1O31A

Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Elaborate manifold of short hydrogen bond arrays mediating binding of active site-directed serine protease inhibitors.
pubmed doi rcsb
total genus 53
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o31A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1o31A02
1FONA 2GCHG 1SLVB 5I46H 1LHGH 3MNXA 1O2OA 5AVDA 1AFQC 4WMEA 1NRSH 2STAE 1ELDE 1SI5H 1FXYA 1SGEE 4K1SA 2IN2A 1FY4A 4I8HA 1JBUH 3MNBA 4J2YB 1UTKA 4YTAA 1SGDE 1NU7B 1W0ZU 3T5FH 1C2DA 3SJKA 1O2MA 1C4U2 3PMAB 1PQ7A 4I8KA 4AYYB 1W0YH 1AFEH 2A32A 5GJ4B 1TMUH 2VWLA 1GI1A 2FM2A 4I7YH 1L0ZA 2BXTH 3IWMA 1ZHPA 3SW2B 3U8RH 5FX6A 3KNXA 2OQ5A 3BSQA 3AAUA 2C90B 1L1JA 3UIRA 1GMDG 1H9HE 2PLXA 1F2SE 1GJ9B 3A89A 1ZRKA 1C5PA 3N7OA 1ZGVA 1OP2A 1J14A 3T27A 4Y76A 1FJSA 2BHGA 1ANDA 2Z9IA 2GTBA 1ZPZA 5JDUB 1GDUA 1ZGIA 3W95A 5EXNA 1O3KA 1A3EH 3TH3H 1P02A 5DP8A 1IQHA 1P2IA 1G3EA 5HYOA 4CRAA 1TMBH 4ISHH 2HNTC 3MHWU 2ZFTA 1ANCA 3A86A 3GOVB 5HM2A 5C67A 4LZ1H 1S83A 1F0RA 1QRXA 1SGRE 3CS7A 3MNSA 1O5DH 4FUHA 3NPSA 1MTNC 1WV7H 3W94A 1GMHG 1O36A 4OS5A 1SFIA 1G3CA 4ZHMU 1FY5A 3BTWE 3CP7A 1F5LA 1XUIA 2ZQ2A 4NSYA 4MPWA 1ZTKA 1ZTLA 5GXPA 2YNAA 1O2PA 1KXCA 2SNWA 3RC5A 1ESTA 1ZPBA 4X2WA 1O3DA 4CR5A 1KLIH 1MKXK 3H7TA 8LPRA 1YPHE 3LGYA 1GBBA 3GCTF 2EC9H 1EP5A 1C4V2 1ELVA 1AIXH 4MPXA 1GJCB 2HRVA 4O03A 2XC4A 1TGTA 2LPRA 1IQEA 1MTSA 2A2QH 2IJOB 1A3BH 2ZGXH 1QRZA 4O3UA 4Y11E 4YT7H 3P92A 3QK1A 2BMGB 3EYDA 1AVWA 1D9IA 1ZTJA 2ZCLP 1ZHMA 5GWZA 4KKDA 1EAXA 3S9BA 1V2ST 2V0BA 4A1TA 1JMOH 1V2LT 1AGJA 2PR3A 3UFAA 2VGCC 1C9PA 4HFPB 4MPVA 1IQIA 2NU2E 1C5LH 1T4UH 4X6NA 5A09A 4FUGA 4B2AA 1E35B 2WINI 1XVOA 4DJZB 2PV9B 4AFSA 3RM2H 1ZMLA 2G4TA 2ZDAH 2ANMH 2XBYA 3U9AH 4AFZA 3RXVA 3Q3YA 3O8DA 1OSSA 1OYQA 2XWBI 2DE8A 3ZZAA 3ODDA 1SGPE 3KF2A 2QIQA 4JK5A 1QBOA 1QURH 1BRCE 1XXDA 5E0GA 1HAYB 4Q7YA 3ZZCA 1NU9A 4HI3A 1H9IE 1B0FA 4ZKRU 