4A6LA

Beta-tryptase inhibitor
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
242
structure length
242
Chain Sequence
b'IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTASE ALPHA/BETA-1
publication title Structure-Based Library Design and the Discovery of a Potent and Selective Mast Cell Beta-Tryptase Inhibitor as an Oral Therapeutic Agent.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 52
structure length 242
sequence length 242
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2011-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a6lA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4a6lA01
2PFEA 3LGIA 1FXYA 2BY5X 3SV2H 2OD3B 3SU3A 1TGCA 2FOBA 5IDKA 1F0RA 5A8ZA 1PQ5A 1C5MD 1O3AA 1D3QB 1P01A 2XCNA 2Z7FE 1NC6A 2J38A 1ARCA 3MYWA 2P8OC 2GTBA 1FIWA 2SFAA 2ZC9H 3GCOA 1N1LA 2AMDA 4ZXYH 1C1RA 1YCPK 3LIWA 2GCHF 1KYNA 5E2OA 1A46H 5HXFA 2OQ5A 3OYPA 1DX5M 4H4FA 2B5TB 3HKIB 3D65E 4B2BA 1GHBF 1TMTH 1CT4E 3UOPA 2JETB 3E91A 4B74A 1JOUB 2IN2A 1LKAA 1GHXH 1FDPA 3STIA 4AFQA 1THRH 2QC2A 1QGFA 3BTEE 3G01A 4XOJA 2BTCE 1EPTC 1ELAA 1P2KA 4NIXA 1GBKA 3H5CB 4WWYA 3RXTA 1ANDA 2W5EA 5LPFA 1ANEA 2Y5HA 3OU0A 1LVOA 1TPAE 1C4U2 2FEQH 2BDGA 4A5TS 1B0EA 1O2HA 2P93A 4LOYH 1U6QA 2VVUA 1BBRH 4UFFH 4FUDA 1V2OT 1LHEH 3OX7U 3VB3A 1ZZZA 4GUXA 2CF9H 3GCTG 1P2IA 1WU1A 1GMCG 1DOJA 2TIOA 2P95A 1BUIA 4DCDA 4K5ZA 1A5HA 2WPLS 1TE0A 2NU1E 2JKHA 1IHTH 3GICB 1KIGH 1L4DA 4MNWA 1GBJA 3HPTB 3HGNA 2Z9IA 1AFQC 3TITA 1MKWK 2FYQA 2AS9A 4WMDA 5DKMA 3T26A 1QB1A 2QAAA 1AN1E 1EAIA 4CRDA 1C2LA 4YLUA 4Q7ZA 1RGQA 1D4PB 4MVNA 1F0TA 3BIUH 3HATH 4KKDA 2TGDA 1BTWA 4A6LA 2GMTC 4B76A 1O5FH 1TPOA 3PTNA 2H6MA 1ANBA 1FZZA 3RXSA 4F49A 1GI3A 1T8LA 4BAOB 4OS4A 1BTPA 1L4ZA 1N6XA 3A82A 1OS8A 1VZQH 3SBKA 3VB5A 1GBEA 2GZ8A 2PW8H 3SUGA 3S7HB 4ISNA 4JYVH 2FI4E 1OP8A 1EP5A 3UWJH 1O2XA 2HPPH 3UUZA 3LT3A 4DGJA 3BV9B 1SQTA 3KEEA 3MNCA 4O03A 1DLKB 4RSPA 1UTJA 2C8XB 2Z94A 1MQ5A 3BG4B 4I32A 2LNCA 2FZZA 1NU9A 3RXDA 1TX6A 2W3KA 2SNVA 3EA7A 1TBZH 1IQHA 3GOVB 9ESTA 3GCHC 3QN7A 1B0FA 3RXVA 1JMOH 4E7NA 5DPAA 1GI9B 2RCEA 2VIOA 1EATA 1C5ZB 3FP8E 1GBBA 1EXFA 1O3KA 2JH0D 1UTKA 2EC9H 3KNXA 1RFNA 3GYMA 1ESBA 3E3TA 1YPGH 3RXLA 1GBIA 4DVAU 3L3TA 1EUFA 5EOKA 1GJ8B 1TGSZ 4Z6AH 1FQ3A 2ZHQH 2BVRH 2IPHA 1TX7A 1CHOG 1V2WT 2UUYA 5JBCS 1ZLRA 1SLVB 5SGAE 1P3EA 1VCWA 4K2YA 1EAUA 1GCTC 1O3BA 1A5IA 3LU9B 1T8OA 2GMTB 4OS7A 4FUGA 3HGPA 1C9PA 2ZPSA 4D9QA 1C1WH 3RXRA 1P57B 1AU8A 3F9GA 1G30B 4X6MA 3GY6A 2BOKA 1EAXA 2CJIA 5F8XA 1YPHC 4R8TB 1H1BA 1UK3A 3H7OA 1SGNE 1F5RA 1V6DA 3A88A 2I6SA 5L6NH 1LPZB 4X6OA 1RD3B 2OC0A 3BTKE 2ZQ1A 1ZGIA 1VITH 1L1GA 5GXPA 1C1MA 2J92A 1E38B 1C1NA 3BF6H 3S0NA 3ZZ9A 5ABWA 3GCHB 3M7TA 4YZUA 2A2XH 2QCYA 2FDAA 3A87A 2EA3A 2NU3E 2QXJA 3JZ2B 3GY5A 4ABGA 1ETRH 3P17H 3SV8A 1CGHA 1MBMA 2FO9A 3UQVA 5DP3A 3QZQA 2R0LA 2TGPZ 4AG1A 4FUHA 3SJ8A 1OWKA 1GBAA 1F5KU 1K1IA 2ZF0H 4IW4E 4K1SA 2SGFE 2WPJS 4AX9H 4AYVB 5DO4H 3O8BA 2QY0B 4J2YB 4B73A 2GD4B 4D7GA 2FWWA 2R0KA 3PO1B 1HYLA 1HGTH 1FJSA 2FIRH 2ZDVH 1P9UA 1H8IH 1PQ8A 4AG2A 4X6NA 6CHAC 2B8OH 3KN2A 1L1JA 4NZLA 3SW2B 1YBWA 3B23B 3GY2A 2QXGA 1Z8GA 2YNBA 5AFYH 1P2OA 1F7ZA 3EDXB 3GDUA 3SHAH 2ZHEH 2ZTZA 4MLFB 3SNBA 2Y81A 3LC5A 2Q6GA 1ZMLA 2AGGX 3RC5A 7LPRA 9LPRA 1SLWB 2BLQA 1G2MA 1GDNA 3VB7A 3QZRA 3FZDA 1PPGE 1SB1H 3ODFA 1RJXB 2HNTF 1DWDH 3ZZBA 2ZP0H 4H42U 1Y8TA 1P05A 2BDBA 1PQAA 1ZPZA 1WYKA 1NFUA 5ESBA 1OP2A 2J95A 1S83A 4GSOA 4IN1A 3KGPA 1Z7KA 1W12U 1EAWA 1OSSA 1MZDA 1FY3A 1C1PA 4CRCA 1JBUH 3M5LA 1OWHA 2JH6D 4NA7A 1WTGH 3SU0A 3GCNA 1DICA 3TH4H 2Z3DA 2VH6A 4CBOA 3RXMA 1V2RT 3O8RA 2P16A 2BD9A 3RXIA 3UY9A 4FU9A 2F9VA 2VVVA 1NY22 4CRBA 1ELDE 2Q6DA 2WYJA 4F4OC 1ZR0A 3LJOA 5G4BA 2BDYA 3RXUA 1ZGVA 2ZU1A 1P02A 1SC8U 4X2WA 2R3UA 3UNSA 3LONA 4IC5A 5I25A 2Z9GA 3EGKH 1IQGA 2BXUH 2BYAX 2WINI 1TPSA 1AZ8A 2A4RA 2ZFRH 2C93B 1BQYA 1YPEH 3MHWU 6CHAB 4NCYA 1EOLA 3MI4A 3M35A 4O9VA 3A83A 3TIUA 2A4OA 1A0HB 1UVUH 2PSYA 5EXNA 3U98H 1TX8A 3GDVA 5DP7A 3ZYDA 4ABEA 2A1DB 3A7TA 1SVPA 1FAKH 2SGEE 1TPPA 4XBCA 4AORA 2TGTA 3SJ9A 2XCFA 4MDSA 1EB1H 1BJUA 4JZEH 1BMAA 1P10A 1FAXA 1UCYE 3KQBA 1O2QA 2ZO3H 2BY9X 4I8KA 2BY6X 1V2NT 1Z8IB 1O2UA 1VGCC 4UONA 3SN8A 1O3NA 3RXJA 5F03A 4DT7B 1NZQH 4MNVA 2PKAB 8ESTE 3Q3KA 5E0HA 4ABIA 3MNSA 2FP7B 2GV6A 1O5AB 1WUNH 3RU4E 4ISOA 4VGCB 1O2PA 3ZZ6A 1FPHH 4NZQA 3RU4D 1CU1A 1G32B 2RA3A 1EKBB 1AMHA 1KLTA 3LJJA 4D8NA 5F8ZA 1RS0A 1LVBA 2OUAA 1O3FA 1A4WH 1QL9A 5K7RA 4IMZA 1GMHG 5A0AE 2HALA 2A7CA 1HNEE 2F9BH 3URDA 4X2VA 2ZNKH 3ZVGA 1O3LA 3RU4T 4AOQA 1O32A 2WV4A 4JCNA 3F9FA 3PV4A 1C2DA 1JIRA 3GYLB 2Z3EA 2QF0A 3SU1A 2ZDMA 3T62A 4XBBA 1BZXE 3SQHE 2HNTC 1CA8B 1TLDA 1ZHPA 1AZZA 1BMLA 1K1PA 1SOTA 2ODYB 4K69A 2BLVA 4X8VH 1GBMA 1O2ZA 1UK2A 2PUXB 3DFJA 1GJBB 2A5AA 1MZAA 5L2ZH 3MU5A 1O5BB 1O3CA 1V2QT 2ZU4A 1RTLA 4DJZB 1AUJA 2PKSC 4BANB 5AFZH 1MTNB 5JBBS 2A2QH 2ZGJA 1TNHA 2XC4A 1SFQB 1VITF 1S82A 5EPYA 1EJAA 4OS6A 4NWLA 5E0GA 1EOJA 1YPMH 2UUKB 2BD4A 3IG6B 1N6YA 3QLPH 3RXFA 2C8WB 3S69A 5GCHF 4I33A 1CGIE 3QTVH 2V3OH 5E0JA 1WQSA 2A31A 1GGDB 1AQ7A 1BRUP 1A7SA 1G3CA 3QTOH 4TPIZ 2FX4A 1UCYH 1O30A 3QGNB 