3A7VA

Crystal structure of trypsin complexed with 3-formylbenzimidamide
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-Crystal Chemical Ligation for Drug Discovery
rcsb
molecule tags Hydrolase
total genus 58
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2009-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7vA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3a7vA02
4B74A 1GMHF 1OS8A 4U30A 2M5TA 3K2UA 3SV8A 1PJPA 1H9HE 2B5TB 1FN6A 1P01A 2ZPRA 2ZDKA 3LGVA 5GIBA 1PQAA 2FEQH 3ZZ5A 1KIGH 1AFQC 1JMOH 2HALA 2IN2A 1THPB 2PLXA 1KXEA 1LKAA 3B23B 1E36B 4NSYA 5EW1H 4TPIZ 1B0FA 1Z71A 5TCCA 1AGJA 2C3SA 5DP9A 3RXAA 2HPPH 1KXAA 5GWZA 2D1JA 1AQ7A 3T29A 5E0HA 1J15A 5CE1A 1ZJKA 2JH6D 2QV1A 4K8YA 3EA7A 1EZUC 1K1MA 2XYAA 4YM9A 5BPEA 1A7SA 2Y80A 3LGIA 1YYY1 3RXTA 1GHZA 3MWIU 1DPOA 2OQ5A 3A8CA 3FP8E 1C5UA 2A45B 3GCOA 2YNAA 5F6MA 1CHGA 2W5EA 2Q1JA 4CRFA 1C1VH 1JIRA 2ALVA 1WCZA 2EA3A 1DLKB 3W94A 1C5ZB 1S83A 2Z9GA 2CF9H 3MHWU 1W0ZU 2H9EH 1C1MA 1O33A 3SI4H 4ZROA 4GSOA 1BOQA 4OGXA 2ANMH 4IS5A 1DWCH 4RKOB 4DGJA 1BA8B 1MD7A 1Q3XA 2RG3A 1ID5H 2I6SA 3FP6E 4B1TA 2P95A 1O3FA 3D49H 1BRCE 1C1WH 1FY8E 7LPRA 5HXFA 4TY6A 4H6SB 2GDDA 2ODYB 2PSYA 1QRWA 4AG1A 4E05H 1ESTA 3LJJA 2IJOB 6LPRA 1O32A 1IAUA 3M61U 5C3NA 1MD8A 1ZTKA 1A0HB 1UTMA 3Q77A 3FVFB 3Q3XA 4FUCA 3SGQE 3UOPA 1G3EA 1TGBA 4ZH8A 4CRDA 4E06H 4O3UA 1GBHA 3LKWA 3P8NA 1ESBA 1QB6A 1EASA 4CRCA 2ZCLP 1BBRK 1D3DB 1P3EA 4X1NU 3TH2H 1PQ7A 1IHSH 1MTVA 1D6RA 5JB8S 4RSPA 2J38A 3NXPA 4K69A 4GLYA 4NIYA 1ELFA 3QGJA 6GCHF 1BTHH 3A85A 3ODFA 2O8MA 1XUFA 1SGDE 3LIWA 4ZXYH 3M36A 1RTLA 3T27A 1H8DH 2SGEE 2PHBA 1VITH 3I77A 3RUOA 3MNXA 6CHAB 1O3PB 2F3CE 1K1LA 1BMLA 1KXDA 3GY4A 2BDGA 4ISOA 3E0PB 2ANYA 5C2ZA 5HGGA 1O2GH 2WPKS 1RXPA 4Y11E 3M3TA 1HAGE 1TOMH 1ARCA 1MZDA 4UFEH 2FXRA 1C2IA 2OQUA 2BQ6B 1CGJE 1C5RA 1BMNH 4ABHA 1DICA 1N6YA 1Q2WA 1Y59T 2VWMA 4Y76A 2GV7A 3KQCA 1BJUA 1KSNA 2O8UA 5JBTA 1ZMJA 1T8OA 4O3TA 1UTLM 3Q00A 1V2TT 9ESTA 1IQLA 3ESTA 3E6PH 4LZ4B 2BOKA 4YESB 1O5DH 1P2QA 6CHAC 4BAOB 1P11E 3SHCH 4ZHMU 3QWCH 5IDKA 3UFAA 1O2RA 1NO9H 1YGCH 2ZGBH 1G3DA 3QN7A 1C4U2 1GBFA 2ZA5A 1AZZA 3S0NA 1DXWA 1NN6A 1CT2E 1SFIA 2ZF0H 1CE5A 1O31A 2C93B 2OBQA 2BHGA 2AH4X 1V2RT 1DX5M 1C2MA 1TNKA 1NU9A 2FOGA 4OS1A 3SO3A 5FX5A 2C8WB 1DLEA 1G32B 4NG9H 5GCHG 2GT8A 2VIOA 2FLRH 2VB0A 1SGTA 3RC4A 1GHWH 1GG6B 4NWLA 1FUJA 4NWKA 1KYNA 4WXIA 1P9SA 2QXHA 2R2WU 3RLWH 1GI8B 2GD4B 2XC4A 1GJ8B 1MMJN 2FODA 1O5CB 1CBWC 1LHFH 3UY9A 3A84A 3BTHE 2F9VA 3FFGA 1Z8GA 2P3TB 2Y5HA 2G5NA 2PKAB 3M37A 3SU0A 1YLCA 5TJXA 5K0HA 4YOIA 2ZFQH 3RM0H 4BAHB 2Y82A 1TMTH 3LT3A 4MPWA 4OS7A 4BXWA 1NRQH 2SGAA 5FPSA 4D76A 1GBEA 2WPHS 3MU4A 3MU8A 1OSSA 2CGAA 2ZGJA 1A46H 7GCHG 2A7CA 3PLPA 1QTFA 1ANDA 1CT4E 3IG6B 2VIPA 1TNGA 1THRH 1K22H 2B9LA 7KMEH 2BDBA 1D3QB 1GJ6A 3RXKA 1GBCA 2BDYA 3ZYEA 1EJNA 4GUXA 2UWOA 1YCPM 3SGBE 1PPGE 4Y71A 4K2YA 2Z9IA 3F68H 4AYVB 2Z3DA 3KQEA 2HNTC 2SGDE 5LPFA 2WUBA 1TALA 1GI5A 2WINI 4I32A 2SNWA 3BTEE 1SPJA 4CBOA 2VNTA 1W12U 1TPAE 1SHYA 5C5OA 1O5AB 1WOFA 3STIA 8ESTE 1Z1IA 1DANH 1QB1A 3BIUH 1GBAA 4Y10E 5SGAE 3SUEA 4INLA 1SI5H 3UPEA 2I6QA 4ISLA 2JKHA 3A7ZA 5EOKA 1QL8A 1WTGH 1V2WT 1PYTC 4F49A 2G8TA 1ZOMA 2AMQA 4XSKU 4JYVH 1KDQA 4ASHA 2P93A 4FUFA 4AFQA 5AVDA 1RRKA 4UFGH 2PUQH 3M35A 4K1SA 2J2UA 3RXRA 2Z3EA 1GBJA 4AYYB 4I33A 2F9NA 3BIVH 3RC6A 1YF4A 3PMAB 3SW2B 3UWIA 3STJA 1GI0A 1GHAG 1TFXA 4INKA 4FUJA 5ETXA 1O3HA 2ZWLH 1AZ8A 1ZGVA 1V2LT 1BHXF 1TA6A 1GDUA 1QRXA 1BIOA 3M5LA 1RD3B 1ZSKA 2V0BA 3M3SA 4BAMB 1BRUP 1GGDB 3MO3A 1VCPA 1UO6A 3T25A 1TGCA 2QXJA 1XUJA 4ZXXH 3QTOH 3LDXH 1GI4A 4CHAB 1V2QT 1UVOA 1ZSJA 2BVSH 2BD5A 1OP2A 1OWIA 1TPPA 2A7HA 1G37A 4X0WU 1Y5UT 1DITH 1ANEA 2BLVA 4FUEA 1FY4A 3L6PA 4NCYA 1A2CH 4Q7XA 1YPKH 5FBEA 1GVLA 3KIDU 5EPYA 4FUBA 1J17T 2CHAB 1FQ3A 1NM6A 1L1JA 3VFEA 1UTKA 3BTKE 5EQSA 5GXPA 3H7TA 3MU0A 1QJ6B 2XCFA 1QQ4A 5A8YA 2OINA 1V2VT 2GCTB 3MH4A 2FOFA 1J14A 2JH0D 1O2YA 4XBCA 3MO9A 1GGDC 1JIMA 2FZZA 1ZPZA 3SV2H 2Q6DA 3DHKH 3MH7A 3S9CA 4NA8A 1QBVH 1SBWA 2XC5A 4X8VH 1A3EH 4CHAC 2XBXA 4HZHA 4IN2A 1O2NA 3P8FA 3GDSA 1YPJH 2ULLA 2FMJA 4GVUA 1HAHH 2NU2E 4FVDA 5EXNA 2W7UA 1E34B 1KTSB 2KAIB 2VIDA 3A7TA 2D8WA 2YNBA 4E7RG 2C8ZB 1EP6A 1P8VC 1AE5A 3IITA 1PPFE 1HIAB 2BDIA 4A5TS 1HAIH 1O0DH 4UDWH 4SGBE 3RM2H 2CHAC 2SFAA 2FI4E 1S0QA 3ATMA 5EW2H 1GBKA 1VR1H 1DM4B 1TGNA 1E0FD 3ZVDA 3CP7A 2STAE 4IGDA 1P2JA 1V2NT 2GCTC 5DP4A 2A2XH 1AE8H 1C2LA 1C2EA 2BLOA 2NU1E 2XTTB 1ABIH 4I8JA 1GJDB 1V2UT 2BVXH 1SC8U 2VWLA 2C8YB 4ESTE 2J95A 5CHAB 4DY7B 4CRBA 3AASA 1H8IH 2GX4A 2V35A 1B7XB 1GJ7B 1MU8B 5FAHA 3LC5A 4H6TA 5GCHF 1FY1A 1C5SA 2ZIQH 3FAOA 1SOTA 5C67A 1XXDA 3MFJA 1NRRH 4I7YH 2OD3B 2SGPE 3S9AA 4GPGA 1HV7A 4UE7H 4ABFA 1YBWA 4Y7AA 1ABJH 2WPJS 1DUEA 2AGGX 3PO1B 4KTUA 1UJ1A 3LJOA 5JB9S 1FY5A 1BTYA 2ZHFH 2BLWA 1KXFA 1ZMNA 1RGQA 4Y8ZA 1ZHMA 1FI8A 3OYPA 4X6OA 2HWLB 2WV4A 1T4UH 1AUTC 1LQEA 2Y7XA 1GHVH 1JXPA 1TRYA 2A32A 1XX9A 4GCHG 5I46H 2F83A 3UREA 4K8BA 2HOBA 5EGMA 1CGIE 4I8KA 1O37A 2ZC9H 1O2HA 1Z8JB 1ZPBA 3SUFA 1QRZA 1AB9C 4K60A 4DT7B 3Q3KA 1TABE 1P0SH 1O3KA 2VWNA 1K2I1 