4A6LA

Beta-tryptase inhibitor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
242
structure length
242
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords TRYPTASE ALPHA/BETA-1
publication title Structure-Based Library Design and the Discovery of a Potent and Selective Mast Cell Beta-Tryptase Inhibitor as an Oral Therapeutic Agent.
pubmed doi rcsb
source organism Homo sapiens
total genus 52
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2011-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a6lA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a6lA01
1NROH 5F8XA 3UUZA 4WMDA 4ZKOU 1SPJA 2J95A 3SJIA 2UUJB 4AYVB 3MNXA 1OX1A 1Y3VA 1BRBE 5FX6A 2ZFFH 3TH4H 5L30H 4X1NU 2FTLE 4GUXA 5DK1A 1H8DH 1C5QA 2VIDA 1O2IA 4UE7H 2HPQH 2ZKSA 4K1SA 1SGPE 2OC7A 3SJOA 2ZGJA 3T5FH 2P94A 5DGJA 1GBHA 2GVFA 1UTKA 3QK1A 4MDSA 1UTLM 2A5IA 1NESE 1V2LT 2QY0B 2OQUA 1TBQH 1TABE 3VB7A 2B9LA 2P16A 1ZPCA 2WV5A 1XVMA 2A2XH 3ZVCA 1OKXA 5JDUB 1K21H 1UVOA 2HRVA 2ANMH 1IQEA 1WBGB 2GD4B 3P92A 1O2NA 3PROA 1FY8E 2G55A 2XCFA 4JMYA 1KXEA 2PSYA 4I8JA 1GJ6A 2F9NA 1MTNB 3RC5A 1OPHB 1J9CH 1O0DH 1H1BA 4GSOA 1C2KA 1OP8A 1C2DA 2F9PA 4WXVA 3GY7A 1GBCA 4X6PA 3MYWA 1MMJN 3ATKA 3SNAA 4YOGA 2BLWA 1ZPBA 1NC6A 1C2LA 3DHKH 3ZZBA 4XFQA 2JETB 2XXLA 1TNKA 1OWHA 8KME2 1ABJH 2C93B 2LPRA 4NWKA 1TIOA 4WWYA 3TIUA 1AB9C 1DE7H 1MU6B 2UWPA 1P57B 1O3HA 1A1RA 4ABJA 2Z7FE 1P05A 2A7JA 3P8FA 4CR9A 5F6MA 3LPRA 3D23A 1AZZA 1GBKA 2FOCA 4X6NA 3SI4H 5ESBA 1GJAB 2SNVA 4ZKRU 2PSXA 1F0TA 2BDAA 1ANEA 1ZTJA 1A0LA 3MU1A 2AGIX 4HFPB 2EI8A 4FU9A 1AD8H 2ZNKH 1BTPA 2XBWA 4BOHA 4IC5A 2XRCA 4F4OC 1EATA 2OINA 1G2MA 2BVSH 1ESTA 1QA7A 4ZAEA 1GL1A 1AUTC 3E3TA 3LONA 1Y59T 5GCHG 3UY9A 1CVWH 1FV9A 2B7DH 5DG6A 5FXLA 2FEQH 1QCPA 2ZTZA 1EPTC 3SU0A 4AX9H 4Q7XA 1EAXA 1VJ9U 3RXVA 4X2YA 1AFEH 2R9PA 1Y3WA 2CHAC 3UQVA 3NCLA 1QL8A 1MCTA 1YPLH 1GBFA 4NCYA 5A8XA 2P95A 2BY5X 3TGIE 2ANYA 2AMQA 2J9NA 2R3YA 3KF2A 1P2QA 4ZHMU 1O5EH 2GZ9A 3ZZ6A 4BTUB 1S6HA 1TMTH 2YOLA 3DFJA 4CBNA 1LVOA 1YCPK 1AN1E 1J17T 1WOFA 1P01A 2O8WA 4WY3A 3W94A 2Y82A 1QQUA 1SGIB 2PTCE 2O8LA 1IQFA 2Y5GA 3OTJE 2OD3B 3BTTE 2J2UA 5ETXA 3OYPA 2IJOB 1C5MD 3QTVH 1SQAA 1DWDH 3QLPH 3RXGA 1W11U 1SBWA 3BV9B 1G30B 1K1LA 2Z3EA 2BD7A 1S5SA 3MU5A 1SGCA 2QXHA 4KGAA 2WINI 5DP7A 4BXSA 3U98H 2OXSA 1SC8U 5GWZA 3MO3A 1YLCA 4KP0A 4KTSA 5EG4A 1GI7B 2FPZA 1BJUA 4UFDH 3BTQE 4B2AA 2BDHA 2ZTXA 1H9LB 5B6OA 1E0FD 3STIA 1MTSA 2STBE 4XOJA 2BDBA 1UJ1A 1W14U 3V3MA 3SV6A 1NU9A 3FANA 3MH7A 1A5HA 2H5DA 1P09A 2R0KA 2GTBA 4O03A 2NU0E 3LH1A 2GKVE 1VGCB 3RU4D 1ELDE 3HK3B 3B9FH 1TFXA 3T2NA 4UFGH 1K2I1 2C3SA 1IQNA 3IWMA 1BUIA 1D9IA 1TQ0B 1AI8H 2ZPRA 3E8LA 2HVXA 1NRNH 1TGSZ 2VWLA 4AFSA 1XUGA 4NZLA 1WYKA 4NG9H 1O2GH 2C8YB 2I6QA 1TPSA 1C1SA 1HIAB 2OC1A 4BNRA 1JIRA 3VXEH 3KEEA 4LZ1H 3I77A 5C5OA 3A7YA 5TCCA 1KXDA 4ISIH 1AWFH 1SGFG 1L2EA 4IS5A 1IQJA 2FX6A 4Y71A 4A92A 1LHCH 3LKWA 4K60A 1NRPH 1AHTH 3S7HB 1TALA 2ZCHP 4CHAC 1DSTA 1E36B 3VEQB 3UWJH 1PYTC 1MCVA 3HGNA 2GCTB 2K1QA 4IW4E 1ZZZA 4A7IB 3BG4C 1V3XA 1DUAA 3MMGA 2P3FH 2TIOA 1WQSA 1THRH 3AASA 2IPHA 3M36A 3BTFE 1O2PA 1HGTH 3EYDA 4I7YH 1HLTH 2SNWA 3E16B 1FZZA 3RXBA 4D76A 3UR6A 4NIXA 1UVUH 3S7KB 1Z6JH 1LVBA 2BVXH 2VINA 5DJ7A 3URDA 5FX5A 4RKJB 4UDWH 4E06H 1AVGH 1Y3YA 2IOTA 1UHBA 1C9PA 2P3TB 2ZI2H 1RXPA 3AVZA 2ZO3H 1QTFA 3AW0A 4MQAA 2FOMB 1QBVH 1K1NA 3LU9B 2HNTE 1GHBF 1JWTA 4D9QA 1UTQA 1LPZB 2Q6GA 2EI7A 1PPCE 2A0QB 3RXCA 1C5VA 1FAXA 3RMMH 1O2RA 1BMLA 1KXFA 3A8CA 5A09A 2J34A 1Y5UT 1C1PA 3RDZA 1PPBH 5EW2H 1HFDA 3ZZCA 1HV7A 3LJOA 5L2YH 3P95A 2PKAA 1S6FA 4I33A 1ELGA 2TBSA 2J92A 1C2IA 3P8NA 3LGUA 4CRBA 1GDUA 1H9HE 1O2VA 2FLBH 1P0SH 1SGRE 2F9VA 3K6ZA 1FI8A 2HOBA 1C2MA 1K1MA 1KDQB 4B71A 1F5LA 1TX6A 2F9OA 3M5NA 3JZ2B 4YM9A 4K8BA 2Z94A 1N1LA 1TPPA 4U32A 1T4VH 1GHAF 1QIXB 2Z6BD 2BQ6B 4DGJA 2HNTF 2QAAA 1Z1IA 1SG8B 1N6XA 4I8HA 1BHXB 4UD9H 1MQ6A 1TMUH 4I8KA 2R0LA 4TY6A 3EA7A 2DE8A 3TNTA 3P8GA 1DDJA 3NPSA 2GV7A 1C5WB 3B8JA 4YLQH 1O2OA 4FU7A 4AFQA 1MKXH 3MO9A 4U2WA 1F7ZA 3V7TA 1LHEH 3LC5A 1ETRH 1A7SA 1RGQA 3Q3YA 2G5NA 4KKDA 1JOUB 1SGFA 2GGVB 2ZU1A 1P04A 4JYUH 1THSH 5LPEA 3HKJB 3EA9A 1HJ8A 2P93A 4UEHH 4YESB 1MUEB 2ZFQH 3MO6A 2ZHDA 1YKTA 1GVLA 3LGWA 4JZIA 3A84A 2QA9E 4NSVA 3RXEA 1HJAB 3HKIB 4Y8XA 1P9SA 1HIAA 2R3UA 1EQ9A 4OS1A 3OY5U 4RKOB 1AB9B 2H9HA 4MVNA 1A46H 1ZHPA 1G9IE 3A83A 1UK2A 1F0RA 3AW1A 3LC3A 3BEFB 1FY4A 1QNJA 1W3CA 4VGCB 1YYY1 1GI2A 5A2MH 1OYTH 2ZFSA 1GHVH 3A8AA 1GJ7B 1HXFH 1U6QA 2H5CA 3RC6A 4B2CA 4JZEH 1KXAA 5C2ZA 4DVAU 1C1NA 2EEKA 3TGJE 1BRAA 1PFXC 1SHYA 1SI5H 1BJVA 2VIOA 1ZRKA 2VIVA 5BRRE 1QBNA 2UWOA 1UCYE 1RFNA 1TOMH 2AYWA 1CBWC 1A5IA 3ELAH 1EKBB 1UVPA 3LH3A 1O3GA 4WH6A 6LPRA 3GCTF 3TK5A 3KGPA 4B75A 3O8CA 1YPHE 1NRSH 3IG6B 1AY6H 2Z9LA 1WTGH 1EPTB 3SU1A 4A1TA 2GZ7A 5C1UA 1HBTH 4FUEA 2D26C 2BDYA 4ZXYH 3P17H 1W0YH 2QIQA 3C1KA 5DP5A 2EA3A 5AVDA 3BTME 4FVBA 1O3PB 4O97A 2FLRH 1OWDA 1ESBA 1TA2A 3UFAA 3SJKA 2P59A 1SGEE 2ZHEH 3RXQA 1GJ9B 4CR5A 2Z3DA 5IDKA 1TAWA 1CA0C 4NIVA 4ZHLU 3JZ1B 4CRGA 3ZV9A 1NZQH 2THFB 2QC2A 1C5RA 1BRUP 1B0EA 4YTAA 2XC5A 1C1QA 1FIZA 2GX4A 3VB5A 