3A7VA

Crystal structure of trypsin complexed with 3-formylbenzimidamide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7vA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7vA02
3K65B 2WV5A 4K8BA 1HAPH 4X1SU 3NKKA 1F0TA 2ZPRA 1AFQC 5G4BA 1GBMA 3D23A 1AQ7A 2ZU3A 1GL1A 3VPKA 5GWZA 5BRRE 2BVXH 1EPTC 2EI7A 5JB9S 2GP9B 4MPUA 1O3GA 1HAGE 4Q80A 3RMNH 1G32B 1XUJA 2VB0A 2PFEA 1HAVA 5DGJA 5ESTE 3RXCA 1LQDB 4XE4A 3F68H 3SNAA 2Z9GA 1DXPA 1OWKA 1PQAA 4JZDH 3A80A 5E0HA 2RA0A 1SGYE 3F6UH 1LDTT 4NCYA 3IWMA 3MO6A 2YNAA 3Q3XA 3MH4A 1TGCA 3A85A 1KDQA 1FY4A 1RJXB 1JXPA 4UFDH 4RN6A 5FCRA 3P95A 4ZXXH 4FUIA 2FODA 2NU3E 4K2YA 2HWLB 1ANDA 2JETC 3STJA 1NRRH 4Y76A 5DP7A 2BLVA 1TRNA 1BBRH 1V2LT 1GBEA 1MD7A 2HGTH 2Q1JA 1EX3A 4ZHAA 1MBMA 1MZDA 3HK3B 5DJ7A 1VCPA 2Z9KA 1GJ9B 1O5AB 2ZI2H 4AN7A 3FVFB 4HFPB 4B76A 2OQUA 2GVFA 1EATA 1F7ZA 3UTUH 3A7ZA 3MFJA 1T8MA 1MMJN 2FMJA 1Y5UT 2HNTF 2H9HA 3E90B 1FNIA 1FQ3A 3CP7A 1MUEB 1K1IA 1QNJA 1THRH 1GMCG 1Z8GA 3SJ9A 5DKMA 1UTNA 1XUFA 2PGQB 1QJ6B 1C9TA 2GV7A 1L1NA 2ZQ1A 5E0GA 1O5FH 3CENA 5EQRA 1D3PB 1DUEA 2HOBA 2QV1A 2VVCA 3VFEA 5AFYH 1SGEE 1O39A 1AZZA 3UREA 3Q76A 1DOJA 1OWEA 4RSPA 3ZZ8A 5DP4A 3QO6A 2FM2A 2R0KA 1WU1A 3S69A 4BAOB 3M7QA 4I8HA 3E8LA 1S83A 3URDA 2ANWA 1TPAE 5CMXH 2AYWA 1ARCA 1B0EA 4ZROA 1OP2A 3QWCH 3PMBB 2ZO3H 1P2MA 5L2ZH 4LOYH 4H4FA 2Z3EA 4FXGH 1AB9C 1ELCA 3P8GA 1XMNB 2CF8H 1GBJA 3S9CA 3SHCH 4WF8A 1HYLA 2QN5T 1JIRA 3LIWA 1O3JA 1NRQH 3B8JA 1QURH 3PWCA 1Y3YA 2GCTC 3V13A 1V2MT 1IHTH 3I78A 3C27B 3KGPA 4IGDA 1TPOA 4BTTB 4MQAA 1O2LA 1NY22 4HI3A 2C8ZB 1SOZA 1C5XB 3D49H 2PTNA 4NSYA 1SLVB 1D3QB 2BZ6H 1UCYE 1HAZB 1VJ9U 1EKBB 2VIPA 5FCKA 1KXDA 1GHAF 1O3BA 1GI9B 2GX4A 4B2CA 1ABJH 2AIQA 3RXJA 8KME2 1HFDA 1C2DA 1O2OA 1TNLA 2AGEX 1NFXA 3VGCB 1CA8B 1UTOA 1V2RT 4JZIA 3KIDU 1MKXK 1TGTA 4XBCA 1AKSA 1FY8E 3D62A 2BLOA 1C2FA 1V2KT 1IQKA 3UIRA 1BJUA 1IAUA 1O2PA 2Y5FA 3HKIB 1D3TB 5A2MH 1HJAB 1ZGIA 1QR3E 3GCHB 3SU1A 1HIAA 2AMPA 1EZQA 1SGPE 2P59A 2G55A 4FUBA 3P6ZB 1K9OE 2GMTC 1P9UA 1C5RA 3PYHA 1O2MA 2OUAA 1GHYH 1G37A 3ZVFA 1C2EA 3URCA 4H6TA 1O3OA 2KAIB 3RM0H 3ZVCA 3ZVBA 1BJVA 3PO1B 4K1EA 1P2NA 3A7WA 3SNBA 1XUHA 1MU8B 2AMQA 1HAIH 2C8YB 1BMLA 1BTWA 2OTVA 3A7XA 1B7XB 1S6FA 1TMUH 1LHGH 2D26C 1SFQB 5HM2A 1GBAA 2QIQA 4AG2A 2ZECA 2RCEA 1DDJA 2XNIA 2Y82A 2ZG0H 1SMFE 1BDAA 1P57B 1GBTA 1UVUH 3C1KA 2QXHA 1GCTB 1YPJH 4Q7ZA 2I6QA 2Z94A 1C1UH 1MD8A 2SGFE 2QXJA 4B1TA 1ELFA 3M5MA 1KY9A 2FTMA 1UK4A 1O3MA 1HJ9A 1Z7KA 2FS9A 1Z8JB 3GY8A 4XSKU 3ZV9A 4Q2KA 4ESTE 3M35A 3A7TA 1Y3WA 1YF4A 4O9VA 1LHDH 3D65E 4Y0ZE 4YZUA 1BQYA 4U2WA 1FAXA 3LH1A 1K2I1 1ETSH 5EODA 1NZQH 5FPSA 4B74A 1V2OT 1V2VT 2F9BH 1ZSLA 1ESAA 1UK2A 3QN7A 1QHRB 3U8OH 1A0JA 3OTJE 2O9QA 5FX5A 5HGGA 1P3EA 2A4QA 1NO9H 2QY0B 1C5UA 4Y10E 2VGCC 2VIWA 2Z7FE 4DW2U 2NU1E 5FAHA 1RRKA 2TGPZ 4IN1A 5C1UA 3DFLA 7LPRA 5F8XA 1O0DH 1C1RA 1KLJH 2Y81A 5GCHG 1O5EH 3GY3A 3V3MA 2O8UA 1GDUA 1WV7H 2D1JA 5FX6A 1YC0A 1DWCH 1TAWA 1SGCA 1TX7A 4H42U 1SL3A 4JK6A 1CU1A 3SU3A 1OWDA 2H6MA 4MTBA 1ANCA 2BLQA 3MNBA 3OY6U 3LGYA 1A46H 1P2OA 4I8GA 1C1MA 3EDXB 4B73A 1UK3A 1P05A 2F91A 1F0UA 1DWBH 1C1OA 1FN6A 1GBBA 3GCTF 5FPTA 2ZA5A 2AH4X 4J1YA 1C2HA 2BDGA 4O97A 1T32A 1U6QA 1C5NH 4FUEA 2ZDVH 1AGJA 4UEHH 3H7TA 2WYGA 4LXBH 1GCDA 2UUJB 1WQVH 1GHXH 2RA3A 5E0JA 1E37B 1MTSA 1O2ZA 2ZU5A 3BTGE 3FAOA 2FOEA 3NXPA 1FPHH 2JH5D 2ZFQH 4NA9H 1QQUA 5EXMA 2D8WA 4X0WU 1V2UT 2Y80A 3U9AH 3UNQA 3RC5A 3BIUH 2GZ8A 2F83A 1O35A 2WYJA 3PLBA 1DE7H 1O2JA 3OU0A 2V3HH 4X2WA 2FX6A 1SGDE 2PR3A 1V2JT 1FUJA 4DIHH 5EXNA 2ZCLP 3SORA 1DANH 3M5LA 1A5IA 1MKWK 1XKAC 4ZHMU 5JPMH 1O5DH 2DE8A 3RXHA 1ETRH 5GPIB 2IPHA 3ZZ9A 1Y59T 1T31A 2ZTZA 3AW0A 3RP2A 1NS3A 4ABAA 2FI5E 1BMAA 1GVLA 4Y8YA 1TLDA 1QJ1B 3SJ8A 1YPGH 3ATWA 1Y3VA 3PMAB 3RXUA 1JRTA 1BRUP 1LVMA 3AVZA 2R3UA 2SFAA 1O2YA 2OQ5A 4F4OC 4AG1A 2QCYA 2K1QA 1DSUA 4IMZA 3H7OA 3MWIU 2ZU4A 2G5VA 2QC2A 5J4QA 1H1BA 3LGIA 1ZZZA 1L1GA 1MQ6A 1OYQA 1RIWC 1EZXC 3T5FH 2ZFPH 1GHBF 3KQEA 1FXYA 1O2KA 1C1SA 4OGYA 2XC4A 3MHWU 2BY9X 2Y6TA 2ZQ2A 2ZEBA 5JBTA 1A61H 1VR1H 1BRAA 1CHGA 2ZFFH 3M7UA 3GDVA 4X8UH 5L2YH 2G5NA 6CHAB 3GISB 1G3BA 1P2KA 3MNXA 1HLTH 1BMNH 1GI3A 1LMWB 2GD4B 2WPHS 1UCYH 2ZHDA 4UONA 1FMGA 1O3NA 4CR5A 1N8OB 5DP8A 4LZ1H 5C5NA 4WMEA 1Q31A 1EOJA 2TBSA 1XUKA 1AUTC 4K60A 4JYVH 1TMTH 2VVVA 1A4WH 4ZUHA 1W3CA 2P8OB 1AWFH 1OSSA 1PPHE 5TCAA 1YPMH 4OGXA 4WVPE 1G30B 1TRYA 5FBEA 1DY8A 1VZQH 4KTUA 1ANEA 2W5EA 4R0IA 1GBIA 1TNKA 2O8WA 5DP3A 1MTUA 2R9PA 2WPJS 2TGDA 1HBTH 3MU4A 4B2AA 4X6OA 1LHEH 1HDTH 4LK4A 4E05H 1IQGA 1MTWA 2PW8H 1JMOH 2F9NA 3KHVA 2V0BA 1ZGVA 4AFSA 2ALPA 3UFAA 4OS2A 4I31A 2G51A 1RXPA 1DPOA 4WY3A 1TBRH 1FZZA 4A1XA 1NN6A 1TGNA 2Q6DA 5K0HA 2CHAB 1TPPA 4NIVA 4BXWA 7ESTE 1TFXA 1UVSH 1AY6H 4B75A 4FUCA 1P2IA 1CT2E 4CRAA 3RC4A 4UDWH 6GCHG 2P94A 1ARBA 1HPGA 1W12U 1AFQB 3NPSA 1C4V2 1FIWA 2WPMS 1BHXB 2ZCHP 1Y5BT 1O2HA 1EPTB 3SJKA 1O2QA 4DG4A 1KYNA 2XCFA 5EGMA 4BANB 1HNEE 2THFB 3RXFA 5JBCS 3QGNB 4LZ4B 4WWYA 1IQMA 2H5DA 3S9AA 1AE5A 1E38B 4KTSA 3ZZ3A 1INCA 1TOCB 1OKXA 1PQ7A 5EQSA 2BLWA 5I46H 1ZJKA 3A7VA 2PSXA 