3A7VA

Crystal structure of trypsin complexed with 3-formylbenzimidamide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7vA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7vA02
1SHHB 1O2JA 3O8RA 4JZDH 1UK4A 1HIAB 1K1MA 1TALA 3RXIA 3VEQB 3VXEH 6CHAB 3UQVA 2PKAB 4B71A 3EQ0H 1FY3A 1MZDA 2BD3A 3T5FH 1JRSA 2V6NA 4I8KA 2WPHS 1HFDA 1EZXC 4ZMAH 4NG9H 1GBEA 4HFPB 4CBOA 1AN1E 3P6ZB 4ZKOU 2GV7A 3BTFE 1AUJA 1UVPA 1V2ST 1O2TA 1H8IH 3BV9B 1C2GA 3M5NA 2F9VA 2BLVA 4Y8XA 1O3KA 3EA9A 3SU4A 2FM2A 4Q7ZA 1GBMA 1QJ7B 2FYRA 2TGDA 1P0SH 1FY4A 3M61U 4Y7BA 1C2EA 2SGDE 4M7GA 1NFXA 3VXFH 2BHGA 1PPGE 4ABHA 3GCTF 1YPHE 2QXGA 3CS7A 1YGCH 3KQDA 2V0BA 2ANWA 1YPJH 1RXPA 1QCPA 2HGTH 2QN5T 4X1SU 2ZTYA 1S81A 1W2KH 4FUBA 3F9FA 3OSYA 3SBKA 1DX5M 4WMFA 1OWHA 5CMXH 2ODQA 1D6RA 3Q76A 1T8MA 5C1YA 1C2JA 1SLXB 2B5TB 5F8ZA 4X1NU 1S5SA 3MFJA 5LH8A 1A0JA 2OXSA 2QXHA 1LPKB 3ZVGA 2XYAA 2SGFE 1FI8A 1TNKA 5DKMA 1C2LA 1CGHA 3TVJB 1JXPA 1LVYA 1QJ6B 1MZAA 1PYTD 3IG6B 2BVRH 4BAQB 3GOVB 3PTBA 2DE9A 3PM3A 2F9OA 1JBUH 3NCLA 4VGCC 4TYDA 3HKJB 1KXAA 1EAWA 1OOKB 1TAWA 1AE8H 9ESTA 1YCPM 1AVGH 1VITG 4OS2A 2AMPA 4YOGA 1O3CA 1MQ5A 1YKTA 1TMUH 3FFGA 4AFSA 1HJAC 3LIWA 1P06A 3SUEA 4U2WA 1A2CH 1UCYK 3ESTA 1K9OE 1DY8A 2FOFA 2AS9A 1J17T 1K2I1 4ZKNU 1TGTA 5TCAA 1P3EA 3OY6U 1IQMA 1A5GH 4D8NA 1JIMA 1C5WB 1GCTC 3ZV9A 3TK5A 1AD8H 3BF6H 1FXYA 5DP8A 1QIXB 1ELCA 5B6OA 4K1SA 5EOKA 1XUKA 1C2MA 4RN6A 1KYNA 1O36A 1XM1A 1FMGA 2IPHA 5GXPA 5T6GA 1GI2A 3N7OA 1JMOH 2XC5A 4LK4A 1RTLA 1AWHB 3BEFB 1MU8B 1AIXH 1C5TA 3ATMA 4INHA 3AW0A 1V2LT 1SPJA 2Z6BD 2BD4A 4GSOA 1TBZH 2VWLA 4PROA 4Y0YE 2HNTE 1PPFE 1TNLA 1O38A 1GJBB 1BHXF 1E36B 2RA3A 3E0PB 5HM2A 4K8YA 3LGVA 8GCHG 4WMEA 3KEEA 3MO3A 1AY6H 2G81E 1FNIA 1HV7A 1PQAA 1T8OA 3GDVA 1GVLA 3AASA 1THRH 4GUXA 4IC5A 1A61H 1GHBG 1QRZA 2Q6DA 1P9UA 1HAVA 3TNTA 4Y71A 1V2RT 1SGEE 4BANB 2H5DA 2GZ8A 3M36A 2VB0A 4INKA 4XBCA 1CU1A 1GMDF 2C4FH 1KLIH 5JBAS 4SGBE 3RXLA 2ZFTA 5BRRE 2ZHEH 1HAVB 1O3DA 2HALA 4NSVA 1FIZA 1GDQA 2A4GA 1B0EA 3R0FA 3U1IB 1DUEA 1ABJH 1UTKA 2Z9IA 1KTSB 2P95A 1DT2A 3Q3KA 2QIQA 5A8XA 2F91A 1ZJDA 3FP7E 3E16B 6LPRA 5FPTA 3RDZA 2ZP0H 1SG8B 1C1NA 3TJNA 1SGYE 1SGFG 1BTPA 4AOQA 3UTUH 2Z3EA 3KQCA 8KME2 2G55A 3T29A 1TPPA 1MBMA 1CA0C 1PPZA 1VGCC 1ZMNA 4H42U 3RP2A 3SHAH 3PV4A 2A4RA 3ZZ9A 3GCHC 3V3MA 4AYYB 1S6HA 4QT8C 2BQ7B 4JZIA 4JK6A 1C5PA 4X2XA 2FTMA 4MVNA 1BRUP 5A8YA 3EA7A 1NFUA 1QL9A 1O2LA 2BVXH 3MH4A 3STIA 2QXIA 3H5CB 3IWMA 2UWPA 1C1QA 1EZUC 2BM2A 2HWLB 2ZHQH 2ZPSA 4YLQH 1S0RA 2TIOA 1MBQA 1DDJA 3SUGA 3S9BA 1CT2E 1TBRH 4DG4A 3RXDA 2ZEBA 3RXUA 2H5CA 3UNSA 1ELVA 1GHXH 3SGAE 1O2MA 2ALPA 3PMAB 4KELA 1E38B 3TK9A 1OXGA 4ESTE 1NRRH 3M35A 5LGOA 1G3CA 5DP3A 1IQLA 1S85A 4GCHG 4GVUA 3T2NA 3SI4H 2Z9JA 4E7RG 1LKBA 3F1SB 1OP8A 1TGBA 3Q00A 2WPMS 4CBNA 1SGFA 3S0NA 2O8MA 3ZZ4A 1ELBA 2FOGA 2PSXA 1LPZB 4ISLA 2DUCA 2CHAC 1TNIA 1QB6A 2BD7A 1CT0E 1P3CA 4FVBA 1DLKB 1P2KA 3VB6A 5EQSA 2LNCA 3BTWE 4ABDA 1V2PT 3K6YA 1CGIE 1UMAH 3SU2A 3QLPH 1MAYA 2FOMB 2BDBA 1P2QA 1V2JT 1QBOA 2UUJB 3ATIA 3MNXA 4YOIA 1ZPZA 3T25A 4RSPA 1GI0A 3HKIB 1HJ8A 1A5HA 4CRFA 2ZTZA 1DITH 4MG3A 2ZF0H 2JETC 1H9HE 2UWLA 4CREA 4TY6A 1OKXA 2HNTC 5FBEA 1HAXB 4AN7A 1K1LA 1D9IA 4X6MA 1ETRH 3C27B 1YM0A 3TH4H 1C5YB 5FPYA 2BDAA 1LO6A 1QNJA 1IOEA 2G4UA 1F2SE 2FTLE 2ZTXA 2XBWA 2ZQ2A 3UUZA 4MLFB 2PHBA 1P04A 3AAUA 1W3CA 3A88A 2BY8X 3A7TA 4NIWA 4YOJA 5PTPA 1TOCB 1AU8A 3SU0A 4NZQA 1DICA 2ZHDA 3GDSA 2AGGX 3ENSB 3BTEE 4ZHLU 3B9FH 1XUGA 5EQRA 2TGAA 1NFWA 4JMYA 5I46H 1GCDA 1J16A 1QB1A 3RXKA 3UOUA 2ZDMA 1AB9B 3RC5A 1XUJA 4ISHH 1A7SA 2SFAA 2BX3A 1YYY1 3IITA 1UTLM 1SVPA 1ESTA 5AFZH 5DJ7A 1XVMA 1BTZA 1UCYE 1GBCA 1FAKH 3UR6A 1QJ1B 3ZZAA 1O5CB 4DY7B 1C1TA 1GHZA 1IQKA 1O2KA 3SJOA 1ETTH 1BMAA 8ESTE 1QL7A 2VU8E 1F0SA 4X8VH 2VWMA 3RMOH 1HAZB 3RM0H 4MNXA 1RRKA 3AW1A 4CHAC 2STBE 2WYGA 2ZWLH 1SBWA 4FU7A 2BY9X 1HAOH 3LH3A 4A7IB 3PO1C 3LC5A 1QBVH 3A81A 1XXFA 1LTOA 4INLA 2OC0A 3GY8A 1A0LA 1C4U2 3P8FA 3HK3B 4BTTB 5DP4A 3TJUA 3M3TA 5C5NA 2ZA5A 3MMGA 3GY2A 3Q3YA 2HNTF 2VGCB 1ETSH 3ZZ3A 2FMJA 4CR5A 2A2QH 1MKWK 4MDSA 1HNEE 1QURH 1TPSA 5G4BA 3LGWA 4F4OC 1SGCA 2A4OA 1SOTA 2G5VA 1GJCB 3NK8A 1W8BH 3BTGE 3RXVA 1N8OB 2ZZUH 3GDUA 3D62A 1YLDA 1Q31A 1V2UT 2ZI2H 3A85A 3RXRA 1FZZA 1LHGH 1W12U 3DA9B 1C1MA 1JIRA 5GJ4B 2Z7FE 1OPHB 1O35A 2C8ZB 2OBQA 4YO9A 1QTFA 4IBLH 5GCHG 2FWWA 4K5ZA 2FIRH 3T28A 1DWCH 1ZOMA 2GX4A 3A80A 4Y0ZE 1GGDB 1MTUA 1QRWA 1UVSH 1GJ7B 1RD3B 8LPRA 1O2GH 2GVFA 1IAUA 1TRYA 1NPMA 2XBYA 3U69H 1UVOA 2OC8A 3DHKH 2F9UA 3OX7U 3VGCC 4O3TA 5CHAB 2ZFPH 3QK1A 3P8NA 1LHDH 2GCHG 5IDKA 1P10A 1SGPE 5A0CA 3QO6A 1IHSH 1HB0B 1OP0A 5EPNA 1B0FA 1T8NA 2FOEA 1P05A 3ZZCA 3E1XB 2R0KA 4X6NA 5J4SA 5TJXA 1ZLRA 3T26A 2VJ1A 1EKBB 3BTME 2FODA 2QXJA 1V2VT 2PUQH 2G5NA 1IQHA 2PWXA 4X8SH 5LPEA 1N6XA 2H1UA 2FP7B 2JKHA 1ZZZA 2WV4A 2ZU1A 1SLUB 1C1WH 1GL0E 4WJG2 1MTNC 4JK5A 1O3FA 3LDXH 2ZU4A 5GDSH 3QGNB 2ZFRH 3E6PH 9LPRA 2PFEA 1O2ZA 5C1XA 2H9EH 1Y3UA 1O3PB 2XBXA 3GY7A 1O2UA 5JB9S 4HZHA 3RM2H 3PTNA 1O5AB 3V13A 2D26C 2ZKSA 3VB7A 4K3JA 1Z1JA 1SI5H 1GHWH 2QY0B 3RU4D 2FLBH 