5HYOA 4ABHA 2J4IA 1C1OA 1J16A 2GCTC 4MNVA 3VB3A 1SOTA 1O2TA 1QRWA 1RTFB 1AIXH 1EAIA 1W7XH 2G51A 4NA7A 1TGBA 1CHOF 1PPFE 3RXRA 2PGQB 1IQKA 1KDQA 3SHAH 3A85A 3T28A 1HNEE 1F5KU 2F9UA 1P12E 1T8LA 5ESTE 2BX3A 1RD3B 1O2WA 1CGIE 3RXAA 4X6OA 1VITG 2ZC9H 1MZDA 3QTOH 3DD2H 4KELA 1WTHD 1NTPA 1BBRE 3ZVAA 1K22H 3SQHE 3F1SB 1DLEA 2BXUH 1K1JA 1CSOE 1O31A 1GCTC 5LPRA 3LIWA 1ETTH 3TLOA 1KLJH 1H8IH 1O5FH 3SHCH 3F9GA 3NZIA 3SU3A 3SO3A 2W3KA 1S82A 1EJNA 1X7AC 2Z9JA 4CRDA 2BD2A 1NFYA 1E34B 2A1DB 2W7UA 2CXVA 1VITH 1Y3UA 1LHFH 3I78A 4TWYA 2ZDKA 5A0CA 1YPEH 2JH5D 1S0QA 3BSQA 1Z1JA 5C1XA 1UVTH 4X6MA 2ZQ2A 3S0NA 1AVXA 3MU4A 6GCHG 2AFQB 2BDGA 1BZXE 5HM9A 4DY7B 4K2YA 1O2SA 3SGAE 3SGQE 1SB1H 1UO6A 1OWEA 1W13U 4JZDH 5EPNA 1LVYA 1D6WA 2ZCLP 3BEIB 3FFGA 1XUIA 5G4BA 4BAQB 3ZVFA 2ZDMA 1GHZA 5EXNA 1DLKB 3SNDA 3QZRA 1YCPH 1C5SA 4Y11E 1UCYK 3RLWH 1DXWA 3V0XA 3UNRA 2O8TA 5GJ4B 2ZQ1A 1L1GA 3ENSB 3SORA 3P8OA 2QYIA 4CHAB 3TPIZ 1XXDA 3GY5A 5E2OA 5EQSA 5DKMA 1HAYB 2QF0A 4GCHF 3ODDA 2TGAA 1WUNH 3RXPA 1P06A 3BG4B 3F6UH 1ANCA 4OS4A 3S9AA 4DT7B 3CS0A 5FHTA 1XKAC 2V0BA 4AYYB 2G4TA 4YT7H 2PHBA 1BTHH 1BTUA 3RM0H 1TQ7B 4FUCA 2GP9B 1GMCF 1O32A 1PQ7A 2JH6D 1SGDE 2VWOA 1EPTA 3U8RH 1EB2A 5EQRA 3GY3A 1LQDB 8GCHF 1FPHH 4ABBA 4FUDA 1IQHA 1G32B 1P2IA 4FXGH 2ZU5A 1EJAA 3S69A 4JZ1A 1O2JA 2FMJA 1HJAC 5EODA 1HJ9A 1NN6A 4J2YB 3ZZ3A 1C1RA 4JK5A 5E0GA 1MAXA 4E7RG 2VH6A 1W10U 4LZ4B 1W12U 2BZ6H 1YGCH 4K69A 2ZHWH 2DE9A 3GDUA 1FY5A 4A5TS 4VGCC 1GI0A 3QGNB 1ID5H 3RXFA 3GCNA 1YCPM 2RDLA 1W8BH 4B1TA 2CGAA 1NY22 4THNH 1G37A 1LQEA 6GCHF 3E6PH 1P2KA 1GPZA 3R0FA 4IN1A 1MAYA 4AORA 3TJVA 1GI4A 2FM2A 5T3HA 1A4WH 3A87A 2FX4A 7GCHG 1XXFA 4O3TA 2SGEE 5CHAB 1BBRK 1KTSB 1LDTT 3BTKE 1O3NA 4YLUA 4OS7A 3BIVH 1JRTA 1DANH 1P2OA 1DX5M 3EGKH 5DP9A 1GBMA 1S0RA 2UUKB 3HPTB 1O2HA 2VGCC 1FN6A 3R3GB 3SGBE 1QB6A 3RXIA 1DITH 2SGAA 2A5KA 1TPAE 3QX5H 1ELAA 2R2MB 3RXSA 1PYTD 2Z9GA 3GICB 3FZDA 2WV4A 4TPIZ 2ULLA 3F9HA 5FBEA 3DA9B 1O3IA 3SV8A 4IN2A 1AU8A 1BTZA 1ELBA 1T32A 2FODA 2ZCKP 5FBIA 4AFUA 7KMEH 2BMGB 3RM2H 1AMHA 5C5NA 3DT0H 1C2FA 1ZTKA 2O8MA 3LGIA 2FWWA 1Q31A 3DFLA 3O8BA 2PTNA 2XBVA 3M7UA 1DUEA 2A4QA 3LT3A 1Q2WA 3ATLA 3IITA 3UOUA 1HAOH 2H9TH 1OP2A 1QL9A 3OU0A 3UPEA 3GCOA 3PMHB 1O37A 2BD8A 4AOQA 3RU4E 5HM2A 2EC9H 2O9QA 1OS8A 3SQEE 5T6FA 2FZZA 1XKBC 5EU8A 4B73A 1JMOH 4K5ZA 1HB0B 3Q77A 5T6GA 5A0BA 1EP6A 1NRQH 2BOKA 3PLPA 1EOLA 4X0WU 2CV3A 4ZMAH 3GCHC 4CREA 5K7RA 1GHXH 1FLEE 1RJXB 5T6DA 1AVWA 2PFEA 1O2MA 5JBBS 4BANB 5EQQA 3GDVA 3W95A 2XBYA 1D3QB 4DW2U 4CRFA 1V2QT 4X1PU 3RXOA 1CBWB 2XC4A 1AE8H 1O3AA 1DM4B 2A31A 4LXBH 2WYGA 1ELTA 1Q3XA 2H1UA 5GCHF 1IOEA 3KQDA 1TBRH 1P2MA 1Z6EA 1WCZA 2ASUB 3PO1B 2LNCA 1BMNH 1V6DA 1SL3A 3A7WA 5DPAA 1LO6A 1Z8RA 3RP2A 5DP3A 1HYLA 3A8DA 1IQMA 2QV1A 2ZHFH 1QURH 4U01A 4D8NA 4INKA 2ALVA 2ANKH 2OC8A 1G2LA 5F8ZA 3GISB 1Z8GA 2B8OH 3FAOA 1T8NA 2Q1JA 1DY8A 1HAIH 4X8SH 5AF9H 5L6NH 4DIHH 4FUBA 5GXPA 1CU1A 4DOQA 1EZSC 1JXPA 3OSYA 1CA0B 2FOBA 1UTPA 1ZSLA 3A80A 2PR3A 1MBQA 4M7GA 1UK4A 2QCYA 1TRNA 2F3CE 4TY7A 2BD4A 1EX3A 1C5UA 1C5XB 3WY8A 1T4UH 1THPB 2WUCA 1PJPA 3PLKA 1K1OA 3RU4T 2PKSC 1W7GH 3SJ9A 5LGOA 1C5YB 2FOGA 2ZFRH 8LPRA 2W5EA 2G00A 1C5NH 1NPMA 1IAUA 2AGGX 3MU0A 3SOSA 2A4RA 4AB9A 2CJIA 3RXHA 1Y3XA 1NO9H 1O5AB 3SI3H 1CGJE 1SGNE 5LPFA 1NRRH 1AE5A 5GPIB 2QXGA 1QHRB 4WVPE 5LH8A 1HXEH 1FJSA 4I31A 4LOYH 1MKWH 3TK6A 2Y7ZA 3D62A 1NFWA 2Q6FA 3MNCA 3TU7H 1AGJA 1DS2E 2HWLB 3PMBB 2KAIB 1TGCA 3M37A 2TRMA 1GG6C 1ZHMA 3KNXA 1TWXB 5CE1A 3PWBA 1GCTB 5DO4H 3V13A 2VVUA 2Y5HA 1TNHA 5JBAS 1S85A 2GT7A 3L33A 4A1VA 1RRKA 3BN9A 1BIOA 2SGFE 4XBCA 3RXKA 1EUFA 7LPRA 1V2WT 1SFQB 3LJJA 1GVKB 3RLYH 5A0AE 3PWCA 4WJG2 2F91A 1TRYA 3E1XB 4XBBA 3BG8A 1GBLA 3QGJA 1ZYOA 1FPCH 2ZECA 1Z8JB 3GY2A 1L4DA 1V2ST 3MFJA 4UONA 1CHGA 4OS5A 1BTYA 2NU2E 4MPXA 5J4QA 1ZTLA 1BTWA 5CHAC 4MPUA 1B7XB 1P02A 2UWLA 1F2SE 3SV9A 3TNSA 4WMFA 1DICA 2P8OC 3BTDE 3MH6A 1XUJA 2BLOA 4YO9A 1DT2A 3ZZ5A 2G8TA 1O3MA 2CF9H 2VIWA 4E7NA 4DCDA 2ZG0H 1MD8A 1L0ZA 2JKHA 1F5RA 4HTCH 2BY7X 4BAOB 3EE0B 1C9TA 2PUQH 3SUEA 3UOPA 1A2CH 1P2NA 1TE0A 3GY4A 1D3TB 1QJ7B 1XUFA 2ZU4A 1G36A 1GMHG 2BQ7B 2AMDA 1A3BH 2HALA 1QQ4A 4H4FA 3QZQA 1QA0A 2H6MA 1VCWA 4NA8A 2VVCA 3URCA 1V2TT 1YP9A 4X2VA 3SW2B 3T27A 1C5TA 1ARBA 3TJUA 1RIWB 3FP6E 3MI4A 3PM3A 4X8VH 1OWKA 2Z9KA 1SLWB 4NA9H 1BRCE 1JIMA 3LGYA 1P2JA 3M3SA 2ZZUH 5AHGH 2W3IA 1WSSH 1HRTH 5SGAE 2FS9A 3A7XA 1P03A 3AAUA 3RMNH 2VB0A 1MD7A 1OWIA 2FO9A 2G81E 1IQLA 3N7OA 4Y8ZA 3SUDA 4ABDA 1C5PA 1E38B 2C4FH 4F49A 2C8ZB 1FY3A 1V2KT 3GDSA 1C2EA 1ZGVA 1MBMA 4Y79A 4NWLA 5CMXH 3QUMP 4ISOA 3SZNA 2RA0A 2VWMA 5JPMH 1F0SA 1DWCH 3ZZ8A 1GDNA 1FDPA 3MWIU 2ZIQH 4TPYA 1NT1A 2ODYB 1GBBA 4JCNA 1YLDA 4D9RA 1XUHA 1AWHB 2QN5T 1G3DA 1GJ4H 1FONA 1LHGH 2WPKS 2BDCA 2VVVA 1LCYA 2FIRH 3K2UA 1V2VT 1MTVA 2VGCB 1GMDG 5AFYH 3PO1C 1MZAA 1N8OC 2KAIA 4BAHB 1L1NA 2VU8E 2FI3E 1NFUA 2G52A 1XUKA 2XYAA 3VGCC 5TCAA 4CRAA 4MNYA 2OP9A 3A82A 4ABFA 4K3JA 2VIPA 2FOFA 1GDQA 3M5OA 2QXJA 3A81A 1ANDA 1C1VH 2XTTB 1GMHF 1SSXA 5ABWA 1IQGA 1PQAA 1VCPA 4AG1A 4DG4A 1GI3A 1TNLA 2WYJA 3HATH 4AG2A 1C2GA 2M5TA 1BHXF 5PTPA 2FYQA 