4A6LA

Beta-tryptase inhibitor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
242
structure length
242
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTASE ALPHA/BETA-1
publication title Structure-Based Library Design and the Discovery of a Potent and Selective Mast Cell Beta-Tryptase Inhibitor as an Oral Therapeutic Agent.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 52
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2011-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a6lA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a6lA01
1OYTH 1YCPH 2BY8X 1LHGH 2RG3A 3BTGE 1G32B 1P57B 1HJAB 2ALPA 1F0TA 4R0IA 1ELCA 4MPUA 3TVJB 4Y0YE 1LHCH 3DFLA 2F9NA 4X2WA 1UCYH 5AF9H 1N8OB 4JK5A 1W7XH 2OP9A 4U32A 3NPSA 2STAE 3RXCA 2IPHA 5I46H 4AFQA 1GJ4H 3AW0A 3SU5A 1AUJA 1XUIA 2ZU4A 1VCQA 2BLQA 3A7WA 3UWJH 4TWYA 5EQRA 3VXFH 2AH4X 3SV6A 4F49A 1D3DB 1MH0A 1Y3YA 2O8MA 3GYMA 2PKAA 1SC8U 2CXVA 1GWAA 2ZDMA 1F5LA 2XNIA 1E37B 2EEKA 1QGFA 1WAYB 1BA8B 1QB1A 1MTSA 1KDQB 2GV6A 2ZU5A 4Y8ZA 3RU4E 5FXLA 1H9LB 1CVWH 1FY3A 1O37A 2B5TB 1AFQB 4NA8A 2Y5GA 1PYTD 4Y10E 1GHBF 4SGBE 2J38A 2ODPA 2DE8A 3MHWU 4MPXA 1MQ6A 1WTGH 2C4FH 2F9VA 1F92A 1FIWA 1GL1A 1ZZZA 3PV4A 3QN7A 5DGJA 3UTUH 1DXWA 3NK8A 2XXLA 1A0LA 2GZ8A 1NRQH 1HDTH 1TPPA 1ESTA 1INCA 5G4BA 1P2QA 1PPHE 3F9HA 1CBWB 3OY5U 5HM9A 3MU8A 4AZ2B 3B9FH 9LPRA 3UUZA 1LVMA 2VIOA 2Y5HA 2BM2A 3U8TH 1O3HA 2ZQ2A 1NM6A 4XBBA 2GZ7A 4RN6A 7KMEH 1TB6H 2OC8A 2GKVE 2OXSA 4GLYA 5A8XA 2OC0A 1O5EH 1GI0A 4MDSA 1UTLM 3SOSA 1RRKA 4FUGA 2GTBA 1P06A 2BY9X 1Z8JB 5K0HA 3STIA 3A85A 1EAXA 1O5AB 4INLA 3EA7A 1GMDF 1C1VH 2VJ1A 4E05H 1TOMH 1EZXC 1JXPA 3FVFB 5FAHA 4XSKU 3MNXA 4CRAA 4HZHA 1PQAA 3UNSA 1OP0A 2Z3EA 2FPZA 2BVXH 1T7CA 1GJAB 5A8ZA 5HXFA 4MPVA 1E38B 4I31A 1UVOA 1DWBH 1F5RA 1HAXB 4ZMAH 4WMEA 1BT7A 4X1SU 1O5BB 5BPEA 5DKMA 1TLDA 2I6SA 3M5MA 1YC0A 2LPRA 4Q7YA 3A7XA 3URDA 1V2UT 2VIVA 1IQLA 1O0DH 2B0FA 3TH2H 2Z9IA 1OKXA 1S0RA 3GY6A 3SU2A 3RXAA 4JZ1A 1CT2E 1Y3UA 2WPJS 5GXPA 1ZPCA 3LPRA 4NA9H 3P6ZB 1XKAC 2Z3DA 1HAVB 1TNHA 3QWCH 3BEFB 3P95A 2G00A 4Q2KA 1G2LA 2AMQA 2Y80A 1ZJKA 2VWOA 5DO4H 4AORA 3SUGA 3H5CB 3OU0A 1E35B 1H8DH 1SGFA 1UVTH 4UDWH 5GJ4B 1SFQB 1S0QA 2ESTE 3ZZBA 1P3EA 1SSXA 3A87A 1O2QA 1AKSB 2NU3E 5ETXA 1ZGIA 1GMHG 4INHA 4K1TA 1HAZB 4NFEA 3TH4H 4CR5A 1GVLA 4LXBH 2ZU1A 2ZTYA 3MI4A 3EYDA 5JDUB 4YLQH 2FESH 3T27A 4NIVA 1ZMNA 2HGTH 2FLRH 1LVOA 2ZFFH 3MO9A 3V12A 2ZGCA 1GI3A 3FAOA 2UUJB 1C1WH 2UWPA 4GAWA 2BDHA 1TNGA 4INKA 4FUHA 1HXFH 3SI3H 1A3EH 1C2JA 1IQFA 1EPTC 2FOBA 1BCUH 2G4UA 2GV7A 1QJ7B 3IITA 3O8RA 2GX4A 4WH6A 1WBGB 4JCNA 2D26C 2XBYA 3PMAB 5C20A 4AGJA 1P3CA 2J95A 2FOAA 1YP9A 5EGMA 1LVYA 4IN1A 1CA0C 4DOQA 2ZKSA 5AHGH 3DHKH 1SGFG 1MKWH 2VINA 3UNQA 4O97A 5EODA 4IBLH 1UTMA 1XUFA 2G5NA 1VJ9U 4OGXA 1K1PA 1ETTH 4F4OC 1TWXB 3U9AH 1MBMA 1FY5A 4DY7B 1KXAA 2IJOB 1C5LH 1HAHH 3P8OA 2PSYA 5CHAC 1A5HA 2ZECA 2IN2A 2W26A 1K22H 2FOFA 4FXGH 4YT7H 3A8DA 1EASA 3RU4D 3UR9A 3RC4A 1FMGA 1TABE 2W7SA 3PTNA 1GI2A 1RXPA 1LHEH 1ZTKA 4AG1A 1LPZB 2ZA5A 3KL6A 2XBXA 3OTJE 3MU4A 2GCHF 2GGVB 3NZIA 4J2YB 4GPGA 1UJ1A 1PQ7A 2Q6DA 2ZTZA 2VU8E 4NIWA 1GJ5H 2GP9B 3KHVA 3LGVA 1LQEA 1ESAA 4HTCH 1O2TA 1BTWA 2KAIA 1O3LA 3RC6A 4ABFA 2CN0H 1UTJA 1C5UA 1PPCE 3VPKA 1NT1A 1WUNH 1MAXA 1BBRH 1HFDA 1C5WB 1HIAB 2NWNA 1RJXB 1YCPK 1C2KA 1G9IE 3U1IB 3SZNA 2FEQH 3BIVH 2FM2A 1UHBB 4CH8B 1WSSH 1EJAA 1ELFA 1K1OA 3A8AA 1F0UA 3BTKE 4I7YH 1GBCA 1UCYK 3ZVAA 1FLEE 1UVPA 1TQ0B 1C2IA 1F2SE 2P16A 1FDPA 1SLUB 2H2ZA 4YTAA 3QX5H 5EXNA 2HRVA 4UFEH 1JWTA 4MVNA 3V0XA 1OP8A 1TRYA 2ZDKA 4X8SH 3O8BA 4ZXXH 3BIUH 4ABHA 4ABBA 1O36A 4KP0A 2O8TA 1C5TA 4IMQA 1GBJA 3MOCA 4YT6H 1QRZA 4HFPB 4XE4A 4ABEA 2W3IA 5AFYH 2P93A 3A84A 2QY0B 2XBWA 3LOXA 1MKXH 2FOMB 4GUXA 1GVKB 2FWWA 3M7QA 3ZZ9A 3CS0A 1O33A 2NU4E 1NTPA 1ZSLA 1XUKA 4O9VA 1CT0E 4YM9A 4FUJA 1SBWA 1FPHH 1UTKA 2WV5A 1IQMA 3TGIE 3GY8A 3SO3A 4D7FA 5J4QA 1QJ6B 3EAJA 4NSVA 2GCTC 2QXIA 2V3OH 4KELA 3ZVCA 3E0NB 1P04A 2AIQA 2FO9A 4DURA 1ANBA 3LONA 2G52A 4ZAEA 1GI4A 1MTWA 2Z9GA 1LKAA 5ABWA 4MTBA 1W0YH 2VIPA 3BTFE 2AGIX 3TK9A 5H4IB 3ZZDA 1G30B 1EB2A 3K2UA 5DG6A 1CA8B 1AVWA 8KME2 2HNTE 2BLOA 2SGAA 2ZWLH 3RXMA 4A92A 1Q31A 1S81A 1GI1A 1Z6EA 2W7UA 3BTME 3UWIA 1CGIE 2JETC 1NROH 1OP2A 3T29A 1AY6H 5DP5A 4TY6A 1EPTB 3LH3A 4Q7XA 1ZPBA 1D3QB 1IHTH 1FIZA 1GG6C 6ESTA 4ISIH 5T3HA 3L33A 3VB6A 2HWLB 2ALVA 1O2OA 5FPYA 1LKBA 2FI3E 1BOQA 1FN8A 5F8TA 4WWYA 5L6NH 1PQ5A 3SV9A 1A5GH 2R3YA 2Y6TA 1S85A 2WPKS 3HGNA 1DY8A 3F9FA 2HPPH 2PUXB 1H9HE 2FS8A 1HAIH 1AIXH 1GBBA 2V6NA 2BDCA 2WPLS 2FOCA 2BLWA 1G3DA 5CHAB 1THSH 1GBTA 1HJ9A 1TMTH 1LHFH 5GIBA 5A0CA 1TGCA 4DW2U 1MD7A 2VIQA 2YNAA 3SI4H 3ZV8A 1X7AC 3EA8A 2A2XH 3HKJB 1KIGH 1TGNA 1O2JA 2ZCKP 1JIMA 4JZIA 1Y3VA 2Y7ZA 1YKTA 1ANDA 3EQ0H 3VGCC 2VWNA 1MMJN 3SNBA 4AFUA 1NESE 1VGCC 1P02A 1BIOA 2VH6A 1GHAF 1XXFA 4WMDA 1YGCH 1D6RA 1DY9A 2PV9B 1O39A 5EW1H 4AOQA 1CBWC 1KXFA 2F9BH 1KTTB 2UUFB 4DG4A 2ZFSA 3LGUA 4Y6DA 3A8BA 2CJIA 1G37A 1O2UA 2B8OH 3FP6E 5SGAE 3RXEA 3PMBB 4AGKA 1DWDH 2ZEBA 3RXDA 1ELVA 1SGNE 1ZSKA 2R0LA 4YZUA 1OYQA 3RC5A 1C4V2 4WH8A 4XFQA 3UR6A 