1O31A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
molecule tags Hydrolase
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o31A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o31A02
4OS4A 2CMYA 2WUCA 3S9CA 3L6PA 3UOUA 2Y7ZA 1L4DA 4UDWH 4Y11E 1P06A 5A0CA 1GI6A 3RXMA 1NC6A 3VB7A 2AFQB 3RXEA 1AVXA 1LVOA 1O0DH 4AGJA 3K6ZA 1YC0A 3M5OA 1C1SA 4GSOA 4X1PU 3SV8A 3IITA 1V2VT 4YT6H 1FAXA 3NWUA 3WY8A 1OYTH 4AB8A 3I29A 4AFQA 4ISNA 1BHXB 3BTKE 1MMJN 1QB6A 2J2UA 4DJZB 2GTBA 1FI8A 1SGFG 5FXLA 1SGQE 4D9QA 1F5RA 1TPOA 4XFQA 4Y6DA 1FXYA 2QAAA 2WYGA 2A32A 6CHAB 4M7GA 2WPLS 1W7XH 5ETXA 4HGCA 4UFGH 4HZHA 1MZDA 1GI1A 1FZZA 3R3GB 1LVBA 2F9PA 1AB9B 1SC8U 3E8LA 3T2NA 4Y79A 2PLXA 4U01A 2BY7X 1MQ5A 3M5LA 2F3CE 2ZDNA 1CT0E 8ESTE 2Q6DA 1SL3A 3FP6E 1SQTA 2UUFB 4JK5A 1TB6H 2SNWA 3QDZB 3RDZA 2AMPA 1OOKB 3PB1E 2UWOA 2TGAA 3KCGH 2UUYA 1W0YH 3RXLA 5LH8A 1EZQA 1KYNA 2H5DA 2BVRH 3ATIA 3MMGA 3Q3YA 5EXNA 3P6ZB 3LH3A 5FHTA 4TWYA 1MTNC 3EE0B 2A4QA 2EA3A 1C1UH 3SHAH 2GDEH 1YPGH 5DP3A 3ZZ8A 1WQSA 2QN5T 2JH6D 4B75A 1CSOE 1P10A 3K6YA 1ZTLA 3RXOA 3BTEE 3V7TA 3Q77A 5LPRA 1YPJH 1IQKA 2TRMA 4CREA 3UNQA 4X1QU 1Z8RA 3MHWU 3BTFE 3PLPA 3A87A 2PFEA 3KIDU 1JIRA 3E3TA 2QF0A 2ZFSA 1SQAA 1P2NA 1GMHF 1TOCB 4FUGA 1YPLH 2PHBA 1V2PT 2XBWA 4MLFB 2EI6A 3SU0A 1O2PA 4Q7YA 1A1RA 1EATA 3QX5H 3F9HA 3GY6A 2R2MB 1OP0A 1FIZA 1IQGA 4MNVA 2Z9JA 3L33A 3V13A 5DG6A 1HAOH 1D6WA 1N8OC 2Z9GA 4ABAA 3SHCH 1RTLA 2Q6GA 1C4U2 4CR9A 1NESE 1CGHA 3BTGE 2FOFA 2OBQA 2BDAA 1Z8IB 1QBVH 3RU4D 1HLTH 1TGBA 2TIOA 2FODA 3BG4C 1GGDC 3RUOA 1O5CB 1AI8H 2WPKS 4AN7A 5ESBA 1C5WB 1BJVA 4K1EA 1HJAC 3T29A 2P3FH 1W13U 2PUXB 3G01A 3ZZ5A 2ANMH 1MKWH 4X6OA 4Z6AH 1QRXA 4GHTA 3RMMH 3EQ0H 2AMQA 2D1JA 2GX4A 5E0GA 4AFSA 1OP2A 1O3PB 2VWOA 4GLYA 1RIWC 3V3MA 1DT2A 1IQFA 1GBTA 1TPSA 1X7AC 1BJUA 3ODFA 5B6OA 2ZCHP 1F0RA 4JZEH 3SI4H 3HGPA 4YESB 2ZCLP 4MNWA 1ELGA 1AKSA 1BBRE 4K5ZA 4WH8A 2H9TH 3KHVA 3DD2H 1HAVA 1V2JT 3RLWH 5K7RA 1QBNA 3U1JB 3RXHA 4I8HA 1TOMH 1GPZA 5AVDA 1P3CA 1W7GH 1KXFA 4B1TA 3AASA 1TX8A 3QZQA 1O2KA 1HXEH 2A7CA 4MNXA 1SGIB 2OINA 3NUMA 3PWCA 4FU7A 4JZFH 1XMNB 2ZFFH 4X6PA 2SGEE 1NFYA 2OLGA 1C2FA 4ZKNU 3MNSA 1ELTA 2ZHDA 4AFUA 1GWAA 2QY0B 1GJDB 1W2KH 4OS5A 5GIBA 2W3KA 1TNHA 2B9LA 1HAXB 3STIA 1FY8E 1O2WA 1NRPH 1GBIA 1O2GH 1J17T 1XUJA 2PTCE 3SU4A 2VB0A 2AS9A 3DA9B 1GDQA 1RRKA 3KN2A 1LPKB 1YYY1 3RXAA 3A84A 2G5NA 1NRQH 1P9UA 1DVAH 2FOAA 1GHBG 2TPIZ 3LC5A 4X8VH 1N1LA 1P04A 1V2WT 5EOKA 1NN6A 4NFFA 2VWNA 1LVYA 2C3SA 1QTFA 3SW2B 3MI4A 4LZ4B 1LPZB 2UWLA 1TPAE 1YBWA 1IHTH 1HB0B 2FX4A 1ORFA 2SFAA 3D49H 1HDTH 2BVSH 1XUGA 4MPVA 3TVJB 4ZHLU 1EAIA 3ESTA 1NFXA 1BB0B 1O38A 4H4FA 2QXIA 1QL9A 2BD3A 4I31A 3MH5A 1EZUC 1HAHH 1DY8A 2FIRH 2B8OH 4ABBA 1P05A 2BHGA 5IDKA 5TCAA 3S7KB 1ESTA 4YLQH 1S83A 3UR9A 1V2TT 1Z6JH 2BOKA 1C2KA 1HRTH 1TNJA 1AFQC 4NIXA 1ZJKA 4TYDA 3P17H 5ESTE 2D8WA 4Y8ZA 2J38A 1O3HA 2VVUA 2EI7A 3GOVB 3TH3H 2G51A 5EQQA 2BD2A 1EB1H 3TGIE 1J9CH 1OWDA 2ANKH 3QTVH 4Y8YA 3FP7E 3GICB 3TPIZ 2IPHA 3QGNB 1HAGE 2FO9A 2G8TA 5BRRE 4BXWA 5EQRA 4MPUA 1GI3A 1QRZA 4GAWA 3T26A 3SUEA 5DP7A 2Z7FE 2XC4A 2C8XB 1Y3XA 1GBFA 3BG8A 4KTCA 4TPYA 3U9AH 1IQLA 4XBBA 1SBWA 4X2WA 1PPHE 4BTTB 2QIQA 1YPHC 2GDDA 3LT3A 3PWBA 3FVFB 3TJUA 1OSSA 3AAUA 3HATH 3MOCA 1TA6A 3ZV9A 1IQIA 4X2XA 1DWEH 4R0IA 1FPCH 1XKBC 1G3EA 1G3CA 1O5AB 3E1XB 4WF8A 3GY7A 2OC0A 3LGTA 1H1BA 1KSNA 3KQDA 1YLDA 2BQ7B 4NZLA 2G5VA 4RSPA 2BQ6B 2VINA 1NY22 1V2OT 4PROA 3BEIB 4CHAB 1C2LA 1EP5A 1ZGIA 2C8WB 2EC9H 1AE5A 1SGPE 2ODYB 2XWBI 2Q1JA 4A92A 4X6NA 1VGCB 1NU7B 2IOTA 1HAPH 4JZIA 1CBWB 3RXPA 3RXGA 1GCDA 1O3LA 3CP7A 2OQUA 4QT8C 1MAYA 3LPRA 5DGJA 5EODA 1UHBA 1SLUB 3SUFA 1SGCA 1SPJA 3QZRA 1GJCB 1Z1IA 4GCHF 5C1YA 7LPRA 1C1PA 4ZHMU 2EI8A 1V3XA 4BNRA 1GBMA 2GZ7A 3ELAH 3RXBA 4CRAA 1EJAA 2F9VA 3SGQE 1VJ9U 2SGPE 1ZJDA 1NO9H 4Y0ZE 1UO6A 4O3TA 3PLKA 3P8OA 1ZPCA 1GVLA 1UMAH 1FQ3A 4KTSA 3SOSA 2A7HA 4H6SB 2A1DB 1L1JA 3SGBE 3UFAA 1S82A 2QC2A 4YOJA 1GVZA 3OY5U 1T8NA 2SGDE 1YPKH 3GCOA 1Z7KA 2ODQA 1AWHB 1C2GA 1KXEA 1O37A 2OBOA 1C9PA 3A85A 3UNSA 1EAXA 4WJG2 2ANYA 4NIWA 4INKA 1JRTA 1FY1A 2GZ9A 1GBBA 2W7UA 3C1KA 9LPRA 3SNAA 2WPIS 3SU5A 1SLXB 1GHYH 1LKBA 3E91A 1ELBA 2AYWA 1GBAA 1HGTH 5FPTA 1ELFA 3RXTA 2AGGX 2THFB 1IQEA 3DT0H 1C1RA 1DXWA 2ZA5A 1HPGA 1ZLRA 3BF6H 2FX6A 1A46H 1H9HE 4WWYA 2LNCA 4ZUHA 1SGRE 2ASUB 2FXRA 1NRRH 2BDBA 4I33A 1TE0A 1ZRBA 5GCHG 3UQVA 1HAZB 3GYMA 4NSYA 1NPMA 4K8BA 3RXKA 1HIAA 4J2YB 1M9UA 4WVPE 5FBIA 3VB4A 2ULLA 3EAJA 2BMGB 3B23B 1BIOA 1ZHMA 2FDAA 1TQ7B 2HLCA 2P3TB 2ZU4A 1QIXB 1D9IA 1G36A 1EOLA 2FESH 1JBUH 2FZZA 1VR1H 1A5HA 2P59A 2XNIA 4O3UA 4SGAE 4TWWA 1GHXH 3ZVBA 1PJPA 4CBOA 4NIVA 5HM9A 1TRMA 1O35A 4A7IB 1YCPK 2Z6BD 3TK9A 1ANDA 1XKAC 1Y3WA 4BANB 3MU0A 3Q00A 1TGNA 1ZSKA 1F7ZA 1UK4A 3O8DA 2O8WA 1O3FA 2YNBA 1XX9A 2PSYA 1NS3A 5LGOA 4IC5A 1C4Y2 3ATKA 1BRCE 3ATLA 3D65E 3T62A 2ZGXH 1C5ZB 4ZAEA 4WMFA 4BXSA 4AG2A 2PUQH 4X2YA 3VGCC 2ILNA 1A2CH 3IWMA 4ABIA 1DLEA 3LGVA 2QF3A 2QA9E 1GDUA 3GDVA 1XUFA 1K2I1 4MPXA 1WAYB 1PPBH 4YOGA 5C5OA 3HKIB 1O2IA 2J94A 2FM2A 1KXAA 3K9XB 2BDIA 