1O3JA 2OLGA 1O34A 1O3FA 1UVSH 3PMJA 4YT6H 1SQOA 1FIWA 1AUJA 3PB1E 2FOHA 3SU5A 4ASHA 3ATMA 1GI9B 2W26A 3MH5A 1TGTA 2C8WB 4A6LA 2PLXA 2V6NA 1KY9A 2ALPA 1SGQE 1A5GH 1K1IA 4XDEA 1C4Y2 4YOIA 3KHVA 1FQ3A 4FUGA 1SLXB 1GL0E 1YPJH 2OTVA 3LGVA 5DP8A 1SR5C 4X8TH 1RTLA 2AEIH 1TYNA 1QGFA 1SVPA 1GGDB 3VB6A 1DXPA 3RXUA 2GMTB 3CP7A 1OXGA 3GCHB 3TK9A 4ABIA 2ZPQA 1K1PA 3U8TH 1FXYA 2PGBB 4B74A 2OBQA 1LKAA 5FCKA 1NM6A 5DP4A 1D6RA 2ILNA 2ZGHA 3H7OA 1MKXK 1RTKA 1DWBH 2BD5A 4U30A 5F03A 4HZHA 1BCUH 2BD9A 3F9FA 3U1IB 3UNSA 4YZUA 1GWAA 1T8OA 5J4SA 1BOQA 1EAWA 1ZRBA 3LGTA 1A0HB 3P6ZB 3M7QA 3BTGE 1KIGH 4QT8C 1GI5A 4X1QU 1ZJDA 1IHTH 2GCHG 4MG3A 2R2WU 3M35A 2FESH 3F9EA 1C1TA 2XWAA 1QFKH 3VPKA 1UTMA 3S9CA 4MNWA 2ODQA 3SV2H 2ZDAH 2BY8X 1Z71A 1O5GH 2ZGCA 1TBZH 1H9IE 5EPYA 3NKKA 1V2JT 3S9BA 1DFPA 1GBJA 1HDTH 2ZFTA 4Y7BA 2OUAA 1CA8B 1DWEH 5EXMA 2NU4E 1V2MT 1K28D 3TITA 1P10A 2B0FA 1OYQA 4MPVA 1ARCA 1YF4A 2OCVB 1KLIH 2XNIA 4WXIA 3V12A 2Y80A 2XC0A 1C1UH 2ANWA 1DVAH 4KTCA 4Y0ZE 1HAVB 5JYIA 1HAHH 3ZVBA 1QRZA 2BY6X 1S81A 2ZFPH 1PPHE 1GBTA 1GJ5H 1O2QA 2ZA5A 1YPKH 2QF3A 2J38A 1EOJA 2PKSB 1AFQB 3PTNA 3TH2H 1A3EH 2FI4E 1JBUH 3K65B 4I8LA 1LHDH 3QO6A 4FUHA 4BTTB 3QN7A 3MOCA 1QRXA 2G5VA 1CO7E 1VR1H 1C5LH 3UNQA 1BITA 4CRCA 1HPGA 3FP8E 4BTIB 1VITF 1QL7A 1RIWC 1PPGE 9LPRA 3PYHA 2A32A 3KIDU 1YPHC 1HAZB 1INCA 1C1MA 2A45B 3PLBA 1EXFA 1UTOA 1GG6B 3ITIA 1HCGA 1H4WA 1SOZA 1XX9A 2FI5E 1J8AA 1ZMNA 1O39A 3B23B 1W0ZU 4ABGA 3P70B 1O5BB 1ELEE 3TH3H 1EAUA 4GLYA 3I29A 1GBEA 1SMFE 1O2ZA 1GJDB 1T31A 1ZR0A 2VIQA 4FUFA 2IN2A 5L2ZH 1TB6H 1TRMA 3F68H 2GCHF 3VB4A 2ZU3A 3E90B 4B76A 4K8YA 1UTJA 5F8TA 1EASA 6CHAB 2GT8A 5JBCS 2RCEA 3TJNA 3ZZDA 1QJ1B 3ZZ7A 1W2KH 4B2BA 2ZPSA 1LTOA 1V2RT 3O8RA 2A7CA 1G3BA 3KN2A 4ESTE 1ESAA 2C8XB 1AKSB 3SV7A 1TOCB 1O2XA 3SNCA 2Z3CA 3E0PB 1YM0A 4CH8B 2FYRA 1TMBH 4I32A 4ZHAA 3A8BA 1LVMA 2J94A 2VJ1A 3M5MA 2TGDA 2P8OB 3RMLH 1B5GH 3VXFH 1ZSJA 4BAMB 5JB8S 1O33A 2V3HH 2RA3A 1P11E 2EI6A 1S83A 3BTEE 1Z7KA 1ZHRA 1QY6A 1OP0A 1K9OE 1C4U2 3E91A 4MNXA 3GOVB 1MU8B 3U8OH 1GJ8B 3T25A 1CT4E 2B5TB 2D2DA 5C1YA 4OS2A 3ZVEA 2TPIZ 5H4IB 1WV7H 3RXLA 1SGTA 2SFAA 5E0JA 1WQVH 1O35A 1L1JA 2BTCE 3RXJA 1UHBB 4FUIA 4WMEA 1C5OH 1N6YA 4H6SB 2BD3A 3M61U 4TWWA 5C20A 1KXCA 3CS7A 4R0IA 1SLVB 2FTMA 1MTWA 1TGNA 4WH8A 4AGKA 5FPYA 2WPIS 5A8YA 6ESTA 3BTHE 3VFEA 4HGCA 2JH0D 2ZDNA 3KQBA 1TNGA 5JB9S 4SGBE 1NS3A 4IMZA 1L4ZA 3ATIA 5AFZH 1UMAH 1O3LA 1GJBB 3SNBA 1GGDC 3L3TA 2OC0A 1O38A 2PKAB 1HAVA 2SGPE 2GMTC 4X1SU 4OGYA 4DIIH 2BDIA 1T8MA 1V2OT 4INHA 1DPOA 1XMNB 1AZ8A 4ZH8A 1EZQA 3H7TA 1Y5BT 1J14A 2XWBI 1QBOA 4I8GA 7GCHF 3BIUH 2BYAX 5DP6A 3C27B 4JYTA 4Q7ZA 4H6TA 4ZXXH 5E8EH 1ELFA 4ISNA 1LPKB 1TX8A 1CGHA 3MTYA 1EZXC 3OY6U 4GAWA 1AQ7A 3TJOA 2Y5FA 2PWXA 1EP5A 3KL6A 1GHBG 1GHYH 1N8OB 1F92A 2XCNA 4SGAE 4D7GA 1WU1A 3UREA 4E05H 4O9VA 2GV6A 3VGCB 2WUBA 3RC4A 5I46H 2W7SA 4GPGA 2AERH 2Y7XA 2VNTA 1XVOA 2SGQE 4OS6A 1C2HA 2V35A 1RS0A 1E37B 3A7VA 4XSKU 2HPPH 1QJ6B 3UIRA 4FU8A 3NWUA 1V2NT 1GI8B 1KTTB 1BB0B 2AH4X 3PTBA 4ZKSU 1M9UA 3TVJB 2CF8H 3ZVDA 1YC0A 1EJMA 2F9BH 2GDDA 2ZGXH 1D3DB 4YOJA 1P9UA 3LOXA 1AKSA 1YBWA 1Y8TA 3D65E 2P3UB 3FZZA 3D49H 1FUJA 4RN6A 1AFQC 4PROA 1GHAG 1O36A 5GDSH 5HGGA 1GVZA 2HGTH 1GBDA 2NU3E 1TX7A 3OX7U 4OGXA 3SU6A 3NK8A 1O3EA 1ANBA 3G01A 4CBOA 1C1WH 1LPGB 2ZHQH 1FN8A 4MTBA 4H42U 5GIBA 5HMAA 1UK3A 5FCRA 1A61H 1KSNA 4Y6DA 3A86A 4IMQA 2UUFB 3A7TA 3SUFA 2BOHB 2PV9B 5K0HA 3ZV8A 8ESTE 3A89A 3SJ8A 4ZUHA 3GYLB 1PQ5A 3NUMA 1MTNC 4Y0YE 3MNBA 3T62A 4Y8YA 2FXRA 1FY1A 2ZTYA 4FUJA 3BF6H 5TJXA 2UUYA 3Q3XA 4CH2B 1CQQA 3A7ZA 1ZPZA 1ZOMA 1JRSA 4LK4A 3SU2A 3U69H 4NSYA 3M7TA 5BPEA 3RXMA 4Q7YA 3H5CB 2FS8A 2AS9A 3ESTA 3MU8A 2ZP0H 2JETC 6CHAC 1ZJKA 2BM2A 2NWNA 1NFXA 3EQ0H 4NFEA 2GDEH 4X1RU 3TGKE 3NXPA 3UTUH 3SN8A 2STAE 2A5AA 3U9AH 4Y7AA 1O3OA 1HAPH 2A4OA 3ZVGA 1ABIH 2A7HA 1O3BA 2G4UA 2ZEBA 1GBIA 1GI1A 4NIYA 1EB1H 1CT0E 4BXWA 1O2UA 1ZSKA 4BAKB 1BMMH 3GYMA 3RXTA 2ZU2A 3O8DA 1YPMH 1BTXA 1C5ZB 2I6SA 3SU4A 1ORFA 5E2PA 1KYNA 2AMPA 2HLCA 3L6PA 4TYDA 3GY6A 1BMAA 1CE5A 1O3DA 3GCTG 4NZQA 1ZGIA 2WPJS 4NIWA 4X2XA 2BZAA 1MTUA 4JZFH 2FOEA 1SGYE 5FPTA 3HK6B 1TNIA 1J15A 2CMYA 1DOJA 3MH4A 2QXIA 4NGAH 2WPLS 2VH0A 2H9EH 1ETSH 1YPGH 1ZLRA 1FNIA 1GI6A 2V3OH 1O5CB 1BT7A 3M3TA 5C67A 4IBLH 3EDXB 4INLA 5A8ZA 4DJZB 3HGPA 3A88A 1XM1A 1O3KA 2ZF0H 3UWIA 1C2JA 1O3CA 4K1TA 4ZKNU 3ODFA 2XW9A 1HAGE 4DURA 1SFIA 3BEUA 1V2PT 2BHGA 1GCDA 4FVDA 2Z9IA 2ZWLH 2ODPA 4GHTA 4GVUA 1BA8B 5FPSA 1C4V2 5E0HA 2F83A 4UFEH 2AIQA 2XBXA 5JBTA 1CHOG 3DUXH 3U1JB 2Q6DA 1O2KA 1O5DH 1TLDA 4Y76A 1QR3E 1T7CA 1D3PB 1WAYB 4JYVH 4D7FA 1ELVA 1SLUB 2QGRA 3RXDA 4XE4A 1UCYH 2FDAA 4ISLA 4AN7A 1GJCB 3E0NB 2D1JA 1O2LA 3M5LA 1PQ8A 1VZQH 1KLTA 2OQ5A 1Z8IB 2C90B 1KXBA 1MKWK 1IHSH 1G3EA 3UR9A 2TGPZ 3T26A 3Q76A 1Y5AT 4IC6A 4IGDA 1P8VC 2FOAA 2FP7B 3ZZ9A 4X2WA 3PMAB 1MH0A 3FP7E 2Y6TA 2ZDLA 4WF8A 4Z6AH 2SGDE 3QDZB 4RSPA 1HAXB 1GHWH 3AAVA 1QB9A 4A1XA 5HXFA 1VGCC 2TGTA 1ZMJA 4HI3A 3LDXH 2AIPA 1GBAA 2BVRH 2GZ8A 4UFFH 3KCGH 1DY9A 1BQYA 2DUCA 4ABEA 3MHWU 4XBDA 1BDAA 3RMOH 2HNTC 1UTNA 2CHAB 2ESTE 2PUXB 1DSUA 1OOKB 1SQTA 1VCQA 