 2HNTE 5C5NA 5EPYA 1O3PB 7GCHG 2QN5T 6GCHG 2I6SA 2ZDLA 1OWEA 3UOPA 4XBDA 2RCEA 4U30A 1C1QA 3QZRA 1MZDA 3PWBA 2VIQA 4K8BA 2AYWA 2R9PA 5E0JA 1ELBA 2SGEE 1FAKH 1O2NA 3KL6A 1O3CA 3O8BA 1C1TA 1RD3B 2GT8A 4K5ZA 3MMGA 4ABFA 2BDYA 8KME2 1LHEH 1LKBA 2UWPA 2ZG0H 3FFGA 2A1DB 3MU1A 4I8KA 3DA9B 1O3DA 3TH4H 2ZGJA 5E2PA 2FOEA 2FWWA 4XBCA 1HPGA 1IQHA 2W26A 1DXWA 1EXFA 1MTUA 3P6ZB 3VXEH 4DGJA 3KN2A 1KDQB 1ZHRA 1O3OA 4ZKSU 1Z8JB 2WYGA 2P3UB 1LMWB 2EI6A 3RU4E 3Q3XA 9LPRA 2WINI 3VGCC 4AB8A 3L6PA 3A80A 2XC5A 1EPTC 5J4QA 1BIOA 2ZKSA 1O3GA 4IW4E 3W95A 4Q7ZA 1O5FH 4U2WA 2ZC9H 1QB9A 1NROH 1QRWA 1AI8H 2UWLA 2XBVA 2XCNA 1TMBH 1HGTH 1VJ9U 2GCHG 3SU2A 1O5CB 2EI7A 2F9NA 4A7IB 1GGDB 2ZF0H 3ZZ5A 1FNIA 3UREA 4MTBA 1GBHA 1SGRE 3U8OH 2WPKS 4MVNA 4TY7A 1QNJA 4KELA 2FOAA 3KQDA 3GDUA 2EI8A 1OX1A 1GMDF 3TNTA 3RXMA 1ID5H 1K1MA 1UCYH 2PWXA 3NCLA 4LZ4B 1EASA 1NFYA 1MCTA 2AH4X 3M3TA 1NT1A 5EQRA 2P59A 3VB4A 2BY7X 3SU5A 4YT7H 1O0DH 4B1TA 4OS6A 1Q31A 3D62A 2JH5D 1D6RA 1KXCA 1SQTA 3MU5A 3ZVEA 1IQGA 1NESE 2OXSA 4MNXA 2JETC 2O8UA 3HGPA 1GDNA 1BBRH 2WUBA 5T3HA 3HGNA 4ESTE 5CHAB 2QC2A 3DT0H 1UHBB 2W7UA 2XBYA 4I31A 1HJAB 1FQ3A 1SOTA 3L33A 5K7RA 1FIZA 3LDXH 2A7JA 4FUDA 5HM9A 1V2MT 1F0SA 3GY2A 3S9BA 3SGAE 3NPSA 2C90B 1T8LA 2TRMA 3UNQA 1CA0C 1GHBF 1TE0A 2ZPQA 1YCPK 2KAIB 2FOFA 1OWHA 3RUOA 2G5NA 4MQAA 1G37A 1MQ5A 5FCRA 3AW1A 4K1SA 1OP2A 2FTMA 2GGVB 1LTOA 2A5KA 2HNTF 2QF0A 5L2ZH 3GOVB 3ZZ9A 3U8RH 2VIPA 3MNSA 1ZMLA 4RSPA 2QY0B 3UWJH 4TWYA 3VB6A 1FZZA 3MNXA 5F8ZA 4ISNA 3GCHC 1IQMA 1O3AA 2ZHFH 2OLGA 2Y82A 2ZHQH 2ZU4A 4M7GA 3TH2H 1GI9B 2VWMA 2GZ9A 2CXVA 2H1UA 1RJXB 3RXLA 1A2CH 4Y0YE 1B5GH 4TPYA 5AFZH 1SQOA 1GHYH 3GYLB 1P0SH 5HXFA 3E16B 4BAQB 1L1NA 1CQQA 1QL7A 1EB1H 1UVPA 1QA7A 1YPMH 1ZJKA 3DFJA 4J1YA 5F8TA 1ZTJA 3GDVA 2ZECA 4BTUB 1C5QA 1G9IE 1ELGA 2BD9A 1SGPE 2ZTZA 5DP4A 5FBEA 3BTTE 1V2NT 4Q7XA 1IQNA 2B9LA 1FMGA 1N6XA 1WOFA 5JB8S 1DT2A 1ZSJA 1NO9H 4X1QU 2GMTB 3RLWH 5C67A 3M7QA 3LGIA 4Y8YA 2Y80A 3GCTF 1YCPH 1GBDA 1HAPH 1GBEA 2F83A 1C5WB 1O3LA 1QQUA 2THFB 3F9FA 3LGUA 1W13U 2PKAA 2IOTA 1FDPA 3SZNA 3LOXA 3MHWU 1ARBA 4DURA 1GCTB 1Y3WA 2OP9A 2XW9A 1AFQC 2ZCLP 2BQWB 1LDTT 2HPPH 1W0YH 2DE9A 3NXPA 1QURH 2G00A 1PPZA 2WPJS 2VVCA 2ILNA 2DE8A 1AO5A 2ZDNA 3M5MA 1E35B 1NRSH 1GMHF 3A7WA 1P3EA 2UUJB 5K0HA 2CJIA 2XBWA 4ZAEA 5EPNA 4NFEA 1TLDA 2ODPA 5GJ4B 1IQJA 2GDEH 1JOUB 4X8SH 1AE5A 4K1TA 3EDXB 4X0WU 2QYIA 3V13A 1T8OA 1SFIA 4ZKOU 3MTYA 4WF8A 1BMAA 1VITH 2ZU3A 2ZFRH 2A2QH 3TK6A 1XUHA 3UY9A 1SGIB 1TNIA 4I8LA 4UFFH 1C2DA 4FUCA 5DK1A 2BTCE 2OBQA 5JB9S 4HFPB 2EA3A 1UTOA 3SO3A 1AVWA 3UWIA 5HM2A 1Y5AT 3AASA 1YPHC 4Y10E 1J16A 3ZZDA 1HAZB 3IWMA 1AB9B 1A4WH 3LGWA 2STBE 4Y8XA 3I77A 1CGHA 1Z6JH 4U32A 1UCYE 3BTHE 3PO1C 4E7NA 5T6FA 1P06A 2Z9JA 1VR1H 4KTCA 3DHKH 2CGAA 5FPSA 1BHXB 2ASUB 3RDZA 2Y6TA 4X2XA 3NKKA 5EXMA 1QHRB 2STAE 1P2QA 4K69A 1ESAA 4UONA 4Y71A 2HLCA 2BDCA 1HCGA 2ZHDA 1Z71A 1EP6A 1LQDB 1C1PA 1VCPA 1TGTA 1GI1A 3VPKA 4E7RG 2C93B 2ZWLH 2B5TB 5LGOA 1WUNH 5HGGA 4H4FA 3ZVGA 2ZCHP 2PLXA 4O97A 2OQ5A 4Z6AH 3URCA 1QB1A 1MCVA 2Z9KA 1ELDE 2BOKA 5JYIA 2J95A 1BQYA 3A8DA 2XXLA 3E90B 3F68H 2SNVA 2A7HA 5GCHF 2SFAA 1UTQA 3ITIA 1BITA 3LC5A 4E05H 1A3BH 2IN2A 2J9NA 4X1PU 1GBBA 1C4Y2 1ZGVA 1NS3A 1GBAA 1QGFA 2VIVA 3P8OA 1L1JA 5JDUB 3BTFE 3EA7A 1EB2A 1BTHH 1P2JA 1PQ5A 5IYTA 1TNHA 1XKBC 1YPKH 3BEUA 2PV9B 3RC6A 1AKSB 4OS7A 2BDBA 3VXFH 5AVDA 1P57B 2CF8H 1MMJN 2GZ7A 2QXIA 4YESB 6LPRA 2AGGX 1SGCA 1WU1A 4DT7B 2ZFTA 4YOGA 7KMEH 4U01A 2IPHA 1CVWH 4X6MA 2TGAA 1YYY1 1LVOA 2ANKH 2PR3A 1AUJA 3RXHA 1ESTA 1MUEB 2XBXA 3FVFB 2NU2E 1EZUC 3U9AH 1UK3A 2ZFPH 4Y7BA 2R3YA 2ZPSA 2F91A 1P10A 5FCKA 5L2YH 1GI2A 3M3VA 2FS8A 1TFXA 4ZHLU 1TWXB 1KSNA 1OWJA 4X6NA 1MBQA 5TJXA 4A1XA 2FM2A 2ZA5A 3RMLH 1CBWC 4WVPE 5E8EH 3AAVA 7ESTE 4NSYA 3DFLA 3SV2H 1XM1A 3AW0A 4B76A 3Q3YA 1BRAA 1DWCH 3QN7A 4WMDA 2F9BH 2A0QB 2ZI2H 4FU8A 2Z3EA 4UFEH 1GL1A 1FY5A 3RU4T 4IN2A 2LPRA 4OGYA 1FY3A 3SU6A 3SGQE 3HK3B 1C5VA 2FIRH 4K60A 1EAUA 4OS5A 3BG4C 2SGPE 3KNXA 2B8OH 1GHZA 1N1LA 2VWOA 2HVXA 1KXFA 4NA9H 1FAXA 1DY8A 2C8ZB 1DICA 1EOJA 1OP8A 3E6PH 1N8OB 1NFUA 1C5RA 2AEIH 2RG3A 1MTSA 1GBCA 2A2XH 1TGBA 3LGYA 2Z9LA 1A5IA 1HXFH 2GV7A 4A1VA 1ZR0A 1KXAA 1PPCE 1U6QA 3A87A 3MU0A 1QL9A 3Q76A 1EP5A 1NN6A 1T7CA 1H8IH 3BEFB 4D76A 4BAOB 8GCHF 4BNRA 5JBCS 3SI3H 3SJKA 1K1NA 3RXRA 1SLVB 5EODA 6CHAC 4FU7A 3QUMP 5EU8A 1E36B 1H9HE 2GX4A 5DP7A 2H6MA 2HALA 2PGQB 3LC3A 4NIWA 2TGTA 2ZDVH 2G4UA 2FI5E 2NU4E 3N7OA 2BLWA 2V35A 4YTAA 1BJUA 1S85A 2XRCA 5DGJA 1IHTH 2D2DA 1C4V2 1DLEA 4AG2A 1P9SA 1HUTH 3BTGE 1XVMA 2FXRA 3V3MA 3H7TA 