1QBOA 1SLVB 1KLIH 2RDLA 1S6HA 3UNSA 1RTFB 1FMGA 3GY6A 4ZKRU 1QA0A 1BBRH 2Y5GA 1HAYB 3SORA 1EQ9A 4AFZA 3ZZDA 3P8GA 3PO1C 1SL3A 1LHDH 4Q80A 3UTUH 1KY9A 2A5IA 2BD7A 2R3YA 1O3BA 1OP8A 3U1IB 1DSUA 1BTUA 3A83A 1T7CA 1AHTH 3KCGH 1QY6A 2ZEBA 3RXHA 5ABWA 1G3CA 1H9LB 1DWBH 1RTKA 3BEFB 1P03A 5EU8A 1T4VH 1EUFA 1EPTA 3F9HA 4LZ1H 2TPIZ 3LU9B 1GBIA 2GMTC 4YT6H 3ZVFA 3A7YA 2ZU3A 5T6FA 4AB8A 2UUYA 1BBRE 1SQAA 3DFJA 1S84A 2LNCA 3ODDA 4UFDH 3OY6U 3T5FH 3SJ8A 1GHBG 1TBRH 3A8BA 3ITIA 2FX6A 3SU2A 1YPEH 1GHAF 2GP9B 1K21H 1MTNC 3RXLA 1C4V2 1Z1JA 3ZZ4A 3R3GB 1UMAH 2G4UA 2ZHWH 2VINA 2ZU2A 1LPKB 4JZDH 1SGQE 1LHGH 3TH4H 3AAUA 3E0NB 1OKXA 2W3IA 2XXLA 1KXCA 3IWMA 2PUXB 3TU7H 1HAZB 2BD2A 4BAQB 4ZKOU 2ZDNA 3TGJE 1PPEE 2ZO3H 1SLWB 2FWWA 3BV9B 5FXLA 1C2JA 4YLQH 1V6DA 1LTOA 1ETRH 1K1NA 1UTOA 1UTNA 4HFPB 1AVWA 1AI8H 2VVVA 2FTMA 2Z9KA 2XWBI 1PFXC 1L1GA 2BQWB 3NUMA 3ZZ6A 2CJIA 1EZXC 3O8CA 5LPRA 4CREA 2NU4E 1BTXA 1AFEH 4MG3A 1A0JA 1GCDA 1ZR0A 3BTME 1YPGH 3A7VA 4AX9H 4ZKNU 1HUTH 3GCNA 4THNH 1S6FA 2XBWA 1EZSC 4KELA 2D2DA 4X1SU 4WVPE 4I8HA 4CH2B 1P12E 2Q6FA 3K6ZA 5JYIA 1GHYH 3U8OH 1VITG 4ZHAA 2F9UA 4INHA 2A0QB 4H42U 4NA7A 1QA7A 2GZ7A 4YOGA 2BY7X 2BX4A 3ZZ9A 4Y7BA 1F0SA 3RXJA 1BB0B 4NGAH 4YT7H 1V2OT 1DVAH 5DP3A 3MYWA 3H5CB 4XE4A 1DDJA 1MKXK 4RKJB 5E2PA 4O9VA 4NFEA 1SSXA 1C5OH 2ZU1A 1GJ9B 2DE8A 3GY3A 3SUDA 2AMDA 1FZZA 4ZKSU 1MKWH 2GZ9A 2K1QA 5EQRA 1P2IA 1XMNB 3ZVGA 1ACBE 1YPHE 3LH3A 3VB4A 1MTSA 3NZIA 4Q7YA 2AGIX 2R9PA 4JZ1A 2G51A 1JWTA 2FLBH 1VCQA 3RMLH 1GMDG 1SHHB 2F9OA 4KKDA 1SQOA 4X6PA 1WV7H 1C4Y2 1DXPA 5G4BA 4E7NA 1ELBA 1TAWA 4ISIH 1NFWA 4IMQA 1F5LA 3PV4A 1DY8A 4YZUA 3EGKH 1HXEH 1DWEH 1HRTH 2FTLE 1A4WH 1D4PB 4K5ZA 3GDVA 3T28A 3RC5A 1N6XA 1O2MA 3U1JB 1RJXB 4X8TH 2G55A 2PW8H 1QCPA 3UR9A 1C5YB 2OC8A 1IQFA 1OXGA 1ZLRA 3KEEA 4OS5A 4BTIB 2AYWA 1C2HA 5C5NA 4O97A 4D7GA 1HPGA 3ATWA 1TNHA 5AFZH 1EAXA 1YCPK 4MVNA 4Y8YA 1O3MA 4A6LA 1UVUH 4TY7A 4B76A 4Z6AH 1JOUB 2VGCB 3GCTG 2ODPA 1MZAA 2DUCA 1O3CA 1GBDA 2ZHDA 5GJ4B 1NRPH 1SGFG 3ZV9A 3P92A 1YLDA 3BG4B 3T26A 4NIXA 4GCHF 1W13U 3SJIA 1GI9B 2R2MB 3ZZ8A 2ZHQH 1EB1H 1K1OA 2A7JA 1FIWA 1EOLA 2CXVA 3TLOA 3QGNB 3TVJB 3L3TA 5I25A 3TNTA 1EXFA 4IW4E 2HNTE 3I78A 1S0RA 1P9UA 3ZVBA 1HBTH 3T2NA 3BF6H 1HLTH 4ISHH 3ELAH 3UQOA 3ZZCA 1P2NA 3BEUA 4XDEA 1YPHC 3P95A 4A1XA 4ZAEA 3O8DA 3DUXH 4A92A 3BTWE 2Y6TA 2GT7A 3PROA 2G4TA 1GJCB 4CRAA 2SNVA 2VGCC 1K28D 2AGEX 5E0GA 3TITA 2FOBA 2Y7ZA 3Q3YA 1W10U 2B8OH 1SGFA 4WMEA 3NK8A 1ZMLA 4BAKB 2AFQB 1O5EH 3LGYA 1UVSH 3BG4C 3QTVH 4NZQA 3RU4E 2P3UB 1T32A 1HB0B 4CR9A 4IN1A 1QIXB 3D23A 1MAXA 1XKBC 1DY9A 5PTPA 3RXBA 1BHXB 1C1UH 4DIHH 1XXFA 1IQJA 5FX6A 1ZPCA 4TYDA 1HAPH 1HAVA 3PB1E 4D9RA 1SQTA 2TBSA 1LCYA 1TNJA 1QHRB 1XUHA 3MU5A 4MPXA 1DS2E 4QT8C 2OC7A 3O8RA 5L6NH 1GHBF 2XW9A 1UHBA 3SNBA 5A8XA 4DG4A 1V3XA 1L4DA 1EJAA 2HLCA 1Y3UA 1D3TB 2HPQH 3RP2A 8KME2 1A61H 1O39A 2VJ1A 4WY3A 1CO7E 3SUGA 1NS3A 4X1RU 1DFPA 4ABAA 1HAXB 2RA3A 1L1NA 5ESBA 1GG6C 3AVZA 3GICB 4AGKA 5DO4H 2W7SA 3KNXA 2FS9A 3A8DA 3MH5A 1QB9A 1LVOA 2TIOA 3KHVA 1O35A 2G00A 3EA9A 3M7UA 1W0YH 1O2UA 2XRCA 4O03A 1QR3E 1MQ5A 4UFFH 1OP0A 3RXUA 1C5WB 4X1PU 3ZZBA 1BRBE 3PWBA 3TGKE 3UR6A 2WPLS 2PSXA 3GY8A 2ZTYA 4LOYH 1NPMA 5DK1A 2TGDA 2J92A 1UK3A 1SGYE 3SU6A 1BTPA 3MI4A 2C8XB 1FIZA 3A89A 3KF2A 3UOUA 4BANB 2H6MA 1W3CA 4AB9A 2BY9X 1IQMA 5A09A 1C5QA 4XOJA 1ZHPA 3RDZA 1FAKH 3SOSA 4IC6A 1SB1H 1XUIA 3I29A 1LQDB 2GZ8A 2ZDVH 4AOQA 3RMOH 2A1DB 1P2MA 2ASUB 1VITF 4D8NA 1WU1A 4X2YA 1XVOA 2ZG0H 1HNEE 1SGPE 3A86A 1NTPA 2A4QA 4LXBH 3QX5H 3K6YA 2BD9A 4GAWA 5JBBS 2QF3A 5AFYH 4JK5A 1F5RA 4IMZA 2JETB 1S81A 1SGEE 4D7FA 1V2KT 3E16B 1GMHG 1QL9A 5DGJA 1Y3YA 1IQGA 3QZQA 3RXOA 1OYQA 1GI6A 1A5IA 3V3MA 2QAAA 4TPYA 1BRAA 1FY3A 1C5NH 4D9QA 1K1JA 1ELGA 1GI7B 1C2KA 1CQQA 4X2WA 1MBMA 1NROH 1YP9A 1KLJH 1P10A 1UTQA 1G9IE 1C5VA 4NFFA 1ELAA 1PQ8A 1WQVH 4HTCH 1WSSH 1OWEA 1QGFA 3SI3H 1AKSA 4HI3A 1O34A 3GCHB 3SU3A 1V2ST 1B5GH 4MNWA 4X2VA 1O5FH 1O3EA 2PTNA 3HK6B 2FOHA 2WPMS 4JYTA 1AY6H 3AW0A 2FYRA 3M3VA 1CT0E 1TWXB 3RXDA 2BTCE 1F0RA 3FANA 5C1UA 2AERH 2OBOA 2BY5X 2JETC 1LVMA 1JRTA 3ENSB 1P04A 2R0LA 1EAUA 2SGQE 1PYTD 4DW2U 1C1RA 1SG8B 2TGAA 5HMAA 3RLYH 1OWJA 3E91A 2YOLA 2QC2A 1EJMA 1C1TA 1S85A 1C5PA 3RU4T 2B0FA 1O3NA 2DE9A 3RXMA 1P3CA 6ESTA 1AMHA 3RMMH 3TK6A 2LPRA 1TX7A 1KDQB 4Y0YE 3ATIA 1T8MA 2A5KA 3QK1A 2Z3CA 1GCTB 5EPNA 2UWPA 1Y5BT 5HM9A 2EI6A 3M5MA 3GCHC 4KTSA 1B0EA 4JMYA 3RXGA 2GCHG 2NU0E 5TCAA 5A0AE 2A4GA 1EB2A 3QO6A 4X1QU 4AGJA 3EDXB 2R3UA 1NY22 4ABJA 4F4OC 1DWDH 1O2WA 2ZFTA 1XUGA 1EP5A 2F9BH 1TPSA 3ATLA 1ORFA 1QQUA 1KTTB 3PTBA 3E1XB 2EC9H 3TPIZ 1ZJDA 2ZFPH 5J4QA 1DOJA 1C9PA 1UCYK 5E8EH 3CENA 1F0TA 4FU7A 4X8SH 2ZGCA 3VXFH 1FNIA 3F9GA 3QUMP 5DKMA 4YOJA 1ZRKA 2WUCA 3BTFE 3GISB 3PMJA 2ZDAH 4XFQA 4ABGA 1IQEA 1GCTC 2BY6X 5C1XA 2OP9A 1O36A 1ZHRA 2ZDLA 1ELCA 5A2MH 1E35B 2W26A 1NRNH 1OWDA 1K1PA 2P8OB 3JZ1B 1YM0A 2BX3A 1LHEH 4FU8A 1O2ZA 1P05A 1H9IE 5B6OA 1MH0A 4WWYA 1AUJA 3F9EA 5CHAC 4AZ2B 1C1SA 1G2MA 1G36A 1UK4A 3P6ZB 1O2IA 2V3HH 7GCHF 2ZFSA 5A8ZA 2OXSA 1VCWA 1MKXH 2OTVA 2ZKSA 3AAVA 3A8AA 4AN7A 1LPZB 1CHOG 