1S85A 2FP7B 3E0NB 1WCZA 1H9LB 1G2LA 3BEIB 1FY1A 1SLUB 3VB3A 2P93A 3RXLA 1A0LA 4DW2U 1TOCB 3TGKE 1ZSKA 1GBAA 2FX6A 1TNIA 1C1UH 5EXMA 3MO3A 4X6OA 3PTBA 1GHAF 1DUEA 1WUNH 1O5CB 4KTSA 2XBVA 3MNCA 2SGFE 1BZXE 4Y6DA 2QCYA 5C1UA 5FPYA 2GCHF 2F9OA 1GHBG 2V3HH 1C5VA 3BTME 3ZVGA 1EPTC 1ETSH 2ZPQA 4K5ZA 1UVOA 3SO3A 3NK8A 3MH5A 4X8SH 7LPRA 3PO1C 3L6PA 3UWIA 1L4DA 2BZ6H 1GBDA 1Y3YA 2F9UA 3TGIE 3MU5A 1FZZA 2FX4A 3DHKH 1F0TA 5JB9S 2G5NA 1S5SA 3BTDE 4BNRA 2ZHWH 4GSOA 1TBZH 2C8ZB 1BTZA 2PTCE 4ABDA 1TPSA 3D65E 4ZKOU 1S84A 4IC5A 2Z3CA 1P2NA 4CHAC 1GMDF 3K6ZA 3B23B 6CHAB 2ZU4A 1MCVA 3UQOA 1F0SA 1G30B 3ZYEA 1UK2A 3MH6A 2GZ8A 4GPGA 3RXKA 1LVYA 2KAIB 1E37B 1C5ZB 1BBRK 1MKWK 3BTQE 1T7CA 2VINA 5E0HA 2ZF0H 1O34A 5A8ZA 2A4RA 1SGFG 2UUKB 1O3MA 3MH7A 3GCOA 1SVPA 1PPFE 2FMJA 3S0NA 1W13U 1Y3VA 2PKAA 3MU1A 1O3BA 3TITA 1C5NH 1NPMA 3PWCA 1XXFA 5B6OA 2GCTB 1TA2A 2AFQB 1UTNA 5E0JA 4AFUA 2Q1JA 1J9CH 2AIQA 4ZKNU 1SOZA 3TNSA 2PGQB 1SB1H 5A0CA 1GBEA 1TNJA 1O5GH 4SGAE 1C2FA 3E6PH 2WPKS 4X1SU 1OWJA 2VIPA 2ZQ1A 1MTWA 1ZJKA 1WYKA 1FN8A 3URDA 2FOEA 2VU8E 1SSXA 4CRFA 1O3CA 2ZDMA 4VGCC 2VH6A 1ZYOA 2G51A 2TIOA 3A8DA 2GMTB 3HGPA 1TONA 2GVFA 1HAXB 1ZSJA 2FLBH 3ZVDA 1QQ4A 3TH2H 3V13A 1UVTH 2Y5FA 3HATH 1AZZA 2OD3B 1C5RA 2OXSA 1IQLA 2ODQA 1ETRH 1ETTH 2A5KA 2OCVB 2AS9A 1AWFH 2OC8A 4I8GA 1RJXB 1Z8IB 1UMAH 3H7OA 1TLDA 1O2GH 2A7JA 3TH4H 4FUFA 1ABJH 3SN8A 1UK3A 1EATA 2FI3E 1SLWB 1ELFA 2O8LA 1ELAA 1TNGA 4BAHB 3MYWA 1BIOA 4IBLH 1V2OT 4B1TA 3QZQA 1P3EA 1GL0E 2J94A 3C27B 2A5AA 1O2UA 1KTSB 4B2CA 2Y82A 3SJIA 1AKSB 3A81A 1O33A 2NU3E 3IITA 4KELA 4MG3A 2ZO3H 1LDTT 1DFPA 1O2XA 1C1VH 2J4IA 3NUMA 1EPTA 1XUKA 3S69A 1AUJA 3E0PB 3SBKA 1GHXH 1HJ8A 2F9NA 2OP9A 5FBIA 3TK5A 4YM9A 1A2CH 1L1NA 2Y80A 1O0DH 3A7YA 2FZZA 2FEQH 2H9HA 2A4GA 3BTGE 1K1NA 1D6WA 1CBWB 2ZPRA 3PROA 1SQTA 1QIXB 3UQVA 1DICA 2B7DH 1QA7A 3A8BA 5ESBA 5GIBA 3KQBA 4BAOB 4Y8YA 2VIVA 2J95A 3SJ9A 4FVDA 