1GBFA

Alpha-lytic protease with met 190 replaced by ala and gly 216 replaced by leu complex with methoxysuccinyl-ala-ala-pro-alanine boronic acid
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
198
structure length
198
Chain Sequence
ANIVGGIEYSINNASLCSVGFSVTRGATKGFVTAGHCGTVNATARIGGAVVGTFAARVFPGNDRAWVSLTSAQTLLPRVANGSSFVTVRGSTEAAVGAAVCRSGRTTGYQCGTITAKNVTANYAEGAVRGLTQGNACAGRGDSGGSWITSAGQAQGVMSGLNVQSNGNNCGIPASQRSSLFERLQPILSQYGLSLVTG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords ALPHA-LYTIC PROTEASE
publication title Kinetic and structural characterization of mutations of glycine 216 in alpha-lytic protease: a new target for engineering substrate specificity.
pubmed doi rcsb
source organism Lysobacter enzymogenes
total genus 50
structure length 198
sequence length 198
ec nomenclature ec 3.4.21.12: Alpha-lytic endopeptidase.
pdb deposition date 1995-09-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbfA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1gbfA01
1QQUA 2BD9A 1MTUA 1FONA 2ZC9H 1P0SH 5ESBA 2OC8A 1GBHA 2Y81A 2PKSC 3ZV8A 2H5CA 3RM0H 4FUHA 5F8ZA 1F0SA 1OWKA 1HAGE 1XUHA 3TJUA 1ELAA 1P9UA 1TMBH 2BDBA 2VIDA 3W94A 2QXJA 1NY22 1ZJDA 3MNXA 1HAOH 1LQEA 1A5GH 4CRGA 2HLCA 1SGYE 4YT6H 1RIWC 1S84A 3AAUA 2SNVA 3GCTF 4A92A 2ZGCA 3S0NA 1PYTD 2K1QA 1HJ8A 1BTUA 3TVJB 4XE4A 3F68H 2ZPSA 4D9RA 1GBAA 3PV4A 3HGPA 1DT2A 1QL8A 2BOHB 8LPRA 1EOLA 1C5OH 4XFQA 4BTUB 3NWUA 1WV7H 1FV9A 1QB6A 3E16B 3M37A 3RU4T 2FOMB 4JK6A 1GJ6A 1QL7A 4AG1A 4D7FA 1NS3A 4QT8C 4AOQA 1TRNA 4Q80A 4NIXA 3P8NA 1EXFA 2XRCA 2J94A 1S5SA 2Z7FE 5J4QA 3UNRA 5F8XA 2ZG0H 1FAKH 3MNCA 4XSKU 1C2GA 3RC6A 2TGPZ 1C2KA 5EQRA 1MBMA 1Y3VA 4B73A 1AUJA 1F2SE 2VJ1A 1GDQA 2FOGA 3SZNA 4XBCA 1N6YA 3E8LA 3OY6U 4UE7H 1YPHE 4AFZA 1F0UA 2OQUA 3SJ8A 1S83A 1SQTA 4U32A 3OU0A 4FUIA 1AHTH 1N6XA 2ZU1A 4BTIB 4X6OA 1O2HA 1W0ZU 3QK1A 2YNBA 1GBKA 1J14A 3BEUA 5CHAC 4JYVH 3EYDA 1W3CA 1AVXA 2UWOA 2JH0D 1ZSJA 2QIQA 2VIQA 3SGQE 4IC5A 1NFYA 1SSXA 4ZMAH 3RXJA 3ATWA 1MKXK 1EAWA 2WPMS 1GI9B 1NRRH 9LPRA 4LOYH 1EOJA 1TPSA 2CJIA 2ANWA 2C93B 4GSOA 1TRMA 3SNDA 3BTGE 4A1TA 3UPEA 1MUEB 1ZZZA 3RU4E 4CRBA 1M9UA 3RXUA 3AAVA 4NA8A 4E7NA 1QRWA 3RXBA 2EC9H 2D1JA 4UFFH 4ISLA 2BMGB 4JCNA 1HAVA 2OQ5A 2AFQB 3PLBA 3CENA 3VEQB 3A7XA 2STBE 1TGBA 1V2MT 1C2JA 1SGFA 4AGJA 1TX6A 1PQAA 1O3DA 1D6WA 1PQ5A 2BD2A 2H9HA 2QGRA 4OGYA 2D8WA 3R3GB 3ZYDA 4TWWA 2EEKA 4CR9A 5JB8S 3P92A 2IN2A 4B2BA 2C8YB 2VB0A 2Z6BD 1ACBE 4NGAH 3LGUA 3RXEA 3UWJH 5CE1A 2PGQB 5E0HA 2KAIB 3ZVBA 1EPTC 2G51A 1MQ6A 2BTCE 5DP3A 2BY6X 3BSQA 1W11U 1C1UH 3OTJE 2AGIX 1AN1E 2TBSA 4BNRA 4AFQA 2BDGA 2GZ7A 1BBRK 2TGDA 5EPNA 4INKA 4JZFH 1N8OB 2ZCLP 1RS0A 2PW8H 3T26A 1MTVA 3V7TA 3Q00A 1RTKA 2V3OH 1HAPH 2QXGA 3SW2B 2GV6A 7GCHG 1O2JA 1P2IA 5HXFA 2NU2E 1L1JA 1DS2E 2PTNA 2JETC 3KCGH 1UTNA 2R9PA 1MTNC 4I31A 3O8DA 1G2MA 2F9OA 2O9QA 1CO7E 1ESAA 3Q77A 3TPIZ 5GJ4B 2G00A 1DPOA 2ODPA 2ZQ2A 5JPMH 3AVZA 1SGDE 2TIOA 3BTKE 2JH6D 2J34A 1HAIH 1H4WA 1EZXC 1T8MA 1QGFA 1C2FA 2B8OH 1P01A 1EATA 1C5NH 2XBYA 3AW0A 3T27A 7GCHF 5LH8A 2CHAB 1UK2A 1E35B 1O2RA 1LTOA 2OC1A 1EP5A 3PO1B 2BY9X 1MU8B 2V0BA 5LPEA 2W3KA 3H5CB 1YKTA 3GOVB 1P2OA 4X8VH 2CV3A 4J1YA 4UEHH 1BCUH 4TWYA 3Q3YA 4DG4A 1EZQA 1Z71A 1KXBA 1SGEE 3A82A 3QDZB 3GY4A 5C2ZA 1NROH 1LKAA 3ZVEA 4R0IA 2LPRA 2PKSB 1G36A 4D8NA 4DIIH 4I7YH 1FLEE 5A2MH 3RXVA 3UWIA 1ZLRA 3ENSB 1OWDA 4NWKA 2HNTF 1SHHB 4NFFA 2TGAA 2UUJB 1SPJA 1QRZA 3M5OA 2BY5X 1A5IA 2XC5A 1EZSC 2P3TB 1GMHG 1C2HA 2J9NA 2XYAA 2QY0B 3PM3A 1HNEE 2C90B 1TYNA 1C4V2 1HV7A 1RGQA 3WY8A 2H2ZA 1TQ0B 3PLKA 1TNGA 1E38B 1O3GA 1P57B 1CSOE 1VJ9U 3GY2A 3OY5U 1ETTH 2BDCA 1BT7A 1BB0B 1FQ3A 2GVFA 1T4UH 4Y8XA 1UCYE 2BXUH 4HFPB 4WWYA 3TLOA 1MKWH 3H7OA 2B0FA 3QGNB 4Q7ZA 3A7ZA 2ZDKA 1OYQA 2ZHQH 1GBIA 1CT2E 4CH2B 1SGRE 1OOKB 1VR1H 5GDSH 1GPZA 4AB8A 1GMHF 2G55A 4K5ZA 1MD7A 1SLWB 2ZCKP 1NTPA 5C1UA 3JZ2B 1Z8RA 1XUGA 3TK5A 1P10A 1DUEA 2UUKB 1NRPH 2YOLA 3BTTE 1MD8A 1QBNA 1O3AA 1O2GH 3GDUA 5HGGA 3I77A 4IGDA 1TE0A 2OTVA 5AF9H 2NU1E 2H1UA 3NCLA 2ZEBA 1BTHH 1C1VH 4BTTB 3CS7A 3KN2A 3FAOA 1OS8A 3FZDA 3KF2A 3CP7A 1GMCG 2OCVB 2QN5T 2FS9A 2H6MA 2P3FH 3TJVA 4GVUA 3V12A 5CHAB 4VGCB 3SU3A 3SUEA 3MOCA 4B76A 3QLPH 1KLIH 1YF4A 2FLBH 1YLDA 4KELA 1MU6B 2PKAB 1LPZB 1PYTC 3MYWA 1A0HB 1BTYA 2ZGJA 5IYTA 1TQ7B 2VWOA 1O2NA 4DT7B 3MH7A 1SQOA 1P2JA 3SUFA 1MH0A 1XUFA 4ZAEA 4I8JA 1PPEE 4DY7B 1P9SA 3SUDA 2A7HA 3ZVCA 1GL1A 2CXVA 1NU7B 1ZTKA 1TMTH 1SGIB 2EI7A 2VWLA 1TIOA 1O30A 1GBLA 2B9LA 5C20A 3NPSA 4A5TS 2J38A 1OWIA 1A5HA 1K1OA 1W2KH 4UD9H 4WH8A 3LGTA 3NUMA 1S85A 2XWBI 1V2NT 3U8RH 1V2RT 2F83A 1ZGVA 2BLOA 1NFUA 1SGQE 4UFGH 1HXFH 2BD8A 2BOKA 5A09A 1OKXA 4CRDA 4YT7H 2R3YA 3ATLA 4DURA 5GWZA 2NU0E 1SB1H 4UFEH 2ZPRA 1D6RA 1O3HA 1P2NA 2FESH 1P3CA 3URCA 4FU7A 1O3PB 4X0WU 1SHYA 1VJAU 1A61H 5GPIB 4XOJA 1UVSH 3UY9A 1K1LA 4NSVA 1LVBA 1QURH 3MU5A 3V13A 4OS7A 2FTLE 4BXSA 3U98H 4B71A 1JIRA 2UUYA 1DWBH 1AZ8A 3S69A 1S0QA 1C2EA 2ODQA 1ZGIA 1P09A 2OXSA 3NZIA 2A45B 3SBKA 2QYIA 3ZZ7A 2G81E 4FUEA 3QN7A 4MPWA 3ZZCA 2JETB 3RLWH 1MTNB 1F92A 3LGIA 4YZUA 1FMGA 1LVOA 2FPZA 2SGQE 1GHVH 2RCEA 4BAHB 3SJ9A 1FY3A 1ARBA 1O2KA 3RXPA 