1ZGIA 1F7ZA 1GBMA 2BYAX 3SHAH 1TRNA 1O2KA 1TYNA 5EXLA 2SGFE 1A5GH 5FPYA 2XWAA 1MUEB 4MDSA 3UWJH 2G81E 1TNLA 3HGNA 1AVGH 2Q6GA 1EX3A 1O3JA 2PFEA 2G52A 3BTQE 2WYJA 1NFUA 4WXVA 3QLPH 1ANBA 3TK5A 4B2AA 1OPHB 5DP7A 4Z0KA 2P8OC 1RS0A 3BTTE 1Z7KA 5FHTA 5FCRA 3BG8A 5C1YA 3BEIB 1GDNA 3P70B 3RXVA 3BSQA 3W95A 2ZPQA 2H9TH 4WH8A 4B75A 3LGTA 3MU1A 4DURA 1ELEE 1AFQB 2XNIA 2GDEH 1GMCG 3RXQA 2BZ6H 3MOCA 3LOXA 1AWFH 1CVWH 1Y3WA 4BXSA 1W14U 2O8WA 5T6GA 1LVYA 2CF8H 1BCUH 4FUDA 1OOKB 2OLGA 1GWAA 1RFNA 1O3LA 1BMMH 2PKSB 1YCPH 3U8TH 3RXPA 4DVAU 3ATKA 1UVTH 2BZAA 2BDCA 1FAXA 4CBNA 2H9HA 2PWXA 2TGTA 1TBZH 2OC0A 5CMXH 4DOQA 2WPIS 1P02A 2VU8E 1FV9A 1Y8TA 1AWHB 2J9NA 3QZRA 1VJ9U 4U32A 3G01A 3TJNA 2Z9JA 1N8OB 4KTCA 3OSYA 1GBLA 1SGIB 3BN9A 4FUGA 3SNDA 1TMBH 3MTYA 5JDUB 2ANKH 1YKTA 2QA9E 2ZECA 3TIUA 4AFUA 1HGTH 4SGAE 4ZHLU 3WY8A 1EAIA 3NKKA 2IOTA 3TK9A 5DP5A 2J4IA 5F8ZA 1O3GA 1T8NA 1C1QA 2A2QH 4WMFA 2PKSC 4IBLH 2Y81A 2GTBA 1KXBA 5L2ZH 3F6UH 3VGCB 1HJ8A 2VH0A 2FP7B 1XKAC 3A87A 1AD8H 2ZPSA 3RXCA 3H7OA 1S5SA 1F2SE 1L4ZA 4NA9H 2STBE 4YLUA 1O38A 1WAYB 3URCA 2BB4A 1P2KA 3ZVEA 3EQ0H 1W11U 3S7KB 1TBQH 4UEHH 3B8JA 1N8OC 2HRVA 8GCHG 1CSOE 3NWUA 2BQ7B 4OGYA 2BY8X 2ZHEH 5T6DA 1EPTB 3LGWA 2QN5T 4CH8B 1P2OA 4JZIA 1TA2A 3KQBA 3TH3H 4FXGH 5DG6A 1UK2A 1IQNA 2AIPA 3C1KA 3LGUA 5JBCS 4ABEA 3HPTB 1BITA 1OWHA 4MNVA 1W8BH 3DFLA 5AF9H 3VGCC 2GCHF 3KN2A 1D6WA 3OTJE 1MAYA 2EI7A 3F9FA 3KL6A 2ZGHA 3EYDA 3VB5A 1TIOA 1UVPA 1NFYA 1EATA 1K9OE 2H5CA 4VGCB 1BMAA 3AW1A 4GHQA 1CA0B 2P16A 4XBDA 1HXFH 1M9UA 3OX7U 1AO5A 4H4FA 4AORA 2WV5A 1WUNH 1EPTC 5DP6A 1IHTH 2Z7FE 4BTTB 1GVZA 3SJOA 3EE0B 1TPOA 2A4RA 2OUAA 1SLUB 3RXIA 3P8OA 4DIIH 1ELTA 3LONA 5E2OA 1A1RA 1P06A 2PKAA 4WF8A 1SGNE 4NIWA 2CN0H 2BD3A 3PYHA 4I31A 2BD8A 2NWNA 3N7OA 5BRRE 3DD2H 3FZZA 4BTUB 3VB3A 1GI1A 1D3PB 1V2PT 4FU9A 2BM2A 3ZYDA 1FXYA 2FOAA 1N1LA 4VGCC 4B71A 2ALPA 2XBYA 3R0FA 4J2YB 1GHXH 3MO6A 4WH6A 3SJ9A 3UIRA 1CA0C 1CA8B 4MNXA 3KGPA 2QGRA 4K1TA 4MQAA 3MNSA 2V3OH 1INCA 2A31A 3S69A 3LC3A 2GV6A 2GVFA 3MH6A 1MCVA 1QJ7B 1HJ9A 1CHOF 4Q2KA 5AHGH 1O3OA 1CBWB 2AS9A 1DSTA 2PTCE 1GL0E 1Y3XA 1QNJA 4X6NA 3ZVAA 1SR5C 2BVRH 1C1OA 1GPZA 3EAJA 1MTUA 1TX8A 2A4OA 1JBUH 2A5AA 1NU7B 1T31A 1HCGA 3SGAE 3PM3A 4YO9A 1IQIA 1FPHH 2Y5FA 1O2LA 2VVCA 1TB6H 1FDPA 3VPKA 4RN6A 2ZTZA 3M5OA 3M7TA 1ZSLA 4K1EA 3S9BA 4R0IA 2EEKA 3GOVB 3U9AH 1OX1A 5F03A 4BOHA 1MCTA 2ZNKH 1GMCF 1XM1A 2ANWA 1ZTJA 2HVXA 1BZXE 3MNCA 4B2BA 3ZZ7A 2GGVB 3S7HB 3A82A 1CGHA 1WQSA 1Q31A 2FIRH 3PLKA 4Y0ZE 3P17H 4Y6DA 2ZZUH 1TQ0B 1VZQH 1FONA 2PV9B 2ZI2H 3SJKA 2NU3E 1GJ5H 2BLQA 4GHTA 1QURH 2XBVA 2AIQA 1TX6A 4DJZB 1BJVA 4R8TB 3HGPA 4Y79A 3A88A 3PWCA 1BDAA 1YPMH 1W7XH 1Y5AT 2THFB 5JBAS 3CS0A 1GL1A 4KGAA 4B73A 2TGPZ 2F91A 3RMNH 1PPHE 3B9FH 3SQHE 1MKWK 5LGOA 2FS8A 4UONA 2H2ZA 5C20A 1A0LA 4WMDA 1G3BA 3TNSA 2OCVB 1GBBA 1VJAU 3CS7A 1IQHA 3C27B 3GY2A 5DJ7A 2VIVA 2D26C 1LDTT 1NFXA 4MLFB 2FX4A 3V0XA 1C9TA 1O3AA 3SQEE 3SU5A 2BOHB 1XUKA 4NIVA 4MNYA 1RIWB 1MTWA 1AU8A 1Z6JH 1LPGB 1QFKH 2ZQ2A 1CU1A 2ZP0H 1O2JA 1DE7H 3UNRA 3ZVCA 3ZV8A 2Z6BD 1MU6B 2P59A 1FPCH 5EODA 1UCYH 2XCNA 3TJVA 3E8LA 1LKBA 1C2GA 4FVBA 1AIXH 1C5XB 3GDUA 4A7IB 2ZFFH 1TQ7B 5L30H 4FUHA 1F0UA 2BMGB 3SNCA 3D65E 1FLEE 2BDAA 5GPIB 3TGIE 2J94A 4CR5A 3A81A 4FUIA 2FI5E 1OWKA 3RXEA 1O2OA 2KAIA 8GCHF 1O5GH 1W2KH 1BQYA 4NZLA 1C5LH 1HIAA 1O2TA 3HKIB 4JCNA 1D9IA 3SV9A 1G30B 2G5VA 2VIWA 3DA9B 1SFQB 1E37B 3URDA 5F8XA 2FOEA 3GY5A 2V6NA 1UCYE 1C1PA 4MTBA 4U01A 1HAVB 3DT0H 3OU0A 2C90B 5J4SA 3JZ2B 4JZFH 3HATH 1GDQA 3GYLB 2HNTF 1E38B 1ELVA 1LHCH 5F8TA 1RIWC 1UHBB 3UNQA 1MBQA 1PQ5A 1ETSH 2BXUH 1THSH 4OS2A 3UQVA 2UUKB 2ZFRH 1C2FA 3EA8A 1KLTA 1EKBB 1O3DA 1O2QA 4ZMAH 1O2PA 4IC5A 1Z8IB 1ELDE 1HYLA 2PGBB 4Q7ZA 2ZU5A 5HYOA 3SNAA 1GMDF 4ABIA 8LPRA 1A5HA 9LPRA 2ZQ1A 1P57B 3SU1A 1TONA 3F1SB 3SV7A 3O8BA 3BTGE 1NT1A 3SV6A 4K3JA 1WYKA 1GVKB 1JRSA 3BTDE 3FP7E 1ANCA 4AFSA 2BD4A 4X6MA 4OS4A 3MNBA 3A7WA 1HAOH 5A0CA 2CV3A 2B7DH 1SOZA 3PMHB 4JK6A 4WJG2 4ABBA 2W3KA 1TMUH 2O8TA 2OC1A 4ZUHA 3E3TA 1VGCB 1NZQH 1ETTH 3E90B 1C1NA 5GDSH 3RXFA 3U8RH 2ZTXA 4MPUA 3RU4D 5IYTA 1U6QA 2VWOA 3GCTF 4ISNA 3M5NA 3UUZA 3V13A 3LPRA 1P09A 2UUJB 4YTAA 2O8LA 1H1BA 4XBBA 1V2JT 1FN8A 5EQQA 2QIQA 1XVMA 1EAWA 2VH6A 5DP8A 1A3BH 1UTPA 2VVUA 1IQKA 1IOEA 2J34A 3HK3B 2UWLA 4CRGA 3SN8A 2FESH 1BUIA 1L0ZA 1TGTA 1OYTH 2BXTH 3U98H 3V7TA 5T3HA 1MQ6A 1J16A 4NSVA 3ZZ3A 4BNRA 1C2DA 4MPVA 1YPLH 3VB7A 1L2EA 2FOMB 2PR3A 5A0BA 1HDTH 2AMPA 3PMBB 4I8GA 1AN1E 1Z6EA 5LPEA 2ZCHP 2FM2A 3A7XA 3ZZAA 1NESE 5FCKA 1O2XA 3FZDA 1ARBA 1W7GH 2FO9A 3V12A 1O2SA 1TNIA 4B2CA 2QY0B 5EXMA 2H1UA 3A80A 2RA0A 1VGCC 1T8LA 1PPBH 1O5BB 2RCEA 2FOCA 3L33A 2ILNA 1FJSA 4PROA 3TJUA 2ODQA 6GCHG 1HFDA 1O2VA 5ESTE 3M7QA 4X8UH 1PPCE 1ZRBA 3VB6A 4U2WA 1EZQA 4KP0A 1SGCA 2ESTE 1S82A 1GI3A 1C5TA 1UTJA 1AKSB 1TGSZ 5EG4A 7ESTE 1AB9B 2TRMA 4JZEH 1Z8RA 2Z94A 3SU4A 3MMGA 2AEIH 3OY5U 2H5DA 1BT7A 2R0KA 2F9PA 2ZGXH 1F5KU 1LVBA 2ZU4A 1V2MT 5K7RA 3NPSA 4AG2A 5H4IB 1DT2A 1J9CH 1LO6A 4J1YA 3SBKA 2HGTH 3K9XB 4M7GA 1K1IA 1SVPA 3NCLA 2ZCKP 1WBGB 3QDZB 5L2YH 2QXIA 1C5MD 1SGRE 4DCDA 5DPAA 2PGQB 1GJAB 3PLBA 2QCYA 1HJAB 2XC0A 1AVXA 5E0JA 2EI8A 2BDHA 4OS6A 2IPHA 1DUAA 3GY7A 2ZDMA 3Q76A 1PPZA 1GI2A 2O9QA 2QXGA 4UD9H 2JH5D 5LH8A 3HKJB 1GJBB 2FPZA 2GMTB 2QYIA 1YC0A 5JPMH 3T62A 3RXSA 1BTWA 1ESAA 3GYMA 2P94A 4ABDA 3U69H 1EOJA 2GKVE 1SMFE 2VIQA 4LK4A 1QL7A 1TE0A 1Y3VA 3SNEA 1J8AA 3SZNA 2FI3E 2FYQA 1ZYOA 1MTNB 2WYGA 1G2LA 1NC6A 3K65B 2QF0A 5FPTA 3D62A 4HGCA 4A1VA 1WTHD 1QJ1B 3PTNA 2P3FH 1QBNA 1HJAC 3KQDA 1O3IA 3LH1A 1H4WA 3TJOA 4X2XA 2UUFB 1X7AC 1GJ4H 1TRMA 4TWYA 1TLDA 4TWWA 1SLXB 4A1TA 1NRSH 5HM2A 2CMYA 1LMWB 2Z9LA 4Y8XA 4I8LA 2FDAA 1GBTA 5FBIA 2C4FH 4JYUH 1ZZZA 1BTZA 1F92A 3VEQB 1TOCB 1ZTLA 1O30A 3VXEH