3PYHA 3UR9A 1HAVB 1UTMA 3V12A 1GJ4H 4LXBH 2OP9A 1C2MA 3MO6A 1P04A 1QB9A 3M7UA 2PKAA 2AMPA 1LPKB 4H6TA 1XXDA 1O5EH 1SGIB 1OPHB 2QF3A 2ZGHA 1V2ST 1IQNA 4CRGA 4E7RG 2VIPA 1TRMA 2XWAA 3P92A 2FYRA 1HIAB 1AVXA 1CA0B 1AUTC 2XXLA 4X1QU 4GCHG 1D9IA 1O2IA 2ZGCA 1PQ7A 4YM9A 4Y7BA 1J9CH 1ELCA 3TK6A 2SGPE 1CO7E 1UVSH 4O3UA 1C5RA 2C4FH 4TYDA 3TGKE 4ABDA 2GZ7A 4B71A 3E6PH 2XRCA 1HFDA 1IAUA 4CRAA 2FOCA 2RG3A 1PPZA 2H9HA 2GZ9A 3QO6A 3M3TA 4AN7A 1ZRBA 2FPZA 1EZUC 2H1UA 3RP2A 2ZHFH 4BAQB 2ZFQH 1VCPA 3SI3H 2OXSA 2WV5A 4BTUB 4X8SH 2BXTH 1K1OA 3ELAH 4K1TA 1SGFA 1SLXB 3RXCA 1X7AC 2OBOA 4X0WU 1CBWB 2TRMA 1YLDA 5T6FA 5GDSH 5EU8A 5CE1A 1GJAB 2FOMB 3SGAE 2A45B 4FVBA 1J15A 4GHQA 3ZZ4A 3T5FH 5CMXH 1QL7A 1WBGB 2BVXH 3ODDA 1J17T 4AFSA 2PR3A 3IWMA 3VGCB 1V2PT 4JYTA 2OCVB 3NCLA 1YCPH 1BHXF 1H8DH 1YP9A 2P3FH 5L30H 4GHTA 4OGYA 3TJVA 1HAXB 1O5GH 1BOQA 1ZRKA 1XXFA 1EQ9A 3RXHA 3M61U 1ZPCA 2VVCA 3BSQA 1C5PA 3GCTF 4WH6A 1GMCF 1UHBB 3TJUA 3F9HA 1EZXC 1DY9A 1HAVA 3M5OA 5A8XA 2BQ6B 1HJ8A 1O2VA 2ZTXA 2ZDAH 3T29A 4AFZA 1Y5UT 4OS1A 3A8BA 1GDQA 3ZVBA 2B0FA 2XBVA 3EA9A 3GY8A 2A4GA 3T2NA 3LGYA 3ZYEA 1D3PB 4YLQH 1BDAA 5F6MA 3RMOH 1Y59T 3U69H 1DXPA 1KLJH 2OBQA 1C5VA 1NO9H 2ZHWH 3UREA 1HIAA 4JK6A 2FI5E 2A32A 3SU5A 1W11U 1GDUA 4A92A 4X1RU 4MPVA 1J16A 3MU8A 2SGAA 2WUCA 3P6ZB 1PPEE 4FUFA 3LH3A 2ZFSA 2HVXA 3KIDU 4ZH8A 1GI6A 1O2MA 3Q76A 1MKWH 1GI8B 1K21H 3A89A 1OXGA 1BA8B 4ABFA 2D2DA 1TGNA 3TVJB 4Y8ZA 2FS9A 1C5QA 3MO9A 1NESE 1O3EA 4NFEA 1HBTH 3LKWA 1Y5BT 1ANCA 1L0ZA 4TY6A 1ZOMA 3ZZ7A 1HAZB 1TWXB 4XE4A 4ZROA 2HOBA 3RLYH 2FI3E 4YOIA 5FPSA 2B7DH 2FODA 1O5DH 5T6GA 1O2WA 1HPGA 4WMFA 3RXKA 5GJ4B 4JZIA 2BHGA 1LHDH 1A1RA 2P8OB 4GVUA 2VIQA 4YOJA 1W2KH 1ELBA 3RXQA 3SGQE 5FX5A 2ZQ2A 2SGDE 2F9NA 1SGCA 3QUMP 1QRXA 2BB4A 1GJ5H 1JIMA 1S0RA 2GKVE 3SU6A 3ATWA 1W0YH 3Q3YA 1ZSLA 1FN8A 3R3GB 1NFWA 1P9SA 2BZ6H 4BTTB 3MH7A 2ZEBA 4WMEA 3U8TH 1FY8E 1P12E 4I8LA 1CHOF 3ATMA 5FBIA 1BTYA 1AIXH 2ZA5A 1DS2E 2O8MA 3HK3B 3VB6A 1BB0B 1EPTB 4INHA 1XM1A 1DFPA 4Y79A 3M5MA 1UHBA 4NFFA 1C1VH 1E37B 3KCGH 2Y5GA 1AB9C 2AERH 1QTFA 3SV7A 1E0FD 2P59A 2ZU5A 4AZ2B 1HJAC 3RXAA 1BTXA 3T28A 3BG8A 4Y71A 1KXAA 1GG6C 2DUCA 3UFAA 3AW1A 1FIZA 1GBDA 4MTBA 2ZPRA 3B9FH 3KQDA 3NKKA 1G37A 1IHSH 1SI5H 7KMEH 2VB0A 1AFQB 2F9PA 1V2KT 3MU4A 3TK5A 1ESTA 1DWEH 1K1NA 1D3DB 3BTHE 3V7TA 3P70B 2V35A 1KTSB 2QYIA 1AHTH 4IBLH 1TMUH 2D26C 2TPIZ 4UFGH 5HM9A 1IQKA 2EI6A 4YO9A 4B1TA 3S9BA 1YPKH 3KHVA 5EQQA 4ZHMU 1UTPA 1DANH 1XUHA 1EZSC 1CT0E 3T27A 1BCUH 1OWIA 3M5NA 1O3PB 4AYYB 2OC1A 2BM2A 3M36A 3RC4A 1C2HA 5JPMH 2GCTC 5PTPA 6GCHG 3UNQA 3TH3H 3PROA 1OWEA 1ZMNA 1Q2WA 3A7WA 3SQEE 4B2AA 1G3DA 1C4V2 1J14A 1J8AA 2AGIX 4WVPE 4XSKU 3U1IB 1AWHB 5BRRE 3FZZA 3SNCA 3PMBB 1YCPM 3KL6A 2H2ZA 2ZTYA 1BHXB 2BLOA 1RXPA 1GWAA 1Y3VA 1GMDG 1QA7A 4CR9A 1HV7A 3BTME 2BDIA 1ORFA 1AVWA 2H9EH 1JRTA 5LPRA 1HJAB 1XVOA 3A84A 4X2YA 1EPTA 2OQUA 2ZCLP 1F0SA 3A8AA 1S5SA 4RKOB 4MPUA 2QA9E 5ESTE 4BAKB 2K1QA 3LH1A 2F9OA 2OLGA 4ZAEA 5CHAC 5A0CA 5JB9S 1XUIA 1CSOE 5TJXA 4E05H 1CHGA 4B2CA 3CS0A 1O34A 2XBYA 1MCTA 1PPBH 1GI2A 1QBVH 1GJ7B 2OTVA 4CRFA 1S81A 1NRRH 2CMYA 1LTOA 1V2LT 1AKSB 2A0QB 1GCTB 1C4Y2 1YM0A 7GCHG 2NWNA 1FLEE 4Y8XA 1P2JA 1IQFA 1GVKB 2ZG0H 5A2MH 1GCDA 3BTDE 5JYIA 1RTKA 1SGDE 1IQMA 3P95A 4R0IA 1BRBE 1QJ1B 4Y11E 4DURA 1MCVA 4HTCH 3RLWH 4DOQA 3ZVDA 1FV9A 3UPEA 1BITA 3PM3A 3JZ1B 3GISB 2VINA 3M37A 1SPJA 1Y3WA 4B75A 1RTFB 1SGFG 1ZHRA 1O3OA 2Z9JA 4Q7XA 4ZKRU 1HB0B 3VFEA 1VJAU 2PTCE 2VJ1A 1AGJA 1VCQA 2O9QA 2Z9KA 1OP0A 3EE0B 1P3CA 4Q80A 2G8TA 4HZHA 2TGAA 5K0HA 1C5OH 3SGBE 1MTSA 2ZKSA 2ZWLH 3A81A 3E16B 1W7GH 2AGEX 2Y5FA 4AGKA 2VH0A 1V2MT 1UO6A 1GL1A 1YPHE 2QXIA 3OTJE 1QRZA 1D6RA 3GDSA 4BXSA 2VWNA 2G55A 1MH0A 2V3HH 4JZFH 1O2KA 3PMAB 3I29A 4HI3A 2ALVA 2WPKS 3ZZCA 4MPWA 3UWIA 1A3EH 3RM2H 2PHBA 1C5LH 1XUJA 3GY4A 3O8CA 1MKXK 3ZVCA 3MH5A 4YT6H 3TGIE 5DG6A 5C3NA 2ILNA 4J1YA 4UE7H 1GBLA 1MAYA 4FXGH 2RDLA 4X1SU 1V2UT 1GPZA 1V3XA 1O2GH 1JRSA 1NROH 3A7YA 1Z71A 5AHGH 1GMHF 4OS2A 3UR6A 3MH6A 1E34B 4A7IB 2G5NA 1SHYA 4HFPB 3KF2A 4QT8C 2ANYA 3CP7A 2CHAC 3QK1A 1SG8B 1AKSA 4AB9A 2F91A 3E0PB 8KME2 1GI0A 2HGTH 4X8TH 1K28D 3MMGA 3H7TA 1GHAG 4DG4A 1HRTH 3URCA 2XC0A 2XTTB 3BTTE 1FUJA 1BIOA 5HM2A 1DY8A 1SHHB 1W10U 3TGJE 2R2MB 3BEUA 3RXBA 2J34A 1Z1IA 4ZXXH 1QBNA 1ZSJA 4X2XA 3ATLA 4FUIA 1HXFH 2FTLE 1MD7A 5GPIB 5HYOA 2PGQB 1C5TA 3E90B 2BQWB 1MMJN 1DPOA 2V0BA 1OYTH 4GAWA 4U01A 1S6FA 3QDZB 4MNYA 5DP4A 5DP8A 5HMAA 2XBWA 4U2WA 1TB6H 4MPXA 1O2NA 1UVPA 1GHYH 4JZ1A 1TYNA 2HRVA 1AO5A 5ETXA 1UTQA 5TCAA 4RN6A 5E8EH 5DP9A 2P94A 2CXVA 2FLBH 1QURH 4ISLA 4KP0A 1ZHMA 4HGCA 1PYTC 2JH5D 2BDAA 3MNXA 1E35B 1VJ9U 1K2I1 1C2IA 1LVYA 2Q6FA 3ZZ8A 3P8NA 1O38A 4M7GA 1LVMA 3ZV9A 1T8NA 1BJVA 2PLXA 1P06A 1T7CA 5FAHA 3LGVA 5DP5A 4NSVA 1WTHD 1W7XH 2STAE 3F1SB 1Z8JB 3AAUA 1QY6A 1P2MA 2IJOB 4GLYA 1IQEA 1DDJA 1H9HE 5T3HA 4DY7B 4U30A 4NG9H 4GCHF 5LPEA 1VGCB 1ELGA 2BD3A 3SZNA 3M3SA 1QBOA 3MNBA 3MH4A 5F8TA 3W94A 4Z0KA 3PLPA 2SNWA 2ODPA 2FX6A 1DSUA 3SJKA 1C5WB 5EQSA 2NU4E 1OKXA 3R0FA 4OGXA 1MQ6A 1WOFA 4K8BA 3N7OA 1YYY1 2QGRA 4IN2A 1Q31A 4CREA 2TBSA 1Z6EA 3TJNA 2VIWA 3V0XA 