3K6ZA 3ZZCA 5FPTA 4GCHG 2A45B 4X8UH 4X8VH 3QUMP 1RFNA 1IQKA 1ZLRA 2ZP0H 2PHBA 2AEIH 4I32A 2A7JA 4WVPE 2P8OC 3V13A 3HK3B 4D76A 4MPWA 8GCHG 2BXTH 3KNXA 4FVBA 1ZTLA 2BD7A 4CBOA 8LPRA 3PLKA 2PGQB 4IC5A 4CHAC 1BQYA 3U98H 1L1NA 1MU8B 1C1OA 2FMJA 1O35A 5AVDA 5F8XA 1KLJH 4U01A 5C2ZA 4WF8A 1TNLA 2XW9A 1TMBH 2XWBI 4OGYA 1O32A 3M7UA 3SNEA 5L30H 3TNTA 4XDEA 4JYTA 1E34B 1O38A 1XUGA 1C9TA 2TBSA 3JZ2B 3M5NA 1NFWA 1AMHA 1JRTA 2H9EH 4B2AA 5FX5A 1ELAA 2SGDE 2B7DH 2RA0A 1C2HA 4JZDH 1W12U 1BRBE 1QFKH 1QJ1B 1TALA 3GDVA 3S0NA 3JZ1B 1ZHPA 3UOUA 2P94A 2ZGHA 3N7OA 5C67A 5I25A 1XUJA 4NG9H 4CRGA 5GCHF 4I8HA 4I8LA 1O3MA 4WY3A 2ZC9H 1T8MA 1UO6A 2H1UA 1DXPA 1WU1A 1O31A 2GCTB 3SV2H 4NFFA 1TGSZ 4D9RA 1EQ9A 3LC5A 2OUAA 3WY8A 1YCPM 1A3BH 4Y71A 1P01A 1SR5C 1LHDH 1DUEA 1T32A 3LIWA 2A4GA 1PYTC 4UD9H 4ZROA 1G3CA 4JYVH 1DUAA 1QL7A 1GDQA 3KQBA 3QK1A 4ZHLU 1WOFA 3UNRA 1B0EA 2BDIA 4ABDA 1QURH 2AFQB 5F8ZA 5TJXA 1U6QA 1K21H 2Z7FE 4BAKB 2JETB 1Y3XA 2FOGA 1Q2WA 1UTQA 4Y79A 1W13U 3T26A 1GG6B 1HAOH 1ELTA 1GVZA 1Z6JH 4FU9A 1HAGE 2W5EA 4B71A 1C1QA 4R8TB 5C5OA 1BUIA 4X1RU 3M3TA 4E7RG 1O2GH 1BBRK 2ZNKH 1S6HA 4MNWA 1O2LA 1SI5H 1L4ZA 3ATLA 2WV4A 2ZHFH 4HI3A 5C3NA 1CO7E 2CV3A 1UK4A 3MFJA 4B76A 1HCGA 4A1VA 2QA9E 3TJUA 4K8BA 4B73A 1FZZA 2BQ6B 3EE0B 3BTHE 4KTCA 1LMWB 1GDUA 1H1BA 3F68H 1SGIB 2BZ6H 6CHAB 1RTKA 2OTVA 3SU6A 2TGAA 1J17T 1EAIA 2BYAX 1GJDB 3VGCB 1BJUA 4A5TS 4B2BA 3SNCA 1VGCB 4IGDA 2QF0A 5JBTA 4FUEA 3FZZA 2QXJA 4CRDA 1QIXB 2Z3CA 1MKXK 1AO5A 1LQDB 2HVXA 2M5TA 2ZCHP 1OWJA 2PR3A 2PW8H 1CGHA 1W2KH 2NU0E 1B0FA 1EJNA 1ANEA 1IQEA 1MU6B 2A0QB 3E16B 1GI9B 4THNH 5E0JA 3RP2A 2TGPZ 4LK4A 3HKIB 3KN2A 2ZF0H 2J2UA 3KEEA 5HMAA 2ILNA 3UPEA 1XMNB 1RTLA 3SUFA 1C2DA 3F6UH 4X8TH 1C5QA 1MTVA 3SGQE 1C5YB 3QLPH 1W8BH 1VITF 1YPJH 2QF3A 1XKBC 1XM1A 1TX8A 1ELEE 1V2WT 1EZQA 2GDDA 1V2VT 3SQHE 2P8OB 1H8IH 1AE8H 4K60A 1HJ8A 1L4DA 2BOKA 4A1TA 2BOHB 2A7HA 1O3JA 4CHAB 3KF2A 1VZQH 4I8KA 1AQ7A 3M3VA 3CENA 1DSUA 2TGTA 2UWLA 2VWLA 2PFEA 3RXUA 2ANMH 4Y11E 2RA3A 7LPRA 4BTIB 3F9GA 2B9LA 3V7TA 5IDKA 1ARCA 4OS1A 1W14U 2XRCA 4E7NA 5L2YH 1TE0A 3BG4C 3IG6B 1TGTA 4Y7AA 1C1TA 4I33A 2BX3A 2OQUA 1ZHMA 1C5SA 3GCNA 1ID5H 3TNSA 1YPHC 1BRCE 3RM0H 1KTSB 2BXUH 1NPMA 1UTNA 3IWMA 1GBHA 3E8LA 3SJIA 3KIDU 1T8OA 3RXPA 1OOKB 1WV7H 2EI7A 3AAVA 3DD2H 2THFB 1JOUB 3TGJE 1SGEE 4M7GA 4YESB 2PGBB 1O3KA 2SGPE 5F03A 2XWAA 1OSSA 5K7RA 2QXHA 1IQHA 3LH1A 4BAMB 4K1SA 1LPGB 3GCTF 2VB0A 1O2ZA 4FUBA 3ZYDA 1O30A 1S6FA 1P11E 4A7IB 1GCTC 2HPQH 1EJMA 2BD3A 3SHAH 1ETSH 4K5ZA 2CF8H 3L3TA 2Q6FA 3O8DA 4H6TA 2A5KA 1SB1H 2ZFRH 3EGKH 4Y0ZE 4ESTE 4FU7A 1P2JA 4UE7H 1FN6A 1FAKH 1DITH 1TX7A 2GT8A 3BTTE 2RCEA 4ZH8A 1H9IE 1HB0B 1V2RT 1QL8A 2FXRA 1QA7A 1GHVH 1D3PB 1ELGA 3F9EA 3RXIA 4NCYA 2FYRA 4ZKSU 5E0HA 1BTXA 2BD5A 1C1NA 1ZRBA 4B74A 2CHAC 3LJJA 2C8YB 1J15A 3OSYA 3UQVA 1SL3A 1TNJA 7GCHG 4GSOA 3RMMH 2ZTXA 1FUJA 4JZFH 3P17H 2UUKB 3ATIA 3ZVDA 3K65B 1QRWA 3TITA 1MZDA 1G2MA 1DANH 1GHBG 1FV9A 3P92A 4CRCA 3U1JB 1QB9A 2FI5E 1THRH 1O3GA 4KTSA 2WUBA 2ZHQH 1YPLH 3E90B 3T28A 3T25A 2OCVB 1IQNA 2ZFTA 4PROA 3Q3XA 1JBUH 4ASHA 4VGCC 6GCHG 3RXKA 1Y8TA 1GBLA 2OC1A 2R0KA 4X6OA 2BTCE 2BQ7B 5FX6A 4FUCA 2WUCA 3RXRA 2BY5X 1SGTA 3QGNB 2XC4A 1O2NA 2SGFE 3SBKA 2JH0D 1L1JA 1TONA 5FCKA 1W0ZU 2I6QA 4BXWA 4ISHH 1GBKA 1GHWH 1QNJA 1SQTA 3M5OA 4ZKNU 2BB4A 1HRTH 4UEHH 1RGQA 1GI7B 3MNSA 2XYAA 1KDQA 1S82A 4CREA 5LPEA 3D65E 1QCPA 1SHHB 1TA2A 3KCGH 2FDAA 2AS9A 2QN5T 4DIHH 1GMDG 1TRMA 1TMUH 3KQCA 4WJG2 3TGKE 1C5PA 1SGRE 2A32A 4TYDA 1EATA 3FANA 4B1TA 3P8FA 7ESTE 3MYWA 4AN7A 2ZIQH 2P95A 3RLYH 4GCHF 3TJVA 1NN6A 1E0FD 1Z1JA 1AE5A 1JIRA 1AGJA 3BTDE 2PUQH 3AASA 1V2QT 3ZZ8A 1XX9A 1NU7B 1D4PB 1NU9A 1SOTA 8GCHF 2WYGA 2ZHEH 3BG4B 1TPOA 2ZG0H 5T6DA 3RXJA 3ATKA 3RXGA 3D49H 2P3TB 2PWXA 5TCCA 3MTYA 3VXEH 1Y5AT 4B2CA 2ZGJA 1GHZA 1LCYA 4AFZA 2CMYA 3S9BA 1F5KU 1V2LT 1Y5UT 1M9UA 1HBTH 3ZYEA 1DE7H 1QQ4A 2BY7X 1ZPZA 5FBIA 1HLTH 1DPOA 1O3CA 3A7YA 1E36B 1RD3B 3GDSA 1MAYA 4Q7ZA 5GDSH 1QB6A 3SNDA 3GDUA 1DM4B 2P3UB 3QGJA 4CBNA 3PWBA 2SNWA 3GY3A 3M36A 3LDXH 2PKAB 1CHOF 1T4VH 2Q1JA 1VITH 1P2NA 3E3TA 1NFYA 1AZ8A 3CP7A 3A89A 2OQ5A 3ZZAA 1EXFA 1PPEE 1GCTB 2XC5A 1V2ST 3ELAH 3LGYA 2BX4A 2FOEA 3PMJA 1UK2A 2PTCE 1TRNA 1BMNH 2XCNA 3LJOA 2BZAA 2ZFPH 3B8JA 4ABAA 2G4TA 1THPB 2QGRA 4FVDA 3KQEA 4U2WA 1EX3A 3A7TA 1YF4A 2EI8A 2OBQA 3BG8A 3TIUA 1C5XB 2JH5D 2ZFQH 4X2YA 3G01A 2FZZA 2RDLA 4H42U 1ELDE 1DDJA 2O8UA 5EQQA 4DGJA 1KXDA 2YOLA 2Q6GA 4KTUA 5DP8A 4O3UA 3UOPA 1DVAH 3P8NA 1RIWC 2CHAB 1BTUA 3DT0H 4BNRA 2SNVA 1F0RA 1UMAH 3M35A 4X1NU 1C2EA 1HAVA 3PTBA 3KGPA 3BSQA 4D7GA 3GY2A 1TGBA 1IOEA 4QT8C 2F83A 6LPRA 4XBCA 1BTHH 2A2QH 2FLBH 5AFZH 3MWIU 2O8WA 3QZRA 3SHCH 4UFFH 5JPMH 1BMAA 2AGGX 1EKBB 1C1PA 1ZHRA 3HGPA 3U69H 1S83A 3A8CA 1EAWA 3E6PH 1GI6A 5B6OA 3SORA 2WYJA 3QDZB 1OX1A 2G8TA 1K1IA 5FBEA 1P2OA 4VGCB 2HOBA 5DP4A 6CHAC 4CR9A 1NFUA 2VNTA 2ODYB 1UCYE 2ANWA 2ZQ1A 2BD4A 1O2IA 3RXTA 1AKSA 1TYNA 2R2WU 1SOZA 5FCRA 1AZZA 1QBNA 4UFDH 4WXIA 2VIDA 3ZVBA 3EA9A 4NIYA 2GCHG 2H9HA 4X1QU 3W95A 2VIWA 3OX7U 5EPYA 1BTPA 2GVFA 1O3PB 1PPBH 3MU0A 5IYTA 3LU9B 3ODFA 3O8CA 1BMMH 2BVRH 