chains in the Genus database with same CATH superfamily
4B74A 1GMHF 1OS8A 4U30A 2M5TA 3K2UA 3SV8A 1PJPA 1H9HE 2B5TB 5GNDA 1FN6A 1P01A 2ZPRA 2ZDKA 3LGVA 5GIBA 1PQAA 2FEQH 3ZZ5A 1KIGH 1AFQC 1JMOH 2HALA 2IN2A 1THPB 1H8ED 2PLXA 1KXEA 1LKAA 3B23B 1E36B 2JJ2D 4NSYA 5EW1H 4TPIZ 1B0FA 1Z71A 5TCCA 1AGJA 2C3SA 5DP9A 3RXAA 2HPPH 1KXAA 5GWZA 2D1JA 1AQ7A 3T29A 2WPDD 5E0HA 1J15A 5CE1A 4TSFD 1ZJKA 2JH6D 2QV1A 4K8YA 3EA7A 1EZUC 1K1MA 4DT4A 2XYAA 4YM9A 5BPEA 1A7SA 2Y80A 3LGIA 1YYY1 3RXTA 1GHZA 3PRBA 3MWIU 1DPOA 2OQ5A 3A8CA 3FP8E 1C5UA 2A45B 3GCOA 2YNAA 5F6MA 1CHGA 2W5EA 2Q1JA 4CRFA 1C1VH 1JIRA 2ALVA 1WCZA 2EA3A 1DLKB 3W94A 1C5ZB 1S83A 2Z9GA 2CF9H 3MHWU 1W0ZU 2H9EH 1C1MA 1O33A 3SI4H 4ZROA 4GSOA 1BOQA 4OGXA 2ANMH 4IS5A 1DWCH 2KZ4A 4RKOB 4DGJA 1BA8B 1MD7A 1Q3XA 2RG3A 3DCLA 1ID5H 2I6SA 3FP6E 4B1TA 2P95A 1O3FA 3D49H 1BRCE 1C1WH 1FY8E 7LPRA 5HXFA 4TY6A 4H6SB 2GDDA 2ODYB 2PSYA 1QRWA 4AG1A 4E05H 1ESTA 3LJJA 2IJOB 6LPRA 1O32A 1IAUA 3M61U 5C3NA 1MD8A 3PRDA 1ZTKA 1A0HB 1UTMA 3Q77A 3FVFB 3Q3XA 4FUCA 3SGQE 3UOPA 1G3EA 1TGBA 4ZH8A 4CRDA 4E06H 4O3UA 1GBHA 3LKWA 3P8NA 1ESBA 1QB6A 1EASA 4CRCA 2ZCLP 1BBRK 1D3DB 1P3EA 4X1NU 3TH2H 1PQ7A 1IHSH 1MTVA 1D6RA 3U28C 5JB8S 4RSPA 2J38A 3NXPA 4K69A 4GLYA 4NIYA 1ELFA 3QGJA 6GCHF 1BTHH 3A85A 3ODFA 3DSGA 2O8MA 1XUFA 1SGDE 3LIWA 4ZXYH 3M36A 1RTLA 3T27A 1H8DH 1VKYA 2SGEE 2PHBA 1VITH 3I77A 3RUOA 3MNXA 6CHAB 1O3PB 2F3CE 1K1LA 1BMLA 1KXDA 3GY4A 2BDGA 4ISOA 3E0PB 2ANYA 5C2ZA 5HGGA 1O2GH 2WPKS 1RXPA 4Y11E 3M3TA 1HAGE 5C94A 1TOMH 1ARCA 3SZEA 1MZDA 4UFEH 2FXRA 1C2IA 2OQUA 2BQ6B 3WWBA 1CGJE 1C5RA 5IK2D 1BMNH 4ABHA 1DICA 1N6YA 1Q2WA 1Y59T 2VWMA 4Y76A 2GV7A 3KQCA 3DSPA 1BJUA 1KSNA 2O8UA 5JBTA 1ZMJA 1T8OA 4O3TA 1UTLM 3Q00A 1V2TT 9ESTA 1IQLA 3ESTA 3E6PH 4LZ4B 2BOKA 4YESB 1O5DH 1P2QA 6CHAC 4BAOB 1P11E 3SHCH 4ZHMU 3QWCH 5IDKA 3UFAA 1O2RA 1NO9H 1YGCH 2ZGBH 1G3DA 3QN7A 1C4U2 1GBFA 2ZA5A 1AZZA 3S0NA 1DXWA 1NN6A 1CT2E 1SFIA 2ZF0H 1CE5A 1O31A 2C93B 2XNDD 2OBQA 2BHGA 2AH4X 1V2RT 4HG6A 1DX5M 1C2MA 1TNKA 1NU9A 2FOGA 4OS1A 3SO3A 5FX5A 2C8WB 3FKSD 1DLEA 1G32B 4NG9H 5GCHG 2GT8A 3F0OA 2VIOA 5CDFE 2FLRH 2VB0A 1SGTA 3RC4A 1GHWH 1GG6B 4NWLA 1FUJA 4NWKA 1KYNA 4WXIA 1P9SA 2QXHA 2R2WU 3RLWH 1GI8B 2GD4B 2XC4A 1GJ8B 1MMJN 2FODA 1O5CB 1CBWC 1LHFH 3UY9A 3A84A 3BTHE 2F9VA 3FFGA 1Z8GA 2P3TB 2OK5A 2Y5HA 2G5NA 2PKAB 3M37A 4M9FA 3SU0A 1YLCA 5TJXA 5K0HA 4YOIA 2ZFQH 3RM0H 4BAHB 2Y82A 1TMTH 3LT3A 4MPWA 4OS7A 4BXWA 1NRQH 2SGAA 5FPSA 4D76A 1GBEA 2WPHS 3MU4A 3MQKC 3MU8A 1OSSA 2CGAA 2ZGJA 1A46H 7GCHG 2A7CA 3PLPA 1QTFA 1ANDA 1CT4E 3IG6B 2VIPA 1TNGA 2JIZD 1K22H 1THRH 2B9LA 7KMEH 2BDBA 1D3QB 2V3MA 1GJ6A 3RXKA 1GBCA 2BDYA 3ZYEA 1EJNA 4GUXA 2UWOA 1YCPM 3SGBE 1PPGE 4Y71A 3F3BA 4K2YA 2Z9IA 3F68H 4AYVB 2Z3DA 3KQEA 3KYFA 2HNTC 2SGDE 5LPFA 2WUBA 1TALA 1GI5A 2WINI 4I32A 2SNWA 3BTEE 4B6EA 1NBMD 1SPJA 4CBOA 2VNTA 1W12U 1TPAE 1SHYA 5C5OA 1O5AB 1WOFA 3N7DA 3STIA 8ESTE 1Z1IA 1DANH 1QB1A 3BIUH 1GBAA 4Y10E 5SGAE 3SUEA 4INLA 1SI5H 3UPEA 2I6QA 4ISLA 2JKHA 3A7ZA 5EOKA 1QL8A 1WTGH 1V2WT 1OHHD 1PYTC 4F49A 2G8TA 1ZOMA 2AMQA 4XSKU 4JYVH 1KDQA 4ASHA 2P93A 4FUFA 4AFQA 5AVDA 1RRKA 4UFGH 2PUQH 3M35A 4K1SA 2J2UA 3RXRA 2Z3EA 1GBJA 4AYYB 4I33A 2F9NA 3BIVH 3RC6A 1YF4A 3PMAB 3SW2B 3UWIA 2RDEA 3STJA 1GI0A 1GHAG 1TFXA 4INKA 4FUJA 5ETXA 1O3HA 2ZWLH 1AZ8A 1ZGVA 3WW7A 1V2LT 1BHXF 1TA6A 1GDUA 1QRXA 1BIOA 3M5LA 2XOKD 1RD3B 1ZSKA 2V0BA 3M3SA 4BAMB 1BRUP 1GGDB 3MO3A 1VCPA 1UO6A 3T25A 1TGCA 2QXJA 1XUJA 4ZXXH 3QTOH 3LDXH 1GI4A 4CHAB 1V2QT 1UVOA 1ZSJA 2BVSH 2W6JD 2BD5A 1OP2A 1OWIA 1TPPA 2A7HA 1G37A 5EJ1A 4X0WU 1Y5UT 1DITH 1ANEA 2BLVA 4FUEA 1FY4A 3L6PA 4NCYA 1A2CH 4Q7XA 1YPKH 5FBEA 1GVLA 3KIDU 5EPYA 2WZQA 4FUBA 1J17T 2CHAB 1FQ3A 1NM6A 1L1JA 3VFEA 1UTKA 3BTKE 5EQSA 5GXPA 3H7TA 3MU0A 3NRLA 1QJ6B 2XCFA 3OEHD 1QQ4A 5A8YA 2OINA 1V2VT 2GCTB 2VBCA 3MH4A 2FOFA 1J14A 2JH0D 1O2YA 4XBCA 4ZCNA 3MO9A 4XD7D 2K8IA 1GGDC 4Q4LA 1JIMA 2FZZA 5B6LA 1ZPZA 3SV2H 2Q6DA 3DHKH 3MH7A 3S9CA 4NA8A 1QBVH 1SBWA 2XC5A 4X8VH 1A3EH 4CHAC 2XBXA 4HZHA 4IN2A 1O2NA 3P8FA 3GDSA 1YPJH 2ULLA 2FMJA 4GVUA 1HAHH 2NU2E 4FVDA 5EXNA 2W7UA 2IPQX 2LELA 1E34B 1KTSB 2KAIB 2VIDA 3A7TA 2D8WA 2YNBA 4E7RG 2C8ZB 1EP6A 1P8VC 1AE5A 3IITA 1PPFE 5C17A 1HIAB 2BDIA 4A5TS 1HAIH 1O0DH 4UDWH 4SGBE 3RM2H 2CHAC 2SFAA 2FI4E 1S0QA 3ATMA 5EW2H 1GBKA 1VR1H 1DM4B 1TGNA 1E0FD 3ZVDA 2HVYB 3CP7A 2STAE 4IGDA 2IJD1 1P2JA 1V2NT 2GCTC 5DP4A 2A2XH 1AE8H 4Z1MD 1C2LA 1C2EA 