1GBFA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by leu complex with methoxysuccinyl-ala-ala-pro-alanine boronic acid
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGLNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-LYTIC PROTEASE
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
molecule tags Hydrolase/hydrolase inhibitor
total genus 50
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbfA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbfA01
1O3MA 1EXFA 4NIXA 2QA9E 2HRVA 1FLEE 3KQEA 5A09A 4AN7A 2H5DA 2TBSA 1KXEA 3U8OH 3ZVFA 3SU3A 1GGDB 1NRPH 2VVCA 1OPHB 2FESH 1GCTB 4Y8ZA 3EYDA 1P2IA 1WCZA 1WQVH 2BOKA 2BD4A 2VIPA 1SMFE 1VGCB 4CREA 2A7HA 1C1SA 1D3QB 1OS8A 6GCHG 1EPTA 2BZAA 2HVXA 1MUEB 3UY9A 1HAIH 2FEQH 3HGNA 1GMCG 1FY3A 4GVUA 4IBLH 2ZKSA 4A1XA 1FY5A 4Y76A 1P10A 1O33A 1SSXA 4AG2A 1AGJA 1A1RA 1V2JT 1BZXE 1O2QA 2FI4E 1K21H 3NCLA 2FOAA 3GY4A 3V13A 2O8LA 2Z3EA 1A3BH 2FOEA 3SI3H 1JOUB 2Y5GA 4X1NU 5C1XA 1BRUP 2BDYA 1UTLM 4AYYB 1UTJA 3RXVA 3H7OA 1GBJA 1L4ZA 3HK6B 5DJ7A 5JBAS 1V2MT 4MLFB 3QUMP 2HWLB 4BNRA 4A7IB 2ZDNA 1ID5H 1LTOA 1V2OT 1W10U 3UWIA 2IPHA 3M35A 4TPYA 1O32A 1DSUA 1FONA 3ZZCA 1S81A 1DITH 2A7JA 5DP5A 1OWKA 4E7RG 1TE0A 2G52A 2IJOB 4WMFA 2VIVA 7LPRA 4OS1A 2GGVB 3GCNA 2B0FA 3O8DA 1PPFE 1V6DA 4AB8A 5FAHA 2UUJB 1CO7E 1DVAH 3QTVH 2XBVA 5F6MA 3ENSB 4X2XA 1DM4B 2OTVA 2QYIA 1GJDB 3PO1C 1ZTLA 2P3FH 1MTWA 2O9QA 5C2ZA 4UD9H 2DE8A 3ZYDA 1PYTC 1VITH 3EA9A 1LHEH 1WOFA 3V12A 4IW4E 1YCPM 2BDHA 3C1KA 1GHBG 2R2WU 1GBKA 2TRMA 1VR1H 4O03A 1C1OA 3SUGA 1KIGH 1MKWH 3NXPA 1SGQE 2TGDA 1NFYA 1NU9A 1YGCH 2OQ5A 2FOMB 2BB4A 5A8XA 1DSTA 3MU1A 1NFWA 1MMJN 3Q3KA 2AERH 5EPNA 3OYPA 3T26A 3TK6A 4X2VA 3SW2B 3QWCH 3LT3A 5EQRA 1L2EA 1TNHA 3KNXA 3SQHE 4BOHA 3VB5A 4LZ1H 4ZKSU 5SGAE 1QR3E 4YT6H 1BTYA 4A1VA 4KELA 3V7TA 1W14U 6ESTA 1HAVA 1GHVH 2P95A 2ZNKH 4WWYA 3CP7A 4Q7YA 2FYQA 1O0DH 1C1MA 2F9OA 1V2LT 3B8JA 1S85A 1WV7H 3HGPA 2BD9A 1RJXB 1ELCA 2P94A 3L3TA 3SO3A 1ARCA 1QA0A 1AWFH 2BQWB 3TJVA 3WY8A 1O5DH 1TNJA 5JBBS 1GMDG 1TNKA 2AYWA 4U01A 1HXFH 3M5NA 4Y0YE 5FPSA 4ABJA 3BTQE 4LOYH 1SGNE 3MYWA 4DY7B 3U1IB 1AY6H 2EA3A 2NU2E 1D9IA 1SPJA 4XSKU 3RXDA 4RKJB 1AKSB 1PPGE 4LZ4B 3BTDE 1C2HA 1KLJH 3EA7A 3SU0A 3M3SA 1A5IA 1A3EH 5A0AE 2ZFFH 3VB6A 1TBQH 1HJ9A 1F5LA 3P6ZB 1OOKB 1K1JA 1EQ9A 1WBGB 3RMNH 3S69A 3SV7A 1E0FD 3IITA 2BD5A 4MPWA 5F8ZA 3A84A 3RM0H 3LGVA 1BB0B 1C2KA 2PKAA 1FNIA 4IGDA 1GI0A 2FIRH 4NWKA 1GHZA 3MU4A 1E36B 1YPGH 3D23A 5C20A 4ZH8A 3UIRA 2AIQA 1DWDH 1FQ3A 1TPOA 1O5CB 2W5EA 3A7YA 1O36A 2JKHA 1O3BA 1H9HE 1FAXA 1GJCB 1UMAH 3MH6A 1FUJA 1PQ8A 1ZGVA 4D9QA 4AGJA 1W11U 3D62A 3ATKA 3W95A 2ZQ1A 6CHAB 1NESE 1ZPZA 1C5QA 1G32B 2Q6GA 1O2XA 3RXLA 1TB6H 4H4FA 4MPXA 3SV8A 1QJ1B 3A7VA 4GHQA 1LHFH 5T3HA 1JIRA 1GI2A 2Z3CA 4ZKNU 1DY9A 1MQ6A 2YOLA 2CMYA 2GZ7A 4B74A 1K1PA 1GI8B 2XWBI 2A2QH 2BX4A 4XOJA 2HPQH 1W13U 3RXFA 2FPZA 2ZO3H 2PR3A 4ZXYH 3PROA 1TRMA 3VXFH 2EI8A 1NY22 2QF0A 1FZZA 1SGIB 1ELAA 2I6SA 2J9NA 1BCUH 2AFQB 3R0FA 1EPTC 2PUQH 2AMPA 1SLXB 1H9IE 4I8HA 2ZU5A 2ZECA 1FMGA 3HKJB 1O2UA 2BVXH 1EOJA 1MD8A 1RS0A 2XBWA 3FZDA 8GCHF 4MTBA 4TWWA 1UTMA 4ZXXH 1ZHPA 4TY7A 4X8SH 1J16A 2WPLS 1SGDE 5AHGH 3RUOA 1O3KA 1FY4A 3A8DA 4Q80A 4A6LA 4GHTA 2PSXA 2C8YB 4YLQH 3PWBA 1C5LH 3U9AH 1TYNA 3SJ8A 1GCTC 2XC4A 1C9PA 3RC6A 5F8TA 1GPZA 5J4SA 5DP6A 1Q2WA 2J2UA 1GBFA 1A4WH 3MNSA 1LVOA 2R3YA 1ZRBA 1S84A 3PWCA 4MNVA 1RD3B 2W26A 1YPEH 1CHGA 4WXIA 1P2QA 1IQHA 1C5SA 5E0HA 1AE5A 4JZ1A 1AD8H 4X1SU 3F9FA 4KKDA 1O37A 1V2UT 4XBBA 1OWHA 1THSH 3RXRA 4YOJA 3QZQA 1HIAA 3E0PB 4I8GA 3LONA 4B2BA 1D6WA 1A7SA 4E05H 1O2IA 1AFQC 3M7UA 2YNBA 4RSPA 1NRNH 5FPTA 3HATH 4KTUA 4B1TA 2ZCLP 3BEUA 3A81A 3TH2H 6GCHF 5T6GA 3TH4H 1CU1A 1C1NA 1FN8A 1ANBA 1GI3A 1AVWA 1VITG 3PO1B 3SV6A 1BUIA 5TCAA 3RXEA 1GMCF 1S6HA 5E2OA 5EQQA 1EP6A 4B75A 3MH5A 3RXMA 4AG1A 2ZFTA 4O97A 1DY8A 2Z9KA 2WYJA 1G2LA 1Y3UA 4GCHG 1D3PB 3S9AA 4UEHH 3TJUA 1O2VA 3RP2A 1GI6A 1H1BA 4Y6DA 3LC3A 4Y71A 1P12E 2ZZUH 2PGQB 2SNWA 1DXPA 3PMAB 3ZV9A 1Y3XA 5LGOA 1DLKB 2GDDA 1PPHE 1QQ4A 2BDBA 2QXIA 4B2AA 1O2ZA 1KTTB 2FYRA 2BM2A 2ZU2A 2OBOA 3I77A 1Q31A 1F92A 1EAIA 1HAYB 1V2TT 4WH6A 1CA0C 1NO9H 1IQIA 3BEIB 1N8OC 1MCVA 4K8BA 1C5UA 4TYDA 3RXCA 1TPAE 2BXTH 4B76A 4MQAA 4E06H 3A8CA 1FJSA 2BY6X 2JH5D 2HOBA 2V35A 3RXQA 1D6RA 2ZFRH 3QZRA 1ZOMA 1ETRH 1ARBA 3H7TA 4TY6A 5C5OA 1T8OA 1P0SH 1QHRB 3URDA 3K6ZA 4IC6A 3PM3A 1XM1A 1RRKA 1L4DA 1AZ8A 1X7AC 1A46H 1K22H 4I7YH 4FU8A 2BYAX 5E0GA 1B0EA 1SLWB 2CF8H 1W7XH 4WY3A 3ATWA 3VXEH 4J2YB 3TH3H 1NRRH 2P3TB 4NG9H 1YLDA 2FLRH 3HPTB 4ISIH 1JRTA 1Q3XA 2P8OB 3BTKE 1QBOA 5ESBA 1XX9A 4Z0KA 1O34A 1A0LA 1YLCA 1G36A 3MWIU 3SUFA 4X1PU 2XXLA 3F1SB 2BX3A 3KN2A 2SNVA 2ODYB 2ANMH 1OWEA 5HM2A 4TWYA 3TIUA 1EZUC 1QRWA 2PWXA 1O5EH 2O8TA 4FUBA 1QRXA 3E91A 5E2PA 1W2KH 2QGRA 2RA3A 2ZEBA 3Q3XA 4DW2U 1Y3VA 3IWMA 4AFUA 4OS6A 3F6UH 4XBCA 3VEQB 4HZHA 4ISOA 2Y81A 5A0BA 4FVDA 4BTUB 3SBKA 1SB1H 1IHSH 1BMAA 1TONA 3SNAA 1FAKH 4VGCB 1ACBE 4CH2B 2ZIQH 1NPMA 3UUZA 3NK8A 1BRAA 1BTUA 5K7RA 3MNXA 1QCPA 1Z6JH 4AFQA 4ABIA 3EAJA 2R3UA 1GMDF 1HGTH 2FX6A 1K1MA 4FUIA 