5K7RA 4TWWA 1UVTH 1AMHA 1O33A 1AFEH 4Y7AA 2KAIA 1YPMH 1K22H 1WQSA 2ZU3A 3SV9A 4Y76A 3GYMA 2BZAA 4YESB 5JBTA 4KP0A 1C1OA 1M9UA 2XTTB 1CBWC 1GBFA 2BY6X 2Y82A 2PKAA 4WY3A 3P8OA 1TGNA 2BDYA 1C5SA 3CENA 1C5VA 2KAIB 3M5LA 1O5BB 2FZZA 5L6NH 5E0HA 3HPTB 3W94A 2RG3A 4B73A 1FPCH 5AF9H 2NU1E 1ACBE 3EGKH 3NXPA 2B7DH 4J2YB 1EQ9A 4MPWA 5E2PA 3TNSA 5IYTA 1CHOF 3SQHE 1GG6C 2VIPA 4MNYA 2XC4A 3A8CA 1NC6A 2GGVB 4NIYA 1QL8A 4JYVH 5T3HA 3S7KB 5L30H 3KF2A 3S69A 3LJOA 1KXBA 2EI7A 4X2WA 5JBBS 1V2MT 3SGQE 1EOJA 2WYJA 1IQEA 4BNRA 1V2QT 5EXNA 5EW2H 3GYLB 1TPOA 3ITIA 4Q2KA 3SNAA 5FXLA 1BIOA 4DT7B 5K0HA 1L0ZA 1O32A 2WPIS 1QFKH 1XXDA 1C2HA 2P94A 4U32A 6GCHF 1HCGA 2GCTB 1JOUB 1Y3YA 2OLGA 1TONA 4ABEA 5DP9A 1KXCA 4D9RA 3GCTG 1NM6A 1C5MD 3VB3A 3MU4A 3RMNH 2UWOA 2VWNA 2OBOA 2G52A 2VH0A 2ZHWH 3FP6E 2D1JA 3HK6B 1ANEA 1O2IA 1SLWB 2Z3CA 3TIUA 1FY5A 4WXVA 1C5ZB 1MUEB 1GJAB 1QR3E 1MKXH 1BOQA 4WH6A 3UWJH 1O3AA 1SR5C 2BVSH 3SZNA 1GBTA 2FOHA 2PTCE 2XCFA 3UFAA 1AWFH 1B5GH 1S83A 2NU4E 2R0LA 4YLUA 1BTHH 1W14U 1EAIA 1LPGB 2FO9A 4X6OA 4MPUA 1P2OA 1TA6A 2CJIA 3QTVH 5F8XA 4MPVA 3B8JA 3ZVCA 1BB0B 2BLWA 2O8WA 3BTKE 4OGXA 4LZ1H 1ZSLA 1VITF 5JDUB 1RIWC 1EUFA 4BAOB 1F92A 2GT7A 4DGJA 3TGIE 4I8LA 2A31A 1RFNA 5EW1H 1HUTH 1T8LA 2I6QA 2SGEE 1BA8B 1BDAA 3ZZ6A 1OSSA 2I6SA 4DJZB 4I33A 3FP8E 1GMCF 1ELFA 1ZJKA 1D3PB 1TGSZ 1BRBE 2G00A 2B0FA 3P92A 4JYUH 5A0BA 4J1YA 1IQIA 1SFQB 2EI6A 1HXEH 2VIQA 3RXBA 1QHRB 4UE7H 1SB1H 1V2WT 4O3UA 4ZXXH 1J14A 2O8TA 3PYHA 2FDAA 1LVMA 3ZV8A 1C4Y2 3DFLA 2FPZA 4NA9H 2ZHFH 4XSKU 4IGDA 1T7CA 1TX8A 5H4IB 1AVWA 1GHAF 1YCPK 3ZVAA 1E35B 1W7GH 4MTBA 1SGRE 3UOPA 1C5XB 3LOXA 1A46H 1A5IA 4UFGH 1INCA 1D4PB 1P2NA 1BUIA 4ZAEA 3SNEA 1NRNH 4XE4A 4CH8B 1MTVA 3C1KA 3SV2H 3K2UA 2GMTC 2Z9LA 1ZMJA 1WUNH 1DSTA 4THNH 1NO9H 2PR3A 1H9LB 3MU1A 1Z6JH 4O03A 3SORA 2Y5GA 5F8TA 3LU9B 2H2ZA 1O2RA 4X8UH 2HRVA 2ZDKA 1BITA 1LHCH 2P3TB 2AERH 1H9IE 4NGAH 1Z8GA 1ZHPA 4DCDA 1NROH 3KGPA 3BTHE 1TFXA 2P8OC 1DFPA 1HXFH 2QGRA 4Y11E 5FCRA 3M7QA 3B23B 2PKSC 4NCYA 5EPYA 3A89A 3PMHB 1AGJA 1EAUA 5AFYH 5ETXA 2R3YA 1XUFA 3MU5A 1P01A 1PFXC 2BDGA 1AFQB 4Z0KA 3SV6A 2A5KA 3I29A 1UTMA 5JBCS 1S0QA 2YNBA 1TYNA 2FXRA 3U8TH 4NFFA 3F9EA 4FU9A 1GHVH 2Q6FA 3EDXB 4ISIH 3U9AH 2QF0A 5F6MA 1V2KT 3LONA 1P2JA 3CS0A 1DS2E 1YPHC 2OD3B 1H1BA 2ODPA 5GIBA 3TPIZ 3PMBB 2XWAA 2ZQ1A 1J9CH 1O37A 1Y3VA 1GBLA 3SU3A 4AB8A 1O0DH 4DIIH 1MCTA 4GAWA 1P03A 2TGTA 4AFQA 1U6QA 1YF4A 1LHEH 4NIVA 2BD5A 2P3UB 1KSNA 3LGIA 1GJDB 7KMEH 4NSYA 1SQTA 1F7ZA 3NZIA 1OYQA 4R8TB 1G9IE 1XX9A 4KGAA 4IC6A 3D65E 3RXSA 1O31A 2WINI 3GICB 1O2XA 1BCUH 4ISNA 1ZMLA 3A7ZA 4A6LA 4AG2A 1DANH 3OYPA 3SU5A 2W3IA 4B76A 1OS8A 2VVCA 3D49H 1ELEE 3UWIA 1GI5A 1QRXA 1OP2A 3UY9A 3OTJE 4Y10E 2TBSA 4IN2A 2BLOA 1GJ8B 1QA0A 4NWKA 1Z8RA 3VB4A 1NT1A 1F0UA 3BTQE 2CGAA 4VGCB 4AYVB 1DPOA 1S84A 3M7UA 1C1UH 4CH2B 4BTIB 1TNGA 1EOLA 4MQAA 3SJ9A 1HJAB 2YOLA 5CHAC 4GHQA 2GZ9A 1YLCA 4FVDA 1XUIA 1EJMA 2ZCKP 1UCYH 3RUOA 3A8BA 1QBNA 4YM9A 1O5DH 4NFEA 4U30A 4YT7H 1DVAH 3RU4T 3ZVBA 1O5FH 1EPTC 2GP9B 1VITH 2J2UA 1GCTB 1GMHF 2THFB 1MCVA 2R2WU 2PTNA 1L1JA 2OUAA 5LPRA 3NPSA 3HGPA 2V3HH 5DPAA 4DVAU 1G32B 1MTWA 1YPKH 2R3UA 3SN8A 1AZ8A 3RXHA 1N1LA 2ZDLA 4K69A 4OS7A 4I31A 1P09A 1QQ4A 3V7TA 4B2BA 1QA7A 1VCWA 3BG4B 4Y6DA 1P11E 3JZ1B 3UPEA 1SGNE 1BBRK 4LZ4B 1EB1H 1BJUA 3MU8A 2G51A 4JZFH 1O2VA 2BXUH 4LXBH 3A87A 2Z9KA 1SGIB 2ZGCA 5T6FA 1QY6A 2BD2A 3MU0A 4IW4E 3MH5A 2D8WA 1YBWA 4I8HA 4I7YH 2PW8H 5DGJA 1GDUA 4Q7YA 3SJKA 1F0TA 2BTCE 3RXFA 1D6WA 1GI1A 2HPPH 1TB6H 3UQOA 1TMTH 2BOKA 1QGFA 5CE1A 4O97A 1DOJA 1MQ6A 2RCEA 1MD8A 1OYTH 2Y80A 2O8LA 3ZZBA 3BIUH 1S82A 3ZZDA 4FUHA 4UDWH 4WMDA 1SC8U 4BAKB 1GBIA 2GZ7A 1HAPH 1C9PA 2STAE 1J8AA 3ZVEA 1DXWA 1E0FD 2Y5HA 1V2OT 1MMJN 1HLTH 1YPEH 1P8VC 2QA9E 1C5RA 1WQVH 6CHAC 1DY9A 1FY1A 2EI8A 1ZR0A 1YC0A 4K60A 3MH6A 1IQNA 1KDQA 1GBDA 1E34B 3SUFA 1PJPA 4FUIA 3H7OA 1HGTH 3E0NB 2BYAX 5A09A 4UFEH 1BJVA 5BPEA 5L2YH 1CA0B 1VGCB 2TGPZ 3GY4A 3SNDA 1SMFE 3U8OH 3PLPA 1KDQB 4DIHH 1ABIH 1DXPA 1O3EA 1SL3A 1NFYA 2IN2A 3PLKA 3GCHB 3M7TA 4FXGH 4NWLA 1H4WA 1AKSB 1C5LH 2VIDA 2PSYA 1W10U 3T62A 3A82A 4Y8YA 1ZRKA 3DFJA 2A5AA 1YP9A 3E90B 1GI4A 2BY5X 1SFIA 3TJVA 4A1TA 2OCVB 1EX3A 2Z9GA 1HPGA 1HBTH 3LGTA 2FS9A 1YPGH 4GLYA 2QAAA 5GCHF 1K1PA 1T32A 1BTUA 1O3JA 2FI4E 1TRNA 1EASA 1SSXA 2OC1A 1X7AC 1SOZA 2O9QA 2ANYA 4JZEH 4X2YA 5LPFA 1Z8IB 3RMMH 1TGCA 2QYIA 1TNHA 2C8XB 4ZKRU 2J9NA 2J92A 4IMZA 1OX1A 3Q3XA 1RTFB 1ELAA 1WV7H 3ZZ8A 1Z7KA 7GCHG 1C1SA 2FI3E 2CHAB 1VJAU 3SNBA 3S7HB 1LMWB 3S9CA 3NWUA 3DD2H 2NU0E 3MO6A 1GHYH 4ISOA 5HMAA 4TPIZ 3M3VA 4B75A 4OS1A 3QGJA 2BD8A 1LDTT 3ZYDA 1S6FA 1A1RA 1C5UA 1TX7A 4U01A 4ZROA 2ZO3H 3TITA 1KXFA 1W0YH 3RXCA 5E0GA 1Y3WA 1OWKA 1GBKA 3VPKA 4XBBA 2W5EA 4XBDA 1PQ7A 4JZ1A 1LKAA 1Q2WA 2A32A 1EJAA 2CF8H 5F03A 2Z3DA 1SQAA 2XCNA 3QX5H 4UD9H 2D2DA 1LHFH 2GKVE 2JETB 1L1GA 4I8JA 2OQUA 1GJ4H 1PQ5A 1QQUA 3ODDA 2XW9A 4FUEA 1GBHA 2A5IA 1SLVB 2H9HA 1PPBH 1OWDA 2W26A 5A0AE 1BQYA 3K65B 2V35A 3P95A 3F9GA 3HGNA 3A8DA 5SGAE 1EP5A 3TH2H 3SOSA 1TBQH 5C1UA 3F6UH 3P17H 3HATH 5EQQA 1AVXA 