2ZQ2A 1C2IA 1GMCG 2ZFQH 3SI4H 1YCPM 1DXPA 1MAYA 3P70B 1O3HA 2G5VA 4XBBA 4WMFA 3GY8A 3P8FA 1C5XB 1O38A 2BDGA 1EAXA 2BHGA 4MDSA 4AGKA 2OTVA 5DKMA 2EEKA 3FP7E 1NM6A 3V12A 4X2VA 2PTNA 1Y59T 3KEEA 3UOUA 3V0XA 1FI8A 3W94A 5A0AE 3O8CA 2Q6FA 4XE4A 3SHAH 3S0NA 1A5HA 1J17T 1PPEE 1V2UT 1MAXA 5DPAA 4BAHB 2HPQH 3F1SB 4Y7AA 3ZV8A 2AERH 1BRCE 1JRSA 1P01A 2BD7A 1SB1H 2Z9GA 2P95A 3E0NB 1K1PA 1GBLA 1TX8A 3QDZB 2QAAA 4Q2KA 1N6YA 1TMUH 3M35A 1DDJA 1CT0E 1HBTH 1V2JT 1BRUP 3M3SA 3V7TA 1Z8GA 1P2IA 3P92A 1CHOF 3QTOH 2Y5HA 2D26C 1WTGH 1B0FA 3A89A 2ZP0H 2IJOB 1BTWA 1ZPZA 1A5GH 2ZPRA 1O2YA 2Y7XA 4X2YA 5T6GA 3SNEA 3LPRA 1ACBE 3M5OA 1WYKA 1LHGH 1GJ9B 3PLBA 1GHAF 2GCTB 2DUCA 1GGDC 3M7UA 1QB6A 1RGQA 3GISB 2V0BA 3TNSA 4CBOA 2OC8A 5L30H 1MTNC 1PFXC 1AUTC 2FYQA 7GCHF 1M9UA 3SJ8A 3SU3A 6GCHF 1D3TB 2R2MB 1C1OA 1BOQA 1C5ZB 2R0LA 1BCUH 3RXGA 3M5NA 2B0FA 2PKAB 5JBBS 1XUGA 1TMTH 1TNGA 4NFFA 1P12E 4B73A 4CBNA 1XUKA 1HFDA 1IQIA 1V2KT 1EZSC 1F92A 3H7OA 1O3NA 1F5RA 1HNEE 1GI0A 1HAYB 1CSOE 1P2KA 3TGJE 1O2OA 1MBMA 3UNSA 3OX7U 4AFZA 3PTBA 5A8XA 2HOBA 4VGCB 5CHAC 4X6PA 1Q2WA 1VITF 2GP9B 4WXVA 5T6DA 1HJAC 4JK6A 5ESTE 4FUIA 1RRKA 4ZROA 3PLKA 1G3DA 1MZAA 3TGIE 3L3TA 3MH4A 1GI7B 4ZHMU 3A84A 2HNTC 1O2ZA 3OY5U 4ABGA 1LHCH 3A7XA 3RXQA 4BXSA 3FZDA 3U1JB 1EUFA 1O34A 1C5LH 1RXPA 3UTUH 2SGFE 3RLYH 1DITH 3SGBE 3LJJA 1MU6B 3P95A 1NZQH 3EQ0H 2G81E 2W3IA 2FDAA 1W10U 1MTNB 1QRZA 3A83A 1C5PA 3MWIU 4NA8A 1D3DB 4CR5A 4NWKA 1QL8A 5F8XA 3ZZBA 2Z3DA 4TPIZ 3URDA 5EG4A 2OD3B 1GCDA 3ATMA 1AU8A 5AFYH 3A7TA 3SN8A 1SC8U 1K21H 1ZMNA 2C4FH 2TBSA 3SV7A 2A5IA 7LPRA 1O2KA 1F2SE 4X1NU 2ZDMA 4UE7H 2C3SA 1UTKA 1BTPA 3MYWA 1TYNA 4YOJA 1IQKA 1AFEH 1SBWA 1GBIA 4WY3A 1O31A 4LXBH 4CRAA 2RA0A 1V6DA 2R2WU 4O03A 1O5BB 5JPMH 4IMQA 4AFQA 4DCDA 4JYTA 3QWCH 3RM2H 4I7YH 4ZKNU 4OS2A 2YNAA 2OQUA 3UQOA 1O39A 3SQEE 1NFWA 2GMTC 1P09A 2QXGA 3CENA 1SGQE 1UVUH 1T8NA 3CS0A 3SU1A 2NU1E 3RXUA 3PMHB 3UQVA 2TGPZ 4TWWA 4GUXA 4F4OC 1V2TT 1GJ8B 1UJ1A 1NPMA 1SGTA 3ZZAA 1V2OT 2O8WA 1S81A 2FI3E 2G55A 3U98H 1P3CA 4GSOA 4BXWA 1UTJA 1GCTC 3LKWA 4CRCA 1C5MD 1S83A 1ZTKA 3C1KA 3EE0B 1V3XA 1XMNB 2VWLA 2BVRH 2PKSB 2UUFB 1FV9A 3OSYA 3EYDA 4QT8C 3AAUA 1C2MA 2PUQH 1L0ZA 3M5LA 2Z9IA 1V2VT 1A46H 3STIA 2ESTE 3T27A 9ESTA 2BZAA 4O9VA 2A32A 2O8TA 2BOHB 4LZ1H 1JXPA 4IGDA 1SL3A 1P2OA 1C1VH 2GZ8A 4CREA 2H9TH 5F03A 1SHHB 3PTNA 1O2LA 2R0KA 4A5TS 1TNJA 2CMYA 4JZFH 4YZUA 2FOBA 1X7AC 3RXAA 2AMDA 1GI5A 2GTBA 4Y8ZA 3QK1A 3GICB 1BMMH 1C2LA 1TOMH 1TRMA 4I8HA 4DIIH 3B8JA 2BDHA 2RA3A 3BG8A 4ZXYH 1DLKB 4ISOA 2VB0A 3FANA 2FOHA 3UFAA 1H9IE 5EXLA 1O2JA 2EC9H 1SGFG 1MKWK 3PB1E 1NFXA 3BTEE 1E34B 4GCHF 1O3BA 2ZFFH 1BMNH 1GJ6A 1AB9C 3OU0A 1TAWA 3FAOA 1QQ4A 5A0BA 1FPCH 3RXBA 2AIQA 2OBOA 1HAVA 4D8NA 2BLVA 1W7GH 1D9IA 1KYNA 5PTPA 1NRQH 1NU9A 2BY6X 4FU9A 4MNWA 4PROA 3S9CA 1V2QT 4MNVA 2PSYA 4INHA 3VFEA 3DUXH 4UFDH 3O8RA 1ARCA 3RXTA 1YPHE 3F9GA 4R8TB 1GDUA 2ZGHA 4DOQA 1RTFB 1PPFE 1UTPA 2QIQA 1HAXB 1ABIH 1TGNA 1P05A 4YT6H 4IMZA 3MI4A 3GY5A 1EJMA 3BF6H 3SUEA 3ZZCA 1C2JA 1EZXC 2Q1JA 5TCCA 3UNRA 1ETRH 1YPLH 2PTCE 1V2LT 2FO9A 2FODA 2UUYA 4SGAE 1OWKA 3SNCA 1OOKB 1Y3XA 2BQ7B 3LJOA 4GHTA 5FHTA 2ZDKA 1HIAA 1FN8A 2M5TA 3UUZA 4CRFA 1EATA 1BTUA 1AVGH 1O2WA 1ELTA 2VWNA 1CHGA 2GD4B 4A92A 4JK5A 4IS5A 1FIWA 1RS0A 3MH5A 1C5OH 2P94A 1IOEA 5FX5A 1KXEA 1SPJA 2ZO3H 2ZGBH 2ZQ1A 4NA7A 2UUKB 1GJCB 3ZYEA 3D23A 1G2MA 1YF4A 4KTUA 4BANB 1ZHMA 3MNCA 1O3FA 4K8YA 2PUXB 1O2QA 1UTNA 2R3UA 5FX6A 4WH6A 1DSTA 1F0RA 4HGCA 1OWDA 1G32B 1G3BA 1MU8B 5EGMA 2G4TA 4Y11E 1XUFA 2H2ZA 4NIXA 4GVUA 1TPOA 1Y5UT 1AQ7A 2VIWA 1C1NA 3A81A 1QBNA 1FY1A 5LH8A 1QJ6B 2BY9X 4AOQA 3ATIA 4GAWA 2O8LA 4GPGA 1JIMA 1SLXB 2AGEX 2V3OH 4GLYA 3RM0H 3SJ9A 1GVZA 1DVAH 4AGJA 1SQAA 3BTKE 1MKXK 1UTMA 1AD8H 4F49A 1KXBA 4WXIA 3TITA 1EPTA 1ZRKA 5I25A 4X8TH 3K6ZA 2C8XB 2C8YB 4XFQA 2ZEBA 3A8AA 1WQSA 2FS9A 2RDLA 3VB3A 4WWYA 1ESBA 3KQEA 5GDSH 2PFEA 3GYMA 3RU4D 4BTTB 3RC4A 2D1JA 2Q6GA 5A8ZA 1EJAA 4ZUHA 3ZV9A 1C5NH 4OS1A 1CGJE 1AMHA 2A4OA 3PV4A 5JBAS 3E1XB 1UVSH 4CRDA 1H9LB 1N8OC 1O3KA 3P8NA 1C1RA 2A7CA 2J92A 1WTHD 4JZEH 3PMAB 4NIVA 1HJ9A 3ESTA 3I78A 4Q80A 1P2NA 1TPPA 4AFUA 1NC6A 3TJUA 1SGEE 1LVYA 4R0IA 4ZKRU 2JKHA 3UPEA 4WJG2 4NG9H 3GCOA 5C1UA 1G2LA 3BIUH 2SGQE 3FP8E 1MTVA 1DX5M 2WV4A 5BPEA 1MKXH 3TVJB 1T4VH 3P8GA 4IN1A 1CA8B 1KLTA 4XOJA 5G4BA 1OSSA 1O5DH 4FUGA 1XVOA 2J34A 4AX9H 2P8OB 2G8TA 1S0QA 5C3NA 4B75A 2W3KA 1TOCB 4X1SU 1ELEE 2ZTYA 2A45B 1DWBH 3F9EA 2GT7A 2VNTA 5E2OA 2CF9H 3MO6A 3VEQB 1OKXA 3DD2H 2V6NA 2JH6D 1ELVA 4YOIA 3RXKA 3M37A 2FLRH 1EQ9A 3B9FH 1HXEH 2XWAA 1G3EA 