1ANEA 5IDKA 1T8MA 5L2ZH 1QB1A 1DDJA 1PYTD 2OUAA 1GJ8B 2F83A 1DWCH 1UTQA 3JZ1B 1SGRE 4AFSA 1O3EA 1TMUH 1SL3A 3SORA 1MBMA 1TNIA 2WPHS 1G9IE 4NWLA 4TPIZ 2ZQ2A 3M37A 1T8LA 3CS7A 3BN9A 1GI9B 2B7DH 5DP7A 1GVLA 2WPKS 3PTNA 8KME2 1SGFG 3LJJA 1ETSH 2Y7XA 3SJIA 1UCYE 1WSSH 2ZCKP 3K2UA 1TQ7B 1EPTB 4XE4A 3PB1E 6CHAC 1KXBA 1TBZH 2GDEH 2R2MB 3ZVAA 1DWBH 4IC5A 4X6NA 1MD7A 2OC8A 5HGGA 3BTFE 1BDAA 1DLEA 3MO3A 2P16A 1ANDA 2QY0B 1O2PA 4R0IA 3O8BA 1K9OE 1F5RA 3Q3YA 2F3CE 1YBWA 3TK5A 1A5GH 2ZDVH 1K1OA 2NU1E 2UWOA 4CBNA 1RXPA 3FVFB 1H9LB 3BTTE 1DANH 3PYHA 1BRCE 1C1VH 3BSQA 2A4RA 2B9LA 1V2NT 1O31A 1LPKB 1UK3A 2QN5T 4ABBA 1XVMA 1KDQA 1ZPCA 1CGIE 3MNBA 1SOTA 4NZQA 2GV7A 1FY1A 1IQGA 3TLOA 2P93A 5GDSH 2A45B 1P3EA 2ZTZA 1LDTT 1JMOH 3F9HA 2NU3E 1ZGIA 1LCYA 2BDAA 1QBVH 1ZSKA 2PW8H 4X8TH 1QNJA 5JPMH 3VFEA 2OQUA 2KAIA 4ABFA 1TIOA 2D8WA 1JRSA 2VJ1A 2ZHEH 4KGAA 3SI4H 1UO6A 3HKIB 1DUEA 2F9PA 2HNTE 4WH8A 1C5OH 1OX1A 2Y5HA 1SLUB 1SOZA 1CHOG 1C1PA 2QXGA 4DIIH 3BF6H 5JB8S 5DK1A 5A8YA 3SV2H 1XUJA 2BDGA 2H6MA 1TA6A 2FO9A 2ESTE 5GCHG 1P11E 1AFQB 1NN6A 5G4BA 3HK3B 3RXTA 5GJ4B 1L1NA 2G51A 3NZIA 5DGJA 1KLTA 5DP8A 4H6SB 3FANA 2SGEE 4FUCA 1BMLA 1Y5BT 1ZMNA 3ZZ6A 2AGGX 4UFFH 4D76A 4YO9A 5CE1A 2ZGCA 1GI1A 4FUEA 3SNBA 1TGCA 3SV9A 8LPRA 2BD3A 2O8UA 4LK4A 1KTSB 3QTOH 1GMHG 1XUIA 4MVNA 2VVVA 1O2SA 1QJ6B 2QV1A 1NROH 3ATMA 3U8RH 1O2LA 2OINA 3GDUA 3LJOA 1XUFA 1HXEH 3SU2A 5FCRA 2O8MA 5I25A 1HAZB 2EC9H 1Z8GA 2NWNA 4CRGA 2Z94A 2Z9IA 4A1TA 3FZZA 1FPHH 1O3FA 1HAVB 1WTHD 2SGAA 1ETTH 1LQDB 2EI6A 2A4QA 5DO4H 1C4U2 2GD4B 1C1WH 2ZGXH 4YESB 5K0HA 3V3MA 1GL0E 1UHBA 3GY3A 1AHTH 4ZHAA 1T4VH 1O5GH 2ANWA 4XFQA 3T28A 1BJUA 1CA0B 4KTCA 4FU7A 1N8OB 4NFEA 1ESTA 1JXPA 3VPKA 1G3BA 4X2WA 3RU4T 3KEEA 3BTGE 1GHAG 3RLYH 2G4TA 1ABJH 1XUGA 1UK4A 2ZF0H 1XVOA 3SGQE 1VITF 2H5CA 4XDEA 2ZU4A 4BAMB 2VB0A 3EQ0H 2XNIA 1Y3WA 1UTPA 4OGXA 5EPYA 3FP7E 2A0QB 2YNAA 1P04A 2J95A 4NSVA 1QQUA 3SGBE 4Y11E 2ZP0H 1UCYH 4Y8YA 3GCOA 3M7QA 2CN0H 3S9CA 4GCHF 5FXLA 2PKAB 1NRSH 4QT8C 1QY6A 1ELFA 1XKAC 1THRH 3MMGA 4FVBA 2AGEX 5LPEA 1U6QA 1G3DA 1P09A 2AEIH 3SU4A 2FODA 3A86A 3LDXH 5AVDA 1NT1A 3RU4D 3MO6A 1HRTH 4UONA 4DURA 1GBLA 1C2EA 2D1JA 1P2OA 2D26C 2UWLA 3LGWA 1LHDH 1HBTH 3UWJH 2ODQA 4X6OA 4K1SA 3GYLB 4X1RU 4LXBH 2M5TA 3TGIE 1K28D 2RA0A 2P8OC 1SGFA 1GDUA 3VB7A 4WF8A 1SGYE 2B8OH 3AW0A 1BTXA 1O2TA 2G4UA 2ZFQH 1B7XB 1P05A 3KGPA 3A88A 3ITIA 1TNGA 1P06A 3UOPA 2XC0A 2WPIS 1TPPA 5T6DA 3U98H 3UR6A 5BRRE 2AIPA 1P9UA 4I32A 1SQAA 3B23B 1NM6A 3E16B 2ZGHA 3M7TA 1BMMH 5E8EH 3GY5A 3UTUH 2FOFA 4Y7BA 1GJBB 3VGCC 3BTWE 4ZROA 4VGCC 1UVOA 1UVTH 2OXSA 2VWNA 2A5KA 3E8LA 1O3HA 2C8WB 4IS5A 4MNWA 2H9TH 3A7WA 4E7NA 1Z71A 2G8TA 2SGQE 1EAWA 2A2XH 4FUJA 1Y5AT 1W7GH 2Y5FA 4O9VA 1TFXA 1T7CA 4D9RA 5ABWA 1N6XA 1F2SE 1HFDA 4JYUH 3M5LA 3GOVB 4ISHH 4BTIB 1SFQB 3R3GB 4OS2A 2Q6DA 1O3PB 1HAOH 4PROA 1JIMA 4FUHA 2OLGA 3SUEA 1Y3YA 1Y8TA 1AMHA 2ZHQH 1N1LA 1CT2E 2EI7A 3D49H 3MI4A 2W7SA 1QL9A 3RXOA 2ANKH 3K65B 1SGPE 4U2WA 2Q1JA 1J14A 5DPAA 1OWJA 5GIBA 1O3LA 1LPZB 3LGIA 1BITA 2F9NA 1UJ1A 2CHAC 5EXMA 3KIDU 5LPFA 3UQOA 1C4Y2 4K2YA 3TPIZ 2BQ6B 5C3NA 2NU0E 3RXPA 1N6YA 1O2NA 4JCNA 1KXDA 2OCVB 2ANYA 1Y59T 2Y82A 4DIHH 5BPEA 1HIAB 1ORFA 1QJ7B 1J9CH 1EAUA 3STIA 1B0FA 3F9EA 4GUXA 4H42U 1UTOA 1TALA 2PLXA 4JZDH 3VB4A 4HGCA 3RM2H 1ZRKA 3QLPH 1YPLH 5EXNA 1PFXC 4DGJA 1K1IA 3OY6U 3GYMA 4ZMAH 4UFDH 1ELVA 3RXKA 1DICA 1QFKH 5FHTA 4Z6AH 1HB0B 2D2DA 4NIYA 1HPGA 2GVFA 1MU8B 2GT8A 3ZZ9A 2FZZA 2ZC9H 1OYQA 1Z8RA 1QL8A 1V2VT 1T32A 1PPZA 2W3IA 2B5TB 3PV4A 2BLWA 3F68H 2OC0A 4ZUHA 2A31A 2PTNA 2ZDMA 1O5AB 1TGSZ 3M61U 4OS7A 4IMZA 3A89A 1CGHA 3PLPA 5DP9A 1NTPA 1ELGA 3UQVA 1IQMA 3T29A 3F9GA 3PLBA 3ELAH 4UFEH 1V2PT 4ZHLU 3NKKA 2DUCA 3T25A 1LO6A 4ABAA 4INLA 4ZAEA 5LPRA 4AZ2B 4B71A 1OP8A 3TVJB 3ATLA 1WQSA 1DWEH 1GJ5H 4ISNA 5FBEA 1OWIA 5LH8A 2BDCA 1TX8A 1ZTKA 2V3HH 1C2MA 4Y10E 2FI3E 2XCNA 5JBTA 5L6NH 4K69A 4NIWA 1BTPA 1GHWH 3A8BA 5AFYH 1NC6A 1GBIA 4X0WU 3U1JB 4X1QU 1J17T 3PMBB 1ELEE 3W94A 2ZFSA 1G2MA 3QDZB 1WU1A 2JH0D 1INCA 7GCHG 1MKXH 4MPUA 1ZJDA 4JK6A 1GDNA 1EAXA 4D7FA 1GBTA 2R0LA 5GCHF 3TJOA 1AWHB 1MAXA 1HDTH 2FS9A 1AU8A 1RFNA 3ODDA 1L1JA 2FS8A 1KXAA 1SGTA 1XXDA 1TAWA 2PKSB 1ZHMA 4YM9A 4D7GA 1ZMJA 6LPRA 1P2MA 4U30A 1HCGA 3G01A 1KYNA 1FXYA 1AO5A 1MTNB 3EE0B 1C2GA 3LGTA 1IQFA 4U32A 2TIOA 4AOQA 1GI7B 1YPMH 2LPRA 1PJPA 1Z8JB 1RIWB 3TJNA 1TGBA 1W8BH 3TNSA 1ZPBA 1Z8IB 2OC1A 1SQOA 1CA8B 1TRYA 4NCYA 1Z7KA 2THFB 4GAWA 2RCEA 1V2QT 4ZKRU 1O2JA 2ZG0H 1KXCA 1C1UH 4OGYA 4BTTB 2BLQA 1QBNA 1GWAA 1K2I1 1O5BB 3RXBA 4AGKA 1THPB 4CBOA 4OS4A 4K60A 3DT0H 1LKAA 1DT2A 2XBXA 1WAYB 2ZPSA 2C4FH 3SNEA 2FOCA 1DX5M 4JZEH 1O3CA 1GHBF 1V2KT 4I8JA 3ZZBA 3SGAE 3I78A 3GDVA 1IQEA 5A2MH 2XTTB 2CF9H 4DCDA 2H2ZA 2PTCE 2Y80A 5EG4A 2W3KA 3PMHB 2Z9GA 2FM2A 5L30H 2A4OA 3SZNA 1GBBA 4K1EA 2V3OH 2Z7FE 4GLYA 4BAKB 1LMWB 3BG4B 4CH8B 3RXGA 3A7XA 3MTYA 1O39A 3MO9A 3QN7A 4THNH 1ESAA 2AH4X 4MDSA 2ALVA 1AI8H 1TABE 3T5FH 1T4UH 3SNCA 1XMNB 9LPRA 1GJ7B 1ESBA 3SU5A 3LOXA 3VGCB 1EZXC 3M3TA 2WINI 3KL6A 4ISLA 1K1LA 1C2DA 2R9PA 3H5CB 3JZ2B 1MU6B 3SQEE 1BRBE 3TU7H 2G55A 1SHYA 