4MNVA 1VJ9U 1RTKA 4JCNA 3OY5U 5EGMA 1ZTKA 2OTVA 1BT7A 3SU6A 3SUDA 1AHTH 3BTTE 4B74A 3LH1A 3QUMP 1WSSH 2PUXB 2C8WB 1IQGA 3TJOA 4OGYA 1FV9A 4TWYA 1D3DB 4FU8A 1K1JA 7LPRA 2UUFB 3L3TA 1ZTLA 4TY7A 4NIXA 1G3DA 5FPSA 3RXAA 3ZVFA 2ZGHA 1CT4E 5DP6A 1D3QB 1A3EH 1NZQH 4ABBA 2BXTH 4JYTA 1DM4B 1EATA 4I8GA 5HGGA 2WUBA 2JH0D 1O2PA 5EXMA 2ANKH 5L2ZH 1BMNH 4I32A 4HGCA 4WH8A 2VVUA 2UUYA 2BLQA 3LJJA 4XDEA 2W7SA 3QWCH 5C20A 4CHAB 3KIDU 1CHOG 5FBIA 4H6TA 2G8TA 3PO1B 3LGUA 3P8GA 1FAXA 3RXEA 1E37B 1CSOE 4MNWA 2AIQA 1Y5AT 2P3FH 1OWIA 4ABFA 1F5KU 3WY8A 4CRDA 1AE5A 1ARBA 1GJ6A 1BBRE 4AG1A 4B1TA 1FONA 1FPHH 1NU9A 2R2MB 2TPIZ 1C2FA 1MKWH 2AMDA 2VIVA 2ZFFH 3V0XA 5I25A 4K1EA 1P9SA 1BTWA 1TLDA 2CV3A 1ZGIA 2ZNKH 3OU0A 4IN1A 1SGDE 6GCHG 3MYWA 5E0JA 1CVWH 2ZGBH 1K21H 2GDDA 2GV6A 6ESTA 1RJXB 2FLRH 3M3SA 2O8UA 4RKOB 2CMYA 1PPCE 1DLEA 1N6YA 4FUDA 1SQOA 1GI8B 1NRSH 2Q6GA 1HAGE 2EEKA 1UHBA 4A92A 5ABWA 2FEQH 3MWIU 3VB5A 1CQQA 2P16A 4B2AA 2ALVA 3SI3H 5DG6A 1BZXE 1O2YA 1P2IA 1L2EA 1NTPA 3STJA 3O8BA 1AO5A 1Y3XA 1GVKB 3T27A 1FIWA 1TWXB 1UHBB 1O2SA 5ESBA 2AH4X 1TPAE 1HAIH 4X8TH 2A7CA 2XC0A 2ZU2A 3W95A 2WPLS 3F9HA 3GCOA 2ZGJA 3VGCB 2A4QA 3SJIA 1GVZA 2UUKB 2BOHB 1AQ7A 1WBGB 2SGQE 1O34A 3GISB 3FZZA 3U98H 2ZGXH 1HRTH 1BTXA 3M5MA 4ABJA 1EP6A 2VWOA 1V6DA 1JWTA 4CRCA 1GMCG 1DWBH 1ORFA 4K1TA 2VIWA 5A2MH 2ZFQH 3AVZA 4AFUA 1A0HB 1IQJA 1O3IA 1TA2A 7ESTE 1K28D 2FS8A 2ZU5A 2FOBA 2G4TA 2BZ6H 3E3TA 3PWCA 3JZ2B 3SO3A 1MTNB 2OINA 2QV1A 2F3CE 1O2WA 1O3GA 2VINA 2QC2A 4FUFA 5JPMH 2SGAA 2B8OH 1K1NA 8GCHF 3BG4C 1V2TT 3PMJA 4UFDH 1GHAG 1P02A 2LPRA 1ARCA 2ZPQA 1DE7H 1LQDB 2Y7XA 4AFZA 2CN0H 1C2KA 3SNCA 3LGYA 1O2QA 1GHBF 4BXSA 4AGKA 4A1XA 5J4QA 3KNXA 2Z94A 2QF3A 1GBJA 4BOHA 3ZZ5A 5C2ZA 1O3MA 1W11U 4D7GA 3NKKA 5DP5A 1O30A 4BAMB 1UTJA 2FX4A 1C1VH 1Z1IA 2AEIH 1XVOA 1G30B 5FHTA 1GMDG 1AB9C 3A7WA 3RMLH 3SGBE 2DE8A 2WUCA 2XRCA 2H9TH 4X1RU 1MTSA 1DSUA 3M37A 4O9VA 4AGJA 1CBWB 3KCGH 1HYLA 4WF8A 4NZLA 4D76A 3R3GB 1RS0A 1PPEE 2EA3A 2GD4B 1EAXA 4ZHAA 4NA7A 3URCA 2SNVA 3QN7A 1J15A 2SGPE 2K1QA 3LT3A 1G3BA 3QDZB 5FX5A 3E91A 1GG6B 2EC9H 3A84A 3ATLA 3RU4E 4E05H 5C3NA 2ODYB 1SGTA 2FX6A 1WTGH 2PV9B 1TMBH 2Y6TA 1WCZA 4Y79A 1LVBA 1LQEA 3RC4A 5C67A 3A7XA 3SV8A 4ZXYH 3SW2B 3RXOA 1TX6A 1XKBC 5FAHA 4YZUA 2VGCC 3K9XB 1ZRBA 1G2MA 2PLXA 2W3KA 1NU7B 1VCQA 3AAVA 3BSQA 1P12E 1ZYOA 3E8LA 1PQ8A 1DUAA 3LPRA 5DK1A 4CRAA 3CP7A 4BTUB 1N8OC 2HVXA 1O3OA 1BHXB 1GBBA 4ASHA 2XWBI 4AX9H 1KIGH 2XBVA 3GY3A 1XUHA 3I77A 3QTOH 1K1OA 1Y5BT 2OC7A 3SJ8A 4ZHMU 2VIOA 3RXQA 3TLOA 1GJ9B 1DWEH 1UVUH 1ESBA 3ATKA 2VVVA 4OS5A 3F68H 2ZCLP 1C2DA 4HI3A 1IQFA 2GDEH 4GCHF 3A7YA 4YT6H 5FX6A 4X0WU 3TGJE 3TGKE 2HOBA 1GGDC 4RKJB 1MD7A 1GL1A 1T31A 3M5OA 4Q80A 5JYIA 1C1PA 5E2OA 3Q77A 3PWBA 1JRTA 3RXTA 2IOTA 2F9BH 4TPYA 3LC3A 1RIWB 3ZVDA 2C93B 1EXFA 3EYDA 2ZPRA 4ZKSU 3NUMA 1Y59T 2TRMA 1MH0A 1TNJA 2M5TA 2IJOB 1F5RA 2SNWA 1W7XH 1O2HA 1O5EH 3MO9A 4LOYH 1KLJH 4ZH8A 2RDLA 3DUXH 3PROA 4CRBA 1TQ7B 1SGQE 1WOFA 2FESH 1ID5H 1UTPA 2ZIQH 1ESAA 2C90B 1FDPA 1FN6A 2WPJS 3D23A 5TCCA 4ABGA 1BMLA 1UTNA 2BY7X 4KKDA 1ELDE 4B2CA 4ABIA 4Z6AH 1ZSJA 1HAHH 1KXDA 1C5NH 1AUTC 1ZHRA 2FOAA 1V2NT 1KTTB 1GMHG 2J38A 1TRMA 2J95A 2ZFSA 1F5LA 3I78A 1O3HA 1GJ5H 1PPHE 2C8YB 1C1RA 2H6MA 1UTQA 4DOQA 3URDA 2FI5E 1C4V2 1UO6A 2NU3E 1THPB 1YCPH 2HPQH 2F83A 4AZ2B 2Y5FA 3MNBA 4X6PA 4KTSA 3VFEA 1KLTA 1Z8JB 2F9PA 1WYKA 3K6ZA 1BMMH 4XFQA 5HYOA 1O39A 2BD9A 1Z71A 3PB1E 3G01A 2GMTB 2RA0A 3PLBA 5T6DA 4OS4A 2AGIX 2OP9A 2W7UA 1RGQA 1CGJE 1EB2A 1UK2A 3SU1A 1O2OA 5A8ZA 4MPXA 1LCYA 4WXIA 1EZQA 2BQWB 1V3XA 2F9NA 3FVFB 2Y7ZA 4K8BA 1ZPBA 3KHVA 2B9LA 4H6SB 3RLWH 3FANA 2A2XH 1XMNB 1FJSA 3RLYH 2PGQB 1MU6B 2BDCA 4KTUA 1Q3XA 2BX4A 3UNRA 1C2IA 1GDNA 4CRGA 1O3LA 2P8OB 2GTBA 3EA8A 2JH6D 3BN9A 4WVPE 5DP7A 3BIVH 3L33A 2PKSB 2ZC9H 3DT0H 1O5GH 4Y8ZA 2P59A 5EODA 4GHTA 1CHGA 4F49A 4DURA 2HLCA 2ULLA 1VZQH 3KQBA 3MI4A 3FZDA 3ZYEA 2ZDAH 1WAYB 4ABAA 5E8EH 1AKSA 1ANBA 4BAHB 1FQ3A 1GI3A 3MOCA 2OQ5A 4FUCA 4CR9A 3L6PA 3KQEA 2J34A 4NA8A 2FYQA 1BRCE 1UJ1A 2QCYA 2ZG0H 3U1JB 1W0ZU 2Q1JA 4OS6A 2A7HA 5HM9A 4DW2U 3BG8A 1FN8A 1IHTH 4Q7XA 3V12A 3RC6A 3RXJA 2VH6A 1LVOA 3S9AA 3UREA 2GCTC 4XOJA 1WTHD 2FOCA 1TIOA 1UK3A 5HXFA 3KN2A 1CO7E 4AB9A 4E7NA 3A86A 2JH5D 3UNQA 1D3TB 3GY5A 3P70B 1CE5A 1ZHMA 4X2VA 1YPLH 1OWJA 4UFFH 4A1VA 1MKXK 4FUGA 1GBAA 1GPZA 1BRAA 2CF9H 2CXVA 3FAOA 1ELGA 1G36A 3RXMA 2ZDVH 5AHGH 5C5OA 3GCNA 1ZPCA 2AFQB 1GWAA 2WV5A 4X1PU 3ODFA 1TQ0B 1L4ZA 2NWNA 5AVDA 4IMQA 1C9TA 2ANMH 1ANCA 3MHWU 3TH3H 3MH7A 5EG4A 1ZSKA 1EZSC 1B7XB 1NRQH 3A8AA 1THSH 2XNIA 1FLEE 2J94A 2R9PA 1T4UH 1ZGVA 2BDIA 5ESTE 3RXGA 3RXPA 2GCHF 2A45B 7GCHF 1FUJA 2PGBB 5EXLA 4YTAA 2VNTA 4D9QA 1EJNA 3GY6A 1OWEA 1EPTA 1H8DH 1O2NA 2XXLA 4R0IA 1A4WH 3SV7A 3ELAH 1VCPA 1NESE 1FY8E 1HJ9A 1K1IA 1PYTC 2ASUB 3QZRA 3LKWA 2AIPA 1NRPH 2A7JA 2ZDNA 1CA8B 3BEIB 2GT8A 1SHYA 1ELTA 1EPTB 2C3SA 1KY9A 1VR1H 1AZZA 1Y5UT 1DWDH 4UEHH 1P57B 4FUJA 4D7FA 4GPGA 2Y81A 4A5TS 3TK6A 2AMQA 4HTCH 1HAYB 3EE0B 1C5OH 1GI7B 1L1NA 2A1DB 5EU8A 3QZQA 1Z6EA 1MAXA 2J4IA 4WWYA 4SGAE 1UTOA 3U8RH 2BB4A 4X1QU 5GPIB 1A3BH 1W13U 2NU2E 1NS3A 2ZECA 4ZUHA 5DO4H 2AYWA 1NN6A 1NY22 4AORA 1ZTJA 1Y8TA 2BMGB 1BBRH 3UR9A 2AGEX 3MTYA 2WPKS 1O3NA 1HDTH 1G3EA 2A0QB 3KL6A 4K2YA 1T4VH 2YNAA 1L4DA 1O3BA 2ILNA 1XKAC 2BQ6B 3O8DA 3BTDE 3BEUA 1ANDA 1F0RA 1TABE 2V3OH 1GI9B 1G2LA 1BTYA 3H7TA 4E06H 3EAJA 1C5QA 1QB9A 1GI6A 5FCKA 3SQEE 3ATWA 3TU7H 3SHCH 1KXEA 1P2MA 3MNSA 4KTCA 5JB8S 2ZCHP 4BXWA 3MNCA 4IS5A 5GWZA 1G37A 1HIAA 3O8CA 1TE0A 2P93A 1AI8H 3UIRA 2ESTE 2BDHA 4UONA 1WU1A 3A83A 3ZZ7A 4H4FA 1TOMH 3A7VA 1AFQC