2ALVA 2XBYA 1C2DA 3RXQA 4DIHH 7GCHF 2J95A 5EU8A 1A3EH 1KDQB 2ZGBH 4OGYA 4IBLH 1SFIA 6LPRA 1HJ9A 1LMWB 4X8UH 3SNCA 3FAOA 2F9UA 1ETRH 1HFDA 1BHXF 3GY4A 2QXGA 1LQDB 4DW2U 1AD8H 1G30B 1QL7A 1XUIA 4DIIH 1INCA 2ZC9H 1MH0A 3M7QA 5FPYA 1P09A 3A7YA 3A7TA 2GT8A 1ZPBA 1MTUA 2ZU3A 2ZECA 1OS8A 3V0XA 1O2MA 1O3GA 2O8UA 1W10U 3JZ1B 2FOEA 4I32A 3E16B 1GBCA 1GJ5H 4FUJA 1TGCA 4WMEA 3OTJE 1LPGB 1BA8B 1W3CA 2WINI 3M7UA 1H8IH 3PM3A 1NRSH 1XUHA 2R3YA 4DY7B 1XXFA 1AY6H 2J4IA 1AUTC 3UQOA 3VEQB 1RXPA 1C5OH 4Y71A 2VVVA 1QJ1B 3T28A 1YPHE 2H6MA 2ZNKH 2F83A 1ELCA 4UFEH 1V2LT 1BTPA 3NXPA 3EA9A 1LHCH 3JZ2B 3TNTA 2ZHWH 1ZTJA 1O2RA 2RA3A 4UEHH 1J14A 2BD5A 2HPQH 6GCHF 1O3EA 2F9BH 1C5TA 3M5NA 1FDPA 5T3HA 2G81E 1OXGA 2GKVE 1BMLA 1W0ZU 3UPEA 3ZVGA 2JKHA 3GDUA 1V2MT 2YNAA 4JYUH 4Z0KA 1K1IA 3F6UH 2JH5D 3U8OH 1A0JA 1MBMA 1NM6A 4DG4A 1THPB 2FTMA 1QRWA 1WV7H 5T6GA 4VGCC 4BTUB 5FCRA 4D7FA 3BEUA 4K2YA 2WV5A 3GCHC 4Y0YE 5DP8A 5GJ4B 1ZZZA 3ZYEA 3UWJH 1O2XA 5L6NH 3MNXA 2VH6A 1AVGH 1W8BH 3RU4E 4K3JA 2F91A 4UD9H 1TNIA 4ZROA 2IJOB 1S5SA 2Z3EA 1K9OE 4ASHA 1TRYA 3B8JA 1QGFA 1YKTA 2ODPA 2BOHB 1PYTD 3BTHE 4H6TA 2A31A 1O3JA 3RXSA 1T7CA 5L30H 1E36B 1O2OA 1MKXH 4ABEA 1CA0B 1GI0A 1V2KT 2A4GA 2A4RA 2XWAA 3FP8E 3ZZAA 2D2DA 2Y6TA 2FWWA 4UFFH 3SGAE 1OX1A 1O36A 5DP4A 5A8XA 1O2QA 2AMDA 1C2IA 3RXFA 2JETC 4YM9A 3GY3A 2SGQE 1MCVA 3OSYA 3PMHB 4LZ1H 2ZPSA 3PTBA 3GY2A 1EPTB 2OTVA 1SGNE 1LKAA 1BTYA 1O32A 1S85A 2PKSC 3SV9A 2F9NA 1KXBA 2ZU5A 3GCNA 1GI9B 1SR5C 2DE9A 1DDJA 4AFZA 4B74A 1DUEA 1O3KA 1VITF 2BLVA 1FY4A 1IQJA 2PWXA 1WOFA 3SN8A 1GHZA 3E6PH 3PV4A 4J1YA 5CMXH 2BD7A 4FVDA 5TCCA 1WUNH 1HV7A 1UHBB 4JYVH 1BBRH 1C5RA 1KLIH 3LGWA 3LGYA 2FOGA 3KQCA 1SVPA 2BD9A 3QWCH 4X2VA 1RTFB 2VGCB 4INHA 2ZQ1A 1MTSA 1TALA 2BX3A 1MUEB 3SJ8A 2ZDLA 1T8OA 3T27A 3AVZA 3V12A 1P2IA 3LJOA 1UTNA 4ABFA 1OYQA 1S6HA 3AAVA 1GG6C 1FN6A 1HJ8A 4MQAA 1O5GH 2WV4A 3LGIA 3OY6U 2FI4E 2H5CA 1A3BH 5A8ZA 1CHOF 1GL0E 3TGJE 1EB2A 1E0FD 1PPCE 1K1PA 5K0HA 6GCHG 1ZSJA 1TGSZ 3BV9B 5PTPA 3FZDA 2GV7A 1MKWK 3CS0A 1DWDH 2ZFTA 3ZVFA 2SGFE 3MU5A 1L2EA 2OD3B 4AGKA 4X8SH 4I7YH 4K8YA 1P12E 2A5IA 3LKWA 3M3SA 7KMEH 3U1IB 2BDHA 2FOMB 4AYYB 2GMTB 4ABHA 2A7JA 1F92A 3MU8A 4X0WU 1JXPA 1ZYOA 1GCTC 4X1RU 4NA8A 3HK3B 1DX5M 4ZKRU 1SFQB 1GMCF 1O33A 1Y5BT 3E0PB 2WYJA 3UWIA 4CHAC 3M61U 2DE8A 4ISHH 3TNSA 4KKDA 1BTUA 2VIOA 2ZP0H 2I6SA 1ID5H 2O8LA 5E2PA 2G00A 4ISOA 2NU0E 4DT7B 2Z9KA 2BY9X 4NFEA 1QQUA 4YOIA 2ZPQA 1WCZA 4Y7BA 1E35B 1BMMH 4H42U 4CRGA 1O3BA 3SU6A 1CA8B 1GMHG 3BN9A 1HUTH 3MH6A 1MTNB 1IAUA 3SV6A 2ZGJA 3A8CA 1T8MA 1CGJE 2R0KA 2GCHF 4RN6A 3A8DA 4FUFA 2HPPH 1NFUA 1B5GH 2H1UA 3A88A 4KGAA 2FTLE 1Y3UA 5EG4A 1L1NA 1AO5A 2AIPA 1P3EA 4A1VA 3RXCA 4IGDA 1AMHA 2VIDA 1C2JA 5J4SA 1UCYH 1DFPA 1ESAA 1P8VC 1T32A 4BOHA 1PPZA 3EA7A 3TK6A 3ZVEA 1TBRH 2ZHFH 4U2WA 4LXBH 1ANBA 4ESTE 3SUGA 4YO9A 1TPPA 2B0FA 3F1SB 3GDSA 4U30A 4Q80A 4GHQA 3O8BA 3PTNA 4WH6A 2NU1E 1D4PB 4AG1A 1TONA 2FS9A 2VNTA 5GDSH 3KF2A 1S81A 1BTHH 3H7TA 1K1LA 1DY9A 5JBAS 1GI4A 2TGDA 2GD4B 2PKAA 1VCPA 1WU1A 1A61H 1CT4E 4ZKSU 3P8GA 1N8OB 5A8YA 2PGBB 1LHFH 8GCHF 1FIWA 5DO4H 5L2YH 2CXVA 1GHAF 1K1JA 5HGGA 2ZU2A 1UK3A 3BG4B 1GGDB 1EOJA 1AIXH 1VCWA 2ZCKP 3AW0A 1HJAB 5HMAA 2GCTC 2XBXA 1EQ9A 4ISIH 1CU1A 1MQ6A 5FX6A 1ABIH 1K1OA 4MDSA 1P02A 3Q3KA 1KTTB 1C9TA 4E7NA 5E2OA 3H5CB 3SNDA 4WXIA 4CRBA 2BDYA 1KXDA 2W26A 1HCGA 1RIWB 1IOEA 1C1WH 4FUCA 1AHTH 2A0QB 1AZ8A 4JMYA 3A7WA 2ZKSA 4CRFA 1A4WH 1SOTA 2PV9B 2RA0A 5ABWA 1PYTC 1KIGH 1W11U 3M5MA 1EX3A 2BLOA 2GP9B 4NWLA 2IN2A 1EZSC 5DJ7A 1ZHPA 2NU3E 1BMAA 5AFZH 1RFNA 2KAIA 2ZWLH 1DSTA 2BLWA 2FPZA 2XW9A 2P94A 4ZXYH 1BZXE 3DUXH 1D3PB 1O39A 5HM2A 4YT7H 3LIWA 5T6FA 2D26C 1TAWA 4XBCA 1Z1JA 1QB9A 4U32A 4THNH 2A2QH 1GJ4H 4OS2A 3A82A 1QFKH 2Y5GA 3PYHA 3T5FH 2XCFA 1GJ6A 4ZXXH 3RC4A 1CO7E 3P8FA 1QA7A 3EA8A 1UTQA 2WPHS 1C1NA 3ODDA 4DCDA 4NZQA 1VZQH 2W5EA 5JBCS 1V2NT 2FOCA 1G9IE 1UTJA 1PQAA 3HKJB 2H2ZA 4BAMB 2RG3A 2CHAC 1L4ZA 1TWXB 1UTLM 5GXPA 1FNIA 1OWIA 4JZ1A 4KP0A 1V2RT 3N7OA 4XE4A 3SUDA 4ISLA 1O3AA 3MNCA 1V2ST 1QURH 1HAYB 2P16A 2EEKA 3KQBA 1ZMNA 5DPAA 4O9VA 2P8OC 2TBSA 2DUCA 3SJOA 4IN2A 1C5MD 2GZ8A 2Y80A 3TGKE 4CH2B 1D3DB 2Z94A 1BCUH 3MH7A 2SNVA 1H4WA 1GJ7B 4YZUA 2OC8A 8GCHG 1ELDE 1HYLA 1SGEE 1SLWB 1AZZA 1XM1A 2A5AA 4INLA 1EJNA 2AEIH 1KXCA 2V3OH 4IW4E 1UK2A 1DOJA 4HTCH 5DP9A 3GCTF 3MO9A 1O3DA 1MCTA 1FJSA 2BD8A 1GDNA 2OQ5A 1YM0A 1UTKA 1H8DH 2R3UA 1ZOMA 2ZZUH 1P9SA 1C5VA 2Y81A 1MZAA 1EZXC 1Q31A 2P93A 3BTQE 4MG3A 1O2YA 3QUMP 1WTGH 1YF4A 3VXFH 1MD7A 3ZV8A 1MU8B 2FEQH 5EXLA 3UREA 4D8NA 1AFQB 5F6MA 3S7HB 1BTWA 4X8TH 1RGQA 2YOLA 3C27B 1J16A 4B2AA 4F49A 4Q7XA 4ZMAH 6CHAC 1QJ7B 2BY5X 1TMTH 3TLOA 3NPSA 1QY6A 1BT7A 2G4TA 4GPGA 1LDTT 2BVXH 1ZSLA 1AWFH 1P0SH 2XCNA 4AB9A 3DFJA 1CQQA 1AB9C 4Y7AA 3URDA 2ZTZA 1TNKA 1O2LA 1H9LB 1SLVB 1GHVH 3SO3A 1K28D 1XXDA 1ANCA 1O5EH 1AUJA 3KEEA 1BITA 2HGTH 1CHGA 2ZGHA 2O8MA 3VFEA 3QK1A 1P2JA 2HOBA 1DXPA 3QTOH 1O2JA 2Q6FA 3P95A 1F5LA 3FZZA 1ARCA 1LCYA 1P2QA 1UVSH 2TGTA 2VIPA 2ZTXA 3PO1B 5G4BA 3VB3A 4AORA 5AFYH 3W94A 3UUZA 1TRNA 1PPGE 2RCEA 3F68H 