5EPNA 3VB7A 1G36A 4YLUA 2H5CA 2F91A 1VJAU 2SGEE 4YO9A 4AYVB 4BANB 2ANYA 4ZUHA 9ESTA 1L0ZA 3RXHA 5ESTE 1O2MA 4ISNA 1OWDA 1C5MD 1MQ5A 1AVXA 3BTQE 1GBDA 1SGCA 4Y7BA 1ZR0A 1QRXA 2PTNA 1V2PT 1RS0A 1KYNA 4RKJB 2QYIA 2ZDNA 1AUTC 3ZVEA 3T5FH 1OWEA 3AW1A 1XUHA 1O2VA 2R3UA 5DPAA 2H6MA 2J94A 1DICA 1P09A 1P9SA 4O3TA 1ELBA 2GMTB 2F9PA 3SN8A 1UVSH 1CSOE 1O2PA 1OPHB 1V2OT 1P05A 4NWKA 2VVVA 5E2PA 4FUIA 1GMCG 1VR1H 1EB1H 2ZGBH 1IQJA 3PLBA 3LGWA 2YNBA 3RXLA 2Y7XA 3BF6H 3TK6A 1DFPA 3RMNH 1QTFA 1F0SA 1NZQH 1KSNA 2G5VA 3A83A 4UFGH 1ACBE 4ZKOU 1V2MT 2Z9JA 5EW2H 4ZXYH 1BB0B 1DLEA 4X6MA 3ZVGA 1AB9C 1K1MA 4FUFA 1H4WA 1O2YA 1P03A 2ZZUH 4X0WU 2BDGA 2Z94A 1BMLA 1FXYA 1NO9H 1S5SA 5J4SA 1GL0E 1O2RA 5DP7A 1O5CB 3I29A 1HIAA 3A7ZA 1C4Y2 2A31A 2OD3B 3SGAE 5PTPA 5A8YA 1FNIA 1BJVA 1TA6A 1UHBA 1HV7A 4BXSA 1B7XB 1W10U 1ZYOA 3RXOA 3M61U 3GOVB 4NWLA 1MCVA 2G81E 1ETRH 4TPIZ 1O5GH 1P2MA 2A5AA 1DWEH 4Z0KA 3SW2B 2OBOA 1LO6A 1WTHD 3RXBA 4DJZB 4I8GA 2DE9A 2GT7A 4WMFA 3DA9B 1YPHE 1GMHF 2F3CE 3A81A 3M37A 1EOJA 1QQUA 1RIWB 1W11U 3RXSA 1QBVH 3C1KA 3M7TA 2BMGB 1AFEH 1CHGA 1TBQH 4AFSA 2TRMA 1BHXF 2JKHA 5DP3A 4X2XA 1C1UH 1LDTT 4BAQB 1MZAA 3GISB 2A4QA 2XBVA 1N6YA 1TNKA 1C9PA 4OS6A 4YOJA 5A09A 1O34A 2BDYA 1TX6A 2KAIB 1FY4A 3UFAA 3AVZA 4JYUH 1C1SA 4BTUB 1L1GA 1V3XA 1Z8IB 4KGAA 1V2KT 2Y5FA 3TLOA 2BQWB 7GCHF 2ODQA 1SLWB 3DUXH 1O5DH 1O2KA 1ORFA 1WYKA 2VVCA 4ABGA 1PJPA 3U8OH 2TIOA 2ZPQA 2AMPA 3D23A 1Y59T 1O3BA 2V0BA 1Z8RA 4ZHAA 1ARBA 1UVUH 2FIRH 1YPKH 2F9OA 3BEUA 2D8WA 2ULLA 1IAUA 3VB4A 1C5RA 1TNIA 3VB3A 2FP7B 1CT4E 1F7ZA 1O3FA 2C8XB 2D2DA 2GD4B 2H9TH 3PO1C 3PB1E 5C1XA 4A1XA 4AX9H 1EUFA 1GGDC 1GHAG 4CRBA 1Z8GA 1OXGA 3M3SA 2A5IA 6GCHF 1EPTA 2P59A 2BY6X 3T62A 1PQ8A 1T8LA 1YLCA 1VCPA 1WCZA 2D1JA 2ZO3H 1P2IA 2WINI 1NC6A 1C2MA 2EC9H 3ITIA 1SGPE 2QAAA 1Z71A 4AB9A 5HGGA 5JYIA 5GPIB 3FP7E 5LGOA 1KXCA 3TJNA 1PPFE 1OWKA 2AYWA 2J4IA 1T8NA 3DFJA 3PYHA 1FPCH 2UUYA 1ZSJA 3FFGA 1S84A 1K1NA 1EZUC 3PROA 1SGYE 1BITA 3GCHC 4YOGA 1RTFB 1YLDA 2C8ZB 5EQSA 1FQ3A 4H6SB 1NS3A 1D9IA 1ZRKA 3I78A 1TPSA 1YM0A 3AAUA 1SMFE 3QZQA 1DWCH 3Q3YA 2STBE 1GBIA 1EP6A 2C90B 1OS8A 3SJ9A 5HYOA 4A6LA 3MO6A 2FTLE 4UONA 3W94A 2DUCA 4XBDA 1AB9B 4X1PU 3STJA 5EXLA 5CE1A 1BBRE 5GCHG 3VFEA 5CMXH 3F1SB 1SPJA 4SGAE 1ZJDA 1A5IA 3PMHB 1P12E 3K6YA 1DS2E 1K2I1 1Q3XA 3SJOA 1GCDA 1O3OA 2PSXA 2G55A 3I77A 1K1JA 3K9XB 1TIOA 3HATH 5T6FA 1JRSA 3B23B 4TY7A 5EOKA 1O2SA 2ANKH 1QR3E 3LKWA 2O9QA 1EAUA 4DCDA 1V2NT 1J16A 3SV8A 1DOJA 5L2ZH 1ABIH 2P3FH 2GZ9A 2H5DA 1SQAA 5A0AE 8ESTE 1PFXC 4AB8A 1BTYA 2ASUB 1WQSA 1SGQE 3RU4T 1LPKB 1C2FA 3QTVH 2V3HH 1KLTA 1O2WA 1MBQA 3ZZ3A 4K69A 3SGBE 1A0HB 2BVSH 1UTOA 5FPSA 4U30A 3RXFA 3TU7H 3NKKA 3ESTA 1A46H 1FY8E 1O3EA 1ZMJA 1YPGH 1A7SA 2IOTA 1HXEH 4B75A 3L6PA 3PWCA 1A61H 2QIQA 5E0GA 1O3IA 4XOJA 1SFIA 3Q76A 4OS5A 1BZXE 2J92A 3CS7A 1QA0A 1V6DA 4JK6A 5C1YA 3MNBA 3UREA 1BRAA 2W3KA 3NXPA 2BHGA 3V3MA 2R9PA 1FAXA 2XC0A 1G3BA 1CQQA 1BRUP 1J14A 3LGIA 2TPIZ 3SJ8A 4RSPA 1GJBB 4X6PA 1A0JA 3ZZ4A 3VEQB 1AVGH 4ISLA 2ZU2A 2QC2A 1HPGA 4MNVA 2VGCC 3PO1B 1OWHA 2ZDAH 1GGDB 4IC6A 1O3NA 4NIXA 1ABJH 1MTNC 2ZHWH 4OS2A 1HAPH 5HM2A 1P0SH 1XVOA 2BLVA 1GBEA 2ZDLA 3PLPA 3LGTA 5JB9S 1ESBA 2ZPRA 3TK5A 3ZV9A 1O3AA 4GHQA 3ATMA 3Q3KA 2G51A 1XXDA 2FX6A 3ZVFA 2PKSC 3PM3A 4E06H 5JBAS 4MNXA 2HNTF 2XCFA 4TWWA 4GVUA 1CE5A 1CU1A 1GBAA 1GHYH 4IMZA 1HUTH 1GI8B 1D3TB 3ZZ7A 1QY6A 4D8NA 4K8YA 2C93B 1GJ8B 1SLVB 2NU2E 3BTWE 4O03A 5E8EH 4BAHB 1W3CA 1VITG 2BDAA 1IQGA 3SU4A 1C1RA 1N1LA 1P8VC 3A80A 4JMYA 1O2HA 3GCHB 4MNYA 3SU0A 2C3SA 1AHTH 1QHRB 1K9OE 1C5VA 4J1YA 2Z6BD 4NSYA 5FHTA 1YYY1 5DJ7A 4IS5A 2ZPSA 2NU1E 4BTTB 1NRRH 1BDAA 1SG8B 4Q80A 1BTZA 1GJCB 3HPTB 2VH0A 1NY22 4D9QA 1J8AA 1UTPA 1GI5A 2GMTC 3KQDA 3QTOH 1AD8H 4CRFA 3T2NA 4K1EA 1C4U2 4ZHMU 1V2JT 2BD8A 3R0FA 2FOHA 2FTMA 3D62A 5DP9A 4NGAH 2BD2A 3BTEE 1TAWA 5DK1A 2J9NA 3RUOA 1HGTH 1GMCF 1TBZH 1B5GH 1GJ7B 2A1DB 3E1XB 3C27B 1D6WA 1KY9A 3HK6B 2OINA 2F9UA 3URCA 1C5ZB 2EI6A 4YOIA 4WXVA 2ZU3A 4FUDA 1KLIH 3MNCA 5JBCS 4ZKRU 3MU1A 2OC7A 3TPIZ 5DP6A 3SJKA 3QO6A 1C5OH 1L2EA 2QXGA 4H4FA 1TBRH 2FYQA 3GCTG 2A4RA 1HYLA 3SQEE 4DVAU 1GHXH 3VB5A 1UK3A 1TOCB 2FX4A 2HALA 3M5LA 1G3EA 5C1UA 2V35A 1VCWA 2XTTB 3Q77A 1SLXB 1C5NH 1DX5M 2PLXA 2Z9LA 1MUEB 3A7VA 3MH7A 1Y5BT 3TH3H 1DT2A 3RLWH 4LZ4B 3RDZA 3MO3A 3SU3A 2HLCA 2AERH 3A88A 1CGJE 3RMOH 5T6GA 1Y3WA 4LOYH 4KKDA 3P8GA 1IHSH 3FZDA 1ANCA 1HJAC 1YBWA 1GPZA 4AG2A 2FI4E 1C1MA 4DT7B 3NCLA 2WPMS 3SNAA 3MH6A 3NWUA 1XVMA 2QCYA 3S7HB 5C5NA 4K2YA 3GY4A 1W7GH 4Y76A 3SUEA 1N8OC 2CF9H 3ODDA 3E91A 2AMDA 2ZCLP 1NRPH 1LVBA 3ZZ6A 5EXMA 4ISOA 5EG4A 5LPRA 3H7TA 1CA0B 3UIRA 1FI8A 5TCAA 3E0PB 1A2CH 2C8WB 4OS4A 4CH2B 1T4UH 2SGQE 3S7KB 1QBOA 1PPZA 5LPFA 1C2LA 4NZQA 2VGCB 1GDNA 2Y82A 2A4OA 4OS7A 4Y8XA 5GWZA 1MTNB 1SQOA 3LT3A 1NFXA 2VWMA 2J34A 4JZEH 2Z9KA 4IW4E 2ZDVH 5JB8S 1AN1E 1P10A 1FJSA 4NZLA 3Q00A 4IN2A 1AFQC 4AYYB 2PKSB 1SVPA 4NA7A 2WPIS 1FONA 3GY5A 4MLFB 3EDXB 1Z7KA 3BEIB 4TPYA 4ABJA 3SU1A 4GHTA 1GJ9B 1YPMH 3GCOA 2UWOA 1TPAE 3FP8E 1J9CH 5E2OA 1ZMLA 2ZHDA 2JH6D 5F6MA 4I8JA 1GBMA 1BHXB 3BN9A 1P2KA 4X2VA 4MQAA 2OLGA 