1F5KU 4I33A 4Z0KA 1BT7A 4AB9A 3A7YA 5AF9H 1K28D 1O33A 1JIRA 1BRBE 1SMFE 1LHFH 3E91A 1P02A 3BIVH 4MLFB 2F9VA 4X2WA 4ZXXH 2J4IA 3E8LA 1UK4A 3A85A 3KQBA 4H6SB 1Y3VA 4AYYB 1OXGA 3KHVA 1TQ7B 2H9HA 1F0UA 1Z1JA 3RXPA 1ZHPA 3GY4A 3Q00A 1GBMA 5TCAA 3OYPA 1SOZA 1BTZA 2FP7B 2FPZA 2ODQA 1YLCA 3SORA 2BY5X 3SU4A 5CMXH 4OGXA 1CE5A 3SV8A 1GVLA 1BZXE 5FAHA 3MH6A 1GBTA 5A8YA 1C1UH 3T28A 3PMBB 5C2ZA 4AN7A 1O5GH 2WYJA 3LU9B 1ZSKA 1SFQB 5FXLA 1O36A 1Z1IA 2FOMB 2AIPA 1GBJA 2XYAA 3LGVA 1FY8E 3A8BA 5E0HA 5DG6A 1GBKA 4K3JA 3T5FH 2GCTC 2QA9E 3A82A 3OTJE 1QTFA 2ZHWH 3R0FA 1DANH 2AMPA 5EQQA 1AE8H 2Q6DA 1ZMJA 1EZQA 3QGNB 3QO6A 4ZH8A 1AGJA 1GMCF 4A1TA 3EA9A 1AZ8A 4DW2U 2ODYB 2J94A 1EKBB 3U8TH 1AWFH 1HV7A 1GHVH 3BSQA 3RP2A 3PROA 4JZIA 1TPAE 1TRNA 4B2AA 3NZIA 1K1OA 3LH1A 4ZHAA 2ZIQH 2GKVE 2P16A 5FPTA 4K2YA 4JYUH 3F6UH 4KGAA 2XC0A 1RTLA 4JMYA 1Q3XA 2HRVA 1KIGH 1P03A 4D7FA 3BV9B 1C9PA 3M7TA 3RXFA 2BXTH 3R3GB 1G36A 1QY6A 2G52A 4B2CA 1E38B 3MU4A 3KCGH 2FTLE 2VGCC 4VGCC 3RXCA 3FZZA 2BD5A 2VINA 1CHOG 2GVFA 3AVZA 2ALVA 2BB4A 1LVBA 3RXOA 4TY6A 4FUEA 4B71A 1AWHB 1GVKB 3K2UA 4O3UA 1ABJH 1C5TA 2GDDA 2Z94A 1H8DH 2NU3E 1HAGE 1O2SA 1GWAA 3VB5A 1BDAA 2ZHEH 3ELAH 2BZ6H 2A5AA 2CN0H 4Q7YA 2NU0E 1ZRBA 4I32A 1F0TA 1UTLM 4GHQA 3GCNA 1DM4B 3SNDA 3ZVCA 3VB7A 1W14U 2OC0A 2GV6A 3D65E 3O8DA 1H4WA 1PPGE 3ZVAA 2XNIA 1K1JA 1B0EA 2XCFA 1A0LA 1O2TA 1O5AB 5B6OA 1DY9A 3SUGA 4JZ1A 1YBWA 3A86A 1AIXH 1FY4A 4DJZB 4X1RU 4K1EA 4FXGH 4B74A 1JRTA 1ZYOA 3CP7A 4INLA 3QLPH 2PW8H 4ASHA 1W12U 1CT4E 2A4RA 3B23B 3S7HB 1HAVB 3RXIA 1IAUA 1UCYK 3A7VA 1PPHE 2CHAB 2BVSH 1NRNH 1SG8B 1QFKH 1ZTLA 1VGCB 5HMAA 2VGCB 3ZVFA 4KTSA 1C5YB 3A7ZA 1QRXA 4BAMB 3SV9A 1TGSZ 5DJ7A 3TIUA 1CGIE 1OPHB 1P2MA 4HZHA 2ZU5A 2Y5GA 1VITG 1BBRK 3QGJA 4ABEA 1W7XH 4RKOB 3UR9A 2W7SA 1C1SA 1DOJA 1D6WA 1GJDB 4J2YB 4Y79A 5ETXA 4LK4A 1V2ST 1GJ4H 1TBRH 1O30A 4B2BA 1GG6B 1JMOH 2GCHF 1C1WH 3TJNA 3LH3A 3TK5A 2Z3CA 5SGAE 1HRTH 2Z7FE 4IC6A 2BDAA 3TH3H 4IC5A 4X8UH 1GMDG 1HYLA 1TGCA 3SBKA 1ELAA 3PYHA 1HIAB 1GJ7B 3HKIB 4MPVA 5IDKA 1O2RA 2G51A 1EJNA 2PKSC 2B7DH 3ATLA 4AG1A 1KTTB 2C8WB 3MFJA 4Y0ZE 1NU7B 2FESH 3ZZ8A 1TNLA 1YM0A 1ETTH 1FONA 1MD7A 2ULLA 2BYAX 3S69A 1W11U 3U1IB 1DSUA 1P04A 1Z7KA 3BTQE 1TX7A 1ANEA 3TJVA 1SSXA 2Z6BD 2BVXH 2I6QA 1FJSA 1PJPA 2ZZUH 1QJ7B 4RKJB 1WCZA 2BLOA 1DWEH 2TIOA 1SGYE 5DP8A 3LIWA 4YO9A 3ZVDA 1HDTH 2BMGB 5H4IB 4MG3A 3ODDA 4ABDA 1C1MA 1KLIH 1YPGH 4BTIB 4CH8B 3VGCB 1GHBG 2UWOA 1Z6EA 3T25A 1FUJA 3ZZ3A 1ANDA 3SJOA 4CHAC 1WV7H 1EPTB 2A4QA 1K22H 4THNH 2CV3A 2FX4A 4NSVA 1ZSLA 1C2HA 2YOLA 5BRRE 1O2GH 1O5EH 2A4GA 1TALA 3D49H 1GI8B 1SGNE 4D9RA
chains in the Genus database with same CATH superfamily
2SGDE 3PV5A 3RMNH 3RXJA 3TU7H 3JZ2B 1XKAC 3T29A 2FOGA 2ANWA 1A61H 4FVDA 4OS4A 3E0PB 2XC4A 3OY6U 4UEHH 2QXJA 4ABIA 2KCOA 4CH2B 2OC7A 3MH7A 3A88A 2KFWA 1IHSH 5LPEA 1LCYA 4ABAA 1BTXA 2VIDA 2SGAA 2Y7ZA 1UVOA 2FI4E 1O3MA 3ZZ7A 2BM2A 4D9QA 1YLDA 1LQEA 1D3PB 1P11E 2BD8A 2NWNA 3BTME 2WV5A 1TBZH 1HAOH 5KECA 2KCAA 1SI5H 1T31A 2JETB 1DS2E 8LPRA 3PM3A 5HKKD 2D8WA 1C2FA 1JBUH 1ZZZA 5L6NH 2FOCA 2BQ6B 2A31A 1MH0A 5DP6A 1C5SA 3QZQA 4CHAB 2VH6A 4FVBA 4ISHH 1IQLA 3CS7A 3GCTG 1S6LA 1PYTD 3U28C 3T26A 2ZCKP 3QX5H 1A3EH 1ANBA 5EOKA 1WAYB 1V2RT 2BDIA 1P9UA 2JH0D 1WQVH 2ZDAH 1O2IA 1CA0B 5HYOA 4GCHG 1K1IA 1J15A 1TABE 1ELFA 1A1RA 1UMAH 2BX3A 2BD4A 4I8JA 2OUAA 1C4U2 4HTCH 2H5DA 3UIRA 3SQHE 1S82A 4LOYH 1LPZB 5C5OA 1DPOA 4AYVB 3M61U 1L2EA 3KIDU 2HWLB 4BOHA 2RFKC 3GCHB 4AORA 3TGKE 1FXYA 1OWIA 3K6YA 5J4SA 1NTPA 3MQKC 1GMHG 1EAWA 3MO9A 1DFPA 3P17H 3SJIA 2J2UA 4ISLA 3WY8A 1ZOMA 1KDQA 1OS8A 2ZU2A 1VKYA 1L4ZA 5GIBA 5EQSA 2VU8E 1EAIA 2OCVB 1NBMD 1O2PA 4INKA 1UK2A 1QIXB 2W5EA 3RXVA 1DWDH 2WPHS 1WDIA 3RXSA 1XUJA 1PQ8A 2O9QA 1MKWH 1UO6A 2V3MA 2VVVA 1EX3A 4NIYA 2ALPA 3IITA 1S84A 1E0FD 3HK6B 2JIZD 2H9EH 1HB0B 1TPSA 1E37B 3ZZ6A 3F3BA 1A0JA 4AZ2B 1UVTH 1P8VC 5A2MH 2QCYA 1QR3E 2ANYA 1H1BA 3ZVBA 1J14A 1D3QB 3Q3KA 4RN6A 3TJOA 5AHGH 3SV6A 3GY6A 1BTYA 1OYQA 2FYRA 2FLBH 2WPMS 3EGKH 1KXDA 1SGDE 1AFQB 2K8IA 2Y5FA 3PLPA 4YLUA 1FPHH 4DVAU 1GHWH 4NCYA 3TK9A 3UAIC 1W0JD 2BLQA 1ZJDA 3BEIB 1S6FA 4X6OA 4ABJA 2ZTXA 3SHCH 2BD3A 1T8MA 1RIWC 1GPZA 1UHBA 2TGDA 1Y3YA 3SOSA 1BB0B 1UW7A 1G3CA 1LPGB 3E3TA 1C2GA 2WV9A 4F55A 1FLEE 1DE7H 2P93A 4RT0A 5GCHG 1TRYA 1O2MA 3SU0A 1TIOA 1BBRE 3TPIZ 1O2VA 1L1GA 3OFND 4ISIH 1BHXF 2LNCA 1T32A 1XUIA 2KAIA 2P8OC 1O35A 1SLUB 4Q63A 1NRRH 3S9AA 4DY7B 5GXPA 1BA8B 5EW2H 4B6FA 1WBGB 1HAHH 5GWZA 3PWCA 2OC1A 1YP9A 1BJVA 2XWBI 1W2KH 3RXDA 4XDEA 1O3JA 1C9TA 3H5CB 4XSKU 3KF2A 1THRH 3OAAD 3RC5A 