4O97A 1AKSB 3P8NA 1GMDF 2HVXA 3SU1A 1O2SA 1HAVB 3D23A 3D62A 1TIOA 5JPMH 5GPIB 1HBTH 1P11E 1ZPZA 1TYNA 4GCHG 1F5KU 4DGJA 1FAKH 3ZVAA 1JRSA 1EP6A 4IN1A 1L0ZA 2ZEBA 3BIUH 5FPSA 1O2UA 4Q2KA 1J15A 1NTPA 3KL6A 1GI7B 3RM0H 4WY3A 4B2CA 1T8LA 3TJNA 3QLPH 1YGCH 5GWZA 1GI2A 3UNRA 4Y10E 1EXFA 3TJOA 1O3IA 1E34B 1FY5A 2J34A 1C4V2 5F8ZA 3ENSB 3OYPA 2BY8X 4XSKU 5DP6A 2FI5E 2BTCE 4FUHA 5EW2H 1GJ8B 1PPFE 2ZDKA 3DHKH 1SQOA 3A8AA 2FLBH 2GT7A 1GJ9B 3ZVCA 1YP9A 2BXUH 1SHYA 2HNTC 5A0BA 1THSH 1GHWH 2M5TA 2WPJS 2PSXA 1XVOA 1GI8B 4B71A 2UUKB 1FY3A 4ZH8A 1TABE 3MO3A 2AIQA 1O2HA 3T25A 1ARBA 1TMUH 5HXFA 5E0HA 4BAOB 1O2TA 4HI3A 5L2ZH 1O3OA 2CV3A 2BXTH 4GUXA 3ZVDA 1TX6A 1BOQA 1NROH 1OWHA 3TH2H 1F0TA 1ZMLA 3L3TA 1Y3YA 1SGTA 1G3DA 1Y8TA 1CE5A 2FOBA 3MO6A 1CVWH 1QCPA 5CHAB 2R0LA 2A45B 5C5NA 4MPWA 4LK4A 3URCA 2ZFQH 1A0HB 1C1OA 1SGDE 3RMNH 5EPNA 4ZHAA 1UVTH 4XOJA 2Y7XA 1N6XA 3BTME 5JB8S 4I8JA 3EYDA 2STBE 1C1VH 3CENA 4UONA 2PKAB 2GGVB 1DANH 4FUBA 2H9EH 4JZDH 1ZRKA 4JCNA 1NU9A 2HWLB 2ZTYA 2C90B 1YPMH 1A0LA 1ESBA 2W7SA 2GMTC 3HPTB 5E8EH 3M36A 2ANWA 2Z3CA 3PMJA 3A81A 1TFXA 1GMDG 1JIMA 3A7XA 4A1XA 2BD4A 4TY7A 1J8AA 3SJIA 1A5GH 1OP8A 3RLYH 1O5BB 1JOUB 1AE8H 4D9RA 3M3TA 2P3UB 2UUJB 5I25A 4K60A 4YTAA 1C5XB 1Z6EA 1K1NA 5FAHA 1YLCA 3SQEE 3QGJA 2QGRA 1FPHH 3RMLH 3PLBA 3FFGA 3S9AA 1QJ6B 1TQ0B 6ESTA 1IQHA 4CRCA 3BTDE 3LH1A 5C1UA 4IS5A 3FANA 3GYLB 4NWKA 2HNTF 3MU1A 5A09A 1UTPA 7GCHG 2PTNA 5LPEA 4B2BA 1O3MA 4AYVB 2KAIB 1UVUH 3NCLA 3M3VA 1BMNH 4NCYA 1S0QA 1C5SA 3F9EA 1JWTA 4IC6A 1B0EA 1O34A 2PR3A 4XDEA 5EPYA 3ZZ3A 5JBBS 4K1SA 1F0SA 1C5QA 3OX7U 3VGCB 3ZZ7A 1ZTKA 1MD8A 2XTTB 3M35A 1PQ8A 2VJ1A 1MTWA 4NIYA 2VH0A 4AZ2B 1U6QA 2VIVA 2ZQ2A 3ZZ6A 4AOQA 2A4OA 5EGMA 3RXDA 1E38B 2FLRH 2BZ6H 5JBTA 2ZGCA 1BUIA 3RC5A 4UFDH 2FP7B 1GHBF 1MKXK 4YLUA 3P70B 1YPEH 4Q7ZA 5I46H 5LPFA 2CF9H 4SGBE 1HAIH 1UJ1A 2G4UA 1FV9A 3PMBB 2BZAA 1D3QB 5T6DA 2CJIA 3VB5A 1SG8B 3NK8A 1EKBB 1LHGH 1Z8JB 3TH4H 4MTBA 1LO6A 4NA7A 1GJAB 1C5YB 1C5LH 4AX9H 4XBDA 2OXSA 5C1XA 1GBEA 2OCVB 1VJAU 2BM2A 3QN7A 1EUFA 1BDAA 4RKJB 1V6DA 3RXUA 2GVFA 2JH0D 4E05H 1TMBH 3VB6A 2VWLA 3S9BA 3KGPA 1DE7H 2XXLA 1BBRK 2BDGA 2O8TA 1S84A 1MU6B 1ZMJA 4CRDA 3VXEH 3STJA 3DFLA 2BB4A 1RD3B 4IMQA 4B76A 1C1MA 4ABJA 3SBKA 5HYOA 3RC6A 4ZKOU 1WSSH 1KLJH 1OWEA 1GBJA 3OU0A 2C93B 1DPOA 1GVKB 3A83A 5F03A 3BEFB 3ZZ4A 3SI3H 2BLQA 3UIRA 1B7XB 1ZGVA 4JYTA 1ACBE 1RTKA 3SNEA 1DWBH 1BRAA 1SGFA 1TX7A 3UTUH 4DOQA 1GBKA 5A2MH 1KY9A 2RDLA 1VGCC 1GBHA 2Z9LA 1G32B 2GV6A 1WQVH 1BTXA 4ABGA 3A89A 3U98H 1CBWC 3GISB 4NA9H 2QXHA 1OWJA 4FVBA 2Y5HA 2ZDVH 1NZQH 2G55A 1HIAB 1ZHRA 4E7RG 1MAXA 4VGCB 1SSXA 1EASA 5DKMA 1T4UH 4LOYH 3GCHB 4IMZA 5EQSA 5H4IB 1GL1A 4A5TS 1KDQA 1UTMA 3E0NB 1VITH 2XC0A 2CGAA 2VIWA 1OPHB 3H7OA 1C2EA 2HALA 3P92A 3BSQA 1VITG 1SB1H 2ZO3H 3SV7A 2B5TB 1IHSH 3RM2H 3O8CA 1SMFE 2HNTE 1UVPA 1B0FA 5E0JA 2Z9IA 1C5NH 4RKOB 3MWIU 3BTWE 1FMGA 1CT2E 2Y82A 1DLKB 2PW8H 3IG6B 4D7GA 2QXJA 2AERH 4HFPB 2ZFPH 1AN1E 7ESTE 3RXJA 2JETB 2XC5A 2BDCA 1O2NA 1DUAA 1QR3E 4BAKB 5A0AE 2BY6X 1E37B 4CH8B 3F9FA 4NG9H 2R9PA 1QL8A 2WUBA 1NRNH 3CS7A 1S0RA 2PKSB 4K69A 1GBDA 1QHRB 1LHEH 2J9NA 2NU2E 3MFJA 3U69H 1DM4B 5J4QA 1ABJH 2A5KA 1MTVA 1CHOG 1N6YA 4OS7A 4DVAU 2C8ZB 1UCYK 1UVOA 1K1MA 3AW1A 2K1QA 4FUDA 1CGIE 1QBOA 1G3BA 2P95A 4OGXA 4Y8XA 1O30A 3SU3A 1EAWA 2HRVA 1BRBE 1IQMA 4CBNA 3VPKA 5FX5A 3BIVH 1SHHB 1O5FH 5BPEA 3NZIA 1FUJA 1UCYE 3ITIA 1BRUP 3PROA 1Z71A 1D6RA 1JMOH 2QYIA 4MVNA 4FU9A 2VVCA 1GBLA 1GG6B 3SZNA 4OS1A 2ZDMA 1GMCG 3ATMA 1DS2E 3EDXB 3HGNA 5C3NA 1BTZA 3E90B 1F0UA 2V3HH 3HK6B 3LGUA 1OKXA 2SGAA 1UTOA 5C2ZA 3U8TH 2XRCA 1SGYE 2R2WU 3SJKA 1VCQA 3PO1C 2FS8A 2TGPZ 9ESTA 2BYAX 3LJJA 1O2VA 4BAQB 2OC7A 2VWMA 1ELAA 1O31A 1D3TB 3QO6A 2W3IA 2GCHG 2CF8H 4GVUA 1C1TA 3SV2H 4A6LA 1ELEE 2FOHA 3MTYA 1O5DH 2ZIQH 1TBQH 4KELA 5GCHF 1GCTB 3KQEA 1NT1A 2XBVA 3GY5A 4F4OC 4DURA 1SI5H 2OUAA 1YCPM 4NGAH 2J92A 3MYWA 1DWCH 4K1TA 4R8TB 2AGIX 1EPTA 1H9IE 1GI5A 2OC1A 3ZZDA 2NU4E 5EXMA 2CN0H 2Y5FA 1ANEA 3ZZCA 1G2LA 4O03A 1FN8A 1NFWA 1O3NA 4TPIZ 1PQ7A 3RU4T 1TA2A 1L1GA 1WTHD 2G52A 8LPRA 3B9FH 1Y5UT 4FUIA 2QCYA 2WPMS 5SGAE 2QV1A 5DP5A 3MU4A 4FXGH 1DICA 1DSUA 4BTIB 2PGQB 1KTSB 3I78A 1Y5AT 2ZFRH 3LC3A 3MH4A 1O2ZA 2V0BA 3W95A 3M37A 1QQ4A 1GHAG 4KTUA 3PMAB 5TJXA 3SQHE 1SOZA 2AH4X 3EGKH 1O3CA 3K2UA 5JYIA 4TY6A 3SJ9A 1OWKA 2FYRA 5IYTA 1C2MA 1ZR0A 1HNEE 3TITA 3SU2A 2OP9A 3A86A 2FI3E 1C5PA 1G37A 1V2QT 1AVWA 2ZG0H 2A2XH 3M7TA 1AU8A 1G2MA 1Y3VA 4FU8A 1K21H 1ETTH 1HXFH 3RXVA 1PFXC 5CHAC 2C8YB 3A80A 8KME2 4BAHB 3TIUA 3TK5A 1XVMA 1P01A 4WXVA 4I8GA 3U8RH 5FCKA 2LPRA 2VU8E 3BTTE 5DK1A 3Q76A 3R0FA 1K22H 3K65B 1TLDA 4ABDA 1Q2WA 2GCTB 3UY9A 1IQNA 1FONA 2C4FH 1S6FA 1YCPH 1LHDH 1EAUA 1W14U 3LONA 3F9GA 5C20A 2ZF0H 5AHGH 1RS0A 3ZZ9A 4I8KA 1AQ7A 1AFEH 3LDXH 1TBZH 2F9OA 4Y76A 2FMJA 5CE1A 1WYKA 3SNBA 2ZHQH 2XYAA 1LQEA 4X6MA 3NKKA 2AGEX 1A7SA 1EJMA 3KNXA 1Q3XA 2Z3DA 5JB9S 1T31A 2O9QA 1W12U 3RXRA 4FUEA 5FBEA 4X1NU 2H9HA 2STAE 1QA0A 3SORA 1V2UT 4JK6A 1P2MA 4CR5A 1BQYA 1A5IA 1T4VH 1P03A 2V6NA 3A7VA 2I6QA 1KLTA 3RP2A 1CA0C 1F2SE 4MNYA 3A8BA 4B73A 1LTOA 3O8RA 3LU9B 1TNGA 1FLEE 1ELVA 1Z8GA 3Q3XA 2ZDAH 4D76A 2BX4A 3LOXA 5C67A 2V35A 3RMOH 1EPTC 1PPEE 2ZI2H 3I77A 1GJBB 3ATWA 3ZZBA 1RJXB 2ZPRA 1LVMA 1TGTA 3TJVA 2B7DH 2UWPA 1P57B 1AGJA 3RXIA 2CHAB 3TU7H 1WBGB 4I8LA 1C5UA 2FYQA 4NSVA 4E06H 4WMDA 3GCTG 1THRH 3UOPA 1MBQA 3ZYDA 1DITH 4A1TA 4OS6A 2ALPA 2ESTE 2ZHEH 2ZU1A 5F8TA 3GY8A 5EW1H 1Y59T 2VGCC 3MNBA 4UE7H 1TNLA 1QNJA 5AF9H 1ETSH 4X1SU 2P8OB 1PQ5A 1C2HA 2NWNA 1QB1A 3A7ZA 5JDUB 2VIQA 3S0NA 1XUKA 1P2KA 1C1QA 5F8XA 2BQWB 3S69A 3UR6A 1P2OA