4ABAA 1O2YA 2CN0H 2RG3A 4O3UA 1PPEE 3BTWE 2WPHS 1MQ5A 4Z0KA 2PW8H 4J1YA 5EOKA 2H2ZA 4JK6A 3MNSA 4MPWA 1TA6A 3SBKA 2BLVA 4ZROA 1TONA 1OSSA 2YNBA 3QWCH 1P3EA 1FAKH 5EGMA 2WPMS 1A0JA 3UQOA 1TNJA 3STJA 1D4PB 5IYTA 4AGJA 2D8WA 3GY8A 1FMGA 3FVFB 4GCHG 4GHQA 3KQCA 1HUTH 1EZUC 1SHHB 1OWJA 1TPOA 3EA8A 2BLQA 4K1EA 2ZGBH 4MLFB 3ZYDA 3Q3KA 1NU7B 4ISHH 1P3CA 3K9XB 3EAJA 1QB1A 4X8UH 3KQEA 3RUOA 3CENA 7ESTE 1LKBA 1B0FA 3ZZAA 1ACBE 4NFFA 1GMCG 1BBRH 3SUGA 1PPZA 1LMWB 4AZ2B 1G3CA 4AB8A 3SNEA 2A4GA 2BB4A 2O8UA 2Y81A 5FAHA 4R8TB 9ESTA 2OBOA 8GCHG 3ATWA 1F0UA 3ZYEA 2BQWB 1AO5A 2YNAA 3PV4A 3Q00A 5EW1H 1O30A 2VWNA 2A2QH 1IQIA 2BY9X 3ZZ4A 1GMDF 4KTUA 1ELCA 2BX4A 3K6YA 1VJAU 5I25A 5EXLA 1CT2E 1S84A 5C3NA 3T29A 3M3VA 1V2UT 4Q80A 4Q2KA 4AFZA 1E35B 2AGEX 2BXTH 2ZDVH 4Y10E 2NU1E 1ZMLA
chains in the Genus database with same CATH superfamily
1NROH 5F8XA 3UUZA 4WMDA 4ZKOU 1SPJA 2J95A 3MQKC 3SJIA 2UUJB 4AYVB 3MNXA 1OX1A 1Y3VA 1BRBE 5FX6A 2ZFFH 3TH4H 5L30H 4X1NU 2FTLE 4GUXA 3F3BA 5DK1A 1H8DH 1C5QA 2VIDA 1O2IA 4UE7H 2HPQH 2ZKSA 4K1SA 1SGPE 2OC7A 2KZ4A 3SJOA 2ZGJA 3T5FH 2P94A 5DGJA 1GBHA 2GVFA 1UTKA 3QK1A 4MDSA 1UTLM 2A5IA 1NESE 1V2LT 2QY0B 2OQUA 1TBQH 5DSFA 1TABE 3VB7A 2B9LA 2P16A 1ZPCA 2WV5A 1XVMA 2A2XH 3ZVCA 1OKXA 5JDUB 1K21H 1UVOA 2HRVA 2ANMH 1IQEA 1WBGB 2GD4B 3P92A 1O2NA 3PROA 1FY8E 2G55A 2XCFA 4JMYA 1KXEA 2PSYA 4I8JA 1GJ6A 2F9NA 1MTNB 3RC5A 1OPHB 1J9CH 1O0DH 1H1BA 4GSOA 1C2KA 1OP8A 1C2DA 2F9PA 4WXVA 3GY7A 1GBCA 4X6PA 3MYWA 1MMJN 3ATKA 5F53A 3SNAA 4YOGA 2BLWA 3N99A 1ZPBA 1NC6A 2W6JD 1C2LA 3DHKH 3ZZBA 4XFQA 2JETB 2XXLA 1TNKA 1OWHA 8KME2 1ABJH 2C93B 2LPRA 4NWKA 1TIOA 4WWYA 3TIUA 1AB9C 4F48B 1DE7H 1MU6B 2UWPA 4F55A 1P57B 3F0OA 1O3HA 1A1RA 4ABJA 2Z7FE 1P05A 2A7JA 3P8FA 4CR9A 5F6MA 3LPRA 3D23A 1AZZA 1GBKA 2FOCA 4X6NA 3SI4H 5ESBA 1GJAB 2SNVA 4ZKRU 2PSXA 1F0TA 2BDAA 1ANEA 1ZTJA 1A0LA 2IJD1 3MU1A 2AGIX 4HFPB 2EI8A 4FU9A 1AD8H 2ZNKH 1BTPA 2XBWA 4BOHA 4IC5A 2YMSB 2XRCA 4F4OC 1EATA 2OINA 1G2MA 4M9FA 2BVSH 1ESTA 1QA7A 4ZAEA 1GL1A 1AUTC 3E3TA 3LONA 1Y59T 5GCHG 3UY9A 1CVWH 1FV9A 2B7DH 5CHBA 5DG6A 5FXLA 2FEQH 1QCPA 2ZTZA 1EPTC 3SU0A 4AX9H 4Q7XA 1EAXA 1VJ9U 3RXVA 4X2YA 1AFEH 2R9PA 1Y3WA 2CHAC 3UQVA 3NCLA 1QL8A 1MCTA 1YPLH 1GBFA 4NCYA 5A8XA 2P95A 2BY5X 3TGIE 2ANYA 2AMQA 2J9NA 2R3YA 3OEHD 3KF2A 1P2QA 4ZHMU 1O5EH 2GZ9A 3ZZ6A 4BTUB 1S6HA 1TMTH 2YOLA 3DFJA 4CBNA 1LVOA 1YCPK 1AN1E 1J17T 1WOFA 5EJ1A 1P01A 2O8WA 4WY3A 3W94A 2Y82A 1QQUA 1SGIB 2PTCE 2O8LA 1IQFA 2Y5GA 3OTJE 2OD3B 3BTTE 2J2UA 5ETXA 3OYPA 2IJOB 1C5MD 3QTVH 1SQAA 2K8IA 1DWDH 3QLPH 3RXGA 1W11U 1SBWA 3BV9B 1G30B 1K1LA 2Z3EA 2BD7A 1S5SA 3MU5A 1SGCA 2QXHA 4KGAA 2WINI 5DP7A 4BXSA 3U98H 2OXSA 1SC8U 5GWZA 3MO3A 1YLCA 4KP0A 4KTSA 5EG4A 1GI7B 2FPZA 1BJUA 4UFDH 3BTQE 4B2AA 4ACBA 2BDHA 2ZTXA 3OTPA 1H9LB 5B6OA 1E0FD 3STIA 1MTSA 2STBE 4XOJA 2BDBA 1UJ1A 1W14U 3V3MA 3SV6A 1NU9A 3FANA 3MH7A 1A5HA 2H5DA 1P09A 2R0KA 2J98B 2GTBA 4O03A 2NU0E 3LH1A 2GKVE 1VGCB 3RU4D 1ELDE 3HK3B 3B9FH 3OEED 1TFXA 2YMSD 3T2NA 3DSPA 4UFGH 1K2I1 2C3SA 4Q4LA 1IQNA 3IWMA 1BUIA 1D9IA 1TQ0B 1AI8H 2ZPRA 4XRNA 3E8LA 2HVXA 1NRNH 1TGSZ 2VWLA 4AFSA 1XUGA 4NZLA 1WYKA 4NG9H 1O2GH 2C8YB 2I6QA 1TPSA 1C1SA 1HIAB 2OC1A 4BNRA 1JIRA 2IPQX 3VXEH 3KEEA 4LZ1H 3I77A 5C5OA 3A7YA 5TCCA 1KXDA 4ISIH 1AWFH 1SGFG 1L2EA 4IS5A 1IQJA 2FX6A 4Y71A 4A92A 1LHCH 3LKWA 4K60A 1NRPH 1AHTH 3S7HB 1TALA 2ZCHP 4CHAC 1DSTA 1E36B 3VEQB 3UWJH 1PYTC 1MCVA 3HGNA 2GCTB 2K1QA 4IW4E 1ZZZA 4A7IB 3BG4C 1V3XA 1DUAA 3MMGA 3DSGA 2F43B 2P3FH 2TIOA 1WQSA 1THRH 3AASA 2IPHA 3M36A 3BTFE 1O2PA 1HGTH 3EYDA 4I7YH 1HLTH 2SNWA 3E16B 1FZZA 3RXBA 4D76A 3UR6A 4NIXA 1UVUH 3S7KB 1Z6JH 1LVBA 2BVXH 2VINA 5DJ7A 3URDA 5FX5A 4RKJB 4UDWH 4E06H 1AVGH 1Y3YA 2IOTA 1UHBA 1C9PA 2P3TB 2ZI2H 1RXPA 3AVZA 2ZO3H 1QTFA 3AW0A 4MQAA 2FOMB 1QBVH 1K1NA 3VG8A 3LU9B 2HNTE 1GHBF 1JWTA 4D9QA 1UTQA 1LPZB 2Q6GA 2EI7A 1PPCE 2A0QB 3RXCA 3NRLA 1C5VA 1FAXA 3RMMH 1O2RA 1BMLA 1KXFA 3A8CA 5A09A 2J34A 1Y5UT 1C1PA 3RDZA 3FN8A 1PPBH 5EW2H 1HFDA 3ZZCA 1HV7A 3LJOA 5L2YH 3P95A 2PKAA 1S6FA 4I33A 1ELGA 2TBSA 3SYJA 2J92A 1C2IA 2V3MA 3P8NA 3LGUA 4CRBA 1GDUA 1H9HE 1O2VA 2FLBH 4B6EA 1P0SH 1SGRE 2F9VA 3K6ZA 1FI8A 2HOBA 1C2MA 1K1MA 1KDQB 4B71A 5CDFE 1F5LA 1TX6A 2F9OA 3M5NA 3JZ2B 4YM9A 4K8BA 2Z94A 1N1LA 1TPPA 4U32A 1T4VH 1GHAF 1QIXB 2Z6BD 2BQ6B 4DGJA 2HNTF 2QAAA 1Z1IA 1SG8B 1N6XA 4I8HA 1BHXB 4UD9H 1MQ6A 1TMUH 4I8KA 2R0LA 4TY6A 3EA7A 2DE8A 3TNTA 3P8GA 1DDJA 2KCOA 3NPSA 2GV7A 1C5WB 3B8JA 4YLQH 2J98A 3F2GA 1O2OA 4FU7A 4AFQA 1MKXH 3MO9A 4U2WA 1F7ZA 3V7TA 1LHEH 3LC5A 1ETRH 1A7SA 1RGQA 3Q3YA 2G5NA 4KKDA 1JOUB 1SGFA 2GGVB 2ZU1A 1P04A 4JYUH 1THSH 5LPEA 3HKJB 3EA9A 1HJ8A 2P93A 4UEHH 4YESB 1MUEB 2ZFQH 3MO6A 2ZHDA 1YKTA 1GVLA 3LGWA 4JZIA 3A84A 2QA9E 4NSVA 3RXEA 5T1VA 1HJAB 3HKIB 4Y8XA 1P9SA 1HIAA 2R3UA 1EQ9A 4OS1A 3OY5U 4RKOB 2RFKC 1AB9B 2H9HA 4MVNA 1A46H 2KR7A 1ZHPA 1G9IE 3A83A 1UK2A 1F0RA 3AW1A 3LC3A 3BEFB 1FY4A 1QNJA 1W3CA 3OFND 1YYY1 4VGCB 1GI2A 3KQ5A 4ASUD 1OYTH 2ZFSA 5A2MH 4P00A 1GHVH 3A8AA 1GJ7B 1HXFH 1U6QA 2H5CA 3RC6A 4B2CA 4JZEH 1KXAA 5C2ZA 4DVAU 1C1NA 2EEKA 3TGJE 1BRAA 1PFXC 1SHYA 1SI5H 