3NPSA 7KMEH 3LKWA 3TK9A 4UDWH 2FOGA 1SGEE 1VCPA 1UVSH 3KHVA 4X2YA 3E3TA 3UR9A 4WMDA 5F8XA 3SU1A 3E6PH 1EZSC 1DFPA 3ZVCA 2O8WA 4F49A 1GCDA 1P01A 3DFJA 3Q76A 4K8YA 2ZWLH 1ZSLA 1HYLA 1SGCA 1O30A 1EJNA 1Z6EA 1O3NA 2ZPRA 2H9HA 4Y8XA 1T31A 3UNSA 1AE8H 1C2LA 1GBMA 1TRNA 4IN2A 8ESTE 1QTFA 3BEFB 1SR5C 1C5NH 2SGFE 2QCYA 4SGBE 1SVPA 2SGDE 1PQ5A 3L33A 2KAIB 1O2WA 3FP8E 1O2YA 2CHAB 3GY2A 5JYIA 1O2MA 1RTFB 2TGAA 1P9SA 1CVWH 1YYY1 5I46H 5HM9A 1EX3A 1BQYA 3DD2H 2STBE 2WPMS 4I8LA 4DOQA 3SJ9A 2F91A 1LKBA 3K6YA 1SFIA 2GCTC 3S0NA 2EEKA 1O3AA 3QGJA 1HJAB 1TQ0B 2ULLA 3MH7A 1E34B 2OP9A 4MNXA 4XBDA 1UK2A 1ZHRA 1LVBA 1LVYA 1QURH 1CT0E 1CQQA 5FX5A 3E1XB 2WUBA 2C8XB 2VU8E 5EW2H 3TGJE 3BG8A 3QK1A 3RU4E 5AF9H 2BVSH 1O2GH 4NSYA 3BTME 4AYVB 2TPIZ 3PMJA 4YT7H 5DP3A 1W0YH 4ESTE 2WPJS 3PTBA 1D4PB 1E38B 1EASA 3AW1A 5T6FA 1UCYK 1DE7H 5DG6A 3IG6B 2A5IA 3O8CA 3SJOA 2ZHFH 3UPEA 1MZDA 4NA7A 2VIOA 1K1NA 1A61H 4Q7ZA 5E0JA 2GZ8A 3FAOA 1VJAU 1ZLRA 2AGIX 4Y0ZE 2A7CA 1PPBH 3ZVDA 3DA9B 4KP0A 1MZAA 3PLKA 1C9TA 2CJIA 5C1YA 1O38A 1W0ZU 1FI8A 1PPEE 3LU9B 1GBCA 1UHBB 4RKOB 1TA2A 2A1DB 2GMTB 4NA8A 2NU4E 4BXWA 1SLVB 7ESTE 4MNYA 4A92A 2VIWA 2FLBH 3RXJA 2HPPH 2JETC 4ABDA 1LPGB 3P95A 4X8UH 2XYAA 1RGQA 2BOHB 3GCTG 2Z9JA 4K3JA 3OSYA 1YPHC 2UUFB 3MNCA 4WXVA 2ALPA 2VWMA 3ZZ3A 2F9VA 2ZHDA 1QGFA 4AORA 1E37B 1IAUA 1KY9A 3RXIA 1EATA 2VH0A 3QX5H 2Y6TA 1EUFA 1GJ6A 3I29A 4CHAC 1MBQA 2ZGBH 1UTNA 4NGAH 2ZHWH 3S7HB 1A0HB 2H1UA 1MTSA 2UUKB 1YKTA 1FN6A 4BAQB 2P3UB 1S82A 2FOBA 1OKXA 1OP2A 2ZDKA 2BY5X 1LVMA 1YM0A 1C5WB 3KQCA 3A8AA 3TNTA 4AB9A 3ZZ7A 4RN6A 1F0UA 2PV9B 5DP4A 1BA8B 2VGCB 1NFXA 5B6OA 2RDLA 2PGBB 1ZR0A 2QXHA 4K1TA 4X6MA 1TOCB 2PKSC 4NFFA 2BHGA 1HLTH 1EJMA 3M36A 2V6NA 1RTKA 2AMDA 1ZTJA 3DFLA 2BD2A 4DVAU 1UTKA 1MTNC 2J4IA 1GI4A 4ABEA 1C4V2 1F5KU 4NZLA 3DUXH 2FTLE 2FOHA 7GCHF 1RIWC 1PQ7A 3ZZ4A 1C5TA 3AAUA 4GPGA 2ILNA 1BHXB 2AMQA 4INKA 2PHBA 1ZSJA 4SGAE 4WMEA 3GISB 5GPIB 3KCGH 2UUYA 3A7ZA 2R0KA 2G81E 1DXWA 4AFZA 1VCWA 3T62A 2HLCA 2PSYA 4MPVA 1QB6A 3GY6A 4ZKOU 2ZDLA 1AQ7A 1AVGH 1NRQH 1UVPA 3A83A 1BJVA 2VVUA 2Z6BD 2OD3B 3M5OA 1O3IA 2C93B 4A5TS 1NU7B 3E90B 2WV4A 1YCPK 2V0BA 5GWZA 3K9XB 5EW1H 3EDXB 4ZHMU 5DKMA 3UREA 1LHGH 1EZQA 1D3TB 1AN1E 2ZA5A 3P8NA 3ZZ5A 3LH1A 2Z9LA 1JWTA 1MCTA 3CENA 2OC7A 3RMOH 2AS9A 1P2JA 3AASA 2ZGJA 3BIUH 1DPOA 1RTLA 3BTEE 1GI5A 3MH4A 2VH6A 3LPRA 2VWLA 2P59A 3LH3A 1A5HA 1C1RA 1EB1H 2GT7A 3LC5A 4FUDA 1GG6B 3BG4C 2WYGA 2GX4A 2JH6D 1HUTH 3SNDA 3UFAA 2QF3A 3RXHA 3M5MA 2BLVA 1O2OA 1XXFA 2BY7X 1P03A 1AIXH 2GCHG 1CBWB 1C1TA 1J8AA 2IOTA 3LGUA 2CV3A 3T2NA 1AZZA 1KSNA 1O5FH 4GSOA 5FPYA 1KLIH 1C2JA 3GCHB 3ZVBA 1TGNA 2WV5A 4CR9A 1W12U 5ETXA 5EODA 4FXGH 2A32A 1C5PA 3URCA 1FV9A 5CMXH 4IN1A 5JB9S 3A82A 1EP5A 3MHWU 1P2NA 5EQSA 5HMAA 3OTJE 2HNTF 4WVPE 3STJA 3RMLH 1AB9B 1P57B 1C1QA 3L6PA 4B73A 1XKBC 1AVXA 1CT4E 2Q6FA 2QXJA 5H4IB 5FCKA 1A0JA 3SJKA 1MKXK 5JDUB 4UE7H 3KQDA 3U69H 1UVUH 3C27B 2GCTB 2GP9B 1O2HA 1AKSA 1BTZA 3UNRA 1GJAB 1S0RA 3RC5A 2FP7B 2ZU3A 1OSSA 3FFGA 2GV6A 3ODFA 2ZFPH 1L0ZA 1IQJA 3S7KB 3ZV8A 1TX7A 3SUDA 1KXFA 1ZYOA 4UFGH 2BMGB 1TPSA 5IYTA 1DOJA 1FIWA 5HYOA 4CRDA 3MFJA 4F4OC 4I8KA 1TBRH 3D65E 1DS2E 3BV9B 1S83A 4M7GA 3RXSA 1HJAC 1GVKB 2ODPA 5F03A 3SHCH 1GHYH 1BOQA 1TX6A 2BQ7B 2J94A 1BMNH 2XRCA 2A5AA 2G00A 4CR5A 3P8FA 2J92A 1GJ9B 1YCPH 3A85A 4YLUA 1GHXH 1SI5H 1A2CH 1H4WA 4DJZB 3GY8A 3UNQA 4JYTA 3SHAH 3GY7A 1O3GA 1H8DH 1MH0A 1JBUH 3KQBA 3Q00A 3LIWA 2ZPQA 1EOLA 5FBIA 1TMBH 4YZUA 1IQNA 2VIDA 2ZTXA 1C5RA 1F0RA 1YPJH 2BY8X 1C2IA 3LGYA 5EOKA 3N7OA 5CHAC 1BHXF 1C2FA 2RG3A 1WYKA 3M3VA 3Q77A 1G37A 1Z1IA 1SC8U 3P17H 3RXAA 1QL7A 4BANB 1TOMH 2XW9A 3UOUA 1YPHE 2XC5A 3P8GA 3P8OA 2JETB 2CXVA 1GGDC 1OP0A 5HXFA 2Z3DA 2G5VA 4K5ZA 2SGPE 1YC0A 2LNCA 1SQTA 4NIVA 1IQKA 1HV7A 2BLOA 4X8VH 1ABIH 5PTPA 1BT7A 1E35B 1VGCC 2FI5E 2STAE 1V2WT 1EB2A 1S0QA 1TGTA 1F0TA 1AFEH 4YOGA 1HAXB 1XUHA 1FPCH 1GJ4H 2ZCHP 9ESTA 1V2RT 1V3XA 1GBHA 3MOCA 1ZJKA 3ZZ8A 1GVZA 2GMTC 3ESTA 1ELDE 4CHAB 4YOIA 1QB9A 2BTCE 4Y79A 1T8NA 4FUGA 2HNTC 3S9BA 2SFAA 1CGJE 5TCCA 1ANCA 1YPKH 2G5NA 3ZYEA 2Y7ZA 1BBRE 4JK5A 1CHOF 2GKVE 4JYVH 1V2ST 1VZQH 1P2KA 1IHTH 1WTGH 3AVZA 3SU6A 3TGKE 1XUKA 1EJAA 3ZVGA 5A0CA 1NZQH 4AX9H 4Q2KA 4WJG2 5AFZH 2XWAA 2VWOA 4J1YA 1S5SA 1J15A 2DE9A 1F7ZA 1C5XB 3TITA 3BIVH 1O3DA 1FY8E 4Q7XA 3GCTF 1NS3A 2H9EH 3EA8A 1TMTH 2IN2A 1GMHF 4CRCA 5TJXA 1YF4A 2VGCC 2ZTYA 3AAVA 3SOSA 3A87A 3OU0A 3P70B 1OXGA 4I33A 3ZVEA 4FU9A 4HI3A 1YP9A 1BBRK 2C8ZB 4FUFA 3KF2A 4B2CA 3MU0A 2FWWA 2HALA 4KTSA 4CRAA 1GBDA 1IQLA 4X6PA 1QA7A 4BAHB 1SHHB 5A8ZA 2FTMA 3QO6A 4IMQA 3O8RA 1QIXB 5C5NA 4CRBA 1HNEE 1SG8B 1MTUA 3V0XA 1H8IH 1C5MD 1MTVA 4H6TA 1OWDA 4NA9H 1HJ8A 2QC2A 4O3UA 4ABGA 1EKBB 5ESTE 2FMJA 2A4GA 3NWUA 4MG3A 3SN8A 1WUNH 4I31A 5GXPA 4JMYA 1HAGE 1GHAF 1F0SA 1C5VA 3RXUA 3T27A 1O3OA 2XCFA 1G3CA 4JZFH 1W3CA 1D3DB 2ZDAH 1S6FA 4HFPB 3OY5U 4ABHA 2FDAA 1FIZA 2BD7A 5JBCS 1MAYA 2UWPA 2QIQA 2FXRA 2BY9X 1BTWA 2BDIA 2J34A 3GDSA 4ASHA 4BXSA 1BTHH 2BVRH 1NFUA 2F9BH 1C5ZB 2XBYA 3EGKH 1GL1A 3MU5A 1GDQA 5EU8A 3RDZA 1Z1JA 4R8TB 4HTCH 1B5GH 2F9UA 1CSOE 1GG6C 3NUMA 1DUAA 2ZI2H 1TWXB 4JZIA 1O2RA 1Y5UT 4DG4A 3ZZDA 1IOEA 3FP6E 1C5YB 1FDPA 1CBWC 2GTBA 1GBAA 1O3JA 3B9FH 2QAAA 3P92A 3VB3A 3MU8A 1TNLA 1HAHH 2ASUB 2C90B 3GCHC 1QRZA 2C3SA 1KDQB 2VIQA 2I6QA 1CE5A 4CRFA 2J38A 1AUTC 1SBWA 1AUJA 1M9UA 4OS5A 1P3CA 3OX7U 2TGPZ 2VNTA 1GBEA 2W7UA 2OBQA 2VINA 1VJ9U 1LQEA 5L2YH 3CS0A 2PFEA 5C1UA 1O35A 5EXLA 3RC4A 1AB9C 2FX4A 2GZ9A 1LHCH 1PQAA 8GCHG 4YTAA 2HGTH 3BTHE 1ELBA 3A80A 2K1QA 2GCHF 1BBRH 2BXUH 4D8NA 2ZU1A 3U8TH 3DHKH 4INHA 1HAPH 3RLWH 1MQ5A 2BD8A 4BAOB 2PUXB 2WUCA 1ELTA 1G30B 1ZMLA 1PPCE 1G3EA 1P8VC 4Y7AA 5EGMA 5C67A 2BZ6H 1VCQA 2TGTA 4O3TA 3RMMH 5J4QA 1BIOA 3QGNB 1P02A 1O2KA 1L1GA 3GICB 3A7TA 1ZZZA 2CGAA 3ZZAA 1MKWK 4DT7B 1OYTH 3ATIA 1TLDA 3E0NB 5FX6A 5CHAB