chains in the Genus database with same CATH superfamily
4OS4A 2CMYA 2WUCA 3S9CA 3L6PA 3UOUA 2Y7ZA 1L4DA 4UDWH 4Y11E 1P06A 5A0CA 1GI6A 3RXMA 1NC6A 3VB7A 2AFQB 3RXEA 1AVXA 1LVOA 4P00A 1O0DH 5GNDA 4AGJA 3K6ZA 1YC0A 3M5OA 1C1SA 4GSOA 4X1PU 3SV8A 3IITA 1V2VT 4YT6H 1FAXA 3F0OA 3NWUA 3WY8A 1OYTH 4AB8A 3I29A 4AFQA 4ISNA 1BHXB 3BTKE 5CDFE 1MMJN 1QB6A 2J2UA 4DJZB 2WSSD 2GTBA 1FI8A 1SGFG 5FXLA 1SGQE 4D9QA 1F5RA 1TPOA 4XFQA 4Y6DA 1FXYA 2QAAA 2WYGA 2A32A 6CHAB 4M7GA 2WPLS 1E79D 1W7XH 5ETXA 4HGCA 5HIZA 4UFGH 4HZHA 1MZDA 1GI1A 1FZZA 3R3GB 1LVBA 2F9PA 1AB9B 1SC8U 3E8LA 3T2NA 4Y79A 2PLXA 4U01A 2BY7X 1MQ5A 3M5LA 2F3CE 2ZDNA 3FKSD 1CT0E 8ESTE 2Q6DA 4RT0A 1SL3A 3FP6E 1SQTA 2UUFB 4JK5A 3WWFA 1TB6H 2SNWA 3QDZB 3RDZA 2AMPA 1OOKB 3PB1E 2UWOA 2TGAA 3KCGH 2UUYA 1W0YH 3RXLA 5LH8A 1EZQA 1KYNA 2H5DA 2BVRH 3ATIA 3MMGA 3Q3YA 5EXNA 3P6ZB 3LH3A 5FHTA 4TWYA 1MTNC 3DSOA 3EE0B 2A4QA 2EA3A 1C1UH 3SHAH 2GDEH 1YPGH 5DP3A 3ZZ8A 1WQSA 2QN5T 2JH6D 4B75A 1CSOE 1P10A 3K6YA 1YY3A 1ZTLA 3RXOA 3BTEE 3V7TA 3Q77A 5LPRA 1YPJH 1IQKA 2TRMA 4CREA 3UNQA 4X1QU 1Z8RA 3MHWU 3BTFE 3PLPA 3A87A 2PFEA 3KIDU 1JIRA 3E3TA 2QF0A 2ZFSA 4M9FA 1SQAA 1P2NA 1GMHF 1TOCB 4FUGA 1YPLH 2PHBA 1V2PT 2XBWA 4MLFB 2EI6A 3SU0A 1O2PA 4Q7YA 1A1RA 1EATA 3QX5H 5C17A 3F9HA 5EJZA 3GY6A 2R2MB 1OP0A 1FIZA 1IQGA 4MNVA 2Z9JA 3L33A 3V13A 5DG6A 1HAOH 1D6WA 1N8OC 2Z9GA 4ABAA 3SHCH 1RTLA 2Q6GA 1C4U2 4CR9A 1NESE 1CGHA 3BTGE 2FOFA 2OBQA 2BDAA 1Z8IB 1QBVH 3RU4D 1HLTH 1TGBA 2TIOA 2FODA 3BG4C 1GGDC 3RUOA 1O5CB 1AI8H 2WPKS 4AN7A 5ESBA 1C5WB 1BJVA 4K1EA 1HJAC 3T29A 2P3FH 1W13U 2PUXB 3G01A 3ZZ5A 2KCPA 2ANMH 1MKWH 4X6OA 4Z6AH 1QRXA 4GHTA 3RMMH 3EQ0H 2AMQA 3SYJA 2D1JA 2GX4A 5E0GA 4AFSA 2PP6A 1OP2A 1O3PB 2KZ4A 2VWOA 4GLYA 1RIWC 3V3MA 1DT2A 1IQFA 1GBTA 1TPSA 1X7AC 1BJUA 3ODFA 5B6OA 2ZCHP 1W0KD 1F0RA 4JZEH 3SI4H 3HGPA 4YESB 2IJD1 2ZCLP 4MNWA 1ELGA 2YMSB 1AKSA 1BBRE 4K5ZA 4TT3D 4WH8A 2H9TH 3KHVA 3DD2H 1HAVA 1V2JT 3CNRA 3RLWH 5K7RA 1QBNA 3U1JB 3RXHA 4I8HA 1TOMH 1GPZA 5AVDA 1P3CA 1W7GH 1KXFA 4B1TA 3AASA 2J5UA 1TX8A 3QZQA 1O2KA 1HXEH 2A7CA 4MNXA 1SGIB 2OINA 3NUMA 3PWCA 4FU7A 2WPDD 1E1QD 4JZFH 1XMNB 2ZFFH 4X6PA 4TSFD 2SGEE 1NFYA 2OLGA 1C2FA 4ZKNU 3MNSA 1ELTA 2ZHDA 3DSGA 4AFUA 1GWAA 2QY0B 1GJDB 1W2KH 4OS5A 5GIBA 2W3KA 1TNHA 2B9LA 1HAXB 3STIA 1FY8E 1O2WA 1NRPH 1GBIA 1O2GH 1J17T 1XUJA 2PTCE 3SU4A 2VB0A 2AS9A 3DA9B 1GDQA 1RRKA 3KN2A 1LPKB 1YYY1 3RXAA 3A84A 2G5NA 1NRQH 1P9UA 1DVAH 2FOAA 1GHBG 2TPIZ 3LC5A 4X8VH 1N1LA 1P04A 1V2WT 5EOKA 1NN6A 4NFFA 2VWNA 1LVYA 2C3SA 1QTFA 3SW2B 3MI4A 4LZ4B 1LPZB 2UWLA 1TPAE 1YBWA 1IHTH 1HB0B 2FX4A 1ORFA 2SFAA 2JDID 3D49H 1HDTH 2BVSH 1XUGA 4MPVA 3TVJB 4ZHLU 1EAIA 3ESTA 1NFXA 1BB0B 1O38A 4H4FA 2QXIA 1QL9A 2BD3A 4I31A 3MH5A 1EZUC 1HAHH 1DY8A 2FIRH 2B8OH 4ABBA 1P05A 2BHGA 5IDKA 5TCAA 3S7KB 1ESTA 4YLQH 1S83A 3UR9A 3FOAA 1V2TT 1Z6JH 2BOKA 1C2KA 1HRTH 1TNJA 1AFQC 4NIXA 1ZJKA 4TYDA 3P17H 5ESTE 3ZIAD 2D8WA 4Y8ZA 2J38A 1O3HA 2VVUA 2EI7A 3GOVB 3TH3H 2G51A 5EQQA 2BD2A 1EB1H 3TGIE 1J9CH 2KCAA 1OWDA 2ANKH 3QTVH 4Y8YA 3FP7E 3GICB 3TPIZ 2IPHA 3QGNB 1HAGE 2FO9A 2G8TA 5BRRE 4BXWA 5EQRA 4MPUA 1GI3A 1QRZA 4GAWA 3T26A 3F2HA 3SUEA 5DP7A 2Z7FE 2XC4A 2C8XB 1Y3XA 1GBFA 3BG8A 4KTCA 4TPYA 3U9AH 1IQLA 2M2AA 4XBBA 1SBWA 4X2WA 1PPHE 4BTTB 2QIQA 1YPHC 2GDDA 3LT3A 3PWBA 3FVFB 3TJUA 1OSSA 3AAUA 3HATH 3MOCA 3UB0A 1TA6A 3ZV9A 1IQIA 3KYGA 4X2XA 1DWEH 4R0IA 1FPCH 1COWD 1XKBC 1G3EA 2WV9A 1G3CA 1O5AB 3E1XB 4WF8A 3GY7A 2OC0A 3LGTA 1H1BA 1KSNA 3KQDA 1YLDA 2BQ7B 4NZLA 2G5VA 4RSPA 2BQ6B 2VINA 1NY22 1V2OT 4PROA 3BEIB 4CHAB 1C2LA 1EP5A 1ZGIA 2C8WB 2EC9H 1AE5A 1SGPE 2ODYB 2XWBI 2Q1JA 4A92A 2KM0A 4X6NA 1VGCB 1NU7B 2IOTA 1HAPH 4JZIA 1CBWB 3RXPA 3RXGA 1GCDA 1O3LA 3CP7A 2OQUA 4QT8C 1MAYA 3LPRA 5DGJA 5EODA 1UHBA 1SLUB 3SUFA 1SGCA 1SPJA 3QZRA 1GJCB 1Z1IA 4GCHF 5C1YA 7LPRA 1C1PA 4ZHMU 2EI8A 1MABB 1V3XA 4BNRA 1GBMA 2GZ7A 3ELAH 3RXBA 4CRAA 1EJAA 2F9VA 3SGQE 1VJ9U 2SGPE 1ZJDA 1NO9H 4Y0ZE 1UO6A 4O3TA 3PLKA 3P8OA 1ZPCA 1GVLA 1UMAH 1FQ3A 4KTSA 3SOSA 1KMHB 2A7HA 4H6SB 2A1DB 1L1JA 3SGBE 3UFAA 1S82A 2QC2A 4YOJA 1GVZA 3OY5U 1T8NA 2SGDE 1YPKH 3GCOA 1Z7KA 2ODQA 2F43B 5KGOA 1AWHB 1C2GA 1KXEA 1O37A 2OBOA 1C9PA 3A85A 3UNSA 1EAXA 4WJG2 2ANYA 4NIWA 4INKA 1JRTA 1FY1A 2GZ9A 1GBBA 2W7UA 3C1KA 9LPRA 3SNAA 2WPIS 3SU5A 1SLXB 1GHYH 1LKBA 3E91A 1ELBA 2AYWA 1GBAA 1HGTH 5FPTA 1ELFA 3RXTA 2AGGX 2THFB 1IQEA 3U28C 3DT0H 1C1RA 3FN8A 1DXWA 2ZA5A 1HPGA 1ZLRA 3BF6H 2FX6A 1A46H 1H9HE 4WWYA 2LNCA 2QF5A 4ZUHA 1SGRE 2ASUB 2FXRA 1NRRH 2BDBA 4I33A 1TE0A 1FX0B 