1BJVA 2VIOA 1ZRKA 2VIVA 5BRRE 1QBNA 2UWOA 1UCYE 2KFWA 1RFNA 1TOMH 2AYWA 1CBWC 1A5IA 3ELAH 1EKBB 1UVPA 3LH3A 1O3GA 4WH6A 6LPRA 3GCTF 3TK5A 3KGPA 4B75A 3O8CA 1YPHE 1NRSH 3IG6B 1AY6H 2Z9LA 1WTGH 1EPTB 1W0KD 3SU1A 4A1TA 2GZ7A 5C1UA 1HBTH 4FUEA 2D26C 2BDYA 4ZXYH 3P17H 1W0YH 2QIQA 3C1KA 5DP5A 2EA3A 5AVDA 3BTME 4FVBA 1O3PB 4O97A 2FLRH 1OWDA 1ESBA 1TA2A 3UFAA 3SJKA 2P59A 1SGEE 2ZHEH 3RXQA 1GJ9B 4CR5A 2Z3DA 5IDKA 1TAWA 1CA0C 4NIVA 4ZHLU 3JZ1B 4CRGA 3ZV9A 1NZQH 2THFB 2QC2A 1C5RA 1BRUP 1B0EA 4YTAA 2WSSD 2XC5A 5EJLA 1C1QA 1FIZA 2GX4A 3VB5A 5HYOA 4ABHA 2J4IA 1C1OA 1J16A 2GCTC 4MNVA 3VB3A 1SOTA 1O2TA 1QRWA 1RTFB 1AIXH 1EAIA 1W7XH 2G51A 4NA7A 1TGBA 1CHOF 1PPFE 3RXRA 2PGQB 1IQKA 1KDQA 3SHAH 3A85A 3T28A 1HNEE 1F5KU 2F9UA 1P12E 1T8LA 5ESTE 2BX3A 1RD3B 1O2WA 1CGIE 3RXAA 5GNDA 4X6OA 1VITG 2ZC9H 1MZDA 2JIZD 3QTOH 3DD2H 3N7EA 4KELA 1WTHD 1NTPA 1BBRE 3ZVAA 1K22H 3SQHE 5C0UA 3F1SB 1DLEA 2BXUH 1K1JA 1CSOE 1O31A 1GCTC 5LPRA 3LIWA 1ETTH 3TLOA 1KLJH 1H8IH 1O5FH 3SHCH 3F9GA 3NZIA 3SU3A 3SO3A 2W3KA 1S82A 1EJNA 1X7AC 2Z9JA 4CRDA 2BD2A 1NFYA 1E34B 2A1DB 2W7UA 2CXVA 1VITH 1Y3UA 1LHFH 3I78A 5C94A 4TWYA 2ZDKA 5A0CA 1YPEH 2JH5D 1S0QA 3BSQA 1Z1JA 5C1XA 1UVTH 4X6MA 2ZQ2A 3S0NA 1AVXA 3MU4A 6GCHG 5C0TA 2AFQB 2BDGA 1BZXE 5HM9A 4DY7B 1BMFD 4K2YA 1O2SA 3SGAE 2GJGA 3SGQE 1SB1H 1UO6A 1OWEA 1W13U 4JZDH 5EPNA 1LVYA 1D6WA 2ZCLP 3BEIB 3FFGA 1XUIA 5G4BA 4BAQB 3ZVFA 2ZDMA 1GHZA 5EXNA 1DLKB 3SNDA 3QZRA 1YCPH 1C5SA 4Y11E 1UCYK 3RLWH 1COWD 1DXWA 3V0XA 3UNRA 2CK3D 2O8TA 2ZQ1A 5GJ4B 1L1GA 3ENSB 3SORA 3P8OA 2QYIA 4CHAB 3TPIZ 1XXDA 3GY5A 5E2OA 5EQSA 5DKMA 1HAYB 2QF0A 4GCHF 3ODDA 3PRBA 2TGAA 1WUNH 3RXPA 1P06A 3BG4B 3F6UH 3PV5A 4FOUC 1ANCA 4OS4A 3S9AA 4DT7B 3CS0A 5FHTA 1XKAC 1S6LA 2V0BA 4AYYB 2G4TA 1VKYA 2PHBA 4YT7H 1BTHH 1BTUA 3RM0H 1TQ7B 4FUCA 2GP9B 1GMCF 1O32A 1PQ7A 2JH6D 1MABB 1SGDE 2VWOA 1EPTA 3U8RH 1EB2A 5EQRA 3GY3A 1LQDB 8GCHF 2W6ID 1FPHH 4ABBA 4FUDA 1IQHA 1G32B 1P2IA 4FXGH 2ZU5A 1EJAA 3S69A 4JZ1A 3GS9A 1KMHB 1O2JA 1HJAC 2FMJA 5EODA 1HJ9A 1NN6A 4J2YB 3ZZ3A 1C1RA 4JK5A 5E0GA 1MAXA 4E7RG 2VH6A 1W10U 4LZ4B 1W12U 2BZ6H 1YGCH 4ZCNA 4K69A 2ZHWH 2DE9A 3GDUA 1FY5A 4A5TS 4VGCC 1GI0A 3QGNB 1ID5H 4P02A 3RXFA 3GCNA 1YCPM 2RDLA 1W8BH 4B1TA 2CGAA 1NY22 4THNH 1G37A 1LQEA 6GCHF 3E6PH 1P2KA 1GPZA 3R0FA 4IN1A 1MAYA 4AORA 3TJVA 1GI4A 2FM2A 5T3HA 1A4WH 5KGOA 3A87A 2FX4A 7GCHG 1XXFA 4O3TA 2SGEE 5CHAB 1BBRK 1KTSB 1LDTT 1OHHD 3BTKE 1O3NA 4YLUA 4OS7A 3BIVH 1JRTA 1DANH 1P2OA 1DX5M 3EGKH 5DP9A 1GBMA 1S0RA 2UUKB 3HPTB 1O2HA 2VGCC 1FN6A 3R3GB 4RT1A 3SGBE 1QB6A 3RXIA 4ACAA 1DITH 2SGAA 2A5KA 1TPAE 3QX5H 4TSFD 1ELAA 2R2MB 3RXSA 1PYTD 2RDEA 2Z9GA 3GICB 3FZDA 2WV4A 4TPIZ 2ULLA 3F9HA 5FBEA 3DA9B 1O3IA 3SV8A 4IN2A 1AU8A 1BTZA 1ELBA 1T32A 2FODA 2ZCKP 5FBIA 4AFUA 7KMEH 2BMGB 3RM2H 1AMHA 5C5NA 5C17A 3DT0H 1C2FA 1ZTKA 2O8MA 3LGIA 2FWWA 1Q31A 3DFLA 3O8BA 2PTNA 2XBVA 3M7UA 1DUEA 2L6OA 2A4QA 3LT3A 1Q2WA 3ATLA 3IITA 3UOUA 1HAOH 2H9TH 1OP2A 1QL9A 4Z1MD 3OU0A 3UPEA 3GCOA 3PMHB 1O37A 2BD8A 4AOQA 3RU4E 3KYGA 2EC9H 5HM2A 4AC9A 2O9QA 1OS8A 3SQEE 5T6FA 2FZZA 1QZ8A 1XKBC 5EU8A 4B73A 1JMOH 4K5ZA 1HB0B 3Q77A 5T6GA 5A0BA 1EP6A 1NRQH 2BOKA 3PLPA 1EOLA 4X0WU 2CV3A 4ZMAH 3GCHC 4CREA 5K7RA 1GHXH 1FLEE 1RJXB 5T6DA 1AVWA 2PFEA 1O2MA 5JBBS 4BANB 5EQQA 2HVYB 3GDVA 3W95A 2XBYA 1D3QB 4DW2U 4CRFA 1V2QT 4X1PU 3RXOA 1CBWB 2XC4A 1AE8H 1O3AA 1DM4B 2A31A 4LXBH 2WYGA 1ELTA 1Q3XA 4Q63A 2H1UA 5GCHF 1IOEA 3KQDA 1E79D 1TBRH 1P2MA 1Z6EA 1WCZA 2ASUB 3PO1B 2LNCA 1BMNH 1V6DA 1SL3A 3A7WA 5DPAA 3UB0A 1LO6A 1Z8RA 3RP2A 5DP3A 1HYLA 3A8DA 1IQMA 1YWUA 2QV1A 2ZHFH 1K0HA 1QURH 4U01A 4D8NA 4INKA 2ALVA 2ANKH 2OC8A 1G2LA 5F8ZA 3GISB 1Z8GA 2B8OH 3FAOA 1T8NA 2Q1JA 1DY8A 1HAIH 4X8SH 5AF9H 5L6NH 4DIHH 4FUBA 5GXPA 1CU1A 4DOQA 1EZSC 1JXPA 3OSYA 1CA0B 2FOBA 1UTPA 3FKSD 1ZSLA 3A80A 2PR3A 1MBQA 4M7GA 1UK4A 2QCYA 1TRNA 2F3CE 4TY7A 2BD4A 1EX3A 1C5UA 1C5XB 3WY8A 1T4UH 1THPB 2WUCA 1PJPA 3PLKA 1K1OA 3RU4T 2PKSC 1W7GH 3SJ9A 5LGOA 1C5YB 2FOGA 2ZFRH 8LPRA 2W5EA 2G00A 1C5NH 1NPMA 1IAUA 2AGGX 3MU0A 3SOSA 5HKKD 2A4RA 4AB9A 2CJIA 3RXHA 1Y3XA 1NO9H 1O5AB 3SI3H 1CGJE 1SGNE 5LPFA 1NRRH 1AE5A 5GPIB 2QXGA 2KX4A 1QHRB 4WVPE 5LH8A 1HXEH 1FJSA 4I31A 3PV2A 1MKWH 4LOYH 3TK6A 2Y7ZA 3D62A 1NFWA 2Q6FA 3MNCA 3TU7H 1AGJA 1DS2E 2HWLB 3PMBB 2KAIB 1TGCA 3M37A 2TRMA 1GG6C 1ZHMA 3KNXA 4I86A 1TWXB 5CE1A 3PWBA 1GCTB 5DO4H 3V13A 2VVUA 2Y5HA 1TNHA 5JBAS 1S85A 2GT7A 3L33A 4A1VA 1YLNA 1RRKA 3BN9A 1BIOA 2SGFE 4XBCA 3RXKA 1EUFA 7LPRA 1V2WT 1SFQB 3LJJA 1GVKB 3RLYH 5A0AE 3PWCA 4WJG2 2F91A 1TRYA 3E1XB 4XBBA 3BG8A 1GBLA 3QGJA 1ZYOA 1FPCH 2ZECA 1Z8JB 3GY2A 1L4DA 1V2ST 3MFJA 4UONA 1CHGA 4OS5A 1BTYA 2NU2E 4MPXA 3EE7A 5J4QA 1ZTLA 1BTWA 5CHAC 4MPUA 1B7XB 1P02A 2UWLA 1F2SE 3SV9A 3TNSA 4WMFA 1DICA 2P8OC 3BTDE 3MH6A 1XUJA 2BLOA 4YO9A 1DT2A 3ZZ5A 2G8TA 1O3MA 2CF9H 2VIWA 4E7NA 4DCDA 2ZG0H 1MD8A 1L0ZA 2JKHA 1F5RA 4HTCH 2BY7X 4DT4A 4BAOB 3EE0B 1C9TA 2PUQH 3SUEA 3UOPA 1A2CH 1P2NA 1TE0A 3GY4A 1D3TB 1QJ7B 1XUFA 2ZU4A 1G36A 2M2AA 1GMHG 2BQ7B 3N7DA 2AMDA 2JDID 1A3BH 2HALA 1QQ4A 4H4FA 3QZQA 1QA0A 2H6MA 1VCWA 4NA8A 2VVCA 4OM9A 3URCA 1V2TT 1YP9A 