1O3JA 1DWBH 3LGWA 1MUEB 2FMJA 2G81E 2XNIA 3NZIA 3SNDA 1SGQE 2J94A 2PUQH 1W3CA 2YOLA 2P3TB 2C90B 3LGUA 5L2YH 3A80A 3LPRA 4ISIH 4BTIB 3ZZAA 3HK6B 3EAJA 1Z6JH 4ZHAA 5A0BA 2GX4A 1YPLH 1DLEA 1GHZA 1KSNA 1HAPH 4DIIH 1SGTA 1K1MA 2AH4X 1IOEA 1XX9A 4LZ4B 3AW0A 5AVDA 4IGDA 1P0SH 2M5TA 1KDQB 1NTPA 4A1TA 1SR5C 1SGRE 2VIDA 3SV9A 1S6HA 2PKSB 1O3GA 3PB1E 1GVZA 1DT2A 1QJ7B 1HUTH 4WXIA 2F9UA 2ULLA 2GP9B 3F9EA 4JYUH 1DM4B 4NWKA 4WJG2 1D3TB 2XWBI 2BDHA 2ZIQH 3FAOA 2Y82A 1PJPA 3FFGA 1NRQH 3EYDA 1ZYOA 3A86A 3RXGA 2ANMH 4WXVA 3U8OH 4I31A 3HKJB 3PWBA 1G2LA 3LOXA 1GBFA 3IITA 3VEQB 5JBAS 2BD5A 1EASA 4MG3A 1B5GH 1HAIH 3E8LA 4CR5A 5EXLA 4NIYA 1IQLA 3P8GA 4X8UH 8GCHF 1IQJA 1CT2E 1ABJH 1M9UA 1W8BH 3QWCH 1EB2A 4UFEH 4Y6DA 3BTWE 3GY7A 1C1UH 3FANA 2UUFB 3KQCA 3QGJA 1FN6A 1LHFH 1AI8H 1JWTA 2VWOA 1SQAA 4ZUHA 3SV6A 1P2QA 2W7SA 2FXRA 4NA8A 1PFXC 2ASUB 5T6DA 1TMBH 5JB8S 3LDXH 4U32A 3STJA 1O5CB 2DE9A 4UFDH 3VPKA 1XKAC 3TPIZ 1V2TT 1H9IE 2VWLA 2CV3A 1VR1H 4Y76A 3NK8A 4E06H 1W13U 3SJOA 1C2JA 2Z6BD 4Y0ZE 1T4VH 2UWLA 1CQQA 2VNTA 1C9TA 3Q00A 4ZKSU 1MBQA 1QRWA 2A4QA 2B9LA 3DA9B 5EW1H 3MU0A 2UWPA 1GL0E 8GCHG 1Q3XA 5FX6A 1TABE 1SOZA 4TWYA 3BTQE 1YF4A 1WAYB 6LPRA 3PMHB 4ZMAH 5EXMA 1N8OC 2OINA 1KDQA 1THPB 2A7HA 1TIOA 4Y8YA 2A7JA 1Z8RA 3ATIA 1FNIA 1SBWA 4MQAA 4ZKOU 3A7VA 2NU2E 7ESTE 1BTZA 1IQIA 2DE8A 3BG4C 1TNKA 3RXOA 4Y0YE 1OWJA 3DUXH 1C1OA 2VIVA 1A0LA 2NU0E 4XDEA 1O2OA 3S9AA 1O2SA 2BD7A 1EJNA 1G9IE 1TA6A 4X1NU 3UTUH 3V3MA 3V13A 3Q77A 4CBNA 3RMMH 5FPYA 1QFKH 2GCHG 2QIQA 1GI1A 2Y7ZA 4FUJA 1K22H 3C27B 2D1JA 3PLKA 1GHBG 3RXEA 2A5KA 1UMAH 1CVWH 3NXPA 5J4SA 5C20A 1Z1JA 3OY6U 1BBRK 1TBRH 3VB4A 1ZTJA 4CH2B 2I6QA 2FM2A 5DGJA 3W95A 1EP6A 2BQ7B 1LCYA 3NUMA 1GHWH 4ISHH 1LPGB 1PPHE 1TGBA 2WUBA 3I77A 2W26A 1K1LA 1MU6B 1NRSH 1SFIA 3A8CA 2ZCHP 3BTGE 4ZHLU 2Q1JA 2Y7XA 4OS5A 5EODA 5E2PA 3A7XA 4BOHA 2AIPA 2ZPQA 1SGYE 3MWIU 3SO3A 1DUEA 1HAGE 4KTSA 3UOUA 1QNJA 2WYGA 2AMQA 2FOGA 3C1KA 4LZ1H 4O3TA 1NRNH 1NS3A 1NU7B 1XVMA 1N8OB 1C5XB 2CF8H 1TRNA 2F3CE 1Y3UA 1V2JT 6GCHF 4JZDH 1ACBE 3SJIA 1KTTB 2ZI2H 3FVFB 1GJ9B 2O8LA 1C5SA 3K6YA 1HLTH 4D76A 2BZAA 2LPRA 4Q7YA 2AEIH 4ABJA 2C8ZB 2ZZUH 1GMDF 4XBDA 1T31A 2FS8A 4NSYA 4FU7A 1TA2A 1GI4A 3S7KB 4IS5A 1NFXA 1TOCB 1C5UA 2ALPA 1DUAA 1LHGH 1NM6A 1KXFA 1HAYB 5C1UA 3RMNH 5GWZA 3EQ0H 5A09A 1G36A 2ZDNA 2CGAA 1KXBA 1TNLA 1ARBA 1Y3XA 1SQOA 1BMMH 2BVSH 2BMGB 3PO1C 1HAOH 3ZZ3A 5DJ7A 1ABIH 3F6UH 1Y3YA 2WPIS 1W14U 3GY3A 4A1VA 2HLCA 2Z9LA 2F83A 1S0QA 3AASA 1DSTA 1FPCH 2HWLB 3O8DA 4KTUA 2VGCC 1GJ6A 2AFQB 3QX5H 3RM0H 1UVTH 2ZDKA 1MU8B 2ZECA 1MD8A 2OC7A 1SLUB 1T32A 1ID5H 7GCHF 4NGAH 1ETTH 4UD9H 5I46H 1WV7H 4ASHA 1AB9B 1BTHH 3MU1A 2C8YB 3ZZ5A 5TCCA 2BY7X 3SU2A 1G3BA 2STBE 4FVDA 2ZGXH 3ZZDA 1GG6B 1Y5AT 5C1XA 4Y10E 1TQ7B 3MTYA 2RA0A 1F5LA 1O35A 1ZPBA 2QN5T 4UEHH 2FLRH 2FESH 4KELA 2FOAA 1DVAH 1NT1A 4AB8A 3NPSA 3PLBA 1V2VT 1SGEE 4KGAA 2KAIB 4D7FA 1WQVH 2Y80A 3PMJA 5LGOA 5C67A 1ELFA 3ESTA 1LKBA 1TQ0B 2YNAA 1KLIH 5H4IB 4BNRA 1FY4A 1XUKA 1T8MA 1BRAA 1QCPA 3FP7E 3RXPA 1BT7A 2BX4A 2ZDLA 5FBEA 3SUDA 3BIVH 2BY8X 2FTMA 2XYAA 2ZGBH 1O3HA 1W0ZU 1QJ6B 4Q2KA 2R3YA 1AE8H 1T4UH 1A3BH 1C2FA 1AY6H 2BD2A 2XBXA 3AAVA 2ZFPH 1WCZA 1F0UA 4YT7H 3U9AH 3ZV8A 3TNTA 5J4QA 5BPEA 2ANKH 4BXWA 1XMNB 5C2ZA 2GCTB 4I8HA 2R9PA 1PPFE 1C5NH 3P8FA 3TLOA 4THNH 5FCKA 2OC8A 2VGCB 2O8WA 1FONA 1F92A 6ESTA 5EW2H 1ETSH 4RKJB 3A85A 4D9RA 3I78A 4MNXA 4UDWH 1SL3A 1A2CH 3EA8A 1GJCB 3TU7H 1SSXA 2BD8A 2VWMA 2J2UA 1GI7B 4ABHA 4I7YH 1S84A 2WPMS 1GHVH 1BRCE 1TALA 1DITH 1ZSKA 3OY5U 1MKXH 4O97A 1HXEH 2AIQA 1AE5A 2PGBB 1NN6A 4TWWA 5FHTA 3RDZA 1TNIA 3K65B 1O0DH 1F2SE 1WSSH 5A8YA 5CHAB 4AGJA 1FY1A 1EJMA 1AWFH 5GIBA 2Z3CA 1GHAF 4VGCC 3T25A 1O33A 2G4UA 1TBQH 1HAHH 4K8YA 5EGMA 3A8DA 1NPMA 2XW9A 1ESAA 2PV9B 2GV7A 2UUJB 3M3VA 3TH2H 3K9XB 3SUFA 5IYTA 3SI4H 1CE5A 2ZU2A 2KAIA 3ZVAA 1LDTT 2SGQE 1GBTA 2H5CA 1MTWA 2GVFA 2GDEH 3MO3A 4KTCA 4X6PA 2R2WU 2H9TH 3BTFE 4IMQA 1C1SA 2D8WA 1SMFE 1QQUA 4CHAC 3L33A 2QXHA 1JXPA 2XC5A 4ESTE 3ENSB 1UTOA 3DT0H 1H4WA 3U8RH 5C5OA 1QL8A 3NWUA 1A61H 3A7ZA 1QHRB 1S85A 4CH8B 1MTVA 1L2EA 1GJDB 2PSXA 3PTBA 2GT8A 5EQRA 3M7QA 4SGBE 3K6ZA 1FI8A 1XKBC 4INKA 3UNRA 1THSH 1MTNC 2IOTA 1SGPE 1LQDB 3RUOA 1O31A 3E1XB 5C1YA 3D49H 1QQ4A 1C5YB 3D23A 1XUFA 4I8GA 4K3JA 3SU4A 2HPQH 4ABAA 1D6WA 3RC6A 3CS7A 1QIXB 4XFQA 1G3EA 1P8VC 4TY7A 3B8JA 1ZTLA 3E0NB 4NA9H 1B7XB 2Y6TA 3BEIB 1TAWA 3ZVFA 1GGDC 2WPHS 5EPNA 2FOFA 1AVGH 4INLA 4K1EA 2J4IA 2PTNA 3ITIA 2W3IA 2ANWA 5JDUB 1P09A 1C2GA 4YOGA 1UJ1A 4WH8A 4NIVA 1P03A 2J9NA 4FU8A 1KY9A 3KQEA 5AF9H 3VXFH 3ATKA 2VU8E 4FUEA 1A0JA 4X1PU 2O8UA 1HJ9A 3D62A 4TPYA 1UTNA 1O2TA 2O8TA 4WF8A 4K60A 1UTLM 4GPGA 1DXWA 1CA0C 4FUBA 3F68H 1LMWB 1EZQA 4JK5A 3PWCA 2C3SA 5HGGA 1O3DA 4CHAB 1C1TA 2CHAB 3K2UA 4BAHB 4I8JA 1QR3E 5JBTA 1HDTH 4BAMB 3U1JB 2FOHA 2BDCA 1FMGA 2H5DA 1K9OE 2EI8A 2EI7A 5DP6A 1AFEH 2G4TA 1O36A 3DHKH 1O39A 5EG4A 2BX3A 5DK1A 1TRYA 4AFUA 1MTUA 1RRKA 3L6PA 3AVZA 1ZMJA 1KXCA 1MAXA 1ZJDA 1CBWC 1KXEA 1QA0A 2THFB 2GDDA 1ELEE 1GI5A 1P2NA 3SORA 2GGVB 2GT7A 5FCRA 1ZTKA 1YC0A 1RIWC 4ABBA 4DW2U 1C2KA 1XUGA 2FOEA 1L1NA 4NIWA 1P11E 