1SC8U 2A31A 4YOIA 1Z8GA 3PMHB 1L4ZA 1Q31A 2WPHS 3ESTA 5E2OA 4CRAA 1IQEA 1DANH 2EI6A 1D3QB 2BLVA 3KL6A 3SU1A 3LOXA 1SGNE 1GBFA 3F6UH 3LPRA 1TNIA 1O2UA 1WTHD 1QA0A 1GJ8B 3K6YA 3RXHA 1SFQB 3DA9B 5DPAA 3LIWA 1DSUA 2ODYB 4CR5A 1XXDA 4O9VA 4E06H 1GI6A 2OBOA 1O31A 4GAWA 2CN0H 5TCAA 3NK8A 1A0LA 2FX6A 4KGAA 3SJKA 2BQ6B 1GL0E 1GI1A 4ISOA 3A86A 1AFQC 3L33A 3V3MA 1UCYH 3URDA 3A8AA 2P94A 4KP0A 1ELFA 2XBVA 1C9PA 3TK6A 3JZ1B 4GHTA 5EXLA 2OBQA 1RRKA 2H9EH 1ESTA 3O8RA 2XWAA 1G3CA 1VZQH 2O8TA 3MH6A 5HM2A 1CVWH 2NU3E 4YLUA 2FOCA 5DKMA 1GBJA 2SGEE 1YLCA 1TGTA 2Z9GA 1T8NA 2A7JA 4XDEA 1EJNA 1BRAA 3EAJA 1H9HE 1O5EH 2FEQH 3KIDU 4X1SU 4DGJA 1BUIA 4JYUH 1ANCA 3LDXH 1GBTA 2VVVA 2BZAA 1OPHB 2FP7B 1HB0B 1C1SA 3RU4D 1HAVB 1AKSB 1AD8H 2ZFTA 3GY7A 3S7KB 1AWHB 1VGCB 1C5MD 2A1DB 4SGAE 3ZVAA 7KMEH 1IQNA 1C5PA 1C5RA 3RMOH 3ZZBA 3QGJA 1QJ6B 3PO1C 4WMDA 4Q7YA 1O2SA 4LXBH 1HLTH 2FXRA 3MU8A 2AGGX 2FYRA 4MG3A 1RTFB 5G4BA 2VIPA 4BOHA 3E6PH 2QC2A 5EQSA 4THNH 4TPIZ 4Y7AA 2SGAA 2G5VA 1H9LB 1OWJA 1UK3A 5FBIA 1W13U 2H5DA 1DVAH 2J4IA 4X1NU 2ZECA 4DJZB 6GCHF 3D23A 1NESE 4KKDA 1EJAA 3TGJE 1GJ5H 3PLPA 4WMFA 2C3SA 1TOMH 1BRCE 1W10U 1V3XA 1HAYB 2EA3A 1F5RA 2PGBB 1TA2A 1O2ZA 2R0LA 1ZPZA 1NRSH 1TMUH 1CGJE 1V2ST 5K0HA 1O3JA 2F9UA 2HWLB 1K21H 2QAAA 1S0RA 1HDTH 3LU9B 2ZFQH 3TJNA 2Z9LA 3MNSA 2QXIA 3P8FA 1LVMA 1DICA 5DP4A 1GJ7B 3GCOA 1YCPK 5EODA 4D76A 5FPSA 1CBWC 4X6MA 1GBDA 1A46H 2AIPA 1ZRKA 2VIWA 2PUXB 3U8OH 3TITA 1H1BA 1XX9A 2G52A 2ZDMA 1V2QT 1O2TA 1BMMH 1CA0C 3A81A 4CBOA 1AIXH 2P3UB 2ZGXH 3G01A 4Q2KA 3SU5A 1ESBA 4YM9A 3TU7H 2XCNA 2OC0A 5FCRA 1Z8IB 1TBRH 1P2QA 1J15A 5C67A 5DP8A 1BTZA 2XW9A 2ESTE 3LC3A 4ZKNU 2C8WB 3MH4A 2R3UA 4Y10E 1ZJKA 1KXEA 1TBQH 1ZR0A 1O34A 2SFAA 4X8UH 4ABFA 5F03A 1UJ1A 1HCGA 1FAXA 1QIXB 2BQWB 1TNHA 3FP7E 2A5IA 1FXYA 1AWFH 2BB4A 2Y80A 4RKOB 2SGPE 1TALA 1UTQA 1F7ZA 1CGHA 4JMYA 1FUJA 1IQHA 4VGCC 2AMQA 3LH1A 3C27B 1P2MA 1C5VA 4ZHAA 1RTLA 1PPHE 2VIVA 5DP5A 4AFSA 3ZZ5A 2BM2A 2FS8A 1BRBE 3MO3A 1AVWA 1MTSA 4INLA 3PMAB 1IQFA 3SOSA 5EGMA 1P02A 1FY8E 3OX7U 1JMOH 1SBWA 1ANBA 1W14U 3BTEE 2BDIA 1UTPA 4E05H 1BHXB 2BVSH 4BAKB 1O5BB 1XUJA 5I46H 4KTSA 1C5LH 2OLGA 4Z0KA 1AKSA 1MKWK 5B6OA 1DLKB 1GHBG 2G4UA 2ZO3H 4OS6A 3TNTA 5EPYA 1ZHMA 2H9TH 2FLRH 1O39A 4X2VA 3MNBA 1EUFA 5JYIA 1Y3UA 3GDSA 5JBCS 1O2OA 4IMZA 1EQ9A 2XTTB 3VXEH 2GKVE 1K2I1 3PB1E 4OS5A 2AS9A 2Y5FA 2ZU2A 1MTWA 1V2JT 3MH5A 1SVPA 2ZTXA 1B0FA 1RD3B 2IOTA 1SGPE 1IQLA 4X8TH 1SGTA 1ZMLA 5L6NH 5JBTA 1LMWB 4AORA 1XXFA 3TIUA 3F1SB 3F9HA 1W0YH 1BITA 1V2LT 1QTFA 3BIVH 2PWXA 3BG4B 1O36A 3A7TA 3AASA 3A83A 1AFQB 2ALPA 1GHBF 3MU0A 4ABHA 1ZRBA 1DLEA 1ZMJA 5EOKA 5HMAA 1UK4A 1GHWH 2FZZA 3D65E 2XXLA 1NT1A 3MO6A 1TPOA 4ISNA 2I6QA 1DWDH 1NN6A 4Y8YA 1AVGH 1LKBA 1SOZA 1UVTH 1HJ9A 2FOBA 2ZGBH 1DSTA 1FDPA 1AB9C 1BMAA 1O2LA 2FYQA 1EAUA 3GISB 1C2MA 2ZU3A 2VINA 1TNLA 4MNYA 3PMBB 1IQIA 1ELCA 1G3BA 2V35A 2ZDNA 1CGIE 1DITH 1QBOA 2BDYA 1TGSZ 3R0FA 2HGTH 2ZHWH 3M5NA 1FPHH 4UFDH 2XBXA 6ESTA 3A80A 2GP9B 1A0JA 1OP8A 3QO6A 2BD5A 1PPZA 1GVKB 2ZQ1A 2ZA5A 1A3EH 4D7GA 8KME2 1JRSA 1LVYA 1T4VH 3GICB 3M7QA 1FN8A 5C1XA 1O3NA 1O2YA 2A4OA 3S9CA 4B1TA 1YPKH 1S81A 2VNTA 3HGNA 4FUJA 1DXWA 4H6SB 3L6PA 1S6HA 2A4RA 4CH8B 2CMYA 2F9VA 1Z1JA 2QF0A 2Z94A 4Y7BA 3HKJB 5C5OA 1GCDA 1FY1A 1QB1A 4ZH8A 5GCHF 1PFXC 1BHXF 2OC7A 1GBCA 1PPCE 3A7YA 4FVBA 5C3NA 3E91A 1UVPA 5EW2H 1C1WH 4ZROA 1F5LA 3M7UA 2B7DH 1A2CH 5BPEA 3PYHA 4Y0ZE 2BVRH 1DXPA 1UTJA 1YGCH 4B2AA 3TNSA 2O8WA 1TPAE 1V2OT 2AERH 2Q6FA 4BAMB 3EA8A 4X1PU 1ORFA 2GCTC 4O3UA 5JBBS 1KDQA 5FXLA 3GY6A 2RA0A 1VGCC 1LCYA 1G37A 1C5XB 1GHAF 3SN8A 7LPRA 5EQQA 1O32A 3ZZAA 1CBWB 2P8OC 4DVAU 3SU6A 1U6QA 2HNTE 3SV9A 2A5AA 1HJAC 1ZHPA 3QTVH 2AIQA 3U1IB 3K9XB 3ZZ6A 3RXAA 1DFPA 2C8XB 1A7SA 3N7OA 4WJG2 1O5CB 1GBMA 1WAYB 2JH5D 1UTLM 1E37B 2W3IA 5A0BA 1CA0B 5L2ZH 1VITF 4Y8ZA 2ZHEH 1O3LA 3UNSA 4Y79A 1XM1A 2O8UA 2M5TA 4A1XA 3U1JB 5AFYH 1UCYK 2ZP0H 2YNAA 1LQDB 1T31A 1D3TB 1Z7KA 4RN6A 1Y8TA 2J92A 1BDAA 1YPLH 3UIRA 2WPKS 2THFB 2ZIQH 2ZHDA 1B0EA 3ODDA 2AYWA 1J8AA 6CHAC 1JWTA 4OGXA 4ABEA 1O3MA 1INCA 1YPJH 2ANKH 2BX3A 1C5YB 2PSYA 1NRNH 2A0QB 3IWMA 3PROA 3K65B 2QF3A 3SJOA 2VGCC 5F6MA 5A8YA 1VCWA 3SHAH 1Y5AT 4A1VA 1NFXA 2R2WU 3U8TH 1BBRH 4XBBA 3LGWA 3KGPA 1QQ4A 4O03A 1K1MA 1GBEA 1AO5A 3MTYA 4LK4A 2Y6TA 4JYTA 3SQEE 1TBZH 4FUGA 1TB6H 2GDDA 1GGDC 1P11E 1BOQA 3ELAH 4A6LA 5FHTA 5BRRE 1QRXA 2F91A 2GTBA 1AE5A 3DD2H 4NZLA 1Y3XA 3ZZ9A 5L30H 1BTPA 3BEFB 9ESTA 3D49H 1QBVH 3BTME 1C1TA 1G30B 1L4DA 1Y59T 1NO9H 1C1OA 1GVZA 1LHFH 2F3CE 2O8MA 3A84A 4BXWA 3T29A 3ITIA 2A2XH 2FIRH 1THSH 3QX5H 3BEIB 2WYJA 3PWCA 2WV4A 1S6FA 2FWWA 5EW1H 2J2UA 1LPGB 4NZQA 4FUCA 4IBLH 1DWCH 5DJ7A 1HIAA 1V2KT 4OS1A 1J9CH 3UR6A 5SGAE 1P03A 1TNKA 2VIOA 4X2YA 4FUBA 4AYVB 1T32A 1BZXE 2C4FH 1B5GH 2SGFE 2BDAA 2BLWA 1FJSA 2GMTC 1AMHA 1LHDH 2AEIH 3GCHB 3SHCH 2Y5GA 2CF9H 2P16A 1AB9B 3RMLH 1ZPCA 3UQVA 4ZXYH 3FZZA 4TPYA 1KYNA 1P3EA 5JDUB 1P05A 2ZDLA 2C8ZB 4X6NA 2FX4A 4BANB 3O8BA 3TJOA 3P8GA 1KY9A 1O33A 4GCHF 2ZTZA 4Z6AH 3KEEA 2XNIA 3HK6B 2AH4X 2UWLA 2EI8A 2GZ8A 3A89A 4ABAA 1UVOA 2OP9A 4D9QA 1XVOA 1K1IA 3NKKA 1EAIA 1DOJA 1WU1A 5A8XA 1JIMA 4FU9A 1O2QA 1SMFE 2A4GA 2A7CA 3UFAA 