1ZRBA 5GCHG 3UQVA 1HAZB 3GYMA 4I86A 4NSYA 1NPMA 4K8BA 5FL7D 3RXKA 1HIAA 4J2YB 1M9UA 4WVPE 5FBIA 3OFND 3VB4A 2ULLA 3EAJA 2BMGB 3B23B 1BIOA 1ZHMA 2FDAA 1TQ7B 2HLCA 2P3TB 2ZU4A 1QIXB 1D9IA 1G36A 1EOLA 2FESH 1JBUH 2FZZA 1VR1H 1A5HA 2P59A 2XNIA 3OEED 4O3UA 4SGAE 1GHXH 4TWWA 1PJPA 3ZVBA 4NIVA 4CBOA 1H8HD 5HM9A 1TRMA 1O35A 4A7IB 1YCPK 2Z6BD 3TK9A 1ANDA 1XKAC 1Y3WA 4BANB 2HVYB 3MU0A 3Q00A 1TGNA 1ZSKA 1F7ZA 3PRDA 1UK4A 3O8DA 2O8WA 1O3FA 2YNBA 1XX9A 3KQ5A 2PSYA 1NS3A 5LGOA 4IC5A 1C4Y2 3ATKA 1BRCE 3KYFA 3ATLA 3D65E 3T62A 2ZGXH 1C5ZB 4ZAEA 4WMFA 4BXSA 4AG2A 2PUQH 4X2YA 3VGCC 2ILNA 1A2CH 3IWMA 4ABIA 1DLEA 3LGVA 2QF3A 2KR7A 2QA9E 1GDUA 3GDVA 1XUFA 1K2I1 2OK5A 4MPXA 1WAYB 1PPBH 4YOGA 5C5OA 3HKIB 1O2IA 2J94A 2FM2A 2WZQA 1KXAA 1NBMD 3K9XB 3OAAD 2BDIA 2ALVA 2XBYA 1C2DA 2K8IA 3PRBA 4Q4LA 3RXQA 4DIHH 7GCHF 2J95A 5EU8A 1A3EH 1KDQB 2ZGBH 4OGYA 4IBLH 1SFIA 6LPRA 1HJ9A 1LMWB 4X8UH 3SNCA 3FAOA 2F9UA 1ETRH 1HFDA 1BHXF 3GY4A 2QXGA 1LQDB 4DW2U 1AD8H 1G30B 1QL7A 1XUIA 4DIIH 1INCA 2ZC9H 1MH0A 3F2FA 3M7QA 5FPYA 1P09A 3A7YA 3A7TA 2GT8A 1ZPBA 1MTUA 2ZU3A 2ZECA 1OS8A 3V0XA 1O2MA 1O3GA 2O8UA 1W10U 3JZ1B 2FOEA 4I32A 3E16B 1GBCA 1GJ5H 4FUJA 1TGCA 4WMEA 2J98A 3OTJE 1LPGB 1BA8B 1W3CA 2WINI 3M7UA 1H8IH 3PM3A 1NRSH 1XUHA 2R3YA 4DY7B 1XXFA 1AY6H 2J4IA 1AUTC 3UQOA 3VEQB 4F55A 1RXPA 1C5OH 4Y71A 2VVVA 1QJ1B 3T28A 1YPHE 2H6MA 2ZNKH 2F83A 5C0UA 1ELCA 4UFEH 1V2LT 1BTPA 3NXPA 3EA9A 1LHCH 3JZ2B 3TNTA 2ZHWH 1ZTJA 1O2RA 2RA3A 3UAIC 4UEHH 1J14A 2BD5A 2HPQH 6GCHF 1O3EA 2F9BH 1C5TA 3M5NA 1FDPA 5T3HA 2G81E 1OXGA 2GKVE 1BMLA 1W0ZU 3UPEA 3ZVGA 2JKHA 3GDUA 1V2MT 2YNAA 4JYUH 4Z0KA 1K1IA 3F6UH 2JH5D 3U8OH 1A0JA 1MBMA 1NM6A 4DG4A 1THPB 2FTMA 1QRWA 1WV7H 5T6GA 4VGCC 4BTUB 5FCRA 4D7FA 3GS9A 3BEUA 4K2YA 2WV5A 3GCHC 4Y0YE 5DP8A 5GJ4B 1ZZZA 3ZYEA 3UWJH 1O2XA 5L6NH 3MNXA 2VH6A 1AVGH 1W8BH 3RU4E 4K3JA 2F91A 4UD9H 4Z1MD 1TNIA 4ZROA 2IJOB 1S5SA 2Z3EA 1K9OE 4ASHA 1TRYA 3B8JA 1QGFA 2VBCA 1YKTA 2ODPA 2BOHB 4FOUC 1PYTD 3BTHE 4H6TA 3MQKC 2A31A 1O3JA 3RXSA 4XRNA 1T7CA 5L30H 1E36B 1O2OA 1MKXH 4ABEA 1CA0B 1GI0A 1V2KT 2A4GA 2A4RA 2XWAA 3FP8E 3ZZAA 2D2DA 2Y6TA 2FWWA 4UFFH 5T1VA 3SGAE 1OX1A 1O36A 5DP4A 5A8XA 1O2QA 2AMDA 1C2IA 3RXFA 2JETC 4YM9A 3GY3A 2SGQE 1MCVA 3OSYA 3PMHB 4LZ1H 2ZPSA 3PTBA 3GY2A 1EPTB 2OTVA 1SGNE 1LKAA 1BTYA 1O32A 1S85A 2PKSC 3SV9A 2F9NA 1KXBA 2ZU5A 3GCNA 1GI9B 1SR5C 2DE9A 1DDJA 4AFZA 4B74A 1DUEA 1O3KA 1VITF 2BLVA 1FY4A 1IQJA 2PWXA 1WOFA 3SN8A 1GHZA 3E6PH 3PV4A 4J1YA 5CMXH 2BD7A 4FVDA 5TCCA 1WUNH 1HV7A 1UHBB 4JYVH 1WXRA 1BBRH 1C5RA 1KLIH 3LGWA 3AK5A 3LGYA 2FOGA 3KQCA 1SVPA 2BD9A 5DN6D 3QWCH 4X2VA 1RTFB 2VGCB 4INHA 2ZQ1A 1MTSA 1TALA 2BX3A 1MUEB 3SJ8A 2ZDLA 1T8OA 3T27A 3AVZA 3V12A 3WW7A 1P2IA 3LJOA 1UTNA 4ABFA 1OYQA 4B6FA 1S6HA 3AAVA 1GG6C 3SZEA 1FN6A 1HJ8A 4MQAA 1O5GH 2WV4A 3LGIA 3OY6U 2FI4E 2H5CA 1A3BH 2CK3D 5A8ZA 1CHOF 1GL0E 3TGJE 1EB2A 1E0FD 1PPCE 1K1PA 5K0HA 6GCHG 1ZSJA 1TGSZ 3BV9B 5PTPA 3FZDA 2GV7A 1MKWK 3CS0A 1DWDH 2ZFTA 3ZVFA 2SGFE 3MU5A 1L2EA 2OD3B 4AGKA 1OHHD 4X8SH 4I7YH 4K8YA 1P12E 2A5IA 3LKWA 3M3SA 7KMEH 2JJ1D 2BDHA 2FOMB 3U1IB 2GMTB 4AYYB 4ABHA 3N99A 2A7JA 1F92A 3MU8A 4RT1A 4X0WU 1JXPA 1ZYOA 1GCTC 4X1RU 4NA8A 3HK3B 1DX5M 4ZKRU 1SFQB 1GMCF 1O33A 1Y5BT 3E0PB 2WYJA 3UWIA 4CHAC 3M61U 2DE8A 4ISHH 3TNSA 4KKDA 1BTUA 2VIOA 2ZP0H 2I6SA 1ID5H 2O8LA 5E2PA 2G00A 4ISOA 2NU0E 4P02A 4DT7B 2Z9KA 2BY9X 4NFEA 1QQUA 4YOIA 2ZPQA 1WCZA 3F0PA 4Y7BA 1E35B 1BMMH 4H42U 4CRGA 1O3BA 3SU6A 1CA8B 1GMHG 3BN9A 1HUTH 3MH6A 1MTNB 1IAUA 3SV6A 2ZGJA 3A8CA 1T8MA 1CGJE 2R0KA 2GCHF 4RN6A 3A8DA 4FUFA 2HPPH 1NFUA 1B5GH 2H1UA 3A88A 4KGAA 2FTLE 1Y3UA 5EG4A 1L1NA 1AO5A 2AIPA 1P3EA 4A1VA 3RXCA 4F48B 4IGDA 1AMHA 2VIDA 1C2JA 3DSPA 5J4SA 1UCYH 1DFPA 1ESAA 1P8VC 3N7EA 1T32A 4BOHA 1PPZA 3EA7A 5B6LA 3TK6A 3ZVEA 1TBRH 2KFWA 2ZHFH 4U2WA 4LXBH 1ANBA 4ESTE 3SUGA 4YO9A 1TPPA 2B0FA 3F1SB 3GDSA 4U30A 4Q80A 4GHQA 3O8BA 3PTNA 4WH6A 2NU1E 1D4PB 4AG1A 3H09A 1TONA 2FS9A 2VNTA 5GDSH 3KF2A 2IPQX 1S81A 1BTHH 3H7TA 1K1LA 1DY9A 5JBAS 2XOKD 1GI4A 2TGDA 2J97A 2GD4B 2PKAA 1VCPA 1WU1A 1A61H 1CT4E 4ZKSU 3P8GA 1N8OB 5A8YA 2PGBB 1LHFH 8GCHF 1FIWA 5DO4H 5L2YH 2CXVA 1GHAF 1K1JA 5HGGA 2ZU2A 1UK3A 3BG4B 1GGDB 1EOJA 1AIXH 1VCWA 2ZCKP 3AW0A 1HJAB 5HMAA 2GCTC 1EFRD 2XBXA 5EIYA 1EQ9A 4ISIH 1CU1A 1MQ6A 5FX6A 1ABIH 1K1OA 3VG8A 4MDSA 1P02A 3Q3KA 1KTTB 1C9TA 2EY4C 4E7NA 5E2OA 3H5CB 2K0QA 4WXIA 3SNDA 4CRBA 2BDYA 1KXDA 2W26A 1HCGA 1RIWB 1IOEA 4Q63A 1C1WH 4FUCA 1AHTH 2A0QB 1AZ8A 4JMYA 3A7WA 2ZKSA 4CRFA 1A4WH 1SOTA 2PV9B 2RA0A 5ABWA 2GJGA 1PYTC 1KIGH 1W11U 3M5MA 1EX3A 2BLOA 2GP9B 2J98B 4NWLA 2IN2A 1EZSC 5DJ7A 1ZHPA 2NU3E 1BMAA 5AFZH 1RFNA 2KAIA 2ZWLH 1DSTA 1VKYA 2BLWA 2FPZA 2XW9A 2P94A 4ZXYH 1BZXE 3DUXH 1D3PB 1O39A 2YMSD 5HM2A 4YT7H 3LIWA 5T6FA 2D26C 1TAWA 4XBCA 1Z1JA 1QB9A 4U32A 4THNH 2A2QH 1GJ4H 4OS2A 3A82A 1QFKH 2Y5GA 3PYHA 3T5FH 1S6LA 1GJ6A 2XCFA 4ZXXH 3RC4A 1CO7E 3P8FA 1QA7A 3EA8A 1UTQA 2WPHS 1C1NA 3ODDA 4DCDA 4NZQA 1VZQH 2W5EA 5JBCS 1V2NT 2FOCA 1G9IE 1UTJA 1PQAA 2V7QD 3HKJB 2H2ZA 4BAMB 2RG3A 2CHAC 1L4ZA 1TWXB 1UTLM 5GXPA 1FNIA 