4IBLH 2O8MA 4CR9A 5JBTA 3M36A 3GY7A 2WPLS 4ABBA 3BTDE 1YGCH 4HI3A 3IG6B 4NZLA 3CNRA 1TB6H 1L4DA 1SR5C 1HLTH 1MD8A 1AVXA 4MPXA 4JYVH 5GPIB 1YPJH 2CK3D 1J8AA 3S7KB 3KGPA 3PO1B 4O3TA 1ZPCA 3ATWA 3HPTB 2XTTB 1HJ8A 3BN9A 1LVMA 3OEED 3NWUA 1XXFA 3WWFA 1AY6H 1Z8IB 1RIWB 1YWUA 1T4UH 2AMQA 2BX4A 4MNYA 5LPFA 4DT4A 5A09A 4ABHA 1SGFA 1GI6A 3ZZ4A 2QV1A 3PMJA 5CE1A 4WMEA 5C1YA 1W8BH 3GY3A 5EJ1A 5C20A 1O2HA 1VCQA 2WUCA 2VH0A 1IQFA 1VJAU 3RXEA 1NRPH 3ZYDA 4YM9A 1O32A 1KY9A 1INCA 4CRBA 1J9CH 2BY8X 4KKDA 1O2UA 1TONA 3SYJA 1IQEA 5E0GA 4MPWA 1WSSH 2PHBA 2BXUH 5ABWA 1D4PB 1COWD 2K1QA 1C2KA 3K65B 2FEQH 4JZDH 3SUDA 4UFGH 1PPBH 5FBIA 4A6LA 2AFQB 1G30B 1Z8RA 1ZGIA 2J38A 5DP5A 2V3HH 1FX0B 2QF4A 3SNAA 1GDQA 8ESTE 3GDSA 2F9PA 4F48B 2ZNKH 3RMMH 3A8CA 1O3EA 2PGBB 3ODFA 1O2XA 1TQ0B 1THPB 3FP6E 3SNBA 2ZGXH 2PSXA 2FZZA 3HATH 1K9OE 5DO4H 2Y81A 4ACBA 4Y6DA 1GJ5H 2ZFSA 4OM9A 1CT2E 1W3CA 4WH8A 1O3IA 4JCNA 4E06H 2VJ1A 1TA2A 4D7GA 3RMOH 4P00A 4YLQH 1F5LA 3F9HA 5ESBA 8GCHG 4DIHH 1QCPA 1QJ1B 1THSH 1SLWB 1XXDA 1HAIH 2YMSC 2HGTH 1FN6A 2ANMH 3LT3A 3LGTA 4BAKB 3SUFA 2QXHA 3LONA 3MU8A 1Y5BT 3NK8A 2VVUA 1ETSH 2ZGCA 1YC0A 1YPEH 3MOCA 4NWLA 1ZPBA 1MQ6A 2QGRA 1GL0E 3QTVH 4H42U 3SW2B 2AHME 1GI4A 1F7ZA 5DP3A 1DUEA 5HIZA 1QBVH 5C1XA 5LPRA 1RFNA 1PQ7A 1TX6A 1CBWB 4I8GA 4FUFA 4AFSA 1BMLA 4NZQA 2VIOA 6ESTA 2J97A 2L74A 2P3FH 4X8VH 2SNWA 2F9OA 1ELCA 3GS9A 1S5SA 1V2PT 4KP0A 4FUJA 1LO6A 3G01A 4TT3D 2PP6A 1NY22 2P3TB 3HKJB 3EA8A 2AGIX 1C5UA 1LHDH 1PQAA 1BUIA 5EW1H 3JZ1B 3KQCA 1JWTA 1TNKA 1ORFA 4CRGA 2BD2A 2KM0A 1CO7E 3BG4B 3I29A 5EXNA 2ZU1A 4Y76A 1CU1A 1K2I1 3Q77A 3MNBA 3ENSB 1O37A 4UD9H 3MO3A 3ZIAD 1W0ZU 5A0CA 1SHYA 4DG4A 4ZMAH 2F9UA 1AZZA 1Y3UA 1LPKB 1MTWA 1GJBB 3U69H 1TBQH 3UR6A 2AS9A 4FUBA 3STJA 1VCWA 5F6MA 2KX4A 1PYTC 2CHAC 4H6TA 1Y8TA 2WPIS 2FMJA 2H5CA 6CHAB 1VGCC 5FPYA 1ZLRA 2HLDD 4SGBE 2WHXA 1LKAA 4TYDA 5I46H 3AK5A 1S6HA 5DP9A 1GHXH 1C2EA 2FX6A 3F2HA 3NUMA 4NGAH 1XX9A 1B7XB 4AC9A 1RTKA 1A0HB 5IK2D 3C27B 1OP0A 1V2WT 1K1LA 2F3CE 1AKSA 1SKYE 4FUHA 3EAJA 3K9XB 1A7SA 1VZQH 5DSFA 5C94A 1YKTA 1AHTH 1GHAG 2OINA 4UDWH 1TA6A 1GJAB 1GI3A 1QA0A 4MPUA 1ANCA 1GG6C 1S0RA 1QBOA 3ATKA 2TPIZ 1AN1E 3T62A 1EOLA 1DUAA 1GBFA 1KTSB 1OYTH 2YNBA 3BTWE 2QF3A 1SVPA 1KLJH 3TLOA 3T2NA 2HNTE 5C5NA 5EPYA 1O3PB 7GCHG 2QN5T 6GCHG 2I6SA 2ZDLA 4RT1A 1OWEA 3UOPA 4XBDA 2RCEA 4U30A 1C1QA 3QZRA 1MZDA 3PWBA 3EE7A 2J98A 2VIQA 4K8BA 2AYWA 2R9PA 5E0JA 1ELBA 2SGEE 1FAKH 1O2NA 3KL6A 1O3CA 3O8BA 1C1TA 1RD3B 2GT8A 4K5ZA 3MMGA 4ABFA 2BDYA 8KME2 1LHEH 1LKBA 2UWPA 2ZG0H 3FFGA 2A1DB 3MU1A 4I8KA 5KGOA 3DA9B 1O3DA 3TH4H 2ZGJA 5E2PA 2FOEA 2FWWA 4XBCA 1HPGA 4B6EA 1IQHA 2W26A 3DSPA 1DXWA 1EXFA 1MTUA 3P6ZB 3VXEH 4DGJA 3KN2A 1KDQB 1ZHRA 1O3OA 4ZKSU 1Z8JB 2WYGA 2P3UB 1LMWB 2EI6A 3RU4E 3Q3XA 9LPRA 2WINI 3VGCC 4AB8A 3L6PA 3A80A 2XC5A 2GJGA 1EPTC 5J4QA 1BIOA 2ZKSA 1O3GA 4IW4E 3W95A 4Q7ZA 1O5FH 4U2WA 2ZC9H 1QB9A 1NROH 1QRWA 1AI8H 2UWLA 2XBVA 2XCNA 4HG6A 1TMBH 1HGTH 1VJ9U 2GCHG 3SU2A 1O5CB 2EI7A 2F9NA 4A7IB 1GGDB 2ZF0H 3ZZ5A 1FNIA 3UREA 4MTBA 1GBHA 1SGRE 3N7EA 3U8OH 2WPKS 4MVNA 4TY7A 1QNJA 4KELA 2FOAA 3KQDA 3GDUA 2EI8A 1OX1A 1GMDF 3TNTA 3RXMA 1ID5H 1K1MA 1UCYH 2PWXA 3NCLA 4LZ4B 3DSOA 1EASA 1NFYA 1MCTA 2AH4X 3M3TA 1NT1A 5EQRA 2P59A 3VB4A 2BY7X 3SU5A 4YT7H 1O0DH 4B1TA 4OS6A 1Q31A 3D62A 2JH5D 1D6RA 1KXCA 1SQTA 3MU5A 3ZVEA 1IQGA 1NESE 2KR7A 2OXSA 4MNXA 2JETC 2O8UA 3HGPA 1GDNA 1BBRH 2WUBA 5T3HA 3HGNA 4ESTE 5CHAB 2QC2A 3DT0H 1UHBB 2W7UA 2XBYA 4I31A 1HJAB 1FQ3A 1SOTA 3L33A 5K7RA 2IPQX 1FIZA 3LDXH 2A7JA 4FUDA 5HM9A 1V2MT 1F0SA 3GY2A 3S9BA 3SGAE 3NPSA 2C90B 1T8LA 2TRMA 3UNQA 1CA0C 1GHBF 1TE0A 2ZPQA 1YCPK 2KAIB 2FOFA 1OWHA 3RUOA 2G5NA 4MQAA 1G37A 1MQ5A 5FCRA 3AW1A 4K1SA 1OP2A 2FTMA 2GGVB 1LTOA 2A5KA 2HNTF 2QF0A 2KCYA 5L2ZH 3GOVB 3ZZ9A 3U8RH 2VIPA 3MNSA 1ZMLA 4RSPA 2QY0B 3UWJH 4TWYA 3VB6A 1FZZA 3MNXA 5F8ZA 4ISNA 3GCHC 1IQMA 2LP6A 1O3AA 2ZHFH 2OLGA 2Y82A 2ZHQH 2ZU4A 4M7GA 3TH2H 1GI9B 2VWMA 2GZ9A 2CXVA 2H1UA 1WXRA 1RJXB 3RXLA 1A2CH 4Y0YE 1B5GH 4TPYA 5AFZH 1SQOA 1GHYH 3GYLB 1P0SH 3PRDA 3E16B 5HXFA 4BAQB 1H8HD 1L1NA 1CQQA 1QL7A 1EB1H 1UVPA 1QA7A 1ZJKA 1YPMH 3DFJA 4J1YA 2LELA 5F8TA 1ZTJA 3KYGA 3GDVA 2ZECA 4BTUB 1C5QA 1G9IE 1ELGA 2BD9A 1SGPE 2ZTZA 5DP4A 5FBEA 3BTTE 1V2NT 4Q7XA 1IQNA 2B9LA 1FMGA 1N6XA 1WOFA 5JB8S 1DT2A 1ZSJA 1NO9H 4X1QU 2GMTB 3RLWH 5FL7D 5C67A 3M7QA 3LGIA 4Y8YA 2Y80A 1BMFD 3GCTF 1YCPH 1GBDA 1HAPH 1GBEA 2F83A 1C5WB 1O3LA 1QQUA 2THFB 3F9FA 3LGUA 1W13U 5DN6D 2PKAA 2IOTA 1FDPA 3SZNA 3LOXA 3MHWU 1ARBA 4DURA 1GCTB 1Y3WA 3OE7D 2OP9A 2XW9A 3OTPA 1AFQC 2ZCLP 