3H7OA 1AWFH 1NRNH 2O8LA 3ENSB 3MH4A 3UQOA 1HAYB 4FU8A 1FY1A 1EOLA 2WPHS 2A7CA 1TQ7B 1TFXA 1A1RA 1LTOA 4DIIH 1K1LA 3A82A 3RMLH 1MCTA 2BD9A 3GYLB 2SFAA 1SHYA 3GICB 3U8RH 3LC3A 1ZOMA 1N6XA 2LNCA 3ATWA 1WQVH 1O2XA 2CGAA 1A4WH 3R3GB 1ZTJA 1JMOH 1MD8A 2Y81A 1Z1IA 3RM2H 4HGCA 2FS9A 3SV7A 2GDEH 2BDBA 4ABIA 1O3DA 4Z6AH 1IQIA 3RXVA 5A2MH 1EP5A 1AWHB 1YPEH 3TJOA 1AU8A 2ZGXH 1HNEE 1AI8H 1K28D 3P70B 1P9UA 4X6NA 3MH5A 3SUDA 3ZZ5A 5A0BA 5ESBA 1GJ6A 5JBBS 3OYPA 1MTUA 1ZGVA 2HNTC 4K3JA 1GBFA 3GY7A 3S9CA 2AGEX 1C2GA 3S9AA 2VVUA 1KXEA 1QL9A 3MMGA 1V2TT 4BAOB 1CHOG 4BOHA 1NRSH 3OY6U 3BV9B 1MKWK 1EZSC 1SGDE 2K1QA 4LZ1H 1DSTA 4MG3A 5BRRE 2TGDA 1KXBA 1OWIA 5EU8A 5LH8A 2QV1A 3RXQA 4RKOB 2ZI2H 2EA3A 3A86A 3S69A 4Y8YA 1DLKB 1O5FH 1PPGE 3MU5A 2R2MB 2AIPA 3NUMA 2FODA 1T31A 3UY9A
chains in the Genus database with same CATH superfamily
1OYTH 1YCPH 2BY8X 1LHGH 2RG3A 3BTGE 1G32B 1P57B 1HJAB 2ALPA 4Q4LA 2KZ4A 1F0TA 4R0IA 1ELCA 4MPUA 3TVJB 4Y0YE 1LHCH 3DFLA 2F9NA 4X2WA 4RT0A 1UCYH 5AF9H 1N8OB 4JK5A 1W7XH 2OP9A 4U32A 3NPSA 2STAE 3RXCA 1SKYE 2IPHA 5I46H 4AFQA 1GJ4H 3AW0A 3SU5A 1AUJA 1XUIA 4XD7D 2EY4C 2J98A 2ZU4A 1VCQA 2BLQA 3A7WA 3UWJH 4TWYA 5EQRA 3VXFH 2AH4X 3SV6A 3F2HA 3FO8D 4F49A 1D3DB 1MH0A 1Y3YA 2O8MA 3GYMA 2PKAA 1SC8U 2CXVA 1GWAA 2ZDMA 1F5LA 2XNIA 1E37B 2EEKA 1QGFA 1WAYB 1BA8B 1QB1A 1MTSA 5C17A 1KDQB 2GV6A 2ZU5A 4Y8ZA 3RU4E 2RFKC 5FXLA 1H9LB 1CVWH 1FY3A 1O37A 4M9FA 2B5TB 1AFQB 4NA8A 2Y5GA 1PYTD 4Y10E 1GHBF 4SGBE 2J38A 2ODPA 2DE8A 3MHWU 4MPXA 1MQ6A 1WTGH 2C4FH 2F9VA 1F92A 1FIWA 1GL1A 1ZZZA 3PV4A 3QN7A 5DGJA 3UTUH 1DXWA 3NK8A 2XXLA 1A0LA 2GZ8A 1NRQH 1HDTH 1S6LA 1TPPA 1ESTA 1INCA 5G4BA 1P2QA 1PPHE 3F9HA 1CBWB 3OY5U 5HM9A 3MU8A 4AZ2B 3B9FH 9LPRA 3UUZA 1LVMA 2VIOA 2Y5HA 2BM2A 3U8TH 1O3HA 2ZQ2A 1NM6A 4XBBA 2GZ7A 4RN6A 7KMEH 1TB6H 5KEDA 2OC8A 2GKVE 2OXSA 4GLYA 5A8XA 4FETA 2OC0A 1O5EH 1GI0A 4MDSA 2V3MA 1UTLM 3SOSA 1RRKA 4FUGA 2GTBA 1P06A 2BY9X 1Z8JB 5K0HA 3STIA 3A85A 1EAXA 1O5AB 4INLA 3EA7A 1GMDF 1C1VH 2VJ1A 4E05H 1TOMH 2L74A 1EZXC 1JXPA 3FVFB 5FAHA 4XSKU 3MNXA 4CRAA 4HZHA 1PQAA 3UNSA 1OP0A 3FKSD 2Z3EA 2FPZA 2BVXH 1T7CA 1GJAB 5A8ZA 5HXFA 4MPVA 4I86A 1E38B 4I31A 1UVOA 1DWBH 1F5RA 1HAXB 4ZMAH 3F2GA 4WMEA 1BT7A 4X1SU 1O5BB 5BPEA 5DKMA 1TLDA 2I6SA 3M5MA 1YC0A 2LPRA 4Q7YA 3A7XA 3URDA 1V2UT 2VIVA 1IQLA 1O0DH 2B0FA 3TH2H 2Z9IA 1OKXA 1S0RA 3N7DA 3GY6A 3SU2A 3RXAA 4JZ1A 1CT2E 1Y3UA 2WPJS 5GXPA 1ZPCA 3LPRA 4NA9H 3P6ZB 1XKAC 2Z3DA 1HAVB 1TNHA 3QWCH 3H09A 3BEFB 3P95A 2G00A 4Q2KA 1G2LA 2KCOA 2AMQA 5KGOA 2JJ1D 2Y80A 1ZJKA 2VWOA 3UAIC 5DO4H 4AORA 3SUGA 3H5CB 3OU0A 1E35B 1H8DH 1SGFA 1UVTH 4UDWH 5GJ4B 1SFQB 1S0QA 2ESTE 3ZZBA 1P3EA 1SSXA 3A87A 1O2QA 1AKSB 2NU3E 5ETXA 1ZGIA 1GMHG 4INHA 4K1TA 1HAZB 4NFEA 5IK2D 3TH4H 4CR5A 1GVLA 4LXBH 2ZU1A 2ZTYA 3MI4A 3EYDA 5JDUB 4YLQH 2FESH 3T27A 4NIVA 1ZMNA 2HGTH 2FLRH 1LVOA 2ZFFH 3MO9A 3V12A 2ZGCA 1GI3A 3FAOA 2UUJB 1C1WH 2UWPA 4GAWA 2BDHA 1TNGA 4INKA 4FUHA 1HXFH 3SI3H 1A3EH 1C2JA 1IQFA 5HIZA 1EPTC 2FOBA 1BCUH 2G4UA 2GV7A 5C0TA 1QJ7B 3IITA 3O8RA 2GX4A 4WH6A 1WBGB 4JCNA 2D26C 2XBYA 3PMAB 5C20A 4AGJA 1P3CA 2J95A 2FOAA 1YP9A 3N99A 5EGMA 1LVYA 4IN1A 1CA0C 4DOQA 2ZKSA 5AHGH 1E79D 3DHKH 1SGFG 1MKWH 2VINA 3UNQA 4O97A 5EODA 4IBLH 1UTMA 1XUFA 2G5NA 1VJ9U 4OGXA 1K1PA 1ETTH 4F4OC 1TWXB 3U9AH 1MBMA 1FY5A 4DY7B 1KXAA 2IJOB 1C5LH 1HAHH 3P8OA 2PSYA 5CHAC 1A5HA 2ZECA 2IN2A 2W26A 1K22H 2FOFA 4FXGH 4YT7H 3A8DA 1EASA 3RU4D 3UR9A 3RC4A 1FMGA 1TABE 2W7SA 3PTNA 1GI2A 1RXPA 1LHEH 1ZTKA 4AG1A 1LPZB 2ZA5A 3KL6A 2XBXA 3OTJE 3MU4A 2GCHF 2GGVB 3NZIA 4J2YB 4GPGA 1UJ1A 1PQ7A 2Q6DA 2ZTZA 2VU8E 4NIWA 1GJ5H 2GP9B 3KHVA 3LGVA 3DSPA 1LQEA 1ESAA 4HTCH 1O2TA 1BTWA 2KAIA 1O3LA 3RC6A 4ABFA 2CN0H 1UTJA 1C5UA 1PPCE 3VPKA 1NT1A 1WUNH 1MAXA 1BBRH 1HFDA 4DT4A 1C5WB 1HIAB 2NWNA 1RJXB 1YCPK 1C2KA 1G9IE 3U1IB 3SZNA 2FEQH 3BIVH 2FM2A 1UHBB 4CH8B 1WSSH 1EJAA 1ELFA 1K1OA 2WV9A 1F0UA 3A8AA 3BTKE 4I7YH 1GBCA 1UCYK 3ZVAA 1FLEE 1UVPA 1TQ0B 1C2IA 1F2SE 4ACAA 2P16A 1FDPA 1SLUB 2H2ZA 4YTAA 3QX5H 5EXNA 2HRVA 4UFEH 1JWTA 4MVNA 3V0XA 1OP8A 1TRYA 2LELA 2ZDKA 4X8SH 3O8BA 4ZXXH 3BIUH 4ABHA 4ABBA 1O36A 4KP0A 2O8TA 1C5TA 4IMQA 1GBJA 3MOCA 4YT6H 1QRZA 4HFPB 4XE4A 4ABEA 5CHBA 2W3IA 5AFYH 2P93A 3A84A 2QY0B 2XBWA 3LOXA 1MKXH 2FOMB 4GUXA 1GVKB 2FWWA 3OEHD 3M7QA 3ZZ9A 3CS0A 1O33A 2NU4E 1NTPA 1ZSLA 1XUKA 4O9VA 1CT0E 4YM9A 4FUJA 1SBWA 1FPHH 1UTKA 2WV5A 1IQMA 3TGIE 3GY8A 3SO3A 4D7FA 5J4QA 1QJ6B 3EAJA 4NSVA 2GCTC 2QXIA 2V3OH 4KELA 3ZVCA 2W6JD 3EE7A 3E0NB 1P04A 2AIQA 2FO9A 5EJLA 4DURA 1ANBA 3LONA 2G52A 4ZAEA 1GI4A 1MTWA 1MABB 2Z9GA 1LKAA 5ABWA 4MTBA 1W0YH 2VIPA 3BTFE 2AGIX 3TK9A 5H4IB 3ZZDA 1G30B 1EB2A 3K2UA 5DG6A 1CA8B 1AVWA 8KME2 2HNTE 2BLOA 2SGAA 2ZWLH 3RXMA 4A92A 1Q31A 1S81A 1QZ8A 1GI1A 1Z6EA 2W7UA 3BTME 3UWIA 4P02A 1CGIE 2JETC 1NROH 1OP2A 3T29A 1AY6H 1VKYA 2K8IA 5DP5A 4TY6A 1EPTB 1YY3A 3LH3A 4Q7XA 1ZPBA 4HG6A 1D3QB 1IHTH 1FIZA 1GG6C 3WWFA 6ESTA 4ISIH 5T3HA 3L33A 3VB6A 2HWLB 2ALVA 1O2OA 5FPYA 1LKBA 2FI3E 1BOQA 1FN8A 5F8TA 4WWYA 5L6NH 1PQ5A 3SV9A 1A5GH 2R3YA 2Y6TA 1S85A 2WPKS 3HGNA 1DY8A 3F9FA 2HPPH 2PUXB 1H9HE 2FS8A 1HAIH 1AIXH 