4X2VA 3SW2B 3T27A 3W1EA 1C5TA 1ARBA 3TJUA 1RIWB 3FP6E 1H8HD 3MI4A 3PM3A 4X8VH 1OWKA 2Z9KA 1SLWB 4NA9H 1BRCE 1JIMA 3LGYA 1P2JA 3M3SA 2ZZUH 5AHGH 2W3IA 3AK5A 1WSSH 3DCLA 1HRTH 5SGAE 2FS9A 3A7XA 1P03A 3AAUA 3RMNH 2VB0A 1MD7A 1OWIA 2FO9A 2G81E 1IQLA 3N7OA 4Y8ZA 3SUDA 4ABDA 1C5PA 1E38B 2C4FH 2KCPA 4F49A 2C8ZB 1FY3A 1V2KT 3GDSA 1C2EA 1ZGVA 3U28C 1MBMA 4Y79A 4NWLA 5CMXH 3QUMP 4ISOA 3SZNA 2RA0A 2VWMA 5JPMH 1F0SA 1DWCH 3ZZ8A 1GDNA 1FDPA 3MWIU 2ZIQH 4TPYA 1NT1A 2ODYB 1GBBA 4JCNA 1YLDA 4D9RA 1XUHA 1AWHB 2QN5T 1G3DA 1GJ4H 1FONA 1LHGH 5HIYA 2WPKS 2BDCA 2VVVA 1LCYA 2FIRH 3K2UA 1V2VT 1MTVA 2VGCB 1GMDG 5AFYH 2AHME 3PO1C 1MZAA 1N8OC 5DN6D 2KAIA 4BAHB 1L1NA 2VU8E 2FI3E 3OAAD 1H8ED 1NFUA 2G52A 1XUKA 2XYAA 3VGCC 5TCAA 4CRAA 4MNYA 2OP9A 3A82A 4ABFA 4K3JA 2VIPA 2FOFA 1GDQA 3M5OA 1SQRA 3KYFA 2QXJA 3A81A 5KEDA 1ANDA 1C1VH 2XTTB 1GMHF 1SSXA 5ABWA 1IQGA 1PQAA 1VCPA 4AG1A 4DG4A 1GI3A 1TNLA 2WYJA 3HATH 4AG2A 1C2GA 2M5TA 1BHXF 5PTPA 2FYQA 1O3JA 2OLGA 1O34A 1O3FA 1UVSH 3PMJA 4YT6H 1SQOA 1FIWA 1AUJA 3PB1E 2FOHA 3SU5A 4ASHA 3ATMA 1GI9B 2W26A 3MH5A 1TGTA 2C8WB 4A6LA 2PLXA 2V6NA 3DSOA 1KY9A 2ALPA 1SGQE 1A5GH 1K1IA 4XDEA 1C4Y2 4YOIA 3KHVA 1FQ3A 4FUGA 1SLXB 1GL0E 1YPJH 2OTVA 3LGVA 2L74A 5DP8A 1SR5C 4X8TH 1RTLA 2AEIH 1TYNA 1QGFA 1SVPA 1GGDB 3VB6A 1DXPA 3RXUA 2GMTB 3CP7A 1OXGA 3GCHB 3TK9A 4ABIA 2ZPQA 2XNDD 1K1PA 3U8TH 1FXYA 2PGBB 4B74A 2OBQA 1LKAA 5FCKA 1NM6A 5DP4A 1D6RA 2ILNA 2ZGHA 3H7OA 1MKXK 1RTKA 3CNRA 1DWBH 2BD5A 4U30A 5F03A 4HZHA 1BCUH 2BD9A 3F9FA 3U1IB 3UNSA 4YZUA 3WWBA 1GWAA 3OE7D 1T8OA 5J4SA 1BOQA 1EAWA 1ZRBA 3LGTA 1A0HB 3P6ZB 3M7QA 3BTGE 1KIGH 4QT8C 1GI5A 4X1QU 1ZJDA 1IHTH 2GCHG 4MG3A 2R2WU 3M35A 2FESH 3F9EA 1C1TA 2XWAA 1QFKH 4FETA 3VPKA 1UTMA 3S9CA 4MNWA 2ODQA 3SV2H 2ZDAH 2BY8X 1Z71A 1O5GH 2ZGCA 1TBZH 1H9IE 5EPYA 3NKKA 1V2JT 3S9BA 1DFPA 1GBJA 1HDTH 2ZFTA 4Y7BA 2OUAA 1CA8B 1DWEH 5EXMA 2NU4E 1V2MT 1K28D 3TITA 1P10A 2B0FA 1OYQA 4MPVA 1ARCA 1YF4A 2OCVB 1KLIH 2XNIA 4WXIA 3V12A 2Y80A 2XC0A 1C1UH 2ANWA 2OK5A 1DVAH 4KTCA 4Y0ZE 1HAVB 5JYIA 1HAHH 3ZVBA 1QRZA 2BY6X 1S81A 2ZFPH 1PPHE 2J5UA 1GBTA 1GJ5H 1O2QA 2ZA5A 1YPKH 2QF3A 2J38A 1EOJA 2PKSB 2VBCA 2JJ2D 2KM0A 1AFQB 3PTNA 3TH2H 1A3EH 2FI4E 1JBUH 3K65B 4I8LA 1LHDH 3QO6A 4FUHA 4BTTB 3QN7A 1FX0B 3MOCA 1QRXA 2G5VA 1CO7E 1VR1H 1C5LH 3UNQA 1BITA 4CRCA 1HPGA 3FP8E 2QF5A 4BTIB 1VITF 1QL7A 1RIWC 1PPGE 2QE7D 3PYHA 9LPRA 2A32A 3KIDU 1YPHC 1HAZB 1INCA 3H09A 1C1MA 2A45B 3PLBA 1EXFA 1UTOA 1GG6B 3ITIA 1HCGA 1H4WA 1SOZA 1XX9A 2FI5E 1J8AA 1ZMNA 1O39A 3B23B 1W0ZU 4ABGA 3P70B 4HG6A 1O5BB 5EJZA 1ELEE 3TH3H 1EAUA 4GLYA 3I29A 1GBEA 1SMFE 4TT3D 1O2ZA 1GJDB 1T31A 1ZR0A 2VIQA 4FUFA 2IN2A 5L2ZH 3PRDA 1TB6H 1TRMA 3F68H 2GCHF 3VB4A 2ZU3A 3E90B 4B76A 4K8YA 1UTJA 5F8TA 1EASA 6CHAB 2GT8A 5JBCS 2RCEA 3TJNA 3ZZDA 1QJ1B 3ZZ7A 1W2KH 4B2BA 2ZPSA 1LTOA 1V2RT 3O8RA 2A7CA 1G3BA 3KN2A 4ESTE 1ESAA 1SKYE 2C8XB 1AKSB 3SV7A 1TOCB 1O2XA 3SNCA 2Z3CA 3E0PB 1YM0A 4CH8B 2FYRA 1TMBH 4I32A 4ZHAA 3A8BA 1LVMA 2J94A 2VJ1A 1NBME 3M5MA 2TGDA 2P8OB 3RMLH 1B5GH 3VXFH 1ZSJA 4BAMB 5JB8S 1O33A 2V3HH 2RA3A 1P11E 2EI6A 1S83A 3BTEE 1Z7KA 1ZHRA 1QY6A 1OP0A 1K9OE 1C4U2 3E91A 4MNXA 3GOVB 1MU8B 3U8OH 1GJ8B 3T25A 1CT4E 2B5TB 2LELA 2D2DA 5C1YA 4OS2A 3ZVEA 2TPIZ 5H4IB 1WV7H 3RXLA 1SGTA 2SFAA 5E0JA 1WQVH 1O35A 1L1JA 2BTCE 3RXJA 1NBMD 1UHBB 4FUIA 4WMEA 1C5OH 1N6YA 4H6SB 4B6FA 2F4LA 2BD3A 3M61U 4TWWA 5C20A 1KXCA 3CS7A 4R0IA 1SLVB 2FTMA 1MTWA 2WPDD 1TGNA 4WH8A 4AGKA 5FPYA 2WPIS 5A8YA 6ESTA 3BTHE 3VFEA 5IK2D 4HGCA 2JH0D 2ZDNA 3KQBA 1TNGA 5JB9S 4SGBE 1NS3A 4IMZA 1L4ZA 3ATIA 5AFZH 1UMAH 1O3LA 1GJBB 3SNBA 1GGDC 3L3TA 2OC0A 1O38A 2PKAB 1HAVA 2EQNA 2JJ1D 2SGPE 2GMTC 4X1SU 4RI0A 4OGYA 4DIIH 2BDIA 1T8MA 1V2OT 4INHA 1DPOA 1XMNB 1AZ8A 4ZH8A 1EZQA 3F2HA 3H7TA 1Y5BT 1J14A 2XWBI 1QBOA 4I8GA 7GCHF 3BIUH 2BYAX 5DP6A 3C27B 4JYTA 4Q7ZA 4H6TA 4ZXXH 5E8EH 1ELFA 4ISNA 1LPKB 1TX8A 3SZEA 1CGHA 3MTYA 1EZXC 3OY6U 4GAWA 1AQ7A 3TJOA 2Y5FA 2PWXA 1EP5A 3KL6A 1GHBG 1GHYH 1N8OB 1F92A 2XCNA 4SGAE 4D7GA 1WU1A 3UREA 4E05H 4O9VA 4XD7D 2GV6A 3VGCB 2WUBA 3RC4A 5I46H 2W7SA 4GPGA 2AERH 2Y7XA 2VNTA 1XVOA 2SGQE 4OS6A 1C2HA 2V35A 1RS0A 1E37B 3A7VA 4XSKU 2HPPH 1QJ6B 3UIRA 4FU8A 5EIYA 3NWUA 1V2NT 3FO8D 1GI8B 1KTTB 1BB0B 2AH4X 3PTBA 4ZKSU 4YXWD 1M9UA 3TVJB 2CF8H 3ZVDA 1YC0A 1EJMA 2F9BH 2GDDA 2ZGXH 3WWFA 1D3DB 4YOJA 1P9UA 3LOXA 1AKSA 1YBWA 1Y8TA 3D65E 2P3UB 3FZZA 1WDIA 2EY4C 3D49H 1FUJA 4RN6A 1AFQC 4PROA 1GHAG 1O36A 5GDSH 5HGGA 1GVZA 2HGTH 1GBDA 2NU3E 1TX7A 3OX7U 4OGXA 3SU6A 2K0QA 3NK8A 1O3EA 3FOAA 1ANBA 3G01A 4CBOA 1C1WH 1LPGB 1YY3A 2PP6A 2ZHQH 1FN8A 4MTBA 4H42U 5GIBA 5HMAA 1UK3A 5FCRA 1A61H 1KSNA 4Y6DA 3A86A 4IMQA 2UUFB 3A7TA 3SUFA 1WXRA 2BOHB 2PV9B 5K0HA 3ZV8A 8ESTE 3A89A 3SJ8A 4ZUHA 3GYLB 1PQ5A 3NUMA 1MTNC 4Y0YE 3MNBA 3T62A 4Y8YA 2FXRA 1FY1A 2ZTYA 4FUJA 3BF6H 5TJXA 2UUYA 3Q3XA 4CH2B 1CQQA 3A7ZA 1ZPZA 1ZOMA 1JRSA 4LK4A 3SU2A 3U69H 4NSYA 3M7TA 5BPEA 3RXMA 4Q7YA 3H5CB 2FS8A 2AS9A 3ESTA 3MU8A 2ZP0H 2JETC 2J97A 6CHAC 1ZJKA 2BM2A 2NWNA 1NFXA 3EQ0H 4NFEA 2GDEH 4X1RU 3TGKE 3NXPA 3UTUH 3SN8A 2STAE 2A5AA 3U9AH 1EFRD 4Y7AA 1O3OA 1HAPH 2A4OA 3ZVGA 