1C2EA 2V6NA 3VGCC 1NRPH 2BLWA 1HCGA 3WY8A 3UIRA 5C5NA 1BMNH 4Y7AA 1LO6A 1GVLA 1OYQA 1UVOA 5FXLA 4A1XA 5FPTA 1GBCA 4FUCA 3BN9A 3MOCA 1YLCA 1AD8H 1DWCH 1H9LB 1KXDA 2G51A 1YPJH 1YKTA 1OWDA 2QV1A 4IC6A 3P8OA 4YESB 3SHCH 1INCA 1QB6A 3SNAA 3Q3XA 4JMYA 8LPRA 3RMLH 1TONA 2BOHB 1UCYK 2G00A 3DD2H 1VITG 4PROA 1BTUA 1E36B 1O37A 4LK4A 3SNEA 1PPCE 2HNTE 3LC3A 3MFJA 2ZCKP 2ZFTA 1OOKB 1ELTA 2JETC 2UWOA 1BBRE 1ZJKA 5GCHG 3ZVEA 1EX3A 1PYTD 1DE7H 3TJOA 3DFLA 2W7UA 2PWXA 2ODQA 5B6OA 1TNJA 3OSYA 4H6SB 3TNSA 1O2YA 3BEFB 1CGJE 1O2JA 1O3IA 4ZKNU 1LQEA 3SUEA 3LGTA 1A5GH 1NFYA 3VXEH 1FY5A 1YGCH 1ELVA 3S9CA 2ZHDA 1O2LA 2A5IA 1K1JA 1O2RA 2EEKA 2P3UB 3UQOA 3FP6E 2ZFFH 3CENA 2ZU3A 1GBHA 4SGAE 1TGTA 3SOSA 2CN0H 4WY3A 1OX1A 1TNGA 1RIWB 1UK4A 1O3MA 1TFXA 1TOMH 1C1QA 2G5VA 4DIHH 1LHCH 2AYWA 4YTAA 5LH8A 2ESTE 2G52A 3TK9A
chains in the Genus database with same CATH superfamily
2PFEA 3LGIA 2K8IA 1FXYA 2BY5X 3SV2H 2OD3B 3SU3A 1TGCA 2FOBA 3F0OA 5IDKA 1F0RA 5A8ZA 1PQ5A 1C5MD 1BMFD 1O3AA 1D3QB 1P01A 2XCNA 2Z7FE 1NC6A 2J38A 1ARCA 3MYWA 2P8OC 2GTBA 1FIWA 4ZCNA 2SFAA 5EJ1A 2ZC9H 3GCOA 1N1LA 2AMDA 4ZXYH 3UAIC 2RDEA 1C1RA 1YCPK 3LIWA 2GCHF 1KYNA 5E2OA 1A46H 5HXFA 3DCLA 2OQ5A 3OYPA 1DX5M 4H4FA 2B5TB 3HKIB 3D65E 4B2BA 1GHBF 1TMTH 2KM0A 1CT4E 3UOPA 2JETB 3E91A 4B74A 1JOUB 2IN2A 1LKAA 1GHXH 1FDPA 3STIA 4AFQA 1THRH 2QC2A 1QGFA 3BTEE 3G01A 4XOJA 2BTCE 1EPTC 1ELAA 1P2KA 4NIXA 1GBKA 3KYFA 3H5CB 4WWYA 3RXTA 1ANDA 2W5EA 5LPFA 1ANEA 2Y5HA 3OU0A 1LVOA 1TPAE 1C4U2 2FEQH 2BDGA 4A5TS 1B0EA 1O2HA 2P93A 4LOYH 1U6QA 1W0JD 2VVUA 1BBRH 4UFFH 4FUDA 1V2OT 1LHEH 3OX7U 3VB3A 1ZZZA 4GUXA 1H8ED 2CF9H 3GCTG 1P2IA 1WU1A 1GMCG 1DOJA 2TIOA 2P95A 1BUIA 4DCDA 4K5ZA 2WSSD 1A5HA 2WPLS 1TE0A 2NU1E 2JKHA 1IHTH 3GICB 1KIGH 1L4DA 4B6EA 4MNWA 1GBJA 3HPTB 3HGNA 2Z9IA 1AFQC 3TITA 1MKWK 2FYQA 2AS9A 4WMDA 5DKMA 3T26A 1QB1A 2QAAA 1AN1E 1EAIA 4CRDA 1C2LA 4YLUA 4Q7ZA 1RGQA 1D4PB 4MVNA 1F0TA 3BIUH 3HATH 4KKDA 2TGDA 1BTWA 4A6LA 3EE7A 2GMTC 4B76A 1O5FH 1TPOA 3PTNA 2H6MA 1ANBA 1FZZA 3RXSA 4F49A 1GI3A 1T8LA 4BAOB 4OS4A 1BTPA 1L4ZA 1N6XA 1KMHB 3A82A 1OS8A 1VZQH 3SBKA 3VB5A 1GBEA 2GZ8A 2PW8H 3SUGA 1EFRD 3S7HB 4ISNA 4JYVH 2FI4E 1OP8A 1EP5A 3UWJH 1O2XA 2HPPH 3UUZA 3LT3A 4DGJA 3BV9B 1SQTA 3KEEA 3MNCA 4O03A 1DLKB 1YLNA 4RSPA 1UTJA 2C8XB 2Z94A 1MQ5A 3BG4B 4I32A 2LNCA 2FZZA 1NU9A 3RXDA 1TX6A 2W3KA 2SNVA 3EA7A 1TBZH 1IQHA 3GOVB 9ESTA 3GCHC 3QN7A 1B0FA 3RXVA 1JMOH 4E7NA 5DPAA 1GI9B 2RCEA 2VIOA 1EATA 1C5ZB 3FP8E 1GBBA 1EXFA 1O3KA 2JH0D 1UTKA 2EC9H 3KNXA 1RFNA 3GYMA 1ESBA 3E3TA 1YPGH 3RXLA 1GBIA 3F2FA 3L3TA 4DVAU 1EUFA 5EOKA 1GJ8B 1TGSZ 2YMSC 4Z6AH 1FQ3A 2ZHQH 2BVRH 2IPHA 1TX7A 1CHOG 1V2WT 2UUYA 2WZQA 5JBCS 1ZLRA 1SLVB 5SGAE 1P3EA 1VCWA 4K2YA 1EAUA 1GCTC 1O3BA 1A5IA 3LU9B 1T8OA 2GMTB 4OS7A 4FUGA 3HGPA 1C9PA 2ZPSA 4D9QA 1C1WH 3RXRA 1P57B 1AU8A 3F9GA 1G30B 4X6MA 3GY6A 2BOKA 1EAXA 2CJIA 5F8XA 1YPHC 4R8TB 1H1BA 1UK3A 3H7OA 1SGNE 1F5RA 4RT0A 1V6DA 3A88A 2I6SA 2XNDD 5L6NH 1LPZB 4X6OA 1RD3B 2OC0A 3BTKE 2ZQ1A 1ZGIA 1VITH 1L1GA 5GXPA 1C1MA 2J92A 1E38B 1C1NA 3BF6H 3S0NA 1FX0B 3ZZ9A 5ABWA 3GCHB 3M7TA 4YZUA 2A2XH 2QCYA 2FDAA 3A87A 2EA3A 2NU3E 2QXJA 3JZ2B 3GY5A 4Q4LA 4DT4A 4ABGA 1ETRH 3P17H 3SV8A 1CGHA 4TSFD 1MBMA 2FO9A 3UQVA 5DP3A 5HIZA 3QZQA 2R0LA 2TGPZ 4AG1A 4FUHA 3SJ8A 1OWKA 1SKYE 1GBAA 1F5KU 1K1IA 2ZF0H 4IW4E 4K1SA 2SGFE 2WPJS 4AX9H 4AYVB 5DO4H 3O8BA 2QY0B 4J2YB 4HG6A 4B73A 2GD4B 4D7GA 2FWWA 2R0KA 3PO1B 1HYLA 3WWBA 1HGTH 1FJSA 2FIRH 2ZDVH 4FOUC 1P9UA 1H8IH 1PQ8A 4AG2A 4X6NA 6CHAC 2B8OH 3KN2A 1L1JA 4NZLA 3SW2B 1YBWA 3B23B 3GY2A 2QXGA 1Z8GA 2YNBA 5AFYH 1P2OA 1F7ZA 3EDXB 3GDUA 3SHAH 2ZHEH 5EJZA 2ZTZA 4MLFB 3SNBA 2Y81A 3LC5A 2Q6GA 1ZMLA 2AGGX 3RC5A 3H09A 7LPRA 9LPRA 1SLWB 2BLQA 1G2MA 1GDNA 3VB7A 3QZRA 3FZDA 1PPGE 1SB1H 3ODFA 1RJXB 2HNTF 1DWDH 3ZZBA 2ZP0H 4H42U 1Y8TA 1P05A 2BDBA 1PQAA 1ZPZA 1WYKA 1NFUA 5ESBA 1OP2A 2J95A 1S83A 4GSOA 4IN1A 3KGPA 1Z7KA 1W12U 1EAWA 1OSSA 3KYGA 5KGOA 1MZDA 1FY3A 1C1PA 4CRCA 5DN6D 1JBUH 3M5LA 1OWHA 2JH6D 4NA7A 1WTGH 3SU0A 3GCNA 1DICA 3TH4H 2Z3DA 2VH6A 4CBOA 3RXMA 1V2RT 3O8RA 2P16A 2BD9A 3PRDA 3RXIA 2XOKD 3UY9A 4FU9A 2F9VA 2KR7A 2VVVA 1NY22 4CRBA 1ELDE 2Q6DA 2WYJA 3CNRA 4F4OC 1ZR0A 3LJOA 5G4BA 2BDYA 3RXUA 1ZGVA 2ZU1A 1P02A 1SC8U 4X2WA 2R3UA 3UNSA 3LONA 4IC5A 5I25A 2Z9GA 3EGKH 1IQGA 2BXUH 2BYAX 2WINI 1TPSA 1AZ8A 2A4RA 2ZFRH 2C93B 1BQYA 2F43B 1YPEH 3MHWU 6CHAB 4NCYA 1EOLA 3MI4A 3M35A 5B6LA 4O9VA 3A83A 3TIUA 2A4OA 1A0HB 5EIYA 1UVUH 2PSYA 5EXNA 3U98H 1TX8A 3GDVA 5DP7A 3ZYDA 4ABEA 2A1DB 3A7TA 1SVPA 2KCPA 1FAKH 2SGEE 1TPPA 4XBCA 4AORA 2TGTA 3SJ9A 2HVYB 2XCFA 4MDSA 1EB1H 1BJUA 4JZEH 1BMAA 1P10A 1FAXA 1UCYE 3KQBA 1O2QA 4I86A 2ZO3H 2BY9X 3SZEA 4I8KA 2BY6X 1V2NT 1Z8IB 1O2UA 1VGCC 4UONA 3SN8A 1O3NA 3RXJA 5F03A 4DT7B 1NZQH 4MNVA 2PKAB 3F0PA 8ESTE 3Q3KA 5E0HA 4ABIA 3MNSA 2FP7B 2GV6A 1O5AB 3OAAD 5F53A 1WUNH 3RU4E 2JDID 4ISOA 4VGCB 1O2PA 3ZZ6A 1FPHH 4NZQA 3RU4D 1CU1A 1G32B 2RA3A 1EKBB 1AMHA 1KLTA 3LJJA 4D8NA 5F8ZA 1RS0A 1LVBA 2IJD1 2OUAA 1O3FA 1A4WH 1QL9A 5K7RA 4IMZA 1GMHG 5A0AE 2HALA 2A7CA 1HNEE 2F9BH 3URDA 4X2VA 2ZNKH 3ZVGA 5IK2D 1O3LA 3RU4T 4AOQA 