1GBBA 2V6NA 2JIZD 2BDCA 2WPLS 2FOCA 2BLWA 1G3DA 5CHAB 4F55A 1THSH 1GBTA 1HJ9A 1TMTH 1LHFH 5GIBA 5A0CA 1TGCA 4DW2U 1MD7A 2VIQA 2YNAA 3SI4H 3ZV8A 1X7AC 3EA8A 2A2XH 3HKJB 1KIGH 1TGNA 1O2JA 2ZCKP 1JIMA 4JZIA 1Y3VA 2Y7ZA 1YKTA 1ANDA 3EQ0H 3OAAD 3VGCC 2VWNA 1MMJN 3SNBA 4AFUA 1NESE 1VGCC 3KYFA 1P02A 1BIOA 2VH6A 1GHAF 1XXFA 4WMDA 1YGCH 1D6RA 1DY9A 2PV9B 1O39A 5EW1H 4AOQA 1CBWC 1KXFA 4P00A 2F9BH 1KTTB 2UUFB 4DG4A 2ZFSA 3LGUA 4Y6DA 3A8BA 2CJIA 1G37A 1O2UA 2B8OH 3U28C 3FP6E 5SGAE 3RXEA 3PMBB 4AGKA 1DWDH 2ZEBA 3RXDA 2KCYA 1ELVA 1SGNE 1ZSKA 2R0LA 4YZUA 1OYQA 3RC5A 1C4V2 4WH8A 4XFQA 3UR6A 3K6ZA 3ZZCA 5FPTA 4GCHG 2A45B 4X8UH 4X8VH 3QUMP 1RFNA 1IQKA 1ZLRA 2ZP0H 2PHBA 2AEIH 4I32A 2A7JA 4WVPE 2P8OC 3V13A 3HK3B 4D76A 4MPWA 8GCHG 2BXTH 3KNXA 4FVBA 1ZTLA 2BD7A 4CBOA 8LPRA 3PLKA 2PGQB 4IC5A 4CHAC 1BQYA 3PRBA 3U98H 1L1NA 1MU8B 1C1OA 2FMJA 1O35A 5AVDA 5F8XA 1KLJH 4U01A 5C2ZA 4WF8A 1TNLA 2XW9A 1TMBH 2XWBI 4OGYA 1O32A 3M7UA 2EQNA 3SNEA 5L30H 3TNTA 4XDEA 2JJ2D 4JYTA 1E34B 1O38A 1XUGA 1C9TA 2TBSA 3JZ2B 3M5NA 1NFWA 1AMHA 1JRTA 2H9EH 4B2AA 5FX5A 1ELAA 2SGDE 2B7DH 3OE7D 2RA0A 1C2HA 4JZDH 1W12U 1BRBE 1QFKH 1QJ1B 1TALA 3GDVA 3S0NA 3JZ1B 1ZHPA 3KQ5A 2P94A 2ZGHA 3N7OA 3UOUA 5C67A 1XUJA 5I25A 4NG9H 4CRGA 5GCHF 1H8ED 4I8HA 4I8LA 1O3MA 4WY3A 2ZC9H 3GS9A 1T8MA 1UO6A 2H1UA 1DXPA 1WU1A 1O31A 2GCTB 3SV2H 4NFFA 1TGSZ 4D9RA 1EQ9A 3LC5A 2OUAA 3WY8A 1YCPM 1A3BH 4Y71A 5DN6D 1P01A 1SR5C 1LHDH 1DUEA 1T32A 3LIWA 2A4GA 1PYTC 4UD9H 4ZROA 1G3CA 4JYVH 1DUAA 1QL7A 1COWD 1GDQA 3KQBA 3QK1A 4ZHLU 1WOFA 3UNRA 1B0EA 2BDIA 4ABDA 1QURH 2AFQB 5F8ZA 5TJXA 1U6QA 1K21H 2Z7FE 4BAKB 2JETB 1Y3XA 2FOGA 1Q2WA 1UTQA 4Y79A 1W13U 3T26A 1GG6B 1HAOH 1ELTA 1GVZA 1Z6JH 4FU9A 1HAGE 2W5EA 4B71A 1C1QA 4R8TB 5C5OA 1BUIA 4X1RU 3M3TA 4E7RG 1O2GH 5EIYA 1BBRK 2ZNKH 4YXWD 1S6HA 4MNWA 1O2LA 1SI5H 1L4ZA 3ATLA 2WV4A 2ZHFH 4HI3A 5C3NA 1CO7E 2CV3A 1UK4A 3MFJA 4B76A 1HCGA 4A1VA 2QA9E 3TJUA 4K8BA 4B73A 1FZZA 2BQ6B 3EE0B 3BTHE 4RI0A 4KTCA 1LMWB 1GDUA 1H1BA 3F68H 1SGIB 2BZ6H 6CHAB 1RTKA 2OTVA 3SU6A 2TGAA 4Z1MD 1J17T 1EAIA 3DSOA 2BYAX 1GJDB 3VGCB 1BJUA 4A5TS 2QF5A 4B2BA 3SNCA 5DSFA 1VGCB 4IGDA 2QF0A 5JBTA 4FUEA 2F4LA 3FZZA 2QXJA 4F48B 4CRDA 1QIXB 2Z3CA 1MKXK 3OFND 1AO5A 1LQDB 2HVXA 2M5TA 2ZCHP 1OWJA 1K0HA 2PR3A 2PW8H 1CGHA 1W2KH 2NU0E 1B0FA 1EJNA 1ANEA 1IQEA 1MU6B 2A0QB 3E16B 3MQKC 1GI9B 4THNH 5E0JA 3RP2A 2TGPZ 4LK4A 3HKIB 3KN2A 3UB0A 2ZF0H 2J2UA 3KEEA 5HMAA 2ILNA 3UPEA 1XMNB 1RTLA 3SUFA 1C2DA 3F6UH 4X8TH 1C5QA 1MTVA 3SGQE 1C5YB 3QLPH 1W8BH 1VITF 1YPJH 5KECA 2QF3A 1XKBC 1XM1A 1TX8A 1ELEE 1V2WT 1EZQA 2GDDA 1V2VT 3SQHE 2KFWA 2P8OB 1H8IH 1AE8H 3PV2A 1HJ8A 1L4DA 2BOKA 4K60A 4A1TA 2BOHB 1W0JD 2A7HA 1O3JA 4CHAB 3KF2A 1VZQH 4I8KA 3SZEA 1AQ7A 3KYGA 3M3VA 3CENA 1DSUA 2TGTA 2UWLA 2VWLA 3PRDA 2PFEA 3RXUA 2ANMH 4Y11E 2RA3A 2XOKD 7LPRA 4BTIB 3F9GA 2B9LA 3V7TA 5IDKA 1ARCA 4OS1A 1W14U 2XRCA 4E7NA 5L2YH 1TE0A 3BG4C 3IG6B 1TGTA 4Y7AA 1C1TA 4I33A 2BX3A 2OQUA 1ZHMA 1C5SA 3GCNA 1ID5H 3TNSA 1YPHC 1BRCE 3RM0H 1KTSB 2BXUH 1NPMA 1UTNA 3IWMA 1GBHA 3E8LA 3SJIA 3KIDU 1T8OA 3RXPA 1OOKB 1WV7H 2EI7A 3AAVA 3DD2H 2THFB 1JOUB 3TGJE 1SGEE 4M7GA 4YESB 2PGBB 1O3KA 2SGPE 5F03A 2XWAA 1OSSA 5K7RA 2QXHA 1IQHA 3LH1A 4BAMB 4K1SA 1LPGB 3GCTF 2VB0A 1O2ZA 4FUBA 3ZYDA 1O30A 1S6FA 1P11E 4A7IB 2GJGA 1GCTC 2HPQH 1EJMA 2BD3A 3SHAH 1ETSH 4K5ZA 2CF8H 3L3TA 2Q6FA 3O8DA 4H6TA 2A5KA 2YMSC 1SB1H 2ZFRH 3EGKH 4Y0ZE 4ESTE 4FU7A 1P2JA 4UE7H 3FOAA 1FN6A 1FAKH 1DITH 1TX7A 2GT8A 3BTTE 2RCEA 4ZH8A 1H9IE 1HB0B 3AK5A 1V2RT 1QL8A 2FXRA 1QA7A 1GHVH 1D3PB 1ELGA 3F9EA 3RXIA 4NCYA 2FYRA 4ZKSU 5E0HA 1BTXA 2BD5A 1C1NA 1ZRBA 4B74A 2CHAC 3LJJA 2C8YB 1J15A 3OSYA 3UQVA 1SL3A 1TNJA 7GCHG 4GSOA 3RMMH 2ZTXA 1FUJA 4JZFH 3P17H 2UUKB 3ATIA 3ZVDA 3K65B 1QRWA 3TITA 1MZDA 1G2MA 1DANH 1GHBG 1FV9A 2LP6A 3P92A 4CRCA 3U1JB 1QB9A 2FI5E 1THRH 2KCAA 1O3GA 4KTSA 2WUBA 2ZHQH 1YPLH 3E90B 3NRLA 3T28A 2OCVB 1IQNA 2ZFTA 3T25A 4PROA 3Q3XA 1JBUH 4ASHA 4VGCC 6GCHG 3RXKA 1Y8TA 1GBLA 2OC1A 2R0KA 4X6OA 2BTCE 2BQ7B 5FX6A 4FUCA 2WUCA 3RXRA 2BY5X 1SGTA 3QGNB 2XC4A 1O2NA 2SGFE 3SBKA 2JH0D 5FL7D 1L1JA 4RT1A 1TONA 5FCKA 1W0ZU 2I6QA 4BXWA 4ISHH 1GBKA 1GHWH 1QNJA 1SQTA 3M5OA 1OHHD 4ZKNU 2BB4A 1HRTH 4UEHH 1RGQA 1GI7B 3MNSA 3DSGA 2XYAA 1KDQA 1S82A 4CREA 5LPEA 3D65E 1QCPA 1SHHB 1TA2A 3KCGH 2FDAA 2AS9A 2QN5T 4DIHH 1GMDG 1TRMA 1TMUH 3KQCA 4WJG2 3TGKE 5C0UA 1C5PA 1SGRE 2A32A 4TYDA 1EATA 3FANA 4B1TA 3P8FA 7ESTE 3MYWA 4AN7A 2ZIQH 2P95A 3RLYH 4GCHF 3TJVA 1NN6A 1E0FD 1Z1JA 1AE5A 1JIRA 1AGJA 3BTDE 2PUQH 3AASA 1V2QT 3ZZ8A 1XX9A 1NU7B 1D4PB 1EFRD 1NU9A 1SOTA 8GCHF 2WYGA 2ZHEH 3BG4B 1TPOA 2ZG0H 5T6DA 3RXJA 3ATKA 3RXGA 3D49H 2P3TB 2PWXA 5TCCA 3MTYA 4XRNA 1Y5AT 3VXEH 4B2CA 2ZGJA 1GHZA 1LCYA 4AFZA 2CMYA 3S9BA 1F5KU 1V2LT 1Y5UT 1M9UA 1HBTH 3ZYEA 1DE7H 1QQ4A 2BY7X 1ZPZA 5FBIA 1HLTH 1DPOA 2J98B 1O3CA 3A7YA 1E36B 1RD3B 3GDSA 1MAYA 2WHXA 4Q7ZA 5GDSH 1QB6A 3SNDA 3GDUA 1DM4B 2P3UB 3QGJA 4CBNA 3PWBA 2SNWA 3GY3A 3M36A 3LDXH 2PKAB 5GNDA 1CHOF 1T4VH 2Q1JA 1VITH 1P2NA 3E3TA 1NFYA 1AZ8A 4ASUD 3CP7A 3A89A 2OQ5A 3ZZAA 1EXFA 1PPEE 1GCTB 4ACBA 2XC5A 1V2ST 3ELAH 3LGYA 2BX4A 