2AFQB 4E7NA 1K1JA 1HUTH 3U1IB 4MLFB 1Y3UA 4ABFA 2XXLA 3BTFE 1GMHF 4JK5A 5C1YA 4BOHA 2BD8A 3TJUA 1EP5A 2M5TA 1ZHPA 2A2QH 4O3UA 4D8NA 2AERH 1NU9A 1GPZA 1QBNA 2Z3DA 1DX5M 1ZPZA 2KAIA 2NU4E 3SUGA 2FI3E 4X2VA 2GZ9A 2B9LA 1L4DA 1T4VH 1V2TT 2ZFRH 5T6DA 3RUOA 1A2CH 1BMMH 4A92A 1MTVA 4CREA 2ZF0H 3SHAH 4ZAEA 1ZTLA 3DD2H 2BX4A 3B23B 2PKAB 4NSVA 2BD3A 1ELBA 3PTBA 1NT1A 3L33A 8LPRA 4INKA 1BIOA 2Y5GA 2ANKH 3TNSA 2J2UA 3E6PH 4DVAU 1SGNE 1KXEA 3RLYH 1VCWA 9LPRA 3ZZ4A 5LH8A 1QGFA 1AO5A 1ZTJA 2SGQE 2GGVB 2PTCE 1DY9A 2SGPE 1G3DA 1FLEE 5LPRA 3RMMH 1QL7A 4YLUA 1O3KA 4H6SB 4GSOA 1TRMA 5AFZH 1BHXF 2VWMA 3BTDE 1YCPK 4MNXA 3TIUA 8ESTE 1G2LA 1EAWA 1P8VC 1GL0E 3RU4E 4X1RU 4ISNA 1O2TA 4OS7A 1GJCB 3P8FA 4X8TH 1UHBB 2A7CA 1EZSC 1TNGA 1LQEA 1FN8A 1AB9B 4NWLA 1BTHH 1NM6A 3F9FA 3PLKA 4Y7AA 3M3VA 4K8YA 2FOFA 1O33A 3LT3A 3RXMA 2GCHG 5A0AE 3SI4H 2G81E 2GCTB 4B2BA 1LPZB 1C4U2 5ETXA 1S84A 1W0YH 1GI1A 2V35A 5B6OA 1VGCC 1F0SA 3RXLA 1D9IA 2SGDE 1Y8TA 2QF3A 1GWAA 2FOCA 2OC8A 1TNIA 1NRSH 4CR9A 3FFGA 1IQIA 3L6PA 2A2XH 4NA8A 5AF9H 1CQQA 4Y8ZA 1UTQA 1YCPH 3U69H 1W14U 2H1UA 3GY2A 1S6HA 2BDYA 3MTYA 4XBDA 1TGBA 3RU4T 2BZAA 3MH6A 2GV6A 1EQ9A 4Y6DA 3OY5U 3RMLH 5BPEA 1CHOF 1JBUH 3PWBA 1C1PA 5T6FA 3T25A 3BEIB 4OS6A 1J14A 2JKHA 3BV9B 1HAHH 1MCVA 1EAUA 2XWAA 3I77A 2ZGHA 4AB9A 5C2ZA 5C67A 1WOFA 3BTHE 5E2OA 4I8LA 9ESTA 5HMAA 4NFFA 1W13U 3STIA 1ZR0A 3F1SB 2TGTA 4TPYA 1THSH 4KP0A 2G8TA 4ZKNU 4SGAE 4R8TB 1DXWA 2G00A 4K69A 1EZUC 1O37A 3RM2H 1SOTA 1KTSB 1E36B 2AEIH 3M3SA 2VU8E 1PPFE 2GT7A 3GYMA 1YCPM 2P16A 2VIDA 1FJSA 1H9IE 3U8TH 1C1NA 4Y8XA 3QDZB 1GGDC 1DWDH 2G52A 3T26A 1P2JA 1DT2A 3RU4D 2VWOA 3RXKA 3T2NA 2XBYA 3AAUA 3MU5A 3SN8A 2ZPSA 4X1PU 1L2EA 1BUIA 3SO3A 2QYIA 1DWEH 4ZH8A 3TVJB 1G9IE 3RXTA 1O5BB 1S0RA 4GUXA 2ZTXA 3FZZA 1TBQH 4BAMB 1O2NA 4UFEH 2BXTH 5EU8A 4GCHF 3VB7A 4ISOA 3JZ2B 2UUFB 5I25A 4ZMAH 3AASA 3RXGA 1ORFA 1QCPA 1XM1A 2QXGA 4IC6A 4CBOA 1FIZA 2QAAA 2W26A 3SUEA 3RXEA 1CT0E 1OX1A 1FPCH 3TJNA 3PTNA 1CE5A 1Y5AT 1AE8H 2WPIS 2VGCB 1P09A 3PMHB 1BRCE 1W7GH 1EAIA 3DUXH 1S5SA 1UO6A 2FESH 1CT4E 3S9BA 4JCNA 1MTNB 2WV4A 3LH3A 1JWTA 2A5KA 4F49A 3UWJH 3RXRA 3UOPA 3SGQE 1GJ4H 1FAKH 1BB0B 1C5OH 1Q2WA 1RTKA 3A8DA 1D6WA 4OS1A 3NZIA 2A7HA 3P70B 1YPEH 5JDUB 4FU8A 1EAXA 1UVPA 1MKXH 3BG4C 2ANMH 5LGOA 2ZGCA 3E1XB 1TBZH 1TOMH 3FP6E 3EAJA 1DLEA 1KLTA 1T7CA 4BXSA 1LKAA 2HPPH 4D7FA 2XBXA 3P8OA 1WBGB 2EC9H 2BQWB 3TPIZ 1MBQA 1WYKA 2ODQA 3TGIE 4TY7A 4Z0KA 1ZMLA 5C3NA 4YT7H 3SV9A 3ZZ7A 5EW2H 1CGHA 1L4ZA 1OP8A 3PLPA 4THNH 5AVDA 1Z6JH 4D9RA 2CV3A 1A7SA 3EGKH 1GHAG 1LHCH 1MU6B 2VIVA 1YM0A 3RMOH 2C93B 1AIXH 5EXLA 4U30A 1AWHB 4ABHA 1W7XH 1V2NT 3M7TA 2PUQH 1O3FA 1BTYA 1BRBE 4KGAA 1WCZA 3KQBA 4YOGA 2ODYB 3LJOA 2H5CA 3GY7A 4ABIA 3VGCC 5EW1H 2QGRA 1S82A 3GY6A 4YTAA 4I8JA 1EJNA 4Y7BA 2ZC9H 4ABGA 1ID5H 5A0BA 2EI8A 3GCHC 1TGSZ 1ELAA 4NIYA 1GG6B 1SGFG 1ZRBA 2ULLA 3UPEA 2FX4A 4X1NU 5FPYA 3H5CB 5PTPA 1NRNH 1KDQB 2DUCA 3HK6B 1ZPCA 1PYTD 1LVYA 4Y0YE 4NIWA 3LDXH 2DE9A 4MNYA 2F9PA 3BSQA 2FI4E 1V3XA 1P0SH 1QL9A 4JZFH 4CH8B 1K21H 2QF0A 1EB2A 2VNTA 3PO1C 3RC6A 3A8BA 1BT7A 2ZGXH 1N6XA 5JYIA 1ELGA 3BF6H 1BTPA 1TABE 1YPKH 1J15A 1Z6EA 4TPIZ 1RIWB 5JBBS 3SU2A 3EA7A 3LPRA 2GKVE 5L30H 1GHWH 2XW9A 1PJPA 1EP6A 1AI8H 1T8LA 1IOEA 1H8IH 3MO3A 7GCHF 2F9VA 1GMDF 1F5LA 1O2WA 1GJ6A 2PKAA 1GBHA 2SGAA 2VIQA 4YT6H 1GCTC 5DK1A 2XBWA 1XKBC 1HCGA 1C1VH 4ZKSU 3SV7A 2A4GA 4Z6AH 3SU5A 5E2PA 1ZMNA 1K1OA 1XUGA 4BAQB 5EPNA 4OS4A 3SI3H 6ESTA 5CHAC 1O2SA 4JZEH 8GCHF 1ZSKA 4A1TA 4AZ2B 1K1PA 4WH6A 2YOLA 1MQ5A 1QY6A 2W7UA 1TA2A 2B5TB 4XOJA 2WPKS 1IQJA 1EUFA 1W10U 1MH0A 2PUXB 4UFGH 1SGQE 1SHYA 3KQDA 1TA6A 2Z9LA 3VXEH 2FWWA 2Z9JA 1PFXC 4JYTA 1IQHA 1AVWA 1IQLA 2HVXA 2EEKA 4XDEA 3ZVDA 1AUJA 4U32A 1PPCE 1MCTA 1TX6A 1P12E 2HRVA 3NCLA 3RDZA 3SV2H 1KXCA 1V6DA 2VIOA 2A5IA 1RFNA 1D4PB 3GY4A 1HAOH 2A1DB 1XVMA 1ABIH 2W3KA 1PPBH 2Q6FA 3E0NB 2SNVA 3EYDA 2FPZA 4E7RG 2BD5A 4KKDA 2EA3A 2H2ZA 3UQOA 3GCTG 1P11E 1VITF 1OWJA 1E0FD 3W95A 4INHA 1MKWH 1PPEE 2V6NA 1YBWA 1GJDB 2AGGX 2WPLS 3T28A 2F9OA 1SPJA 1TWXB 3DA9B 2PKSC 1OPHB 7KMEH 1QA7A 2Q6GA 4CH2B 1TIOA 2J95A 1QRZA 4NG9H 1SSXA 2EI6A 1P10A 4AFZA 2RG3A 4O03A 4CRGA 1SGTA 3QZRA 3AAVA 3O8BA 1D3DB 3FZDA 1NPMA 3BTTE 2R3YA 1SHHB 4DT7B 1Z8IB 2BB4A 2ZGJA 4CRBA 4ZXYH 3BEUA 1SGFA 2GDEH 4E06H 2A4RA 1HAXB 1Z1JA 3MU0A 3UWIA 3SV8A 1GI6A 1O31A 1TNJA 2PLXA 4CRDA 1K1MA 1AFEH 2PHBA 1C5VA 1KTTB 1CA0B 2BDCA 3TK6A 2ZIQH 3ENSB 2QXIA 1A5GH 4CHAC 4FUGA 2SNWA 1NTPA 1GI4A 2STAE 5LPFA 1IQEA 2GT8A 4GVUA 4XBBA 2XC0A 2J94A 3R0FA 1YLCA 2FZZA 1MZAA 2TIOA 2O8TA 1NFWA 3QZQA 1S85A 2FOGA 2BOKA 1GI8B 1QL8A 2ZU2A 3MO9A 3SZNA 2FOHA 1T4UH 1PPGE 4ZKOU 5GDSH 5TJXA 2ZGBH 1EASA 1GJ7B 2ANYA 1ZJDA 1ZHMA 3GCOA 4AFUA 1OOKB 1GHBG 3HPTB 3SV6A 1AVGH 2C90B 3E91A 2BD4A 3W94A 1BITA 1XVOA 2ZU1A 2BD9A 1C4Y2 1GVZA 1PQ8A 1O2RA 1C5ZB 4X2YA 5FBIA 1J17T 2B8OH 1QTFA 2ZDMA 3JZ1B 4PROA 1PQ5A 4GPGA 1FONA 5DP5A 4M7GA 1ETTH 4D9QA 2OCVB 1GJ8B 1DFPA 3RXOA 1GHZA 3OSYA 1YPHC 3UUZA 3EA8A 1QQ4A 1FDPA 5E8EH 1LHFH 3EA9A 1O5GH 3QTVH 3TH4H 3VB6A 3TJOA 1O3IA 1GJ5H 1L1JA 1QJ7B 