1O32A 2WV4A 4JCNA 3F9FA 3PV4A 1C2DA 1JIRA 3GYLB 2Z3EA 2QF0A 3SU1A 2ZDMA 3T62A 4XBBA 1BZXE 3SQHE 2HNTC 1CA8B 1TLDA 1ZHPA 1AZZA 1BMLA 1K1PA 1SOTA 2ODYB 4K69A 2BLVA 4X8VH 1GBMA 1O2ZA 1UK2A 2PUXB 2LELA 3DFJA 1GJBB 2A5AA 4F48B 1MZAA 5L2ZH 3MU5A 1WXRA 1O5BB 1O3CA 1V2QT 2ZU4A 1RTLA 4DJZB 1AUJA 2PKSC 4BANB 5AFZH 2KCOA 1MTNB 2KFWA 5JBBS 2A2QH 2ZGJA 2OK5A 5C94A 1TNHA 2XC4A 1SFQB 1VITF 1S82A 5KECA 2HLDD 5EPYA 1EJAA 4OS6A 4NWLA 5E0GA 1EOJA 1YPMH 2UUKB 2BD4A 3IG6B 1N6YA 3QLPH 3RXFA 2C8WB 3S69A 5GCHF 4I33A 1CGIE 3QTVH 3NRLA 2V3OH 2WPDD 5E0JA 1WQSA 2A31A 1GGDB 1AQ7A 1BRUP 1A7SA 1G3CA 3QTOH 4TPIZ 2FX4A 1UCYH 1O30A 3QGNB 3PYHA 3UR9A 1HAVB 2J98B 1UTMA 3V12A 1GJ4H 4LXBH 2OP9A 1C2MA 3MO6A 1P04A 1QB9A 3M7UA 2AMPA 1LPKB 2PKAA 4H6TA 1XXDA 1O5EH 1SGIB 1OPHB 2QF3A 2ZGHA 1V2ST 1IQNA 4CRGA 4E7RG 3MQKC 2VIPA 1TRMA 2XWAA 3P92A 2FYRA 2W6JD 1HIAB 1AVXA 1CA0B 1AUTC 2XXLA 4X1QU 4GCHG 1D9IA 1O2IA 2ZGCA 1PQ7A 4YM9A 4Y7BA 1J9CH 1ELCA 3TK6A 2SGPE 1CO7E 5HKKD 1UVSH 4O3UA 1C5RA 2C4FH 4TYDA 3TGKE 4ABDA 2GZ7A 4B71A 3E6PH 2XRCA 1HFDA 1IAUA 2F4LA 2FOCA 4CRAA 2RG3A 1PPZA 2H9HA 2GZ9A 3QO6A 3M3TA 4AN7A 2L6OA 1ZRBA 2FPZA 1EZUC 2H1UA 3RP2A 2ZHFH 4BAQB 2ZFQH 1VCPA 3SI3H 2OXSA 2WV5A 4BTUB 4X8SH 2BXTH 1K1OA 3ELAH 4K1TA 1SGFA 1SLXB 3RXCA 1X7AC 2OBOA 4X0WU 1CBWB 2TRMA 1YLDA 5T6FA 5GDSH 5EU8A 5CE1A 1GJAB 2FOMB 3SGAE 2A45B 4FVBA 1J15A 4GHQA 3ZZ4A 3T5FH 5CMXH 1QL7A 1WBGB 2BVXH 3ODDA 1J17T 4AFSA 2PR3A 3IWMA 3VGCB 1V2PT 4JYTA 2OCVB 3NCLA 1YCPH 1BHXF 1H8DH 1YP9A 2P3FH 5L30H 4GHTA 4OGYA 3TJVA 1HAXB 1O5GH 1BOQA 1ZRKA 1XXFA 1MABB 1EQ9A 3RXHA 3N7EA 3M61U 1ZPCA 2VVCA 1H8HD 3BSQA 1C5PA 3GCTF 4WH6A 1GMCF 1UHBB 3TJUA 3F9HA 1EZXC 4ACAA 2V3MA 1DY9A 1HAVA 2J98A 3M5OA 3PV2A 5A8XA 2BQ6B 1HJ8A 1O2VA 2ZTXA 2ZDAH 4XRNA 3T29A 4AFZA 1WDIA 1Y5UT 3A8BA 4OS1A 1GDQA 3ZVBA 2B0FA 2XBVA 3EA9A 3GY8A 2A4GA 3T2NA 3LGYA 3ZYEA 1D3PB 4YLQH 1BDAA 5F6MA 3RMOH 1Y59T 3U69H 1DXPA 1KLJH 2OBQA 1C5VA 1NO9H 2ZHWH 3SYJA 3UREA 1HIAA 4JK6A 2FI5E 2A32A 3SU5A 1W11U 1GDUA 3OTPA 4A92A 4X1RU 4MPVA 1J16A 3MU8A 2SGAA 2WUCA 3P6ZB 1PPEE 4FUFA 3LH3A 4ASUD 2ZFSA 2HVXA 3KIDU 4ZH8A 1GI6A 1O2MA 3Q76A 1MKWH 1GI8B 1K21H 3A89A 1OXGA 1BA8B 4ABFA 2D2DA 1TGNA 3TVJB 2WHXA 2FS9A 1C5QA 4Y8ZA 3MO9A 1NESE 1O3EA 4NFEA 3OEED 1HBTH 3LKWA 5C0TA 1Y5BT 1ANCA 1L0ZA 4TY6A 1ZOMA 3ZZ7A 1HAZB 1TWXB 4XE4A 4ZROA 2HOBA 3RLYH 2FI3E 4YOIA 5FPSA 2B7DH 2FODA 1O5DH 5T6GA 1O2WA 1HPGA 4WMFA 3RXKA 5GJ4B 3DSOA 4JZIA 2KZ4A 2BHGA 1LHDH 1A1RA 2P8OB 4GVUA 2VIQA 4YOJA 1W2KH 1ELBA 3RXQA 3SGQE 5FX5A 2ZQ2A 2SGDE 2F9NA 1SGCA 3QUMP 1QRXA 2BB4A 2K0QA 1GJ5H 3GS9A 1JIMA 1S0RA 2GKVE 3SU6A 3ATWA 1W0YH 3Q3YA 1ZSLA 1FN8A 3R3GB 1NFWA 1P9SA 2BZ6H 4BTTB 3MH7A 2ZEBA 4WMEA 3U8TH 1FY8E 1P12E 4I8LA 1CHOF 3ATMA 5FBIA 1BTYA 1AIXH 2ZA5A 1DS2E 2O8MA 3HK3B 3VB6A 1BB0B 1EPTB 4INHA 1XM1A 1DFPA 4Y79A 3M5MA 1UHBA 4NFFA 1C1VH 1E37B 3KCGH 2Y5GA 1AB9C 2AERH 1QTFA 3SV7A 1E0FD 2P59A 2ZU5A 4AZ2B 1HJAC 3RXAA 1BTXA 3T28A 3BG8A 4Y71A 1KXAA 4RT1A 1GG6C 2DUCA 5HIYA 3UFAA 3AW1A 1FIZA 1GBDA 4MTBA 2ZPRA 3B9FH 3KQDA 3NKKA 1G37A 1IHSH 1SI5H 7KMEH 2VB0A 1AFQB 2F9PA 1V2KT 3MU4A 3TK5A 1ESTA 1DWEH 1K1NA 1D3DB 3BTHE 3V7TA 3P70B 2V35A 1KTSB 2QYIA 1AHTH 3F2HA 4IBLH 1TMUH 2D26C 2TPIZ 4UFGH 5HM9A 1IQKA 3KQ5A 2EI6A 1UW7A 4YO9A 4B1TA 3S9BA 1YPKH 3KHVA 5EQQA 4ZHMU 1UTPA 1DANH 1XUHA 1EZSC 1CT0E 1OHHD 3T27A 1BCUH 1OWIA 3M5NA 1O3PB 4AYYB 2OC1A 2BM2A 3M36A 3RC4A 1C2HA 5JPMH 2GCTC 5PTPA 6GCHG 3UNQA 3TH3H 3PROA 1OWEA 1ZMNA 1Q2WA 3A7WA 3SQEE 4B2AA 1G3DA 1C4V2 1J14A 1J8AA 2AGIX 4WVPE 4XSKU 3U1IB 1AWHB 5BRRE 3FZZA 3SNCA 3PMBB 1YCPM 3KL6A 2H2ZA 2ZTYA 1BHXB 2BLOA 1RXPA 1GWAA 1Y3VA 1GMDG 1QA7A 4CR9A 1HV7A 3BTME 2BDIA 1ORFA 1AVWA 2H9EH 1JRTA 5LPRA 1HJAB 3PRBA 1XVOA 3A84A 4X2YA 2EQNA 1EPTA 2OQUA 2ZCLP 1F0SA 3A8AA 1S5SA 4RKOB 2JJ1D 4MPUA 2QA9E 3FOAA 5ESTE 2K1QA 4BAKB 3LH1A 2F9OA 2OLGA 4ZAEA 5CHAC 5A0CA 5JB9S 2QE7D 1XUIA 2YMSB 1CSOE 5TJXA 4E05H 1CHGA 4B2CA 3CS0A 1O34A 2XBYA 1MCTA 1PPBH 3DSPA 1GI2A 1QBVH 3WWFA 1GJ7B 2OTVA 3FKSD 4CRFA 1S81A 1NRRH 2CMYA 1LTOA 1V2LT 1AKSB 2A0QB 1GCTB 1C4Y2 1YM0A 7GCHG 2NWNA 1FLEE 4Y8XA 1P2JA 1IQFA 1GVKB 2ZG0H 1NBMD 5A2MH 1GCDA 3BTDE 5JYIA 1RTKA 1SGDE 1IQMA 3P95A 4R0IA 1BRBE 2J97A 1QJ1B 4Y11E 4DURA 1MCVA 4HTCH 3RLWH 4DOQA 2YMSD 1FV9A 3ZVDA 3UPEA 1BITA 3PM3A 3JZ1B 3GISB 2VINA 3M37A 1SPJA 1Y3WA 4B75A 1RTFB 1SGFG 1ZHRA 1O3OA 2Z9JA 4Q7XA 4ZKRU 1HB0B 3VFEA 1VJAU 2PTCE 2VJ1A 1AGJA 1VCQA 2O9QA 2Z9KA 1OP0A 3EE0B 1P3CA 4Q80A 2G8TA 4HZHA 2TGAA 5K0HA 1C5OH 3SGBE 1MTSA 2ZKSA 2ZWLH 3A81A 3E16B 4XD7D 1W7GH 2AGEX 2Y5FA 5T1VA 4AGKA 2VH0A 1V2MT 1UO6A 1GL1A 1YPHE 2QXIA 3PV5A 3OTJE 1QRZA 1D6RA 3GDSA 4BXSA 2VWNA 2G55A 1MH0A 2V3HH 4JZFH 1O2KA 3PMAB 3I29A 4HI3A 2ALVA 2WPKS 3ZZCA 4MPWA 3UWIA 1A3EH 3RM2H 2PHBA 1C5LH 1XUJA 3GY4A 3O8CA 1MKXK 3ZVCA 3MH5A 4YT6H 3TGIE 3UB0A 2GJGA 5DG6A 5C3NA 2ILNA 4J1YA 4UE7H 1GBLA 1MAYA 4FXGH 2RDLA 4X1SU 1V2UT 1GPZA 1V3XA 1O2GH 1JRSA 1NROH 3A7YA 1Z71A 5AHGH 1GMHF 4OS2A 3UR6A 3MH6A 1E34B 4A7IB 2G5NA 1SHYA 3FO8D 4HFPB 3KF2A 4QT8C 2ANYA 1E79D 3CP7A 2CHAC 3QK1A 1SG8B 1AKSA 4AB9A 2F91A 3E0PB 8KME2 1GI0A 3OFND 2HGTH 4X8TH 1K28D 3MMGA 