chains in the Genus database with same CATH superfamily
1O3MA 1EXFA 4NIXA 2QA9E 2HRVA 1FLEE 3KQEA 5A09A 4AN7A 2H5DA 2TBSA 3DCLA 1KXEA 3U8OH 3ZVFA 4RT0A 3SU3A 1GGDB 1NRPH 2VVCA 1OPHB 2FESH 1GCTB 4Y8ZA 3EYDA 1P2IA 1WCZA 1WQVH 2BOKA 2BD4A 2VIPA 1SMFE 1VGCB 4CREA 2A7HA 1C1SA 1D3QB 1OS8A 6GCHG 1EPTA 2BZAA 2HVXA 1MUEB 3UY9A 1HAIH 2FEQH 3HGNA 1GMCG 1FY3A 4GVUA 4IBLH 2ZKSA 4A1XA 1FY5A 4Y76A 1P10A 1O33A 1SSXA 4AG2A 1AGJA 1A1RA 1V2JT 1BZXE 1O2QA 2FI4E 1K21H 3NCLA 2FOAA 3GY4A 3V13A 2O8LA 2Z3EA 1A3BH 2FOEA 3SI3H 1JOUB 2Y5GA 4X1NU 5C1XA 1BRUP 2BDYA 1UTLM 4AYYB 1UTJA 3RXVA 3H7OA 1GBJA 1L4ZA 3HK6B 5DJ7A 5JBAS 1V2MT 4MLFB 3QUMP 2HWLB 4BNRA 4A7IB 2ZDNA 1ID5H 1LTOA 1V2OT 1W10U 2OK5A 3UWIA 2IPHA 3M35A 4TPYA 1O32A 1DSUA 2WV9A 1FONA 3ZZCA 1S81A 1DITH 2A7JA 5DP5A 1OWKA 4E7RG 1TE0A 2G52A 2IJOB 4WMFA 2VIVA 7LPRA 4OS1A 2GGVB 3GCNA 2B0FA 3O8DA 1PPFE 1V6DA 4AB8A 5FAHA 4ASUD 2UUJB 2JDID 1CO7E 1DVAH 3QTVH 2KM0A 2XBVA 5F6MA 3ENSB 4X2XA 2CK3D 1DM4B 5C17A 2OTVA 2QYIA 1GJDB 3PO1C 1ZTLA 2P3FH 1MTWA 2O9QA 5C2ZA 4UD9H 2DE8A 3ZYDA 1PYTC 1VITH 3EA9A 1LHEH 1WOFA 3V12A 4IW4E 1YCPM 2BDHA 3C1KA 1GHBG 2R2WU 1GBKA 2TRMA 1VR1H 4O03A 1C1OA 3SUGA 1KIGH 1MKWH 3NXPA 4RI0A 1SGQE 2TGDA 1NFYA 1NU9A 1YGCH 2OQ5A 2FOMB 2BB4A 5A8XA 1DSTA 3MU1A 1NFWA 1MMJN 3Q3KA 2AERH 2IJD1 5EPNA 3OYPA 3T26A 3TK6A 4X2VA 3SW2B 3QWCH 3LT3A 5EQRA 1L2EA 1TNHA 3KNXA 3SQHE 4BOHA 3VB5A 4LZ1H 4ZKSU 5SGAE 1QR3E 4YT6H 1BTYA 4A1VA 4KELA 3V7TA 1W14U 2HVYB 6ESTA 1HAVA 1GHVH 2P95A 2ZNKH 4WWYA 3CP7A 4Q7YA 2FYQA 1O0DH 1C1MA 2F9OA 1V2LT 3B8JA 1S85A 1WV7H 3HGPA 2BD9A 1RJXB 1ELCA 2L74A 2P94A 3L3TA 4I86A 1ARCA 1QA0A 1AWFH 2BQWB 3SO3A 3TJVA 3WY8A 1O5DH 1TNJA 5JBBS 1GMDG 1TNKA 2AYWA 4U01A 1HXFH 3M5NA 4Y0YE 5FPSA 4ABJA 3BTQE 4LOYH 1SGNE 3MYWA 4DY7B 3U1IB 1AY6H 2EA3A 2NU2E 1D9IA 1SPJA 4XSKU 3RXDA 4RKJB 1AKSB 1PPGE 4LZ4B 3BTDE 1C2HA 1KLJH 3EA7A 3SU0A 3M3SA 1A5IA 1A3EH 5A0AE 2ZFFH 3VB6A 1SQRA 1TBQH 1HJ9A 1F5LA 3P6ZB 1OOKB 1K1JA 1EQ9A 1WBGB 3RMNH 3S69A 3SV7A 1E0FD 2WZQA 2BD5A 3IITA 4MPWA 5F8ZA 3A84A 3RM0H 5KEDA 3U28C 3LGVA 1BB0B 1C2KA 2PKAA 1FNIA 4IGDA 1GI0A 2FIRH 4NWKA 1GHZA 1NBMD 3MU4A 1E36B 1YPGH 3D23A 5C20A 4ZH8A 3UIRA 2AIQA 1DWDH 1FQ3A 1TPOA 1O5CB 2W5EA 3A7YA 1O36A 2JKHA 1O3BA 1H9HE 1FAXA 1GJCB 1UMAH 3MH6A 1FUJA 1PQ8A 1ZGVA 4D9QA 4AGJA 1W11U 3D62A 3ATKA 3W95A 2ZQ1A 6CHAB 1NESE 2YMSB 1ZPZA 4ACAA 1C5QA 1G32B 2Q6GA 1O2XA 3RXLA 1TB6H 4H4FA 4MPXA 3SV8A 1QJ1B 3A7VA 4GHQA 1LHFH 5T3HA 1JIRA 1GI2A 2Z3CA 4ZKNU 1DY9A 1MQ6A 2YOLA 2CMYA 2GZ7A 4B74A 1K1PA 1GI8B 2XWBI 2A2QH 2BX4A 4XOJA 2HPQH 1W13U 5C94A 3RXFA 2FPZA 2ZO3H 2PR3A 4ZXYH 3PROA 1TRMA 3VXFH 2EI8A 1NY22 2QF0A 1FZZA 1SGIB 2J9NA 1ELAA 2I6SA 4M9FA 1EFRD 3ZIAD 1BCUH 2AFQB 3R0FA 1EPTC 2PUQH 2AMPA 1SLXB 1H9IE 4I8HA 2ZU5A 2ZECA 1FMGA 3HKJB 1O2UA 2BVXH 1EOJA 5HKKD 1MD8A 1RS0A 2XBWA 3FZDA 8GCHF 4MTBA 4TWWA 1UTMA 4ZXXH 1ZHPA 4TY7A 4X8SH 1J16A 2WPLS 1SGDE 4Q4LA 5AHGH 3RUOA 1O3KA 1FY4A 3A8DA 4Q80A 4A6LA 4GHTA 2PSXA 2C8YB 4YLQH 3PWBA 1C5LH 3U9AH 1TYNA 3SJ8A 1GCTC 2XC4A 1C9PA 3RC6A 5F8TA 1GPZA 5J4SA 5DP6A 1Q2WA 2J2UA 1GBFA 1A4WH 3MNSA 2W6ID 1UW7A 1LVOA 2R3YA 1ZRBA 1S84A 3PWCA 4MNVA 2M2AA 2J5UA 1RD3B 2W26A 1YPEH 1CHGA 4WXIA 1P2QA 1IQHA 1C5SA 5E0HA 1AE5A 4JZ1A 1AD8H 4X1SU 3MQKC 3F9FA 4KKDA 1O37A 1V2UT 1WDIA 4XBBA 1OWHA 1THSH 3RXRA 4YOJA 3QZQA 1HIAA 3E0PB 4I8GA 3LONA 4B2BA 1D6WA 1A7SA 4E05H 1O2IA 1AFQC 3M7UA 2YNBA 4RSPA 1NRNH 5FPTA 2WPDD 3HATH 4KTUA 4B1TA 2ZCLP 2KX4A 3BEUA 3A81A 3TH2H 6GCHF 5T6GA 3TH4H 1CU1A 1C1NA 1FN8A 1ANBA 1GI3A 1AVWA 1VITG 3PO1B 3SV6A 3WWBA 1BUIA 5TCAA 3RXEA 1GMCF 1S6HA 5E2OA 5EQQA 1EP6A 4B75A 4Q63A 3MH5A 3RXMA 2KCYA 4AG1A 2ZFTA 4O97A 1DY8A 2Z9KA 2WYJA 1G2LA 1Y3UA 4GCHG 3PV2A 1D3PB 3S9AA 3DSGA 4UEHH 2YMSD 3TJUA 1O2VA 3RP2A 1GI6A 1H1BA 4Y6DA 3LC3A 4Y71A 1P12E 2ZZUH 2PGQB 2SNWA 1DXPA 3PMAB 3ZV9A 1Y3XA 5LGOA 1DLKB 2GDDA 1PPHE 1QQ4A 2BDBA 2QXIA 4B2AA 1O2ZA 1KTTB 2FYRA 2BM2A 2ZU2A 2OBOA 3I77A 1Q31A 1F92A 1EAIA 1HAYB 1V2TT 4WH6A 1CA0C 1NO9H 1IQIA 3BEIB 1N8OC 1MCVA 4K8BA 1C5UA 4TYDA 3RXCA 1TPAE 2BXTH 4B76A 4MQAA 4E06H 3A8CA 1FJSA 2BY6X 2JH5D 4YXWD 2HOBA 2V35A 3RXQA 4TT3D 1D6RA 2ZFRH 3QZRA 1ZOMA 1ETRH 1ARBA 3H7TA 4TY6A 5C5OA 1T8OA 1P0SH 1QHRB 3URDA 3K6ZA 4IC6A 3PM3A 1XM1A 1RRKA 1L4DA 1AZ8A 1X7AC 3GS9A 1A46H 1K22H 4I7YH 4FU8A 2BYAX 5E0GA 1B0EA 1SLWB 2CF8H 1W7XH 4WY3A 3ATWA 3VXEH 2JJ2D 4J2YB 3TH3H 