1CBWC 1P03A 3GOVB 3M61U 5T6GA 4FU9A 4ZKRU 1C5SA 4YOJA 2XRCA 2FTLE 2ASUB 1NU7B 2JETB 4X6PA 1TYNA 1Z71A 1O2XA 1G36A 2A31A 2ZKSA 4TWWA 3T62A 1LCYA 2BD7A 2VVUA 2G4UA 2GTBA 2TGAA 1UMAH 2XCNA 2FIRH 2XYAA 2ZDKA 2OC0A 2NWNA 1VJAU 1QB1A 1VGCB 2XWBI 5GJ4B 2HPQH 3A7YA 4Q7YA 1QRXA 1H9LB 2NU0E 3KNXA 2CN0H 4CRCA 3SQHE 3GY5A 3BEFB 1P04A 4TYDA 2ZFSA 3I29A 2P95A 3HGPA 1SR5C 1MAYA 3DHKH 1WTHD 1AZ8A 3LGWA 3M5NA 2ZDNA 5IYTA 2B7DH 1RD3B 2WUCA 3SJIA 1P3CA 3A84A 2BTCE 3V0XA 1GBDA 4HZHA 4X8VH 3V7TA 5F8ZA 1GMCF 1EOLA 2ZHFH 2ZHWH 3QGJA 3S7KB 3ZZDA 1IHSH 1THPB 2UUKB 1SGRE 1SQOA 1SVPA 1BBRK 3RXSA 3ELAH 3IG6B 1S0QA 1YPLH 2BY5X 3UR9A 2J34A 4NZLA 1GJAB 2OC1A 3R3GB 4XFQA 3ATKA 1F92A 2FXRA 1W8BH 3TITA 4A6LA 1Z8RA 5F03A 3SOSA 1E34B 3BG8A 1UVOA 3ZV8A 1UVTH 4Y11E 2FEQH 1GMHG 3GDUA 1F5KU 1HB0B 1SLUB 2JH6D 3S7HB 1GI7B 4K1SA 1LTOA 3P92A 1GGDB 4DGJA 1O2UA 2UWLA 3MI4A 4K1TA 1CGIE 1O3HA 1DS2E 1BZXE 2SGEE 2C8WB 4MPVA 1ESBA 2OP9A 5EOKA 3KCGH 4AGJA 5DO4H 1TNHA 1ESTA 5DP6A 3TNTA 3KL6A 1QIXB 1W0ZU 4VGCC 5A8ZA 1T8OA 3GYLB 1P02A 1TQ0B 2XTTB 2HNTC 2FLBH 5DPAA 3ATLA 4BAHB 1HAYB 3DFJA 4RKOB 2Z9IA 1K22H 3RXBA 5EG4A 1V2QT 2FP7B 1EXFA 1LPGB 4WJG2 4J2YB 3Q3YA 3M3TA 1J9CH 5HYOA 1O3DA 1OXGA 1EJMA 3HKJB 1RS0A 2RDLA 3QLPH 2A0QB 1ELDE 3CS0A 1TX8A 2Y5HA 1X7AC 2AS9A 2GMTB 3T29A 4GLYA 3SU6A 1RTFB 1KLIH 3LOXA 3LGUA 1GBCA 2W7SA 3MNCA 2Z6BD 4KELA 1C5QA 4Y79A 1GBKA 1H4WA 3FP8E 3ODFA 4IC5A 2BDAA 5J4SA 4AYVB 2WINI 4X1QU 3TGJE 1DM4B 4ZHLU 4YLQH 2J9NA 3U8RH 3RXAA 1C5WB 1A0LA 1GI0A 1BTZA 3MYWA 2BY7X 1V2ST 2BY6X 2VINA 1A0HB 1O3EA 1C2IA 1C2GA 2G4TA 3UR6A 3BG4B 2J92A 2OD3B 1OWHA 1NFUA 3DT0H 1FY3A 1S81A 1GI2A 1YGCH 3A87A 2A45B 1O2GH 1ZMJA 1P06A 3OYPA 3UOUA 5L6NH 1HGTH 1ACBE 1ANBA 4MDSA 3QK1A 5EPYA 3UNSA 1DSTA 4KTCA 5A09A 1FY5A 2I6SA 2ILNA 2CF9H 2LPRA 2O8LA 1A3EH 1QBOA 1FY1A 1C1TA 1GI5A 1HV7A 5C1XA 5AHGH 4K5ZA 2Y7XA 5CE1A 3RXVA 3TU7H 4NIXA 3ZZ5A 1ZTKA 2ZWLH 3LONA 5A8XA 1TQ7B 3ZZ6A 4NFEA 2LNCA 2Y7ZA 4DJZB 3OX7U 1K28D 1CHOG 3LKWA 2Z3CA 3GCNA 3M36A 4UE7H 3LGVA 3ZYDA 3O8CA 2BQ7B 5A0CA 4NGAH 1HXFH 4BAKB 1O38A 2YNBA 1H8DH 2ZPQA 1FV9A 3SUDA 2R2MB 3KN2A 2UWPA 1LVBA 1AMHA 1W11U 2ZCKP 4FUDA 3VB4A 4DCDA 1SFIA 2BMGB 5T3HA 5GCHF 1HRTH 4YO9A 2STBE 1Q3XA 1DLKB 1OS8A 5C5OA 1Z1IA 3ZVAA 5F8TA 4YOIA 1O34A 3PB1E 2H9EH 1O3CA 3BN9A 2OLGA 1NRPH 1KXBA 1LVOA 1EJAA 5DG6A 3LGTA 2ALVA 3A8CA 4UD9H 4FVBA 3VB3A 3A83A 3FP7E 3SGBE 1ZHRA 4I32A 2BD2A 2CJIA 1DICA 2F9UA 5HXFA 1C5YB 2NU2E 4A5TS 4IMQA 1XX9A 4B71A 3GDSA 4IS5A 3U98H 4FVDA 1C5MD 2VWNA 2BYAX 3K6YA 3QUMP 2B0FA 3MNSA 2P3FH 2HLCA 4IN2A 3FANA 1SQTA 1A3BH 1F0RA 1G3CA 3NK8A 1O30A 4GCHG 1TALA 3UQVA 2P3UB 1C1QA 4UFFH 1SGIB 3ATMA 3QTOH 4DOQA 1TMBH 3ZZBA 5ABWA 5IDKA 1ZYOA 2ZTYA 3M5OA 3SU0A 2VH0A 2QA9E 4BTUB 1EPTA 3GICB 1C9PA 2H9TH 1HAVB 1WAYB 3A89A 5CHAB 1KXAA 3MU8A 3O8RA 1WSSH 2VH6A 4CRFA 2GDDA 1P2QA 1HJAC 3A88A 4MVNA 1XXFA 1E35B 5ESBA 2BDIA 1LKBA 1GJBB 2BQ6B 2BX3A 2OXSA 3PMJA 1TB6H 2CGAA 2ZFTA 4A1VA 3IITA 3WY8A 1WQSA 3BTEE 3E3TA 1C5PA 1QFKH 4WH8A 2PV9B 3A8AA 3O8DA 3KQCA 4MPWA 1C2MA 1MTNC 4QT8C 5LPEA 1WUNH 4AFQA 2ESTE 2O8MA 4JZ1A 1YP9A 3UY9A 2ZHEH 1G3EA 3M37A 4HGCA 1YKTA 2ZZUH 4I33A 4U01A 1UTLM 1O3AA 4WMDA 3T27A 3AW1A 4JYUH 3TK5A 1MAXA 1C1WH 3LU9B 4AORA 2PSYA 4GAWA 3MH7A 2PKSB 1CGJE 1UTMA 1DITH 1ELVA 1A1RA 2BDBA 3CS7A 3TLOA 2ZDAH 1F2SE 1AU8A 4ISHH 5H4IB 5A8YA 1UJ1A 3V12A 4AOQA 1IQNA 1EB1H 4Y71A 1UTKA 1UTPA 3MU1A 2IJOB 4ABJA 2C3SA 3PM3A 4DIIH 2CMYA 5HM9A 1PYTC 4AYYB 3Q77A 3BTQE 1SQAA 4O3TA 3BIVH 2ODPA 1PPZA 2VWLA 1WTGH 1ZSJA 4X6NA 2OC7A 5GIBA 1P9SA 4BTIB 1YPHE 4MNVA 2HALA 4AGKA 1BBRE 3SNEA 1N1LA 4MNWA 3U1JB 1FI8A 4CHAB 1O36A 3MH5A 4FUFA 1C5TA 2BXUH 1DVAH 1K1LA 1UHBA 4K3JA 1UTJA 4JMYA 1GG6C 1TE0A 3BTKE 1OP0A 4TY6A 3ZZAA 3ZZCA 3BTWE 3P8NA 1RGQA 3P17H 2AMDA 3L3TA 4X6MA 1NROH 2ZDLA 2FS8A 2FOBA 3K6ZA 3S0NA 1C2LA 2UWOA 5TCCA 1UCYK 2A5AA 1QB6A 3NWUA 1SB1H 3F9HA 3HATH 2UUYA 1VCQA 3SNDA 2FYQA 1QBVH 4NZQA 3ZYEA 1AD8H 2ZP0H 1JIMA 2XBVA 1O3LA 4GHQA 1K1NA 4X2XA 3VB5A 1A5HA 7GCHG 3LC5A 1GMDG 3PROA 1KXFA 3A82A 4CBNA 4D7GA 2D2DA 1AKSB 3Q3KA 6GCHF 1XUIA 1D6RA 1J16A 2XC5A 2ZHQH 1ELTA 1RTLA 2FO9A 3MOCA 2WUBA 2OBQA 4TWYA 4ASHA 3F9GA 2BHGA 2FYRA 1HIAB 2P3TB 1GVKB 3KF2A 4YESB 4INLA 1TONA 3SW2B 5JB8S 8GCHG 2BVSH 1BCUH 2P93A 4BNRA 1GBFA 1C2KA 1CBWB 3BTME 1L0ZA 2BDHA 2R2WU 1AN1E 3SGAE 2PWXA 1TPSA 1NESE 2BVRH 3NUMA 4X8SH 3A86A 1GBLA 3SJOA 4HTCH 5DP9A 3K9XB 3E16B 1HXEH 1OWIA 2AGIX 2AIPA 3ATIA 1ZLRA 1XXDA 4YM9A 2J4IA 1C2JA 5SGAE 3HGNA 1IQFA 1F5RA 2R0LA 4MPXA 1SBWA 4OS5A 2IOTA 3RXIA 1QA0A 5F6MA 2W3IA 4FU7A 1SG8B 1O5CB 1V2WT 1SLXB 2TPIZ 3B9FH 1LO6A 1B0FA 1VITG 1YLDA 5FHTA 2ZNKH 4A7IB 3ZVGA 5K7RA 3ESTA 2J38A 1GHVH 2V3OH 1QB9A 1SC8U 2HNTE 2TRMA 4I8KA 3EQ0H 4ISLA 2BM2A 3F9EA 3VXFH 3PV4A 4FUJA 3E0PB 1ZPBA 1OYTH 4ISIH 2FDAA 2OBOA 4WXIA 1ZOMA 1AVXA 1N6YA 4DY7B 1VITH 4NA7A 2BOHB 1SI5H 3RLWH 1B5GH 6CHAC 3RXQA 4MG3A 2BY8X 3VEQB 1G2MA 4IBLH 3SQEE 1W2KH 2FOAA 1JOUB 2FLRH 3TJVA 1JRSA 3TGKE 4AX9H 4SGBE 4WMFA 2A32A 3LJJA 2VJ1A 1BA8B 1GDQA 1NFYA 1N8OC 1O3PB 4RKJB 1V2PT 3G01A 5JBAS 2JH0D 1ZRKA 3TH3H 4DURA 2C4FH 1KIGH 3Q00A 1H9HE 1CO7E 3MMGA 4D76A 2PGBB 2A7JA 3SU4A 1LPKB 3UNRA 2P8OC 5EQQA 4WXVA 2FOMB 3ZVEA 3ITIA 1J8AA 1AHTH 1KSNA 1O2IA 4Q7XA 3RXDA 1T8NA 3TK9A 1O2VA 6LPRA 1DUAA 1BTUA 3N7OA 2OINA 4GHTA 3TH2H 1BOQA 2A4OA 4ABEA 3EE0B 1SLWB 1CA0C 3QX5H 2GCHF 3SUFA 1C5LH 3SBKA 1O32A 2CXVA 5GXPA 1Y3XA 3KEEA 4VGCB 3RXPA 1ELEE 2F3CE 4AB8A 1NC6A 4I7YH 1P01A 5C20A 3K2UA 4FUHA 4NWKA 2CHAC 3A81A 1M9UA 1QRWA 3SNCA 4ABDA 4ABBA 1CSOE 1GDNA 4IW4E 2GZ7A 2IN2A 2C8XB 1BTXA 1YYY1 3ODDA 5FXLA 1HJ8A 1CVWH 3LC3A