chains in the Genus database with same CATH superfamily
1SHHB 1O2JA 3O8RA 4JZDH 1UK4A 1HIAB 5DSFA 1K1MA 1TALA 3RXIA 3VEQB 3VXEH 6CHAB 3UQVA 2PKAB 4B71A 3EQ0H 1FY3A 1MZDA 2BD3A 3T5FH 1JRSA 2V6NA 4I8KA 2WPHS 1HFDA 3DSOA 1EZXC 4ZMAH 4NG9H 1GBEA 4HFPB 4CBOA 1AN1E 3P6ZB 4ZKOU 2GV7A 3BTFE 1AUJA 1UVPA 1V2ST 1O2TA 1H8IH 3BV9B 1C2GA 3M5NA 2F9VA 2BLVA 4Y8XA 2QF4A 1O3KA 3EA9A 3SU4A 2FM2A 4Q7ZA 1GBMA 1QJ7B 2FYRA 2TGDA 1P0SH 1FY4A 3M61U 4Y7BA 1C2EA 2SGDE 4HG6A 4M7GA 3WWBA 1NFXA 3VXFH 2BHGA 1PPGE 4ABHA 3GCTF 1YPHE 2QXGA 3CS7A 1YGCH 3KQDA 2V0BA 2ANWA 2VBCA 1YPJH 1RXPA 1QCPA 2HGTH 2QN5T 4X1SU 2ZTYA 1S81A 1W2KH 4FUBA 3F9FA 3OSYA 3SBKA 1DX5M 4WMFA 1OWHA 5CMXH 2ODQA 1D6RA 3Q76A 1T8MA 5C1YA 1C2JA 1SLXB 2B5TB 5F8ZA 4X1NU 1S5SA 3MFJA 5LH8A 1A0JA 2OXSA 2QXHA 1LPKB 3ZVGA 2XYAA 2SGFE 1FI8A 1TNKA 5DKMA 1UW7A 1C2LA 1CGHA 3FOAA 1JXPA 1LVYA 1QJ6B 1MZAA 1VKYA 3TVJB 1PYTD 3IG6B 3OFND 2BVRH 4BAQB 3GOVB 3PTBA 2DE9A 3PM3A 2F9OA 1JBUH 3NCLA 5CHBA 4VGCC 4TYDA 3HKJB 1KXAA 1EAWA 1OOKB 1TAWA 1AE8H 9ESTA 1YCPM 1AVGH 1VITG 4OS2A 2AMPA 4YOGA 1O3CA 1MQ5A 1YKTA 1TMUH 3FFGA 4AFSA 1HJAC 3LIWA 1P06A 3SUEA 4U2WA 1A2CH 1UCYK 3ESTA 1K9OE 1DY8A 2V7QD 2FOFA 2AS9A 1J17T 1K2I1 4ZKNU 1TGTA 5TCAA 1P3EA 3OY6U 1IQMA 1A5GH 4D8NA 1JIMA 1C5WB 1GCTC 3ZV9A 3TK5A 1AD8H 3BF6H 1FXYA 5DP8A 1QIXB 1ELCA 5B6OA 4K1SA 5EOKA 1XUKA 1C2MA 4RN6A 1KYNA 1O36A 1XM1A 1YWUA 1FMGA 2IPHA 5GXPA 5T6GA 1GI2A 3N7OA 1JMOH 2XC5A 4LK4A 1RTLA 1AWHB 3BEFB 1MU8B 1AIXH 3AK5A 1C5TA 3ATMA 4INHA 3AW0A 1V2LT 1SPJA 2Z6BD 2BD4A 4GSOA 1TBZH 2VWLA 4PROA 4Y0YE 3WW7A 2HNTE 1PPFE 1TNLA 1O38A 1GJBB 1BHXF 3N7DA 1E36B 2RA3A 3E0PB 5HM2A 4K8YA 3LGVA 8GCHG 4WMEA 3KEEA 1EFRD 3MO3A 1AY6H 2G81E 1FNIA 1HV7A 1PQAA 1T8OA 3GDVA 1GVLA 3AASA 1THRH 4GUXA 4IC5A 1A61H 4TT3D 1GHBG 1QRZA 2Q6DA 1P9UA 1HAVA 3TNTA 4Y71A 1V2RT 1SGEE 4BANB 2H5DA 2GZ8A 3M36A 2VB0A 4INKA 4XBCA 1CU1A 1GMDF 2C4FH 1KLIH 5JBAS 4SGBE 3RXLA 2ZFTA 5BRRE 2ZHEH 1KMHB 1HAVB 1O3DA 2HALA 4NSVA 1FIZA 1GDQA 2A4GA 1B0EA 3F3BA 3R0FA 3U1IB 1DUEA 1ABJH 1UTKA 2Z9IA 3OTPA 1WDIA 1KTSB 1DT2A 2P95A 3Q3KA 2QIQA 5A8XA 1E1QD 2F91A 1ZJDA 3FP7E 3E16B 6LPRA 5FPTA 3RDZA 2ZP0H 1SG8B 1C1NA 3TJNA 1SGYE 1SGFG 1BTPA 4AOQA 3UTUH 2Z3EA 3F2GA 3KQCA 8KME2 2G55A 3T29A 1TPPA 1MBMA 1CA0C 1PPZA 1VGCC 1ZMNA 2QE7D 4H42U 3RP2A 3SHAH 3PV4A 3SYJA 2A4RA 3ZZ9A 3GCHC 3V3MA 4AYYB 1S6HA 4QT8C 2BQ7B 4JZIA 4JK6A 1C5PA 4X2XA 2FTMA 4MVNA 1BRUP 5A8YA 3EA7A 1NFUA 1QL9A 1O2LA 2BVXH 3MH4A 3STIA 2QXIA 3H5CB 2YMSC 3IWMA 2UWPA 1C1QA 1EZUC 2BM2A 2HWLB 2ZHQH 2ZPSA 4YLQH 1S0RA 2TIOA 1MBQA 5EIYA 1DDJA 3SUGA 3S9BA 2J97A 1CT2E 1TBRH 2JDID 4DG4A 3RXDA 2ZEBA 3RXUA 2H5CA 3UNSA 1ELVA 1GHXH 3SGAE 1O2MA 2ALPA 3PMAB 4KELA 1E38B 3TK9A 1OXGA 4ESTE 1NRRH 3M35A 5LGOA 1G3CA 4ACAA 5DP3A 1IQLA 1S85A 5KGOA 4GCHG 4GVUA 3T2NA 3SI4H 2Z9JA 4E7RG 1LKBA 3F1SB 1MABB 1OP8A 2J5UA 1TGBA 3Q00A 2WPMS 4CBNA 1SGFA 3S0NA 2O8MA 3ZZ4A 1ELBA 2FOGA 2PSXA 1LPZB 4ISLA 2DUCA 2CHAC 1TNIA 4Q4LA 1QB6A 2BD7A 1CT0E 1P3CA 4FVBA 1DLKB 1P2KA 3VB6A 5EQSA 2LNCA 3BTWE 4ABDA 1V2PT 3K6YA 1CGIE 1UMAH 3SU2A 3QLPH 1MAYA 2FOMB 2BDBA 5KECA 1P2QA 1V2JT 1QBOA 4B6EA 2UUJB 3ATIA 3MNXA 4YOIA 1ZPZA 3T25A 4RSPA 1GI0A 3HKIB 1HJ8A 1A5HA 4CRFA 2ZTZA 1DITH 4MG3A 2ZF0H 2JETC 1H9HE 2K8IA 2UWLA 4CREA 4TY6A 1OKXA 2HNTC 5FBEA 1COWD 2M2AA 1HAXB 4AN7A 1K1LA 1D9IA 4X6MA 1ETRH 3C27B 1YM0A 3TH4H 1C5YB 5FPYA 2BDAA 1LO6A 1QNJA 1IOEA 2G4UA 1F2SE 2FTLE 2ZTXA 3KQ5A 2XBWA 2ZQ2A 3UUZA 4MLFB 2PHBA 1P04A 3AAUA 1W3CA 3A88A 2BY8X 3A7TA 4NIWA 4YOJA 5PTPA 1TOCB 1AU8A 3SU0A 4NZQA 1DICA 2ZHDA 3GDSA 2AGGX 3ENSB 3BTEE 4ZHLU 3B9FH 1XUGA 5EQRA 2TGAA 1NFWA 4JMYA 1SKYE 5I46H 1GCDA 1J16A 1QB1A 3RXKA 3UOUA 2XNDD 2ZDMA 1AB9B 3RC5A 1XUJA 4ISHH 1A7SA 2SFAA 2BX3A 1YYY1 3IITA 1UTLM 1SVPA 1ESTA 5AFZH 5DJ7A 1XVMA 1BTZA 1UCYE 1GBCA 1FAKH 3UR6A 1QJ1B 3ZZAA 1O5CB 4DY7B 1C1TA 1GHZA 1IQKA 1O2KA 3SJOA 1ETTH 1BMAA 8ESTE 1QL7A 2VU8E 4RT1A 1F0SA 3W1EA 4X8VH 2VWMA 3RMOH 1YY3A 1HAZB 3RM0H 4MNXA 1RRKA 3AW1A 4CHAC 2STBE 2WYGA 2ZWLH 1SBWA 2AHME 4FU7A 2BY9X 1HAOH 2YMSD 3LH3A 4A7IB 3PO1C 3F0PA 3LC5A 1QBVH 3A81A 1XXFA 1LTOA 3SZEA 4INLA 2OC0A 5B6LA 3GY8A 1A0LA 1C4U2 3P8FA 3HK3B 4BTTB 5DP4A 3TJUA 3M3TA 5C5NA 2ZA5A 3MMGA 3GY2A 3Q3YA 2HNTF 2VGCB 1ETSH 3ZZ3A 2FMJA 4CR5A 2A2QH 1MKWK 4MDSA 1HNEE 1QURH 1TPSA 5G4BA 3LGWA 4F4OC 1SGCA 2A4OA 1SOTA 2G5VA 1GJCB 3NK8A 1W8BH 3BTGE 3RXVA 1N8OB 2ZZUH 3GDUA 3D62A 1YLDA 1Q31A 1V2UT 2ZI2H 3A85A 3RXRA 1FZZA 1LHGH 1W12U 3DA9B 1C1MA 1JIRA 5GJ4B 2Z7FE 1OPHB 1O35A 2C8ZB 2OBQA 3FO8D 4YO9A 1QTFA 4IBLH 5GCHG 2FWWA 