3H7TA 4YXWD 1GHAG 4DG4A 1HRTH 3URCA 2XC0A 2XTTB 3BTTE 2QF4A 1FUJA 1BIOA 5HM2A 1DY8A 1SHHB 1W10U 3TGJE 2R2MB 3BEUA 3RXBA 2J34A 1Z1IA 4ZXXH 1QBNA 1SQRA 1ZSJA 4X2XA 3ATLA 4FUIA 1HXFH 2FTLE 1MD7A 5GPIB 5HYOA 2PGQB 1C5TA 3E90B 2BQWB 1MMJN 1DPOA 2V0BA 1OYTH 4GAWA 4U01A 1S6FA 3QDZB 4MNYA 5DP4A 5DP8A 5HMAA 2XBWA 4U2WA 1TB6H 5C0UA 4MPXA 1O2NA 1UVPA 1GHYH 4JZ1A 1TYNA 2HRVA 1AO5A 5ETXA 1UTQA 5TCAA 4RN6A 5E8EH 5DP9A 2P94A 2CXVA 2FLBH 1QURH 4ISLA 4KP0A 1ZHMA 4HGCA 1PYTC 2JH5D 2BDAA 3MNXA 1E35B 1K0HA 1VJ9U 4RI0A 1K2I1 1C2IA 1LVYA 2Q6FA 3ZZ8A 3P8NA 1O38A 4M7GA 1LVMA 3ZV9A 1T8NA 1BJVA 2PLXA 1P06A 1T7CA 5FAHA 3LGVA 5DP5A 4NSVA 1WTHD 1W7XH 2STAE 5CDFE 3F1SB 1Z8JB 3AAUA 3U28C 1QY6A 1P2MA 2IJOB 4GLYA 1IQEA 1DDJA 1H9HE 5T3HA 4DY7B 4U30A 4NG9H 4GCHF 5LPEA 1VGCB 1ELGA 2BD3A 3SZNA 3M3SA 1QBOA 3MNBA 3MH4A 5F8TA 3W1EA 3W94A 4Z0KA 1E1RD 2RFKC 3PLPA 5C17A 2SNWA 2ODPA 2FX6A 1DSUA 3SJKA 1C5WB 5EQSA 2NU4E 1OKXA 3R0FA 4OGXA 1MQ6A 1WOFA 4Q63A 2KX4A 2W6ID 4K8BA 3N7OA 1YYY1 2AHME 2QGRA 4IN2A 1Q31A 4CREA 2TBSA 1Z6EA 3TJNA 2VIWA 3V0XA 1O3JA 1DWBH 3LGWA 1MUEB 2FMJA 2G81E 2XNIA 3NZIA 3SNDA 2WV9A 1SGQE 2J94A 2PUQH 1W3CA 2YOLA 2P3TB 2C90B 3LGUA 5L2YH 3A80A 3LPRA 4ISIH 4BTIB 3ZZAA 3HK6B 3EAJA 1Z6JH 4ZHAA 5A0BA 2GX4A 1YPLH 1DLEA 1GHZA 1KSNA 1HAPH 4DIIH 1SGTA 1K1MA 2AH4X 1IOEA 1XX9A 4LZ4B 3AW0A 5AVDA 3DSGA 4IGDA 1P0SH 2M5TA 1KDQB 1NTPA 4A1TA 1SR5C 1SGRE 2VIDA 3SV9A 1S6HA 4TT3D 3F2GA 2PKSB 1O3GA 3PB1E 1GVZA 1DT2A 1QJ7B 1HUTH 4WXIA 2F9UA 2ULLA 2GP9B 3F9EA 4JYUH 1DM4B 4NWKA 4WJG2 1D3TB 2XWBI 2BDHA 2ZIQH 3FAOA 2Y82A 2KCYA 1PJPA 3FFGA 1NRQH 3EYDA 1ZYOA 3A86A 3RXGA 2ANMH 4WXVA 3U8OH 4I31A 3HKJB 3PWBA 1G2LA 3LOXA 1GBFA 3IITA 3VEQB 5JBAS 2BD5A 1EASA 4MG3A 1B5GH 1HAIH 3E8LA 4CR5A 5EXLA 4NIYA 1IQLA 3P8GA 4X8UH 8GCHF 1IQJA 1CT2E 1ABJH 1M9UA 1W8BH 3QWCH 1EB2A 4UFEH 4Y6DA 3BTWE 3GY7A 1C1UH 3FANA 2UUFB 3KQCA 3QGJA 1FN6A 1LHFH 1AI8H 1JWTA 2VWOA 1SQAA 4ZUHA 3SV6A 1P2QA 2W7SA 2FXRA 4NA8A 1PFXC 2ASUB 5T6DA 1TMBH 5JB8S 3LDXH 4U32A 3STJA 1O5CB 2DE9A 4UFDH 3VPKA 1XKAC 3TPIZ 1V2TT 1H9IE 2VWLA 1W0KD 2CV3A 1VR1H 4Y76A 3NK8A 4E06H 1W13U 3SJOA 1C2JA 2Z6BD 4Y0ZE 1T4VH 2UWLA 1CQQA 2VNTA 1C9TA 3Q00A 4ZKSU 1MBQA 1QRWA 2A4QA 2B9LA 3DA9B 5EW1H 3MU0A 2UWPA 1GL0E 8GCHG 1Q3XA 5FX6A 1TABE 1SOZA 4TWYA 3BTQE 1YF4A 1WAYB 6LPRA 3PMHB 4ZMAH 5EXMA 1N8OC 1KDQA 1THPB 2OINA 2A7HA 1TIOA 4Y8YA 2A7JA 5DSFA 1Z8RA 3ATIA 1FNIA 1SBWA 4MQAA 4ZKOU 3A7VA 2NU2E 7ESTE 1BTZA 1IQIA 2DE8A 3BG4C 1TNKA 3RXOA 4Y0YE 1OWJA 3DUXH 1C1OA 2VIVA 1A0LA 2NU0E 4XDEA 1O2OA 3S9AA 1O2SA 2BD7A 1EJNA 1G9IE 1TA6A 4X1NU 2M2AA 3UTUH 3V3MA 3V13A 3Q77A 4CBNA 2JIZD 3RMMH 5FPYA 1QFKH 2QF5A 2GCHG 2QIQA 1GI1A 5CHBA 2Y7ZA 4FUJA 1K22H 3C27B 2D1JA 3PLKA 4P02A 1GHBG 3RXEA 2A5KA 1UMAH 1CVWH 3NXPA 5J4SA 5C20A 1Z1JA 3OY6U 1BBRK 1TBRH 3VB4A 1ZTJA 4CH2B 2I6QA 2FM2A 5DGJA 3W95A 1EP6A 2BQ7B 1LCYA 3NUMA 1GHWH 4ISHH 3FN8A 1LPGB 1PPHE 1TGBA 2WUBA 3I77A 2W26A 1K1LA 1MU6B 1NRSH 1SFIA 3A8CA 2ZCHP 3BTGE 4ZHLU 2Q1JA 2Y7XA 4OS5A 5EODA 5E2PA 3A7XA 4BOHA 2AIPA 2ZPQA 1SGYE 3MWIU 2PP6A 3SO3A 1DUEA 1HAGE 4KTSA 3UOUA 1QNJA 2WYGA 2AMQA 2FOGA 3C1KA 4LZ1H 4O3TA 1NRNH 1NS3A 4Z1MD 1NU7B 1XVMA 1N8OB 1C5XB 4M9FA 2CF8H 1TRNA 5FL7D 2F3CE 1Y3UA 1V2JT 6GCHF 4JZDH 1ACBE 3SJIA 1KTTB 2ZI2H 3FVFB 5EJLA 1GJ9B 2O8LA 1C5SA 3OEHD 3K6YA 1HLTH 4D76A 2BZAA 2LPRA 4Q7YA 2AEIH 4ABJA 2C8ZB 2ZZUH 1GMDF 4XBDA 1T31A 2FS8A 4NSYA 4FU7A 1TA2A 1GI4A 3S7KB 2V7QD 4IS5A 2CK3D 1NFXA 1TOCB 1C5UA 2ALPA 1DUAA 1LHGH 1NM6A 1KXFA 1HAYB 5C1UA 3RMNH 5GWZA 3EQ0H 5A09A 1G36A 2ZDNA 2CGAA 1KXBA 1TNLA 1ARBA 1Y3XA 1SQOA 1BMMH 2BVSH 2BMGB 3PO1C 1HAOH 3ZZ3A 5DJ7A 4B6FA 1ABIH 3F6UH 1Y3YA 2WPIS 1W14U 3GY3A 4A1VA 2HLCA 2Z9LA 2F83A 1S0QA 3AASA 1DSTA 1FPCH 2HWLB 3O8DA 4KTUA 2VGCC 1GJ6A 2AFQB 3QX5H 3RM0H 1UVTH 2ZDKA 1MU8B 2ZECA 1MD8A 1COWD 2OC7A 1SLUB 1T32A 1ID5H 7GCHF 4NGAH 1ETTH 4UD9H 5I46H 1WV7H 4ASHA 1AB9B 1BTHH 3MU1A 2C8YB 1QZ8A 3ZZ5A 5TCCA 2BY7X 3SU2A 1G3BA 2STBE 4FVDA 2ZGXH 3ZZDA 1GG6B 1Y5AT 5C1XA 4Y10E 1TQ7B 3MTYA 2RA0A 1F5LA 1O35A 1ZPBA 2QN5T 4UEHH 2FLRH 2FESH 4KELA 2FOAA 1DVAH 1NT1A 4AB8A 3NPSA 3PLBA 1V2VT 1SGEE 2KCAA 4KGAA 2KAIB 4D7FA 1WQVH 2Y80A 3PMJA 5LGOA 5C67A 1ELFA 3ESTA 1LKBA 1TQ0B 2YNAA 1KLIH 5H4IB 4BNRA 1FY4A 1XUKA 1T8MA 1BRAA 1QCPA 3FP7E 3RXPA 1BT7A 2BX4A 2ZDLA 5FBEA 3SUDA 3BIVH 2BY8X 2FTMA 2XYAA 2ZGBH 1O3HA 1W0ZU 1NBME 1QJ6B 4Q2KA 2R3YA 2J5UA 1AE8H 1T4UH 4AC9A 1A3BH 1C2FA 1AY6H 2BD2A 2XBXA 3AAVA 2ZFPH 1WCZA 1F0UA 4YT7H 3U9AH 3ZV8A 5GNDA 3TNTA 5J4QA 5BPEA 2ANKH 4BXWA 2LP6A 1XMNB 5C2ZA 2GCTB 4I8HA 2L74A 2R9PA 1PPFE 1C5NH 3P8FA 3TLOA 2VBCA 4THNH 5FCKA 2OC8A 2VGCB 2O8WA 1FONA 1F92A 6ESTA 5EW2H 1ETSH 4RKJB 3A85A 4D9RA 3I78A 1VKYA 4MNXA 4UDWH 1SL3A 1A2CH 3EA8A 4FETA 1GJCB 3TU7H 1SSXA 2BD8A 2VWMA 2J2UA 1GI7B 4ABHA 4I7YH 1S84A 2WPMS 1GHVH 1BRCE 1TALA 1DITH 1ZSKA 3OY5U 1MKXH 4O97A 1HXEH 2AIQA 1AE5A 4OM9A 2PGBB 1NN6A 4TWWA 5FHTA 3RDZA 1TNIA 3K65B 1O0DH 1F2SE 1WSSH 5A8YA 5CHAB 4AGJA 1FY1A 1EJMA 1AWFH 5GIBA 2Z3CA 1GHAF 4VGCC 3T25A 1O33A 2G4UA 1TBQH 1HAHH 4K8YA 5EGMA 3A8DA 1NPMA 2XW9A 1ESAA 2PV9B 2GV7A 2UUJB 3M3VA 3TH2H 3K9XB 3SUFA 5IYTA 3SI4H 