chains in the Genus database with same CATH superfamily
3K65B 2WV5A 4K8BA 1HAPH 4X1SU 3NKKA 1F0TA 2ZPRA 1AFQC 5G4BA 1GBMA 3D23A 1AQ7A 2ZU3A 1GL1A 3VPKA 5GWZA 5BRRE 2BVXH 1EPTC 2EI7A 5JB9S 5EJZA 2GP9B 4MPUA 1O3GA 1HAGE 4Q80A 5CHBA 1G32B 1XUJA 2VB0A 3RMNH 2PFEA 1HAVA 5DGJA 5ESTE 3RXCA 1LQDB 4XE4A 3F68H 3SNAA 2Z9GA 1DXPA 1OWKA 1PQAA 4JZDH 3A80A 5E0HA 2RA0A 1SGYE 3F6UH 1LDTT 4NCYA 3IWMA 3PRBA 3MO6A 2YNAA 3Q3XA 3MH4A 1TGCA 3A85A 1KDQA 1FY4A 1RJXB 3FOAA 1JXPA 4UFDH 4RN6A 5FCRA 3P95A 4ZXXH 4FUIA 2FODA 2NU3E 4K2YA 2HWLB 2OK5A 1ANDA 2JETC 3STJA 1NRRH 4Y76A 5DP7A 2BLVA 1TRNA 1BBRH 1V2LT 1GBEA 1MD7A 2HGTH 2Q1JA 1EX3A 4ZHAA 1MBMA 1MZDA 3HK3B 5DJ7A 1VCPA 2Z9KA 1GJ9B 1O5AB 2ZI2H 4AN7A 3FVFB 4HFPB 4B76A 2OQUA 2GVFA 1EATA 1F7ZA 3UTUH 3A7ZA 3MFJA 1T8MA 1MMJN 2FMJA 1Y5UT 2HNTF 2H9HA 3E90B 1FNIA 1FQ3A 3CP7A 1MUEB 1K1IA 1QNJA 1THRH 2K8IA 1GMCG 1Z8GA 3SJ9A 5DKMA 1UTNA 1XUFA 2PGQB 1QJ6B 1C9TA 2GV7A 1L1NA 2ZQ1A 5E0GA 1O5FH 3CENA 5EQRA 1D3PB 1DUEA 3GS9A 2HOBA 2QV1A 2VVCA 4Q63A 3VFEA 5AFYH 1SGEE 1O39A 1AZZA 3UREA 3Q76A 1DOJA 1OWEA 4RSPA 3ZZ8A 5DP4A 3QO6A 2FM2A 2R0KA 1WU1A 3S69A 4BAOB 3M7QA 4I8HA 3E8LA 1S83A 3SZEA 3URDA 2ANWA 1TPAE 5CMXH 2AYWA 1ARCA 1B0EA 4ZROA 1OP2A 3QWCH 3PMBB 2ZO3H 1P2MA 5L2ZH 4LOYH 4H4FA 5HKKD 2Z3EA 4FXGH 1AB9C 1ELCA 2KCYA 3P8GA 1XMNB 2CF8H 1GBJA 3S9CA 3SHCH 4WF8A 1HYLA 2QN5T 1JIRA 3LIWA 1O3JA 1NRQH 3B8JA 1QURH 3PWCA 1Y3YA 2GCTC 3V13A 1V2MT 1IHTH 3I78A 3C27B 3KGPA 4IGDA 1TPOA 4BTTB 4MQAA 5C94A 1O2LA 1NY22 4HI3A 2C8ZB 1SOZA 1C5XB 2YMSC 2PTNA 3D49H 4NSYA 1SLVB 1D3QB 2BZ6H 1UCYE 1HAZB 1NBME 1VJ9U 1EKBB 5GNDA 3KYGA 2VIPA 5FCKA 1KXDA 1GHAF 1O3BA 1GI9B 2GX4A 4B2CA 1ABJH 2AIQA 3RXJA 8KME2 1HFDA 1C2DA 1O2OA 1TNLA 2AGEX 1NFXA 3VGCB 1CA8B 1UTOA 1V2RT 4JZIA 3KIDU 1MKXK 1TGTA 4XBCA 1AKSA 4XD7D 1FY8E 3D62A 2BLOA 1C2FA 1V2KT 1IQKA 3UIRA 1BJUA 1IAUA 1O2PA 2Y5FA 3HKIB 1D3TB 5A2MH 1HJAB 1ZGIA 1QR3E 3GCHB 3SU1A 1HIAA 2AMPA 1EZQA 1SGPE 2P59A 3EE7A 2G55A 4FUBA 3P6ZB 3F0PA 1K9OE 2GMTC 1P9UA 1C5RA 3PYHA 1O2MA 2OUAA 1GHYH 1G37A 3ZVFA 1C2EA 3URCA 4H6TA 1O3OA 2KAIB 3RM0H 3ZVCA 3ZVBA 1BJVA 3PO1B 4K1EA 1P2NA 3A7WA 3SNBA 1XUHA 1MU8B 2AMQA 1HAIH 2C8YB 1BMLA 1BTWA 2OTVA 3A7XA 1B7XB 1S6FA 1TMUH 4YXWD 1LHGH 2D26C 1SFQB 5HM2A 1GBAA 2QIQA 4AG2A 2ZECA 2RCEA 1DDJA 2XNIA 2Y82A 2ZG0H 1SMFE 1BDAA 1P57B 1GBTA 1UVUH 3C1KA 2QXHA 1GCTB 3DSOA 1YPJH 4Q7ZA 2I6QA 2Z94A 1C1UH 1MD8A 2SGFE 2QXJA 3FO8D 4B1TA 1ELFA 3M5MA 1KY9A 2FTMA 1UK4A 1O3MA 1HJ9A 1Z7KA 2FS9A 1Z8JB 3GY8A 4XSKU 3ZV9A 4Q2KA 4ESTE 3M35A 3OEHD 3A7TA 1Y3WA 2K0QA 1YF4A 4O9VA 1LHDH 3D65E 4Y0ZE 4YZUA 1BQYA 4U2WA 3VG8A 1FAXA 3LH1A 1K2I1 4P00A 1ETSH 5EODA 1NZQH 5FPSA 4B74A 1V2OT 1V2VT 2F9BH 1ZSLA 1ESAA 1UK2A 3QN7A 2QF5A 1NBMD 1QHRB 3U8OH 1A0JA 3OTJE 2O9QA 5FX5A 5HGGA 1P3EA 2A4QA 1NO9H 2QY0B 4P02A 1C5UA 4Y10E 2VGCC 2VIWA 2Z7FE 4DW2U 2NU1E 5FAHA 5KECA 1RRKA 2TGPZ 4IN1A 5C1UA 3DFLA 7LPRA 5F8XA 1O0DH 1C1RA 1KLJH 2Y81A 5GCHG 1O5EH 3GY3A 3V3MA 2O8UA 1GDUA 1WV7H 2RFKC 2D1JA 5FX6A 1YC0A 1DWCH 1TAWA 1SGCA 1TX7A 4H42U 1SL3A 4JK6A 1CU1A 3SU3A 2KX4A 1OWDA 2H6MA 4MTBA 1ANCA 2BLQA 3MNBA 3OY6U 3LGYA 1A46H 1QZ8A 1P2OA 4I8GA 1C1MA 3EDXB 4B73A 1UK3A 1P05A 2F91A 1F0UA 1DWBH 1C1OA 1FN6A 1GBBA 3GCTF 5FPTA 2ZA5A 2AH4X 4J1YA 1C2HA 2BDGA 4O97A 1T32A 1U6QA 1C5NH 4FUEA 2ZDVH 1AGJA 4UEHH 3H7TA 2WYGA 4LXBH 1GCDA 2UUJB 4Q4LA 1WQVH 1GHXH 2RA3A 5E0JA 1E37B 1MTSA 1O2ZA 2ZU5A 3BTGE 3FAOA 2FOEA 3NXPA 1FPHH 2JH5D 2ZFQH 4NA9H 1QQUA 5EXMA 2D8WA 4X0WU 1V2UT 2Y80A 3U9AH 3UNQA 3RC5A 3BIUH 2GZ8A 2F83A 3ZIAD 1O35A 2WYJA 3PLBA 1DE7H 1O2JA 3OU0A 2V3HH 4X2WA 2FX6A 1SGDE 2PR3A 1V2JT 1FUJA 4DIHH 5EXNA 2ZCLP 3SORA 1DANH 3M5LA 1A5IA 1MKWK 1XKAC 4ZHMU 5JPMH 1O5DH 2DE8A 3RXHA 1ETRH 5GPIB 2IPHA 1SQRA 3ZZ9A 2RDEA 1Y59T 1T31A 2ZTZA 3AW0A 3RP2A 1NS3A 4ABAA 2FI5E 1BMAA 1YWUA 1GVLA 4Y8YA 1TLDA 1QJ1B 3SJ8A 1YPGH 3ATWA 1Y3VA 3PMAB 3RXUA 1JRTA 1BRUP 1LVMA 3AVZA 2R3UA 2SFAA 1O2YA 2OQ5A 4F4OC 4AG1A 2QCYA 2K1QA 1DSUA 4IMZA 3H7OA 3MWIU 2ZU4A 2G5VA 2QC2A 5J4QA 1H1BA 3LGIA 1KMHB 1ZZZA 1L1GA 1MQ6A 1OYQA 1RIWC 1EZXC 3T5FH 2ZFPH 1GHBF 3KQEA 1FXYA 1O2KA 1C1SA 4OGYA 2XC4A 3MHWU 2BY9X 2Y6TA 2ZQ2A 2ZEBA 5JBTA 1A61H 1VR1H 1BRAA 1CHGA 2ZFFH 3M7UA 3GDVA 4X8UH 5L2YH 2G5NA 6CHAB 3GISB 1G3BA 1P2KA 3MNXA 1HLTH 1BMNH 1GI3A 1LMWB 3F2FA 2GD4B 2WPHS 1UCYH 2ZHDA 4UONA 1FMGA 1O3NA 4CR5A 1N8OB 5DP8A 4LZ1H 5C5NA 4WMEA 1Q31A 1EOJA 2TBSA 1XUKA 1AUTC 4K60A 4JYVH 1TMTH 2EY4C 5EJLA 2VVVA 1A4WH 4ZUHA 1W3CA 2P8OB 1AWFH 1OSSA 1PPHE 5TCAA 1YPMH 4OGXA 4WVPE 1G30B 1TRYA 5FBEA 2WHXA 1DY8A 1VZQH 