1NBMD 5DN6D 4K5ZA 2FIRH 3T28A 1DWCH 1ZOMA 2GX4A 3A80A 4Y0ZE 1GGDB 1MTUA 1QRWA 1UVSH 1GJ7B 1RD3B 8LPRA 1O2GH 2JJ1D 2GVFA 1IAUA 1TRYA 1NPMA 2XBYA 3U69H 1UVOA 2OC8A 3DHKH 2F9UA 3OX7U 3VGCC 4O3TA 5CHAB 2ZFPH 3QK1A 3P8NA 1LHDH 2GCHG 5IDKA 1P10A 1SGPE 1FX0B 5A0CA 3QO6A 1IHSH 1HB0B 1OP0A 5EPNA 1B0FA 1T8NA 2FOEA 1P05A 3ZZCA 3E1XB 2R0KA 4X6NA 5J4SA 5TJXA 1ZLRA 3T26A 2VJ1A 1EKBB 3BTME 2FODA 2QXJA 1V2VT 2PUQH 2G5NA 1IQHA 2PWXA 3OEED 4X8SH 5LPEA 1N6XA 2H1UA 2FP7B 2JKHA 4Q63A 4Z1MD 1ZZZA 2WV4A 2ZU1A 1SLUB 1C1WH 1GL0E 4WJG2 1MTNC 4JK5A 1O3FA 3LDXH 2ZU4A 5GDSH 3QGNB 2ZFRH 3E6PH 9LPRA 2PFEA 1O2ZA 5C1XA 2H9EH 2XOKD 1Y3UA 4ZCNA 1O3PB 2XBXA 3GY7A 1O2UA 5JB9S 4HZHA 3RM2H 3PTNA 1O5AB 3V13A 2D26C 2ZKSA 3VB7A 4K3JA 1Z1JA 1SI5H 1GHWH 3N7EA 2QY0B 3RU4D 2FLBH 5K7RA 4TWWA 1UVTH 1AMHA 1O33A 1AFEH 4Y7AA 2KAIA 1YPMH 1K22H 1WQSA 2ZU3A 3SV9A 4Y76A 3GYMA 2BZAA 4YESB 5JBTA 4KP0A 1C1OA 1M9UA 2XTTB 1CBWC 1GBFA 2BY6X 2Y82A 2PKAA 4WY3A 3P8OA 1TGNA 2BDYA 1C5SA 3CENA 1C5VA 2KAIB 3M5LA 1O5BB 2FZZA 5L6NH 5E0HA 3HPTB 3W94A 2RG3A 4B73A 1FPCH 5AF9H 2EQNA 2NU1E 4P02A 1ACBE 3EGKH 3NXPA 2B7DH 4J2YB 1EQ9A 4MPWA 5E2PA 3TNSA 5IYTA 1CHOF 3SQHE 1GG6C 2VIPA 4MNYA 2XC4A 3A8CA 1NC6A 2GGVB 4NIYA 1QL8A 4JYVH 5T3HA 3S7KB 5L30H 3KF2A 3S69A 2CK3D 3LJOA 1KXBA 2EI7A 4X2WA 5JBBS 1V2MT 3SGQE 1EOJA 2WYJA 1IQEA 4BNRA 1V2QT 5EXNA 5EW2H 3GYLB 1TPOA 3ITIA 4Q2KA 3SNAA 5FXLA 1BIOA 4DT7B 5K0HA 1L0ZA 1O32A 2WPIS 1QFKH 1XXDA 1C2HA 2P94A 4U32A 6GCHF 1HCGA 2GCTB 1JOUB 1Y3YA 2OLGA 1TONA 4ABEA 5DP9A 1KXCA 4D9RA 3GCTG 1NM6A 1C5MD 3VB3A 3MU4A 3RMNH 2UWOA 2VWNA 4F55A 2OBOA 2G52A 2VH0A 4DT4A 2ZHWH 3FP6E 2D1JA 3HK6B 1ANEA 1O2IA 1SLWB 2Z3CA 3TIUA 1FY5A 4WXVA 1C5ZB 1MUEB 1GJAB 1QR3E 1MKXH 1BOQA 1H8HD 4WH6A 1O3AA 3UWJH 1SR5C 2BVSH 3SZNA 1GBTA 2FOHA 2PTCE 2XCFA 3UFAA 1AWFH 1B5GH 1S83A 2NU4E 2R0LA 4YLUA 1BTHH 1W14U 1EAIA 1LPGB 2FO9A 4X6OA 4MPUA 1P2OA 5KEDA 1TA6A 2CJIA 3QTVH 5F8XA 4MPVA 3B8JA 3ZVCA 1BB0B 2BLWA 2O8WA 3BTKE 4OGXA 4LZ1H 1ZSLA 1VITF 5JDUB 1RIWC 1EUFA 4BAOB 1F92A 2GT7A 4DGJA 3TGIE 4I8LA 2A31A 5IK2D 1RFNA 5EW1H 1HUTH 1T8LA 2I6QA 2SGEE 1BA8B 1BDAA 3ZZ6A 1OSSA 2I6SA 4DJZB 4I33A 3FP8E 1GMCF 1ELFA 1SQRA 1ZJKA 1D3PB 1TGSZ 3ZIAD 1BRBE 2G00A 2B0FA 2IPQX 3P92A 4JYUH 5A0BA 4J1YA 1IQIA 1SFQB 2EI6A 1HXEH 2VIQA 3RXBA 4B6FA 1QHRB 4UE7H 1SB1H 1V2WT 4O3UA 5GNDA 1J14A 4ZXXH 2O8TA 3PYHA 2FDAA 3PV2A 1LVMA 3ZV8A 1C4Y2 3DFLA 2FPZA 4NA9H 2ZHFH 4XSKU 2KX4A 4IGDA 1T7CA 1TX8A 5H4IB 1AVWA 1GHAF 1YCPK 2KCOA 3ZVAA 1E35B 5EJLA 1W7GH 4MTBA 1SGRE 3UOPA 1WXRA 1C5XB 3LOXA 1A46H 1A5IA 4UFGH 1INCA 1D4PB 3F2HA 1P2NA 1BUIA 5CDFE 4ZAEA 5C0TA 2EY4C 3SNEA 1NRNH 4XE4A 4CH8B 1MTVA 3C1KA 3SV2H 3K2UA 2GMTC 2KCAA 2Z9LA 1ZMJA 1WUNH 1DSTA 3DCLA 4THNH 1NO9H 2PR3A 1H9LB 3MU1A 1Z6JH 4O03A 3SORA 2Y5GA 5F8TA 3LU9B 2H2ZA 1O2RA 4X8UH 2HRVA 2ZDKA 1BITA 1LHCH 2P3TB 2AERH 1H9IE 4NGAH 1Z8GA 1ZHPA 4DCDA 1NROH 3KGPA 3BTHE 1TFXA 2P8OC 1DFPA 1HXFH 2QGRA 4FETA 4Y11E 5FCRA 3M7QA 3B23B 2GJGA 2PKSC 4NCYA 5EPYA 3A89A 3PMHB 1AGJA 1EAUA 5AFYH 5ETXA 2R3YA 3PRDA 1XUFA 3MU5A 1P01A 1PFXC 2BDGA 3OE7D 1AFQB 4Z0KA 3SV6A 5C17A 1E79D 2A5KA 3I29A 1UTMA 5JBCS 1S0QA 2YNBA 1TYNA 2FXRA 3U8TH 4NFFA 3F9EA 4FU9A 1GHVH 2Q6FA 3EDXB 4ISIH 3U9AH 2QF0A 5F6MA 1V2KT 3LONA 1P2JA 3CS0A 1DS2E 1YPHC 2OD3B 1H1BA 2ODPA 5GIBA 3TPIZ 3PMBB 2XWAA 2ZQ1A 1J9CH 1O37A 1Y3VA 1GBLA 3SU3A 4AB8A 1O0DH 4DIIH 1MCTA 4GAWA 1P03A 2TGTA 4AFQA 1U6QA 1W0JD 1YF4A 1LHEH 4NIVA 2BD5A 2P3UB 1KSNA 3LGIA 1GJDB 7KMEH 4NSYA 1SQTA 1F7ZA 3NZIA 1OYQA 4R8TB 1G9IE 1XX9A 4KGAA 2QF5A 2KR7A 4IC6A 3D65E 3RXSA 1O31A 2WINI 3GICB 1O2XA 1BCUH 4ISNA 1ZMLA 3A7ZA 4A6LA 4AG2A 1DANH 3OYPA 4YXWD 3SU5A 2W3IA 4B76A 1OS8A 2VVCA 3D49H 1ELEE 3UWIA 1GI5A 1QRXA 1OP2A 3UY9A 3OTJE 4Y10E 2TBSA 4IN2A 2BLOA 1GJ8B 1QA0A 4NWKA 1Z8RA 3VB4A 4RI0A 1NT1A 1F0UA 3BTQE 2CGAA 4VGCB 4AYVB 1DPOA 3PRBA 1S84A 3M7UA 1C1UH 4CH2B 4BTIB 1TNGA 1EOLA 4MQAA 3SJ9A 1HJAB 2YOLA 5CHAC 4GHQA 2GZ9A 1YLCA 4FVDA 1XUIA 1EJMA 2ZCKP 1UCYH 3RUOA 3A8BA 1QBNA 4YM9A 1O5DH 4NFEA 4U30A 4YT7H 1DVAH 3RU4T 3ZVBA 1O5FH 1EPTC 2GP9B 1VITH 2J2UA 1GCTB 1GMHF 2THFB 5F53A 1MCVA 2R2WU 2PTNA 1L1JA 2OUAA 5LPRA 3NPSA 3HGPA 2V3HH 5DPAA 4DVAU 1G32B 1MTWA 1YPKH 2R3UA 3SN8A 1AZ8A 3RXHA 1N1LA 2ZDLA 4K69A 4OS7A 4I31A 1P09A 1QQ4A 3V7TA 4B2BA 1QA7A 1VCWA 3BG4B 4Y6DA 1P11E 3JZ1B 3UPEA 2F4LA 1SGNE 3FN8A 1BBRK 4LZ4B 1EB1H 1BJUA 2LELA 3MU8A 2G51A 4JZFH 1O2VA 2BXUH 4LXBH 3A87A 2Z9KA 1SGIB 2ZGCA 5T6FA 1QY6A 2BD2A 3MU0A 3VG8A 4IW4E 2KM0A 3MH5A 2D8WA 2WHXA 1YBWA 4I8HA 4I7YH 2PW8H 5DGJA 1GDUA 4Q7YA 3SJKA 1F0TA 2BTCE 5FL7D 3RXFA 1D6WA 1GI1A 2HPPH 1TB6H 3UQOA 1TMTH 2BOKA 1QGFA 5CE1A 4O97A 1DOJA 1MQ6A 2RCEA 1MD8A 1OYTH 2Y80A 2F43B 2O8LA 3ZZBA 3BIUH 1S82A 3ZZDA 4FUHA 4UDWH 4WMDA 1SC8U 4BAKB 1GBIA 2GZ7A 1HAPH 1C9PA 2STAE 1J8AA 3ZVEA 1DXWA 1E0FD 2Y5HA 1V2OT 4FOUC 1MMJN 1HLTH 1YPEH 1BMFD 1P8VC 2QA9E 1C5RA 1WQVH 6CHAC 1DY9A 1FY1A 2EI8A 1ZR0A 1YC0A 4K60A 3MH6A 1IQNA 1KDQA 1GBDA 1E34B 3SUFA 1PJPA 4FUIA 3H7OA 1HGTH 3E0NB 2BYAX 5A09A 4UFEH 1BJVA 5BPEA 5L2YH 1CA0B 1VGCB 2TGPZ 3GY4A 3SNDA 1SMFE 3U8OH 3PLPA 