1ABIH 2A7HA 1O3BA 2G4UA 2ZEBA 1GBIA 1GI1A 5B6LA 4NIYA 1EB1H 1CT0E 4BXWA 1O2UA 1ZSKA 4BAKB 1BMMH 3GYMA 3RXTA 2LP6A 3ZIAD 2ZU2A 3O8DA 1YPMH 1BTXA 1C5ZB 2I6SA 3SU4A 1ORFA 5E2PA 1KYNA 1UW7A 2AMPA 2YMSC 2HLCA 3L6PA 4TYDA 3GY6A 1BMAA 1CE5A 1O3DA 3GCTG 4NZQA 1ZGIA 2WPJS 4NIWA 4X2XA 2BZAA 1MTUA 4JZFH 2FOEA 1SGYE 5FPTA 3HK6B 1TNIA 1J15A 2CMYA 1DOJA 3MH4A 2QXIA 4NGAH 2WPLS 2VH0A 2H9EH 1ETSH 1YPGH 1ZLRA 2V7QD 1FNIA 1GI6A 2V3OH 1O5CB 1BT7A 3M3TA 1E1QD 5C67A 4IBLH 3EDXB 4INLA 5A8ZA 4DJZB 3HGPA 3A88A 1XM1A 1O3KA 2ZF0H 3UWIA 1C2JA 1O3CA 4K1TA 4ZKNU 2WHXA 3ODFA 2XW9A 1HAGE 4DURA 1SFIA 3BEUA 1V2PT 2BHGA 1GCDA 4FVDA 2Z9IA 2ZWLH 2ODPA 4GHTA 4GVUA 1BA8B 5FPSA 1C4V2 5E0HA 2F83A 4UFEH 2AIQA 2XBXA 5JBTA 1CHOG 3DUXH 3U1JB 2Q6DA 1O2KA 1O5DH 1TLDA 4Y76A 3F2FA 1QR3E 1T7CA 1D3PB 1WAYB 4JYVH 4D7FA 1ELVA 1SLUB 2QGRA 3RXDA 4XE4A 1UCYH 2FDAA 4ISLA 4AN7A 1GJCB 3E0NB 2D1JA 1O2LA 3M5LA 1PQ8A 1VZQH 1KLTA 1Z8IB 2OQ5A 2C90B 1KXBA 1MKWK 1IHSH 1G3EA 3UR9A 3F0PA 2TGPZ 3T26A 3Q76A 1Y5AT 2HLDD 4IC6A 4IGDA 1P8VC 2FOAA 2FP7B 3ZZ9A 4X2WA 3PMAB 1MH0A 3FP7E 2Y6TA 2ZDLA 4WF8A 4Z6AH 2SGDE 3QDZB 4RSPA 1HAXB 1GHWH 3AAVA 1QB9A 4A1XA 5HXFA 1VGCC 2TGTA 1ZMJA 4HI3A 3LDXH 2QF4A 2AIPA 1GBAA 2BVRH 2GZ8A 4UFFH 3KCGH 1DY9A 1BQYA 2DUCA 4ABEA 3MHWU 4XBDA 1BDAA 2WZQA 3RMOH 3UAIC 2HNTC 2XOKD 1UTNA 2CHAB 2ESTE 2PUXB 1DSUA 1OOKB 1SQTA 1VCQA 4ABAA 1O2YA 2CN0H 2RG3A 4O3UA 1PPEE 3BTWE 1E1RD 5FL7D 2WPHS 1MQ5A 4Z0KA 2PW8H 4J1YA 5EOKA 2H2ZA 4JK6A 3MNSA 4MPWA 1TA6A 3SBKA 2BLVA 4ZROA 1TONA 1OSSA 2YNBA 3QWCH 1P3EA 1FAKH 5EGMA 2WPMS 1A0JA 3UQOA 1TNJA 3STJA 1D4PB 5IYTA 4AGJA 2D8WA 3GY8A 1FMGA 3FVFB 4GCHG 4GHQA 3KQCA 1HUTH 1EZUC 1SHHB 1W0JD 1OWJA 1TPOA 3EA8A 2BLQA 4K1EA 2ZGBH 4MLFB 3ZYDA 3Q3KA 1NU7B 4ISHH 1P3CA 3K9XB 3EAJA 1QB1A 4RT0A 4X8UH 3KQEA 3RUOA 3CENA 7ESTE 1LKBA 1B0FA 3ZZAA 1ACBE 4NFFA 1GMCG 1BBRH 3SUGA 1PPZA 1LMWB 2KCAA 4AZ2B 1G3CA 4AB8A 3SNEA 2A4GA 2BB4A 2O8UA 2Y81A 5FAHA 4R8TB 9ESTA 2OBOA 8GCHG 3ATWA 1F0UA 3ZYEA 2BQWB 1AO5A 2YNAA 3PV4A 3Q00A 5EW1H 1O30A 2VWNA 5HIZA 2A2QH 2KCYA 1IQIA 2BY9X 3ZZ4A 1GMDF 4KTUA 1ELCA 2BX4A 3K6YA 1VJAU 5I25A 3WW7A 5EXLA 1CT2E 5KECA 1S84A 5C3NA 3T29A 3M3VA 1V2UT 4Q80A 4Q2KA 2WV9A 4AFZA 1E35B 2AGEX 2BXTH 2ZDVH 4Y10E 2NU1E 1ZMLA
chains in the Genus database with same CATH topology
1NROH 5F8XA 3UUZA 4WMDA 4ZKOU 1SPJA 2J95A 3SJIA 2UUJB 4AYVB 3MNXA 1OX1A 1Y3VA 1BRBE 5FX6A 2ZFFH 3TH4H 5L30H 4X1NU 2FTLE 4GUXA 5DK1A 1H8DH 1C5QA 2VIDA 1O2IA 4UE7H 2HPQH 2ZKSA 4K1SA 1SGPE 2OC7A 3SJOA 2ZGJA 3T5FH 2P94A 5DGJA 1GBHA 2GVFA 1UTKA 3QK1A 4MDSA 1UTLM 2A5IA 1NESE 1V2LT 2QY0B 2OQUA 1TBQH 1TABE 3VB7A 2B9LA 2P16A 1ZPCA 2WV5A 1XVMA 2A2XH 3ZVCA 1OKXA 5JDUB 1K21H 1UVOA 2HRVA 2ANMH 1IQEA 1WBGB 2GD4B 3P92A 1O2NA 3PROA 1FY8E 2G55A 2XCFA 4JMYA 1KXEA 2PSYA 4I8JA 1GJ6A 2F9NA 1MTNB 3RC5A 1OPHB 1J9CH 1O0DH 1H1BA 4GSOA 1C2KA 1OP8A 1C2DA 2F9PA 4WXVA 3GY7A 1GBCA 4X6PA 3MYWA 1MMJN 3ATKA 3SNAA 4YOGA 2BLWA 1ZPBA 1NC6A 1C2LA 3DHKH 3ZZBA 4XFQA 2JETB 2XXLA 1TNKA 1OWHA 8KME2 1ABJH 2C93B 2LPRA 4NWKA 1TIOA 4WWYA 3TIUA 1AB9C 1DE7H 1MU6B 2UWPA 1P57B 1O3HA 1A1RA 4ABJA 2Z7FE 1P05A 2A7JA 3P8FA 4CR9A 5F6MA 3LPRA 3D23A 1AZZA 1GBKA 2FOCA 4X6NA 3SI4H 5ESBA 1GJAB 2SNVA 4ZKRU 2PSXA 1F0TA 2BDAA 1ANEA 1ZTJA 1A0LA 3MU1A 2AGIX 4HFPB 2EI8A 4FU9A 1AD8H 2ZNKH 1BTPA 2XBWA 4BOHA 4IC5A 2XRCA 4F4OC 1EATA 2OINA 1G2MA 2BVSH 1ESTA 1QA7A 4ZAEA 1GL1A 1AUTC 3E3TA 3LONA 1Y59T 5GCHG 3UY9A 1CVWH 1FV9A 2B7DH 5DG6A 5FXLA 2FEQH 1QCPA 2ZTZA 1EPTC 3SU0A 4AX9H 4Q7XA 1EAXA 1VJ9U 3RXVA 4X2YA 1AFEH 2R9PA 1Y3WA 2CHAC 3UQVA 3NCLA 1QL8A 1MCTA 1YPLH 1GBFA 4NCYA 5A8XA 2P95A 2BY5X 3TGIE 2ANYA 2AMQA 2J9NA 2R3YA 3KF2A 1P2QA 4ZHMU 1O5EH 2GZ9A 3ZZ6A 4BTUB 1S6HA 1TMTH 2YOLA 3DFJA 4CBNA 1LVOA 1YCPK 1AN1E 1J17T 1WOFA 1P01A 2O8WA 4WY3A 3W94A 2Y82A 1QQUA 1SGIB 2PTCE 2O8LA 1IQFA 2Y5GA 3OTJE 2OD3B 3BTTE 2J2UA 5ETXA 3OYPA 2IJOB 1C5MD 3QTVH 1SQAA 1DWDH 3QLPH 3RXGA 1W11U 1SBWA 3BV9B 1G30B 1K1LA 2Z3EA 2BD7A 1S5SA 3MU5A 1SGCA 2QXHA 4KGAA 2WINI 5DP7A 4BXSA 3U98H 2OXSA 1SC8U 5GWZA 3MO3A 1YLCA 4KP0A 4KTSA 5EG4A 1GI7B 2FPZA 1BJUA 4UFDH 3BTQE 4B2AA 2BDHA 2ZTXA 1H9LB 5B6OA 1E0FD 3STIA 1MTSA 2STBE 4XOJA 2BDBA 1UJ1A 1W14U 3V3MA 3SV6A 1NU9A 3FANA 3MH7A 1A5HA 2H5DA 1P09A 2R0KA 2GTBA 4O03A 2NU0E 3LH1A 2GKVE 1VGCB 3RU4D 1ELDE 3HK3B 3B9FH 1TFXA 3T2NA 4UFGH 1K2I1 2C3SA 1IQNA 3IWMA 1BUIA 1D9IA 1TQ0B 1AI8H 2ZPRA 3E8LA 2HVXA 1NRNH 1TGSZ 2VWLA 4AFSA 1XUGA 4NZLA 1WYKA 4NG9H 1O2GH 2C8YB 2I6QA 1TPSA 1C1SA 1HIAB 2OC1A 4BNRA 1JIRA 3VXEH 3KEEA 4LZ1H 3I77A 5C5OA 3A7YA 5TCCA 1KXDA 4ISIH 1AWFH 1SGFG 1L2EA 4IS5A 1IQJA 2FX6A 4Y71A 4A92A 1LHCH 3LKWA 4K60A 1NRPH 1AHTH 3S7HB 1TALA 2ZCHP 4CHAC 1DSTA 1E36B 3VEQB 3UWJH 1PYTC 1MCVA 3HGNA 2GCTB 2K1QA 4IW4E 1ZZZA 4A7IB 3BG4C 1V3XA 1DUAA 3MMGA 2P3FH 2TIOA 1WQSA 1THRH 3AASA 2IPHA 3M36A 3BTFE 1O2PA 1HGTH 3EYDA 4I7YH 1HLTH 2SNWA 3E16B 1FZZA 3RXBA 4D76A 3UR6A 4NIXA 1UVUH 3S7KB 1Z6JH 1LVBA 2BVXH 2VINA 5DJ7A 3URDA 5FX5A 4RKJB 4UDWH 4E06H 1AVGH 1Y3YA 2IOTA 1UHBA 1C9PA 2P3TB 2ZI2H 1RXPA 3AVZA 2ZO3H 1QTFA 3AW0A 4MQAA 2FOMB 1QBVH 1K1NA 3LU9B 2HNTE 1GHBF 1JWTA 4D9QA 1UTQA 1LPZB 