4KTUA 1ANEA 2W5EA 4R0IA 1GBIA 1TNKA 2O8WA 5DP3A 1MTUA 2R9PA 2WPJS 2TGDA 1HBTH 3MU4A 4B2AA 4X6OA 1LHEH 1HDTH 4LK4A 4E05H 1IQGA 1MTWA 2PW8H 1JMOH 2F9NA 3KHVA 2V0BA 1ZGVA 4AFSA 2ALPA 3UFAA 4OS2A 4I31A 2G51A 1RXPA 1DPOA 4WY3A 1TBRH 3UAIC 1FZZA 4A1XA 1NN6A 1TGNA 1E1RD 2Q6DA 5K0HA 2CHAB 1TPPA 4NIVA 4BXWA 7ESTE 1TFXA 1UVSH 1AY6H 4B75A 4FUCA 1P2IA 1CT2E 4CRAA 3RC4A 4UDWH 6GCHG 2P94A 1ARBA 1HPGA 1W12U 1AFQB 3NPSA 1C4V2 1FIWA 2WPMS 1BHXB 2ZCHP 1Y5BT 1O2HA 1EPTB 3SJKA 4Z1MD 1O2QA 4DG4A 1KYNA 2XCFA 5EGMA 4BANB 1HNEE 2THFB 3OAAD 3RXFA 5JBCS 3QGNB 4LZ4B 4WWYA 1IQMA 2H5DA 3S9AA 1AE5A 1E38B 4KTSA 3ZZ3A 1INCA 1TOCB 1OKXA 1PQ7A 5EQSA 2BLWA 5I46H 1ZJKA 3A7VA 2PSXA 2AFQB 4E7NA 1K1JA 1HUTH 3U1IB 5DSFA 4MLFB 1Y3UA 4ABFA 2XXLA 3BTFE 1GMHF 4JK5A 5C1YA 4BOHA 3PRDA 2BD8A 3TJUA 1EP5A 2M5TA 1ZHPA 2A2QH 4O3UA 4D8NA 2AERH 2GJGA 1NU9A 1GPZA 1QBNA 2Z3DA 1DX5M 1ZPZA 2KAIA 2NU4E 2IPQX 2CK3D 3SUGA 2FI3E 4X2VA 2GZ9A 2B9LA 1L4DA 1T4VH 1V2TT 5HIYA 2ZFRH 5T6DA 3RUOA 1A2CH 1BMMH 2V3MA 1MTVA 4A92A 4CREA 2ZF0H 3SHAH 4ZAEA 1ZTLA 3DD2H 2BX4A 3B23B 2PKAB 4NSVA 2BD3A 1ELBA 3PTBA 1NT1A 3L33A 8LPRA 4INKA 1BIOA 2Y5GA 2ANKH 5CDFE 3TNSA 2J2UA 3E6PH 4DVAU 2JDID 1SGNE 1KXEA 5F53A 3RLYH 1VCWA 9LPRA 3ZZ4A 5LH8A 1QGFA 1AO5A 1ZTJA 2SGQE 2GGVB 2PTCE 1DY9A 2SGPE 1G3DA 1FLEE 5LPRA 3RMMH 1QL7A 4YLUA 5KGOA 1O3KA 4H6SB 4GSOA 1TRMA 5AFZH 3PV5A 1BHXF 2VWMA 3BTDE 1YCPK 4MNXA 4M9FA 3TIUA 8ESTE 1G2LA 1EAWA 1P8VC 1GL0E 3RU4E 4X1RU 4ISNA 1O2TA 4OS7A 1GJCB 3P8FA 4X8TH 1UHBB 2A7CA 1EZSC 1TNGA 1LQEA 1FN8A 1AB9B 4NWLA 1BTHH 1NM6A 3F9FA 3PLKA 4Y7AA 3M3VA 5EJ1A 4K8YA 2FOFA 1O33A 3LT3A 3RXMA 2GCHG 5A0AE 3SI4H 2G81E 2GCTB 4B2BA 1LPZB 1C4U2 5ETXA 1S84A 1W0YH 1GI1A 2V35A 5B6OA 1VGCC 1SKYE 1F0SA 3RXLA 1D9IA 2SGDE 1Y8TA 2QF3A 2YMSB 1GWAA 2FOCA 2OC8A 1TNIA 1NRSH 4CR9A 3FFGA 1IQIA 3L6PA 2A2XH 4NA8A 5AF9H 1CQQA 4Y8ZA 1UTQA 2WV9A 1YCPH 3U69H 1W14U 2H1UA 3GY2A 1S6HA 2BDYA 3MTYA 4XBDA 1TGBA 3RU4T 2BZAA 3MH6A 2GV6A 4RT1A 1EQ9A 4Y6DA 3OY5U 3RMLH 5BPEA 1CHOF 1JBUH 3PWBA 1C1PA 5T6FA 3T25A 3BEIB 4OS6A 1J14A 2JKHA 3BV9B 1HAHH 1MCVA 1EAUA 2XWAA 3I77A 2ZGHA 4AB9A 5C2ZA 5C67A 1WOFA 3U28C 3BTHE 5E2OA 4I8LA 9ESTA 5HMAA 4NFFA 1W13U 3STIA 1ZR0A 3F1SB 5KEDA 2TGTA 4TPYA 1THSH 4KP0A 2G8TA 4ZKNU 4SGAE 4R8TB 2IJD1 2G00A 4K69A 1DXWA 1EZUC 1O37A 3RM2H 1SOTA 1KTSB 1E36B 2AEIH 3M3SA 2VU8E 1PPFE 2GT7A 3GYMA 1VKYA 1YCPM 2P16A 2VIDA 1FJSA 1H9IE 3U8TH 1C1NA 4Y8XA 3QDZB 1GGDC 1DWDH 2G52A 3T26A 1P2JA 1DT2A 3RU4D 2VWOA 3RXKA 3T2NA 2XBYA 2J98A 3AAUA 3MU5A 2WSSD 3SN8A 2ZPSA 4X1PU 1L2EA 1BUIA 3SO3A 1OHHD 2QYIA 1DWEH 4ZH8A 3TVJB 1G9IE 3RXTA 1O5BB 1S0RA 4GUXA 2ZTXA 3FZZA 1TBQH 4BAMB 4OM9A 1O2NA 4UFEH 2BXTH 5EU8A 4GCHF 3VB7A 4ISOA 3JZ2B 2UUFB 5I25A 3N7EA 4ZMAH 3AASA 3RXGA 1ORFA 1QCPA 1XM1A 2QXGA 4IC6A 4CBOA 1FIZA 2QAAA 2W26A 3SUEA 3RXEA 3NRLA 1CT0E 1OX1A 1FPCH 3TJNA 3PTNA 1CE5A 2F43B 1Y5AT 3MQKC 1AE8H 2WPIS 2VGCB 1P09A 3PMHB 2M2AA 1BRCE 1W7GH 1EAIA 3DUXH 4F48B 1S5SA 1UO6A 2FESH 1CT4E 3S9BA 2JJ1D 4JCNA 1MTNB 2WV4A 3LH3A 1JWTA 2A5KA 4F49A 3UWJH 3RXRA 3UOPA 3SGQE 1GJ4H 1FAKH 1BB0B 1C5OH 1Q2WA 1RTKA 3A8DA 1D6WA 4OS1A 3NZIA 2A7HA 3P70B 1YPEH 5JDUB 4FU8A 2LELA 1EAXA 1UVPA 1MKXH 3BG4C 1MABB 2ANMH 5LGOA 2ZGCA 3E1XB 1TBZH 1TOMH 3FP6E 3FKSD 3EAJA 1DLEA 1KLTA 1T7CA 4BXSA 1LKAA 2HPPH 4D7FA 2XBXA 3P8OA 1WBGB 2EC9H 2L74A 2BQWB 3TPIZ 1MBQA 1WYKA 2ODQA 3TGIE 4TY7A 4Z0KA 1ZMLA 5C3NA 4YT7H 3SV9A 3ZZ7A 5EW2H 1CGHA 1L4ZA 1OP8A 3PLPA 4THNH 5AVDA 1Z6JH 4D9RA 2CV3A 1A7SA 3EGKH 1GHAG 1LHCH 1MU6B 2VIVA 1YM0A 3RMOH 2C93B 1AIXH 5EXLA 4U30A 1AWHB 4ABHA 1W7XH 1V2NT 3M7TA 2PUQH 1O3FA 1BTYA 1BRBE 4KGAA 1WCZA 3KQBA 4YOGA 2ODYB 3LJOA 2H5CA 3GY7A 4ABIA 3VGCC 5EW1H 2QGRA 1S82A 3GY6A 4YTAA 4I8JA 4HG6A 3DSGA 1EJNA 4Y7BA 2ZC9H 4ABGA 1ID5H 5A0BA 2EI8A 3GCHC 1TGSZ 1ELAA 4NIYA 1GG6B 1SGFG 1ZRBA 2ULLA 3UPEA 2FX4A 4X1NU 5FPYA 3H5CB 5PTPA 1NRNH 1KDQB 2DUCA 3HK6B 1ZPCA 1PYTD 1LVYA 4Y0YE 4NIWA 3LDXH 2DE9A 4MNYA 5C0UA 2F9PA 3BSQA 2FI4E 1V3XA 1P0SH 1QL9A 4JZFH 4CH8B 1K21H 2QF0A 1EB2A 2VNTA 3PO1C 3RC6A 3A8BA 1BT7A 2ZGXH 1N6XA 5JYIA 1ELGA 3BF6H 1BTPA 1TABE 2W6JD 1YPKH 1J15A 1Z6EA 4TPIZ 1RIWB 5JBBS 3SU2A 3EA7A 3LPRA 2GKVE 5L30H 1GHWH 2XW9A 1PJPA 1EP6A 1AI8H 4TSFD 1T8LA 1IOEA 1H8IH 3MO3A 7GCHF 2F9VA 1GMDF 1F5LA 1O2WA 1GJ6A 2PKAA 1GBHA 2SGAA 2VIQA 4YT6H 1GCTC 5DK1A 2XBWA 1XKBC 1HCGA 1C1VH 4ZKSU 3SV7A 2A4GA 4Z6AH 3SU5A 5E2PA 1ZMNA 1K1OA 1XUGA 4BAQB 5EPNA 4OS4A 3SI3H 6ESTA 5CHAC 1O2SA 4JZEH 3AK5A 8GCHF 1ZSKA 4A1TA 2KM0A 2XNDD 4AZ2B 1K1PA 4WH6A 2YOLA 1MQ5A 1QY6A 2W7UA 1TA2A 2B5TB 4XOJA 3OE7D 2WPKS 1IQJA 1EUFA 1W10U 1MH0A 2PUXB 4UFGH 1SGQE 1SHYA 3KQDA 1TA6A 2Z9LA 3VXEH 2FWWA 2Z9JA 1PFXC 4JYTA 1IQHA 1AVWA 1IQLA 2HVXA 2EEKA 4XDEA 3ZVDA 1AUJA 4U32A 1PPCE 1MCTA 1TX6A 1P12E 2HRVA 3NCLA 3RDZA 3SV2H 1KXCA 1V6DA 2VIOA 2A5IA 1RFNA 1D4PB 3GY4A 1HAOH 2A1DB 1XVMA 1ABIH 2W3KA 1PPBH 2Q6FA 3E0NB 5EIYA 2SNVA 3EYDA 2FPZA 4E7RG 2BD5A 4KKDA 2EA3A 2H2ZA 3UQOA 3GCTG 1P11E 1VITF 1OWJA 1E0FD 3W95A 4INHA 1MKWH 1PPEE 2V6NA 1YBWA 1GJDB 2AGGX 2WPLS 3T28A 2F9OA 1SPJA 1TWXB 3DA9B 2PKSC 1OPHB 7KMEH 