1KDQB 4DIHH 1ABIH 1DXPA 1O3EA 1SL3A 1NFYA 2IN2A 3PLKA 3GCHB 3DSGA 3M7TA 4FXGH 4NWLA 2W6ID 1H4WA 1AKSB 4I86A 1C5LH 2VIDA 2PSYA 1W10U 3T62A 3A82A 4Y8YA 1ZRKA 3DFJA 2A5AA 1YP9A 3E90B 1GI4A 2BY5X 2YMSB 1SFIA 3TJVA 4A1TA 2OCVB 1EX3A 2Z9GA 1HPGA 1HBTH 3LGTA 2FS9A 3NRLA 1YPGH 4GLYA 2QAAA 5GCHF 1K1PA 1T32A 1BTUA 1O3JA 2FI4E 1TRNA 1EASA 1SSXA 2OC1A 1X7AC 1SOZA 2O9QA 2ANYA 4JZEH 4X2YA 5LPFA 1Z8IB 3RMMH 1TGCA 2KCPA 2QYIA 3H09A 1TNHA 2C8XB 4ZKRU 2J9NA 2J92A 4IMZA 1OX1A 3Q3XA 1RTFB 1ELAA 1WV7H 3ZZ8A 1Z7KA 7GCHG 1C1SA 2FI3E 2CHAB 1VJAU 3SNBA 3S7HB 1LMWB 3S9CA 1QZ8A 3NWUA 3DD2H 2NU0E 3MO6A 1GHYH 4ISOA 5HMAA 4TPIZ 3M3VA 4B75A 4OS1A 3QGJA 2BD8A 1LDTT 3ZYDA 1S6FA 1A1RA 1C5UA 1TX7A 4U01A 4ZROA 2ZO3H 3TITA 1KXFA 1W0YH 3RXCA 5E0GA 1Y3WA 1OWKA 1GBKA 3VPKA 4XBBA 2W5EA 4XBDA 1PQ7A 4JZ1A 4TSFD 1LKAA 1Q2WA 2A32A 1EJAA 2CF8H 5F03A 2Z3DA 1SQAA 2XCNA 3QX5H 4UD9H 2D2DA 1LHFH 2GKVE 2JETB 1L1GA 3F0OA 4I8JA 2OQUA 1GJ4H 1PQ5A 1QQUA 3ODDA 2XW9A 3WWFA 4FUEA 1GBHA 2A5IA 1SLVB 2H9HA 1PPBH 1K0HA 1OWDA 3F2FA 2W26A 5A0AE 1BQYA 3K65B 2V35A 3P95A 3F9GA 3HGNA 3A8DA 5SGAE 1EP5A 3TH2H 3SOSA 1TBQH 5C1UA 5EJZA 3F6UH 3P17H 3HATH 5EQQA 1AVXA 4MNVA 1VJ9U 1RTKA 4JCNA 3OY5U 5EGMA 1ZTKA 2OTVA 1BT7A 3SU6A 3SUDA 1AHTH 3BTTE 4B74A 3LH1A 3QUMP 1WSSH 2PUXB 2C8WB 1IQGA 3TJOA 4OGYA 1FV9A 4TWYA 1D3DB 4FU8A 1K1JA 7LPRA 2UUFB 3L3TA 1ZTLA 4TY7A 4NIXA 1G3DA 5FPSA 3RXAA 3ZVFA 2ZGHA 1CT4E 5DP6A 1D3QB 1A3EH 1NZQH 4ABBA 2BXTH 4JYTA 1DM4B 1EATA 4I8GA 5HGGA 2WUBA 2JH0D 1O2PA 5EXMA 2ANKH 5L2ZH 1BMNH 2KCYA 4I32A 4HGCA 4WH8A 2VVUA 2J98A 2UUYA 2BLQA 3LJJA 4XDEA 2W7SA 3QWCH 5C20A 4CHAB 3KIDU 1CHOG 5FBIA 4H6TA 2G8TA 3PO1B 3LGUA 3P8GA 1FAXA 3RXEA 1E37B 2J98B 1CSOE 2L6OA 4MNWA 2AIQA 1Y5AT 2P3FH 1OWIA 4ABFA 1F5KU 3WY8A 4CRDA 1AE5A 1ARBA 1GJ6A 1BBRE 4AG1A 4B1TA 1FONA 3DSPA 3EE7A 1FPHH 1NU9A 2R2MB 2TPIZ 1C2FA 1MKWH 2AMDA 2VIVA 2ZFFH 3V0XA 5I25A 4K1EA 1P9SA 1BTWA 1TLDA 5EJ1A 2CV3A 1ZGIA 2ZNKH 3OU0A 4IN1A 1SGDE 6GCHG 3MYWA 5E0JA 1CVWH 2ZGBH 1K21H 2GDDA 2GV6A 6ESTA 1RJXB 2FLRH 3M3SA 2O8UA 4RKOB 2CMYA 1PPCE 1DLEA 1N6YA 4FUDA 1SQOA 1GI8B 1NRSH 2LP6A 2Q6GA 2RFKC 1HAGE 2EEKA 1UHBA 4A92A 5ABWA 2FEQH 3MWIU 3VB5A 1CQQA 2P16A 4B2AA 2ALVA 3SI3H 5DG6A 1OHHD 1BZXE 1O2YA 1P2IA 1L2EA 1NTPA 3STJA 3O8BA 1AO5A 1Y3XA 1GVKB 3T27A 1FIWA 1TWXB 1UHBB 1O2SA 5ESBA 2AH4X 1TPAE 1HAIH 4X8TH 2K0QA 2A7CA 3KYGA 2XC0A 2ZU2A 3W95A 2WPLS 3F9HA 3GCOA 3OEHD 2ZGJA 3VGCB 2A4QA 3SJIA 1GVZA 2UUKB 2BOHB 1AQ7A 1WBGB 2SGQE 1O34A 3GISB 3FZZA 3U98H 2ZGXH 1HRTH 1BTXA 3M5MA 4ABJA 1EP6A 4AC9A 2VWOA 1NBME 5C94A 4P00A 1V6DA 1JWTA 4CRCA 1GMCG 1DWBH 1ORFA 4K1TA 2VIWA 5A2MH 2ZFQH 3AVZA 4AFUA 1A0HB 1IQJA 1O3IA 1TA2A 7ESTE 1E1RD 1K28D 2FS8A 2ZU5A 2FOBA 2G4TA 2BZ6H 3E3TA 3PWCA 3JZ2B 3SO3A 1MTNB 2OINA 2QV1A 2F3CE 1O2WA 1O3GA 2VINA 2QC2A 4FUFA 4XD7D 5JPMH 2SGAA 2B8OH 1K1NA 8GCHF 3BG4C 1V2TT 3PMJA 4UFDH 1GHAG 1P02A 2LPRA 1ARCA 2ZPQA 1DE7H 1LQDB 2Y7XA 4AFZA 2CN0H 1C2KA 3SNCA 3LGYA 1O2QA 1GHBF 4BXSA 4AGKA 4ASUD 4A1XA 5J4QA 3KNXA 2Z94A 2QF3A 1GBJA 4BOHA 3ZZ5A 5C2ZA 2L74A 1O3MA 1W11U 4D7GA 3NKKA 5DP5A 1O30A 4BAMB 1UTJA 2FX4A 1C1VH 1Z1IA 2AEIH 1XVOA 1G30B 5FHTA 1GMDG 1AB9C 3A7WA 3RMLH 3SGBE 2DE8A 2WUCA 4OM9A 2XRCA 2H9TH 4X1RU 2JJ2D 1MTSA 1DSUA 3M37A 4O9VA 4AGJA 1CBWB 3KCGH 1HYLA 4WF8A 4NZLA 4D76A 3R3GB 1RS0A 4RT0A 1PPEE 2EA3A 2GD4B 1EAXA 4ZHAA 4NA7A 3URCA 2SNVA 3QN7A 1J15A 2SGPE 2K1QA 3LT3A 2KZ4A 1G3BA 3QDZB 5FX5A 3E91A 1GG6B 2EC9H 3A84A 3ATLA 3RU4E 4E05H 5C3NA 2ODYB 1SGTA 2FX6A 5HIZA 1WTGH 2PV9B 1TMBH 2Y6TA 1WCZA 4Y79A 1LVBA 1LQEA 2HLDD 3RC4A 5C67A 3A7XA 3SV8A 4ZXYH 3SW2B 3RXOA 3OAAD 1TX6A 1XKBC 5FAHA 4YZUA 2PP6A 2VGCC 3K9XB 1ZRBA 1G2MA 2PLXA 2W3KA 1NU7B 1VCQA 3AAVA 3BSQA 1P12E 2W6JD 1ZYOA 3E8LA 1PQ8A 1DUAA 3LPRA 5DK1A 4CRAA 3CP7A 4BTUB 1N8OC 2HVXA 5T1VA 1O3OA 1BHXB 1GBBA 4ASHA 2XWBI 4AX9H 1KIGH 2XBVA 3GY3A 1XUHA 3I77A 3QTOH 1K1OA 1Y5BT 2OC7A 3SJ8A 4ZHMU 2VIOA 3RXQA 3TLOA 1GJ9B 1DWEH 1UVUH 1ESBA 3ATKA 2VVVA 4OS5A 3F68H 2ZCLP 1C2DA 4HI3A 1IQFA 2GDEH 4GCHF 3A7YA 4YT6H 5FX6A 4X0WU 3TGJE 3TGKE 2HOBA 1GGDC 4RKJB 1MD7A 1GL1A 1T31A 3M5OA 4Q80A 5JYIA 1C1PA 5E2OA 3Q77A 3PWBA 1JRTA 3RXTA 2IOTA 2F9BH 2JIZD 4TPYA 3LC3A 1RIWB 3ZVDA 2C93B 1EXFA 3EYDA 2ZPRA 4ZKSU 3NUMA 1Y59T 2TRMA 1MH0A 1TNJA 2M5TA 2IJOB 1F5RA 2SNWA 1W7XH 1O2HA 1O5EH 3MO9A 4LOYH 1KLJH 4ZH8A 4XRNA 2RDLA 3DUXH 3PROA 4CRBA 1TQ7B 1SGQE 1WOFA 2FESH 1ID5H 1UTPA 2ZIQH 1ESAA 2C90B 1FDPA 1FN6A 2WPJS 3D23A 5TCCA 4ABGA 1BMLA 1UTNA 2BY7X 4KKDA 1ELDE 4B2CA 4ABIA 4Z6AH 1ZSJA 1HAHH 1KXDA 1C5NH 1AUTC 1ZHRA 2FOAA 1V2NT 1KTTB 1GMHG 2J38A 1TRMA 2J95A 2ZFSA 1F5LA 3I78A 1O3HA 1GJ5H 1PPHE 2C8YB 1C1RA 2H6MA 1UTQA 4DOQA 2RDEA 4ACBA 3URDA 2FI5E 1C4V2 1UO6A 2NU3E 1THPB 1YCPH 2HPQH 2F83A 4AZ2B 2Y5FA 3MNBA 4X6PA 4KTSA 3VFEA 1KLTA 1Z8JB 2F9PA 3PV5A 1WYKA 3K6ZA 3N99A 1BMMH 4XFQA 5HYOA 1O39A 2BD9A 1Z71A 3PB1E 3G01A 2GMTB 2RA0A 3PLBA 5T6DA 4OS4A 2AGIX 2OP9A 2W7UA 1S6LA 1RGQA 1CGJE 1EB2A 1UK2A 3SU1A 1O2OA 5A8ZA 4MPXA 1LCYA 4WXIA 1EZQA 2BQWB 1V3XA 2F9NA 3FVFB 2Y7ZA 4K8BA 1ZPBA 3KHVA 2B9LA 4H6SB 3RLWH 3FANA 2A2XH 1XMNB 