1NRRH 2P3TB 4NG9H 1YLDA 2FLRH 3HPTB 4ISIH 1JRTA 1Q3XA 2P8OB 3BTKE 1QBOA 2JJ1D 5ESBA 1XX9A 4Z0KA 2RFKC 1O34A 1A0LA 1YLCA 1G36A 3MWIU 3SUFA 4X1PU 2XXLA 3F1SB 2BX3A 3KN2A 2SNVA 2ODYB 2ANMH 1OWEA 5HM2A 4TWYA 3TIUA 1EZUC 1QRWA 2LELA 2PWXA 1O5EH 2O8TA 4FUBA 1QRXA 3E91A 5E2PA 1W2KH 2QGRA 2RA3A 2ZEBA 3N99A 3Q3XA 4DW2U 1Y3VA 3IWMA 4AFUA 4OS6A 3F6UH 4XBCA 5F53A 3VEQB 4HZHA 4ISOA 2Y81A 5A0BA 4FVDA 4BTUB 2RDEA 3SBKA 1SB1H 1IHSH 4P02A 1BMAA 1TONA 3SNAA 1FAKH 4VGCB 1ACBE 4CH2B 2ZIQH 1NPMA 3UUZA 3NK8A 1BRAA 1BTUA 4P00A 5K7RA 3MNXA 1QCPA 1Z6JH 4AFQA 4ABIA 3EAJA 2R3UA 1GMDF 1HGTH 2FX6A 1K1MA 4FUIA 1ANEA 5IDKA 1T8MA 5L2ZH 1QB1A 1DDJA 1PYTD 2OUAA 1GJ8B 2F83A 1DWCH 1KMHB 1UTQA 3JZ1B 1SGRE 4AFSA 1O3EA 1TMUH 1SL3A 3SORA 1MBMA 1TNIA 2WPHS 1G9IE 4NWLA 4TPIZ 2ZQ2A 3M37A 1T8LA 3CS7A 3BN9A 1GI9B 2B7DH 5DP7A 1GVLA 2WPKS 3PTNA 8KME2 1SGFG 3LJJA 1ETSH 2Y7XA 3SJIA 1UCYE 1WSSH 1S6LA 1YLNA 2ZCKP 3FOAA 3K2UA 1TQ7B 1EPTB 4XE4A 3PB1E 6CHAC 1KXBA 1TBZH 2YMSC 2GDEH 2R2MB 3ZVAA 1DWBH 4IC5A 4X6NA 1MD7A 2KR7A 2OC8A 5HGGA 3BTFE 1BDAA 1DLEA 3MO3A 2P16A 1ANDA 2QY0B 1O2PA 4R0IA 3O8BA 1K9OE 1F5RA 3Q3YA 2F3CE 1YBWA 3TK5A 1A5GH 2L6OA 1K1OA 2NU1E 2UWOA 2ZDVH 1RXPA 4CBNA 4F48B 4ZCNA 3FVFB 1H9LB 3BTTE 1DANH 2AHME 3PYHA 1BRCE 1C1VH 3BSQA 2A4RA 2B9LA 1V2NT 2XNDD 1O31A 4RT1A 1LPKB 1UK3A 2QN5T 4ABBA 1XVMA 1KDQA 1ZPCA 1CGIE 3MNBA 1SOTA 4NZQA 2GV7A 1WXRA 1FY1A 1IQGA 3TLOA 2K0QA 2P93A 5GDSH 2A45B 1P3EA 2ZTZA 1LDTT 1JMOH 3F9HA 2NU3E 1ZGIA 1LCYA 2BDAA 1QBVH 1ZSKA 2PW8H 4X8TH 1QNJA 5JPMH 3VFEA 2OQUA 2KAIA 4ABFA 1TIOA 2D8WA 1JRSA 2VJ1A 2ZHEH 4KGAA 3SI4H 3OTPA 1UO6A 3HKIB 1DUEA 2F9PA 2HNTE 4WH8A 1C5OH 1OX1A 2Y5HA 3OE7D 3WWFA 1SLUB 1SOZA 1CHOG 1C1PA 2QXGA 4DIIH 3BF6H 5JB8S 5DK1A 5A8YA 3SV2H 1XUJA 2BDGA 2H6MA 1TA6A 2FO9A 2ESTE 5GCHG 1P11E 1AFQB 1NN6A 5G4BA 3HK3B 3RXTA 5GJ4B 1L1NA 2G51A 1NBME 3NZIA 5DGJA 1KLTA 5DP8A 4H6SB 3FANA 2SGEE 4FUCA 1BMLA 1Y5BT 1ZMNA 3ZZ6A 2AGGX 4UFFH 4D76A 4YO9A 5CE1A 2ZGCA 1GI1A 4FUEA 3SNBA 4B6FA 1TGCA 3SV9A 8LPRA 3PV5A 2BD3A 2O8UA 4LK4A 1KTSB 3QTOH 1GMHG 1XUIA 4MVNA 2VVVA 1O2SA 1QJ6B 2QV1A 1NROH 3ATMA 5EJLA 1O2LA 3U8RH 2OINA 3GDUA 3LJOA 1XUFA 1HXEH 1OHHD 3SU2A 5FCRA 2O8MA 5I25A 1HAZB 3WW7A 2EC9H 1Z8GA 2NWNA 4CRGA 1K0HA 2Z94A 2Z9IA 4A1TA 3FZZA 1FPHH 1O3FA 1HAVB 1WTHD 2SGAA 1ETTH 1LQDB 2EI6A 2A4QA 3PRBA 5DO4H 1C4U2 2GD4B 1C1WH 2ZGXH 4YESB 5K0HA 3V3MA 1GL0E 1UHBA 3GY3A 1AHTH 4ZHAA 1T4VH 1O5GH 2ANWA 4XFQA 3T28A 1BJUA 1CA0B 4KTCA 4FU7A 1N8OB 4NFEA 1ESTA 1JXPA 3VPKA 4F55A 1G3BA 4X2WA 3RU4T 3KEEA 3BTGE 1GHAG 3RLYH 2G4TA 1ABJH 1XUGA 1UK4A 2ZF0H 1XVOA 3SGQE 1VITF 2H5CA 4XDEA 2ZU4A 4BAMB 3F2GA 2VB0A 3EQ0H 2XNIA 3UAIC 1Y3WA 1UTPA 4OGXA 5EPYA 3FP7E 2A0QB 2YNAA 1P04A 2J95A 4NSVA 1QQUA 3SGBE 4Y11E 2ZP0H 1UCYH 4Y8YA 3GCOA 3M7QA 2CN0H 3S9CA 4GCHF 5FXLA 2PKAB 1NRSH 4QT8C 1QY6A 1ELFA 1XKAC 1THRH 3MMGA 4FVBA 2AGEX 5LPEA 1U6QA 1G3DA 1P09A 2AEIH 3SU4A 2FODA 3A86A 3LDXH 5AVDA 1NT1A 3RU4D 3MO6A 1HRTH 4UONA 4DURA 1GBLA 1C2EA 2D1JA 1P2OA 2D26C 2UWLA 3LGWA 1LHDH 1HBTH 3UWJH 1VKYA 2ODQA 4X6OA 4K1SA 3GYLB 4X1RU 4LXBH 2M5TA 3TGIE 1K28D 2RA0A 2P8OC 5KGOA 3H09A 1SGFA 1GDUA 3VB7A 4WF8A 1SGYE 2B8OH 3AW0A 1BTXA 1O2TA 2G4UA 2ZFQH 1B7XB 1P05A 3KGPA 3A88A 2EQNA 3ITIA 1TNGA 3KQ5A 1P06A 3UOPA 2XC0A 2WPIS 1TPPA 5T6DA 3U98H 3UR6A 5BRRE 2AIPA 1P9UA 4I32A 1SQAA 3B23B 1NM6A 3E16B 2ZGHA 3M7TA 1BMMH 1COWD 5E8EH 3GY5A 3UTUH 2FOFA 4Y7BA 1GJBB 3VGCC 2EY4C 3BTWE 4ZROA 4VGCC 1UVOA 1UVTH 2OXSA 2VWNA 5T1VA 5EJ1A 2A5KA 3E8LA 1O3HA 2C8WB 4IS5A 4MNWA 2H9TH 3A7WA 4E7NA 1Z71A 2G8TA 2SGQE 3KYFA 1EAWA 2A2XH 4FUJA 2WSSD 1Y5AT 1W7GH 2Y5FA 4O9VA 1TFXA 1T7CA 4D9RA 5ABWA 1N6XA 1F2SE 1HFDA 4JYUH 3M5LA 3GOVB 4ISHH 4BTIB 1SFQB 3R3GB 4OS2A 2Q6DA 1O3PB 1HAOH 4PROA 1JIMA 4FUHA 2OLGA 3SUEA 3FKSD 1Y3YA 4FETA 1Y8TA 1AMHA 2ZHQH 1N1LA 1CT2E 2EI7A 3D49H 3MI4A 2W7SA 1QL9A 3RXOA 2ANKH 3K65B 1SGPE 4U2WA 2Q1JA 1J14A 5DPAA 1OWJA 5GIBA 1O3LA 1LPZB 3LGIA 1BITA 3F0OA 2F9NA 1UJ1A 1W0JD 2CHAC 5EXMA 3KIDU 5LPFA 3UQOA 1C4Y2 4K2YA 4ACBA 3F3BA 3TPIZ 2BQ6B 5C3NA 2NU0E 3RXPA 1N6YA 1O2NA 4JCNA 1KXDA 2OCVB 2ANYA 1Y59T 2Y82A 4DIHH 5BPEA 5DN6D 1HIAB 1ORFA 1QJ7B 1J9CH 1EAUA 3STIA 1B0FA 3F9EA 4GUXA 4H42U 1UTOA 1TALA 2PLXA 4JZDH 3VB4A 4HGCA 3RM2H 1ZRKA 3QLPH 1YPLH 5EXNA 1PFXC 4DGJA 1K1IA 3OY6U 3GYMA 4ZMAH 4UFDH 1ELVA 3RXKA 2IPQX 1DICA 1QFKH 5FHTA 4Z6AH 1HB0B 2D2DA 4NIYA 3VG8A 1HPGA 2GVFA 1MU8B 2GT8A 3N7DA 3ZZ9A 2FZZA 2ZC9H 1OYQA 1Z8RA 1QL8A 1V2VT 1T32A 1PPZA 2W3IA 2B5TB 3PV4A 2BLWA 3F68H 2OC0A 4ZUHA 2A31A 2PTNA 2ZDMA 1O5AB 1TGSZ 3M61U 5DSFA 4OS7A 4IMZA 3A89A 1CGHA 3PLPA 5DP9A 1NTPA 1ELGA 3UQVA 1IQMA 3T29A 3F9GA 3PLBA 3ELAH 4UFEH 1V2PT 4ZHLU 3NKKA 2DUCA 3T25A 1LO6A 4ABAA 4INLA 4ZAEA 5LPRA 4AZ2B 4B71A 1OP8A 3TVJB 3ATLA 3OEED 1WQSA 1DWEH 1GJ5H 4ISNA 5FBEA 1OWIA 2QF5A 5LH8A 2BDCA 1TX8A 1ZTKA 2V3HH 1C2MA 4Y10E 2FI3E 2XCNA 5JBTA 5L6NH 4K69A 4NIWA 3OFND 1BTPA 1GHWH 3A8BA 5AFYH 1NC6A 1GBIA 4X0WU 3U1JB 4X1QU 1J17T 3PMBB 1ELEE 3W94A 2ZFSA 1G2MA 2JIZD 3QDZB 1WU1A 2JH0D 2J98A 1INCA 7GCHG 1MKXH 4MPUA 1ZJDA 4JK6A 1GDNA 5CDFE 2HLDD 1EAXA 4D7FA 1GBTA 2R0LA 5GCHF 3TJOA 4B6EA 