2BQWB 1LDTT 2HPPH 2JJ2D 1W0YH 2DE9A 3NXPA 1QURH 2G00A 1PPZA 2WPJS 2VVCA 3FOAA 2ILNA 2DE8A 1AO5A 2ZDNA 3M5MA 1E35B 1NRSH 1GMHF 3A7WA 1P3EA 2UUJB 5K0HA 2CJIA 2XBWA 4ZAEA 5EPNA 4NFEA 1TLDA 2ODPA 5GJ4B 1IQJA 2GDEH 1JOUB 4X8SH 1AE5A 4K1TA 3EDXB 4X0WU 2QYIA 3V13A 1T8OA 1SFIA 4ZKOU 3MTYA 3NRLA 4WF8A 1BMAA 1QZ8A 1VITH 2ZU3A 2ZFRH 2A2QH 3TK6A 1XUHA 3UY9A 1SGIB 1TNIA 4I8LA 4UFFH 1C2DA 4FUCA 5DK1A 2BTCE 2OBQA 5JB9S 4HFPB 2EA3A 1UTOA 3SO3A 1AVWA 3UWIA 5HM2A 4ASUD 1Y5AT 3AASA 1YPHC 4Y10E 1J16A 3ZZDA 1HAZB 3IWMA 1AB9B 1A4WH 3LGWA 2STBE 4Y8XA 3F2FA 3I77A 1CGHA 1Z6JH 4U32A 1UCYE 3BTHE 3PO1C 4E7NA 5T6FA 1P06A 2Z9JA 1VR1H 4KTCA 3DHKH 2CGAA 4XRNA 5FPSA 1BHXB 2ASUB 3RDZA 2Y6TA 4X2XA 3NKKA 5EXMA 1QHRB 2STAE 1P2QA 4K69A 1ESAA 4UONA 4Y71A 2HLCA 2BDCA 1HCGA 2ZHDA 1Z71A 1EP6A 1LQDB 1C1PA 1VCPA 1TGTA 1GI1A 3VPKA 4E7RG 2C93B 2ZWLH 2B5TB 5LGOA 1WUNH 5HGGA 4H4FA 3ZVGA 2ZCHP 2PLXA 4O97A 2OQ5A 4Z6AH 3URCA 2JJ1D 1QB1A 1MCVA 2Z9KA 1ELDE 1MABB 2BOKA 5JYIA 2J95A 1BQYA 3A8DA 2XXLA 3E90B 3F68H 2SNVA 2A7HA 5GCHF 2SFAA 1E1RD 1UTQA 3ITIA 1BITA 3LC5A 4E05H 1A3BH 2IN2A 2J9NA 4X1PU 1GBBA 1C4Y2 1ZGVA 1NS3A 1GBAA 1QGFA 2VIVA 3P8OA 1L1JA 5JDUB 3BTFE 3EA7A 1EB2A 1BTHH 1P2JA 1PQ5A 5IYTA 1TNHA 1XKBC 4Q4LA 1YPKH 3BEUA 2PV9B 3RC6A 1AKSB 4OS7A 2BDBA 3VXFH 5AVDA 1P57B 4ZCNA 2CF8H 1MMJN 2GZ7A 2QXIA 4YESB 6LPRA 2AGGX 1SGCA 1WU1A 4DT7B 2ZFTA 4YOGA 7KMEH 4U01A 2IPHA 1CVWH 4X6MA 2TGAA 1YYY1 1LVOA 2ANKH 2PR3A 2KCPA 1AUJA 3RXHA 1ESTA 1MUEB 2XBXA 3FVFB 2NU2E 1EZUC 3U9AH 3WWBA 1UK3A 2ZFPH 3H09A 4Y7BA 2R3YA 2ZPSA 2F91A 1P10A 5FCKA 5L2YH 1GI2A 3M3VA 2FS8A 1TFXA 4ZHLU 1TWXB 1KSNA 1OWJA 4X6NA 1MBQA 5TJXA 4A1XA 2FM2A 2J98B 2ZA5A 3RMLH 1CBWC 4WVPE 5E8EH 3AAVA 7ESTE 4NSYA 3DFLA 3SV2H 1XM1A 3AW0A 4B76A 3Q3YA 1BRAA 1DWCH 5F53A 3QN7A 4WMDA 2F9BH 2A0QB 2ZI2H 4FU8A 2Z3EA 4UFEH 1GL1A 1FY5A 3RU4T 4IN2A 2LPRA 2W6ID 4OGYA 1FY3A 3SU6A 3SGQE 3HK3B 3UB0A 1C5VA 5B6LA 2FIRH 4K60A 1EAUA 4OS5A 3BG4C 2SGPE 3KNXA 2B8OH 3N7DA 1GHZA 1N1LA 2VWOA 2HVXA 1KXFA 4NA9H 1FAXA 1DY8A 2C8ZB 1DICA 1EOJA 1OP8A 3E6PH 1N8OB 1NFUA 2KZ4A 1C5RA 2AEIH 2RG3A 1MTSA 1GBCA 2A2XH 1TGBA 3LGYA 2Z9LA 1A5IA 1HXFH 2GV7A 4A1VA 1ZR0A 1KXAA 1PPCE 1U6QA 3A87A 3MU0A 1QL9A 3Q76A 1EP5A 1NN6A 1T7CA 1H8IH 3BEFB 3PRBA 4D76A 4BAOB 8GCHF 4BNRA 5JBCS 3SI3H 3SJKA 1K1NA 3RXRA 1SLVB 5EODA 6CHAC 4FU7A 3QUMP 5EU8A 1E36B 1H9HE 2GX4A 5DP7A 2H6MA 2HALA 2PGQB 3LC3A 4NIWA 2TGTA 2ZDVH 2G4UA 2FI5E 2NU4E 3N7OA 2BLWA 2V35A 4YTAA 1BJUA 1S85A 2XRCA 5DGJA 1IHTH 2D2DA 1C4V2 1DLEA 4AG2A 1P9SA 1HUTH 3BTGE 1XVMA 2FXRA 3V3MA 3H7TA 2ZQ2A 1C2IA 1GMCG 2XNDD 2ZFQH 3SI4H 1YCPM 1DXPA 1MAYA 3P70B 1O3HA 5T1VA 2G5VA 4XBBA 4WMFA 3GY8A 3P8FA 1C5XB 1O38A 2BDGA 1EAXA 2BHGA 4MDSA 4AGKA 2OTVA 5DKMA 2EEKA 3FP7E 1NM6A 3V12A 4X2VA 2PTNA 1Y59T 3KEEA 3UOUA 3V0XA 1FI8A 3W94A 5A0AE 3O8CA 2Q6FA 4XE4A 3SHAH 3S0NA 1A5HA 1J17T 1PPEE 1V2UT 1MAXA 5DPAA 4BAHB 2HPQH 3F1SB 4Y7AA 3ZV8A 2AERH 1BRCE 1JRSA 1P01A 2BD7A 1SB1H 2Z9GA 2P95A 3E0NB 1K1PA 1GBLA 1TX8A 3QDZB 2QAAA 4Q2KA 1N6YA 1TMUH 3M35A 1DDJA 1CT0E 1HBTH 1V2JT 1BRUP 3M3SA 3V7TA 3DSGA 1Z8GA 1P2IA 3P92A 1CHOF 3FO8D 3QTOH 2Y5HA 2D26C 2J5UA 1WTGH 1B0FA 3A89A 2ZP0H 2IJOB 1BTWA 1ZPZA 1A5GH 2ZPRA 1O2YA 2Y7XA 4X2YA 5T6GA 3SNEA 3LPRA 1ACBE 3M5OA 1WYKA 1LHGH 1GJ9B 3FKSD 3PLBA 1GHAF 2GCTB 2DUCA 1GGDC 3M7UA 1QB6A 1RGQA 3GISB 2V0BA 3VG8A 3TNSA 4CBOA 2OC8A 5L30H 1MTNC 1PFXC 1AUTC 2FYQA 7GCHF 1M9UA 3SJ8A 3SU3A 6GCHF 1D3TB 2R2MB 1C1OA 1BOQA 1C5ZB 2R0LA 1BCUH 5EJZA 3RXGA 3M5NA 2B0FA 2PKAB 5JBBS 1XUGA 1TMTH 1TNGA 4TSFD 4NFFA 1P12E 4B73A 4CBNA 1XUKA 1HFDA 4M9FA 1IQIA 1E1QD 1V2KT 1EZSC 1F92A 3H7OA 1O3NA 1F5RA 1HNEE 1GI0A 1HAYB 1CSOE 1P2KA 3TGJE 5EIYA 1O2OA 5GNDA 1MBMA 3UNSA 3OX7U 4AFZA 3PTBA 5A8XA 2HOBA 4VGCB 5CHAC 4X6PA 1Q2WA 1VITF 2GP9B 4WXVA 5T6DA 1HJAC 4JK6A 5ESTE 4FUIA 1RRKA 4ZROA 3PLKA 1G3DA 1MZAA 3TGIE 3L3TA 3MH4A 1GI7B 4ZHMU 3A84A 2HNTC 1O2ZA 3OY5U 4ABGA 1LHCH 3A7XA 3RXQA 4BXSA 3FZDA 3U1JB 1EUFA 1O34A 1C5LH 1RXPA 3UTUH 2SGFE 3RLYH 1DITH 3SGBE 3LJJA 1MU6B 3P95A 2OK5A 1NZQH 3EQ0H 2G81E 2W3IA 2FDAA 1W10U 1MTNB 2WZQA 1QRZA 3A83A 1C5PA 3MWIU 4NA8A 1D3DB 4CR5A 4NWKA 1QL8A 5F8XA 3ZZBA 2Z3DA 4TPIZ 3URDA 4Z1MD 5EG4A 2OD3B 1GCDA 3ATMA 1AU8A 5AFYH 3A7TA 3SN8A 1SC8U 1K21H 2C4FH 1ZMNA 2TBSA 3SV7A 2A5IA 7LPRA 1O2KA 1F2SE 4X1NU 2ZDMA 4UE7H 2C3SA 1UTKA 1BTPA 3MYWA 1TYNA 4YOJA 1IQKA 1AFEH 1SBWA 1GBIA 4WY3A 1O31A 4LXBH 4CRAA 2RA0A 1V6DA 2R2WU 1OHHD 4O03A 1O5BB 2EY4C 5JPMH 1H8ED 5C17A 4IMQA 4AFQA 4DCDA 4JYTA 3QWCH 3RM2H 4I7YH 4ZKNU 4OS2A 2YNAA 2OQUA 3UQOA 3WW7A 2XOKD 1O39A 3SQEE 1NFWA 2GMTC 