1FJSA 3RLYH 2PGQB 1MU6B 2BDCA 4KTUA 2HVYB 1Q3XA 2BX4A 3UNRA 1C2IA 1GDNA 4CRGA 3GS9A 1O3LA 2P8OB 2GTBA 3FKSD 3EA8A 2JH6D 3BN9A 4WVPE 5DP7A 3BIVH 3L33A 2PKSB 2ZC9H 3DT0H 1O5GH 4Y8ZA 2P59A 5EODA 4GHTA 1CHGA 4F49A 4DURA 2HLCA 2ULLA 1VZQH 3KQBA 3MI4A 3FZDA 3ZYEA 2ZDAH 1WAYB 4ABAA 5E8EH 1AKSA 1ANBA 4BAHB 1FQ3A 1GI3A 3MOCA 1W0KD 2V3MA 2OQ5A 4FUCA 4CR9A 3L6PA 3KQEA 2J34A 4NA8A 2FYQA 1BRCE 1UJ1A 2QCYA 2ZG0H 3U1JB 1W0ZU 2Q1JA 4OS6A 2A7HA 5HM9A 4DW2U 3BG8A 1FN8A 1IHTH 4Q7XA 3V12A 3RC6A 3RXJA 3U28C 2VH6A 1LVOA 3S9AA 3UREA 2GCTC 2KFWA 4XOJA 1WTHD 2FOCA 1TIOA 1UK3A 5HXFA 3KN2A 1CO7E 4AB9A 5HKKD 4E7NA 3A86A 2WSSD 2JH5D 3UNQA 1D3TB 3GY5A 3P70B 1CE5A 1ZHMA 4X2VA 1YPLH 1OWJA 4UFFH 4A1VA 1MKXK 4FUGA 1GBAA 1GPZA 1BRAA 5HIYA 2CF9H 2CXVA 3FAOA 1ELGA 1G36A 3RXMA 2ZDVH 5AHGH 5C5OA 3GCNA 1ZPCA 2AFQB 1GWAA 2WV5A 4X1PU 3ODFA 1TQ0B 1H8ED 1L4ZA 2NWNA 5AVDA 4IMQA 1C9TA 2ANMH 1ANCA 3MHWU 3TH3H 3MH7A 5EG4A 1ZSKA 1EZSC 1B7XB 1NRQH 3A8AA 5C0UA 1THSH 3UAIC 2XNIA 1FLEE 2J94A 2R9PA 1T4UH 1ZGVA 2BDIA 5ESTE 3RXGA 3RXPA 2GCHF 2A45B 2IJD1 7GCHF 1FUJA 2PGBB 5EXLA 4YTAA 3KYFA 2VNTA 4D9QA 1EJNA 3GY6A 1OWEA 1EPTA 1H8DH 1O2NA 2XXLA 4R0IA 3UB0A 1A4WH 2WZQA 3SV7A 3ELAH 1VCPA 1NESE 1FY8E 1HJ9A 1K1IA 1PYTC 2ASUB 3QZRA 3LKWA 2AIPA 1NRPH 2A7JA 2ZDNA 1CA8B 3BEIB 3CNRA 2GT8A 1SHYA 1ELTA 2OK5A 1EPTB 2C3SA 1KY9A 1VR1H 1AZZA 1Y5UT 1DWDH 4UEHH 1P57B 4FUJA 4D7FA 4GPGA 2Y81A 4A5TS 3TK6A 2AMQA 4HTCH 1HAYB 3EE0B 1C5OH 1GI7B 1L1NA 2A1DB 5EU8A 3QZQA 1Z6EA 1MAXA 2J4IA 4WWYA 4SGAE 1UTOA 3U8RH 2BB4A 4X1QU 5GPIB 1A3BH 1W13U 2NU2E 1NS3A 2ZECA 4ZUHA 5DO4H 2AYWA 1NN6A 4F48B 1NY22 4AORA 4M9FA 1ZTJA 1Y8TA 2BMGB 1BBRH 3UR9A 2AGEX 3MTYA 2WPKS 1O3NA 1HDTH 1G3EA 2A0QB 3KL6A 4K2YA 1T4VH 2YNAA 1L4DA 2WPDD 1O3BA 2ILNA 1XKAC 2BQ6B 3O8DA 3BTDE 3BEUA 1ANDA 1F0RA 1TABE 2V3OH 1GI9B 1G2LA 2WV9A 1BTYA 3H7TA 4E06H 3EAJA 1C5QA 1QB9A 1GI6A 5FCKA 3SQEE 3ATWA 3TU7H 3SHCH 1KXEA 1P2MA 3MNSA 4KTCA 5JB8S 2ZCHP 4BXWA 3MNCA 4IS5A 5GWZA 1G37A 1YLNA 1HIAA 3O8CA 1TE0A 2P93A 1AI8H 3MQKC 3UIRA 2ESTE 2BDHA 4UONA 1WU1A 3A83A 3ZZ7A 4H4FA 1TOMH 3A7VA 1AFQC
chains in the Genus database with same CATH topology
1SHHB 1O2JA 3O8RA 4JZDH 1UK4A 1HIAB 1K1MA 1TALA 3RXIA 3VEQB 3VXEH 6CHAB 3UQVA 2PKAB 4B71A 3EQ0H 1FY3A 1MZDA 2BD3A 3T5FH 1JRSA 2V6NA 4I8KA 2WPHS 1HFDA 1EZXC 4ZMAH 4NG9H 1GBEA 4HFPB 4CBOA 1AN1E 3P6ZB 4ZKOU 2GV7A 3BTFE 1AUJA 1UVPA 1V2ST 1O2TA 1H8IH 3BV9B 1C2GA 3M5NA 2F9VA 2BLVA 4Y8XA 1O3KA 3EA9A 3SU4A 2FM2A 4Q7ZA 1GBMA 1QJ7B 2FYRA 2TGDA 1P0SH 1FY4A 3M61U 4Y7BA 1C2EA 2SGDE 4M7GA 1NFXA 3VXFH 2BHGA 1PPGE 4ABHA 3GCTF 1YPHE 2QXGA 3CS7A 1YGCH 3KQDA 2V0BA 2ANWA 1YPJH 1RXPA 1QCPA 2HGTH 2QN5T 4X1SU 2ZTYA 1S81A 1W2KH 4FUBA 3F9FA 3OSYA 3SBKA 1DX5M 4WMFA 1OWHA 5CMXH 2ODQA 1D6RA 3Q76A 1T8MA 5C1YA 1C2JA 1SLXB 2B5TB 5F8ZA 4X1NU 1S5SA 3MFJA 5LH8A 1A0JA 2OXSA 2QXHA 1LPKB 3ZVGA 2XYAA 2SGFE 1FI8A 1TNKA 5DKMA 1C2LA 1CGHA 3TVJB 1JXPA 1LVYA 1QJ6B 1MZAA 1PYTD 3IG6B 2BVRH 4BAQB 3GOVB 3PTBA 2DE9A 3PM3A 2F9OA 1JBUH 3NCLA 4VGCC 4TYDA 3HKJB 1KXAA 1EAWA 1OOKB 1TAWA 1AE8H 9ESTA 1YCPM 1AVGH 1VITG 4OS2A 2AMPA 4YOGA 1O3CA 1MQ5A 1YKTA 1TMUH 3FFGA 4AFSA 1HJAC 3LIWA 1P06A 3SUEA 4U2WA 1A2CH 1UCYK 3ESTA 1K9OE 1DY8A 2FOFA 2AS9A 1J17T 1K2I1 4ZKNU 1TGTA 5TCAA 1P3EA 3OY6U 1IQMA 1A5GH 4D8NA 1JIMA 1C5WB 1GCTC 3ZV9A 3TK5A 1AD8H 3BF6H 1FXYA 5DP8A 1QIXB 1ELCA 5B6OA 4K1SA 5EOKA 1XUKA 1C2MA 4RN6A 1KYNA 1O36A 1XM1A 1FMGA 2IPHA 5GXPA 5T6GA 1GI2A 3N7OA 1JMOH 2XC5A 4LK4A 1RTLA 1AWHB 3BEFB 1MU8B 1AIXH 1C5TA 3ATMA 4INHA 3AW0A 1V2LT 1SPJA 2Z6BD 2BD4A 4GSOA 1TBZH 2VWLA 4PROA 4Y0YE 2HNTE 1PPFE 1TNLA 1O38A 1GJBB 1BHXF 1E36B 2RA3A 3E0PB 5HM2A 4K8YA 3LGVA 8GCHG 4WMEA 3KEEA 3MO3A 1AY6H 2G81E 1FNIA 1HV7A 1PQAA 1T8OA 3GDVA 1GVLA 3AASA 1THRH 4GUXA 4IC5A 1A61H 1GHBG 1QRZA 2Q6DA 1P9UA 1HAVA 3TNTA 4Y71A 1V2RT 1SGEE 4BANB 2H5DA 2GZ8A 3M36A 2VB0A 4INKA 4XBCA 1CU1A 1GMDF 2C4FH 1KLIH 5JBAS 4SGBE 3RXLA 2ZFTA 5BRRE 2ZHEH 1HAVB 1O3DA 2HALA 4NSVA 1FIZA 1GDQA 2A4GA 1B0EA 3R0FA 3U1IB 1DUEA 1ABJH 1UTKA 2Z9IA 1KTSB 2P95A 1DT2A 3Q3KA 2QIQA 5A8XA 2F91A 1ZJDA 3FP7E 3E16B 6LPRA 5FPTA 3RDZA 2ZP0H 1SG8B 1C1NA 3TJNA 1SGYE 1SGFG 1BTPA 4AOQA 3UTUH 2Z3EA 3KQCA 8KME2 2G55A 3T29A 1TPPA 1MBMA 1CA0C 1PPZA 1VGCC 1ZMNA 4H42U 3RP2A 3SHAH 3PV4A 2A4RA 3ZZ9A 3GCHC 3V3MA 4AYYB 1S6HA 4QT8C 2BQ7B 4JZIA 4JK6A 1C5PA 4X2XA 2FTMA 4MVNA 1BRUP 5A8YA 3EA7A 1NFUA 1QL9A 1O2LA 2BVXH 3MH4A 3STIA 2QXIA 3H5CB 3IWMA 2UWPA 1C1QA 1EZUC 2BM2A 2HWLB 2ZHQH 2ZPSA 4YLQH 1S0RA 2TIOA 1MBQA 1DDJA 3SUGA 3S9BA 1CT2E 1TBRH 4DG4A 3RXDA 2ZEBA 3RXUA 2H5CA 3UNSA 1ELVA 1GHXH 3SGAE 1O2MA 2ALPA 3PMAB 4KELA 1E38B 3TK9A 1OXGA 4ESTE 1NRRH 3M35A 5LGOA 1G3CA 5DP3A 1IQLA 1S85A 4GCHG 4GVUA 3T2NA 3SI4H 2Z9JA 4E7RG 1LKBA 3F1SB 1OP8A 1TGBA 3Q00A 2WPMS 4CBNA 1SGFA 3S0NA 2O8MA 3ZZ4A 1ELBA 2FOGA 2PSXA 1LPZB 4ISLA 2DUCA 2CHAC 1TNIA 1QB6A 2BD7A 1CT0E 1P3CA 4FVBA 1DLKB 1P2KA 3VB6A 5EQSA 2LNCA 3BTWE 4ABDA 1V2PT 3K6YA 1CGIE 1UMAH 3SU2A 3QLPH 1MAYA 2FOMB 2BDBA 1P2QA 1V2JT 1QBOA 2UUJB 3ATIA 3MNXA 4YOIA 1ZPZA 3T25A 4RSPA 1GI0A 3HKIB 1HJ8A 1A5HA 4CRFA 