4CRCA 1CHOG 1KXCA 1MMJN 1BTXA 4Y0YE 1T7CA 3BG4C 1FY4A 2RG3A 1WOFA 3RM2H 3IITA 3DFLA 5I25A 1HAHH 1A3BH 1VCQA 5DG6A 1ARCA 1MCTA 1GJBB 1C1PA 4JZIA 1ZMNA 2WYGA 3E1XB 1SLUB 2VWNA 5A0CA 3ZZ4A 3M5LA 1O37A 1Z6JH 3STJA 1TNJA 1V2VT 3SNBA 1EASA 8GCHG 4NA9H 1PPGE 1O0DH 3LT3A 1OWHA 4NA7A 2HALA 1NRQH 4ZKOU 4OS4A 1UTMA 1UTOA 4ZKRU 1CHOF 3RXGA 4NIWA 3T5FH 2QXHA 3M5MA 1RXPA 3BG8A 4MNXA 1AZZA 1CT0E 3UNQA 2BZ6H 1TGCA 4IN2A 1AY6H 1DUAA 1JXPA 4FVDA 5JB9S 4I8HA 3MHWU 4AYYB 5A8ZA 5FBEA 6GCHG 2GCTB 1ANEA 4ABJA 3MO9A 3SU4A 3S7HB 1O3EA 1O5DH 3EDXB 1X7AC 3ZZ3A 8GCHF 3DT0H 3SNCA 4DOQA 3QZRA 3M3SA 1VITH 4Y76A 3BIUH 2ZZUH 2P8OB 2ZFRH 1FN6A 4X1QU 4H6TA 4KTUA 1T8OA 1HJAB 3OYPA 1Z8JB 5IDKA 2JKHA 1ZHRA 4F4OC 1G3DA 2ZF0H 2ZTYA 4Y6DA 2TRMA 2A2QH 4PROA 1FZZA 1EB1H 1DWEH 4JZEH 2FODA 1VCPA 1FIWA 2BLQA 5C5NA 4AX9H 1NZQH 2V6NA 3ODFA 1GJ4H 3KQEA 4I8GA 1F0TA 2P93A 4OS2A 4ABGA 1UMAH 3M7TA 1G9IE 3A8CA 4NIVA 1T8LA 3KNXA 4K1TA 1LO6A 2BY8X 3M61U 2XC4A 1FIZA 3RLYH 3MMGA 2WUCA 1SI5H 1SR5C 1SGCA 2WUBA 3FP8E 1O5FH 2TPIZ 1HAZB 2ZPQA 1O5AB 3S9AA 1ELEE 5AFZH 2HPPH 2VWMA 5TCCA 1O3OA 1NU9A 3RC4A 3VGCC 3ZVDA 6CHAB 1SG8B 1ZSLA 2FI3E 1P8VC 2VH6A 1THPB 3LONA 1YC0A 3RXFA 1EPTA 1QY6A 2D26C 2B5TB 2VGCB 5DP6A 2UUFB 4J2YB 4KTCA 1GCTC 5DP9A 1WQSA 3ZVFA 1KSNA 4YOGA 1O2XA 3RXQA 1THRH 1ZYOA 3CS0A 4X2WA 1QJ7B 3P95A 3K2UA 1ABJH 1AI8H 4NWLA 2Y7XA 1CA8B 1UHBA 1GGDB 1HGTH 5E0GA 1V2PT 3BTDE 1GG6B 3HKIB 5FX5A 2Z9JA 1BJUA 1D3PB 1H8IH 1IQGA 1SGFG 1JRTA 3Q3KA 1IAUA 1ZTJA 4YOJA 1TRYA 1PJPA 3EGKH 1FNIA 1CHGA 5C1YA 2NU4E 3TGIE 1TPPA 1Y3YA 3EA9A 4WH6A 3KHVA 3ATIA 3PTNA 2W7SA 2OD3B 2ANYA 1KLJH 3BTQE 4GHQA 1AQ7A 3RXKA 1HPGA 3P17H 4WXIA 1FI8A 1C2DA 1Y5UT 2Y5HA 4UONA 2SNWA 2WINI 4ZHMU 1Z1IA 1MBQA 3AW1A 4ABBA 4K1SA 3RXRA 2FOAA 3GYLB 1BIOA 2NWNA 4TYDA 4DW2U 3RXDA 2BVXH 1ANDA 3I78A 1RFNA 3ZZ8A 1QA7A 3RDZA 1TABE 2HRVA 4CHAB 4AFUA 1BMNH 4CBNA 3DUXH 1BJVA 3ZV9A 1XMNB 2GMTB 1HUTH 1NFWA 4TY6A 4ASHA 5LPFA 1KDQB 1ELBA 4LZ1H 4U30A 1C2LA 4ZKSU 1P04A 4MPVA 2Z3CA 1GMDG 2IJOB 1FPCH 3QWCH 3MU4A 3SNEA 3LJOA 2Z9KA 2ZKSA 1EB2A 5FAHA 3UOUA 1PQ8A 5K7RA 2ZDVH 4FXGH 2QV1A 3UUZA 3LGVA 4YESB 4CRFA 1TFXA 1V2TT 2STAE 5GXPA 1LDTT 2Z3EA 4BAQB 4AZ2B 1PPFE 3UTUH 5EXNA 1AFEH 1O2PA 4IS5A 4INHA 1ID5H 1LHEH 3KQCA 2GCHG 1SFIA 4ESTE 1KTTB 4AGKA 2W7UA 1GWAA 2PTCE 3STIA 1GMDF 1ELVA 1PQ7A 4X6PA 1ZTLA 2A5KA 2ZHFH 4MVNA 3RXTA 4NCYA 2ZFSA 2F9PA 4IW4E 3T2NA 1BBRE 2WPLS 1H8DH 5JBAS 3GYMA 3V0XA 3VPKA 5FX6A 2Q6DA 3W95A 3TGKE 2LNCA 3A85A 1ELDE 3BF6H 1TX8A 1YPGH 1D9IA 4GLYA 5T6GA 3VB4A 3GCHC 1IQJA 3QUMP 1GJDB 2BD4A 4X8SH 1UVUH 6LPRA 1V6DA 2OUAA 4B74A 1HYLA 1W8BH 3GY3A 4WXVA 4BAOB 4ZHLU 2PFEA 1MZAA 2GCHF 2FOHA 1J16A 4JZDH 1O3KA 1D4PB 1UO6A 2GV7A 2HOBA 2ZGHA 3PWBA 3EA7A 1EX3A 4U01A 3ATMA 1QCPA 1ZOMA 2PR3A 3A87A 4Y11E 3EQ0H 3GY8A 3SU2A 1YBWA 4GUXA 2HPQH 3A8BA 3SNAA 5CMXH 2GT8A 1E36B 1O2IA 2ZCHP 2FOEA 1C1RA 4JZ1A 2VVUA 3T25A 1C5SA 1YPMH 2GT7A 1XKAC 5J4SA 2W26A 1N1LA 2F9NA 3F9FA 5GCHG 3M36A 1IQMA 5ESTE 2R2MB 1A1RA 1C1MA 1F5KU 3LJJA 5EG4A 1MAXA 1O3IA 2O8LA 5PTPA 1EKBB 1BTWA 1YCPH 3B23B 4MLFB 3I29A 1ETSH 1L0ZA 2I6SA 3U9AH 1OX1A 1TAWA 2OINA 5EU8A 1EAXA 1WTGH 4ZUHA 5AHGH 4MNVA 1O3BA 2VH0A 2GX4A 2TGTA 3HATH 4F49A 4NSYA 5LPRA 4WVPE 1CE5A 1HIAB 1O5GH 2QA9E 3MU1A 1G2LA 2XC0A 3LH3A 3FVFB 4NIYA 3B8JA 3PMJA 3MI4A 3QTOH 1DM4B 3RXSA 4NG9H 1GJCB 5T6FA 1GHAG 5DO4H 1GVLA 2AMDA 1DX5M 2CF8H 1YPHC 2Z3DA 1GHXH 1A4WH 1KXDA 2WPIS 4K69A 4M7GA 4ABIA 1WYKA 1G3EA 3UREA 1ZPBA 4R8TB 5FPYA 1YCPM 2G8TA 1DE7H 1C4Y2 1C5QA 1NPMA 3VGCB 1SLVB 1SL3A 1VITG 2ZWLH 4O97A 1TX7A 4JK5A 1TWXB 3NXPA 5E0JA 2G5NA 3FFGA 2DE8A 2FO9A 3F9EA 2BY7X 4E7RG 4YO9A 1C2IA 1GJ9B 2ALVA 1W12U 5E2PA 4WMEA 5EXMA 1EJMA 1GCTB 2Z9IA 1L1GA 2BX4A 2SGDE 1RIWB 1KIGH 3T62A 3GCNA 3PTBA 1EZUC 1GDUA 4SGBE 1JOUB 1LPKB 1MKXH 1GI0A 4A7IB 4X2XA 3RXMA 4MNWA 1K1JA 1P2KA 2XBWA 4K60A 2DUCA 2PHBA 4RSPA 4HI3A 3RUOA 1QB9A 4DCDA 2FM2A 1MCVA 1BRUP 1V2WT 2A32A 1WQVH 1C1QA 5T6DA 4HTCH 1J17T 3GDVA 2ZFPH 3HK3B 3LGYA 4LZ4B 1AU8A 1HAXB 2WPJS 3VB3A 1IHSH 1G32B 1E0FD 1SQAA 4Y71A 5H4IB 3K6ZA 1P06A 1H9IE 1O3CA 1Q2WA 3SJIA 2PV9B 1TOCB 3F9GA 3BN9A 1O3FA 2KAIA 3S9BA 1BMLA 1CQQA 3SUGA 3C1KA 4MPXA 4AN7A 1GHZA 2CGAA 2ILNA 1K9OE 2A4QA 1Y5BT 1BQYA 1C5UA 1C9TA 3L3TA 1GI8B 3H7TA 5AVDA 1BA8B 1GI4A 4FUDA 1Y3WA 3FANA 2Y7ZA 1CU1A 1OSSA 2FTMA 1C4U2 2BD7A 2BD3A 1NC6A 4U2WA 3RXCA 4GPGA 2ZFFH 1TGNA 1IOEA 1GG6C 1OWEA 3UOPA 4CREA 1CT4E 3VB6A 4IC6A 2R0KA 1FY5A 4K8YA 4X1RU 5E8EH 1AGJA 2RA3A 3EE0B 4NFEA 1QFKH 3IG6B 1YYY1 3RMNH 1C5WB 1KXAA 1QR3E 1MZDA 4MTBA 1IHTH 4DIHH 1GHYH 3KQBA 4UDWH 3T28A 3BTHE 1SLXB 3OSYA 3SGBE 2UWPA 3E0NB 1OP2A 2VVCA 4WF8A 5LGOA 1O38A 2HVXA 3M3TA 3DFJA 3Q3XA 5ABWA 3M35A 3LC5A 1GI3A 1GMCF 2FI5E 1Q3XA 5DGJA 4HGCA 3ZVGA 3VFEA 2Y82A 3SV2H 2BDHA 5ETXA 4XBDA 2ULLA 3TH2H 2WV5A 4IMQA 2RDLA 4CHAC 1Z6EA 1EP6A 4K1EA 1DY8A 1HBTH 3QZQA 2QCYA 3SI3H 1MAYA 4GCHG 2Q6GA 3RMMH 4ISIH 1C5ZB 1K28D 4MPUA 2GDEH 3O8CA 1O2WA 3KQDA 2ZNKH 2BYAX 3ATKA 5HM9A 2W5EA 1EPTB 1K1PA 2GD4B 3BTFE 8ESTE 5A0AE 1XUKA 1UTKA 1KXFA 4MQAA 4HZHA 2P95A 2ZU5A 3E3TA 1DY9A 4ABDA 1HFDA 4FUFA 3RXIA 1O2MA 1HXEH 1KLTA 4ISHH 4FU8A 5T3HA 3DHKH 4MDSA 5DK1A 2FDAA 3FP6E 1TA6A 1GBBA 