1QA7A 2Q6GA 4CH2B 1TIOA 2J95A 1QRZA 4NG9H 2HVYB 5C17A 1SSXA 2EI6A 1P10A 4AFZA 2RG3A 4O03A 4CRGA 1SGTA 3QZRA 3AAVA 3O8BA 1D3DB 3FZDA 1NPMA 3BTTE 2R3YA 1SHHB 4DT7B 1Z8IB 2BB4A 2ZGJA 4CRBA 4ZXYH 3BEUA 1SGFA 2GDEH 4E06H 2A4RA 1HAXB 1Z1JA 3MU0A 3UWIA 3SV8A 1GI6A 1O31A 1TNJA 2PLXA 4CRDA 1K1MA 1AFEH 2PHBA 1C5VA 1KTTB 1CA0B 2BDCA 3TK6A 2ZIQH 3ENSB 2QXIA 1A5GH 4CHAC 4FUGA 2SNWA 1NTPA 1FX0B 3KQ5A 1GI4A 2STAE 5LPFA 1IQEA 2GT8A 4GVUA 4XBBA 2XC0A 2J94A 3R0FA 1YLCA 2FZZA 1MZAA 2TIOA 2O8TA 1NFWA 3QZQA 1S85A 2FOGA 2BOKA 1GI8B 1QL8A 2KCOA 2ZU2A 3MO9A 3SZNA 2FOHA 1T4UH 1PPGE 4ZKOU 5GDSH 5TJXA 2ZGBH 1EASA 1GJ7B 2ANYA 1ZJDA 1ZHMA 2KR7A 3GCOA 4AFUA 1OOKB 1GHBG 3HPTB 3SV6A 1AVGH 2C90B 3E91A 1EFRD 2BD4A 3W94A 1BITA 1XVOA 2F4LA 2ZU1A 2BD9A 1C4Y2 4B6EA 1GVZA 1PQ8A 3WWFA 3PV2A 1O2RA 1C5ZB 4X2YA 4TT3D 5FBIA 1J17T 2B8OH 1QTFA 2ZDMA 3JZ1B 3KYFA 4PROA 1PQ5A 4GPGA 1FONA 5DP5A 4M7GA 1ETTH 4D9QA 1GJ8B 1DFPA 2OCVB 3RXOA 1GHZA 3OSYA 1YPHC 3UUZA 3EA8A 1QQ4A 1FDPA 5E8EH 1LHFH 3EA9A 1O5GH 3QTVH 3TH4H 3VB6A 3TJOA 1O3IA 1GJ5H 1L1JA 1QJ7B 1CBWC 1P03A 3GOVB 3M61U 5T6GA 4FU9A 4ZKRU 1C5SA 4YOJA 2XRCA 2FTLE 2ASUB 1NU7B 2JETB 4X6PA 1TYNA 1Z71A 1O2XA 1G36A 2A31A 2ZKSA 4TWWA 3T62A 2KCAA 1LCYA 2BD7A 2VVUA 2G4UA 2GTBA 2TGAA 1UMAH 2XCNA 2FIRH 2XYAA 2ZDKA 1WXRA 2OC0A 2NWNA 2J97A 1VJAU 1QB1A 1VGCB 2XWBI 5GJ4B 2HPQH 3A7YA 4Q7YA 1QRXA 1H9LB 2NU0E 3KNXA 2CN0H 4CRCA 3SQHE 3GY5A 3BEFB 1P04A 4TYDA 2ZFSA 3I29A 2P95A 3HGPA 1SR5C 2PP6A 1MAYA 3DHKH 1WTHD 1AZ8A 3LGWA 3M5NA 2ZDNA 5IYTA 2B7DH 1RD3B 2WUCA 3F3BA 2AHME 3SJIA 1P3CA 3A84A 2BTCE 3V0XA 1GBDA 4HZHA 4X8VH 3V7TA 5F8ZA 1GMCF 1EOLA 2ZHFH 2ZHWH 3QGJA 3S7KB 3ZZDA 1IHSH 1THPB 2UUKB 1SGRE 1SQOA 1SVPA 2KZ4A 1BBRK 3RXSA 3ELAH 2QE7D 3IG6B 1S0QA 1YPLH 2BY5X 3UR9A 2J34A 4NZLA 1GJAB 2OC1A 3R3GB 4I86A 4XFQA 3ATKA 1F92A 1H8HD 2FXRA 1W8BH 4XRNA 3TITA 3N7DA 4A6LA 1Z8RA 2J5UA 5F03A 3SOSA 1E34B 3BG8A 1UVOA 3ZV8A 3SYJA 1UVTH 4Y11E 1E79D 2FEQH 1GMHG 3GDUA 1F5KU 4FETA 1HB0B 1YY3A 1SLUB 5B6LA 2JH6D 3S7HB 2JIZD 1GI7B 4K1SA 1LTOA 3P92A 1GGDB 4DGJA 1O2UA 2UWLA 3MI4A 4K1TA 1CGIE 1O3HA 1DS2E 1BZXE 2SGEE 2C8WB 4MPVA 1ESBA 2OP9A 5EOKA 3KCGH 4AGJA 5DO4H 1TNHA 1ESTA 5DP6A 3TNTA 3KL6A 1QIXB 1W0ZU 4VGCC 5A8ZA 1T8OA 3GYLB 1P02A 1TQ0B 2XTTB 2HNTC 2FLBH 4DT4A 5DPAA 4F55A 3ATLA 4BAHB 1HAYB 3DFJA 4RKOB 2Z9IA 1K22H 3RXBA 5EG4A 1V2QT 2FP7B 1EXFA 1LPGB 4WJG2 4J2YB 3Q3YA 3M3TA 1J9CH 4RT0A 5HYOA 1O3DA 1OXGA 1EJMA 3HKJB 1RS0A 2YMSD 2RDLA 3QLPH 2A0QB 1ELDE 1W0JD 3CS0A 1TX8A 2Y5HA 1X7AC 2AS9A 2GMTB 3T29A 4GLYA 3SU6A 1RTFB 1KLIH 3LOXA 3LGUA 1GBCA 2W7SA 3MNCA 2Z6BD 4KELA 4ACAA 1C5QA 4FOUC 2XOKD 4Y79A 1GBKA 1H4WA 3FP8E 3ODFA 4IC5A 2BDAA 5J4SA 4AYVB 2WINI 4X1QU 3OTPA 3TGJE 1DM4B 4ZHLU 4YLQH 2J9NA 3U8RH 3RXAA 1C5WB 1A0LA 1GI0A 1BTZA 3MYWA 2BY7X 1V2ST 2BY6X 2VINA 1A0HB 1O3EA 1C2IA 1C2GA 2G4TA 3UR6A 3BG4B 2J92A 2OD3B 1OWHA 1NFUA 3DCLA 3DT0H 1FY3A 1S81A 1GI2A 1YGCH 3A87A 2A45B 1O2GH 1ZMJA 1P06A 3OYPA 3UOUA 5L6NH 1HGTH 1ACBE 1ANBA 4MDSA 3QK1A 5EPYA 3UNSA 1DSTA 4KTCA 5A09A 1FY5A 2I6SA 2ILNA 2CF9H 2LPRA 2O8LA 1A3EH 1QBOA 4ACBA 1FY1A 1C1TA 1GI5A 1HV7A 5C1XA 5AHGH 4K5ZA 2Y7XA 5CE1A 3RXVA 3TU7H 4NIXA 3ZZ5A 1ZTKA 2ZWLH 2KFWA 3LONA 2LP6A 2V7QD 5A8XA 1TQ7B 3ZZ6A 4NFEA 2LNCA 2Y7ZA 1K0HA 4DJZB 3OX7U 1K28D 1CHOG 3LKWA 2Z3CA 3GCNA 3M36A 2VBCA 3LGVA 3F2HA 4UE7H 3ZYDA 3O8CA 2BQ7B 5A0CA 4NGAH 1HXFH 4BAKB 1O38A 3F0OA 2YNBA 1H8DH 2ZPQA 1FV9A 3SUDA 2R2MB 3KN2A 3DSPA 2UWPA 1LVBA 1AMHA 1W11U 3W1EA 2ZCKP 4FUDA 3VB4A 4DCDA 1SFIA 2BMGB 5T3HA 5GCHF 1HRTH 4YO9A 2STBE 1Q3XA 1DLKB 1OS8A 5C5OA 1Z1IA 3ZVAA 5F8TA 4YOIA 1O34A 3PB1E 2H9EH 4ZCNA 1O3CA 3BN9A 2OLGA 1NRPH 1KXBA 1LVOA 1EJAA 5DG6A 3LGTA 2ALVA 3WWBA 3A8CA 4UD9H 4FVBA 3VB3A 3A83A 3FP7E 3SGBE 1ZHRA 4I32A 2BD2A 2CJIA 1DICA 2F9UA 5HXFA 1C5YB 2NU2E 4A5TS 4IMQA 2KCPA 1XX9A 4B71A 3GDSA 4IS5A 3U98H 4RI0A 2QF4A 4FVDA 1C5MD 2VWNA 2BYAX 3K6YA 3QUMP 2B0FA 3MNSA 2P3FH 2HLCA 4IN2A 3FANA 1SQTA 4B6FA 1A3BH 1F0RA 1G3CA 3NK8A 1O30A 4GCHG 1TALA 3UQVA 2P3UB 1C1QA 4UFFH 1SGIB 3ATMA 3QTOH 4DOQA 1TMBH 3ZZBA 5ABWA 5IDKA 1ZYOA 2ZTYA 5T1VA 3M5OA 3SU0A 2VH0A 2QA9E 4BTUB 1EPTA 3GICB 1C9PA 2H9TH 1HAVB 1WAYB 3A89A 5CHAB 1KXAA 3MU8A 3O8RA 5C0TA 1WSSH 2VH6A 4CRFA 2GDDA 1P2QA 1HJAC 3A88A 3WW7A 4MVNA 1XXFA 1E35B 5ESBA 2BDIA 1LKBA 1GJBB 2BQ6B 2BX3A 2OXSA 3PMJA 1TB6H 2EQNA 2CGAA 2ZFTA 4A1VA 3IITA 3WY8A 1WQSA 2JJ2D 3BTEE 3E3TA 1C5PA 1QFKH 4WH8A 2PV9B 3A8AA 3O8DA 3KQCA 4MPWA 1C2MA 1MTNC 4QT8C 5LPEA 1WUNH 4AC9A 4AFQA 2ESTE 2O8MA 4JZ1A 1YP9A 3UY9A 2ZHEH 1G3EA 3M37A 4HGCA 1YKTA 2HLDD 2ZZUH 4I33A 4U01A 1UTLM 1O3AA 4WMDA 3T27A 3AW1A 4JYUH 3TK5A 1MAXA 1C1WH 3LU9B 4AORA 2PSYA 4GAWA 3F2GA 3MH7A 2PKSB 1CGJE 1UTMA 1DITH 1ELVA 1A1RA 2BDBA 3CS7A 3TLOA 2ZDAH 1F2SE 3H09A 1AU8A 4ISHH 5H4IB 1H8ED 5A8YA 1UJ1A 3V12A 4AOQA 1IQNA 1EB1H 4Y71A 1UTKA 1UTPA 3MU1A 2IJOB 4ABJA 5IK2D 2C3SA 3PM3A 4DIIH 2CMYA 5HM9A 1PYTC 4AYYB 3Q77A 3BTQE 1SQAA 4O3TA 1COWD 3BIVH 2ODPA 1PPZA 2VWLA 1WTGH 1ZSJA 4X6NA 2OC7A 5GIBA 1P9SA 4BTIB 1YPHE 4MNVA 2HALA 4AGKA 1BBRE 2WPDD 3SNEA 3CNRA 1N1LA 4MNWA 3U1JB 1FI8A 