2F4LA 1AWHB 1MAXA 1HDTH 2FS9A 1AU8A 1RFNA 3ODDA 1L1JA 2FS8A 1KXAA 1SGTA 1XXDA 1TAWA 2PKSB 5IK2D 1ZHMA 4YM9A 4D7GA 1ZMJA 6LPRA 1P2MA 4U30A 1HCGA 3G01A 1KYNA 1FXYA 1AO5A 1MTNB 3EE0B 1C2GA 3LGTA 1IQFA 4U32A 2TIOA 4AOQA 1GI7B 1YPMH 2LPRA 1PJPA 1Z8JB 1RIWB 3TJNA 1TGBA 1W8BH 3UB0A 3TNSA 5C0UA 1ZPBA 1Z8IB 2OC1A 1SQOA 1CA8B 1TRYA 4NCYA 1Z7KA 2THFB 4GAWA 2RCEA 1V2QT 4ZKRU 2K8IA 1O2JA 2ZG0H 1KXCA 1C1UH 4OGYA 3OAAD 2BLQA 1QBNA 4BTTB 1GWAA 1K2I1 1O5BB 3RXBA 3F2FA 4AGKA 1THPB 4CBOA 4OS4A 4K60A 3DT0H 1LKAA 1DT2A 2XBXA 1WAYB 2ZPSA 2C4FH 3SNEA 2FOCA 1DX5M 4JZEH 1O3CA 1GHBF 1V2KT 4I8JA 3ZZBA 3SGAE 3I78A 3GDVA 1YWUA 1IQEA 5A2MH 2XTTB 2CF9H 4DCDA 2H2ZA 2PTCE 2Y80A 5EG4A 2W3KA 3PMHB 2Z9GA 2FM2A 5L30H 2A4OA 3SZNA 1GBBA 4K1EA 2V3OH 2Z7FE 4GLYA 4BAKB 1LMWB 3BG4B 4CH8B 3RXGA 3A7XA 3MTYA 1O39A 3MO9A 3QN7A 4THNH 1ESAA 2AH4X 4MDSA 2ALVA 1AI8H 1TABE 3T5FH 1T4UH 3SNCA 1XMNB 9LPRA 1GJ7B 1ESBA 3SU5A 3LOXA 3VGCB 1EZXC 3M3TA 2WINI 3KL6A 4ISLA 1K1LA 1C2DA 2R9PA 3H5CB 3JZ2B 1MU6B 3SQEE 1BRBE 3TU7H 2G55A 1SHYA 3NPSA 4OM9A 3LKWA 3TK9A 7KMEH 4UDWH 2FOGA 1SGEE 1VCPA 1UVSH 3KHVA 4X2YA 3E3TA 3UR9A 4WMDA 5F8XA 2KCPA 3SU1A 3E6PH 1EZSC 1DFPA 3ZVCA 2O8WA 4F49A 1GCDA 1P01A 3DFJA 3Q76A 4K8YA 2ZWLH 1ZSLA 1HYLA 1SGCA 1O30A 1EJNA 1Z6EA 1O3NA 2ZPRA 2H9HA 4Y8XA 1T31A 3UNSA 1AE8H 1C2LA 1GBMA 1TRNA 4IN2A 8ESTE 1QTFA 3BEFB 1SR5C 1C5NH 2SGFE 2QCYA 4SGBE 1SVPA 2SGDE 1PQ5A 3L33A 2KAIB 1O2WA 3FP8E 1O2YA 2CHAB 3GY2A 5JYIA 1O2MA 1RTFB 2TGAA 1P9SA 1CVWH 1YYY1 5I46H 5HM9A 1EX3A 1BQYA 3DD2H 2STBE 2KZ4A 2WPMS 4I8LA 4DOQA 3SJ9A 2F91A 1LKBA 3K6YA 1SFIA 2GCTC 3S0NA 2EEKA 1O3AA 3QGJA 1HJAB 1TQ0B 2ULLA 3MH7A 1E34B 2OP9A 4MNXA 4XBDA 1QZ8A 3KYGA 1UK2A 1ZHRA 1LVBA 1LVYA 1QURH 1CT0E 1CQQA 5FX5A 2W6JD 3E1XB 1E1QD 2WUBA 2C8XB 2VU8E 5EW2H 3TGJE 3BG8A 3QK1A 5EJZA 3RU4E 5AF9H 2BVSH 1O2GH 4NSYA 3BTME 4AYVB 2PP6A 2TPIZ 3PMJA 4YT7H 5DP3A 1W0YH 4ESTE 2WPJS 3PTBA 1D4PB 1E38B 3FN8A 1EASA 3AW1A 2VBCA 5T6FA 1UCYK 1DE7H 5DG6A 3IG6B 2A5IA 3O8CA 2KFWA 3SJOA 2ZHFH 3UPEA 1MZDA 5HIZA 4NA7A 2VIOA 1K1NA 5B6LA 1A61H 4Q7ZA 5E0JA 2GZ8A 3FAOA 1VJAU 1ZLRA 2AGIX 4Y0ZE 2A7CA 1PPBH 3ZVDA 3DA9B 4KP0A 1MZAA 3PLKA 1C9TA 2CJIA 5C1YA 1O38A 1W0ZU 1FI8A 1PPEE 3LU9B 1GBCA 1UHBB 4RKOB 1TA2A 2A1DB 2GMTB 4NA8A 2NU4E 4BXWA 1SLVB 7ESTE 4MNYA 4A92A 2VIWA 2FLBH 3RXJA 2HPPH 2JETC 4ABDA 1LPGB 3P95A 4X8UH 2XYAA 1RGQA 2BOHB 3GCTG 2Z9JA 4K3JA 3OSYA 1YPHC 2UUFB 3MNCA 4WXVA 2ALPA 2VWMA 3ZZ3A 2F9VA 2ZHDA 1H8HD 1QGFA 4AORA 1E37B 1IAUA 1KY9A 3RXIA 1EATA 2VH0A 3QX5H 2Y6TA 3N7EA 1EUFA 4AC9A 1GJ6A 3I29A 4CHAC 1MBQA 2ZGBH 1UTNA 4NGAH 2ZHWH 3S7HB 1A0HB 2H1UA 1MTSA 2J97A 2UUKB 1YKTA 1FN6A 4BAQB 4Z1MD 2P3UB 1S82A 2FOBA 1OKXA 1OP2A 2ZDKA 2BY5X 1LVMA 1YM0A 1C5WB 3KQCA 3A8AA 3TNTA 4AB9A 3ZZ7A 4RN6A 1YY3A 1F0UA 2PV9B 5DP4A 1BA8B 2VGCB 1NFXA 5B6OA 2GJGA 2F43B 2RDLA 3OEHD 2PGBB 1ZR0A 2QXHA 4K1TA 2V3MA 4X6MA 1TOCB 2PKSC 4NFFA 2BHGA 1HLTH 1EJMA 2QE7D 3M36A 2V6NA 1RTKA 2AMDA 1ZTJA 3DFLA 2BD2A 4DVAU 1UTKA 1MTNC 2J4IA 1GI4A 4ABEA 1C4V2 1F5KU 4NZLA 3SYJA 3DUXH 2FTLE 3AK5A 2FOHA 7GCHF 1RIWC 1PQ7A 3ZZ4A 1C5TA 3AAUA 4GPGA 2ILNA 1BHXB 2AMQA 4INKA 2PHBA 1ZSJA 4SGAE 4WMEA 3SZEA 3GISB 5GPIB 3KCGH 2UUYA 3A7ZA 2R0KA 2G81E 1DXWA 4AFZA 1VCWA 3T62A 2HLCA 2PSYA 4MPVA 1QB6A 3GY6A 4ZKOU 2ZDLA 1AQ7A 1AVGH 1NRQH 1UVPA 3A83A 1BJVA 2VVUA 2Z6BD 2OD3B 3M5OA 1O3IA 2C93B 4A5TS 1NU7B 3E90B 2WV4A 1YCPK 2V0BA 5GWZA 3K9XB 1E79D 3EDXB 5EW1H 4ZHMU 5DKMA 3UREA 1LHGH 1EZQA 1D3TB 1AN1E 2ZA5A 3P8NA 3ZZ5A 3LH1A 2Z9LA 1JWTA 1MCTA 3CENA 2OC7A 3DSPA 3RMOH 2AS9A 1P2JA 3AASA 2ZGJA 3BIUH 1DPOA 1RTLA 3BTEE 1GI5A 3MH4A 2VH6A 3LPRA 2VWLA 2P59A 3LH3A 1A5HA 1C1RA 1EB1H 2GT7A 3LC5A 3EE7A 4FUDA 1GG6B 3BG4C 2WYGA 2GX4A 2JH6D 1HUTH 3SNDA 3UFAA 2QF3A 3RXHA 3M5MA 2BLVA 1O2OA 1XXFA 2BY7X 1P03A 1AIXH 2GCHG 1CBWB 1BMFD 1C1TA 1J8AA 2IOTA 3LGUA 1SKYE 2CV3A 3T2NA 1AZZA 1MABB 1KSNA 1O5FH 4GSOA 5FPYA 1KLIH 1C2JA 3GCHB 3ZVBA 1TGNA 2WV5A 4CR9A 1W12U 5ETXA 5EODA 4FXGH 2A32A 1C5PA 3URCA 1FV9A 5CMXH 4IN1A 5JB9S 3A82A 1EP5A 3MHWU 1P2NA 2WHXA 5EQSA 5HMAA 3OTJE 2HNTF 4WVPE 3STJA 3RMLH 1AB9B 4FOUC 1P57B 1C1QA 3L6PA 4B73A 1XKBC 1AVXA 3F2HA 1CT4E 2Q6FA 2QXJA 5H4IB 5FCKA 2LP6A 1A0JA 3SJKA 1MKXK 5JDUB 4UE7H 3KQDA 3U69H 1UVUH 3C27B 2GCTB 2GP9B 1O2HA 1AKSA 1BTZA 3UNRA 1GJAB 1S0RA 3RC5A 2FP7B 2ZU3A 1OSSA 3FFGA 2GV6A 3ODFA 2ZFPH 1L0ZA 1IQJA 3S7KB 3ZV8A 1TX7A 3SUDA 1KXFA 4DT4A 1ZYOA 4UFGH 2BMGB 1TPSA 5IYTA 3PRDA 1DOJA 1FIWA 5HYOA 4CRDA 3MFJA 4F4OC 4I8KA 1TBRH 3D65E 1DS2E 3BV9B 1S83A 4M7GA 3RXSA 1HJAC 1GVKB 2ODPA 5F03A 3SHCH 1GHYH 1BOQA 1TX6A 2BQ7B 2J94A 1BMNH 2XRCA 2A5AA 2G00A 4CR5A 3P8FA 2J92A 1GJ9B 1YCPH 3A85A 4YLUA 1GHXH 1SI5H 1A2CH 1H4WA 4DJZB 3GY8A 3UNQA 4JYTA 3SHAH 3GY7A 1O3GA 1H8DH 1MH0A 1JBUH 3KQBA 1FX0B 3Q00A 3LIWA 2ZPQA 1EOLA 5FBIA 1TMBH 4YZUA 1IQNA 2VIDA 2ZTXA 1C5RA 1F0RA 1YPJH 2BY8X 1C2IA 2J98B 3LGYA 5EOKA 3N7OA 5CHAC 1BHXF 1C2FA 2RG3A 1WYKA 3M3VA 3Q77A 1G37A 1Z1IA 1SC8U 3P17H 3RXAA 1QL7A 4BANB 1TOMH 2XW9A 3UOUA 1YPHE 2XC5A 3P8GA 3P8OA 2JETB 2CXVA 1GGDC 1OP0A 5HXFA 2Z3DA 2G5VA 4K5ZA 2SGPE 1YC0A 1SQTA 2LNCA 4NIVA 1IQKA 1HV7A 2BLOA 4X8VH 