1DDJA 2GZ9A 3TH4H 1UHBB 1L2EA 2IPHA 1WBGB 1WCZA 1OP0A 2J95A 2Q1JA 2V3HH 3MFJA 3U69H 1LHCH 4O3TA 3SI4H 3BTWE 2VU8E 1HRTH 1W7GH 3E90B 4IN1A 1RJXB 1QNJA 3E0PB 2BHGA 1O2VA 2ZU4A 2HNTC 1ABIH 1OXGA 2XCFA 3SQHE 4I33A 3TK9A 1QJ1B 3HPTB 1GJAB 4K8BA 7ESTE 2PUQH 1E34B 1ELTA 3GY5A 1AUTC 4YTAA 5F8TA 1AE8H 1GI5A 2F9BH 3BV9B 1NM6A 3D62A 3A7VA 1IQKA 1K22H 4Q7XA 1W7XH 2BQ7B 3SV8A 1C1NA 5FPTA 4K2YA 1V2UT 2ANMH 1P12E 3UQOA 1GI7B 3A7WA 1K1NA 1N8OC 3A8DA 1L1NA 3P8OA 3B9FH 1C5TA 1QL9A 2FMJA 1XUIA 4WY3A 4H42U 3LKWA 4RKJB 3P70B 3ZZDA 3UR9A 3VXFH 1ELGA 1S82A 1TONA 1KTSB 1PPBH 1GI2A 2G4TA 4I8LA 4B2CA 5FCKA 1ZSKA 3Q76A 2FOFA 1XVMA 3M3VA 3P6ZB 1LHGH 1OYTH 1YM0A 2P59A 4I32A 3RC5A 1F0RA 3VB7A 4TY7A 4AB9A 2PLXA 1TLDA 1JBUH 2ASUB 1WSSH 3SU0A 3MWIU 2ZI2H 2D2DA 1O35A 3RXLA 3RP2A 2BXTH 5L2YH 3SO3A 2PKAA 4B75A 1GDNA 1WUNH 1D3DB 1SOTA 4YLQH 3SV6A 3ZYEA 1YP9A 1YPEH 3SGAE 2ZDAH 2CHAC 4H4FA 5HYOA 2AGEX 2FI4E 4AG2A 1MQ5A 1B7XB 4ZXXH 5GIBA 3TH3H 2AMPA 5DP7A 3A88A 1QHRB 2DE9A 3SORA 2PSXA 3RXOA 2GGVB 4K3JA 4I8KA 3SV7A 1ETRH 1XKBC 5TJXA 3GCTG 3VB5A
chains in the Genus database with same CATH superfamily
1QQUA 2BD9A 1MTUA 1FONA 2ZC9H 1P0SH 5ESBA 2OC8A 1GBHA 2Y81A 2QF5A 2PKSC 3ZV8A 2IPQX 2H5CA 3RM0H 4FUHA 5F8ZA 1F0SA 1OWKA 5DN6D 1HAGE 1XUHA 3TJUA 1ELAA 1P9UA 1TMBH 2BDBA 2VIDA 3W94A 2QXJA 1NY22 1ZJDA 3MNXA 1HAOH 1LQEA 1A5GH 4CRGA 2HLCA 1SGYE 4YT6H 1RIWC 1S84A 3AAUA 2SNVA 3GCTF 4A92A 5C0TA 2ZGCA 3S0NA 1PYTD 2K1QA 1HJ8A 1BTUA 3TVJB 4XE4A 3F68H 2ZPSA 4D9RA 1GBAA 3PV4A 3HGPA 1DT2A 1QL8A 2BOHB 8LPRA 1EOLA 1C5OH 4XFQA 4BTUB 3NWUA 1WV7H 1FV9A 1QB6A 3E16B 3M37A 3RU4T 2AHME 2FOMB 4JK6A 1GJ6A 1QL7A 4AG1A 4D7FA 1NS3A 3N7DA 4QT8C 4AOQA 1TRNA 4Q80A 4NIXA 3P8NA 1EXFA 2XRCA 2J94A 1S5SA 2Z7FE 5J4QA 3UNRA 5F8XA 2ZG0H 1FAKH 3MNCA 4XSKU 1C2GA 3RC6A 2TGPZ 1C2KA 5EQRA 1MBMA 1Y3VA 4B73A 1AUJA 1F2SE 2VJ1A 1GDQA 2FOGA 3SZNA 3F3BA 4XBCA 1N6YA 3E8LA 3OY6U 4UE7H 1YPHE 4AFZA 1F0UA 2OQUA 3SJ8A 1S83A 1SQTA 4U32A 3OU0A 4FUIA 1AHTH 1N6XA 2ZU1A 4BTIB 4X6OA 1O2HA 1W0ZU 3QK1A 2YNBA 1GBKA 1J14A 3BEUA 5CHAC 4JYVH 3EYDA 1W3CA 1AVXA 2UWOA 2JH0D 5CHBA 3FN8A 1ZSJA 2QIQA 2VIQA 3SGQE 4IC5A 1NFYA 1SSXA 2WHXA 4ZMAH 3RXJA 3ATWA 1MKXK 1EAWA 2WPMS 1GI9B 1NRRH 9LPRA 4LOYH 1EOJA 1TPSA 2CJIA 2ANWA 2C93B 4GSOA 1TRMA 3SNDA 3BTGE 4A1TA 3UPEA 1MUEB 1ZZZA 3RU4E 4CRBA 1M9UA 3RXUA 3AAVA 4NA8A 4E7NA 1QRWA 3RXBA 2EC9H 2D1JA 4UFFH 4ISLA 2BMGB 4JCNA 1HAVA 2OQ5A 2AFQB 3PLBA 3CENA 3VEQB 3A7XA 2STBE 1TGBA 1V2MT 1C2JA 1SGFA 4AGJA 1TX6A 1PQAA 5HIYA 1O3DA 1D6WA 1PQ5A 2BD2A 3PRDA 2H9HA 2QGRA 4OGYA 2D8WA 3R3GB 3ZYDA 4TWWA 2EEKA 4CR9A 5JB8S 3P92A 2IN2A 4B2BA 2QE7D 2C8YB 2VB0A 2Z6BD 1ACBE 4NGAH 3LGUA 3N99A 3RXEA 3UWJH 2PGQB 5CE1A 5E0HA 2KAIB 3ZVBA 1EPTC 2G51A 1MQ6A 2BTCE 2KCYA 2BY6X 3BSQA 5DP3A 1W11U 1C1UH 3OTJE 2AGIX 1AN1E 2TBSA 4BNRA 4AFQA 2BDGA 2GZ7A 1BBRK 2TGDA 5EPNA 4INKA 4JZFH 1N8OB 4OM9A 2ZCLP 1RS0A 2PW8H 3T26A 1MTVA 3V7TA 3Q00A 1RTKA 2V3OH 1HAPH 2QXGA 3SW2B 2GV6A 7GCHG 1O2JA 1P2IA 5HXFA 2NU2E 1L1JA 1DS2E 2PTNA 2JETC 3KCGH 1UTNA 2R9PA 1MTNC 4I31A 5F53A 3O8DA 1G2MA 2F9OA 2O9QA 1CO7E 1ESAA 3Q77A 3TPIZ 5GJ4B 2G00A 1DPOA 2ODPA 2ZQ2A 5JPMH 2KFWA 3AVZA 1SGDE 2TIOA 3BTKE 2JH6D 2J34A 1HAIH 1H4WA 1EZXC 1T8MA 1QGFA 1C2FA 2B8OH 1P01A 1EATA 1C5NH 2XBYA 3AW0A 3T27A 7GCHF 5LH8A 2CHAB 1UK2A 1E35B 1O2RA 1LTOA 2OC1A 1EP5A 3PO1B 2BY9X 1MU8B 2V0BA 5LPEA 2W3KA 4B6FA 3H5CB 1YKTA 3GOVB 1P2OA 4X8VH 2CV3A 4J1YA 4UEHH 1BCUH 4TWYA 3Q3YA 4DG4A 1EZQA 1Z71A 1KXBA 1SGEE 3A82A 3QDZB 3GY4A 5C2ZA 1NROH 1LKAA 3ZVEA 2F43B 4R0IA 2LPRA 2PKSB 1G36A 4D8NA 4DIIH 4I7YH 1FLEE 2F4LA 5A2MH 3RXVA 3UWIA 1ZLRA 3ENSB 1OWDA 4NWKA 2HNTF 1SHHB 4NFFA 2TGAA 2UUJB 1SPJA 2HVYB 1QRZA 3M5OA 2BY5X 1A5IA 2XC5A 1EZSC 2P3TB 1GMHG 2QF4A 1C2HA 2J9NA 2XYAA 2QY0B 3PM3A 1HNEE 2C90B 1TYNA 1C4V2 1HV7A 4ACAA 1RGQA 3WY8A 2H2ZA 1TQ0B 3PLKA 1TNGA 1E38B 1O3GA 1P57B 1CSOE 1VJ9U 3GY2A 3OY5U 1ETTH 2BDCA 1BT7A 1BB0B 1FQ3A 2GVFA 1T4UH 4Y8XA 1UCYE 2BXUH 4HFPB 4WWYA 3TLOA 2EQNA 1MKWH 3H7OA 2B0FA 3QGNB 4Q7ZA 3A7ZA 2ZDKA 1OYQA 5GNDA 2ZHQH 1GBIA 1CT2E 4CH2B 1SGRE 1OOKB 1VR1H 2JJ1D 5GDSH 1GPZA 4AB8A 1GMHF 2G55A 4K5ZA 1MD7A 1SLWB 2ZCKP 1NTPA 5C1UA 3JZ2B 1Z8RA 1XUGA 3TK5A 1P10A 1DUEA 2UUKB 1NRPH 2YOLA 3BTTE 1MD8A 1QBNA 1O3AA 1O2GH 2GJGA 3GDUA 5HGGA 3I77A 4IGDA 1TE0A 2OTVA 5AF9H 2NU1E 2H1UA 3NCLA 2ZEBA 1BTHH 1C1VH 4ACBA 4BTTB 3CS7A 3KN2A 3FAOA 1OS8A 3FZDA 3KF2A 3CP7A 1GMCG 2OCVB 2QN5T 2FS9A 2H6MA 2P3FH 3TJVA 4GVUA 3V12A 5CHAB 4VGCB 3SU3A 3SUEA 3MOCA 4B76A 3QLPH 1KLIH 1YF4A 2FLBH 1YLDA 4KELA 1MU6B 2PKAB 1LPZB 1PYTC 3MYWA 1A0HB 1BTYA 2ZGJA 2XOKD 5IYTA 1TQ7B 2VWOA 1O2NA 4DT7B 3MH7A 1SQOA 1P2JA 3SUFA 1MH0A 1XUFA 4ZAEA 4I8JA 1PPEE 4DY7B 1P9SA 3SUDA 2A7HA 3ZVCA 1GL1A 2CXVA 1NU7B 1ZTKA 1TMTH 1SGIB 2EI7A 2VWLA 1TIOA 1O30A 1GBLA 2B9LA 5C20A 3NPSA 4A5TS 2J38A 1OWIA 1A5HA 1K1OA 1W2KH 4UD9H 4WH8A 3LGTA 1E1RD 3NUMA 1S85A 2XWBI 1V2NT 3U8RH 1V2RT 2F83A 1ZGVA 2BLOA 1NFUA 1SGQE 4UFGH 1HXFH 2BD8A 2BOKA 5A09A 1OKXA 4CRDA 4YT7H 4ASUD 2OK5A 2R3YA 3ATLA 4DURA 5GWZA 2NU0E 1SB1H 4UFEH 2ZPRA 1D6RA 1O3HA 1P2NA 2FESH 1P3CA 3URCA 4FU7A 1O3PB 4X0WU 1SHYA 1VJAU 1A61H 5GPIB 4XOJA 1UVSH 3UY9A 1K1LA 4NSVA 1LVBA 1QURH 