4CHAB 1O36A 3MH5A 4FUFA 1C5TA 2BXUH 1DVAH 1K1LA 1UHBA 4K3JA 1UTJA 4JMYA 1GG6C 1TE0A 3BTKE 1OP0A 4TY6A 3ZZAA 3ZZCA 3BTWE 3P8NA 1RGQA 3P17H 2AMDA 3UB0A 3L3TA 3OFND 1NROH 4X6MA 2ZDLA 2FS8A 2FOBA 3K6ZA 3S0NA 1C2LA 2UWOA 5TCCA 1UCYK 2A5AA 1QB6A 3NWUA 1SB1H 2W6ID 3F9HA 3FN8A 2UUYA 3HATH 2J98B 1VCQA 1E1QD 3SNDA 2FYQA 1QBVH 4NZQA 3ZYEA 1AD8H 2ZP0H 1JIMA 2XBVA 1O3LA 4GHQA 1K1NA 4X2XA 3VB5A 1A5HA 7GCHG 3LC5A 1GMDG 3PROA 1KXFA 3A82A 4CBNA 4D7GA 2D2DA 4ASUD 1AKSB 1YLNA 3Q3KA 6GCHF 1XUIA 2WZQA 1D6RA 1J16A 2XC5A 2ZHQH 1ELTA 1RTLA 2FO9A 3MOCA 2WUBA 3N99A 2OBQA 4TWYA 4ASHA 3F9GA 2BHGA 2FYRA 1HIAB 2P3TB 1GVKB 3KF2A 4YESB 4INLA 1WDIA 1TONA 3SW2B 5JB8S 8GCHG 2BVSH 1BCUH 2P93A 4BNRA 1GBFA 1UW7A 1C2KA 1CBWB 3BTME 1L0ZA 2BDHA 2R2WU 5HIZA 1AN1E 3SGAE 2PWXA 1TPSA 1NESE 2BVRH 3NUMA 4X8SH 3A86A 1GBLA 3SJOA 4HTCH 5DP9A 3K9XB 3E16B 1HXEH 1OWIA 2AGIX 2AIPA 3ATIA 1ZLRA 1XXDA 4YM9A 2J4IA 1C2JA 5SGAE 3HGNA 1IQFA 1F5RA 2R0LA 4MPXA 1SBWA 4OS5A 2IOTA 3RXIA 1QA0A 5F6MA 2W3IA 4FU7A 1SG8B 1O5CB 3OEED 1V2WT 1SLXB 2TPIZ 3B9FH 1LO6A 1B0FA 1VITG 1YLDA 5FHTA 2ZNKH 4A7IB 3ZVGA 5K7RA 3ESTA 2J38A 1GHVH 2V3OH 1QB9A 1SC8U 2HNTE 2TRMA 4I8KA 3EQ0H 4ISLA 2BM2A 3F9EA 1S6LA 3VXFH 3PV4A 4FUJA 3E0PB 1ZPBA 1OYTH 4ISIH 2FDAA 2OBOA 4WXIA 1ZOMA 1AVXA 1N6YA 4DY7B 1VITH 4NA7A 2BOHB 1BMFD 1SI5H 3RLWH 1B5GH 6CHAC 3RXQA 4MG3A 2BY8X 3VEQB 1G2MA 4IBLH 3SQEE 1W2KH 2FOAA 1JOUB 2FLRH 3TJVA 1JRSA 3TGKE 4AX9H 4SGBE 4WMFA 2A32A 3LJJA 2VJ1A 1BA8B 2L6OA 1GDQA 1NFYA 1N8OC 1O3PB 4RKJB 1V2PT 3G01A 5JBAS 2JH0D 1ZRKA 3TH3H 4DURA 2C4FH 1KIGH 3Q00A 1H9HE 1CO7E 3MMGA 4D76A 2PGBB 2A7JA 3SU4A 1LPKB 3UNRA 2P8OC 5EQQA 4WXVA 2FOMB 3ZVEA 3ITIA 1J8AA 1AHTH 1KSNA 1O2IA 4Q7XA 3RXDA 1T8NA 3TK9A 1O2VA 6LPRA 1DUAA 1BTUA 3N7OA 2OINA 4GHTA 3TH2H 1BOQA 2A4OA 4ABEA 3EE0B 1SLWB 5DN6D 1CA0C 3QX5H 2GCHF 3SUFA 1C5LH 3SBKA 1O32A 2CXVA 5GXPA 1Y3XA 3KEEA 4VGCB 1W0KD 3RXPA 1ELEE 2F3CE 4AB8A 1NC6A 4I7YH 1P01A 5FL7D 5C20A 3K2UA 4FUHA 4NWKA 2CHAC 3A81A 1M9UA 1QRWA 3SNCA 4ABDA 4ABBA 1CSOE 1GDNA 4IW4E 2GZ7A 2IN2A 2C8XB 1BTXA 1YYY1 3ODDA 5FXLA 1HJ8A 1CVWH 3LC3A
chains in the Genus database with same CATH topology
3K65B 2WV5A 4K8BA 1HAPH 4X1SU 3NKKA 1F0TA 2ZPRA 1AFQC 5G4BA 1GBMA 3D23A 1AQ7A 2ZU3A 1GL1A 3VPKA 5GWZA 5BRRE 2BVXH 1EPTC 2EI7A 5JB9S 2GP9B 4MPUA 1O3GA 1HAGE 4Q80A 3RMNH 1G32B 1XUJA 2VB0A 2PFEA 1HAVA 5DGJA 5ESTE 3RXCA 1LQDB 4XE4A 3F68H 3SNAA 2Z9GA 1DXPA 1OWKA 1PQAA 4JZDH 3A80A 5E0HA 2RA0A 1SGYE 3F6UH 1LDTT 4NCYA 3IWMA 3MO6A 2YNAA 3Q3XA 3MH4A 1TGCA 3A85A 1KDQA 1FY4A 1RJXB 1JXPA 4UFDH 4RN6A 5FCRA 3P95A 4ZXXH 4FUIA 2FODA 2NU3E 4K2YA 2HWLB 1ANDA 2JETC 3STJA 1NRRH 4Y76A 5DP7A 2BLVA 1TRNA 1BBRH 1V2LT 1GBEA 1MD7A 2HGTH 2Q1JA 1EX3A 4ZHAA 1MBMA 1MZDA 3HK3B 5DJ7A 1VCPA 2Z9KA 1GJ9B 1O5AB 2ZI2H 4AN7A 3FVFB 4HFPB 4B76A 2OQUA 2GVFA 1EATA 1F7ZA 3UTUH 3A7ZA 3MFJA 1T8MA 1MMJN 2FMJA 1Y5UT 2HNTF 2H9HA 3E90B 1FNIA 1FQ3A 3CP7A 1MUEB 1K1IA 1QNJA 1THRH 1GMCG 1Z8GA 3SJ9A 5DKMA 1UTNA 1XUFA 2PGQB 1QJ6B 1C9TA 2GV7A 1L1NA 2ZQ1A 5E0GA 1O5FH 3CENA 5EQRA 1D3PB 1DUEA 2HOBA 2QV1A 2VVCA 3VFEA 5AFYH 1SGEE 1O39A 1AZZA 3UREA 3Q76A 1DOJA 1OWEA 4RSPA 3ZZ8A 5DP4A 3QO6A 2FM2A 2R0KA 1WU1A 3S69A 4BAOB 3M7QA 4I8HA 3E8LA 1S83A 3URDA 2ANWA 1TPAE 5CMXH 2AYWA 1ARCA 1B0EA 4ZROA 1OP2A 3QWCH 3PMBB 2ZO3H 1P2MA 5L2ZH 4LOYH 4H4FA 2Z3EA 4FXGH 1AB9C 1ELCA 3P8GA 1XMNB 2CF8H 1GBJA 3S9CA 3SHCH 4WF8A 1HYLA 2QN5T 1JIRA 3LIWA 1O3JA 1NRQH 3B8JA 1QURH 3PWCA 1Y3YA 2GCTC 3V13A 1V2MT 1IHTH 3I78A 3C27B 3KGPA 4IGDA 1TPOA 4BTTB 4MQAA 1O2LA 1NY22 4HI3A 2C8ZB 1SOZA 1C5XB 3D49H 2PTNA 4NSYA 1SLVB 1D3QB 2BZ6H 1UCYE 1HAZB 1VJ9U 1EKBB 2VIPA 5FCKA 1KXDA 1GHAF 1O3BA 1GI9B 2GX4A 4B2CA 1ABJH 2AIQA 3RXJA 8KME2 1HFDA 1C2DA 1O2OA 1TNLA 2AGEX 1NFXA 3VGCB 1CA8B 1UTOA 1V2RT 4JZIA 3KIDU 1MKXK 1TGTA 4XBCA 1AKSA 1FY8E 3D62A 2BLOA 1C2FA 1V2KT 1IQKA 3UIRA 1BJUA 1IAUA 1O2PA 2Y5FA 3HKIB 1D3TB 5A2MH 1HJAB 1ZGIA 1QR3E 3GCHB 3SU1A 1HIAA 2AMPA 1EZQA 1SGPE 2P59A 2G55A 4FUBA 3P6ZB 1K9OE 2GMTC 1P9UA 1C5RA 3PYHA 1O2MA 2OUAA 1GHYH 1G37A 3ZVFA 1C2EA 3URCA 4H6TA 1O3OA 2KAIB 3RM0H 3ZVCA 3ZVBA 1BJVA 3PO1B 4K1EA 1P2NA 3A7WA 3SNBA 1XUHA 1MU8B 2AMQA 1HAIH 2C8YB 1BMLA 1BTWA 2OTVA 3A7XA 1B7XB 1S6FA 1TMUH 1LHGH 2D26C 1SFQB 5HM2A 1GBAA 2QIQA 4AG2A 2ZECA 2RCEA 1DDJA 2XNIA 2Y82A 2ZG0H 1SMFE 1BDAA 1P57B 1GBTA 1UVUH 3C1KA 2QXHA 1GCTB 1YPJH 4Q7ZA 2I6QA 2Z94A 1C1UH 1MD8A 2SGFE 2QXJA 4B1TA 1ELFA 3M5MA 1KY9A 2FTMA 1UK4A 1O3MA 1HJ9A 1Z7KA 2FS9A 1Z8JB 3GY8A 4XSKU 3ZV9A 4Q2KA 4ESTE 3M35A 3A7TA 1Y3WA 1YF4A 4O9VA 1LHDH 3D65E 4Y0ZE 4YZUA 1BQYA 4U2WA 1FAXA 3LH1A 1K2I1 1ETSH 5EODA 1NZQH 5FPSA 4B74A 1V2OT 1V2VT 2F9BH 1ZSLA 1ESAA 1UK2A 3QN7A 1QHRB 3U8OH 1A0JA 3OTJE 2O9QA 5FX5A 5HGGA 1P3EA 2A4QA 1NO9H 2QY0B 1C5UA 4Y10E 2VGCC 2VIWA 2Z7FE 4DW2U 2NU1E 5FAHA 1RRKA 2TGPZ 4IN1A 5C1UA 3DFLA 7LPRA 5F8XA 1O0DH 1C1RA 1KLJH 2Y81A 5GCHG 1O5EH 3GY3A 3V3MA 2O8UA 1GDUA 1WV7H 2D1JA 5FX6A 1YC0A 1DWCH 1TAWA 1SGCA 1TX7A 4H42U 1SL3A 4JK6A 1CU1A 3SU3A 1OWDA 2H6MA 4MTBA 1ANCA 2BLQA 3MNBA 3OY6U 3LGYA 1A46H 1P2OA 4I8GA 1C1MA 3EDXB 4B73A 1UK3A 1P05A 