1ABIH 5PTPA 1BT7A 1E35B 1VGCC 2FI5E 2STAE 1V2WT 1EB2A 1S0QA 1TGTA 1F0TA 1AFEH 4YOGA 1HAXB 1XUHA 1FPCH 1GJ4H 2ZCHP 9ESTA 1V2RT 1V3XA 1GBHA 3MOCA 1ZJKA 3ZZ8A 1GVZA 2GMTC 3ESTA 1ELDE 4CHAB 4YOIA 1W0KD 1QB9A 2BTCE 4Y79A 1T8NA 4FUGA 2HNTC 3S9BA 2SFAA 1CGJE 5TCCA 1ANCA 1YPKH 2G5NA 3ZYEA 2Y7ZA 1BBRE 4JK5A 1CHOF 2GKVE 4JYVH 1V2ST 1VZQH 1P2KA 1IHTH 1WTGH 2V7QD 3AVZA 3SU6A 3TGKE 1XUKA 1EJAA 3ZVGA 5A0CA 1NZQH 4AX9H 4Q2KA 4WJG2 5AFZH 2XWAA 2VWOA 5CHBA 4J1YA 1S5SA 3NRLA 1J15A 2DE9A 1F7ZA 1C5XB 3TITA 3CNRA 3BIVH 3FO8D 1O3DA 1FY8E 4Q7XA 3GCTF 1NS3A 2H9EH 3EA8A 1TMTH 2IN2A 1GMHF 4CRCA 5TJXA 1YF4A 2VGCC 2ZTYA 3AAVA 3SOSA 3A87A 3OU0A 3P70B 1OXGA 4I33A 3ZVEA 4FU9A 4HI3A 1YP9A 5GNDA 1BBRK 2C8ZB 4FUFA 2KCOA 3KF2A 4B2CA 3MU0A 2FWWA 2HALA 4KTSA 4CRAA 1GBDA 5C0TA 1IQLA 4X6PA 1QA7A 4BAHB 5EIYA 1SHHB 5A8ZA 2FTMA 3QO6A 4IMQA 3O8RA 1QIXB 5C5NA 4CRBA 1HNEE 1SG8B 1MTUA 3V0XA 1H8IH 3F0PA 1C5MD 1MTVA 4H6TA 1OWDA 4NA9H 1HJ8A 2QF4A 2QC2A 4O3UA 4ABGA 1EKBB 5ESTE 2FMJA 4TSFD 2A4GA 3NWUA 4MG3A 3SN8A 1WUNH 4I31A 5GXPA 4JMYA 1HAGE 1GHAF 1F0SA 1C5VA 3RXUA 3T27A 1O3OA 1H8ED 2XCFA 1G3CA 4JZFH 1W3CA 1D3DB 4XRNA 2ZDAH 1S6FA 4HFPB 3OY5U 4ABHA 2FDAA 1FIZA 2BD7A 5JBCS 1MAYA 2UWPA 2QIQA 2FXRA 2BY9X 1BTWA 2BDIA 2J34A 3GDSA 4ASHA 4HG6A 4BXSA 1BTHH 2BVRH 1NFUA 2F9BH 1C5ZB 2XBYA 3EGKH 1GL1A 3MU5A 1GDQA 5EU8A 3RDZA 1Z1JA 4R8TB 4HTCH 1B5GH 2F9UA 1CSOE 1GG6C 3NUMA 1DUAA 2ZI2H 1TWXB 4JZIA 1O2RA 1Y5UT 4DG4A 3ZZDA 2XOKD 1IOEA 3W1EA 3FP6E 1C5YB 1FDPA 1CBWC 2GTBA 5KECA 1GBAA 1O3JA 3B9FH 2QAAA 3P92A 3VB3A 3MU8A 1TNLA 1HAHH 2ASUB 2C90B 3GCHC 1QRZA 2C3SA 1KDQB 2VIQA 2I6QA 1CE5A 4CRFA 2J38A 1AUTC 1SBWA 1AUJA 1M9UA 4OS5A 1P3CA 3OX7U 2TGPZ 2VNTA 1GBEA 2W7UA 2OBQA 2VINA 1VJ9U 1LQEA 5L2YH 3CS0A 2PFEA 5C1UA 1O35A 5EXLA 3RC4A 1AB9C 2FX4A 2GZ9A 1LHCH 1PQAA 8GCHG 4YTAA 2HGTH 3BTHE 3DSOA 1ELBA 3A80A 2K1QA 2GCHF 1BBRH 2BXUH 4D8NA 2ZU1A 3U8TH 3DHKH 4INHA 1HAPH 3RLWH 1MQ5A 2BD8A 4BAOB 5FL7D 2PUXB 2WUCA 1ELTA 1E1RD 1G30B 1ZMLA 1PPCE 1G3EA 1P8VC 4Y7AA 5EGMA 5C67A 2BZ6H 1VCQA 2TGTA 4O3TA 5HIYA 3RMMH 5J4QA 1BIOA 3QGNB 1P02A 1O2KA 1L1GA 3GICB 3A7TA 1ZZZA 2CGAA 3ZZAA 1MKWK 4XD7D 4DT7B 1OYTH 3ATIA 1TLDA 3E0NB 2KCAA 5FX6A 5CHAB
chains in the Genus database with same CATH topology
1O3MA 1EXFA 4NIXA 2QA9E 2HRVA 1FLEE 3KQEA 5A09A 4AN7A 2H5DA 2TBSA 1KXEA 3U8OH 3ZVFA 3SU3A 1GGDB 1NRPH 2VVCA 1OPHB 2FESH 1GCTB 4Y8ZA 3EYDA 1P2IA 1WCZA 1WQVH 2BOKA 2BD4A 2VIPA 1SMFE 1VGCB 4CREA 2A7HA 1C1SA 1D3QB 1OS8A 6GCHG 1EPTA 2BZAA 2HVXA 1MUEB 3UY9A 1HAIH 2FEQH 3HGNA 1GMCG 1FY3A 4GVUA 4IBLH 2ZKSA 4A1XA 1FY5A 4Y76A 1P10A 1O33A 1SSXA 4AG2A 1AGJA 1A1RA 1V2JT 1BZXE 1O2QA 2FI4E 1K21H 3NCLA 2FOAA 3GY4A 3V13A 2O8LA 2Z3EA 1A3BH 2FOEA 3SI3H 1JOUB 2Y5GA 4X1NU 5C1XA 1BRUP 2BDYA 1UTLM 4AYYB 1UTJA 3RXVA 3H7OA 1GBJA 1L4ZA 3HK6B 5DJ7A 5JBAS 1V2MT 4MLFB 3QUMP 2HWLB 4BNRA 4A7IB 2ZDNA 1ID5H 1LTOA 1V2OT 1W10U 3UWIA 2IPHA 3M35A 4TPYA 1O32A 1DSUA 1FONA 3ZZCA 1S81A 1DITH 2A7JA 5DP5A 1OWKA 4E7RG 1TE0A 2G52A 2IJOB 4WMFA 2VIVA 7LPRA 4OS1A 2GGVB 3GCNA 2B0FA 3O8DA 1PPFE 1V6DA 4AB8A 5FAHA 2UUJB 1CO7E 1DVAH 3QTVH 2XBVA 5F6MA 3ENSB 4X2XA 1DM4B 2OTVA 2QYIA 1GJDB 3PO1C 1ZTLA 2P3FH 1MTWA 2O9QA 5C2ZA 4UD9H 2DE8A 3ZYDA 1PYTC 1VITH 3EA9A 1LHEH 1WOFA 3V12A 4IW4E 1YCPM 2BDHA 3C1KA 1GHBG 2R2WU 1GBKA 2TRMA 1VR1H 4O03A 1C1OA 3SUGA 1KIGH 1MKWH 3NXPA 1SGQE 2TGDA 1NFYA 1NU9A 1YGCH 2OQ5A 2FOMB 2BB4A 5A8XA 1DSTA 3MU1A 1NFWA 1MMJN 3Q3KA 2AERH 5EPNA 3OYPA 3T26A 3TK6A 4X2VA 3SW2B 3QWCH 3LT3A 5EQRA 1L2EA 1TNHA 3KNXA 3SQHE 4BOHA 3VB5A 4LZ1H 4ZKSU 5SGAE 1QR3E 4YT6H 1BTYA 4A1VA 4KELA 3V7TA 1W14U 6ESTA 1HAVA 1GHVH 2P95A 2ZNKH 4WWYA 3CP7A 4Q7YA 2FYQA 1O0DH 1C1MA 2F9OA 1V2LT 3B8JA 1S85A 1WV7H 3HGPA 2BD9A 1RJXB 1ELCA 2P94A 3L3TA 3SO3A 1ARCA 1QA0A 1AWFH 2BQWB 3TJVA 3WY8A 1O5DH 1TNJA 5JBBS 1GMDG 1TNKA 2AYWA 4U01A 1HXFH 3M5NA 4Y0YE 5FPSA 4ABJA 3BTQE 4LOYH 1SGNE 3MYWA 4DY7B 3U1IB 1AY6H 2EA3A 2NU2E 1D9IA 1SPJA 4XSKU 3RXDA 4RKJB 1AKSB 1PPGE 4LZ4B 3BTDE 1C2HA 1KLJH 3EA7A 3SU0A 3M3SA 1A5IA 1A3EH 5A0AE 2ZFFH 3VB6A 1TBQH 1HJ9A 1F5LA 3P6ZB 1OOKB 1K1JA 1EQ9A 1WBGB 3RMNH 3S69A 3SV7A 1E0FD 3IITA 2BD5A 4MPWA 5F8ZA 3A84A 3RM0H 3LGVA 1BB0B 1C2KA 2PKAA 1FNIA 4IGDA 1GI0A 2FIRH 4NWKA 1GHZA 3MU4A 1E36B 1YPGH 3D23A 5C20A 4ZH8A 3UIRA 2AIQA 1DWDH 1FQ3A 1TPOA 1O5CB 2W5EA 3A7YA 1O36A 2JKHA 1O3BA 1H9HE 1FAXA 1GJCB 1UMAH 3MH6A 1FUJA 1PQ8A 1ZGVA 4D9QA 4AGJA 1W11U 3D62A 3ATKA 3W95A 2ZQ1A 6CHAB 1NESE 1ZPZA 1C5QA 1G32B 2Q6GA 1O2XA 3RXLA 1TB6H 4H4FA 4MPXA 3SV8A 1QJ1B 3A7VA 4GHQA 1LHFH 5T3HA 1JIRA 1GI2A 2Z3CA 4ZKNU 1DY9A 1MQ6A 2YOLA 2CMYA 2GZ7A 4B74A 1K1PA 1GI8B 2XWBI 2A2QH 2BX4A 4XOJA 2HPQH 1W13U 3RXFA 2FPZA 2ZO3H 2PR3A 4ZXYH 3PROA 1TRMA 3VXFH 2EI8A 1NY22 2QF0A 1FZZA 1SGIB 1ELAA 2I6SA 2J9NA 1BCUH 2AFQB 3R0FA 1EPTC 2PUQH 2AMPA 1SLXB 1H9IE 4I8HA 2ZU5A 2ZECA 1FMGA 3HKJB 1O2UA 2BVXH 1EOJA 1MD8A 1RS0A 2XBWA 3FZDA 8GCHF 4MTBA 4TWWA 1UTMA 4ZXXH 1ZHPA 4TY7A 4X8SH 1J16A 2WPLS 1SGDE 5AHGH 3RUOA 1O3KA 1FY4A 3A8DA 4Q80A 4A6LA 4GHTA 2PSXA 2C8YB 4YLQH 3PWBA 1C5LH 3U9AH 1TYNA 3SJ8A 1GCTC 2XC4A 1C9PA 3RC6A 5F8TA 1GPZA 5J4SA 5DP6A 