3MU5A 3V13A 4OS7A 2FTLE 4BXSA 3U98H 4B71A 1JIRA 2UUYA 1DWBH 1AZ8A 3S69A 1S0QA 1C2EA 2ODQA 1ZGIA 1P09A 2OXSA 3NZIA 2A45B 3SBKA 2QYIA 3ZZ7A 2G81E 4FUEA 3QN7A 4MPWA 3ZZCA 2JETB 3RLWH 1MTNB 1F92A 3LGIA 4YZUA 3PRBA 1FMGA 1LVOA 2FPZA 2SGQE 1GHVH 2RCEA 4BAHB 3SJ9A 1FY3A 1ARBA 1O2KA 3RXPA 1SC8U 2A31A 4YOIA 1Z8GA 3PMHB 1L4ZA 1Q31A 2WPHS 3ESTA 5E2OA 4CRAA 1IQEA 5B6LA 1DANH 2EI6A 1D3QB 2BLVA 3KL6A 3SU1A 5IK2D 3LOXA 1SGNE 1GBFA 3F6UH 1E79D 3LPRA 1TNIA 1O2UA 1WTHD 1QA0A 1GJ8B 3K6YA 3RXHA 1SFQB 3DA9B 5DPAA 3LIWA 1DSUA 2ODYB 4CR5A 1XXDA 4O9VA 4E06H 1GI6A 2OBOA 1O31A 4GAWA 2CN0H 3WWBA 5TCAA 3NK8A 1A0LA 2FX6A 4KGAA 3SJKA 2BQ6B 1GL0E 1GI1A 4ISOA 3A86A 1AFQC 3VG8A 3L33A 3V3MA 1UCYH 3URDA 3A8AA 2P94A 4KP0A 1ELFA 2XBVA 1C9PA 3TK6A 3JZ1B 4GHTA 5EXLA 2OBQA 1RRKA 2H9EH 1ESTA 3O8RA 2XWAA 1G3CA 1VZQH 2O8TA 3MH6A 5HM2A 1CVWH 2NU3E 4YLUA 2FOCA 5DKMA 1GBJA 2SGEE 1YLCA 1TGTA 2Z9GA 5T1VA 1T8NA 2A7JA 4XDEA 1EJNA 1BRAA 3EAJA 1H9HE 1O5EH 2FEQH 3KIDU 4X1SU 4DGJA 1BUIA 4JYUH 1ANCA 3LDXH 1GBTA 2VVVA 2BZAA 1OPHB 2FP7B 1HB0B 1C1SA 3RU4D 1HAVB 1AKSB 1VKYA 1AD8H 2ZFTA 3GY7A 3S7KB 1AWHB 1VGCB 1C5MD 2A1DB 4SGAE 3ZVAA 7KMEH 1IQNA 1C5PA 1C5RA 3RMOH 3ZZBA 3QGJA 1QJ6B 3PO1C 4WMDA 4Q7YA 1O2SA 4LXBH 1HLTH 2FXRA 3MU8A 2AGGX 2FYRA 4MG3A 1RTFB 5G4BA 2VIPA 4BOHA 2KX4A 3E6PH 2QC2A 5EQSA 4THNH 4TPIZ 4Y7AA 2SGAA 2G5VA 1H9LB 3KQ5A 1OWJA 1UK3A 5FBIA 1W13U 2H5DA 1DVAH 2J4IA 4X1NU 2ZECA 4DJZB 6GCHF 3D23A 1NESE 4KKDA 1EJAA 3TGJE 1GJ5H 3PLPA 4WMFA 2C3SA 1TOMH 1BRCE 1W10U 1V3XA 1HAYB 2EA3A 1F5RA 2PGBB 1TA2A 1O2ZA 2R0LA 1ZPZA 1NRSH 4Q63A 2WZQA 1TMUH 1CGJE 1V2ST 5K0HA 1O3JA 2F9UA 2HWLB 1K21H 2QAAA 1S0RA 1HDTH 3LU9B 2ZFQH 3TJNA 2Z9LA 3MNSA 2QXIA 3P8FA 1LVMA 1DICA 4AC9A 5DP4A 1GJ7B 3GCOA 1YCPK 5EODA 4D76A 5FPSA 1CBWC 4X6MA 1GBDA 1A46H 2AIPA 1W0KD 1ZRKA 2VIWA 3PV5A 2PUXB 2K0QA 3U8OH 2RFKC 3TITA 1H1BA 1XX9A 2G52A 2ZDMA 1V2QT 1O2TA 1BMMH 1CA0C 3A81A 4CBOA 1AIXH 2P3UB 2ZGXH 3G01A 4Q2KA 3SU5A 1ESBA 1WXRA 2EY4C 4YM9A 3UAIC 3TU7H 2KR7A 2XCNA 2OC0A 4TT3D 5FCRA 1Z8IB 1TBRH 1P2QA 1J15A 5C67A 5DP8A 1BTZA 2XW9A 2ESTE 3LC3A 4ZKNU 2C8WB 3MH4A 2R3UA 4Y10E 1ZJKA 4P00A 1KXEA 1TBQH 1ZR0A 1O34A 2SFAA 4X8UH 4ABFA 5F03A 1UJ1A 1HCGA 1FAXA 1QIXB 2BQWB 1TNHA 3FP7E 2A5IA 2JDID 1FXYA 1AWFH 2BB4A 2Y80A 4RKOB 2SGPE 1TALA 1UTQA 1F7ZA 1H8HD 1CGHA 4JMYA 1FUJA 1IQHA 4VGCC 2AMQA 3LH1A 3C27B 1P2MA 4RT1A 1YY3A 1C5VA 4ZHAA 1RTLA 1PPHE 2VIVA 5DP5A 4AFSA 3ZZ5A 1UW7A 2BM2A 2WV9A 2FS8A 1BRBE 3MO3A 1AVWA 1MTSA 4INLA 2CK3D 3PMAB 1IQFA 3SOSA 5EGMA 1P02A 1FY8E 3OX7U 1JMOH 1SBWA 1ANBA 1W14U 3BTEE 2BDIA 1UTPA 4E05H 1BHXB 2BVSH 4BAKB 1O5BB 1XUJA 5I46H 4KTSA 1C5LH 2OLGA 4Z0KA 1AKSA 2RDEA 1MKWK 2IJD1 5B6OA 1DLKB 1GHBG 2G4UA 2ZO3H 4OS6A 3TNTA 5EPYA 1ZHMA 2H9TH 2FLRH 1O39A 4X2VA 2WSSD 3MNBA 1EUFA 5JYIA 1Y3UA 3GDSA 1OHHD 1O2OA 5JBCS 4IMZA 1EQ9A 2XTTB 3VXEH 2GKVE 1K2I1 3PB1E 4OS5A 2AS9A 2Y5FA 2ZU2A 1MTWA 2XNDD 1V2JT 3MH5A 1SVPA 2ZTXA 1B0FA 1RD3B 2IOTA 1SGPE 1IQLA 4X8TH 1SGTA 1ZMLA 2YMSD 5L6NH 5JBTA 1LMWB 4AORA 1XXFA 3TIUA 5KECA 3F1SB 3F9HA 1W0YH 4DT4A 1BITA 1V2LT 1QTFA 3BIVH 2PWXA 3BG4B 1O36A 3A7TA 3AASA 3A83A 4F55A 1AFQB 1BMFD 1GHBF 2ALPA 3MU0A 4ABHA 1ZRBA 1DLEA 1ZMJA 5EOKA 5HMAA 1UK4A 1GHWH 2FZZA 3D65E 2XXLA 1NT1A 3MO6A 1TPOA 4ISNA 2I6QA 1DWDH 1NN6A 4Y8YA 1AVGH 1LKBA 1SOZA 1UVTH 1HJ9A 2FOBA 2ZGBH 1DSTA 1FDPA 1AB9C 1BMAA 1O2LA 2FYQA 1EAUA 3GISB 1C2MA 2ZU3A 2VINA 1TNLA 4MNYA 3MQKC 3PMBB 1IQIA 1ELCA 1G3BA 2V35A 2ZDNA 1CGIE 1DITH 1QBOA 2BDYA 1TGSZ 2W6JD 3R0FA 2HGTH 2ZHWH 3M5NA 1FPHH 4UFDH 2XBXA 6ESTA 3A80A 2GP9B 1A0JA 1OP8A 3QO6A 1SQRA 3DSPA 2BD5A 1PPZA 1GVKB 2ZQ1A 2ZA5A 3DSOA 1A3EH 4D7GA 4YXWD 8KME2 1YLNA 1JRSA 1LVYA 1T4VH 3GICB 3M7QA 4Z1MD 1FN8A 5C1XA 1O3NA 1O2YA 2A4OA 3S9CA 4B1TA 1YPKH 1S81A 2VNTA 3HGNA 4FUJA 1DXWA 4H6SB 3L6PA 1S6HA 2A4RA 4CH8B 2CMYA 2F9VA 4B6EA 1Z1JA 2QF0A 2Z94A 4Y7BA 3HKJB 5C5OA 1GCDA 1FY1A 1QB1A 4ZH8A 5GCHF 1PFXC 1BHXF 2OC7A 1GBCA 1PPCE 3A7YA 4FVBA 3UB0A 3E91A 5C3NA 1UVPA 5EW2H 1C1WH 4ZROA 1F5LA 3M7UA 2B7DH 3WWFA 1A2CH 5BPEA 3PYHA 4Y0ZE 3DSGA 2BVRH 1DXPA 1UTJA 1YGCH 4B2AA 3TNSA 2O8WA 1TPAE 1V2OT 2AERH 2Q6FA 2L6OA 4BAMB 3EA8A 4X1PU 1ORFA 2GCTC 4O3UA 5JBBS 1KDQA 5FXLA 3GY6A 2RA0A 1VGCC 1LCYA 1G37A 1C5XB 1KMHB 1GHAF 3SN8A 7LPRA 5EQQA 1O32A 3ZZAA 1CBWB 2P8OC 4DVAU 3SU6A 1U6QA 2HNTE 3SV9A 2A5AA 1HJAC 1ZHPA 3QTVH 3KYGA 2AIQA 3U1IB 3K9XB 3ZZ6A 3RXAA 1DFPA 2C8XB 1A7SA 3N7OA 4WJG2 1O5CB 4P02A 1GBMA 5EJLA 1WAYB 2JH5D 1UTLM 1E37B 2W3IA 5A0BA 1CA0B 5L2ZH 1VITF 4Y8ZA 2ZHEH 1O3LA 3UNSA 4Y79A 1H8ED 1XM1A 2O8UA 2M5TA 4A1XA 2JJ2D 3U1JB 5AFYH 1UCYK 2ZP0H 2YNAA 1LQDB 1T31A 1D3TB 1Z7KA 4RN6A 1Y8TA 2J92A 1BDAA 1YPLH 3UIRA 2WPKS 2THFB 2ZIQH 2ZHDA 1B0EA 3ODDA 2AYWA 1J8AA 6CHAC 1JWTA 4OGXA 4ABEA 1O3MA 3WW7A 1INCA 1YPJH 2ANKH 2BX3A 1C5YB 2PSYA 1NRNH 2A0QB 3IWMA 3PROA 3K65B 2QF3A 3SJOA 2VGCC 5F6MA 5A8YA 3F2FA 1VCWA 3SHAH 1Y5AT 4A1VA 1NFXA 2R2WU 3U8TH 1BBRH 4XBBA 1MABB 3LGWA 3KGPA 1QQ4A 4O03A 1K1MA 1GBEA 1AO5A 3MTYA 4LK4A 2Y6TA 4JYTA 3SQEE 1TBZH 2LELA 4FUGA 1TB6H 2GDDA 1GGDC 1P11E 1BOQA 3ELAH 3OFND 4A6LA 5FHTA 5BRRE 1QRXA 2F91A 2GTBA 3FOAA 1AE5A 3DD2H 4NZLA 1Y3XA 3ZZ9A 5L30H 1BTPA 3NRLA 3BEFB 9ESTA 3D49H 1QBVH 