1OWIA 3OTPA 1E1RD 2KX4A 4JZ1A 4KP0A 1V2RT 3N7OA 4XE4A 3SUDA 4ISLA 1O3AA 3MNCA 1V2ST 1QURH 1HAYB 2P16A 2EEKA 3KQBA 1ZMNA 5DPAA 4O9VA 2P8OC 2TBSA 2DUCA 3SJOA 4IN2A 1C5MD 2GZ8A 2Y80A 3TGKE 4CH2B 1D3DB 2Z94A 1BCUH 3MH7A 4AC9A 2SNVA 1H4WA 1GJ7B 4YZUA 2OC8A 8GCHG 1ELDE 1HYLA 1SGEE 1SLWB 1AZZA 1XM1A 2A5AA 4INLA 1EJNA 2AEIH 1KXCA 2V3OH 4FETA 4IW4E 1UK2A 1DOJA 4HTCH 5DP9A 3GCTF 3MO9A 1O3DA 4DT4A 1MCTA 1FJSA 2BD8A 1GDNA 2OQ5A 1YM0A 1UTKA 1H8DH 2R3UA 1ZOMA 2ZZUH 1P9SA 1SKYE 1C5VA 2Y81A 1MZAA 1EZXC 1Q31A 2P93A 3BTQE 4MG3A 1O2YA 3QUMP 1WTGH 1YF4A 3VXFH 1MD7A 3ZV8A 1MU8B 2FEQH 5EXLA 3UREA 2WHXA 4D8NA 1AFQB 5F6MA 3S7HB 1BTWA 3OEHD 4X8TH 1RGQA 2YOLA 3C27B 1J16A 4B2AA 4F49A 4Q7XA 4ZMAH 6CHAC 1QJ7B 2BY5X 1TMTH 3TLOA 3NPSA 1QY6A 1BT7A 2G4TA 4GPGA 1LDTT 2BVXH 1ZSLA 1AWFH 1P0SH 2XCNA 4AB9A 3DFJA 1CQQA 1AB9C 4Y7AA 3URDA 2ZTZA 1TNKA 1O2LA 1H9LB 1SLVB 1GHVH 3PV2A 1K28D 3SO3A 1XXDA 1ANCA 1O5EH 1AUJA 2RDEA 1BITA 3KEEA 2HGTH 1CHGA 2ZGHA 2O8MA 3VFEA 1NBME 3QK1A 1P2JA 2HOBA 1DXPA 3QTOH 1O2JA 2Q6FA 3P95A 1F5LA 3FZZA 1ARCA 1BMFD 1LCYA 1P2QA 1UVSH 2TGTA 2VIPA 2ZTXA 3PO1B 5G4BA 3VB3A 4AORA 4XD7D 5AFYH 3W94A 3UUZA 1TRNA 1PPGE 2RCEA 3F68H 4O97A 1AKSB 3P8NA 1GMDF 2HVXA 3SU1A 4HG6A 1O2SA 1HAVB 3D23A 3D62A 1TIOA 5JPMH 5GPIB 5IK2D 1HBTH 1P11E 1ZPZA 1TYNA 4GCHG 1F5KU 4DGJA 1FAKH 3ZVAA 1JRSA 1EP6A 4IN1A 1L0ZA 2ZEBA 3BIUH 5FPSA 1O2UA 4Q2KA 1J15A 1NTPA 3KL6A 1GI7B 3RM0H 4WY3A 4B2CA 1T8LA 3TJNA 3QLPH 1YGCH 5GWZA 1GI2A 3UNRA 4Y10E 1EXFA 3TJOA 5DSFA 1O3IA 1E34B 1FY5A 2J34A 1C4V2 5F8ZA 3ENSB 3OYPA 2BY8X 4XSKU 1K0HA 5KECA 5DP6A 2FI5E 3WWBA 2BTCE 4FUHA 5EW2H 1GJ8B 1PPFE 2ZDKA 3DHKH 1SQOA 3A8AA 2FLBH 2GT7A 1GJ9B 3ZVCA 1YP9A 2BXUH 1SHYA 2HNTC 5A0BA 1THSH 2QE7D 1GHWH 2M5TA 3FO8D 2WPJS 2PSXA 1XVOA 1GI8B 4B71A 2UUKB 1FY3A 4ZH8A 1TABE 3MO3A 2AIQA 1O2HA 3T25A 1ARBA 1TMUH 3EE7A 5HXFA 5E0HA 4BAOB 1O2TA 4HI3A 5L2ZH 2W6JD 1O3OA 2CV3A 2BXTH 4GUXA 3ZVDA 1TX6A 1BOQA 1NROH 1OWHA 3TH2H 1F0TA 1ZMLA 3L3TA 1Y3YA 1SGTA 1G3DA 1Y8TA 1CE5A 2FOBA 3MO6A 1CVWH 1QCPA 2YMSC 5CHAB 2R0LA 2A45B 5C5NA 4MPWA 4LK4A 3URCA 2ZFQH 1A0HB 1C1OA 1SGDE 3RMNH 5EPNA 4ZHAA 1UVTH 4XOJA 2Y7XA 1N6XA 3BTME 5JB8S 4I8JA 3EYDA 2STBE 1C1VH 3CENA 4UONA 2PKAB 2GGVB 1DANH 4FUBA 2H9EH 4JZDH 1ZRKA 4JCNA 1NU9A 2HWLB 2ZTYA 2C90B 1YPMH 1A0LA 5EJLA 1ESBA 2W7SA 2GMTC 3HPTB 5E8EH 3M36A 2ANWA 2Z3CA 3PMJA 3A81A 1TFXA 1GMDG 1JIMA 2LELA 3A7XA 4A1XA 2BD4A 4TY7A 1J8AA 2W6ID 3SJIA 1A5GH 1OP8A 3RLYH 1O5BB 1JOUB 1AE8H 4D9RA 3M3TA 2P3UB 2UUJB 5I25A 4K60A 4YTAA 1C5XB 3DCLA 1Z6EA 1K1NA 5FAHA 1YLCA 3SQEE 3QGJA 2QGRA 1FPHH 3RMLH 3PLBA 3FFGA 3S9AA 1QJ6B 1TQ0B 6ESTA 1IQHA 4CRCA 3BTDE 3LH1A 5C1UA 4IS5A 3FANA 3GYLB 4NWKA 2HNTF 3MU1A 5A09A 1UTPA 7GCHG 2PTNA 5LPEA 4B2BA 1O3MA 4AYVB 2KAIB 1UVUH 3NCLA 3M3VA 1BMNH 4NCYA 1S0QA 1C5SA 3F9EA 1JWTA 4IC6A 1B0EA 1O34A 2PR3A 4XDEA 5EPYA 3ZZ3A 2KCOA 5JBBS 4K1SA 1F0SA 1C5QA 3OX7U 3VGCB 3ZZ7A 1ZTKA 1MD8A 2XTTB 3M35A 1PQ8A 2VJ1A 1MTWA 4NIYA 2VH0A 4AZ2B 1U6QA 2JJ2D 2VIVA 2ZQ2A 3ZZ6A 4AOQA 2A4OA 5EGMA 3RXDA 1E38B 2FLRH 2BZ6H 5JBTA 2ZGCA 4ZCNA 1BUIA 3RC5A 4UFDH 2FP7B 1GHBF 1MKXK 4YLUA 3P70B 1YPEH 4Q7ZA 5I46H 5LPFA 2CF9H 4SGBE 1HAIH 1UJ1A 2RFKC 2G4UA 1FV9A 3PMBB 2BZAA 1D3QB 5HKKD 5T6DA 2CJIA 3VB5A 1SG8B 3NK8A 1EKBB 1LHGH 1Z8JB 3TH4H 4MTBA 1LO6A 4NA7A 1GJAB 1C5YB 1C5LH 4AX9H 4XBDA 2OXSA 5C1XA 1GBEA 2OCVB 1VJAU 4ACBA 2BM2A 3QN7A 1EUFA 1BDAA 4RKJB 2AHME 1V6DA 3RXUA 2GVFA 2JH0D 4E05H 1TMBH 3VB6A 2VWLA 3S9BA 3KGPA 1DE7H 3OE7D 2XXLA 1BBRK 2BDGA 2O8TA 1S84A 2F4LA 1MU6B 1ZMJA 4CRDA 3VXEH 3STJA 3DFLA 2BB4A 1RD3B 4IMQA 1W0JD 4B76A 1C1MA 4ABJA 3SBKA 5HYOA 3RC6A 4ZKOU 1WSSH 1KLJH 1OWEA 1GBJA 3OU0A 2C93B 2LP6A 1DPOA 2KCYA 1GVKB 3A83A 5F03A 3BEFB 3ZZ4A 3SI3H 2BLQA 3UIRA 1B7XB 1ZGVA 4JYTA 1ACBE 1RTKA 3SNEA 3F3BA 1DWBH 1BRAA 1SGFA 1TX7A 3UTUH 4DOQA 1GBKA 5A2MH 1KY9A 2RDLA 1VGCC 1GBHA 2Z9LA 1G32B 2GV6A 1WQVH 1BTXA 4ABGA 3A89A 3U98H 1CBWC 3GISB 4NA9H 2QXHA 1OWJA 4FVBA 2Y5HA 2ZDVH 1NZQH 2G55A 1HIAB 1ZHRA 4E7RG 1MAXA 4VGCB 1SSXA 1EASA 3F2GA 5DKMA 1T4UH 4LOYH 3GCHB 4IMZA 5EQSA 5H4IB 1GL1A 4A5TS 1KDQA 1UTMA 1UW7A 3E0NB 1VITH 2XC0A 2CGAA 2VIWA 1OPHB 3H7OA 1C2EA 2HALA 3P92A 3BSQA 1VITG 1SB1H 2ZO3H 3SV7A 2B5TB 1IHSH 3RM2H 3O8CA 1SMFE 2HNTE 1UVPA 1B0FA 5E0JA 2Z9IA 1C5NH 4RKOB 3MWIU 3BTWE 1FMGA 2V3MA 1CT2E 2Y82A 1DLKB 2PW8H 3IG6B 4D7GA 2QXJA 2AERH 4HFPB 2ZFPH 1AN1E 7ESTE 3RXJA 2JETB 2XC5A 2BDCA 1O2NA 1DUAA 1QR3E 4BAKB 5A0AE 2BY6X 1E37B 4CH8B 3F9FA 4NG9H 2R9PA 1QL8A 2WUBA 1NRNH 3CS7A 1S0RA 2PKSB 4K69A 1GBDA 1QHRB 1LHEH 2J9NA 2NU2E 3MFJA 3U69H 1DM4B 5J4QA 1ABJH 2A5KA 1MTVA 1CHOG 1N6YA 4OS7A 4DVAU 2C8ZB 1UCYK 1UVOA 1K1MA 3AW1A 1YWUA 2K1QA 4FUDA 1CGIE 1QBOA 1G3BA 2P95A 4OGXA 4Y8XA 1O30A 3SU3A 1EAWA 2HRVA 1BRBE 2HLDD 1IQMA 4CBNA 3VPKA 1WDIA 5FX5A 1QZ8A 3BIVH 1SHHB 1O5FH 5BPEA 3NZIA 1FUJA 1UCYE 3ITIA 1BRUP 3PROA 2L74A 1Z71A 1D6RA 1JMOH 5C0TA 2QYIA 4MVNA 4FU9A 2VVCA 1GBLA 1GG6B 3SZNA 4OS1A 2ZDMA 1GMCG 3ATMA 1DS2E 3EDXB 3HGNA 5C3NA 1BTZA 3E90B 1F0UA 2V3HH 3HK6B 3LGUA 1OKXA 2SGAA 1UTOA 5C2ZA 3U8TH 2XRCA 1SGYE 2R2WU 3SJKA 3N7DA 