2Q6GA 2EI7A 1PPCE 2A0QB 3RXCA 1C5VA 1FAXA 3RMMH 1O2RA 1BMLA 1KXFA 3A8CA 5A09A 2J34A 1Y5UT 1C1PA 3RDZA 1PPBH 5EW2H 1HFDA 3ZZCA 1HV7A 3LJOA 5L2YH 3P95A 2PKAA 1S6FA 4I33A 1ELGA 2TBSA 2J92A 1C2IA 3P8NA 3LGUA 4CRBA 1GDUA 1H9HE 1O2VA 2FLBH 1P0SH 1SGRE 2F9VA 3K6ZA 1FI8A 2HOBA 1C2MA 1K1MA 1KDQB 4B71A 1F5LA 1TX6A 2F9OA 3M5NA 3JZ2B 4YM9A 4K8BA 2Z94A 1N1LA 1TPPA 4U32A 1T4VH 1GHAF 1QIXB 2Z6BD 2BQ6B 4DGJA 2HNTF 2QAAA 1Z1IA 1SG8B 1N6XA 4I8HA 1BHXB 4UD9H 1MQ6A 1TMUH 4I8KA 2R0LA 4TY6A 3EA7A 2DE8A 3TNTA 3P8GA 1DDJA 3NPSA 2GV7A 1C5WB 3B8JA 4YLQH 1O2OA 4FU7A 4AFQA 1MKXH 3MO9A 4U2WA 1F7ZA 3V7TA 1LHEH 3LC5A 1ETRH 1A7SA 1RGQA 3Q3YA 2G5NA 4KKDA 1JOUB 1SGFA 2GGVB 2ZU1A 1P04A 4JYUH 1THSH 5LPEA 3HKJB 3EA9A 1HJ8A 2P93A 4UEHH 4YESB 1MUEB 2ZFQH 3MO6A 2ZHDA 1YKTA 1GVLA 3LGWA 4JZIA 3A84A 2QA9E 4NSVA 3RXEA 1HJAB 3HKIB 4Y8XA 1P9SA 1HIAA 2R3UA 1EQ9A 4OS1A 3OY5U 4RKOB 1AB9B 2H9HA 4MVNA 1A46H 1ZHPA 1G9IE 3A83A 1UK2A 1F0RA 3AW1A 3LC3A 3BEFB 1FY4A 1QNJA 1W3CA 4VGCB 1YYY1 1GI2A 5A2MH 1OYTH 2ZFSA 1GHVH 3A8AA 1GJ7B 1HXFH 1U6QA 2H5CA 3RC6A 4B2CA 4JZEH 1KXAA 5C2ZA 4DVAU 1C1NA 2EEKA 3TGJE 1BRAA 1PFXC 1SHYA 1SI5H 1BJVA 2VIOA 1ZRKA 2VIVA 5BRRE 1QBNA 2UWOA 1UCYE 1RFNA 1TOMH 2AYWA 1CBWC 1A5IA 3ELAH 1EKBB 1UVPA 3LH3A 1O3GA 4WH6A 6LPRA 3GCTF 3TK5A 3KGPA 4B75A 3O8CA 1YPHE 1NRSH 3IG6B 1AY6H 2Z9LA 1WTGH 1EPTB 3SU1A 4A1TA 2GZ7A 5C1UA 1HBTH 4FUEA 2D26C 2BDYA 4ZXYH 3P17H 1W0YH 2QIQA 3C1KA 5DP5A 2EA3A 5AVDA 3BTME 4FVBA 1O3PB 4O97A 2FLRH 1OWDA 1ESBA 1TA2A 3UFAA 3SJKA 2P59A 1SGEE 2ZHEH 3RXQA 1GJ9B 4CR5A 2Z3DA 5IDKA 1TAWA 1CA0C 4NIVA 4ZHLU 3JZ1B 4CRGA 3ZV9A 1NZQH 2THFB 2QC2A 1C5RA 1BRUP 1B0EA 4YTAA 2XC5A 1C1QA 1FIZA 2GX4A 3VB5A 5HYOA 4ABHA 2J4IA 1C1OA 1J16A 2GCTC 4MNVA 3VB3A 1SOTA 1O2TA 1QRWA 1RTFB 1AIXH 1EAIA 1W7XH 2G51A 4NA7A 1TGBA 1CHOF 1PPFE 3RXRA 2PGQB 1IQKA 1KDQA 3SHAH 3A85A 3T28A 1HNEE 1F5KU 2F9UA 1P12E 1T8LA 5ESTE 2BX3A 1RD3B 1O2WA 1CGIE 3RXAA 4X6OA 1VITG 2ZC9H 1MZDA 3QTOH 3DD2H 4KELA 1WTHD 1NTPA 1BBRE 3ZVAA 1K22H 3SQHE 3F1SB 1DLEA 2BXUH 1K1JA 1CSOE 1O31A 1GCTC 5LPRA 3LIWA 1ETTH 3TLOA 1KLJH 1H8IH 1O5FH 3SHCH 3F9GA 3NZIA 3SU3A 3SO3A 2W3KA 1S82A 1EJNA 1X7AC 2Z9JA 4CRDA 2BD2A 1NFYA 1E34B 2A1DB 2W7UA 2CXVA 1VITH 1Y3UA 1LHFH 3I78A 4TWYA 2ZDKA 5A0CA 1YPEH 2JH5D 1S0QA 3BSQA 1Z1JA 5C1XA 1UVTH 4X6MA 2ZQ2A 3S0NA 1AVXA 3MU4A 6GCHG 2AFQB 2BDGA 1BZXE 5HM9A 4DY7B 4K2YA 1O2SA 3SGAE 3SGQE 1SB1H 1UO6A 1OWEA 1W13U 4JZDH 5EPNA 1LVYA 1D6WA 2ZCLP 3BEIB 3FFGA 1XUIA 5G4BA 4BAQB 3ZVFA 2ZDMA 1GHZA 5EXNA 1DLKB 3SNDA 3QZRA 1YCPH 1C5SA 4Y11E 1UCYK 3RLWH 1DXWA 3V0XA 3UNRA 2O8TA 5GJ4B 2ZQ1A 1L1GA 3ENSB 3SORA 3P8OA 2QYIA 4CHAB 3TPIZ 1XXDA 3GY5A 5E2OA 5EQSA 5DKMA 1HAYB 2QF0A 4GCHF 3ODDA 2TGAA 1WUNH 3RXPA 1P06A 3BG4B 3F6UH 1ANCA 4OS4A 3S9AA 4DT7B 3CS0A 5FHTA 1XKAC 2V0BA 4AYYB 2G4TA 4YT7H 2PHBA 1BTHH 1BTUA 3RM0H 1TQ7B 4FUCA 2GP9B 1GMCF 1O32A 1PQ7A 2JH6D 1SGDE 2VWOA 1EPTA 3U8RH 1EB2A 5EQRA 3GY3A 1LQDB 8GCHF 1FPHH 4ABBA 4FUDA 1IQHA 1G32B 1P2IA 4FXGH 2ZU5A 1EJAA 3S69A 4JZ1A 1O2JA 2FMJA 1HJAC 5EODA 1HJ9A 1NN6A 4J2YB 3ZZ3A 1C1RA 4JK5A 5E0GA 1MAXA 4E7RG 2VH6A 1W10U 4LZ4B 1W12U 2BZ6H 1YGCH 4K69A 2ZHWH 2DE9A 3GDUA 1FY5A 4A5TS 4VGCC 1GI0A 3QGNB 1ID5H 3RXFA 3GCNA 1YCPM 2RDLA 1W8BH 4B1TA 2CGAA 1NY22 4THNH 1G37A 1LQEA 6GCHF 3E6PH 1P2KA 1GPZA 3R0FA 4IN1A 1MAYA 4AORA 3TJVA 1GI4A 2FM2A 5T3HA 1A4WH 3A87A 2FX4A 7GCHG 1XXFA 4O3TA 2SGEE 5CHAB 1BBRK 1KTSB 1LDTT 3BTKE 1O3NA 4YLUA 4OS7A 3BIVH 1JRTA 1DANH 1P2OA 1DX5M 3EGKH 5DP9A 1GBMA 1S0RA 2UUKB 3HPTB 1O2HA 2VGCC 1FN6A 3R3GB 3SGBE 1QB6A 3RXIA 1DITH 2SGAA 2A5KA 1TPAE 3QX5H 1ELAA 2R2MB 3RXSA 1PYTD 2Z9GA 3GICB 3FZDA 2WV4A 4TPIZ 2ULLA 3F9HA 5FBEA 3DA9B 1O3IA 3SV8A 4IN2A 1AU8A 1BTZA 1ELBA 1T32A 2FODA 2ZCKP 5FBIA 4AFUA 7KMEH 2BMGB 3RM2H 1AMHA 5C5NA 3DT0H 1C2FA 1ZTKA 2O8MA 3LGIA 2FWWA 1Q31A 3DFLA 3O8BA 2PTNA 2XBVA 3M7UA 1DUEA 2A4QA 3LT3A 1Q2WA 3ATLA 3IITA 3UOUA 1HAOH 2H9TH 1OP2A 1QL9A 3OU0A 3UPEA 3GCOA 3PMHB 1O37A 2BD8A 4AOQA 3RU4E 5HM2A 2EC9H 2O9QA 1OS8A 3SQEE 5T6FA 2FZZA 1XKBC 5EU8A 4B73A 1JMOH 4K5ZA 1HB0B 3Q77A 5T6GA 5A0BA 1EP6A 1NRQH 2BOKA 3PLPA 1EOLA 4X0WU 2CV3A 4ZMAH 3GCHC 4CREA 5K7RA 1GHXH 1FLEE 1RJXB 5T6DA 1AVWA 2PFEA 1O2MA 5JBBS 4BANB 5EQQA 3GDVA 3W95A 2XBYA 1D3QB 4DW2U 4CRFA 1V2QT 4X1PU 3RXOA 1CBWB 2XC4A 1AE8H 1O3AA 1DM4B 2A31A 4LXBH 2WYGA 1ELTA 1Q3XA 2H1UA 5GCHF 1IOEA 3KQDA 1TBRH 1P2MA 1Z6EA 1WCZA 2ASUB 3PO1B 2LNCA 1BMNH 1V6DA 1SL3A 3A7WA 5DPAA 1LO6A 1Z8RA 3RP2A 5DP3A 1HYLA 3A8DA 1IQMA 2QV1A 2ZHFH 1QURH 4U01A 4D8NA 4INKA 2ALVA 2ANKH 2OC8A 1G2LA 5F8ZA 3GISB 1Z8GA 2B8OH 3FAOA 1T8NA 2Q1JA 1DY8A 1HAIH 4X8SH 5AF9H 5L6NH 4DIHH 4FUBA 5GXPA 1CU1A 4DOQA 1EZSC 1JXPA 3OSYA 1CA0B 2FOBA 1UTPA 1ZSLA 3A80A 2PR3A 1MBQA 4M7GA 1UK4A 2QCYA 1TRNA 2F3CE 4TY7A 2BD4A 1EX3A 1C5UA 1C5XB 3WY8A 1T4UH 1THPB 2WUCA 1PJPA 3PLKA 1K1OA 3RU4T 2PKSC 1W7GH 3SJ9A 5LGOA 1C5YB 2FOGA 2ZFRH 8LPRA 2W5EA 2G00A 1C5NH 1NPMA 1IAUA 2AGGX 3MU0A 3SOSA 2A4RA 4AB9A 2CJIA 3RXHA 1Y3XA 1NO9H 1O5AB 3SI3H 1CGJE 1SGNE 5LPFA 1NRRH 1AE5A 5GPIB 2QXGA 1QHRB 4WVPE 5LH8A 1HXEH 1FJSA 4I31A 4LOYH 1MKWH 3TK6A 2Y7ZA 3D62A 1NFWA 2Q6FA 3MNCA 3TU7H 1AGJA