3BTME 1C1TA 1G30B 1L4DA 1Y59T 1NO9H 1C1OA 1GVZA 1LHFH 2F3CE 2O8MA 3A84A 4BXWA 3T29A 3ITIA 2A2XH 5C17A 2FIRH 1THSH 3QX5H 3BEIB 2WYJA 3PWCA 2WV4A 1S6FA 2FWWA 5EW1H 2J2UA 3ZIAD 1LPGB 4NZQA 4FUCA 4IBLH 1DWCH 5DJ7A 1HIAA 1V2KT 4OS1A 1J9CH 3UR6A 5SGAE 1P03A 5EJ1A 1TNKA 2VIOA 4X2YA 4FUBA 4AYVB 2J98A 1T32A 1BZXE 2C4FH 5FL7D 1B5GH 2SGFE 2BDAA 1FX0B 2BLWA 1FJSA 2GMTC 1AMHA 1LHDH 2AEIH 3GCHB 3SHCH 2Y5GA 2CF9H 2P16A 4XD7D 1K0HA 3FO8D 1AB9B 3RMLH 1ZPCA 3UQVA 4ZXYH 3FZZA 4TPYA 1KYNA 1P3EA 5JDUB 1P05A 5CDFE 2ZDLA 2C8ZB 4X6NA 2FX4A 4BANB 3O8BA 4RI0A 3TJOA 3P8GA 1KY9A 2PP6A 1O33A 4GCHF 2ZTZA 4Z6AH 3KEEA 2XNIA 3HK6B 2AH4X 2UWLA 2EI8A 2GZ8A 3A89A 4ABAA 1UVOA 2OP9A 4D9QA 1XVOA 1K1IA 3NKKA 1EAIA 1DOJA 1WU1A 5A8XA 1JIMA 4FU9A 1O2QA 1SMFE 2A4GA 2A7CA 3UFAA 4CRCA 1CHOG 1KXCA 1MMJN 1BTXA 4Y0YE 1T7CA 3BG4C 1FY4A 2RG3A 1WOFA 2W6ID 3RM2H 3IITA 3DFLA 5I25A 1HAHH 1A3BH 1VCQA 5DG6A 1ARCA 1MCTA 1GJBB 1C1PA 4JZIA 1ZMNA 2WYGA 3E1XB 1SLUB 2VWNA 5EIYA 5A0CA 3ZZ4A 3M5LA 1O37A 1Z6JH 3STJA 1TNJA 1V2VT 3SNBA 1EASA 8GCHG 4NA9H 1PPGE 1O0DH 3LT3A 1OWHA 4NA7A 3SZEA 2HALA 1NRQH 4ZKOU 4OS4A 1UTMA 1UTOA 4ZKRU 1CHOF 3RXGA 4NIWA 3T5FH 2QXHA 3M5MA 1RXPA 3BG8A 4MNXA 1AZZA 1CT0E 3UNQA 2HLDD 2BZ6H 1TGCA 4IN2A 1AY6H 1DUAA 1JXPA 4FVDA 5JB9S 4I8HA 3MHWU 4AYYB 5A8ZA 5FBEA 6GCHG 2GCTB 1ANEA 4ABJA 3MO9A 3SU4A 3S7HB 1O3EA 1O5DH 3EDXB 1X7AC 3ZZ3A 8GCHF 3DT0H 3SNCA 4DOQA 3QZRA 3M3SA 1VITH 4Y76A 3BIUH 2ZZUH 2P8OB 2ZFRH 1FN6A 4X1QU 4H6TA 4KTUA 1T8OA 1HJAB 3OYPA 1Z8JB 5IDKA 2JKHA 1ZHRA 3FKSD 4F4OC 1G3DA 2ZF0H 2ZTYA 4Y6DA 2TRMA 2A2QH 4PROA 3W1EA 1FZZA 1EB1H 1DWEH 4JZEH 2FODA 3F2GA 1VCPA 1FIWA 2BLQA 5C5NA 4AX9H 1S6LA 1NZQH 2V6NA 3ODFA 1GJ4H 3KQEA 4I8GA 4M9FA 1F0TA 2P93A 4OS2A 4ABGA 1UMAH 3M7TA 1G9IE 3A8CA 4NIVA 3DCLA 1T8LA 3KNXA 4K1TA 1LO6A 2BY8X 3M61U 2XC4A 1FIZA 3RLYH 3MMGA 2WUCA 1SI5H 1SR5C 1SGCA 2WUBA 3FP8E 1O5FH 2TPIZ 1HAZB 2ZPQA 1O5AB 3S9AA 1ELEE 5AFZH 2HPPH 2VWMA 5TCCA 1O3OA 1NU9A 3RC4A 3VGCC 3ZVDA 6CHAB 1SG8B 1WDIA 1ZSLA 2FI3E 1P8VC 2VH6A 2K8IA 1THPB 3LONA 1YC0A 2J97A 3RXFA 1EPTA 1QY6A 2D26C 2B5TB 2VGCB 5DP6A 2UUFB 4J2YB 4KTCA 1GCTC 3OEED 5DP9A 1WQSA 3ZVFA 1KSNA 4YOGA 4ZCNA 1O2XA 3RXQA 1THRH 1ZYOA 3CS0A 4X2WA 1QJ7B 3P95A 3K2UA 1ABJH 1AI8H 4NWLA 2Y7XA 1CA8B 1UHBA 1GGDB 1HGTH 5E0GA 1V2PT 3BTDE 1GG6B 3HKIB 5FX5A 2Z9JA 1BJUA 1D3PB 1H8IH 1IQGA 1SGFG 1JRTA 3Q3KA 1IAUA 1ZTJA 4YOJA 1TRYA 1PJPA 3EGKH 1FNIA 1CHGA 5C1YA 2NU4E 3TGIE 1TPPA 1Y3YA 3EA9A 4WH6A 3KHVA 3ATIA 3PTNA 2W7SA 2OD3B 2ANYA 1KLJH 3BTQE 4GHQA 1AQ7A 3RXKA 1HPGA 3P17H 4WXIA 1FI8A 1C2DA 1Y5UT 2Y5HA 4UONA 5EJZA 2SNWA 2WINI 4ZHMU 1Z1IA 1MBQA 3AW1A 2KZ4A 4ABBA 4K1SA 3RXRA 2FOAA 3GYLB 1BIOA 1EFRD 2NWNA 4TYDA 1W0JD 4DW2U 3RXDA 2BVXH 1ANDA 3I78A 1RFNA 3ZZ8A 1QA7A 3RDZA 1TABE 2HRVA 4CHAB 4AFUA 1BMNH 4CBNA 3DUXH 1BJVA 3ZV9A 1XMNB 2GMTB 1HUTH 1NFWA 4TY6A 4ASHA 5LPFA 1KDQB 1ELBA 4LZ1H 4U30A 1C2LA 3N7EA 1P04A 4ZKSU 4MPVA 2Z3CA 1GMDG 2IJOB 1FPCH 3QWCH 3MU4A 1NBME 3SNEA 3LJOA 2Z9KA 2ZKSA 1EB2A 5FAHA 3UOUA 1PQ8A 4TSFD 5K7RA 2ZDVH 4FXGH 3F2HA 2QV1A 3UUZA 3LGVA 4YESB 4CRFA 1TFXA 1V2TT 2STAE 5GXPA 4I86A 1LDTT 2Z3EA 4BAQB 4AZ2B 1PPFE 3UTUH 5EXNA 1AFEH 1O2PA 1COWD 4IS5A 4INHA 1ID5H 1LHEH 3KQCA 2GCHG 1SFIA 4ESTE 1KTTB 4AGKA 2W7UA 1GWAA 2PTCE 3STIA 1GMDF 1ELVA 1PQ7A 4X6PA 1ZTLA 2A5KA 2ZHFH 4MVNA 3RXTA 4NCYA 3H09A 5KGOA 2ZFSA 2F9PA 2KCPA 4IW4E 2KCAA 3T2NA 1BBRE 2WPLS 1H8DH 5JBAS 3GYMA 1QZ8A 3V0XA 3VPKA 5FX6A 2Q6DA 3W95A 3TGKE 2LNCA 2L74A 3A85A 1ELDE 3BF6H 1TX8A 1YPGH 1D9IA 4GLYA 5T6GA 3VB4A 3GCHC 1IQJA 2YMSB 1GJDB 2BD4A 3QUMP 4X8SH 1UVUH 6LPRA 1V6DA 2OUAA 4B74A 1HYLA 1W8BH 3GY3A 4WXVA 4BAOB 4ZHLU 2PFEA 1MZAA 2GCHF 2FOHA 1J16A 4JZDH 1O3KA 1D4PB 1UO6A 2GV7A 2HOBA 2ZGHA 3PWBA 3EA7A 1EX3A 4U01A 3ATMA 1QCPA 1ZOMA 3AK5A 2PR3A 3A87A 4Y11E 3EQ0H 3GY8A 3SU2A 1YBWA 4GUXA 2HPQH 3A8BA 3SNAA 5CMXH 2GT8A 1E36B 1O2IA 2ZCHP 2FOEA 1C1RA 4JZ1A 2VVUA 3T25A 1C5SA 1YPMH 2GT7A 1XKAC 5J4SA 2W26A 1N1LA 1YWUA 2F9NA 2WPDD 3F9FA 5GCHG 3M36A 1IQMA 5ESTE 2R2MB 1A1RA 1C1MA 1F5KU 3LJJA 5EG4A 3OTPA 1MAXA 1O3IA 2O8LA 5PTPA 1EKBB 1BTWA 3PV2A 1YCPH 3B23B 4MLFB 3I29A 1ETSH 1L0ZA 2I6SA 3U9AH 1OX1A 1TAWA 2OINA 5EU8A 1EAXA 1WTGH 4ZUHA 5AHGH 4MNVA 5HIZA 1O3BA 2VH0A 2GX4A 2TGTA 3HATH 3F0PA 4F49A 4NSYA 5LPRA 4WVPE 1CE5A 1HIAB 1O5GH 2QA9E 3MU1A 1G2LA 2XC0A 3GS9A 3FVFB 3LH3A 4NIYA 3B8JA 3PMJA 3MI4A 3QTOH 1DM4B 3RXSA 4NG9H 1GJCB 5T6FA 1GHAG 5DO4H 1GVLA 2AMDA 1DX5M 2CF8H 1YPHC 2Z3DA 2J98B 1GHXH 1A4WH 1KXDA 2WPIS 4K69A 4M7GA 4ABIA 1WYKA 1G3EA 2VBCA 3UREA 1ZPBA 4R8TB 5FPYA 1YCPM 2G8TA 1DE7H 1C4Y2 1C5QA 1NPMA 3VGCB 1SLVB 1SL3A 1VITG 2ZWLH 4O97A 1TX7A 4JK5A 1TWXB 2JIZD 3NXPA 5E0JA 2G5NA 3FFGA 2DE8A 2FO9A 3F9EA 2BY7X 4E7RG 4YO9A 1C2IA 1GJ9B 3KYFA 2ALVA 1W12U 5E2PA 4WMEA 5EXMA 1EJMA 1GCTB 2Z9IA 1L1GA 2BX4A 2SGDE 1RIWB 1KIGH 3T62A 3GCNA 3PTBA 1EZUC 1GDUA 4SGBE 1JOUB 1LPKB 1MKXH 1GI0A 4A7IB 4X2XA 3RXMA 4MNWA 1K1JA 1P2KA 2XBWA 4K60A 2DUCA 2PHBA 4RSPA 4HI3A 3RUOA 1QB9A 4DCDA 2FM2A 1MCVA 1BRUP 1V2WT 2A32A 1WQVH 1C1QA 5T6DA 4HTCH 1J17T 3GDVA 5DSFA 2ZFPH 3HK3B 3LGYA 4LZ4B 1AU8A 1HAXB 2WPJS 3VB3A 1IHSH 1G32B 1E0FD 4FETA 1SQAA 4Y71A 5H4IB 3K6ZA 1P06A 1H9IE 1O3CA 1Q2WA 3SJIA 