1VCQA 3PO1C 2FS8A 2TGPZ 9ESTA 2BYAX 3LJJA 1O2VA 4BAQB 2OC7A 2VWMA 1ELAA 1O31A 1D3TB 3QO6A 3W1EA 2W3IA 2GCHG 2CF8H 4GVUA 1C1TA 3SV2H 4A6LA 1ELEE 2FOHA 2L6OA 3MTYA 1O5DH 2ZIQH 1TBQH 4KELA 5GCHF 1GCTB 3KQEA 1NT1A 2XBVA 3GY5A 4F4OC 4DURA 4YXWD 1SI5H 2OUAA 1YCPM 4NGAH 4OM9A 2J92A 3MYWA 1DWCH 4K1TA 4R8TB 2AGIX 1EPTA 1H9IE 1GI5A 2OC1A 3ZZDA 2NU4E 5EXMA 2CN0H 2Y5FA 1ANEA 3ZZCA 1G2LA 4O03A 4B6EA 1FN8A 1NFWA 1O3NA 4TPIZ 1PQ7A 3RU4T 1TA2A 2QF4A 1L1GA 1WTHD 2G52A 8LPRA 3B9FH 1Y5UT 4FUIA 5HIYA 2QCYA 2WPMS 5SGAE 2QV1A 5DP5A 3MU4A 4FXGH 1DICA 1DSUA 4BTIB 2PGQB 1KTSB 3I78A 1Y5AT 2ZFRH 3LC3A 3MH4A 1O2ZA 2V0BA 3W95A 3M37A 1QQ4A 1YLNA 1GHAG 4KTUA 3PMAB 5TJXA 3SQHE 1SOZA 2AH4X 3EGKH 1O3CA 3K2UA 5JYIA 4TY6A 3SJ9A 1OWKA 2FYRA 3NRLA 5IYTA 1C2MA 4RI0A 1ZR0A 1HNEE 3TITA 3SU2A 2OP9A 3A86A 2FI3E 1C5PA 1G37A 1V2QT 1AVWA 2ZG0H 2A2XH 3M7TA 1AU8A 1G2MA 1Y3VA 4FU8A 1K21H 1ETTH 1HXFH 3RXVA 1PFXC 5CHAC 2C8YB 5C94A 3A80A 8KME2 4BAHB 3TIUA 3TK5A 1XVMA 1P01A 4WXVA 4I8GA 3U8RH 5FCKA 2LPRA 2VU8E 3BTTE 5DK1A 4ACAA 3Q76A 3R0FA 1K22H 3K65B 1TLDA 4ABDA 1Q2WA 2GCTB 3UY9A 1IQNA 1FONA 2C4FH 1S6FA 1YCPH 1LHDH 1EAUA 1W14U 3LONA 3F9GA 5C20A 2ZF0H 5AHGH 1RS0A 3ZZ9A 4I8KA 1AQ7A 1AFEH 3LDXH 1TBZH 2F9OA 4Y76A 2FMJA 5CE1A 1WYKA 5CHBA 2EQNA 3SNBA 2ZHQH 2XYAA 1H8ED 1LQEA 4X6MA 3NKKA 2AGEX 1A7SA 1EJMA 3KNXA 1Q3XA 2Z3DA 1SQRA 5JB9S 1T31A 2O9QA 1W12U 3RXRA 4FUEA 5FBEA 4X1NU 2H9HA 2STAE 1QA0A 3SORA 1V2UT 4JK6A 1P2MA 4CR5A 1BQYA 1A5IA 1T4VH 1P03A 2JIZD 2V6NA 3A7VA 3PV5A 2I6QA 1KLTA 3RP2A 1CA0C 1F2SE 4MNYA 3A8BA 4B73A 1LTOA 5F53A 3O8RA 3LU9B 1TNGA 1FLEE 1ELVA 1Z8GA 3Q3XA 2XNDD 5KEDA 2ZDAH 4D76A 2BX4A 3LOXA 5C67A 2V35A 3RMOH 1EPTC 1PPEE 2ZI2H 3I77A 1GJBB 3ATWA 3ZZBA 1RJXB 2ZPRA 1LVMA 1TGTA 5EJ1A 3TJVA 2B7DH 2UWPA 1P57B 1AGJA 3RXIA 2CHAB 3TU7H 1WBGB 4I8LA 1C5UA 2FYQA 4NSVA 4E06H 4WMDA 3GCTG 1THRH 3UOPA 1MBQA 4ASUD 3ZYDA 1DITH 4A1TA 4OS6A 2ALPA 2ESTE 2ZHEH 2ZU1A 5F8TA 3GY8A 5EW1H 1Y59T 2VGCC 3MNBA 4UE7H 1TNLA 1QNJA 5AF9H 1ETSH 4X1SU 2P8OB 1PQ5A 1C2HA 2NWNA 1QB1A 3A7ZA 5JDUB 2VIQA 3S0NA 1XUKA 1P2KA 1C1QA 5F8XA 2BQWB 3S69A 3UR6A 1P2OA
chains in the Genus database with same CATH topology
4OS4A 2CMYA 2WUCA 3S9CA 3L6PA 3UOUA 2Y7ZA 1L4DA 4UDWH 4Y11E 1P06A 5A0CA 1GI6A 3RXMA 1NC6A 3VB7A 2AFQB 3RXEA 1AVXA 1LVOA 1O0DH 4AGJA 3K6ZA 1YC0A 3M5OA 1C1SA 4GSOA 4X1PU 3SV8A 3IITA 1V2VT 4YT6H 1FAXA 3NWUA 3WY8A 1OYTH 4AB8A 3I29A 4AFQA 4ISNA 1BHXB 3BTKE 1MMJN 1QB6A 2J2UA 4DJZB 2GTBA 1FI8A 1SGFG 5FXLA 1SGQE 4D9QA 1F5RA 1TPOA 4XFQA 4Y6DA 1FXYA 2QAAA 2WYGA 2A32A 6CHAB 4M7GA 2WPLS 1W7XH 5ETXA 4HGCA 4UFGH 4HZHA 1MZDA 1GI1A 1FZZA 3R3GB 1LVBA 2F9PA 1AB9B 1SC8U 3E8LA 3T2NA 4Y79A 2PLXA 4U01A 2BY7X 1MQ5A 3M5LA 2F3CE 2ZDNA 1CT0E 8ESTE 2Q6DA 1SL3A 3FP6E 1SQTA 2UUFB 4JK5A 1TB6H 2SNWA 3QDZB 3RDZA 2AMPA 1OOKB 3PB1E 2UWOA 2TGAA 3KCGH 2UUYA 1W0YH 3RXLA 5LH8A 1EZQA 1KYNA 2H5DA 2BVRH 3ATIA 3MMGA 3Q3YA 5EXNA 3P6ZB 3LH3A 5FHTA 4TWYA 1MTNC 3EE0B 2A4QA 2EA3A 1C1UH 3SHAH 2GDEH 1YPGH 5DP3A 3ZZ8A 1WQSA 2QN5T 2JH6D 4B75A 1CSOE 1P10A 3K6YA 1ZTLA 3RXOA 3BTEE 3V7TA 3Q77A 5LPRA 1YPJH 1IQKA 2TRMA 4CREA 3UNQA 4X1QU 1Z8RA 3MHWU 3BTFE 3PLPA 3A87A 2PFEA 3KIDU 1JIRA 3E3TA 2QF0A 2ZFSA 1SQAA 1P2NA 1GMHF 1TOCB 4FUGA 1YPLH 2PHBA 1V2PT 2XBWA 4MLFB 2EI6A 3SU0A 1O2PA 4Q7YA 1A1RA 1EATA 3QX5H 3F9HA 3GY6A 2R2MB 1OP0A 1FIZA 1IQGA 4MNVA 2Z9JA 3L33A 3V13A 5DG6A 1HAOH 1D6WA 1N8OC 2Z9GA 4ABAA 3SHCH 1RTLA 2Q6GA 1C4U2 4CR9A 1NESE 1CGHA 3BTGE 2FOFA 2OBQA 2BDAA 1Z8IB 1QBVH 3RU4D 1HLTH 1TGBA 2TIOA 2FODA 3BG4C 1GGDC 3RUOA 1O5CB 1AI8H 2WPKS 4AN7A 5ESBA 1C5WB 1BJVA 4K1EA 1HJAC 3T29A 2P3FH 1W13U 2PUXB 3G01A 3ZZ5A 2ANMH 1MKWH 4X6OA 4Z6AH 1QRXA 4GHTA 3RMMH 3EQ0H 2AMQA 2D1JA 2GX4A 5E0GA 4AFSA 1OP2A 1O3PB 2VWOA 4GLYA 1RIWC 3V3MA 1DT2A 1IQFA 1GBTA 1TPSA 1X7AC 1BJUA 3ODFA 5B6OA 2ZCHP 1F0RA 4JZEH 3SI4H 3HGPA 4YESB 2ZCLP 4MNWA 1ELGA 1AKSA 1BBRE 4K5ZA 4WH8A 2H9TH 3KHVA 3DD2H 1HAVA 1V2JT 3RLWH 5K7RA 1QBNA 3U1JB 3RXHA 4I8HA 1TOMH 1GPZA 5AVDA 1P3CA 1W7GH 1KXFA 4B1TA 3AASA 1TX8A 3QZQA 1O2KA 1HXEH 2A7CA 4MNXA 1SGIB 2OINA 3NUMA 3PWCA 4FU7A 4JZFH 1XMNB 2ZFFH 4X6PA 2SGEE 1NFYA 2OLGA 1C2FA 4ZKNU 3MNSA 1ELTA 2ZHDA 4AFUA 1GWAA 2QY0B 1GJDB 1W2KH 4OS5A 5GIBA 2W3KA 1TNHA 2B9LA 1HAXB 3STIA 1FY8E 1O2WA 1NRPH 1GBIA 1O2GH 1J17T 1XUJA 2PTCE 3SU4A 2VB0A 2AS9A 3DA9B 1GDQA 1RRKA 3KN2A 1LPKB 1YYY1 3RXAA 3A84A 2G5NA 1NRQH 1P9UA 1DVAH 2FOAA 1GHBG 2TPIZ 3LC5A 4X8VH 1N1LA 1P04A 1V2WT 5EOKA 1NN6A 4NFFA 2VWNA 1LVYA 2C3SA 1QTFA 3SW2B 3MI4A 4LZ4B 1LPZB 2UWLA 1TPAE 1YBWA 1IHTH 1HB0B 2FX4A 1ORFA 2SFAA 3D49H 1HDTH 2BVSH 1XUGA 4MPVA 3TVJB 4ZHLU 1EAIA 3ESTA 1NFXA 1BB0B 1O38A 4H4FA 2QXIA 1QL9A 2BD3A 4I31A 3MH5A 1EZUC 1HAHH 1DY8A 2FIRH 2B8OH 4ABBA 1P05A 2BHGA 5IDKA 5TCAA 3S7KB 1ESTA 4YLQH 1S83A 3UR9A 1V2TT 1Z6JH 2BOKA 1C2KA 1HRTH 1TNJA 1AFQC 4NIXA 1ZJKA 4TYDA 3P17H 5ESTE 2D8WA 4Y8ZA 2J38A 1O3HA 2VVUA 2EI7A 3GOVB 3TH3H 2G51A 5EQQA 2BD2A 1EB1H 3TGIE 1J9CH 1OWDA 2ANKH 3QTVH 4Y8YA 3FP7E 3GICB 3TPIZ 2IPHA 3QGNB 1HAGE 2FO9A 2G8TA 5BRRE 4BXWA 5EQRA 4MPUA 1GI3A 1QRZA 4GAWA 3T26A 3SUEA 5DP7A 