1P09A 2QXGA 3CENA 2YMSD 1SGQE 1UVUH 1T8NA 3CS0A 3SU1A 2NU1E 3RXUA 3PMHB 3UQVA 2TGPZ 4TWWA 4GUXA 4F4OC 1V2TT 1GJ8B 1UJ1A 1NPMA 1SGTA 3ZZAA 1V2OT 2O8WA 1S81A 1YY3A 2FI3E 2G55A 3U98H 1P3CA 4GSOA 4BXWA 1UTJA 1GCTC 3LKWA 4CRCA 1C5MD 1S83A 1ZTKA 3C1KA 3EE0B 1V3XA 1XMNB 2VWLA 2BVRH 2PKSB 2UUFB 1FV9A 3OSYA 3EYDA 4QT8C 3AAUA 2IJD1 1C2MA 2PUQH 1L0ZA 3M5LA 2Z9IA 1V2VT 1A46H 3STIA 2ESTE 3T27A 9ESTA 2BZAA 4O9VA 2A32A 2O8TA 2BOHB 4LZ1H 1JXPA 4IGDA 1SL3A 1P2OA 1C1VH 2K0QA 2GZ8A 4CREA 2H9TH 5F03A 1SHHB 3PTNA 1O2LA 2R0KA 4A5TS 1TNJA 2CMYA 4JZFH 4YZUA 2FOBA 1X7AC 3RXAA 2AMDA 1GI5A 2GTBA 4Y8ZA 3QK1A 3GICB 1BMMH 1C2LA 1TOMH 1TRMA 4I8HA 4DIIH 3B8JA 2BDHA 2RA3A 3BG8A 4ZXYH 3N99A 1DLKB 4ISOA 2VB0A 3FANA 2FOHA 3UFAA 1H9IE 5EXLA 1O2JA 2EC9H 1SGFG 1MKWK 3PB1E 1NFXA 3BTEE 1E34B 4GCHF 1O3BA 2ZFFH 1BMNH 1GJ6A 1AB9C 3OU0A 1TAWA 3FAOA 1QQ4A 5A0BA 1FPCH 3RXBA 2AIQA 2OBOA 1HAVA 4D8NA 2BLVA 1W7GH 1D9IA 1KYNA 5PTPA 1NRQH 1NU9A 2BY6X 4FU9A 4MNWA 4PROA 3S9CA 1V2QT 4MNVA 2PSYA 4INHA 3VFEA 3DUXH 4UFDH 3O8RA 1ARCA 3RXTA 1YPHE 3F9GA 4R8TB 1GDUA 2ZGHA 4DOQA 1RTFB 1W0KD 1PPFE 1UTPA 2QIQA 1HAXB 4FOUC 1ABIH 1TGNA 1P05A 4YT6H 4IMZA 2QE7D 3MI4A 3GY5A 1EJMA 3BF6H 3SUEA 3ZZCA 1C2JA 1EZXC 2Q1JA 5TCCA 3UNRA 1ETRH 1YPLH 2PTCE 1V2LT 2FO9A 2FODA 2UUYA 1K0HA 4SGAE 1OWKA 3SNCA 1OOKB 1Y3XA 2BQ7B 3LJOA 4GHTA 5FHTA 2ZDKA 1HIAA 1FN8A 2M5TA 3UUZA 4CRFA 1EATA 1BTUA 1AVGH 1O2WA 1ELTA 2VWNA 1CHGA 2GD4B 4A92A 4JK5A 4IS5A 1FIWA 1RS0A 3MH5A 1C5OH 2P94A 1IOEA 5FX5A 1KXEA 1SPJA 2ZO3H 2ZGBH 2ZQ1A 4NA7A 2UUKB 1GJCB 3ZYEA 3D23A 1G2MA 1YF4A 4KTUA 4BANB 1ZHMA 3MNCA 1O3FA 4K8YA 2PUXB 1O2QA 1UTNA 2R3UA 4XD7D 5FX6A 4WH6A 1DSTA 1F0RA 4HGCA 1OWDA 5CHBA 1G32B 5CDFE 1G3BA 1MU8B 5EGMA 2G4TA 4Y11E 1XUFA 2H2ZA 4NIXA 4GVUA 1TPOA 1Y5UT 1AQ7A 2VIWA 1C1NA 3A81A 1QBNA 1FY1A 5LH8A 1QJ6B 2BY9X 4AOQA 3ATIA 4GAWA 2O8LA 4GPGA 1JIMA 1SLXB 2AGEX 1E79D 2V3OH 4GLYA 4FETA 3RM0H 3SJ9A 1GVZA 1DVAH 4AGJA 1SQAA 3BTKE 1MKXK 2RDEA 1UTMA 5C0TA 1AD8H 4F49A 1KXBA 4WXIA 3TITA 1EPTA 1ZRKA 5I25A 4X8TH 3K6ZA 2C8XB 2C8YB 4XFQA 2ZEBA 3A8AA 1WQSA 2FS9A 2RDLA 3VB3A 2WSSD 4WWYA 1ESBA 3KQEA 5GDSH 2PFEA 3GYMA 3RU4D 4BTTB 2F4LA 3RC4A 2D1JA 2Q6GA 5A8ZA 1EJAA 4ZUHA 3ZV9A 1C5NH 4OS1A 1CGJE 1AMHA 2A4OA 3PV4A 5JBAS 3E1XB 4YXWD 1UVSH 4CRDA 1H9LB 2V7QD 1N8OC 1O3KA 3P8NA 1C1RA 2A7CA 2J92A 1WTHD 4JZEH 3PMAB 4NIVA 1HJ9A 3ESTA 3I78A 4Q80A 1P2NA 1TPPA 4AFUA 1NC6A 3TJUA 1SGEE 1LVYA 4R0IA 4ZKRU 2JKHA 3UPEA 4WJG2 4NG9H 3GCOA 5C1UA 1G2LA 3BIUH 2SGQE 3FP8E 2HVYB 1MTVA 1DX5M 2W6JD 2WV4A 5BPEA 1MKXH 3TVJB 1T4VH 3W1EA 3P8GA 4IN1A 1CA8B 3F0PA 1KLTA 4XOJA 5G4BA 3KYFA 1OSSA 1O5DH 2WPDD 4FUGA 1XVOA 2J34A 4AX9H 2P8OB 2G8TA 1S0QA 5C3NA 4B75A 2W3KA 1TOCB 4X1SU 1ELEE 2ZTYA 2A45B 1DWBH 3F9EA 2GT7A 2VNTA 5E2OA 2CF9H 3MO6A 3VEQB 1OKXA 3DD2H 2V6NA 2JH6D 1ELVA 4YOIA 3RXKA 3M37A 2FLRH 1EQ9A 3B9FH 1HXEH 2XWAA 1G3EA 1F5KU 4I33A 4Z0KA 3SZEA 1BT7A 4AB9A 3A7YA 5AF9H 1K28D 1O33A 1JIRA 1BRBE 1SMFE 1LHFH 2QF5A 3E91A 1P02A 3BIVH 4MLFB 2F9VA 4X2WA 4ZXXH 2J4IA 3E8LA 1UK4A 3A85A 3KQBA 4H6SB 1Y3VA 4AYYB 1OXGA 3KHVA 1TQ7B 2L6OA 2H9HA 2M2AA 1F0UA 1Z1JA 3RXPA 1ZHPA 3GY4A 3Q00A 1GBMA 5TCAA 3OYPA 1SOZA 1BTZA 2FP7B 2FPZA 2ODQA 1YLCA 3SORA 2BY5X 3SU4A 3OEHD 4OGXA 5CMXH 1SQRA 1CE5A 3SV8A 1GVLA 1BZXE 5FAHA 3MH6A 1GBTA 5A8YA 1C1UH 3T28A 3PMBB 5C2ZA 4AN7A 1O5GH 2WYJA 3LU9B 1ZSKA 1SFQB 5FXLA 1O36A 1Z1IA 2FOMB 2AIPA 1GBJA 2XYAA 3LGVA 1FY8E 3A8BA 5E0HA 5DG6A 1GBKA 4K3JA 3T5FH 2GCTC 2QA9E 3A82A 3OTJE 5EJLA 1QTFA 2ZHWH 3R0FA 1DANH 2AMPA 5EQQA 1AE8H 2Q6DA 1ZMJA 1EZQA 3QGNB 3QO6A 4ZH8A 1AGJA 1GMCF 4A1TA 3EA9A 1AZ8A 4DW2U 2ODYB 2J94A 1EKBB 3U8TH 1AWFH 3F0OA 1HV7A 1GHVH 3BSQA 3RP2A 3PROA 4JZIA 1TPAE 1TRNA 4B2AA 3NZIA 1K1OA 3LH1A 4ZHAA 2ZIQH 2YMSB 2GKVE 2P16A 5FPTA 1NBME 4K2YA 4JYUH 3F6UH 4KGAA 2XC0A 1RTLA 4JMYA 1Q3XA 2HRVA 1KIGH 1P03A 4D7FA 3BV9B 1C9PA 3M7TA 3RXFA 4ACAA 2BXTH 3R3GB 1G36A 1QY6A 2G52A 4B2CA 1E38B 3MU4A 3KCGH 2FTLE 2VGCC 2EQNA 4VGCC 3RXCA 3FZZA 2BD5A 2VINA 1CHOG 2GVFA 3AVZA 2ALVA 2BB4A 1LVBA 3RXOA 4TY6A 4FUEA 4B71A 1AWHB 1GVKB 4I86A 3K2UA 4O3UA 1ABJH 1C5TA 2GDDA 2Z94A 3FN8A 1H8DH 2NU3E 1HAGE 1O2SA 1GWAA 3VB5A 1BDAA 2ZHEH 3ELAH 2BZ6H 2A5AA 2CN0H 4Q7YA 2NU0E 1ZRBA 4I32A 1F0TA 1UTLM 4GHQA 3GCNA 1DM4B 3SNDA 3ZVCA 3VB7A 1W14U 2OC0A 2GV6A 3D65E 3O8DA 1H4WA 1PPGE 2F43B 3ZVAA 2XNIA 1K1JA 1B0EA 2XCFA 1A0LA 1O2TA 1O5AB 5B6OA 1DY9A 3SUGA 4JZ1A 1YBWA 3A86A 1AIXH 1FY4A 4DJZB 3F2GA 4X1RU 4K1EA 4FXGH 4B74A 1JRTA 1ZYOA 3CP7A 4INLA 3QLPH 2PW8H 4ASHA 1W12U 1CT4E 2A4RA 3B23B 3S7HB 1HAVB 3RXIA 5C0UA 1IAUA 1UCYK 3A7VA 1PPHE 