2F91A 1F0UA 1DWBH 1C1OA 1FN6A 1GBBA 3GCTF 5FPTA 2ZA5A 2AH4X 4J1YA 1C2HA 2BDGA 4O97A 1T32A 1U6QA 1C5NH 4FUEA 2ZDVH 1AGJA 4UEHH 3H7TA 2WYGA 4LXBH 1GCDA 2UUJB 1WQVH 1GHXH 2RA3A 5E0JA 1E37B 1MTSA 1O2ZA 2ZU5A 3BTGE 3FAOA 2FOEA 3NXPA 1FPHH 2JH5D 2ZFQH 4NA9H 1QQUA 5EXMA 2D8WA 4X0WU 1V2UT 2Y80A 3U9AH 3UNQA 3RC5A 3BIUH 2GZ8A 2F83A 1O35A 2WYJA 3PLBA 1DE7H 1O2JA 3OU0A 2V3HH 4X2WA 2FX6A 1SGDE 2PR3A 1V2JT 1FUJA 4DIHH 5EXNA 2ZCLP 3SORA 1DANH 3M5LA 1A5IA 1MKWK 1XKAC 4ZHMU 5JPMH 1O5DH 2DE8A 3RXHA 1ETRH 5GPIB 2IPHA 3ZZ9A 1Y59T 1T31A 2ZTZA 3AW0A 3RP2A 1NS3A 4ABAA 2FI5E 1BMAA 1GVLA 4Y8YA 1TLDA 1QJ1B 3SJ8A 1YPGH 3ATWA 1Y3VA 3PMAB 3RXUA 1JRTA 1BRUP 1LVMA 3AVZA 2R3UA 2SFAA 1O2YA 2OQ5A 4F4OC 4AG1A 2QCYA 2K1QA 1DSUA 4IMZA 3H7OA 3MWIU 2ZU4A 2G5VA 2QC2A 5J4QA 1H1BA 3LGIA 1ZZZA 1L1GA 1MQ6A 1OYQA 1RIWC 1EZXC 3T5FH 2ZFPH 1GHBF 3KQEA 1FXYA 1O2KA 1C1SA 4OGYA 2XC4A 3MHWU 2BY9X 2Y6TA 2ZQ2A 2ZEBA 5JBTA 1A61H 1VR1H 1BRAA 1CHGA 2ZFFH 3M7UA 3GDVA 4X8UH 5L2YH 2G5NA 6CHAB 3GISB 1G3BA 1P2KA 3MNXA 1HLTH 1BMNH 1GI3A 1LMWB 2GD4B 2WPHS 1UCYH 2ZHDA 4UONA 1FMGA 1O3NA 4CR5A 1N8OB 5DP8A 4LZ1H 5C5NA 4WMEA 1Q31A 1EOJA 2TBSA 1XUKA 1AUTC 4K60A 4JYVH 1TMTH 2VVVA 1A4WH 4ZUHA 1W3CA 2P8OB 1AWFH 1OSSA 1PPHE 5TCAA 1YPMH 4OGXA 4WVPE 1G30B 1TRYA 5FBEA 1DY8A 1VZQH 4KTUA 1ANEA 2W5EA 4R0IA 1GBIA 1TNKA 2O8WA 5DP3A 1MTUA 2R9PA 2WPJS 2TGDA 1HBTH 3MU4A 4B2AA 4X6OA 1LHEH 1HDTH 4LK4A 4E05H 1IQGA 1MTWA 2PW8H 1JMOH 2F9NA 3KHVA 2V0BA 1ZGVA 4AFSA 2ALPA 3UFAA 4OS2A 4I31A 2G51A 1RXPA 1DPOA 4WY3A 1TBRH 1FZZA 4A1XA 1NN6A 1TGNA 2Q6DA 5K0HA 2CHAB 1TPPA 4NIVA 4BXWA 7ESTE 1TFXA 1UVSH 1AY6H 4B75A 4FUCA 1P2IA 1CT2E 4CRAA 3RC4A 4UDWH 6GCHG 2P94A 1ARBA 1HPGA 1W12U 1AFQB 3NPSA 1C4V2 1FIWA 2WPMS 1BHXB 2ZCHP 1Y5BT 1O2HA 1EPTB 3SJKA 1O2QA 4DG4A 1KYNA 2XCFA 5EGMA 4BANB 1HNEE 2THFB 3RXFA 5JBCS 3QGNB 4LZ4B 4WWYA 1IQMA 2H5DA 3S9AA 1AE5A 1E38B 4KTSA 3ZZ3A 1INCA 1TOCB 1OKXA 1PQ7A 5EQSA 2BLWA 5I46H 1ZJKA 3A7VA 2PSXA 2AFQB 4E7NA 1K1JA 1HUTH 3U1IB 4MLFB 1Y3UA 4ABFA 2XXLA 3BTFE 1GMHF 4JK5A 5C1YA 4BOHA 2BD8A 3TJUA 1EP5A 2M5TA 1ZHPA 2A2QH 4O3UA 4D8NA 2AERH 1NU9A 1GPZA 1QBNA 2Z3DA 1DX5M 1ZPZA 2KAIA 2NU4E 3SUGA 2FI3E 4X2VA 2GZ9A 2B9LA 1L4DA 1T4VH 1V2TT 2ZFRH 5T6DA 3RUOA 1A2CH 1BMMH 4A92A 1MTVA 4CREA 2ZF0H 3SHAH 4ZAEA 1ZTLA 3DD2H 2BX4A 3B23B 2PKAB 4NSVA 2BD3A 1ELBA 3PTBA 1NT1A 3L33A 8LPRA 4INKA 1BIOA 2Y5GA 2ANKH 3TNSA 2J2UA 3E6PH 4DVAU 1SGNE 1KXEA 3RLYH 1VCWA 9LPRA 3ZZ4A 5LH8A 1QGFA 1AO5A 1ZTJA 2SGQE 2GGVB 2PTCE 1DY9A 2SGPE 1G3DA 1FLEE 5LPRA 3RMMH 1QL7A 4YLUA 1O3KA 4H6SB 4GSOA 1TRMA 5AFZH 1BHXF 2VWMA 3BTDE 1YCPK 4MNXA 3TIUA 8ESTE 1G2LA 1EAWA 1P8VC 1GL0E 3RU4E 4X1RU 4ISNA 1O2TA 4OS7A 1GJCB 3P8FA 4X8TH 1UHBB 2A7CA 1EZSC 1TNGA 1LQEA 1FN8A 1AB9B 4NWLA 1BTHH 1NM6A 3F9FA 3PLKA 4Y7AA 3M3VA 4K8YA 2FOFA 1O33A 3LT3A 3RXMA 2GCHG 5A0AE 3SI4H 2G81E 2GCTB 4B2BA 1LPZB 1C4U2 5ETXA 1S84A 1W0YH 1GI1A 2V35A 5B6OA 1VGCC 1F0SA 3RXLA 1D9IA 2SGDE 1Y8TA 2QF3A 1GWAA 2FOCA 2OC8A 1TNIA 1NRSH 4CR9A 3FFGA 1IQIA 3L6PA 2A2XH 4NA8A 5AF9H 1CQQA 4Y8ZA 1UTQA 1YCPH 3U69H 1W14U 2H1UA 3GY2A 1S6HA 2BDYA 3MTYA 4XBDA 1TGBA 3RU4T 2BZAA 3MH6A 2GV6A 1EQ9A 4Y6DA 3OY5U 3RMLH 5BPEA 1CHOF 1JBUH 3PWBA 1C1PA 5T6FA 3T25A 3BEIB 4OS6A 1J14A 2JKHA 3BV9B 1HAHH 1MCVA 1EAUA 2XWAA 3I77A 2ZGHA 4AB9A 5C2ZA 5C67A 1WOFA 3BTHE 5E2OA 4I8LA 9ESTA 5HMAA 4NFFA 1W13U 3STIA 1ZR0A 3F1SB 2TGTA 4TPYA 1THSH 4KP0A 2G8TA 4ZKNU 4SGAE 4R8TB 1DXWA 2G00A 4K69A 1EZUC 1O37A 3RM2H 1SOTA 1KTSB 1E36B 2AEIH 3M3SA 2VU8E 1PPFE 2GT7A 3GYMA 1YCPM 2P16A 2VIDA 1FJSA 1H9IE 3U8TH 1C1NA 4Y8XA 3QDZB 1GGDC 1DWDH 2G52A 3T26A 1P2JA 1DT2A 3RU4D 2VWOA 3RXKA 3T2NA 2XBYA 3AAUA 3MU5A 3SN8A 2ZPSA 4X1PU 1L2EA 1BUIA 3SO3A 2QYIA 1DWEH 4ZH8A 3TVJB 1G9IE 3RXTA 1O5BB 1S0RA 4GUXA 2ZTXA 3FZZA 1TBQH 4BAMB 1O2NA 4UFEH 2BXTH 5EU8A 4GCHF 3VB7A 4ISOA 3JZ2B 2UUFB 5I25A 4ZMAH 3AASA 3RXGA 1ORFA 1QCPA 1XM1A 2QXGA 4IC6A 4CBOA 1FIZA 2QAAA 2W26A 3SUEA 3RXEA 1CT0E 1OX1A 1FPCH 3TJNA 3PTNA 1CE5A 1Y5AT 1AE8H 2WPIS 2VGCB 1P09A 3PMHB 1BRCE 1W7GH 1EAIA 3DUXH 1S5SA 1UO6A 2FESH 1CT4E 3S9BA 4JCNA 1MTNB 2WV4A 3LH3A 1JWTA 2A5KA 4F49A 3UWJH 3RXRA 3UOPA 3SGQE 1GJ4H 1FAKH 1BB0B 1C5OH 1Q2WA 1RTKA 3A8DA 1D6WA 4OS1A 3NZIA 2A7HA 3P70B 1YPEH 5JDUB 4FU8A 1EAXA 1UVPA 1MKXH 3BG4C 2ANMH 5LGOA 2ZGCA 3E1XB 1TBZH 1TOMH 3FP6E 3EAJA 1DLEA 1KLTA 1T7CA 4BXSA 1LKAA 2HPPH 4D7FA 2XBXA 3P8OA 1WBGB 2EC9H 2BQWB 3TPIZ 1MBQA 1WYKA 2ODQA 3TGIE 4TY7A 4Z0KA 1ZMLA 5C3NA 4YT7H 3SV9A 3ZZ7A 5EW2H 1CGHA 1L4ZA 1OP8A 3PLPA 4THNH 5AVDA 1Z6JH 4D9RA 2CV3A 1A7SA 3EGKH 1GHAG 1LHCH 1MU6B 2VIVA 1YM0A 3RMOH 2C93B 1AIXH 5EXLA 4U30A 1AWHB 4ABHA 1W7XH 1V2NT 3M7TA 2PUQH 1O3FA 1BTYA 1BRBE 4KGAA 1WCZA 3KQBA 4YOGA 2ODYB 3LJOA 2H5CA 3GY7A 4ABIA 3VGCC 5EW1H 2QGRA 1S82A 3GY6A 4YTAA 4I8JA 1EJNA 4Y7BA 2ZC9H 4ABGA 1ID5H 5A0BA 2EI8A 3GCHC 1TGSZ 1ELAA 4NIYA 1GG6B 1SGFG 1ZRBA 2ULLA 3UPEA 2FX4A 4X1NU 5FPYA 3H5CB 5PTPA 1NRNH 1KDQB 2DUCA 3HK6B 1ZPCA 1PYTD 1LVYA 4Y0YE 4NIWA 3LDXH 2DE9A 4MNYA 2F9PA 3BSQA 2FI4E 1V3XA 1P0SH 1QL9A 4JZFH 4CH8B 1K21H 2QF0A 1EB2A 2VNTA 3PO1C 3RC6A 3A8BA 1BT7A 2ZGXH