2FOEA 3F2FA 3PMJA 1UK2A 2PTCE 1TRNA 1BMNH 3OEED 2XCNA 3LJOA 2BZAA 2ZFPH 3B8JA 2YMSB 2G4TA 4ABAA 1THPB 2QGRA 4FVDA 3KQEA 4U2WA 1EX3A 3A7TA 1YF4A 2EI8A 2OBQA 3BG8A 3TIUA 1C5XB 2JH5D 2ZFQH 4X2YA 3G01A 2FZZA 2RDLA 4H42U 1ELDE 1DDJA 2O8UA 5EQQA 5HKKD 4DGJA 1KXDA 2YOLA 2Q6GA 4KTUA 5DP8A 4O3UA 3UOPA 1DVAH 3P8NA 1RIWC 2CHAB 1BTUA 3DT0H 4BNRA 2SNVA 1F0RA 1UMAH 5T1VA 3M35A 4X1NU 1C2EA 1HAVA 3PTBA 3KGPA 3BSQA 4D7GA 3GY2A 1TGBA 1IOEA 4QT8C 2F83A 6LPRA 4XBCA 1BTHH 2A2QH 2FLBH 5AFZH 3MWIU 2O8WA 3QZRA 3SHCH 4UFFH 5EJZA 5JPMH 1E1RD 1BMAA 2AGGX 1EKBB 1C1PA 1ZHRA 3HGPA 3U69H 1S83A 3A8CA 1EAWA 3E6PH 1GI6A 5B6OA 3SORA 2WYJA 3QDZB 1OX1A 2G8TA 1K1IA 5FBEA 1P2OA 4VGCB 2HOBA 5DP4A 6CHAC 4CR9A 1NFUA 2VNTA 2ODYB 1UCYE 2ANWA 2ZQ1A 2BD4A 1O2IA 3RXTA 1AKSA 1TYNA 2R2WU 1SOZA 2HVYB 5FCRA 1AZZA 1QBNA 4UFDH 4WXIA 2VIDA 3ZVBA 3EA9A 4NIYA 2GCHG 2H9HA 4X1QU 3W95A 2VIWA 3OX7U 5EPYA 1BTPA 2GVFA 1O3PB 1PPBH 3MU0A 5IYTA 3LU9B 3ODFA 3O8CA 1BMMH 5C94A 1H8HD 2BVRH 5EPNA 3VB7A 1G36A 4YLUA 2H5CA 2F91A 1VJAU 2SGEE 4YO9A 4AYVB 4BANB 2ANYA 5CDFE 4ZUHA 9ESTA 1L0ZA 3RXHA 5ESTE 1O2MA 4ISNA 1OWDA 4B6EA 1C5MD 1MQ5A 1AVXA 3BTQE 1GBDA 1SGCA 4Y7BA 1ZR0A 1QRXA 2PTNA 1V2PT 1RS0A 1KYNA 4RKJB 2QYIA 2ZDNA 1AUTC 3ZVEA 3T5FH 1OWEA 3AW1A 1XUHA 1O2VA 2R3UA 5DPAA 2J94A 2H6MA 1DICA 1YWUA 1P09A 1P9SA 4O3TA 1ELBA 2GMTB 2F9PA 3SN8A 1UVSH 1WXRA 1CSOE 1O2PA 1OPHB 1V2OT 2IJD1 1P05A 4NWKA 2VVVA 5E2PA 4FUIA 1GMCG 1VR1H 1EB1H 2ZGBH 1IQJA 3PLBA 3LGWA 2YNBA 3RXLA 2Y7XA 3BF6H 3TK6A 1DFPA 3RMNH 1QTFA 1F0SA 1NZQH 1KSNA 2G5VA 3A83A 4UFGH 1ACBE 4ZKOU 1V2MT 2Z9JA 5EW2H 4ZXYH 1BB0B 1DLEA 4X6MA 3ZVGA 1AB9C 1K1MA 4FUFA 1H4WA 1O2YA 1P03A 2ZZUH 4X0WU 2BDGA 2Z94A 1BMLA 1FXYA 1NO9H 1S5SA 5J4SA 1GL0E 1O2RA 5DP7A 1O5CB 3I29A 1HIAA 3A7ZA 3F3BA 1C4Y2 2A31A 2OD3B 3SGAE 5PTPA 5A8YA 1FNIA 1BJVA 1TA6A 1UHBA 1HV7A 4BXSA 3F0OA 2KM0A 1B7XB 1W10U 1ZYOA 3RXOA 3M61U 3GOVB 4NWLA 1MCVA 2G81E 1ETRH 4TPIZ 1O5GH 1P2MA 2A5AA 1DWEH 4Z0KA 3SW2B 2OBOA 1LO6A 1WTHD 3RXBA 4DJZB 4I8GA 2DE9A 2GT7A 4WMFA 3WWBA 3DA9B 1YPHE 1GMHF 2F3CE 3A81A 3M37A 1EOJA 1QQUA 1RIWB 1W11U 3RXSA 5B6LA 1QBVH 3C1KA 3M7TA 2BMGB 1AFEH 1CHGA 1TBQH 4AFSA 2TRMA 1BHXF 2JKHA 5DP3A 4X2XA 1C1UH 1LDTT 2F43B 4BAQB 1MZAA 3GISB 2A4QA 2XBVA 1N6YA 1TNKA 1C9PA 4OS6A 4YOJA 5A09A 1O34A 2BDYA 2OK5A 1TX6A 2KAIB 1FY4A 3UFAA 3AVZA 4JYUH 1C1SA 4BTUB 1L1GA 1V3XA 1Z8IB 1E1QD 4KGAA 4TT3D 1V2KT 2Y5FA 3TLOA 2BQWB 4TSFD 7GCHF 2ODQA 1SLWB 3DUXH 1O5DH 1O2KA 1ORFA 1WYKA 2VVCA 4ABGA 1PJPA 3U8OH 2TIOA 2WPDD 2ZPQA 2AMPA 3D23A 1Y59T 1O3BA 2V0BA 1Z8RA 4ZHAA 1ARBA 1UVUH 2FIRH 1YPKH 2F9OA 3BEUA 2D8WA 2ULLA 1IAUA 3VB4A 1C5RA 1TNIA 3VB3A 2FP7B 1CT4E 1F7ZA 1O3FA 2C8XB 2D2DA 2GD4B 2H9TH 3PO1C 3PB1E 5C1XA 4A1XA 4AX9H 1EUFA 1GGDC 1GHAG 4CRBA 1Z8GA 1OXGA 3M3SA 2A5IA 6GCHF 1EPTA 2P59A 2BY6X 3T62A 1PQ8A 1T8LA 1YLCA 1VCPA 1WCZA 2D1JA 2ZO3H 1P2IA 2WINI 1NC6A 1C2MA 2EC9H 3ITIA 1SGPE 2QAAA 1Z71A 4AB9A 5HGGA 5JYIA 5GPIB 3FP7E 5LGOA 1KXCA 3TJNA 1PPFE 1OWKA 2AYWA 2J4IA 1T8NA 3DFJA 3PYHA 1SQRA 1FPCH 2UUYA 1ZSJA 3FFGA 1S84A 1K1NA 1EZUC 3PROA 1SGYE 2V7QD 1BITA 3GCHC 4YOGA 1RTFB 1YLDA 2C8ZB 5EQSA 1FQ3A 4H6SB 1NS3A 1D9IA 1ZRKA 3I78A 1TPSA 1YM0A 3AAUA 1SMFE 3QZQA 1DWCH 3Q3YA 2STBE 1GBIA 1EP6A 2C90B 1OS8A 3SJ9A 5HYOA 4A6LA 3MO6A 2FTLE 4UONA 3W94A 2DUCA 4XBDA 1AB9B 4X1PU 4AC9A 3STJA 5EXLA 5CE1A 1BBRE 3PV5A 5GCHG 3W1EA 3VFEA 5CMXH 3F1SB 2CK3D 1SPJA 4SGAE 1ZJDA 1A5IA 3PMHB 1P12E 3K6YA 1DS2E 1K2I1 1Q3XA 3SJOA 1GCDA 1O3OA 2PSXA 2G55A 3I77A 1K1JA 3K9XB 1TIOA 3HATH 5T6FA 1JRSA 3B23B 4TY7A 5EOKA 1O2SA 2ANKH 1QR3E 3LKWA 1YLNA 2O9QA 1EAUA 4DCDA 1V2NT 1J16A 3SV8A 1DOJA 5L2ZH 1ABIH 2P3FH 2GZ9A 2H5DA 1SQAA 5A0AE 8ESTE 1PFXC 4AB8A 1BTYA 2ASUB 1WQSA 1SGQE 3RU4T 1LPKB 1C2FA 3QTVH 2V3HH 1KLTA 1O2WA 1MBQA 3ZZ3A 4K69A 3SGBE 1A0HB 2BVSH 1UTOA 5FPSA 4U30A 3RXFA 3TU7H 3NKKA 2W6ID 3ESTA 1A46H 1FY8E 1O3EA 1ZMJA 1YPGH 1A7SA 2IOTA 3N7EA 1HXEH 4B75A 3L6PA 3PWCA 1A61H 2QIQA 5E0GA 1O3IA 4XOJA 1SFIA 3Q76A 4OS5A 5F53A 1BZXE 2J92A 3CS7A 4B6FA 1W0KD 1QA0A 1V6DA 4JK6A 5C1YA 3MNBA 2WSSD 3UREA 1BRAA 2W3KA 3NXPA 2BHGA 3V3MA 2R9PA 1FAXA 2XC0A 1G3BA 1CQQA 1BRUP 1J14A 3LGIA 2TPIZ 3SJ8A 4RSPA 1GJBB 4X6PA 1A0JA 3ZZ4A 3VEQB 1AVGH 4ISLA 2ZU2A 2QC2A 1HPGA 4MNVA 2VGCC 3PO1B 1NBME 1OWHA 2ZDAH 1GGDB 3CNRA 4IC6A 1O3NA 4NIXA 1ABJH 1MTNC 2ZHWH 3F0PA 4OS2A 4OM9A 1P0SH 1XVOA 2BLVA 1GBEA 2ZDLA 5HM2A 3PLPA 3LGTA 1UW7A 5JB9S 1ESBA 2ZPRA 3TK5A 3ZV9A 1O3AA 4GHQA 3ATMA 3Q3KA 2G51A 1XXDA 2FX6A 3ZVFA 2PKSC 3PM3A 4E06H 5JBAS 4MNXA 2HNTF 2XCFA 4TWWA 4GVUA 1CE5A 1CU1A 1GBAA 1GHYH 4IMZA 2YMSD 1HUTH 1GI8B 2VBCA 1D3TB 3ZZ7A 1QY6A 4D8NA 4K8YA 3VG8A 2C93B 1GJ8B 1SLVB 2NU2E 3BTWE 4O03A 5E8EH 4BAHB 1W3CA 2RDEA 2WZQA 1VITG 2BDAA 1IQGA 3SU4A 1C1RA 1N1LA 1P8VC 3A80A 4JMYA 5HIYA 1O2HA 3GCHB 4MNYA 3SU0A 1KMHB 2C3SA 2JDID 1AHTH 1QHRB 1K9OE 1C5VA 4J1YA 2Z6BD 4NSYA 5FHTA 1YYY1 5DJ7A 4IS5A 2ZPSA 2NU1E 4BTTB 1NRRH 1BDAA 1SG8B 4Q80A 1BTZA 1GJCB 3HPTB 2VH0A 1NY22 4D9QA 1J8AA 3WW7A 1UTPA 1GI5A 2GMTC 3KQDA 3QTOH 1AD8H 4CRFA 3T2NA 4K1EA 1C4U2 3SYJA 4ZHMU 1V2JT 2BD8A 3R0FA 2FOHA 2FTMA 3D62A 5DP9A 4NGAH 2BD2A 3BTEE 