2BLOA 2NU1E 5KECA 2XTTB 1ABIH 4I8JA 1GJDB 1V2UT 2BVXH 1SC8U 2VWLA 2C8YB 4ESTE 2J95A 5CHAB 4DY7B 4CRBA 3EE7A 3AASA 1H8IH 2GX4A 2V35A 1B7XB 1GJ7B 1MU8B 5FAHA 3LC5A 4H6TA 5GCHF 1FY1A 1C5SA 2ZIQH 3FAOA 1SOTA 5C67A 1XXDA 4F55A 3MFJA 1NRRH 4I7YH 2OD3B 2SGPE 3S9AA 4GPGA 1HV7A 4UE7H 4ABFA 1YBWA 2KM0A 4Y7AA 1ABJH 2WPJS 1DUEA 2AGGX 3PO1B 4KTUA 1UJ1A 3LJOA 5JB9S 1FY5A 1BTYA 2ZHFH 2BLWA 1KXFA 1ZMNA 1RGQA 4Y8ZA 1ZHMA 1FI8A 3OYPA 4X6OA 2HWLB 2WV4A 1T4UH 1AUTC 1LQEA 2Y7XA 1GHVH 1JXPA 1TRYA 2A32A 1XX9A 4GCHG 5I46H 2F83A 3UREA 4K8BA 2HOBA 5EGMA 1CGIE 4I8KA 1SKYE 5DSFA 1O37A 2ZC9H 1O2HA 1Z8JB 1ZPBA 3SUFA 1QRZA 1AB9C 4K60A 4DT7B 3Q3KA 1TABE 1P0SH 1O3KA 2VWNA 1K2I1 4YXWD 1QBOA 1SLVB 1KLIH 2RDLA 1S6HA 3UNSA 1RTFB 1FMGA 3GY6A 4ZKRU 1QA0A 1BBRH 2Y5GA 1HAYB 3SORA 1EQ9A 1E1RD 4AFZA 3ZZDA 3P8GA 3PO1C 1SL3A 1LHDH 4Q80A 3UTUH 1KY9A 2A5IA 2BD7A 2R3YA 1O3BA 1OP8A 3U1IB 1DSUA 1BTUA 3A83A 1T7CA 1AHTH 2F4LA 3KCGH 1QY6A 2ZEBA 5EJLA 3RXHA 5ABWA 1G3CA 1H9LB 1DWBH 1RTKA 3BEFB 1P03A 5EU8A 2KR7A 1T4VH 1EUFA 1EPTA 3F9HA 4LZ1H 2TPIZ 3LU9B 1GBIA 2GMTC 4YT6H 3ZVFA 3A7YA 2ZU3A 5T6FA 4AB8A 2UUYA 1BBRE 1SQAA 3DFJA 1S84A 2LNCA 3ODDA 4UFDH 3OY6U 3T5FH 3SJ8A 1GHBG 1TBRH 3A8BA 3ITIA 2J98A 2FX6A 3SU2A 1YPEH 1GHAF 2GP9B 1K21H 1MTNC 3RXLA 1WDIA 1C4V2 1Z1JA 4ACBA 3ZZ4A 3R3GB 1UMAH 2G4UA 2ZHWH 2VINA 2ZU2A 1LPKB 4JZDH 1SGQE 1LHGH 2CK3D 3TH4H 3AAUA 3E0NB 1OKXA 2W3IA 2XXLA 1KXCA 3IWMA 2PUXB 3TU7H 1HAZB 2BD2A 4BAQB 4ZKOU 2ZDNA 3TGJE 1PPEE 2ZO3H 1SLWB 2FWWA 3BV9B 5FXLA 1C2JA 4YLQH 1V6DA 1LTOA 1ETRH 1K1NA 1UTOA 1UTNA 4HFPB 1AVWA 1AI8H 2VVVA 2RFKC 3OAAD 2FTMA 2Z9KA 2XWBI 1PFXC 1L1GA 2BQWB 3NUMA 3ZZ6A 2CJIA 1EZXC 3O8CA 5LPRA 1FX0B 4CREA 2NU4E 1BTXA 1S6LA 1AFEH 4MG3A 1A0JA 1GCDA 1ZR0A 3BTME 1YPGH 3A7VA 4AX9H 4ZKNU 1HUTH 3GCNA 4THNH 1S6FA 2XBWA 1EZSC 4KELA 2D2DA 4X1SU 4WVPE 4I8HA 4CH2B 1P12E 2Q6FA 3K6ZA 5JYIA 1GHYH 3U8OH 1VITG 4ZHAA 2F9UA 4INHA 3N7EA 2A0QB 4H42U 4NA7A 1QA7A 2GZ7A 4YOGA 2BY7X 2BX4A 3ZZ9A 4Y7BA 1F0SA 3RXJA 1BB0B 4NGAH 4YT7H 1V2OT 1DVAH 5DP3A 3MYWA 3H09A 3H5CB 4XE4A 1DDJA 1MKXK 4RKJB 5E2PA 4O9VA 4NFEA 1SSXA 1C5OH 2ZU1A 1GJ9B 2DE8A 3GY3A 3DSOA 3SUDA 2AMDA 1FZZA 4ZKSU 1MKWH 2GZ9A 2K1QA 5EQRA 1P2IA 1XMNB 3ZVGA 1ACBE 1YPHE 3LH3A 3VB4A 1MTSA 3NZIA 4Q7YA 2AGIX 2QE7D 2R9PA 4JZ1A 2G51A 1JWTA 2FLBH 1VCQA 3RMLH 1SQRA 1GMDG 1SHHB 2F9OA 4KKDA 1SQOA 4X6PA 1WV7H 1C4Y2 1DXPA 5G4BA 4E7NA 1ELBA 1TAWA 2YMSD 4ISIH 1NFWA 4IMQA 1F5LA 3PV4A 1DY8A 4YZUA 3EGKH 1HXEH 1DWEH 1HRTH 2FTLE 5C0UA 4OM9A 1A4WH 1D4PB 4K5ZA 3GDVA 3T28A 3RC5A 1N6XA 1O2MA 3U1JB 1RJXB 4X8TH 2G55A 2PW8H 1QCPA 3UR9A 1C5YB 2OC8A 1IQFA 1OXGA 5HIYA 1ZLRA 3KEEA 4OS5A 4BTIB 2AYWA 1C2HA 5C5NA 4O97A 4D7GA 3W1EA 1HPGA 3ATWA 1TNHA 5AFZH 1EAXA 1YCPK 4MVNA 4Y8YA 4RT1A 1O3MA 4A6LA 1UVUH 4TY7A 4B76A 4Z6AH 1JOUB 2VGCB 3GCTG 2ODPA 1MZAA 2DUCA 3ZIAD 1O3CA 1GBDA 2ZHDA 5GJ4B 1NRPH 1SGFG 3ZV9A 3P92A 1YLDA 3BG4B 3T26A 4NIXA 4GCHF 1W13U 3SJIA 1GI9B 2R2MB 3ZZ8A 2ZHQH 1EB1H 1K1OA 2A7JA 1FIWA 1EOLA 2CXVA 3TLOA 3QGNB 3TVJB 3L3TA 5I25A 3TNTA 1EXFA 4IW4E 2HNTE 3I78A 1S0RA 1P9UA 2KFWA 3ZVBA 1H8HD 1HBTH 3T2NA 3BF6H 1HLTH 4ISHH 3ELAH 3UQOA 3ZZCA 1P2NA 3BEUA 4XDEA 1YPHC 3P95A 4A1XA 4ZAEA 3O8DA 3DUXH 4A92A 3BTWE 2Y6TA 2GT7A 3PROA 2G4TA 1GJCB 4CRAA 2SNVA 2VGCC 1K28D 2AGEX 5E0GA 3TITA 2FOBA 2Y7ZA 3Q3YA 1W10U 2B8OH 1SGFA 4WMEA 3NK8A 1ZMLA 4BAKB 2AFQB 2WSSD 1O5EH 3LGYA 4I86A 1UVSH 2KCOA 3BG4C 3QTVH 4NZQA 3RU4E 2P3UB 1T32A 1HB0B 4CR9A 4IN1A 1QIXB 3D23A 1MAXA 1XKBC 1DY9A 5PTPA 3RXBA 1BHXB 1C1UH 4DIHH 1XXFA 1IQJA 5FX6A 1ZPCA 4TYDA 1HAPH 1HAVA 3PB1E 4D9RA 1SQTA 2TBSA 1LCYA 1TNJA 1QHRB 1XUHA 3MU5A 4MPXA 1DS2E 4QT8C 2OC7A 3O8RA 5L6NH 1GHBF 2XW9A 1UHBA 3SNBA 5A8XA 4DG4A 1V3XA 1L4DA 1EJAA 2HLCA 1Y3UA 2KCPA 1D3TB 2HPQH 3RP2A 8KME2 1A61H 1O39A 2VJ1A 4WY3A 1CO7E 3SUGA 1NS3A 4X1RU 1DFPA 4ABAA 1HAXB 2RA3A 1L1NA 5ESBA 1GG6C 3AVZA 3GICB 4AGKA 5DO4H 2W7SA 3KNXA 2FS9A 3A8DA 3MH5A 1QB9A 1LVOA 3N99A 2TIOA 3KHVA 1O35A 2G00A 3EA9A 3M7UA 1W0YH 1O2UA 2XRCA 4O03A 1QR3E 5KEDA 1MQ5A 4UFFH 1OP0A 3RXUA 1C5WB 4X1PU 3ZZBA 1BRBE 3PWBA 3TGKE 3UR6A 2WPLS 2PSXA 3GY8A 2ZTYA 2QF4A 1NPMA 4LOYH 5DK1A 2TGDA 2J92A 1UK3A 1SGYE 3SU6A 1BTPA 3MI4A 2C8XB 1FIZA 3A89A 3KF2A 3UOUA 4BANB 2H6MA 1W3CA 4AB9A 2BY9X 1IQMA 5A09A 1C5QA 4XOJA 1ZHPA 5EJZA 3RDZA 1FAKH 3SOSA 4IC6A 1SB1H 1XUIA 3I29A 1LQDB 2GZ8A 2ZDVH 4AOQA 3RMOH 3OEED 2A1DB 1P2MA 1KMHB 2ASUB 1VITF 4D8NA 1WU1A 4X2YA 1XVOA 2ZG0H 1HNEE 1SGPE 3A86A 1NTPA 2A4QA 4LXBH 3QX5H 3K6YA 2BD9A 3PV5A 4GAWA 5JBBS 2QF3A 3F0PA 5AFYH 4JK5A 1F5RA 4IMZA 2JETB 1S81A 1SGEE 5EIYA 4D7FA 1V2KT 3E16B 1GMHG 1QL9A 5DGJA 1Y3YA 1IQGA 3QZQA 3RXOA 1OYQA 1GI6A 1A5IA 3V3MA 2QAAA 4TPYA 1BRAA 1FY3A 1C5NH 4D9QA 2PP6A 1K1JA 1ELGA 1GI7B 1C2KA 1CQQA 4X2WA 1MBMA 1NROH 1YP9A 1KLJH 1P10A 1UTQA 1G9IE 1C5VA 4NFFA 1ELAA 1PQ8A 1WQVH 4HTCH 1WSSH 1OWEA 1QGFA 3SI3H 1AKSA 4HI3A 5HIZA 1O34A 3GCHB 3SU3A 1V2ST 1B5GH 4MNWA 4X2VA 1O5FH 1O3EA 2PTNA 3HK6B 2FOHA 1COWD 2WPMS 4JYTA 1AY6H 3AW0A 2FYRA 3M3VA 1CT0E 1TWXB 3RXDA 2BTCE 1F0RA 3FANA 5C1UA 2AERH 2OBOA 2BY5X 2JETC 1LVMA 1JRTA 3ENSB 1P04A 2R0LA 1EAUA 2SGQE 