2CHAB 2BVSH 1NRNH 1SG8B 1QFKH 1ZTLA 1VGCB 5HMAA 2VGCB 3ZVFA 3DCLA 4KTSA 1C5YB 3A7ZA 1QRXA 2JDID 4BAMB 3SV9A 1TGSZ 5DJ7A 3TIUA 1CGIE 1OPHB 1P2MA 4HZHA 2ZU5A 2Y5GA 1VITG 1BBRK 3QGJA 4ABEA 1W7XH 4RKOB 3UR9A 2W7SA 1C1SA 1DOJA 1D6WA 1GJDB 4J2YB 4Y79A 5ETXA 4LK4A 1V2ST 1GJ4H 1TBRH 1O30A 4B2BA 1GG6B 1JMOH 2GCHF 1C1WH 3TJNA 3LH3A 3TK5A 2Z3CA 5SGAE 1HRTH 2Z7FE 4IC6A 2BDAA 3TH3H 4IC5A 3KQ5A 4X8UH 1GMDG 1HYLA 1TGCA 3SBKA 1ELAA 3PYHA 1HIAB 1GJ7B 3HKIB 4MPVA 5IDKA 1O2RA 2G51A 1EJNA 2PKSC 2B7DH 3ATLA 4AG1A 4RI0A 1KTTB 2C8WB 3MFJA 4Y0ZE 4P02A 1NU7B 2FESH 3ZZ8A 1TNLA 1YM0A 3PV2A 1ETTH 1FONA 1MD7A 2ULLA 2BYAX 3S69A 1W11U 3U1IB 1DSUA 1P04A 1Z7KA 3BTQE 1TX7A 1ANEA 3TJVA 1SSXA 2Z6BD 2BVXH 2I6QA 1FJSA 1PJPA 2ZZUH 1QJ7B 2VBCA 4RKJB 1WCZA 2BLOA 1DWEH 2TIOA 1SGYE 5DP8A 3LIWA 4YO9A 3ZVDA 1HDTH 2BMGB 1KMHB 5HIYA 5H4IB 4MG3A 3ODDA 4ABDA 1C1MA 1KLIH 1YPGH 4BTIB 4CH8B 1YLNA 3VGCB 1GHBG 2UWOA 1Z6EA 3T25A 1FUJA 3ZZ3A 1ANDA 3SJOA 4CHAC 1WV7H 1EPTB 2A4QA 1K22H 4THNH 2CV3A 2FX4A 4NSVA 1ZSLA 1C2HA 2YOLA 1EFRD 5BRRE 1O2GH 1O5EH 2A4GA 1TALA 5KEDA 3D49H 1GI8B 1SGNE 4D9RA
chains in the Genus database with same CATH topology
2SGDE 3RMNH 3RXJA 3TU7H 3JZ2B 1XKAC 3T29A 2FOGA 2ANWA 1A61H 4FVDA 4OS4A 3E0PB 2XC4A 3OY6U 4UEHH 2QXJA 4ABIA 4CH2B 2OC7A 3MH7A 3A88A 1IHSH 5LPEA 1LCYA 4ABAA 1BTXA 2VIDA 2SGAA 2Y7ZA 1UVOA 2FI4E 1O3MA 3ZZ7A 2BM2A 4D9QA 1YLDA 1LQEA 1D3PB 1P11E 2BD8A 2NWNA 3BTME 2WV5A 1TBZH 1HAOH 1SI5H 1T31A 2JETB 1DS2E 8LPRA 3PM3A 2D8WA 1C2FA 1JBUH 1ZZZA 5L6NH 2FOCA 2BQ6B 2A31A 1MH0A 5DP6A 1C5SA 3QZQA 4CHAB 2VH6A 4FVBA 4ISHH 1IQLA 3CS7A 3GCTG 1PYTD 3T26A 2ZCKP 3QX5H 1A3EH 1ANBA 5EOKA 1WAYB 1V2RT 2BDIA 1P9UA 2JH0D 1WQVH 2ZDAH 1O2IA 1CA0B 5HYOA 4GCHG 1K1IA 1J15A 1TABE 1ELFA 1A1RA 1UMAH 2BX3A 2BD4A 4I8JA 2OUAA 1C4U2 4HTCH 2H5DA 3UIRA 3SQHE 1S82A 4LOYH 1LPZB 5C5OA 1DPOA 4AYVB 3M61U 1L2EA 3KIDU 2HWLB 4BOHA 3GCHB 4AORA 3TGKE 1FXYA 1OWIA 3K6YA 5J4SA 1NTPA 1GMHG 1EAWA 3MO9A 1DFPA 3P17H 3SJIA 2J2UA 4ISLA 3WY8A 1ZOMA 1KDQA 1OS8A 2ZU2A 1L4ZA 5GIBA 5EQSA 2VU8E 1EAIA 2OCVB 4INKA 1O2PA 1UK2A 1QIXB 2W5EA 3RXVA 1DWDH 2WPHS 3RXSA 1XUJA 1PQ8A 2O9QA 1MKWH 1UO6A 2VVVA 1EX3A 4NIYA 2ALPA 3IITA 1S84A 1E0FD 3HK6B 2H9EH 1HB0B 1TPSA 1E37B 3ZZ6A 1A0JA 4AZ2B 1UVTH 1P8VC 5A2MH 2QCYA 1QR3E 2ANYA 1H1BA 3ZVBA 1J14A 1D3QB 3Q3KA 4RN6A 3TJOA 5AHGH 3SV6A 3GY6A 1BTYA 1OYQA 2FYRA 2FLBH 2WPMS 3EGKH 1KXDA 1SGDE 1AFQB 2Y5FA 3PLPA 4YLUA 1FPHH 4DVAU 1GHWH 4NCYA 3TK9A 2BLQA 1ZJDA 3BEIB 1S6FA 4X6OA 4ABJA 2ZTXA 3SHCH 2BD3A 1T8MA 1RIWC 1GPZA 1UHBA 2TGDA 1Y3YA 3SOSA 1BB0B 1G3CA 1LPGB 3E3TA 1C2GA 1FLEE 1DE7H 2P93A 5GCHG 1TRYA 1O2MA 3SU0A 1TIOA 1BBRE 3TPIZ 1O2VA 1L1GA 4ISIH 1BHXF 2LNCA 1T32A 1XUIA 2KAIA 2P8OC 1O35A 1SLUB 1NRRH 3S9AA 4DY7B 5GXPA 1BA8B 5EW2H 1WBGB 1HAHH 5GWZA 3PWCA 2OC1A 1YP9A 1BJVA 2XWBI 1W2KH 3RXDA 4XDEA 1O3JA 1C9TA 3H5CB 4XSKU 3KF2A 1THRH 3RC5A 4IBLH 2O8MA 4CR9A 5JBTA 3M36A 3GY7A 2WPLS 4ABBA 3BTDE 1YGCH 4HI3A 3IG6B 4NZLA 1TB6H 1L4DA 1SR5C 1HLTH 1MD8A 1AVXA 4MPXA 4JYVH 5GPIB 1YPJH 1J8AA 3S7KB 3KGPA 3PO1B 4O3TA 1ZPCA 3ATWA 3HPTB 2XTTB 1HJ8A 3BN9A 1LVMA 3NWUA 1XXFA 1AY6H 1Z8IB 1RIWB 1T4UH 2AMQA 2BX4A 4MNYA 5LPFA 5A09A 4ABHA 1SGFA 1GI6A 3ZZ4A 2QV1A 3PMJA 5CE1A 4WMEA 5C1YA 1W8BH 3GY3A 5C20A 1O2HA 1VCQA 2WUCA 2VH0A 1IQFA 1VJAU 3RXEA 1NRPH 3ZYDA 4YM9A 1O32A 1KY9A 1INCA 4CRBA 1J9CH 2BY8X 4KKDA 1O2UA 1TONA 1IQEA 5E0GA 4MPWA 1WSSH 2PHBA 2BXUH 5ABWA 1D4PB 2K1QA 1C2KA 3K65B 2FEQH 4JZDH 3SUDA 4UFGH 1PPBH 5FBIA 4A6LA 2AFQB 1G30B 1Z8RA 1ZGIA 2J38A 5DP5A 2V3HH 3SNAA 1GDQA 8ESTE 3GDSA 2F9PA 2ZNKH 3RMMH 3A8CA 1O3EA 2PGBB 3ODFA 1O2XA 1TQ0B 1THPB 3FP6E 3SNBA 2ZGXH 2PSXA 2FZZA 3HATH 1K9OE 5DO4H 2Y81A 4Y6DA 1GJ5H 2ZFSA 1CT2E 1W3CA 4WH8A 1O3IA 4JCNA 4E06H 2VJ1A 1TA2A 4D7GA 3RMOH 4YLQH 1F5LA 3F9HA 5ESBA 8GCHG 4DIHH 1QCPA 1QJ1B 1THSH 1SLWB 1XXDA 1HAIH 2HGTH 1FN6A 2ANMH 3LT3A 3LGTA 4BAKB 3SUFA 2QXHA 3LONA 3MU8A 1Y5BT 3NK8A 2VVUA 1ETSH 2ZGCA 1YC0A 1YPEH 3MOCA 4NWLA 1ZPBA 1MQ6A 2QGRA 1GL0E 3QTVH 4H42U 3SW2B 1GI4A 1F7ZA 5DP3A 1DUEA 1QBVH 5C1XA 5LPRA 1RFNA 1PQ7A 1TX6A 1CBWB 4I8GA 4FUFA 4AFSA 1BMLA 4NZQA 2VIOA 6ESTA 2P3FH 4X8VH 2SNWA 2F9OA 1ELCA 1S5SA 1V2PT 4KP0A 4FUJA 1LO6A 3G01A 1NY22 2P3TB 3HKJB 3EA8A 2AGIX 1C5UA 1LHDH 1PQAA 1BUIA 5EW1H 3JZ1B 3KQCA 1JWTA 1TNKA 1ORFA 4CRGA 2BD2A 1CO7E 3BG4B 3I29A 5EXNA 2ZU1A 4Y76A 1CU1A 1K2I1 3Q77A 3MNBA 3ENSB 1O37A 4UD9H 3MO3A 1W0ZU 5A0CA 1SHYA 4DG4A 4ZMAH 2F9UA 1AZZA 1Y3UA 1LPKB 1MTWA 1GJBB 3U69H 1TBQH 3UR6A 2AS9A 4FUBA 3STJA 1VCWA 5F6MA 1PYTC 2CHAC 4H6TA 1Y8TA 2WPIS 2FMJA 2H5CA 6CHAB 1VGCC 5FPYA 