2Z7FE 2XC4A 2C8XB 1Y3XA 1GBFA 3BG8A 4KTCA 4TPYA 3U9AH 1IQLA 4XBBA 1SBWA 4X2WA 1PPHE 4BTTB 2QIQA 1YPHC 2GDDA 3LT3A 3PWBA 3FVFB 3TJUA 1OSSA 3AAUA 3HATH 3MOCA 1TA6A 3ZV9A 1IQIA 4X2XA 1DWEH 4R0IA 1FPCH 1XKBC 1G3EA 1G3CA 1O5AB 3E1XB 4WF8A 3GY7A 2OC0A 3LGTA 1H1BA 1KSNA 3KQDA 1YLDA 2BQ7B 4NZLA 2G5VA 4RSPA 2BQ6B 2VINA 1NY22 1V2OT 4PROA 3BEIB 4CHAB 1C2LA 1EP5A 1ZGIA 2C8WB 2EC9H 1AE5A 1SGPE 2ODYB 2XWBI 2Q1JA 4A92A 4X6NA 1VGCB 1NU7B 2IOTA 1HAPH 4JZIA 1CBWB 3RXPA 3RXGA 1GCDA 1O3LA 3CP7A 2OQUA 4QT8C 1MAYA 3LPRA 5DGJA 5EODA 1UHBA 1SLUB 3SUFA 1SGCA 1SPJA 3QZRA 1GJCB 1Z1IA 4GCHF 5C1YA 7LPRA 1C1PA 4ZHMU 2EI8A 1V3XA 4BNRA 1GBMA 2GZ7A 3ELAH 3RXBA 4CRAA 1EJAA 2F9VA 3SGQE 1VJ9U 2SGPE 1ZJDA 1NO9H 4Y0ZE 1UO6A 4O3TA 3PLKA 3P8OA 1ZPCA 1GVLA 1UMAH 1FQ3A 4KTSA 3SOSA 2A7HA 4H6SB 2A1DB 1L1JA 3SGBE 3UFAA 1S82A 2QC2A 4YOJA 1GVZA 3OY5U 1T8NA 2SGDE 1YPKH 3GCOA 1Z7KA 2ODQA 1AWHB 1C2GA 1KXEA 1O37A 2OBOA 1C9PA 3A85A 3UNSA 1EAXA 4WJG2 2ANYA 4NIWA 4INKA 1JRTA 1FY1A 2GZ9A 1GBBA 2W7UA 3C1KA 9LPRA 3SNAA 2WPIS 3SU5A 1SLXB 1GHYH 1LKBA 3E91A 1ELBA 2AYWA 1GBAA 1HGTH 5FPTA 1ELFA 3RXTA 2AGGX 2THFB 1IQEA 3DT0H 1C1RA 1DXWA 2ZA5A 1HPGA 1ZLRA 3BF6H 2FX6A 1A46H 1H9HE 4WWYA 2LNCA 4ZUHA 1SGRE 2ASUB 2FXRA 1NRRH 2BDBA 4I33A 1TE0A 1ZRBA 5GCHG 3UQVA 1HAZB 3GYMA 4NSYA 1NPMA 4K8BA 3RXKA 1HIAA 4J2YB 1M9UA 4WVPE 5FBIA 3VB4A 2ULLA 3EAJA 2BMGB 3B23B 1BIOA 1ZHMA 2FDAA 1TQ7B 2HLCA 2P3TB 2ZU4A 1QIXB 1D9IA 1G36A 1EOLA 2FESH 1JBUH 2FZZA 1VR1H 1A5HA 2P59A 2XNIA 4O3UA 4SGAE 4TWWA 1GHXH 3ZVBA 1PJPA 4CBOA 4NIVA 5HM9A 1TRMA 1O35A 4A7IB 1YCPK 2Z6BD 3TK9A 1ANDA 1XKAC 1Y3WA 4BANB 3MU0A 3Q00A 1TGNA 1ZSKA 1F7ZA 1UK4A 3O8DA 2O8WA 1O3FA 2YNBA 1XX9A 2PSYA 1NS3A 5LGOA 4IC5A 1C4Y2 3ATKA 1BRCE 3ATLA 3D65E 3T62A 2ZGXH 1C5ZB 4ZAEA 4WMFA 4BXSA 4AG2A 2PUQH 4X2YA 3VGCC 2ILNA 1A2CH 3IWMA 4ABIA 1DLEA 3LGVA 2QF3A 2QA9E 1GDUA 3GDVA 1XUFA 1K2I1 4MPXA 1WAYB 1PPBH 4YOGA 5C5OA 3HKIB 1O2IA 2J94A 2FM2A 1KXAA 3K9XB 2BDIA 2ALVA 2XBYA 1C2DA 3RXQA 4DIHH 7GCHF 2J95A 5EU8A 1A3EH 1KDQB 2ZGBH 4OGYA 4IBLH 1SFIA 6LPRA 1HJ9A 1LMWB 4X8UH 3SNCA 3FAOA 2F9UA 1ETRH 1HFDA 1BHXF 3GY4A 2QXGA 1LQDB 4DW2U 1AD8H 1G30B 1QL7A 1XUIA 4DIIH 1INCA 2ZC9H 1MH0A 3M7QA 5FPYA 1P09A 3A7YA 3A7TA 2GT8A 1ZPBA 1MTUA 2ZU3A 2ZECA 1OS8A 3V0XA 1O2MA 1O3GA 2O8UA 1W10U 3JZ1B 2FOEA 4I32A 3E16B 1GBCA 1GJ5H 4FUJA 1TGCA 4WMEA 3OTJE 1LPGB 1BA8B 1W3CA 2WINI 3M7UA 1H8IH 3PM3A 1NRSH 1XUHA 2R3YA 4DY7B 1XXFA 1AY6H 2J4IA 1AUTC 3UQOA 3VEQB 1RXPA 1C5OH 4Y71A 2VVVA 1QJ1B 3T28A 1YPHE 2H6MA 2ZNKH 2F83A 1ELCA 4UFEH 1V2LT 1BTPA 3NXPA 3EA9A 1LHCH 3JZ2B 3TNTA 2ZHWH 1ZTJA 1O2RA 2RA3A 4UEHH 1J14A 2BD5A 2HPQH 6GCHF 1O3EA 2F9BH 1C5TA 3M5NA 1FDPA 5T3HA 2G81E 1OXGA 2GKVE 1BMLA 1W0ZU 3UPEA 3ZVGA 2JKHA 3GDUA 1V2MT 2YNAA 4JYUH 4Z0KA 1K1IA 3F6UH 2JH5D 3U8OH 1A0JA 1MBMA 1NM6A 4DG4A 1THPB 2FTMA 1QRWA 1WV7H 5T6GA 4VGCC 4BTUB 5FCRA 4D7FA 3BEUA 4K2YA 2WV5A 3GCHC 4Y0YE 5DP8A 5GJ4B 1ZZZA 3ZYEA 3UWJH 1O2XA 5L6NH 3MNXA 2VH6A 1AVGH 1W8BH 3RU4E 4K3JA 2F91A 4UD9H 1TNIA 4ZROA 2IJOB 1S5SA 2Z3EA 1K9OE 4ASHA 1TRYA 3B8JA 1QGFA 1YKTA 2ODPA 2BOHB 1PYTD 3BTHE 4H6TA 2A31A 1O3JA 3RXSA 1T7CA 5L30H 1E36B 1O2OA 1MKXH 4ABEA 1CA0B 1GI0A 1V2KT 2A4GA 2A4RA 2XWAA 3FP8E 3ZZAA 2D2DA 2Y6TA 2FWWA 4UFFH 3SGAE 1OX1A 1O36A 5DP4A 5A8XA 1O2QA 2AMDA 1C2IA 3RXFA 2JETC 4YM9A 3GY3A 2SGQE 1MCVA 3OSYA 3PMHB 4LZ1H 2ZPSA 3PTBA 3GY2A 1EPTB 2OTVA 1SGNE 1LKAA 1BTYA 1O32A 1S85A 2PKSC 3SV9A 2F9NA 1KXBA 2ZU5A 3GCNA 1GI9B 1SR5C 2DE9A 1DDJA 4AFZA 4B74A 1DUEA 1O3KA 1VITF 2BLVA 1FY4A 1IQJA 2PWXA 1WOFA 3SN8A 1GHZA 3E6PH 3PV4A 4J1YA 5CMXH 2BD7A 4FVDA 5TCCA 1WUNH 1HV7A 1UHBB 4JYVH 1BBRH 1C5RA 1KLIH 3LGWA 3LGYA 2FOGA 3KQCA 1SVPA 2BD9A 3QWCH 4X2VA 1RTFB 2VGCB 4INHA 2ZQ1A 1MTSA 1TALA 2BX3A 1MUEB 3SJ8A 2ZDLA 1T8OA 3T27A 3AVZA 3V12A 1P2IA 3LJOA 1UTNA 4ABFA 1OYQA 1S6HA 3AAVA 1GG6C 1FN6A 1HJ8A 4MQAA 1O5GH 2WV4A 3LGIA 3OY6U 2FI4E 2H5CA 1A3BH 5A8ZA 1CHOF 1GL0E 3TGJE 1EB2A 1E0FD 1PPCE 1K1PA 5K0HA 6GCHG 1ZSJA 1TGSZ 3BV9B 5PTPA 3FZDA 2GV7A 1MKWK 3CS0A 1DWDH 2ZFTA 3ZVFA 2SGFE 3MU5A 1L2EA 2OD3B 4AGKA 4X8SH 4I7YH 4K8YA 1P12E 2A5IA 3LKWA 3M3SA 7KMEH 3U1IB 2BDHA 2FOMB 4AYYB 2GMTB 4ABHA 2A7JA 1F92A 3MU8A 4X0WU 1JXPA 1ZYOA 1GCTC 4X1RU 4NA8A 3HK3B 1DX5M 4ZKRU 1SFQB 1GMCF 1O33A 1Y5BT 3E0PB 2WYJA 3UWIA 4CHAC 3M61U 2DE8A 4ISHH 3TNSA 4KKDA 1BTUA 2VIOA 2ZP0H 2I6SA 1ID5H 2O8LA 5E2PA 2G00A 4ISOA 2NU0E 4DT7B 2Z9KA 2BY9X 4NFEA 1QQUA 4YOIA 2ZPQA 1WCZA 4Y7BA 1E35B 1BMMH 4H42U 4CRGA 1O3BA 3SU6A 1CA8B 1GMHG 3BN9A 1HUTH 3MH6A 1MTNB 1IAUA 3SV6A 2ZGJA 3A8CA 1T8MA 1CGJE 2R0KA 2GCHF 4RN6A 3A8DA 4FUFA 2HPPH 1NFUA 1B5GH 2H1UA 3A88A 4KGAA 2FTLE 1Y3UA 5EG4A 1L1NA 1AO5A 2AIPA 1P3EA 4A1VA 3RXCA 4IGDA 1AMHA 2VIDA 1C2JA 5J4SA 1UCYH 1DFPA 1ESAA 1P8VC 1T32A 4BOHA 1PPZA 3EA7A 3TK6A 3ZVEA 1TBRH 2ZHFH 4U2WA 4LXBH 1ANBA 4ESTE 3SUGA 4YO9A 1TPPA 2B0FA 3F1SB 3GDSA 4U30A 4Q80A 4GHQA 3O8BA 3PTNA 4WH6A 2NU1E 1D4PB 4AG1A 1TONA 2FS9A 2VNTA 5GDSH 3KF2A 1S81A 1BTHH 3H7TA 1K1LA 1DY9A 5JBAS 1GI4A 2TGDA 2GD4B 2PKAA 1VCPA 1WU1A 1A61H 1CT4E 4ZKSU 3P8GA 1N8OB 5A8YA 2PGBB 1LHFH 8GCHF 1FIWA