1PYTD 3WWFA 4DW2U 1C1RA 1SG8B 2TGAA 5HMAA 3RLYH 4RI0A 1OWJA 3E91A 2YOLA 2QC2A 1EJMA 1C1TA 5T1VA 1S85A 4RT0A 1C5PA 3RU4T 2B0FA 1O3NA 2DE9A 3RXMA 1P3CA 6ESTA 1AMHA 3FOAA 3RMMH 3TK6A 3KQ5A 2LPRA 1TX7A 1KDQB 4Y0YE 3ATIA 1T8MA 2A5KA 3QK1A 2Z3CA 1GCTB 5EPNA 2UWPA 1Y5BT 5HM9A 2EI6A 3M5MA 3GCHC 4KTSA 1B0EA 4JMYA 3RXGA 2GCHG 2NU0E 5TCAA 5A0AE 2A4GA 1EB2A 3QO6A 4X1QU 4AGJA 3EDXB 2R3UA 1NY22 4ABJA 4F4OC 1DWDH 1O2WA 2ZFTA 1XUGA 1EP5A 2F9BH 1TPSA 3ATLA 1W0KD 1ORFA 1QQUA 1KTTB 3PTBA 3E1XB 2EC9H 3TPIZ 1ZJDA 2ZFPH 5J4QA 1DOJA 1C9PA 1UCYK 5E8EH 4B6FA 3CENA 1F0TA 4FU7A 4X8SH 2ZGCA 3VXFH 1FNIA 3F9GA 3QUMP 5DKMA 4YOJA 1ZRKA 2WUCA 3BTFE 3GISB 3PMJA 2ZDAH 4XFQA 4ABGA 1IQEA 1GCTC 2BY6X 5C1XA 2OP9A 1O36A 1ZHRA 2ZDLA 1ELCA 5A2MH 1E35B 2W26A 1NRNH 1OWDA 1K1PA 2P8OB 3JZ1B 1YM0A 2BX3A 1LHEH 4FU8A 1O2ZA 1P05A 1H9IE 5B6OA 1MH0A 4WWYA 1AUJA 3F9EA 5CHAC 4AZ2B 1C1SA 1G2MA 1G36A 1UK4A 3P6ZB 1O2IA 2V3HH 7GCHF 2ZFSA 5A8ZA 2OXSA 1VCWA 1MKXH 2OTVA 2ZKSA 3AAVA 3A8AA 4AN7A 1LPZB 1CHOG 1ZGIA 1F7ZA 1GBMA 2BYAX 3SHAH 1TRNA 1O2KA 1QZ8A 1TYNA 5EXLA 2SGFE 1A5GH 5FPYA 2XWAA 1MUEB 4MDSA 3UWJH 2G81E 1TNLA 3HGNA 1AVGH 2Q6GA 1EX3A 1O3JA 2PFEA 2G52A 3BTQE 5KGOA 2WYJA 1NFUA 4WXVA 3QLPH 1ANBA 3TK5A 4B2AA 1OPHB 5DP7A 4Z0KA 2P8OC 1BMFD 1RS0A 3BTTE 1Z7KA 2JDID 5FHTA 5FCRA 3BG8A 5C1YA 3BEIB 1GDNA 3P70B 3RXVA 3BSQA 3W95A 2ZPQA 2H9TH 4WH8A 4B75A 3LGTA 3MU1A 2M2AA 4DURA 1ELEE 1AFQB 2QF5A 2XNIA 2GDEH 1GMCG 3RXQA 2BZ6H 4P02A 3MOCA 3LOXA 1AWFH 1CVWH 2WHXA 1Y3WA 4BXSA 1W14U 4TT3D 2O8WA 5T6GA 1LVYA 2CF8H 1BCUH 4FUDA 1OOKB 2K0QA 2OLGA 1E79D 3GS9A 1GWAA 1RFNA 1O3LA 1BMMH 2PKSB 1YCPH 3U8TH 3RXPA 2YMSB 4DVAU 3ATKA 1UVTH 2BZAA 2BDCA 1FAXA 4CBNA 2H9HA 2PWXA 2TGTA 1TBZH 2OC0A 5CMXH 4DOQA 2WPIS 1P02A 2VU8E 1FV9A 1Y8TA 1AWHB 2J9NA 3QZRA 1VJ9U 4U32A 3G01A 3TJNA 2Z9JA 1N8OB 4KTCA 3OSYA 1GBLA 1SGIB 3BN9A 4FUGA 3SNDA 1TMBH 3MTYA 5JDUB 2ANKH 1YKTA 2QA9E 2ZECA 3TIUA 4AFUA 1HGTH 4SGAE 4ZHLU 3WY8A 1EAIA 3NKKA 2IOTA 1YY3A 3TK9A 5DP5A 2J4IA 5CHBA 5F8ZA 1O3GA 1T8NA 1C1QA 2A2QH 4WMFA 2PKSC 4IBLH 2Y81A 2GTBA 1KXBA 1YWUA 5L2ZH 2YMSC 3F6UH 3VGCB 3SYJA 1HJ8A 2VH0A 2FP7B 1XKAC 3A87A 1AD8H 2ZPSA 3RXCA 3H7OA 1S5SA 1F2SE 1L4ZA 4NA9H 2STBE 5DN6D 4YLUA 1O38A 1WAYB 3URCA 2BB4A 1P2KA 3ZVEA 3EQ0H 1W11U 3S7KB 1TBQH 4UEHH 3B8JA 1N8OC 2HRVA 8GCHG 1CSOE 3NWUA 2BQ7B 4OGYA 2BY8X 2ZHEH 3F2HA 4FOUC 5T6DA 1EPTB 3LGWA 2QN5T 4CH8B 1P2OA 4JZIA 1TA2A 3KQBA 3TH3H 4FXGH 5DG6A 4AC9A 1UK2A 1IQNA 2AIPA 3C1KA 3LGUA 2J98B 5JBCS 4ABEA 3HPTB 1BITA 1OWHA 4MNVA 1W8BH 3DFLA 5AF9H 3OE7D 3VGCC 2GCHF 3KN2A 1D6WA 3OTJE 1MAYA 2EI7A 3F9FA 3KL6A 2ZGHA 3EYDA 3VB5A 1TIOA 2WV9A 1UVPA 1NFYA 1EATA 1K9OE 2H5CA 4VGCB 5FL7D 2AHME 1BMAA 1NBME 3AW1A 2J97A 4GHQA 1CA0B 2P16A 4XBDA 1HXFH 1M9UA 3OX7U 1AO5A 4H4FA 4AORA 4XRNA 2WV5A 1WUNH 1EPTC 5DP6A 3KYGA 1IHTH 2Z7FE 4BTTB 1WXRA 1GVZA 3SJOA 3EE0B 1W0JD 1TPOA 2A4RA 2OUAA 1SLUB 3RXIA 3P8OA 4DIIH 1ELTA 3LONA 5E2OA 1A1RA 1P06A 2PKAA 3UAIC 4WF8A 1SGNE 4NIWA 2CN0H 2BD3A 3PYHA 4I31A 2BD8A 1YLNA 2NWNA 3N7OA 5BRRE 3DD2H 3FZZA 4BTUB 3VB3A 1GI1A 1D3PB 1V2PT 4FU9A 2BM2A 3ZYDA 1FXYA 2FOAA 1N1LA 4VGCC 4B71A 2ALPA 2XBYA 3R0FA 4J2YB 1GHXH 3MO6A 4ASUD 4WH6A 2KCYA 3SJ9A 3UIRA 1CA0C 1CA8B 4MNXA 3KGPA 2QGRA 4K1TA 4MQAA 3MNSA 2V3OH 1INCA 2A31A 3S69A 3LC3A 2GV6A 2JJ1D 2GVFA 3MH6A 1MCVA 1QJ7B 1HJ9A 1CHOF 4Q2KA 4P00A 5AHGH 1O3OA 1CBWB 2AS9A 1DSTA 2PTCE 1GL0E 2L74A 1Y3XA 1QNJA 4X6NA 3ZVAA 1SR5C 2BVRH 1C1OA 1GPZA 3EAJA 1MTUA 1TX8A 2A4OA 1JBUH 2A5AA 2GJGA 1NU7B 1T31A 1HCGA 3SGAE 3PM3A 4YO9A 1IQIA 1FPHH 2Y5FA 1O2LA 2VVCA 1TB6H 1FDPA 3VPKA 4RN6A 2EQNA 2ZTZA 3M5OA 3M7TA 1ZSLA 4K1EA 3S9BA 4R0IA 2EEKA 3GOVB 3U9AH 1K0HA 1OX1A 5F03A 4BOHA 1MCTA 2ZNKH 1GMCF 1XM1A 2ANWA 1ZTJA 2HVXA 1BZXE 3MNCA 4B2BA 3ZZ7A 2GGVB 3S7HB 3F2FA 2KCAA 3A82A 1CGHA 1WQSA 1Q31A 2FIRH 3PLKA 4Y0ZE 3P17H 4Y6DA 3CNRA 2L6OA 2ZZUH 1TQ0B 1VZQH 1FONA 2PV9B 2ZI2H 3SJKA 2NU3E 1GJ5H 2BLQA 4GHTA 1QURH 2XBVA 2AIQA 1TX6A 4DJZB 1BJVA 4R8TB 3HGPA 4Y79A 3A88A 3PWCA 1BDAA 1YPMH 1W7XH 1Y5AT 2THFB 5F53A 5JBAS 3CS0A 1GL1A 4KGAA 4B73A 2TGPZ 2F91A 1MABB 3FN8A 3RMNH 1PPHE 3B9FH 3SQHE 1MKWK 5LGOA 2FS8A 4UONA 2H2ZA 5C20A 1A0LA 4WMDA 1G3BA 3TNSA 2OCVB 1GBBA 1VJAU 3CS7A 1IQHA 3C27B 3FO8D 3GY2A 5DJ7A 2VIVA 2D26C 1LDTT 1NFXA 4MLFB 2FX4A 3V0XA 1C9TA 1O3AA 3SQEE 3SU5A 2BOHB 1XUKA 4NIVA 4MNYA 1RIWB 1MTWA 1AU8A 1Z6JH 1LPGB 1QFKH 2ZQ2A 1CU1A 1E1QD 2ZP0H 1O2JA 1DE7H 3UNRA 3ZVCA 3ZV8A 2Z6BD 1MU6B 2P59A 1FPCH 5EODA 1UCYH 2XCNA 3TJVA 3E8LA 1LKBA 1C2GA 4FVBA 1AIXH 1C5XB 3GDUA 4A7IB 2ZFFH 1TQ7B 5L30H 4FUHA 1F0UA 2BMGB 3SNCA 3D65E 1FLEE 2BDAA 5GPIB 3TGIE 2J94A 4CR5A 3A81A 4FUIA 2FI5E 1OWKA 3RXEA 1O2OA 1EFRD 2KAIA 8GCHF 1O5GH 1W2KH 1BQYA 4NZLA 1C5LH 1HIAA 1O2TA 3HKIB 4JCNA 1D9IA 3SV9A 1G30B 2G5VA 2VIWA 3DA9B 1SFQB 1E37B 3URDA 5F8XA 3UB0A 2FOEA 3GY5A 2V6NA 1UCYE 1C1PA 4MTBA 4U01A 1HAVB 3DT0H 3OU0A 2C90B 5J4SA 3JZ2B 4JZFH 3HATH 1GDQA 3GYLB 2HNTF 1E38B 1ELVA 1LHCH 5F8TA 1RIWC 2V7QD 1UHBB 3UNQA 1MBQA 1PQ5A 1ETSH 2BXUH 1THSH 4OS2A 3UQVA 2UUKB 2ZFRH 1C2FA 3EA8A 1KLTA 1EKBB 1O3DA 1O2QA 4ZMAH 1O2PA 4IC5A 1Z8IB 1ELDE 1HYLA 