1CE5A 2ZU2A 2KAIA 3ZVAA 1LDTT 2SGQE 1GBTA 2H5CA 1MTWA 2GVFA 2GDEH 3MO3A 4KTCA 4X6PA 2R2WU 2H9TH 3BTFE 4IMQA 1C1SA 2D8WA 1SMFE 1QQUA 4CHAC 3L33A 2QXHA 1JXPA 2XC5A 4ESTE 3ENSB 1UTOA 3DT0H 1H4WA 3U8RH 5C5OA 1QL8A 3NWUA 1A61H 3A7ZA 1QHRB 1S85A 4CH8B 1MTVA 1L2EA 1GJDB 2PSXA 3PTBA 2GT8A 5EQRA 3M7QA 4SGBE 3K6ZA 1FI8A 1XKBC 4INKA 3UNRA 1THSH 1MTNC 2IOTA 1SGPE 1LQDB 3RUOA 4P00A 1O31A 3E1XB 5C1YA 3D49H 1QQ4A 1C5YB 3D23A 1XUFA 4I8GA 4K3JA 3SU4A 2HPQH 4ABAA 1D6WA 3N99A 3RC6A 3CS7A 1QIXB 4XFQA 1G3EA 1P8VC 4TY7A 3B8JA 1ZTLA 3E0NB 4NA9H 1B7XB 2Y6TA 3BEIB 1TAWA 3ZVFA 1GGDC 2WPHS 5EPNA 2FOFA 1AVGH 4INLA 4K1EA 2J4IA 2PTNA 3ITIA 2W3IA 2ANWA 5JDUB 1P09A 1C2GA 4YOGA 1UJ1A 4WH8A 4NIVA 1P03A 2J9NA 4FU8A 1KY9A 3KQEA 5AF9H 2EY4C 3VXFH 3ATKA 2VU8E 4FUEA 1A0JA 4X1PU 2O8UA 1HJ9A 3D62A 4TPYA 1UTNA 1O2TA 2O8TA 4WF8A 4K60A 1UTLM 4GPGA 1DXWA 1CA0C 4FUBA 3F68H 1LMWB 3WW7A 1EZQA 4JK5A 3PWCA 2C3SA 5HGGA 1O3DA 4CHAB 1C1TA 2CHAB 3K2UA 4BAHB 4I8JA 1QR3E 5JBTA 1HDTH 4BAMB 3U1JB 2FOHA 2BDCA 1FMGA 2H5DA 1K9OE 2EI8A 2EI7A 5DP6A 1AFEH 2G4TA 1O36A 3DHKH 1O39A 5EG4A 2BX3A 5DK1A 1TRYA 4AFUA 4F55A 1MTUA 1RRKA 3ZIAD 3L6PA 3AVZA 1ZMJA 1KXCA 1MAXA 1ZJDA 1CBWC 1KXEA 3AK5A 1S6LA 1QA0A 2THFB 2GDDA 1ELEE 1GI5A 1P2NA 3SORA 2GGVB 2GT7A 5FCRA 1ZTKA 1YC0A 1RIWC 4ABBA 4DW2U 1C2KA 1XUGA 2FOEA 1L1NA 4NIWA 1P11E 1C2EA 2V6NA 3VGCC 1NRPH 2BLWA 1HCGA 3WY8A 3UIRA 5C5NA 1BMNH 4Y7AA 1LO6A 1GVLA 1OYQA 1UVOA 5FXLA 4A1XA 5FPTA 1GBCA 4FUCA 3BN9A 3MOCA 1YLCA 1AD8H 1DWCH 1H9LB 1KXDA 2G51A 1YPJH 1YKTA 1OWDA 2QV1A 4IC6A 3P8OA 4YESB 3SHCH 1INCA 1QB6A 3SNAA 3Q3XA 4JMYA 8LPRA 3RMLH 1TONA 2BOHB 1UCYK 2G00A 3DD2H 1VITG 4PROA 1BTUA 1E36B 1YY3A 1O37A 3F3BA 4LK4A 3SNEA 1PPCE 2HNTE 3LC3A 3MFJA 5KEDA 2ZCKP 2ZFTA 1OOKB 1ELTA 2JETC 2UWOA 1BBRE 1ZJKA 2IPQX 5GCHG 3ZVEA 1EX3A 1PYTD 1DE7H 3TJOA 3DFLA 2W7UA 2PWXA 2ODQA 5B6OA 1TNJA 4ACBA 3VG8A 3OSYA 4H6SB 3TNSA 1YWUA 1O2YA 3BEFB 1CGJE 1O2JA 1O3IA 4ZKNU 1LQEA 3SUEA 3LGTA 1A5GH 1NFYA 3VXEH 1FY5A 1YGCH 1ELVA 3S9CA 2ZHDA 1O2LA 2A5IA 1K1JA 1O2RA 2EEKA 2P3UB 3OE7D 3FP6E 2JJ2D 2ZFFH 3CENA 3UQOA 2ZU3A 3N7DA 1GBHA 4SGAE 1TGTA 3SOSA 2CN0H 4WY3A 1OX1A 1TNGA 1RIWB 1UK4A 1O3MA 1TFXA 1TOMH 1C1QA 2G5VA 4DIHH 1LHCH 1E1QD 2AYWA 4YTAA 5LH8A 2ESTE 2G52A 3TK9A
chains in the Genus database with same CATH topology
2PFEA 3LGIA 1FXYA 2BY5X 3SV2H 2OD3B 3SU3A 1TGCA 2FOBA 5IDKA 1F0RA 5A8ZA 1PQ5A 1C5MD 1O3AA 1D3QB 1P01A 2XCNA 2Z7FE 1NC6A 2J38A 1ARCA 3MYWA 2P8OC 2GTBA 1FIWA 2SFAA 2ZC9H 3GCOA 1N1LA 2AMDA 4ZXYH 1C1RA 1YCPK 3LIWA 2GCHF 1KYNA 5E2OA 1A46H 5HXFA 2OQ5A 3OYPA 1DX5M 4H4FA 2B5TB 3HKIB 3D65E 4B2BA 1GHBF 1TMTH 1CT4E 3UOPA 2JETB 3E91A 4B74A 1JOUB 2IN2A 1LKAA 1GHXH 1FDPA 3STIA 4AFQA 1THRH 2QC2A 1QGFA 3BTEE 3G01A 4XOJA 2BTCE 1EPTC 1ELAA 1P2KA 4NIXA 1GBKA 3H5CB 4WWYA 3RXTA 1ANDA 2W5EA 5LPFA 1ANEA 2Y5HA 3OU0A 1LVOA 1TPAE 1C4U2 2FEQH 2BDGA 4A5TS 1B0EA 1O2HA 2P93A 4LOYH 1U6QA 2VVUA 1BBRH 4UFFH 4FUDA 1V2OT 1LHEH 3OX7U 3VB3A 1ZZZA 4GUXA 2CF9H 3GCTG 1P2IA 1WU1A 1GMCG 1DOJA 2TIOA 2P95A 1BUIA 4DCDA 4K5ZA 1A5HA 2WPLS 1TE0A 2NU1E 2JKHA 1IHTH 3GICB 1KIGH 1L4DA 4MNWA 1GBJA 3HPTB 3HGNA 2Z9IA 1AFQC 3TITA 1MKWK 2FYQA 2AS9A 4WMDA 5DKMA 3T26A 1QB1A 2QAAA 1AN1E 1EAIA 4CRDA 1C2LA 4YLUA 4Q7ZA 1RGQA 1D4PB 4MVNA 1F0TA 3BIUH 3HATH 4KKDA 2TGDA 1BTWA 4A6LA 2GMTC 4B76A 1O5FH 1TPOA 3PTNA 2H6MA 1ANBA 1FZZA 3RXSA 4F49A 1GI3A 1T8LA 4BAOB 4OS4A 1BTPA 1L4ZA 1N6XA 3A82A 1OS8A 1VZQH 3SBKA 3VB5A 1GBEA 2GZ8A 2PW8H 3SUGA 3S7HB 4ISNA 4JYVH 2FI4E 1OP8A 1EP5A 3UWJH 1O2XA 2HPPH 3UUZA 3LT3A 4DGJA 3BV9B 1SQTA 3KEEA 3MNCA 4O03A 1DLKB 4RSPA 1UTJA 2C8XB 2Z94A 1MQ5A 3BG4B 4I32A 2LNCA 2FZZA 1NU9A 3RXDA 1TX6A 2W3KA 2SNVA 3EA7A 1TBZH 1IQHA 3GOVB 9ESTA 3GCHC 3QN7A 1B0FA 3RXVA 1JMOH 4E7NA 5DPAA 1GI9B 2RCEA 2VIOA 1EATA 1C5ZB 3FP8E 1GBBA 1EXFA 1O3KA 2JH0D 1UTKA 2EC9H 3KNXA 1RFNA 3GYMA 1ESBA 3E3TA 1YPGH 3RXLA 1GBIA 4DVAU 3L3TA 1EUFA 5EOKA 1GJ8B 1TGSZ 4Z6AH 1FQ3A 2ZHQH 2BVRH 2IPHA 1TX7A 1CHOG 1V2WT 2UUYA 5JBCS 1ZLRA 1SLVB 5SGAE 1P3EA 1VCWA 4K2YA 1EAUA 1GCTC 1O3BA 1A5IA 3LU9B 1T8OA 2GMTB 4OS7A 4FUGA 3HGPA 1C9PA 2ZPSA 4D9QA 1C1WH 3RXRA 1P57B 1AU8A 3F9GA 1G30B 4X6MA 3GY6A 2BOKA 1EAXA 2CJIA 5F8XA 1YPHC 4R8TB 1H1BA 1UK3A 3H7OA 1SGNE 1F5RA 1V6DA 3A88A 2I6SA 5L6NH 1LPZB 4X6OA 1RD3B 2OC0A 3BTKE 2ZQ1A 1ZGIA 1VITH 1L1GA 5GXPA 1C1MA 2J92A 1E38B 1C1NA 3BF6H 3S0NA 3ZZ9A 5ABWA 3GCHB 3M7TA 4YZUA 2A2XH 2QCYA 2FDAA 3A87A 2EA3A 2NU3E 2QXJA 3JZ2B 3GY5A 4ABGA 1ETRH 3P17H 3SV8A 1CGHA 1MBMA 2FO9A 3UQVA 5DP3A 3QZQA 2R0LA 2TGPZ 4AG1A 4FUHA 3SJ8A 1OWKA 1GBAA 1F5KU 1K1IA 2ZF0H 4IW4E 4K1SA 2SGFE 2WPJS 4AX9H 4AYVB 5DO4H 3O8BA 2QY0B 4J2YB 4B73A 2GD4B 4D7GA 2FWWA 2R0KA 3PO1B 1HYLA 1HGTH 1FJSA 2FIRH 2ZDVH 1P9UA 1H8IH 1PQ8A 4AG2A 4X6NA 6CHAC 2B8OH 3KN2A 1L1JA 4NZLA 3SW2B 1YBWA 3B23B 3GY2A 2QXGA 1Z8GA 2YNBA 5AFYH 1P2OA 1F7ZA 3EDXB 3GDUA 3SHAH 2ZHEH 2ZTZA 4MLFB 3SNBA 2Y81A 3LC5A 2Q6GA 1ZMLA 2AGGX 3RC5A 7LPRA 9LPRA 1SLWB 2BLQA 1G2MA 1GDNA 3VB7A 3QZRA 3FZDA 1PPGE 1SB1H 3ODFA 1RJXB 2HNTF 1DWDH 3ZZBA 2ZP0H 4H42U 1Y8TA 1P05A 2BDBA 1PQAA 1ZPZA 1WYKA 1NFUA 5ESBA 1OP2A 2J95A 1S83A 4GSOA 4IN1A 3KGPA 1Z7KA 