1TAWA 5DK1A 2J9NA 2KCPA 3RUOA 1HGTH 1GMCF 1TBZH 1B5GH 1GJ7B 2KR7A 2A1DB 3E1XB 3C27B 1D6WA 1KY9A 3HK6B 2OINA 2F9UA 3URCA 1C5ZB 2EI6A 4YOIA 4WXVA 2ZU3A 4FUDA 1BMFD 1KLIH 3MNCA 5JBCS 4ZKRU 3MU1A 2OC7A 3TPIZ 5DP6A 3SJKA 3QO6A 1C5OH 2IPQX 1L2EA 2QXGA 4H4FA 1TBRH 2FYQA 3GCTG 2A4RA 1HYLA 3SQEE 4DVAU 1GHXH 3VB5A 1UK3A 1TOCB 2FX4A 2HALA 3M5LA 1G3EA 5C1UA 2V35A 1VCWA 2XTTB 3Q77A 1SLXB 1C5NH 1DX5M 2PLXA 2Z9LA 1MUEB 3ZIAD 3A7VA 1HAPH 3MH7A 1Y5BT 3TH3H 2J97A 1DT2A 3RLWH 4LZ4B 3RDZA 3MO3A 2XNDD 3SU3A 2HLCA 2AERH 3A88A 1CGJE 3RMOH 5T6GA 1Y3WA 4LOYH 4KKDA 3P8GA 1IHSH 3FZDA 1ANCA 1HJAC 2QF4A 2J5UA 1YBWA 1GPZA 4AG2A 2FI4E 1C1MA 4DT7B 3NCLA 2WPMS 3SNAA 3MH6A 3NWUA 1XVMA 4FOUC 2QCYA 3S7HB 5C5NA 4K2YA 3GY4A 1W7GH 4Y76A 3SUEA 1N8OC 2CF9H 3ODDA 2L6OA 2AMDA 2PP6A 3E91A 3FN8A 2ZCLP 1NRPH 1LVBA 3ZZ6A 5EXMA 4ISOA 5EG4A 5LPRA 5EJ1A 3H7TA 1CA0B 3UIRA 1FI8A 5TCAA 3E0PB 3OTPA 1A2CH 2C8WB 4OS4A 4CH2B 1T4UH 2SGQE 3S7KB 1QBOA 1PPZA 5LPFA 1C2LA 4NZQA 2VGCB 1GDNA 2Y82A 2A4OA 4OS7A 4Y8XA 5GWZA 1MTNB 1SQOA 3LT3A 1NFXA 2VWMA 2J34A 4JZEH 2Z9KA 4IW4E 2ZDVH 5JB8S 1AN1E 1P10A 1FJSA 4NZLA 3Q00A 4IN2A 1AFQC 4AYYB 2PKSB 2HLDD 1SVPA 4NA7A 2WPIS 1FONA 3GY5A 4MLFB 3EDXB 1Z7KA 3BEIB 4TPYA 4ABJA 3SU1A 4GHTA 1GJ9B 1YPMH 3GCOA 2UWOA 1TPAE 3FP8E 1J9CH 5E2OA 1ZMLA 2ZHDA 2JH6D 5F6MA 4I8JA 1GBMA 1BHXB 3BN9A 1P2KA 4X2VA 4MQAA 2OLGA 1NBMD 3H7OA 1AWFH 1NRNH 2O8LA 3ENSB 3MH4A 3UQOA 1HAYB 4FU8A 1FX0B 1FY1A 1EOLA 2AHME 2WPHS 4ZCNA 2A7CA 1TQ7B 1TFXA 1A1RA 1LTOA 4DIIH 1K1LA 3A82A 3RMLH 1MCTA 2BD9A 3GYLB 2SFAA 1SHYA 3GICB 3U8RH 3LC3A 1ZOMA 1N6XA 2LNCA 3ATWA 1WQVH 1O2XA 2CGAA 1A4WH 3R3GB 1ZTJA 1JMOH 1MD8A 2Y81A 1Z1IA 3RM2H 4HGCA 2FS9A 3SV7A 2GDEH 2BDBA 4ABIA 1O3DA 4Z6AH 1IQIA 3RXVA 5A2MH 1EP5A 3DCLA 1AWHB 1YPEH 2KX4A 1AU8A 3TJOA 2ZGXH 1HNEE 1AI8H 1K28D 3P70B 1P9UA 4X6NA 3MH5A 3SUDA 3ZZ5A 5A0BA 5ESBA 1GJ6A 5JBBS 3OYPA 2M2AA 1MTUA 1ZGVA 2HNTC 4K3JA 1GBFA 3GY7A 3S9CA 2AGEX 1C2GA 3S9AA 2VVUA 1KXEA 1QL9A 3MMGA 1V2TT 4BAOB 1CHOG 4BOHA 1NRSH 3OY6U 3BV9B 1MKWK 1EZSC 1SGDE 2K1QA 4LZ1H 1DSTA 4MG3A 5BRRE 2TGDA 1KXBA 1OWIA 5EU8A 5LH8A 2QE7D 2QV1A 3RXQA 4RKOB 2ZI2H 2EA3A 3A86A 3S69A 2K0QA 4Y8YA 1WDIA 1DLKB 4Q63A 1O5FH 1PPGE 3MU5A 2R2MB 2AIPA 3NUMA 2FODA 1T31A 3UY9A
chains in the Genus database with same CATH topology
1OYTH 1YCPH 2BY8X 1LHGH 2RG3A 3BTGE 1G32B 1P57B 1HJAB 2ALPA 1F0TA 4R0IA 1ELCA 4MPUA 3TVJB 4Y0YE 1LHCH 3DFLA 2F9NA 4X2WA 1UCYH 5AF9H 1N8OB 4JK5A 1W7XH 2OP9A 4U32A 3NPSA 2STAE 3RXCA 2IPHA 5I46H 4AFQA 1GJ4H 3AW0A 3SU5A 1AUJA 1XUIA 2ZU4A 1VCQA 2BLQA 3A7WA 3UWJH 4TWYA 5EQRA 3VXFH 2AH4X 3SV6A 4F49A 1D3DB 1MH0A 1Y3YA 2O8MA 3GYMA 2PKAA 1SC8U 2CXVA 1GWAA 2ZDMA 1F5LA 2XNIA 1E37B 2EEKA 1QGFA 1WAYB 1BA8B 1QB1A 1MTSA 1KDQB 2GV6A 2ZU5A 4Y8ZA 3RU4E 5FXLA 1H9LB 1CVWH 1FY3A 1O37A 2B5TB 1AFQB 4NA8A 2Y5GA 1PYTD 4Y10E 1GHBF 4SGBE 2J38A 2ODPA 2DE8A 3MHWU 4MPXA 1MQ6A 1WTGH 2C4FH 2F9VA 1F92A 1FIWA 1GL1A 1ZZZA 3PV4A 3QN7A 5DGJA 3UTUH 1DXWA 3NK8A 2XXLA 1A0LA 2GZ8A 1NRQH 1HDTH 1TPPA 1ESTA 1INCA 5G4BA 1P2QA 1PPHE 3F9HA 1CBWB 3OY5U 5HM9A 3MU8A 4AZ2B 3B9FH 9LPRA 3UUZA 1LVMA 2VIOA 2Y5HA 2BM2A 3U8TH 1O3HA 2ZQ2A 1NM6A 4XBBA 2GZ7A 4RN6A 7KMEH 1TB6H 2OC8A 2GKVE 2OXSA 4GLYA 5A8XA 2OC0A 1O5EH 1GI0A 4MDSA 1UTLM 3SOSA 1RRKA 4FUGA 2GTBA 1P06A 2BY9X 1Z8JB 5K0HA 3STIA 3A85A 1EAXA 1O5AB 4INLA 3EA7A 1GMDF 1C1VH 2VJ1A 4E05H 1TOMH 1EZXC 1JXPA 3FVFB 5FAHA 4XSKU 3MNXA 4CRAA 4HZHA 1PQAA 3UNSA 1OP0A 2Z3EA 2FPZA 2BVXH 1T7CA 1GJAB 5A8ZA 5HXFA 4MPVA 1E38B 4I31A 1UVOA 1DWBH 1F5RA 1HAXB 4ZMAH 4WMEA 1BT7A 4X1SU 1O5BB 5BPEA 5DKMA 1TLDA 2I6SA 3M5MA 1YC0A 2LPRA 4Q7YA 3A7XA 3URDA 1V2UT 2VIVA 1IQLA 1O0DH 2B0FA 3TH2H 2Z9IA 1OKXA 1S0RA 3GY6A 3SU2A 3RXAA 4JZ1A 1CT2E 1Y3UA 2WPJS 5GXPA 1ZPCA 3LPRA 4NA9H 3P6ZB 1XKAC 2Z3DA 1HAVB 1TNHA 3QWCH 3BEFB 3P95A 2G00A 4Q2KA 1G2LA 2AMQA 2Y80A 1ZJKA 2VWOA 5DO4H 4AORA 3SUGA 3H5CB 3OU0A 1E35B 1H8DH 1SGFA 1UVTH 4UDWH 5GJ4B 1SFQB 1S0QA 2ESTE 3ZZBA 1P3EA 1SSXA 3A87A 1O2QA 1AKSB 2NU3E 5ETXA 1ZGIA 1GMHG 4INHA 4K1TA 1HAZB 4NFEA 3TH4H 4CR5A 1GVLA 4LXBH 2ZU1A 2ZTYA 3MI4A 3EYDA 5JDUB 4YLQH 2FESH 3T27A 4NIVA 1ZMNA 2HGTH 2FLRH 1LVOA 2ZFFH 3MO9A 3V12A 2ZGCA 1GI3A 3FAOA 2UUJB 1C1WH 2UWPA 4GAWA 2BDHA 1TNGA 4INKA 4FUHA 1HXFH 3SI3H 1A3EH 1C2JA 1IQFA 1EPTC 2FOBA 1BCUH 2G4UA 2GV7A 1QJ7B 3IITA 3O8RA 2GX4A 4WH6A 1WBGB 4JCNA 2D26C 2XBYA 3PMAB 5C20A 4AGJA 1P3CA 2J95A 2FOAA 1YP9A 5EGMA 1LVYA 4IN1A 1CA0C 4DOQA 2ZKSA 5AHGH 3DHKH 1SGFG 1MKWH 2VINA 3UNQA 4O97A 5EODA 4IBLH 1UTMA 1XUFA 2G5NA 1VJ9U 4OGXA 1K1PA 1ETTH 4F4OC 1TWXB 3U9AH 1MBMA 1FY5A 4DY7B 1KXAA 2IJOB 1C5LH 1HAHH 3P8OA 2PSYA 5CHAC 1A5HA 2ZECA 2IN2A 2W26A 1K22H 2FOFA 4FXGH 4YT7H 3A8DA 1EASA 3RU4D 3UR9A 3RC4A 1FMGA 1TABE 2W7SA 3PTNA 1GI2A 1RXPA 1LHEH 1ZTKA 4AG1A 1LPZB 2ZA5A 3KL6A 2XBXA 3OTJE 3MU4A 2GCHF 2GGVB 3NZIA 4J2YB 4GPGA 1UJ1A 1PQ7A 2Q6DA 2ZTZA 2VU8E 4NIWA 1GJ5H 2GP9B 3KHVA 3LGVA 1LQEA 1ESAA 4HTCH 1O2TA 1BTWA 2KAIA 1O3LA 3RC6A 4ABFA 2CN0H 1UTJA 1C5UA 1PPCE 3VPKA 1NT1A 1WUNH 1MAXA 1BBRH 1HFDA 1C5WB 1HIAB 2NWNA 1RJXB 1YCPK 1C2KA 1G9IE 3U1IB 3SZNA 2FEQH 3BIVH 2FM2A 1UHBB 4CH8B 1WSSH 1EJAA 1ELFA 