2PGBB 4Q7ZA 2ZU5A 5HYOA 3SNAA 1GMDF 4ABIA 8LPRA 1A5HA 9LPRA 2ZQ1A 1P57B 3SU1A 5HKKD 1TONA 3F1SB 3SV7A 3O8BA 3BTGE 1NT1A 3SV6A 4K3JA 1WYKA 1GVKB 1JRSA 3BTDE 3FP7E 1ANCA 4AFSA 2BD4A 4X6MA 4OS4A 3MNBA 3A7WA 1HAOH 5A0CA 2CV3A 2B7DH 1SOZA 3PMHB 4JK6A 4WJG2 4ABBA 2W3KA 1TMUH 2O8TA 2OC1A 4ZUHA 3E3TA 1VGCB 1NZQH 1ETTH 3E90B 1C1NA 5GDSH 3RXFA 3U8RH 2ZTXA 4MPUA 3RU4D 5IYTA 1U6QA 2VWOA 3GCTF 4ISNA 3M5NA 3PV2A 3UUZA 3V13A 3LPRA 1P09A 2UUJB 4YTAA 2HLDD 2O8LA 1H1BA 4XBBA 1V2JT 1FN8A 5EQQA 2QIQA 1XVMA 1EAWA 2VH6A 5DP8A 1A3BH 1UTPA 2VVUA 1IQKA 1IOEA 2J34A 3HK3B 2UWLA 4CRGA 3SN8A 2FESH 1BUIA 1L0ZA 1TGTA 1OYTH 2BXTH 3U98H 3V7TA 5T3HA 1MQ6A 1J16A 4NSVA 3ZZ3A 4BNRA 1C2DA 4MPVA 1YPLH 3VB7A 1L2EA 2FOMB 2PR3A 5A0BA 1HDTH 2AMPA 3PMBB 4I8GA 1AN1E 1Z6EA 5LPEA 2ZCHP 2FM2A 3A7XA 3ZZAA 1NESE 5FCKA 1O2XA 3FZDA 4ACAA 1ARBA 1W7GH 2FO9A 3V12A 1O2SA 1TNIA 4B2CA 2QY0B 5EXMA 2H1UA 3A80A 2RA0A 1VGCC 2LP6A 1T8LA 1PPBH 1O5BB 2RCEA 2FOCA 3L33A 2ILNA 1FJSA 4PROA 3TJUA 2ODQA 6GCHG 1HFDA 1O2VA 5ESTE 3M7QA 4X8UH 1PPCE 1ZRBA 3VB6A 4U2WA 1EZQA 4KP0A 1SGCA 2ESTE 4F48B 1S82A 1GI3A 1C5TA 1UTJA 1AKSB 1TGSZ 5EG4A 7ESTE 1AB9B 2TRMA 4JZEH 1Z8RA 2Z94A 3SU4A 3AK5A 3MMGA 2AEIH 3OY5U 2H5DA 1BT7A 2R0KA 2F9PA 2ZGXH 1F5KU 1LVBA 2ZU4A 1V2MT 5K7RA 3NPSA 4AG2A 5H4IB 1DT2A 1J9CH 1LO6A 4J1YA 3SBKA 2HGTH 3K9XB 4M7GA 1K1IA 1SVPA 3NCLA 2ZCKP 1WBGB 1UW7A 3QDZB 5L2YH 2QXIA 1C5MD 1SGRE 4DCDA 5DPAA 2PGQB 1GJAB 3PLBA 2QCYA 1HJAB 2XC0A 1AVXA 5E0JA 4FETA 2EI8A 2BDHA 4OS6A 2IPHA 1DUAA 3OTPA 3GY7A 2ZDMA 3Q76A 1PPZA 1GI2A 2O9QA 2QXGA 4UD9H 2J5UA 2JH5D 5LH8A 3HKJB 1GJBB 2FPZA 2GMTB 2W6ID 2QYIA 1YC0A 5JPMH 3T62A 3RXSA 1BTWA 1ESAA 3GYMA 2F43B 2P94A 4ABDA 3U69H 1EOJA 2GKVE 1SMFE 2VIQA 4LK4A 1QL7A 1TE0A 1Y3VA 3SNEA 1J8AA 3SZNA 2KX4A 2FI3E 2FYQA 1ZYOA 1MTNB 2WYGA 1G2LA 2EY4C 1NC6A 3K65B 2QF0A 5FPTA 3D62A 4HGCA 4A1VA 3VG8A 1WTHD 1QJ1B 4Q63A 3PTNA 2P3FH 1QBNA 1HJAC 3KQDA 1O3IA 3LH1A 1H4WA 3TJOA 4X2XA 2UUFB 1X7AC 1GJ4H 1TRMA 4TWYA 1TLDA 4TWWA 1SLXB 4A1TA 1NRSH 5HM2A 2CMYA 1LMWB 2Z9LA 4Y8XA 5C0TA 4I8LA 2FDAA 1GBTA 5FBIA 3OFND 2C4FH 4JYUH 3F2GA 1ZZZA 1BTZA 1F92A 3VEQB 1TOCB 1ZTLA 1O30A 3VXEH
chains in the Genus database with same CATH topology
4B74A 1GMHF 1OS8A 4U30A 2M5TA 3K2UA 3SV8A 1PJPA 1H9HE 2B5TB 1FN6A 1P01A 2ZPRA 2ZDKA 3LGVA 5GIBA 1PQAA 2FEQH 3ZZ5A 1KIGH 1AFQC 1JMOH 2HALA 2IN2A 1THPB 2PLXA 1KXEA 1LKAA 3B23B 1E36B 4NSYA 5EW1H 4TPIZ 1B0FA 1Z71A 5TCCA 1AGJA 2C3SA 5DP9A 3RXAA 2HPPH 1KXAA 5GWZA 2D1JA 1AQ7A 3T29A 5E0HA 1J15A 5CE1A 1ZJKA 2JH6D 2QV1A 4K8YA 3EA7A 1EZUC 1K1MA 2XYAA 4YM9A 5BPEA 1A7SA 2Y80A 3LGIA 1YYY1 3RXTA 1GHZA 3MWIU 1DPOA 2OQ5A 3A8CA 3FP8E 1C5UA 2A45B 3GCOA 2YNAA 5F6MA 1CHGA 2W5EA 2Q1JA 4CRFA 1C1VH 1JIRA 2ALVA 1WCZA 2EA3A 1DLKB 3W94A 1C5ZB 1S83A 2Z9GA 2CF9H 3MHWU 1W0ZU 2H9EH 1C1MA 1O33A 3SI4H 4ZROA 4GSOA 1BOQA 4OGXA 2ANMH 4IS5A 1DWCH 4RKOB 4DGJA 1BA8B 1MD7A 1Q3XA 2RG3A 1ID5H 2I6SA 3FP6E 4B1TA 2P95A 1O3FA 3D49H 1BRCE 1C1WH 1FY8E 7LPRA 5HXFA 4TY6A 4H6SB 2GDDA 2ODYB 2PSYA 1QRWA 4AG1A 4E05H 1ESTA 3LJJA 2IJOB 6LPRA 1O32A 1IAUA 3M61U 5C3NA 1MD8A 1ZTKA 1A0HB 1UTMA 3Q77A 3FVFB 3Q3XA 4FUCA 3SGQE 3UOPA 1G3EA 1TGBA 4ZH8A 4CRDA 4E06H 4O3UA 1GBHA 3LKWA 3P8NA 1ESBA 1QB6A 1EASA 4CRCA 2ZCLP 1BBRK 1D3DB 1P3EA 4X1NU 3TH2H 1PQ7A 1IHSH 1MTVA 1D6RA 5JB8S 4RSPA 2J38A 3NXPA 4K69A 4GLYA 4NIYA 1ELFA 3QGJA 6GCHF 1BTHH 3A85A 3ODFA 2O8MA 1XUFA 1SGDE 3LIWA 4ZXYH 3M36A 1RTLA 3T27A 1H8DH 2SGEE 2PHBA 1VITH 3I77A 3RUOA 3MNXA 6CHAB 1O3PB 2F3CE 1K1LA 1BMLA 1KXDA 3GY4A 2BDGA 4ISOA 3E0PB 2ANYA 5C2ZA 5HGGA 1O2GH 2WPKS 1RXPA 4Y11E 3M3TA 1HAGE 1TOMH 1ARCA 1MZDA 4UFEH 2FXRA 1C2IA 2OQUA 2BQ6B 1CGJE 1C5RA 1BMNH 4ABHA 1DICA 1N6YA 1Q2WA 1Y59T 2VWMA 4Y76A 2GV7A 3KQCA 1BJUA 1KSNA 2O8UA 5JBTA 1ZMJA 1T8OA 4O3TA 1UTLM 3Q00A 1V2TT 9ESTA 1IQLA 3ESTA 3E6PH 4LZ4B 2BOKA 4YESB 1O5DH 1P2QA 6CHAC 4BAOB 1P11E 3SHCH 4ZHMU 3QWCH 5IDKA 3UFAA 1O2RA 1NO9H 1YGCH 2ZGBH 1G3DA 3QN7A 1C4U2 1GBFA 2ZA5A 1AZZA 3S0NA 1DXWA 1NN6A 1CT2E 1SFIA 2ZF0H 1CE5A 1O31A 2C93B 2OBQA 2BHGA 2AH4X 1V2RT 1DX5M 1C2MA 1TNKA 1NU9A 2FOGA 4OS1A 3SO3A 5FX5A 2C8WB 1DLEA 1G32B 4NG9H 5GCHG 2GT8A 2VIOA 2FLRH 2VB0A 1SGTA 3RC4A 1GHWH 1GG6B 4NWLA 1FUJA 4NWKA 1KYNA 4WXIA 1P9SA 2QXHA 2R2WU 3RLWH 1GI8B 2GD4B 2XC4A 1GJ8B 1MMJN 2FODA 1O5CB 1CBWC 1LHFH 3UY9A 3A84A 3BTHE 2F9VA 3FFGA 1Z8GA 2P3TB 2Y5HA 2G5NA 2PKAB 3M37A 3SU0A 1YLCA 5TJXA 5K0HA 4YOIA 2ZFQH 3RM0H 4BAHB 2Y82A 1TMTH 3LT3A 4MPWA 4OS7A 4BXWA 1NRQH 2SGAA 5FPSA 4D76A 1GBEA 2WPHS 3MU4A 3MU8A 1OSSA 2CGAA 2ZGJA 1A46H 7GCHG 2A7CA 3PLPA 1QTFA 1ANDA 1CT4E 3IG6B 2VIPA 1TNGA 1THRH 1K22H 2B9LA 7KMEH 2BDBA 1D3QB 1GJ6A 3RXKA 1GBCA 2BDYA 3ZYEA 1EJNA 4GUXA 2UWOA 1YCPM 3SGBE 1PPGE 4Y71A 4K2YA 2Z9IA 3F68H 4AYVB 2Z3DA 3KQEA 2HNTC 2SGDE 5LPFA 2WUBA 1TALA 1GI5A 2WINI 4I32A 2SNWA 3BTEE 1SPJA 4CBOA 2VNTA 1W12U 1TPAE 1SHYA 5C5OA 1O5AB 1WOFA 3STIA 8ESTE 1Z1IA 1DANH 1QB1A 3BIUH 1GBAA 4Y10E 5SGAE 3SUEA 4INLA 1SI5H 3UPEA 2I6QA 4ISLA 2JKHA 3A7ZA 5EOKA 1QL8A 1WTGH 1V2WT 1PYTC 4F49A 2G8TA 1ZOMA 2AMQA 4XSKU 4JYVH 1KDQA 4ASHA 2P93A 4FUFA 4AFQA 5AVDA 1RRKA 4UFGH 2PUQH 3M35A 