2PV9B 1TOCB 3F9GA 3BN9A 1O3FA 2KAIA 3S9BA 1BMLA 1CQQA 3SUGA 3C1KA 4MPXA 4AN7A 1GHZA 2CGAA 2ILNA 1K9OE 2A4QA 1Y5BT 1BQYA 1C5UA 1C9TA 3L3TA 3OEHD 3U28C 1GI8B 3H7TA 5AVDA 1BA8B 1GI4A 3CNRA 4FUDA 1Y3WA 3FANA 2Y7ZA 1CU1A 1OSSA 2FTMA 1C4U2 2BD7A 2BD3A 1NC6A 4U2WA 3RXCA 4GPGA 2ZFFH 1TGNA 1IOEA 1GG6C 1OWEA 3UOPA 4CREA 1CT4E 3VB6A 4IC6A 2R0KA 1FY5A 4K8YA 4X1RU 5E8EH 1AGJA 2RA3A 3EE0B 4NFEA 1QFKH 3IG6B 1YYY1 3RMNH 1C5WB 1KXAA 1QR3E 1MZDA 4MTBA 4HG6A 1IHTH 4DIHH 1GHYH 3KQBA 4UDWH 1E1QD 3T28A 3BTHE 1SLXB 3OSYA 3SGBE 2UWPA 3E0NB 5C0UA 1OP2A 2VVCA 4WF8A 2J5UA 5LGOA 1O38A 2HVXA 3M3TA 3DFJA 3Q3XA 5ABWA 3M35A 3LC5A 1GI3A 1GMCF 4F48B 2FI5E 1Q3XA 5DGJA 4HGCA 3ZVGA 3VFEA 2Y82A 3SV2H 2BDHA 5ETXA 4XBDA 4XRNA 2ULLA 3TH2H 2WV5A 4IMQA 2RDLA 4CHAC 1Z6EA 1EP6A 4K1EA 1DY8A 1HBTH 3QZQA 2QCYA 3SI3H 3OE7D 1MAYA 4GCHG 2Q6GA 3RMMH 4ISIH 1C5ZB 1K28D 2LP6A 4MPUA 2KCOA 2GDEH 3O8CA 1O2WA 3KQDA 2ZNKH 2BYAX 4RT0A 3ATKA 5HM9A 2W5EA 1EPTB 1K1PA 2GD4B 3BTFE 8ESTE 5A0AE 1XUKA 1UTKA 1KXFA 4MQAA 4HZHA 2V7QD 2P95A 2ZU5A 3E3TA 1DY9A 4ABDA 1HFDA 4FUFA 3RXIA 1O2MA 1HXEH 1KLTA 4ISHH 4FU8A 5T3HA 3DHKH 4MDSA 5DK1A 2FDAA 3FP6E 1TA6A 1GBBA 1DDJA 2GZ9A 5C94A 3TH4H 1UHBB 1L2EA 2IPHA 1WBGB 1WCZA 1OP0A 2J95A 2Q1JA 2V3HH 3MFJA 3U69H 1LHCH 4O3TA 3SI4H 3BTWE 2VU8E 1HRTH 1W7GH 3E90B 4IN1A 1RJXB 1QNJA 3E0PB 2BHGA 1O2VA 2ZU4A 3OAAD 2HNTC 1ABIH 1OXGA 2XCFA 3SQHE 4I33A 3TK9A 1QJ1B 3HPTB 1GJAB 4K8BA 7ESTE 2PUQH 1E34B 1ELTA 5KEDA 3GY5A 1AUTC 4YTAA 4FOUC 5F8TA 1AE8H 1GI5A 2F9BH 3BV9B 1NM6A 3D62A 3A7VA 4Q4LA 1IQKA 2YMSC 1K22H 4Q7XA 1W7XH 2BQ7B 3SV8A 1C1NA 5FPTA 4K2YA 1V2UT 2ANMH 1P12E 3UQOA 1GI7B 3A7WA 1K1NA 1N8OC 3A8DA 1L1NA 3P8OA 3B9FH 1C5TA 1QL9A 3EE7A 2FMJA 1XUIA 4WY3A 4H42U 3LKWA 4RKJB 3P70B 3ZZDA 3UR9A 3VXFH 1ELGA 1S82A 1TONA 2KM0A 1KTSB 1SKYE 1PPBH 1GI2A 2G4TA 4I8LA 4B2CA 5FCKA 3F0OA 1ZSKA 3Q76A 2FOFA 1XVMA 3M3VA 3P6ZB 1LHGH 1OYTH 2M2AA 1YM0A 2P59A 1NBMD 4I32A 3RC5A 1F0RA 3VB7A 4TY7A 4AB9A 2PLXA 1TLDA 1JBUH 2V3MA 2ASUB 1WSSH 3SU0A 3MWIU 2ZI2H 2D2DA 1O35A 3RXLA 3RP2A 2BXTH 5L2YH 3SO3A 2PKAA 4B75A 1GDNA 1WUNH 1D3DB 1SOTA 4YLQH 3SV6A 3ZYEA 5HKKD 1YP9A 1YPEH 3SGAE 2ZDAH 2CHAC 4H4FA 3SYJA 5HYOA 2AGEX 2FI4E 4AG2A 1MQ5A 1B7XB 4ZXXH 5GIBA 3TH3H 2AMPA 5DP7A 3A88A 1QHRB 2DE9A 3SORA 2PSXA 3RXOA 2GGVB 4K3JA 4I8KA 3SV7A 1ETRH 1XKBC 5TJXA 3GCTG 3VB5A
chains in the Genus database with same CATH topology
1QQUA 2BD9A 1MTUA 1FONA 2ZC9H 1P0SH 5ESBA 2OC8A 1GBHA 2Y81A 2PKSC 3ZV8A 2H5CA 3RM0H 4FUHA 5F8ZA 1F0SA 1OWKA 1HAGE 1XUHA 3TJUA 1ELAA 1P9UA 1TMBH 2BDBA 2VIDA 3W94A 2QXJA 1NY22 1ZJDA 3MNXA 1HAOH 1LQEA 1A5GH 4CRGA 2HLCA 1SGYE 4YT6H 1RIWC 1S84A 3AAUA 2SNVA 3GCTF 4A92A 2ZGCA 3S0NA 1PYTD 2K1QA 1HJ8A 1BTUA 3TVJB 4XE4A 3F68H 2ZPSA 4D9RA 1GBAA 3PV4A 3HGPA 1DT2A 1QL8A 2BOHB 8LPRA 1EOLA 1C5OH 4XFQA 4BTUB 3NWUA 1WV7H 1FV9A 1QB6A 3E16B 3M37A 3RU4T 2FOMB 4JK6A 1GJ6A 1QL7A 4AG1A 4D7FA 1NS3A 4QT8C 4AOQA 1TRNA 4Q80A 4NIXA 3P8NA 1EXFA 2XRCA 2J94A 1S5SA 2Z7FE 5J4QA 3UNRA 5F8XA 2ZG0H 1FAKH 3MNCA 4XSKU 1C2GA 3RC6A 2TGPZ 1C2KA 5EQRA 1MBMA 1Y3VA 4B73A 1AUJA 1F2SE 2VJ1A 1GDQA 2FOGA 3SZNA 4XBCA 1N6YA 3E8LA 3OY6U 4UE7H 1YPHE 4AFZA 1F0UA 2OQUA 3SJ8A 1S83A 1SQTA 4U32A 3OU0A 4FUIA 1AHTH 1N6XA 2ZU1A 4BTIB 4X6OA 1O2HA 1W0ZU 3QK1A 2YNBA 1GBKA 1J14A 3BEUA 5CHAC 4JYVH 3EYDA 1W3CA 1AVXA 2UWOA 2JH0D 1ZSJA 2QIQA 2VIQA 3SGQE 4IC5A 1NFYA 1SSXA 4ZMAH 3RXJA 3ATWA 1MKXK 1EAWA 2WPMS 1GI9B 1NRRH 9LPRA 4LOYH 1EOJA 1TPSA 2CJIA 2ANWA 2C93B 4GSOA 1TRMA 3SNDA 3BTGE 4A1TA 3UPEA 1MUEB 1ZZZA 3RU4E 4CRBA 1M9UA 3RXUA 3AAVA 4NA8A 4E7NA 1QRWA 3RXBA 2EC9H 2D1JA 4UFFH 4ISLA 2BMGB 4JCNA 1HAVA 2OQ5A 2AFQB 3PLBA 3CENA 3VEQB 3A7XA 2STBE 1TGBA 1V2MT 1C2JA 1SGFA 4AGJA 1TX6A 1PQAA 1O3DA 1D6WA 1PQ5A 2BD2A 2H9HA 2QGRA 4OGYA 2D8WA 3R3GB 3ZYDA 4TWWA 2EEKA 4CR9A 5JB8S 3P92A 2IN2A 4B2BA 2C8YB 2VB0A 2Z6BD 1ACBE 4NGAH 3LGUA 3RXEA 3UWJH 5CE1A 2PGQB 5E0HA 2KAIB 3ZVBA 1EPTC 2G51A 1MQ6A 2BTCE 5DP3A 2BY6X 3BSQA 1W11U 1C1UH 3OTJE 2AGIX 1AN1E 2TBSA 4BNRA 4AFQA 2BDGA 2GZ7A 1BBRK 2TGDA 5EPNA 4INKA 4JZFH 1N8OB 2ZCLP 1RS0A 2PW8H 3T26A 1MTVA 3V7TA 3Q00A 1RTKA 2V3OH 1HAPH 2QXGA 3SW2B 2GV6A 7GCHG 1O2JA 1P2IA 5HXFA 2NU2E 1L1JA 1DS2E 2PTNA 2JETC 3KCGH 1UTNA 2R9PA 1MTNC 4I31A 3O8DA 1G2MA 2F9OA 2O9QA 1CO7E 1ESAA 3Q77A 3TPIZ 5GJ4B 2G00A 1DPOA 2ODPA 2ZQ2A 5JPMH 3AVZA 1SGDE 2TIOA 3BTKE 2JH6D 2J34A 1HAIH 1H4WA 1EZXC 1T8MA 1QGFA 1C2FA 2B8OH 1P01A 1EATA 1C5NH 2XBYA 3AW0A 3T27A 7GCHF 5LH8A 2CHAB 1UK2A 1E35B 1O2RA 1LTOA 2OC1A 1EP5A 3PO1B 2BY9X 1MU8B 2V0BA 5LPEA 2W3KA 3H5CB 1YKTA 3GOVB 1P2OA 4X8VH 2CV3A 4J1YA 4UEHH 1BCUH 4TWYA 3Q3YA 4DG4A 1EZQA 1Z71A 1KXBA 1SGEE 3A82A 3QDZB 3GY4A 5C2ZA 1NROH 1LKAA 3ZVEA 4R0IA 2LPRA 2PKSB 1G36A 4D8NA 4DIIH 4I7YH 1FLEE 5A2MH 3RXVA 3UWIA 1ZLRA 3ENSB 1OWDA 4NWKA 2HNTF 1SHHB 4NFFA 2TGAA 2UUJB 1SPJA 1QRZA 3M5OA 2BY5X 1A5IA 2XC5A 1EZSC 2P3TB 1GMHG 1C2HA 2J9NA 2XYAA 2QY0B 3PM3A 1HNEE 2C90B 1TYNA 1C4V2 1HV7A 1RGQA 3WY8A 2H2ZA 1TQ0B 3PLKA 1TNGA 1E38B 1O3GA 1P57B 1CSOE 1VJ9U 3GY2A 3OY5U 1ETTH 2BDCA 1BT7A 1BB0B 1FQ3A 2GVFA 1T4UH 4Y8XA 1UCYE 2BXUH 4HFPB 4WWYA 3TLOA 1MKWH 3H7OA 2B0FA 3QGNB 4Q7ZA 3A7ZA 2ZDKA 1OYQA 2ZHQH 1GBIA 1CT2E 4CH2B 1SGRE 