1K1OA 3A8AA 1F0UA 3BTKE 4I7YH 1GBCA 1UCYK 3ZVAA 1FLEE 1UVPA 1TQ0B 1C2IA 1F2SE 2P16A 1FDPA 1SLUB 2H2ZA 4YTAA 3QX5H 5EXNA 2HRVA 4UFEH 1JWTA 4MVNA 3V0XA 1OP8A 1TRYA 2ZDKA 4X8SH 3O8BA 4ZXXH 3BIUH 4ABHA 4ABBA 1O36A 4KP0A 2O8TA 1C5TA 4IMQA 1GBJA 3MOCA 4YT6H 1QRZA 4HFPB 4XE4A 4ABEA 2W3IA 5AFYH 2P93A 3A84A 2QY0B 2XBWA 3LOXA 1MKXH 2FOMB 4GUXA 1GVKB 2FWWA 3M7QA 3ZZ9A 3CS0A 1O33A 2NU4E 1NTPA 1ZSLA 1XUKA 4O9VA 1CT0E 4YM9A 4FUJA 1SBWA 1FPHH 1UTKA 2WV5A 1IQMA 3TGIE 3GY8A 3SO3A 4D7FA 5J4QA 1QJ6B 3EAJA 4NSVA 2GCTC 2QXIA 2V3OH 4KELA 3ZVCA 3E0NB 1P04A 2AIQA 2FO9A 4DURA 1ANBA 3LONA 2G52A 4ZAEA 1GI4A 1MTWA 2Z9GA 1LKAA 5ABWA 4MTBA 1W0YH 2VIPA 3BTFE 2AGIX 3TK9A 5H4IB 3ZZDA 1G30B 1EB2A 3K2UA 5DG6A 1CA8B 1AVWA 8KME2 2HNTE 2BLOA 2SGAA 2ZWLH 3RXMA 4A92A 1Q31A 1S81A 1GI1A 1Z6EA 2W7UA 3BTME 3UWIA 1CGIE 2JETC 1NROH 1OP2A 3T29A 1AY6H 5DP5A 4TY6A 1EPTB 3LH3A 4Q7XA 1ZPBA 1D3QB 1IHTH 1FIZA 1GG6C 6ESTA 4ISIH 5T3HA 3L33A 3VB6A 2HWLB 2ALVA 1O2OA 5FPYA 1LKBA 2FI3E 1BOQA 1FN8A 5F8TA 4WWYA 5L6NH 1PQ5A 3SV9A 1A5GH 2R3YA 2Y6TA 1S85A 2WPKS 3HGNA 1DY8A 3F9FA 2HPPH 2PUXB 1H9HE 2FS8A 1HAIH 1AIXH 1GBBA 2V6NA 2BDCA 2WPLS 2FOCA 2BLWA 1G3DA 5CHAB 1THSH 1GBTA 1HJ9A 1TMTH 1LHFH 5GIBA 5A0CA 1TGCA 4DW2U 1MD7A 2VIQA 2YNAA 3SI4H 3ZV8A 1X7AC 3EA8A 2A2XH 3HKJB 1KIGH 1TGNA 1O2JA 2ZCKP 1JIMA 4JZIA 1Y3VA 2Y7ZA 1YKTA 1ANDA 3EQ0H 3VGCC 2VWNA 1MMJN 3SNBA 4AFUA 1NESE 1VGCC 1P02A 1BIOA 2VH6A 1GHAF 1XXFA 4WMDA 1YGCH 1D6RA 1DY9A 2PV9B 1O39A 5EW1H 4AOQA 1CBWC 1KXFA 2F9BH 1KTTB 2UUFB 4DG4A 2ZFSA 3LGUA 4Y6DA 3A8BA 2CJIA 1G37A 1O2UA 2B8OH 3FP6E 5SGAE 3RXEA 3PMBB 4AGKA 1DWDH 2ZEBA 3RXDA 1ELVA 1SGNE 1ZSKA 2R0LA 4YZUA 1OYQA 3RC5A 1C4V2 4WH8A 4XFQA 3UR6A 3K6ZA 3ZZCA 5FPTA 4GCHG 2A45B 4X8UH 4X8VH 3QUMP 1RFNA 1IQKA 1ZLRA 2ZP0H 2PHBA 2AEIH 4I32A 2A7JA 4WVPE 2P8OC 3V13A 3HK3B 4D76A 4MPWA 8GCHG 2BXTH 3KNXA 4FVBA 1ZTLA 2BD7A 4CBOA 8LPRA 3PLKA 2PGQB 4IC5A 4CHAC 1BQYA 3U98H 1L1NA 1MU8B 1C1OA 2FMJA 1O35A 5AVDA 5F8XA 1KLJH 4U01A 5C2ZA 4WF8A 1TNLA 2XW9A 1TMBH 2XWBI 4OGYA 1O32A 3M7UA 3SNEA 5L30H 3TNTA 4XDEA 4JYTA 1E34B 1O38A 1XUGA 1C9TA 2TBSA 3JZ2B 3M5NA 1NFWA 1AMHA 1JRTA 2H9EH 4B2AA 5FX5A 1ELAA 2SGDE 2B7DH 2RA0A 1C2HA 4JZDH 1W12U 1BRBE 1QFKH 1QJ1B 1TALA 3GDVA 3S0NA 3JZ1B 1ZHPA 3UOUA 2P94A 2ZGHA 3N7OA 5C67A 5I25A 1XUJA 4NG9H 4CRGA 5GCHF 4I8HA 4I8LA 1O3MA 4WY3A 2ZC9H 1T8MA 1UO6A 2H1UA 1DXPA 1WU1A 1O31A 2GCTB 3SV2H 4NFFA 1TGSZ 4D9RA 1EQ9A 3LC5A 2OUAA 3WY8A 1YCPM 1A3BH 4Y71A 1P01A 1SR5C 1LHDH 1DUEA 1T32A 3LIWA 2A4GA 1PYTC 4UD9H 4ZROA 1G3CA 4JYVH 1DUAA 1QL7A 1GDQA 3KQBA 3QK1A 4ZHLU 1WOFA 3UNRA 1B0EA 2BDIA 4ABDA 1QURH 2AFQB 5F8ZA 5TJXA 1U6QA 1K21H 2Z7FE 4BAKB 2JETB 1Y3XA 2FOGA 1Q2WA 1UTQA 4Y79A 1W13U 3T26A 1GG6B 1HAOH 1ELTA 1GVZA 1Z6JH 4FU9A 1HAGE 2W5EA 4B71A 1C1QA 4R8TB 5C5OA 1BUIA 4X1RU 3M3TA 4E7RG 1O2GH 1BBRK 2ZNKH 1S6HA 4MNWA 1O2LA 1SI5H 1L4ZA 3ATLA 2WV4A 2ZHFH 4HI3A 5C3NA 1CO7E 2CV3A 1UK4A 3MFJA 4B76A 1HCGA 4A1VA 2QA9E 3TJUA 4K8BA 4B73A 1FZZA 2BQ6B 3EE0B 3BTHE 4KTCA 1LMWB 1GDUA 1H1BA 3F68H 1SGIB 2BZ6H 6CHAB 1RTKA 2OTVA 3SU6A 2TGAA 1J17T 1EAIA 2BYAX 1GJDB 3VGCB 1BJUA 4A5TS 4B2BA 3SNCA 1VGCB 4IGDA 2QF0A 5JBTA 4FUEA 3FZZA 2QXJA 4CRDA 1QIXB 2Z3CA 1MKXK 1AO5A 1LQDB 2HVXA 2M5TA 2ZCHP 1OWJA 2PR3A 2PW8H 1CGHA 1W2KH 2NU0E 1B0FA 1EJNA 1ANEA 1IQEA 1MU6B 2A0QB 3E16B 1GI9B 4THNH 5E0JA 3RP2A 2TGPZ 4LK4A 3HKIB 3KN2A 2ZF0H 2J2UA 3KEEA 5HMAA 2ILNA 3UPEA 1XMNB 1RTLA 3SUFA 1C2DA 3F6UH 4X8TH 1C5QA 1MTVA 3SGQE 1C5YB 3QLPH 1W8BH 1VITF 1YPJH 2QF3A 1XKBC 1XM1A 1TX8A 1ELEE 1V2WT 1EZQA 2GDDA 1V2VT 3SQHE 2P8OB 1H8IH 1AE8H 4K60A 1HJ8A 1L4DA 2BOKA 4A1TA 2BOHB 2A7HA 1O3JA 4CHAB 3KF2A 1VZQH 4I8KA 1AQ7A 3M3VA 3CENA 1DSUA 2TGTA 2UWLA 2VWLA 2PFEA 3RXUA 2ANMH 4Y11E 2RA3A 7LPRA 4BTIB 3F9GA 2B9LA 3V7TA 5IDKA 1ARCA 4OS1A 1W14U 2XRCA 4E7NA 5L2YH 1TE0A 3BG4C 3IG6B 1TGTA 4Y7AA 1C1TA 4I33A 2BX3A 2OQUA 1ZHMA 1C5SA 3GCNA 1ID5H 3TNSA 1YPHC 1BRCE 3RM0H 1KTSB 2BXUH 1NPMA 1UTNA 3IWMA 1GBHA 3E8LA 3SJIA 3KIDU 1T8OA 3RXPA 1OOKB 1WV7H 2EI7A 3AAVA 3DD2H 2THFB 1JOUB 3TGJE 1SGEE 4M7GA 4YESB 2PGBB 1O3KA 2SGPE 5F03A 2XWAA 1OSSA 5K7RA 2QXHA 1IQHA 3LH1A 4BAMB 4K1SA 1LPGB 3GCTF 2VB0A 1O2ZA 4FUBA 3ZYDA 1O30A 1S6FA 1P11E 4A7IB 1GCTC 2HPQH 1EJMA 2BD3A 3SHAH 1ETSH 4K5ZA 2CF8H 3L3TA 2Q6FA 3O8DA 4H6TA 2A5KA 1SB1H 2ZFRH 3EGKH 4Y0ZE 4ESTE 4FU7A 1P2JA 4UE7H 1FN6A 1FAKH 1DITH 1TX7A 2GT8A 3BTTE 2RCEA 4ZH8A 1H9IE 1HB0B 1V2RT 1QL8A 2FXRA 1QA7A 1GHVH 1D3PB 1ELGA 3F9EA 3RXIA 4NCYA 2FYRA 4ZKSU 5E0HA 1BTXA 2BD5A 1C1NA 1ZRBA 4B74A 2CHAC 3LJJA 2C8YB 1J15A 3OSYA 3UQVA 1SL3A 1TNJA 7GCHG 4GSOA 3RMMH 2ZTXA 1FUJA 4JZFH 3P17H 2UUKB 3ATIA 3ZVDA 3K65B 1QRWA 3TITA 1MZDA 1G2MA 1DANH 1GHBG 1FV9A 3P92A 4CRCA 3U1JB 1QB9A 2FI5E 1THRH 1O3GA 4KTSA 2WUBA 2ZHQH 1YPLH 3E90B 3T28A 3T25A 2OCVB 1IQNA 2ZFTA 4PROA 3Q3XA 1JBUH 4ASHA 4VGCC 6GCHG 3RXKA 1Y8TA 1GBLA 2OC1A 2R0KA 4X6OA 2BTCE 2BQ7B 5FX6A 4FUCA 2WUCA 3RXRA 2BY5X 1SGTA 3QGNB 2XC4A 1O2NA 2SGFE 3SBKA 2JH0D 1L1JA 1TONA 5FCKA 1W0ZU 2I6QA 4BXWA 4ISHH 1GBKA 1GHWH 1QNJA 1SQTA 3M5OA 4ZKNU 2BB4A 1HRTH 4UEHH 1RGQA 1GI7B 3MNSA 2XYAA 1KDQA 1S82A 4CREA 5LPEA 3D65E 1QCPA 1SHHB