4K1SA 2J2UA 3RXRA 2Z3EA 1GBJA 4AYYB 4I33A 2F9NA 3BIVH 3RC6A 1YF4A 3PMAB 3SW2B 3UWIA 3STJA 1GI0A 1GHAG 1TFXA 4INKA 4FUJA 5ETXA 1O3HA 2ZWLH 1AZ8A 1ZGVA 1V2LT 1BHXF 1TA6A 1GDUA 1QRXA 1BIOA 3M5LA 1RD3B 1ZSKA 2V0BA 3M3SA 4BAMB 1BRUP 1GGDB 3MO3A 1VCPA 1UO6A 3T25A 1TGCA 2QXJA 1XUJA 4ZXXH 3QTOH 3LDXH 1GI4A 4CHAB 1V2QT 1UVOA 1ZSJA 2BVSH 2BD5A 1OP2A 1OWIA 1TPPA 2A7HA 1G37A 4X0WU 1Y5UT 1DITH 1ANEA 2BLVA 4FUEA 1FY4A 3L6PA 4NCYA 1A2CH 4Q7XA 1YPKH 5FBEA 1GVLA 3KIDU 5EPYA 4FUBA 1J17T 2CHAB 1FQ3A 1NM6A 1L1JA 3VFEA 1UTKA 3BTKE 5EQSA 5GXPA 3H7TA 3MU0A 1QJ6B 2XCFA 1QQ4A 5A8YA 2OINA 1V2VT 2GCTB 3MH4A 2FOFA 1J14A 2JH0D 1O2YA 4XBCA 3MO9A 1GGDC 1JIMA 2FZZA 1ZPZA 3SV2H 2Q6DA 3DHKH 3MH7A 3S9CA 4NA8A 1QBVH 1SBWA 2XC5A 4X8VH 1A3EH 4CHAC 2XBXA 4HZHA 4IN2A 1O2NA 3P8FA 3GDSA 1YPJH 2ULLA 2FMJA 4GVUA 1HAHH 2NU2E 4FVDA 5EXNA 2W7UA 1E34B 1KTSB 2KAIB 2VIDA 3A7TA 2D8WA 2YNBA 4E7RG 2C8ZB 1EP6A 1P8VC 1AE5A 3IITA 1PPFE 1HIAB 2BDIA 4A5TS 1HAIH 1O0DH 4UDWH 4SGBE 3RM2H 2CHAC 2SFAA 2FI4E 1S0QA 3ATMA 5EW2H 1GBKA 1VR1H 1DM4B 1TGNA 1E0FD 3ZVDA 3CP7A 2STAE 4IGDA 1P2JA 1V2NT 2GCTC 5DP4A 2A2XH 1AE8H 1C2LA 1C2EA 2BLOA 2NU1E 2XTTB 1ABIH 4I8JA 1GJDB 1V2UT 2BVXH 1SC8U 2VWLA 2C8YB 4ESTE 2J95A 5CHAB 4DY7B 4CRBA 3AASA 1H8IH 2GX4A 2V35A 1B7XB 1GJ7B 1MU8B 5FAHA 3LC5A 4H6TA 5GCHF 1FY1A 1C5SA 2ZIQH 3FAOA 1SOTA 5C67A 1XXDA 3MFJA 1NRRH 4I7YH 2OD3B 2SGPE 3S9AA 4GPGA 1HV7A 4UE7H 4ABFA 1YBWA 4Y7AA 1ABJH 2WPJS 1DUEA 2AGGX 3PO1B 4KTUA 1UJ1A 3LJOA 5JB9S 1FY5A 1BTYA 2ZHFH 2BLWA 1KXFA 1ZMNA 1RGQA 4Y8ZA 1ZHMA 1FI8A 3OYPA 4X6OA 2HWLB 2WV4A 1T4UH 1AUTC 1LQEA 2Y7XA 1GHVH 1JXPA 1TRYA 2A32A 1XX9A 4GCHG 5I46H 2F83A 3UREA 4K8BA 2HOBA 5EGMA 1CGIE 4I8KA 1O37A 2ZC9H 1O2HA 1Z8JB 1ZPBA 3SUFA 1QRZA 1AB9C 4K60A 4DT7B 3Q3KA 1TABE 1P0SH 1O3KA 2VWNA 1K2I1 1QBOA 1SLVB 1KLIH 2RDLA 1S6HA 3UNSA 1RTFB 1FMGA 3GY6A 4ZKRU 1QA0A 1BBRH 2Y5GA 1HAYB 3SORA 1EQ9A 4AFZA 3ZZDA 3P8GA 3PO1C 1SL3A 1LHDH 4Q80A 3UTUH 1KY9A 2A5IA 2BD7A 2R3YA 1O3BA 1OP8A 3U1IB 1DSUA 1BTUA 3A83A 1T7CA 1AHTH 3KCGH 1QY6A 2ZEBA 3RXHA 5ABWA 1G3CA 1H9LB 1DWBH 1RTKA 3BEFB 1P03A 5EU8A 1T4VH 1EUFA 1EPTA 3F9HA 4LZ1H 2TPIZ 3LU9B 1GBIA 2GMTC 4YT6H 3ZVFA 3A7YA 2ZU3A 5T6FA 4AB8A 2UUYA 1BBRE 1SQAA 3DFJA 1S84A 2LNCA 3ODDA 4UFDH 3OY6U 3T5FH 3SJ8A 1GHBG 1TBRH 3A8BA 3ITIA 2FX6A 3SU2A 1YPEH 1GHAF 2GP9B 1K21H 1MTNC 3RXLA 1C4V2 1Z1JA 3ZZ4A 3R3GB 1UMAH 2G4UA 2ZHWH 2VINA 2ZU2A 1LPKB 4JZDH 1SGQE 1LHGH 3TH4H 3AAUA 3E0NB 1OKXA 2W3IA 2XXLA 1KXCA 3IWMA 2PUXB 3TU7H 1HAZB 2BD2A 4BAQB 4ZKOU 2ZDNA 3TGJE 1PPEE 2ZO3H 1SLWB 2FWWA 3BV9B 5FXLA 1C2JA 4YLQH 1V6DA 1LTOA 1ETRH 1K1NA 1UTOA 1UTNA 4HFPB 1AVWA 1AI8H 2VVVA 2FTMA 2Z9KA 2XWBI 1PFXC 1L1GA 2BQWB 3NUMA 3ZZ6A 2CJIA 1EZXC 3O8CA 5LPRA 4CREA 2NU4E 1BTXA 1AFEH 4MG3A 1A0JA 1GCDA 1ZR0A 3BTME 1YPGH 3A7VA 4AX9H 4ZKNU 1HUTH 3GCNA 4THNH 1S6FA 2XBWA 1EZSC 4KELA 2D2DA 4X1SU 4WVPE 4I8HA 4CH2B 1P12E 2Q6FA 3K6ZA 5JYIA 1GHYH 3U8OH 1VITG 4ZHAA 2F9UA 4INHA 2A0QB 4H42U 4NA7A 1QA7A 2GZ7A 4YOGA 2BY7X 2BX4A 3ZZ9A 4Y7BA 1F0SA 3RXJA 1BB0B 4NGAH 4YT7H 1V2OT 1DVAH 5DP3A 3MYWA 3H5CB 4XE4A 1DDJA 1MKXK 4RKJB 5E2PA 4O9VA 4NFEA 1SSXA 1C5OH 2ZU1A 1GJ9B 2DE8A 3GY3A 3SUDA 2AMDA 1FZZA 4ZKSU 1MKWH 2GZ9A 2K1QA 5EQRA 1P2IA 1XMNB 3ZVGA 1ACBE 1YPHE 3LH3A 3VB4A 1MTSA 3NZIA 4Q7YA 2AGIX 2R9PA 4JZ1A 2G51A 1JWTA 2FLBH 1VCQA 3RMLH 1GMDG 1SHHB 2F9OA 4KKDA 1SQOA 4X6PA 1WV7H 1C4Y2 1DXPA 5G4BA 4E7NA 1ELBA 1TAWA 4ISIH 1NFWA 4IMQA 1F5LA 3PV4A 1DY8A 4YZUA 3EGKH 1HXEH 1DWEH 1HRTH 2FTLE 1A4WH 1D4PB 4K5ZA 3GDVA 3T28A 3RC5A 1N6XA 1O2MA 3U1JB 1RJXB 4X8TH 2G55A 2PW8H 1QCPA 3UR9A 1C5YB 2OC8A 1IQFA 1OXGA 1ZLRA 3KEEA 4OS5A 4BTIB 2AYWA 1C2HA 5C5NA 4O97A 4D7GA 1HPGA 3ATWA 1TNHA 5AFZH 1EAXA 1YCPK 4MVNA 4Y8YA 1O3MA 4A6LA 1UVUH 4TY7A 4B76A 4Z6AH 1JOUB 2VGCB 3GCTG 2ODPA 1MZAA 2DUCA 1O3CA 1GBDA 2ZHDA 5GJ4B 1NRPH 1SGFG 3ZV9A 3P92A 1YLDA 3BG4B 3T26A 4NIXA 4GCHF 1W13U 3SJIA 1GI9B 2R2MB 3ZZ8A 2ZHQH 1EB1H 1K1OA 2A7JA 1FIWA 1EOLA 2CXVA 3TLOA 3QGNB 3TVJB 3L3TA 5I25A 3TNTA 1EXFA 4IW4E 2HNTE 3I78A 1S0RA 1P9UA 3ZVBA 1HBTH 3T2NA 3BF6H 1HLTH 4ISHH 3ELAH 3UQOA 3ZZCA 1P2NA 3BEUA 4XDEA 1YPHC 3P95A 4A1XA 4ZAEA 3O8DA 3DUXH 4A92A 3BTWE 2Y6TA 2GT7A 3PROA 2G4TA 1GJCB 4CRAA 2SNVA 2VGCC 1K28D 2AGEX 5E0GA 3TITA 2FOBA 2Y7ZA 3Q3YA 1W10U 2B8OH 1SGFA 4WMEA 3NK8A 1ZMLA 4BAKB 2AFQB 1O5EH 3LGYA 1UVSH 3BG4C 3QTVH 4NZQA 3RU4E 2P3UB 1T32A 1HB0B 4CR9A 4IN1A 1QIXB 3D23A 1MAXA 1XKBC 1DY9A 5PTPA 3RXBA 1BHXB 1C1UH 4DIHH 1XXFA 1IQJA 5FX6A 1ZPCA 4TYDA 1HAPH 1HAVA 3PB1E 4D9RA 1SQTA 2TBSA 1LCYA 1TNJA 1QHRB 1XUHA 3MU5A 4MPXA 1DS2E 4QT8C 2OC7A 3O8RA 5L6NH 1GHBF 2XW9A 1UHBA 3SNBA 5A8XA 4DG4A 1V3XA 1L4DA 1EJAA 2HLCA 1Y3UA 1D3TB 2HPQH 3RP2A 8KME2 1A61H 1O39A 2VJ1A 4WY3A 1CO7E 3SUGA 1NS3A 4X1RU 1DFPA 4ABAA 1HAXB 2RA3A 1L1NA 5ESBA 1GG6C 3AVZA 3GICB 4AGKA 5DO4H 2W7SA 3KNXA 2FS9A 3A8DA 3MH5A 1QB9A 1LVOA 2TIOA 3KHVA 1O35A 2G00A 3EA9A 3M7UA 1W0YH 1O2UA 2XRCA 4O03A 1QR3E 1MQ5A 4UFFH 1OP0A 3RXUA 1C5WB 4X1PU 3ZZBA 1BRBE 3PWBA 3TGKE 3UR6A 2WPLS 2PSXA 3GY8A 2ZTYA 4LOYH 1NPMA 5DK1A 2TGDA 2J92A 1UK3A 1SGYE 3SU6A 1BTPA 3MI4A 2C8XB 1FIZA 3A89A 3KF2A 3UOUA