1Q2WA 2J2UA 1GBFA 1A4WH 3MNSA 1LVOA 2R3YA 1ZRBA 1S84A 3PWCA 4MNVA 1RD3B 2W26A 1YPEH 1CHGA 4WXIA 1P2QA 1IQHA 1C5SA 5E0HA 1AE5A 4JZ1A 1AD8H 4X1SU 3F9FA 4KKDA 1O37A 1V2UT 4XBBA 1OWHA 1THSH 3RXRA 4YOJA 3QZQA 1HIAA 3E0PB 4I8GA 3LONA 4B2BA 1D6WA 1A7SA 4E05H 1O2IA 1AFQC 3M7UA 2YNBA 4RSPA 1NRNH 5FPTA 3HATH 4KTUA 4B1TA 2ZCLP 3BEUA 3A81A 3TH2H 6GCHF 5T6GA 3TH4H 1CU1A 1C1NA 1FN8A 1ANBA 1GI3A 1AVWA 1VITG 3PO1B 3SV6A 1BUIA 5TCAA 3RXEA 1GMCF 1S6HA 5E2OA 5EQQA 1EP6A 4B75A 3MH5A 3RXMA 4AG1A 2ZFTA 4O97A 1DY8A 2Z9KA 2WYJA 1G2LA 1Y3UA 4GCHG 1D3PB 3S9AA 4UEHH 3TJUA 1O2VA 3RP2A 1GI6A 1H1BA 4Y6DA 3LC3A 4Y71A 1P12E 2ZZUH 2PGQB 2SNWA 1DXPA 3PMAB 3ZV9A 1Y3XA 5LGOA 1DLKB 2GDDA 1PPHE 1QQ4A 2BDBA 2QXIA 4B2AA 1O2ZA 1KTTB 2FYRA 2BM2A 2ZU2A 2OBOA 3I77A 1Q31A 1F92A 1EAIA 1HAYB 1V2TT 4WH6A 1CA0C 1NO9H 1IQIA 3BEIB 1N8OC 1MCVA 4K8BA 1C5UA 4TYDA 3RXCA 1TPAE 2BXTH 4B76A 4MQAA 4E06H 3A8CA 1FJSA 2BY6X 2JH5D 2HOBA 2V35A 3RXQA 1D6RA 2ZFRH 3QZRA 1ZOMA 1ETRH 1ARBA 3H7TA 4TY6A 5C5OA 1T8OA 1P0SH 1QHRB 3URDA 3K6ZA 4IC6A 3PM3A 1XM1A 1RRKA 1L4DA 1AZ8A 1X7AC 1A46H 1K22H 4I7YH 4FU8A 2BYAX 5E0GA 1B0EA 1SLWB 2CF8H 1W7XH 4WY3A 3ATWA 3VXEH 4J2YB 3TH3H 1NRRH 2P3TB 4NG9H 1YLDA 2FLRH 3HPTB 4ISIH 1JRTA 1Q3XA 2P8OB 3BTKE 1QBOA 5ESBA 1XX9A 4Z0KA 1O34A 1A0LA 1YLCA 1G36A 3MWIU 3SUFA 4X1PU 2XXLA 3F1SB 2BX3A 3KN2A 2SNVA 2ODYB 2ANMH 1OWEA 5HM2A 4TWYA 3TIUA 1EZUC 1QRWA 2PWXA 1O5EH 2O8TA 4FUBA 1QRXA 3E91A 5E2PA 1W2KH 2QGRA 2RA3A 2ZEBA 3Q3XA 4DW2U 1Y3VA 3IWMA 4AFUA 4OS6A 3F6UH 4XBCA 3VEQB 4HZHA 4ISOA 2Y81A 5A0BA 4FVDA 4BTUB 3SBKA 1SB1H 1IHSH 1BMAA 1TONA 3SNAA 1FAKH 4VGCB 1ACBE 4CH2B 2ZIQH 1NPMA 3UUZA 3NK8A 1BRAA 1BTUA 5K7RA 3MNXA 1QCPA 1Z6JH 4AFQA 4ABIA 3EAJA 2R3UA 1GMDF 1HGTH 2FX6A 1K1MA 4FUIA 1ANEA 5IDKA 1T8MA 5L2ZH 1QB1A 1DDJA 1PYTD 2OUAA 1GJ8B 2F83A 1DWCH 1UTQA 3JZ1B 1SGRE 4AFSA 1O3EA 1TMUH 1SL3A 3SORA 1MBMA 1TNIA 2WPHS 1G9IE 4NWLA 4TPIZ 2ZQ2A 3M37A 1T8LA 3CS7A 3BN9A 1GI9B 2B7DH 5DP7A 1GVLA 2WPKS 3PTNA 8KME2 1SGFG 3LJJA 1ETSH 2Y7XA 3SJIA 1UCYE 1WSSH 2ZCKP 3K2UA 1TQ7B 1EPTB 4XE4A 3PB1E 6CHAC 1KXBA 1TBZH 2GDEH 2R2MB 3ZVAA 1DWBH 4IC5A 4X6NA 1MD7A 2OC8A 5HGGA 3BTFE 1BDAA 1DLEA 3MO3A 2P16A 1ANDA 2QY0B 1O2PA 4R0IA 3O8BA 1K9OE 1F5RA 3Q3YA 2F3CE 1YBWA 3TK5A 1A5GH 2ZDVH 1K1OA 2NU1E 2UWOA 4CBNA 1RXPA 3FVFB 1H9LB 3BTTE 1DANH 3PYHA 1BRCE 1C1VH 3BSQA 2A4RA 2B9LA 1V2NT 1O31A 1LPKB 1UK3A 2QN5T 4ABBA 1XVMA 1KDQA 1ZPCA 1CGIE 3MNBA 1SOTA 4NZQA 2GV7A 1FY1A 1IQGA 3TLOA 2P93A 5GDSH 2A45B 1P3EA 2ZTZA 1LDTT 1JMOH 3F9HA 2NU3E 1ZGIA 1LCYA 2BDAA 1QBVH 1ZSKA 2PW8H 4X8TH 1QNJA 5JPMH 3VFEA 2OQUA 2KAIA 4ABFA 1TIOA 2D8WA 1JRSA 2VJ1A 2ZHEH 4KGAA 3SI4H 1UO6A 3HKIB 1DUEA 2F9PA 2HNTE 4WH8A 1C5OH 1OX1A 2Y5HA 1SLUB 1SOZA 1CHOG 1C1PA 2QXGA 4DIIH 3BF6H 5JB8S 5DK1A 5A8YA 3SV2H 1XUJA 2BDGA 2H6MA 1TA6A 2FO9A 2ESTE 5GCHG 1P11E 1AFQB 1NN6A 5G4BA 3HK3B 3RXTA 5GJ4B 1L1NA 2G51A 3NZIA 5DGJA 1KLTA 5DP8A 4H6SB 3FANA 2SGEE 4FUCA 1BMLA 1Y5BT 1ZMNA 3ZZ6A 2AGGX 4UFFH 4D76A 4YO9A 5CE1A 2ZGCA 1GI1A 4FUEA 3SNBA 1TGCA 3SV9A 8LPRA 2BD3A 2O8UA 4LK4A 1KTSB 3QTOH 1GMHG 1XUIA 4MVNA 2VVVA 1O2SA 1QJ6B 2QV1A 1NROH 3ATMA 3U8RH 1O2LA 2OINA 3GDUA 3LJOA 1XUFA 1HXEH 3SU2A 5FCRA 2O8MA 5I25A 1HAZB 2EC9H 1Z8GA 2NWNA 4CRGA 2Z94A 2Z9IA 4A1TA 3FZZA 1FPHH 1O3FA 1HAVB 1WTHD 2SGAA 1ETTH 1LQDB 2EI6A 2A4QA 5DO4H 1C4U2 2GD4B 1C1WH 2ZGXH 4YESB 5K0HA 3V3MA 1GL0E 1UHBA 3GY3A 1AHTH 4ZHAA 1T4VH 1O5GH 2ANWA 4XFQA 3T28A 1BJUA 1CA0B 4KTCA 4FU7A 1N8OB 4NFEA 1ESTA 1JXPA 3VPKA 1G3BA 4X2WA 3RU4T 3KEEA 3BTGE 1GHAG 3RLYH 2G4TA 1ABJH 1XUGA 1UK4A 2ZF0H 1XVOA 3SGQE 1VITF 2H5CA 4XDEA 2ZU4A 4BAMB 2VB0A 3EQ0H 2XNIA 1Y3WA 1UTPA 4OGXA 5EPYA 3FP7E 2A0QB 2YNAA 1P04A 2J95A 4NSVA 1QQUA 3SGBE 4Y11E 2ZP0H 1UCYH 4Y8YA 3GCOA 3M7QA 2CN0H 3S9CA 4GCHF 5FXLA 2PKAB 1NRSH 4QT8C 1QY6A 1ELFA 1XKAC 1THRH 3MMGA 4FVBA 2AGEX 5LPEA 1U6QA 1G3DA 1P09A 2AEIH 3SU4A 2FODA 3A86A 3LDXH 5AVDA 1NT1A 3RU4D 3MO6A 1HRTH 4UONA 4DURA 1GBLA 1C2EA 2D1JA 1P2OA 2D26C 2UWLA 3LGWA 1LHDH 1HBTH 3UWJH 2ODQA 4X6OA 4K1SA 3GYLB 4X1RU 4LXBH 2M5TA 3TGIE 1K28D 2RA0A 2P8OC 1SGFA 1GDUA 3VB7A 4WF8A 1SGYE 2B8OH 3AW0A 1BTXA 1O2TA 2G4UA 2ZFQH 1B7XB 1P05A 3KGPA 3A88A 3ITIA 1TNGA 1P06A 3UOPA 2XC0A 2WPIS 1TPPA 5T6DA 3U98H 3UR6A 5BRRE 2AIPA 1P9UA 4I32A 1SQAA 3B23B 1NM6A 3E16B 2ZGHA 3M7TA 1BMMH 5E8EH 3GY5A 3UTUH 2FOFA 4Y7BA 1GJBB 3VGCC 3BTWE 4ZROA 4VGCC 1UVOA 1UVTH 2OXSA 2VWNA 2A5KA 3E8LA 1O3HA 2C8WB 4IS5A 4MNWA 2H9TH 3A7WA 4E7NA 1Z71A 2G8TA 2SGQE 1EAWA 2A2XH 4FUJA 1Y5AT 1W7GH 2Y5FA 4O9VA 1TFXA 1T7CA 4D9RA 5ABWA 1N6XA 1F2SE 1HFDA 4JYUH 3M5LA 3GOVB 4ISHH 4BTIB 1SFQB 3R3GB 4OS2A 2Q6DA 1O3PB 1HAOH 4PROA 1JIMA 4FUHA 2OLGA 3SUEA 1Y3YA 1Y8TA 1AMHA 2ZHQH 1N1LA 1CT2E 2EI7A 3D49H 3MI4A 2W7SA 1QL9A 3RXOA 2ANKH 3K65B 1SGPE 4U2WA 2Q1JA 1J14A 5DPAA 1OWJA 5GIBA 1O3LA 1LPZB 3LGIA 1BITA 2F9NA 1UJ1A 2CHAC 5EXMA 3KIDU 5LPFA 3UQOA 1C4Y2 4K2YA 3TPIZ 2BQ6B 5C3NA 2NU0E 3RXPA 1N6YA 1O2NA 4JCNA 1KXDA 2OCVB 2ANYA 1Y59T 2Y82A 4DIHH 5BPEA 1HIAB 1ORFA 1QJ7B 1J9CH 1EAUA 3STIA 1B0FA 3F9EA 4GUXA 4H42U 1UTOA 1TALA 2PLXA 4JZDH 3VB4A 4HGCA 3RM2H 1ZRKA 3QLPH 1YPLH 5EXNA 1PFXC 4DGJA </