2ZTZA 1DITH 4MG3A 2ZF0H 2JETC 1H9HE 2UWLA 4CREA 4TY6A 1OKXA 2HNTC 5FBEA 1HAXB 4AN7A 1K1LA 1D9IA 4X6MA 1ETRH 3C27B 1YM0A 3TH4H 1C5YB 5FPYA 2BDAA 1LO6A 1QNJA 1IOEA 2G4UA 1F2SE 2FTLE 2ZTXA 2XBWA 2ZQ2A 3UUZA 4MLFB 2PHBA 1P04A 3AAUA 1W3CA 3A88A 2BY8X 3A7TA 4NIWA 4YOJA 5PTPA 1TOCB 1AU8A 3SU0A 4NZQA 1DICA 2ZHDA 3GDSA 2AGGX 3ENSB 3BTEE 4ZHLU 3B9FH 1XUGA 5EQRA 2TGAA 1NFWA 4JMYA 5I46H 1GCDA 1J16A 1QB1A 3RXKA 3UOUA 2ZDMA 1AB9B 3RC5A 1XUJA 4ISHH 1A7SA 2SFAA 2BX3A 1YYY1 3IITA 1UTLM 1SVPA 1ESTA 5AFZH 5DJ7A 1XVMA 1BTZA 1UCYE 1GBCA 1FAKH 3UR6A 1QJ1B 3ZZAA 1O5CB 4DY7B 1C1TA 1GHZA 1IQKA 1O2KA 3SJOA 1ETTH 1BMAA 8ESTE 1QL7A 2VU8E 1F0SA 4X8VH 2VWMA 3RMOH 1HAZB 3RM0H 4MNXA 1RRKA 3AW1A 4CHAC 2STBE 2WYGA 2ZWLH 1SBWA 4FU7A 2BY9X 1HAOH 3LH3A 4A7IB 3PO1C 3LC5A 1QBVH 3A81A 1XXFA 1LTOA 4INLA 2OC0A 3GY8A 1A0LA 1C4U2 3P8FA 3HK3B 4BTTB 5DP4A 3TJUA 3M3TA 5C5NA 2ZA5A 3MMGA 3GY2A 3Q3YA 2HNTF 2VGCB 1ETSH 3ZZ3A 2FMJA 4CR5A 2A2QH 1MKWK 4MDSA 1HNEE 1QURH 1TPSA 5G4BA 3LGWA 4F4OC 1SGCA 2A4OA 1SOTA 2G5VA 1GJCB 3NK8A 1W8BH 3BTGE 3RXVA 1N8OB 2ZZUH 3GDUA 3D62A 1YLDA 1Q31A 1V2UT 2ZI2H 3A85A 3RXRA 1FZZA 1LHGH 1W12U 3DA9B 1C1MA 1JIRA 5GJ4B 2Z7FE 1OPHB 1O35A 2C8ZB 2OBQA 4YO9A 1QTFA 4IBLH 5GCHG 2FWWA 4K5ZA 2FIRH 3T28A 1DWCH 1ZOMA 2GX4A 3A80A 4Y0ZE 1GGDB 1MTUA 1QRWA 1UVSH 1GJ7B 1RD3B 8LPRA 1O2GH 2GVFA 1IAUA 1TRYA 1NPMA 2XBYA 3U69H 1UVOA 2OC8A 3DHKH 2F9UA 3OX7U 3VGCC 4O3TA 5CHAB 2ZFPH 3QK1A 3P8NA 1LHDH 2GCHG 5IDKA 1P10A 1SGPE 5A0CA 3QO6A 1IHSH 1HB0B 1OP0A 5EPNA 1B0FA 1T8NA 2FOEA 1P05A 3ZZCA 3E1XB 2R0KA 4X6NA 5J4SA 5TJXA 1ZLRA 3T26A 2VJ1A 1EKBB 3BTME 2FODA 2QXJA 1V2VT 2PUQH 2G5NA 1IQHA 2PWXA 4X8SH 5LPEA 1N6XA 2H1UA 2FP7B 2JKHA 1ZZZA 2WV4A 2ZU1A 1SLUB 1C1WH 1GL0E 4WJG2 1MTNC 4JK5A 1O3FA 3LDXH 2ZU4A 5GDSH 3QGNB 2ZFRH 3E6PH 9LPRA 2PFEA 1O2ZA 5C1XA 2H9EH 1Y3UA 1O3PB 2XBXA 3GY7A 1O2UA 5JB9S 4HZHA 3RM2H 3PTNA 1O5AB 3V13A 2D26C 2ZKSA 3VB7A 4K3JA 1Z1JA 1SI5H 1GHWH 2QY0B 3RU4D 2FLBH 5K7RA 4TWWA 1UVTH 1AMHA 1O33A 1AFEH 4Y7AA 2KAIA 1YPMH 1K22H 1WQSA 2ZU3A 3SV9A 4Y76A 3GYMA 2BZAA 4YESB 5JBTA 4KP0A 1C1OA 1M9UA 2XTTB 1CBWC 1GBFA 2BY6X 2Y82A 2PKAA 4WY3A 3P8OA 1TGNA 2BDYA 1C5SA 3CENA 1C5VA 2KAIB 3M5LA 1O5BB 2FZZA 5L6NH 5E0HA 3HPTB 3W94A 2RG3A 4B73A 1FPCH 5AF9H 2NU1E 1ACBE 3EGKH 3NXPA 2B7DH 4J2YB 1EQ9A 4MPWA 5E2PA 3TNSA 5IYTA 1CHOF 3SQHE 1GG6C 2VIPA 4MNYA 2XC4A 3A8CA 1NC6A 2GGVB 4NIYA 1QL8A 4JYVH 5T3HA 3S7KB 5L30H 3KF2A 3S69A 3LJOA 1KXBA 2EI7A 4X2WA 5JBBS 1V2MT 3SGQE 1EOJA 2WYJA 1IQEA 4BNRA 1V2QT 5EXNA 5EW2H 3GYLB 1TPOA 3ITIA 4Q2KA 3SNAA 5FXLA 1BIOA 4DT7B 5K0HA 1L0ZA 1O32A 2WPIS 1QFKH 1XXDA 1C2HA 2P94A 4U32A 6GCHF 1HCGA 2GCTB 1JOUB 1Y3YA 2OLGA 1TONA 4ABEA 5DP9A 1KXCA 4D9RA 3GCTG 1NM6A 1C5MD 3VB3A 3MU4A 3RMNH 2UWOA 2VWNA 2OBOA 2G52A 2VH0A 2ZHWH 3FP6E 2D1JA 3HK6B 1ANEA 1O2IA 1SLWB 2Z3CA 3TIUA 1FY5A 4WXVA 1C5ZB 1MUEB 1GJAB 1QR3E 1MKXH 1BOQA 4WH6A 3UWJH 1O3AA 1SR5C 2BVSH 3SZNA 1GBTA 2FOHA 2PTCE 2XCFA 3UFAA 1AWFH 1B5GH 1S83A 2NU4E 2R0LA 4YLUA 1BTHH 1W14U 1EAIA 1LPGB 2FO9A 4X6OA 4MPUA 1P2OA 1TA6A 2CJIA 3QTVH 5F8XA 4MPVA 3B8JA 3ZVCA 1BB0B 2BLWA 2O8WA 3BTKE 4OGXA 4LZ1H 1ZSLA 1VITF 5JDUB 1RIWC 1EUFA 4BAOB 1F92A 2GT7A 4DGJA 3TGIE 4I8LA 2A31A 1RFNA 5EW1H 1HUTH 1T8LA 2I6QA 2SGEE 1BA8B 1BDAA 3ZZ6A 1OSSA 2I6SA 4DJZB 4I33A 3FP8E 1GMCF 1ELFA 1ZJKA 1D3PB 1TGSZ 1BRBE 2G00A 2B0FA 3P92A 4JYUH 5A0BA 4J1YA 1IQIA 1SFQB 2EI6A 1HXEH 2VIQA 3RXBA 1QHRB 4UE7H 1SB1H 1V2WT 4O3UA 4ZXXH 1J14A 2O8TA 3PYHA 2FDAA 1LVMA 3ZV8A 1C4Y2 3DFLA 2FPZA 4NA9H 2ZHFH 4XSKU 4IGDA 1T7CA 1TX8A 5H4IB 1AVWA 1GHAF 1YCPK 3ZVAA 1E35B 1W7GH 4MTBA 1SGRE 3UOPA 1C5XB 3LOXA 1A46H 1A5IA 4UFGH 1INCA 1D4PB 1P2NA 1BUIA 4ZAEA 3SNEA 1NRNH 4XE4A 4CH8B 1MTVA 3C1KA 3SV2H 3K2UA 2GMTC 2Z9LA 1ZMJA 1WUNH 1DSTA 4THNH 1NO9H 2PR3A 1H9LB 3MU1A 1Z6JH 4O03A 3SORA 2Y5GA 5F8TA 3LU9B 2H2ZA 1O2RA 4X8UH 2HRVA 2ZDKA 1BITA 1LHCH 2P3TB 2AERH 1H9IE 4NGAH 1Z8GA 1ZHPA 4DCDA 1NROH 3KGPA 3BTHE 1TFXA 2P8OC 1DFPA 1HXFH 2QGRA 4Y11E 5FCRA 3M7QA 3B23B 2PKSC 4NCYA 5EPYA 3A89A 3PMHB 1AGJA 1EAUA 5AFYH 5ETXA 2R3YA 1XUFA 3MU5A 1P01A 1PFXC 2BDGA 1AFQB 4Z0KA 3SV6A 2A5KA 3I29A 1UTMA 5JBCS 1S0QA 2YNBA 1TYNA 2FXRA 3U8TH 4NFFA 3F9EA 4FU9A 1GHVH 2Q6FA 3EDXB 4ISIH 3U9AH 2QF0A 5F6MA 1V2KT 3LONA 1P2JA 3CS0A 1DS2E 1YPHC 2OD3B 1H1BA 2ODPA 5GIBA 3TPIZ 3PMBB 2XWAA 2ZQ1A 1J9CH 1O37A 1Y3VA 1GBLA 3SU3A 4AB8A 1O0DH 4DIIH 1MCTA 4GAWA 1P03A 2TGTA 4AFQA 1U6QA 1YF4A 1LHEH 4NIVA 2BD5A 2P3UB 1KSNA 3LGIA 1GJDB 7KMEH 4NSYA 1SQTA 1F7ZA 3NZIA 1OYQA 4R8TB 1G9IE 1XX9A 4KGAA 4IC6A 3D65E 3RXSA 1O31A 2WINI 3GICB 1O2XA 1BCUH 4ISNA 1ZMLA 3A7ZA 4A6LA 4AG2A 1DANH 3OYPA 3SU5A 2W3IA 4B76A 1OS8A 2VVCA 3D49H 1ELEE 3UWIA 1GI5A 1QRXA 1OP2A 3UY9A 3OTJE 4Y10E 2TBSA 4IN2A 2BLOA 1GJ8B 1QA0A 4NWKA 1Z8RA 3VB4A 1NT1A 1F0UA 3BTQE 2CGAA 4VGCB 4AYVB 1DPOA 1S84A 3M7UA 1C1UH 4CH2B 4BTIB 1TNGA 1EOLA 4MQAA 3SJ9A 1HJAB 2YOLA 5CHAC 4GHQA 2GZ9A 1YLCA 4FVDA 1XUIA 1EJMA 2ZCKP 1UCYH 3RUOA 3A8BA 1QBNA 4YM9A 1O5DH 4NFEA 4U30A 4YT7H 1DVAH 3RU4T 3ZVBA 1O5FH 1EPTC 2GP9B 1VITH 2J2UA 1GCTB 1GMHF 2THFB 1MCVA 2R2WU 2PTNA 1L1JA 2OUAA