1ZLRA 4SGBE 4TYDA 1LKAA 5I46H 1S6HA 5DP9A 1GHXH 1C2EA 2FX6A 3NUMA 4NGAH 1XX9A 1B7XB 1RTKA 1A0HB 3C27B 1OP0A 1V2WT 1K1LA 2F3CE 1AKSA 4FUHA 3EAJA 3K9XB 1A7SA 1VZQH 1YKTA 1AHTH 1GHAG 2OINA 4UDWH 1TA6A 1GJAB 1GI3A 1QA0A 4MPUA 1ANCA 1GG6C 1S0RA 1QBOA 3ATKA 2TPIZ 1AN1E 3T62A 1EOLA 1DUAA 1GBFA 1KTSB 1OYTH 2YNBA 3BTWE 2QF3A 1SVPA 1KLJH 3TLOA 3T2NA 2HNTE 5C5NA 5EPYA 1O3PB 7GCHG 2QN5T 6GCHG 2I6SA 2ZDLA 1OWEA 3UOPA 4XBDA 2RCEA 4U30A 1C1QA 3QZRA 1MZDA 3PWBA 2VIQA 4K8BA 2AYWA 2R9PA 5E0JA 1ELBA 2SGEE 1FAKH 1O2NA 3KL6A 1O3CA 3O8BA 1C1TA 1RD3B 2GT8A 4K5ZA 3MMGA 4ABFA 2BDYA 8KME2 1LHEH 1LKBA 2UWPA 2ZG0H 3FFGA 2A1DB 3MU1A 4I8KA 3DA9B 1O3DA 3TH4H 2ZGJA 5E2PA 2FOEA 2FWWA 4XBCA 1HPGA 1IQHA 2W26A 1DXWA 1EXFA 1MTUA 3P6ZB 3VXEH 4DGJA 3KN2A 1KDQB 1ZHRA 1O3OA 4ZKSU 1Z8JB 2WYGA 2P3UB 1LMWB 2EI6A 3RU4E 3Q3XA 9LPRA 2WINI 3VGCC 4AB8A 3L6PA 3A80A 2XC5A 1EPTC 5J4QA 1BIOA 2ZKSA 1O3GA 4IW4E 3W95A 4Q7ZA 1O5FH 4U2WA 2ZC9H 1QB9A 1NROH 1QRWA 1AI8H 2UWLA 2XBVA 2XCNA 1TMBH 1HGTH 1VJ9U 2GCHG 3SU2A 1O5CB 2EI7A 2F9NA 4A7IB 1GGDB 2ZF0H 3ZZ5A 1FNIA 3UREA 4MTBA 1GBHA 1SGRE 3U8OH 2WPKS 4MVNA 4TY7A 1QNJA 4KELA 2FOAA 3KQDA 3GDUA 2EI8A 1OX1A 1GMDF 3TNTA 3RXMA 1ID5H 1K1MA 1UCYH 2PWXA 3NCLA 4LZ4B 1EASA 1NFYA 1MCTA 2AH4X 3M3TA 1NT1A 5EQRA 2P59A 3VB4A 2BY7X 3SU5A 4YT7H 1O0DH 4B1TA 4OS6A 1Q31A 3D62A 2JH5D 1D6RA 1KXCA 1SQTA 3MU5A 3ZVEA 1IQGA 1NESE 2OXSA 4MNXA 2JETC 2O8UA 3HGPA 1GDNA 1BBRH 2WUBA 5T3HA 3HGNA 4ESTE 5CHAB 2QC2A 3DT0H 1UHBB 2W7UA 2XBYA 4I31A 1HJAB 1FQ3A 1SOTA 3L33A 5K7RA 1FIZA 3LDXH 2A7JA 4FUDA 5HM9A 1V2MT 1F0SA 3GY2A 3S9BA 3SGAE 3NPSA 2C90B 1T8LA 2TRMA 3UNQA 1CA0C 1GHBF 1TE0A 2ZPQA 1YCPK 2KAIB 2FOFA 1OWHA 3RUOA 2G5NA 4MQAA 1G37A 1MQ5A 5FCRA 3AW1A 4K1SA 1OP2A 2FTMA 2GGVB 1LTOA 2A5KA 2HNTF 2QF0A 5L2ZH 3GOVB 3ZZ9A 3U8RH 2VIPA 3MNSA 1ZMLA 4RSPA 2QY0B 3UWJH 4TWYA 3VB6A 1FZZA 3MNXA 5F8ZA 4ISNA 3GCHC 1IQMA 1O3AA 2ZHFH 2OLGA 2Y82A 2ZHQH 2ZU4A 4M7GA 3TH2H 1GI9B 2VWMA 2GZ9A 2CXVA 2H1UA 1RJXB 3RXLA 1A2CH 4Y0YE 1B5GH 4TPYA 5AFZH 1SQOA 1GHYH 3GYLB 1P0SH 5HXFA 3E16B 4BAQB 1L1NA 1CQQA 1QL7A 1EB1H 1UVPA 1QA7A 1YPMH 1ZJKA 3DFJA 4J1YA 5F8TA 1ZTJA 3GDVA 2ZECA 4BTUB 1C5QA 1G9IE 1ELGA 2BD9A 1SGPE 2ZTZA 5DP4A 5FBEA 3BTTE 1V2NT 4Q7XA 1IQNA 2B9LA 1FMGA 1N6XA 1WOFA 5JB8S 1DT2A 1ZSJA 1NO9H 4X1QU 2GMTB 3RLWH 5C67A 3M7QA 3LGIA 4Y8YA 2Y80A 3GCTF 1YCPH 1GBDA 1HAPH 1GBEA 2F83A 1C5WB 1O3LA 1QQUA 2THFB 3F9FA 3LGUA 1W13U 2PKAA 2IOTA 1FDPA 3SZNA 3LOXA 3MHWU 1ARBA 4DURA 1GCTB 1Y3WA 2OP9A 2XW9A 1AFQC 2ZCLP 2BQWB 1LDTT 2HPPH 1W0YH 2DE9A 3NXPA 1QURH 2G00A 1PPZA 2WPJS 2VVCA 2ILNA 2DE8A 1AO5A 2ZDNA 3M5MA 1E35B 1NRSH 1GMHF 3A7WA 1P3EA 2UUJB 5K0HA 2CJIA 2XBWA 4ZAEA 5EPNA 4NFEA 1TLDA 2ODPA 5GJ4B 1IQJA 2GDEH 1JOUB 4X8SH 1AE5A 4K1TA 3EDXB 4X0WU 2QYIA 3V13A 1T8OA 1SFIA 4ZKOU 3MTYA 4WF8A 1BMAA 1VITH 2ZU3A 2ZFRH 2A2QH 3TK6A 1XUHA 3UY9A 1SGIB 1TNIA 4I8LA 4UFFH 1C2DA 4FUCA 5DK1A 2BTCE 2OBQA 5JB9S 4HFPB 2EA3A 1UTOA 3SO3A 1AVWA 3UWIA 5HM2A 1Y5AT 3AASA 1YPHC 4Y10E 1J16A 3ZZDA 1HAZB 3IWMA 1AB9B 1A4WH 3LGWA 2STBE 4Y8XA 3I77A 1CGHA 1Z6JH 4U32A 1UCYE 3BTHE 3PO1C 4E7NA 5T6FA 1P06A 2Z9JA 1VR1H 4KTCA 3DHKH 2CGAA 5FPSA 1BHXB 2ASUB 3RDZA 2Y6TA 4X2XA 3NKKA 5EXMA 1QHRB 2STAE 1P2QA 4K69A 1ESAA 4UONA 4Y71A 2HLCA 2BDCA 1HCGA 2ZHDA 1Z71A 1EP6A 1LQDB 1C1PA 1VCPA 1TGTA 1GI1A 3VPKA 4E7RG 2C93B 2ZWLH 2B5TB 5LGOA 1WUNH 5HGGA 4H4FA 3ZVGA 2ZCHP 2PLXA 4O97A 2OQ5A 4Z6AH 3URCA 1QB1A 1MCVA 2Z9KA 1ELDE 2BOKA 5JYIA 2J95A 1BQYA 3A8DA 2XXLA 3E90B 3F68H 2SNVA 2A7HA 5GCHF 2SFAA 1UTQA 3ITIA 1BITA 3LC5A 4E05H 1A3BH 2IN2A 2J9NA 4X1PU 1GBBA 1C4Y2 1ZGVA 1NS3A 1GBAA 1QGFA 2VIVA 3P8OA 1L1JA 5JDUB 3BTFE 3EA7A 1EB2A 1BTHH 1P2JA 1PQ5A 5IYTA 1TNHA 1XKBC 1YPKH 3BEUA 2PV9B 3RC6A 1AKSB 4OS7A 2BDBA 3VXFH 5AVDA 1P57B 2CF8H 1MMJN 2GZ7A 2QXIA 4YESB 6LPRA 2AGGX 1SGCA 1WU1A 4DT7B 2ZFTA 4YOGA 7KMEH 4U01A 2IPHA 1CVWH 4X6MA 2TGAA 1YYY1 1LVOA 2ANKH 2PR3A 1AUJA 3RXHA 1ESTA 1MUEB 2XBXA 3FVFB 2NU2E 1EZUC 3U9AH 1UK3A 2ZFPH 4Y7BA 2R3YA 2ZPSA 2F91A 1P10A 5FCKA 5L2YH 1GI2A 3M3VA 2FS8A 1TFXA 4ZHLU 1TWXB 1KSNA 1OWJA 4X6NA 1MBQA 5TJXA 4A1XA 2FM2A 2ZA5A 3RMLH 1CBWC 4WVPE 5E8EH 3AAVA 7ESTE 4NSYA 3DFLA 3SV2H 1XM1A 3AW0A 4B76A 3Q3YA 1BRAA 1DWCH 3QN7A 4WMDA 2F9BH 2A0QB 2ZI2H 4FU8A 2Z3EA 4UFEH 1GL1A 1FY5A 3RU4T 4IN2A 2LPRA 4OGYA 1FY3A 3SU6A 3SGQE 3HK3B 1C5VA 2FIRH 4K60A 1EAUA 4OS5A 3BG4C 2SGPE 3KNXA 2B8OH 1GHZA 1N1LA 2VWOA 2HVXA 1KXFA 4NA9H 1FAXA 1DY8A 2C8ZB 1DICA 1EOJA 1OP8A 3E6PH 1N8OB 1NFUA 1C5RA 2AEIH 2RG3A 1MTSA 1GBCA 2A2XH 1TGBA 3LGYA 2Z9LA 1A5IA 1HXFH 2GV7A 4A1VA 1ZR0A 1KXAA 1PPCE 1U6QA 3A87A