1OOKB 1VR1H 5GDSH 1GPZA 4AB8A 1GMHF 2G55A 4K5ZA 1MD7A 1SLWB 2ZCKP 1NTPA 5C1UA 3JZ2B 1Z8RA 1XUGA 3TK5A 1P10A 1DUEA 2UUKB 1NRPH 2YOLA 3BTTE 1MD8A 1QBNA 1O3AA 1O2GH 3GDUA 5HGGA 3I77A 4IGDA 1TE0A 2OTVA 5AF9H 2NU1E 2H1UA 3NCLA 2ZEBA 1BTHH 1C1VH 4BTTB 3CS7A 3KN2A 3FAOA 1OS8A 3FZDA 3KF2A 3CP7A 1GMCG 2OCVB 2QN5T 2FS9A 2H6MA 2P3FH 3TJVA 4GVUA 3V12A 5CHAB 4VGCB 3SU3A 3SUEA 3MOCA 4B76A 3QLPH 1KLIH 1YF4A 2FLBH 1YLDA 4KELA 1MU6B 2PKAB 1LPZB 1PYTC 3MYWA 1A0HB 1BTYA 2ZGJA 5IYTA 1TQ7B 2VWOA 1O2NA 4DT7B 3MH7A 1SQOA 1P2JA 3SUFA 1MH0A 1XUFA 4ZAEA 4I8JA 1PPEE 4DY7B 1P9SA 3SUDA 2A7HA 3ZVCA 1GL1A 2CXVA 1NU7B 1ZTKA 1TMTH 1SGIB 2EI7A 2VWLA 1TIOA 1O30A 1GBLA 2B9LA 5C20A 3NPSA 4A5TS 2J38A 1OWIA 1A5HA 1K1OA 1W2KH 4UD9H 4WH8A 3LGTA 3NUMA 1S85A 2XWBI 1V2NT 3U8RH 1V2RT 2F83A 1ZGVA 2BLOA 1NFUA 1SGQE 4UFGH 1HXFH 2BD8A 2BOKA 5A09A 1OKXA 4CRDA 4YT7H 2R3YA 3ATLA 4DURA 5GWZA 2NU0E 1SB1H 4UFEH 2ZPRA 1D6RA 1O3HA 1P2NA 2FESH 1P3CA 3URCA 4FU7A 1O3PB 4X0WU 1SHYA 1VJAU 1A61H 5GPIB 4XOJA 1UVSH 3UY9A 1K1LA 4NSVA 1LVBA 1QURH 3MU5A 3V13A 4OS7A 2FTLE 4BXSA 3U98H 4B71A 1JIRA 2UUYA 1DWBH 1AZ8A 3S69A 1S0QA 1C2EA 2ODQA 1ZGIA 1P09A 2OXSA 3NZIA 2A45B 3SBKA 2QYIA 3ZZ7A 2G81E 4FUEA 3QN7A 4MPWA 3ZZCA 2JETB 3RLWH 1MTNB 1F92A 3LGIA 4YZUA 1FMGA 1LVOA 2FPZA 2SGQE 1GHVH 2RCEA 4BAHB 3SJ9A 1FY3A 1ARBA 1O2KA 3RXPA 1SC8U 2A31A 4YOIA 1Z8GA 3PMHB 1L4ZA 1Q31A 2WPHS 3ESTA 5E2OA 4CRAA 1IQEA 1DANH 2EI6A 1D3QB 2BLVA 3KL6A 3SU1A 3LOXA 1SGNE 1GBFA 3F6UH 3LPRA 1TNIA 1O2UA 1WTHD 1QA0A 1GJ8B 3K6YA 3RXHA 1SFQB 3DA9B 5DPAA 3LIWA 1DSUA 2ODYB 4CR5A 1XXDA 4O9VA 4E06H 1GI6A 2OBOA 1O31A 4GAWA 2CN0H 5TCAA 3NK8A 1A0LA 2FX6A 4KGAA 3SJKA 2BQ6B 1GL0E 1GI1A 4ISOA 3A86A 1AFQC 3L33A 3V3MA 1UCYH 3URDA 3A8AA 2P94A 4KP0A 1ELFA 2XBVA 1C9PA 3TK6A 3JZ1B 4GHTA 5EXLA 2OBQA 1RRKA 2H9EH 1ESTA 3O8RA 2XWAA 1G3CA 1VZQH 2O8TA 3MH6A 5HM2A 1CVWH 2NU3E 4YLUA 2FOCA 5DKMA 1GBJA 2SGEE 1YLCA 1TGTA 2Z9GA 1T8NA 2A7JA 4XDEA 1EJNA 1BRAA 3EAJA 1H9HE 1O5EH 2FEQH 3KIDU 4X1SU 4DGJA 1BUIA 4JYUH 1ANCA 3LDXH 1GBTA 2VVVA 2BZAA 1OPHB 2FP7B 1HB0B 1C1SA 3RU4D 1HAVB 1AKSB 1AD8H 2ZFTA 3GY7A 3S7KB 1AWHB 1VGCB 1C5MD 2A1DB 4SGAE 3ZVAA 7KMEH 1IQNA 1C5PA 1C5RA 3RMOH 3ZZBA 3QGJA 1QJ6B 3PO1C 4WMDA 4Q7YA 1O2SA 4LXBH 1HLTH 2FXRA 3MU8A 2AGGX 2FYRA 4MG3A 1RTFB 5G4BA 2VIPA 4BOHA 3E6PH 2QC2A 5EQSA 4THNH 4TPIZ 4Y7AA 2SGAA 2G5VA 1H9LB 1OWJA 1UK3A 5FBIA 1W13U 2H5DA 1DVAH 2J4IA 4X1NU 2ZECA 4DJZB 6GCHF 3D23A 1NESE 4KKDA 1EJAA 3TGJE 1GJ5H 3PLPA 4WMFA 2C3SA 1TOMH 1BRCE 1W10U 1V3XA 1HAYB 2EA3A 1F5RA 2PGBB 1TA2A 1O2ZA 2R0LA 1ZPZA 1NRSH 1TMUH 1CGJE 1V2ST 5K0HA 1O3JA 2F9UA 2HWLB 1K21H 2QAAA 1S0RA 1HDTH 3LU9B 2ZFQH 3TJNA 2Z9LA 3MNSA 2QXIA 3P8FA 1LVMA 1DICA 5DP4A 1GJ7B 3GCOA 1YCPK 5EODA 4D76A 5FPSA 1CBWC 4X6MA 1GBDA 1A46H 2AIPA 1ZRKA 2VIWA 2PUXB 3U8OH 3TITA 1H1BA 1XX9A 2G52A 2ZDMA 1V2QT 1O2TA 1BMMH 1CA0C 3A81A 4CBOA 1AIXH 2P3UB 2ZGXH 3G01A 4Q2KA 3SU5A 1ESBA 4YM9A 3TU7H 2XCNA 2OC0A 5FCRA 1Z8IB 1TBRH 1P2QA 1J15A 5C67A 5DP8A 1BTZA 2XW9A 2ESTE 3LC3A 4ZKNU 2C8WB 3MH4A 2R3UA 4Y10E 1ZJKA 1KXEA 1TBQH 1ZR0A 1O34A 2SFAA 4X8UH 4ABFA 5F03A 1UJ1A 1HCGA 1FAXA 1QIXB 2BQWB 1TNHA 3FP7E 2A5IA 1FXYA 1AWFH 2BB4A 2Y80A 4RKOB 2SGPE 1TALA 1UTQA 1F7ZA 1CGHA 4JMYA 1FUJA 1IQHA 4VGCC 2AMQA 3LH1A 3C27B 1P2MA 1C5VA 4ZHAA 1RTLA 1PPHE 2VIVA 5DP5A 4AFSA 3ZZ5A 2BM2A 2FS8A 1BRBE 3MO3A 1AVWA 1MTSA 4INLA 3PMAB 1IQFA 3SOSA 5EGMA 1P02A 1FY8E 3OX7U 1JMOH 1SBWA 1ANBA 1W14U 3BTEE 2BDIA 1UTPA 4E05H 1BHXB 2BVSH 4BAKB 1O5BB 1XUJA 5I46H 4KTSA 1C5LH 2OLGA 4Z0KA 1AKSA 1MKWK 5B6OA 1DLKB 1GHBG 2G4UA 2ZO3H 4OS6A 3TNTA 5EPYA 1ZHMA 2H9TH 2FLRH 1O39A 4X2VA 3MNBA 1EUFA 5JYIA 1Y3UA 3GDSA 5JBCS 1O2OA 4IMZA 1EQ9A 2XTTB 3VXEH 2GKVE 1K2I1 3PB1E 4OS5A 2AS9A 2Y5FA 2ZU2A 1MTWA 1V2JT 3MH5A 1SVPA 2ZTXA 1B0FA 1RD3B 2IOTA 1SGPE 1IQLA 4X8TH 1SGTA 1ZMLA 5L6NH 5JBTA 1LMWB 4AORA 1XXFA 3TIUA 3F1SB 3F9HA 1W0YH 1BITA 1V2LT 1QTFA 3BIVH 2PWXA 3BG4B 1O36A 3A7TA 3AASA 3A83A 1AFQB 2ALPA 1GHBF 3MU0A 4ABHA 1ZRBA 1DLEA 1ZMJA 5EOKA 5HMAA 1UK4A 1GHWH 2FZZA 3D65E 2XXLA 1NT1A 3MO6A 1TPOA 4ISNA 2I6QA 1DWDH 1NN6A 4Y8YA 1AVGH 1LKBA 1SOZA 1UVTH 1HJ9A 2FOBA 2ZGBH 1DSTA 1FDPA 1AB9C 1BMAA 1O2LA 2FYQA 1EAUA 3GISB 1C2MA 2ZU3A 2VINA 1TNLA 4MNYA 3PMBB 1IQIA 1ELCA 1G3BA 2V35A 2ZDNA 1CGIE 1DITH 1QBOA 2BDYA 1TGSZ 3R0FA 2HGTH 2ZHWH 3M5NA 1FPHH 4UFDH 2XBXA 6ESTA 3A80A 2GP9B 1A0JA 1OP8A 3QO6A 2BD5A 1PPZA 1GVKB 2ZQ1A 2ZA5A 1A3EH 4D7GA 8KME2 1JRSA 1LVYA 1T4VH 3GICB 3M7QA 1FN8A 5C1XA 1O3NA 1O2YA 2A4OA 3S9CA 4B1TA 1YPKH 1S81A 2VNTA 3HGNA 4FUJA 1DXWA 4H6SB 3L6PA 1S6HA 2A4RA 4CH8B 2CMYA 2F9VA 1Z1JA 2QF0A 2Z94A 4Y7BA 3HKJB 5C5OA 1GCDA 1FY1A 1QB1A 4ZH8A 5GCHF 1PFXC 1BHXF 2OC7A 1GBCA 1PPCE 3A7YA 4FVBA 5C3NA 3E91A 1UVPA 5EW2H 1C1WH 4ZROA 1F5LA 3M7UA 2B7DH 1A2CH 5BPEA 3PYHA 4Y0ZE 2BVRH 1DXPA 1UTJA 1YGCH 4B2AA 3TNSA 2O8WA 1TPAE 1V2OT 2AERH 2Q6FA 4BAMB 3EA8A 4X1PU 1ORFA 2GCTC 4O3UA 5JBBS 1KDQA 5FXLA 3GY6A 2RA0A 1VGCC 1LCYA 1G37A 1C5XB 1GHAF 3SN8A 7LPRA 5EQQA 1O32A 3ZZAA 1CBWB 2P8OC 4DVAU 3SU6A 1U6QA 2HNTE 3SV9A 2A5AA 1HJAC 1ZHPA 3QTVH 2AIQA 3U1IB 3K9XB 3ZZ6A 3RXAA 1DFPA 2C8XB 1A7SA 3N7OA 4WJG2 1O5CB 1GBMA 1WAYB 2JH5D 1UTLM 1E37B 2W3IA 5A0BA 1CA0B 5L2ZH