1W12U 1EAWA 1OSSA 1MZDA 1FY3A 1C1PA 4CRCA 1JBUH 3M5LA 1OWHA 2JH6D 4NA7A 1WTGH 3SU0A 3GCNA 1DICA 3TH4H 2Z3DA 2VH6A 4CBOA 3RXMA 1V2RT 3O8RA 2P16A 2BD9A 3RXIA 3UY9A 4FU9A 2F9VA 2VVVA 1NY22 4CRBA 1ELDE 2Q6DA 2WYJA 4F4OC 1ZR0A 3LJOA 5G4BA 2BDYA 3RXUA 1ZGVA 2ZU1A 1P02A 1SC8U 4X2WA 2R3UA 3UNSA 3LONA 4IC5A 5I25A 2Z9GA 3EGKH 1IQGA 2BXUH 2BYAX 2WINI 1TPSA 1AZ8A 2A4RA 2ZFRH 2C93B 1BQYA 1YPEH 3MHWU 6CHAB 4NCYA 1EOLA 3MI4A 3M35A 4O9VA 3A83A 3TIUA 2A4OA 1A0HB 1UVUH 2PSYA 5EXNA 3U98H 1TX8A 3GDVA 5DP7A 3ZYDA 4ABEA 2A1DB 3A7TA 1SVPA 1FAKH 2SGEE 1TPPA 4XBCA 4AORA 2TGTA 3SJ9A 2XCFA 4MDSA 1EB1H 1BJUA 4JZEH 1BMAA 1P10A 1FAXA 1UCYE 3KQBA 1O2QA 2ZO3H 2BY9X 4I8KA 2BY6X 1V2NT 1Z8IB 1O2UA 1VGCC 4UONA 3SN8A 1O3NA 3RXJA 5F03A 4DT7B 1NZQH 4MNVA 2PKAB 8ESTE 3Q3KA 5E0HA 4ABIA 3MNSA 2FP7B 2GV6A 1O5AB 1WUNH 3RU4E 4ISOA 4VGCB 1O2PA 3ZZ6A 1FPHH 4NZQA 3RU4D 1CU1A 1G32B 2RA3A 1EKBB 1AMHA 1KLTA 3LJJA 4D8NA 5F8ZA 1RS0A 1LVBA 2OUAA 1O3FA 1A4WH 1QL9A 5K7RA 4IMZA 1GMHG 5A0AE 2HALA 2A7CA 1HNEE 2F9BH 3URDA 4X2VA 2ZNKH 3ZVGA 1O3LA 3RU4T 4AOQA 1O32A 2WV4A 4JCNA 3F9FA 3PV4A 1C2DA 1JIRA 3GYLB 2Z3EA 2QF0A 3SU1A 2ZDMA 3T62A 4XBBA 1BZXE 3SQHE 2HNTC 1CA8B 1TLDA 1ZHPA 1AZZA 1BMLA 1K1PA 1SOTA 2ODYB 4K69A 2BLVA 4X8VH 1GBMA 1O2ZA 1UK2A 2PUXB 3DFJA 1GJBB 2A5AA 1MZAA 5L2ZH 3MU5A 1O5BB 1O3CA 1V2QT 2ZU4A 1RTLA 4DJZB 1AUJA 2PKSC 4BANB 5AFZH 1MTNB 5JBBS 2A2QH 2ZGJA 1TNHA 2XC4A 1SFQB 1VITF 1S82A 5EPYA 1EJAA 4OS6A 4NWLA 5E0GA 1EOJA 1YPMH 2UUKB 2BD4A 3IG6B 1N6YA 3QLPH 3RXFA 2C8WB 3S69A 5GCHF 4I33A 1CGIE 3QTVH 2V3OH 5E0JA 1WQSA 2A31A 1GGDB 1AQ7A 1BRUP 1A7SA 1G3CA 3QTOH 4TPIZ 2FX4A 1UCYH 1O30A 3QGNB 3PYHA 3UR9A 1HAVB 1UTMA 3V12A 1GJ4H 4LXBH 2OP9A 1C2MA 3MO6A 1P04A 1QB9A 3M7UA 2PKAA 2AMPA 1LPKB 4H6TA 1XXDA 1O5EH 1SGIB 1OPHB 2QF3A 2ZGHA 1V2ST 1IQNA 4CRGA 4E7RG 2VIPA 1TRMA 2XWAA 3P92A 2FYRA 1HIAB 1AVXA 1CA0B 1AUTC 2XXLA 4X1QU 4GCHG 1D9IA 1O2IA 2ZGCA 1PQ7A 4YM9A 4Y7BA 1J9CH 1ELCA 3TK6A 2SGPE 1CO7E 1UVSH 4O3UA 1C5RA 2C4FH 4TYDA 3TGKE 4ABDA 2GZ7A 4B71A 3E6PH 2XRCA 1HFDA 1IAUA 4CRAA 2FOCA 2RG3A 1PPZA 2H9HA 2GZ9A 3QO6A 3M3TA 4AN7A 1ZRBA 2FPZA 1EZUC 2H1UA 3RP2A 2ZHFH 4BAQB 2ZFQH 1VCPA 3SI3H 2OXSA 2WV5A 4BTUB 4X8SH 2BXTH 1K1OA 3ELAH 4K1TA 1SGFA 1SLXB 3RXCA 1X7AC 2OBOA 4X0WU 1CBWB 2TRMA 1YLDA 5T6FA 5GDSH 5EU8A 5CE1A 1GJAB 2FOMB 3SGAE 2A45B 4FVBA 1J15A 4GHQA 3ZZ4A 3T5FH 5CMXH 1QL7A 1WBGB 2BVXH 3ODDA 1J17T 4AFSA 2PR3A 3IWMA 3VGCB 1V2PT 4JYTA 2OCVB 3NCLA 1YCPH 1BHXF 1H8DH 1YP9A 2P3FH 5L30H 4GHTA 4OGYA 3TJVA 1HAXB 1O5GH 1BOQA 1ZRKA 1XXFA 1EQ9A 3RXHA 3M61U 1ZPCA 2VVCA 3BSQA 1C5PA 3GCTF 4WH6A 1GMCF 1UHBB 3TJUA 3F9HA 1EZXC 1DY9A 1HAVA 3M5OA 5A8XA 2BQ6B 1HJ8A 1O2VA 2ZTXA 2ZDAH 3T29A 4AFZA 1Y5UT 4OS1A 3A8BA 1GDQA 3ZVBA 2B0FA 2XBVA 3EA9A 3GY8A 2A4GA 3T2NA 3LGYA 3ZYEA 1D3PB 4YLQH 1BDAA 5F6MA 3RMOH 1Y59T 3U69H 1DXPA 1KLJH 2OBQA 1C5VA 1NO9H 2ZHWH 3UREA 1HIAA 4JK6A 2FI5E 2A32A 3SU5A 1W11U 1GDUA 4A92A 4X1RU 4MPVA 1J16A 3MU8A 2SGAA 2WUCA 3P6ZB 1PPEE 4FUFA 3LH3A 2ZFSA 2HVXA 3KIDU 4ZH8A 1GI6A 1O2MA 3Q76A 1MKWH 1GI8B 1K21H 3A89A 1OXGA 1BA8B 4ABFA 2D2DA 1TGNA 3TVJB 4Y8ZA 2FS9A 1C5QA 3MO9A 1NESE 1O3EA 4NFEA 1HBTH 3LKWA 1Y5BT 1ANCA 1L0ZA 4TY6A 1ZOMA 3ZZ7A 1HAZB 1TWXB 4XE4A 4ZROA 2HOBA 3RLYH 2FI3E 4YOIA 5FPSA 2B7DH 2FODA 1O5DH 5T6GA 1O2WA 1HPGA 4WMFA 3RXKA 5GJ4B 4JZIA 2BHGA 1LHDH 1A1RA 2P8OB 4GVUA 2VIQA 4YOJA 1W2KH 1ELBA 3RXQA 3SGQE 5FX5A 2ZQ2A 2SGDE 2F9NA 1SGCA 3QUMP 1QRXA 2BB4A 1GJ5H 1JIMA 1S0RA 2GKVE 3SU6A 3ATWA 1W0YH 3Q3YA 1ZSLA 1FN8A 3R3GB 1NFWA 1P9SA 2BZ6H 4BTTB 3MH7A 2ZEBA 4WMEA 3U8TH 1FY8E 1P12E 4I8LA 1CHOF 3ATMA 5FBIA 1BTYA 1AIXH 2ZA5A 1DS2E 2O8MA 3HK3B 3VB6A 1BB0B 1EPTB 4INHA 1XM1A 1DFPA 4Y79A 3M5MA 1UHBA 4NFFA 1C1VH 1E37B 3KCGH 2Y5GA 1AB9C 2AERH 1QTFA 3SV7A 1E0FD 2P59A 2ZU5A 4AZ2B 1HJAC 3RXAA 1BTXA 3T28A 3BG8A 4Y71A 1KXAA 1GG6C 2DUCA 3UFAA 3AW1A 1FIZA 1GBDA 4MTBA 2ZPRA 3B9FH 3KQDA 3NKKA 1G37A 1IHSH 1SI5H 7KMEH 2VB0A 1AFQB 2F9PA 1V2KT 3MU4A 3TK5A 1ESTA 1DWEH 1K1NA 1D3DB 3BTHE 3V7TA 3P70B 2V35A 1KTSB 2QYIA 1AHTH 4IBLH 1TMUH 2D26C 2TPIZ 4UFGH 5HM9A 1IQKA 2EI6A 4YO9A 4B1TA 3S9BA 1YPKH 3KHVA 5EQQA 4ZHMU 1UTPA 1DANH 1XUHA 1EZSC 1CT0E 3T27A 1BCUH 1OWIA 3M5NA 1O3PB 4AYYB 2OC1A 2BM2A 3M36A 3RC4A 1C2HA 5JPMH 2GCTC 5PTPA 6GCHG 3UNQA 3TH3H 3PROA 1OWEA 1ZMNA 1Q2WA 3A7WA 3SQEE 4B2AA 1G3DA 1C4V2 1J14A 1J8AA 2AGIX 4WVPE 4XSKU 3U1IB 1AWHB 5BRRE 3FZZA 3SNCA 3PMBB 1YCPM 3KL6A 2H2ZA 2ZTYA 1BHXB 2BLOA 1RXPA 1GWAA 1Y3VA 1GMDG 1QA7A 4CR9A 1HV7A 3BTME 2BDIA 1ORFA 1AVWA 2H9EH 1JRTA 5LPRA 1HJAB 1XVOA 3A84A 4X2YA 1EPTA 2OQUA 2ZCLP 1F0SA 3A8AA 1S5SA 4RKOB 4MPUA 2QA9E 5ESTE 4BAKB 2K1QA 3LH1A 2F9OA 2OLGA 4ZAEA 5CHAC 5A0CA 5JB9S 1XUIA 1CSOE 5TJXA 4E05H 1CHGA 4B2CA 3CS0A 1O34A 2XBYA 1MCTA 1PPBH 1GI2A 1QBVH 1GJ7B 2OTVA 4CRFA 1S81A 1NRRH 2CMYA 1LTOA 1V2LT 1AKSB 2A0QB 1GCTB 1C4Y2 1YM0A 7GCHG 2NWNA 1FLEE 4Y8XA 1P2JA 1IQFA 1GVKB 2ZG0H 5A2MH 1GCDA 3BTDE 5JYIA 1RTKA 1SGDE 1IQMA 3P95A 4R0IA 1BRBE 1QJ1B 4Y11E 4DURA 1MCVA 4HTCH 3RLWH 4DOQA 3ZVDA 1FV9A 3UPEA 1BITA 3PM3A 3JZ1B 3GISB 2VINA 3M37A 1SPJA 1Y3WA 4B75A 1RTFB 1SGFG 1ZHRA 1O3OA 2Z9JA 4Q7XA 4ZKRU 1HB0B 3VFEA 1VJAU