4XE4A 1FLEE 1W8BH 4TY6A 1OXGA 1CE5A 5FBEA 3SU2A 2SGDE 3M3SA 1J16A 1V2VT 1HLTH 4B71A 1SHHB 4INLA 4CRGA 4ABJA 3FZDA 2GP9B 2ZDKA 1BQYA 1Q3XA 3KQEA 3G01A 2ZI2H 1AE5A 1LPZB 1GI7B 3ATWA 1GI3A 2J9NA 3SJ8A 1P2QA 3FANA 4FUCA 4MNWA 3MH4A 1OP0A 3BEFB 5FCRA 1GBMA 3E16B 1OYTH 1GI5A 2XTTB 1GI9B 1BJVA 2UWPA 1SMFE 1PYTD 4Y7AA 4R8TB 1SOTA 1A5IA 1EX3A 1B0EA 5DP3A 1DWEH 1C5WB 1Y5UT 1GDNA 2BD4A 3BTTE 4NZQA 3RXDA 3ZZ9A 1Z1IA 1A0HB 2FYQA 4X1PU 3VEQB 1SBWA 2XC0A 1A61H 4OGXA 2C8YB 1WQSA 1P2MA 5F8XA 3HPTB 1K22H 5DJ7A 1ZPCA 1BA8B 2BLOA 3TLOA 2CF9H 1P57B 4IMZA 2FESH 1O30A 1MTVA 2W26A 3HK3B 4E05H 4F4OC 1TX8A 3A80A 1EASA 4MQAA 4ZXYH 2Z9LA 1QL8A 2A4OA 2GT8A 3SUFA 3SV2H 2Y5HA 1TA6A 2FS8A 1ZLRA 2BQ7B 2FOGA 3GY4A 1OS8A 3OYPA 1GBKA 2VIOA 1KSNA 2Q6GA 1AMHA 3SNBA 1IQKA 3STIA 3GYLB 2AMDA 4IN2A 4INHA 5L2YH 1SHYA 3M35A 1NRRH 5EXLA 4CRDA 1LHEH 1GBLA 1K9OE 1AFQB 3SU1A 3IG6B 2P8OC 1JOUB 3KCGH 2UUYA 2A7HA 3ITIA 2H5DA 2ZHDA 2Z9JA 1BTHH 1XKBC 4MNXA 2A7CA 2FDAA 1V3XA 3GDSA 2F91A 1GI6A 1VCQA 1D3TB 2ZU1A 3ZZ5A 1GJ7B 1Y3XA 2OINA 3ZZ4A 5H4IB 4YT6H 4ABBA 4Z6AH 3TPIZ 4ABEA 3FVFB 3E1XB 3TGJE 1NT1A 3GY8A 2BD2A 3RXUA 5TCCA 1CA0B 5IYTA 3VPKA 4CH8B 1DUAA 1O5BB 2PGBB 1QR3E 1GWAA 3LGTA 1LQDB 3FP7E 3RLYH 1UCYK 2ASUB 2C4FH 2PFEA 1LMWB 1ESBA 1C1MA 5EPYA 1TNHA 1YPMH 1W7XH 2R3YA 1CT2E 2BD8A 4NA7A 4ZMAH 3GCHC 1KXEA 5HM9A 1DLKB 1GVLA 4HGCA 4R0IA 1FQ3A 1IAUA 1C1SA 1NC6A 2ZFQH 1TALA 3TNTA 2GT7A 2JETC 3K9XB 1WSSH 4AX9H 3ELAH 2ANYA 5LPFA 4JZIA 1AB9B 3PYHA 4WJG2 1YP9A 3UOUA 2F9VA 2BDYA 4Q7ZA 1E34B 2QXJA 4ABFA 4UE7H 1QB6A 1KXFA 1Y59T 2FO9A 4XBBA 3OX7U 1QNJA 4AB9A 1BDAA 1UJ1A 1GL1A 3NCLA 3PM3A 3D23A 3LT3A 3VXFH 1UK4A 4LOYH 1QY6A 1DE7H 2AGIX 3M36A 4DY7B 2Z3EA 1YPGH 4YO9A 1BBRE 3SQEE 1LCYA 5E2PA 1LKBA 4MLFB 1P9UA 3QX5H 4UD9H 1FUJA 2BD3A 1NFWA 2ZHEH 2QXIA 1E38B 5AF9H 1P8VC 2B0FA 2PSXA 1ELEE 5TCAA 5A2MH 2Q6DA 1TNKA 3KN2A 1NS3A 2BD5A 1YLDA 1G3DA 1P12E 1PPHE 1T8LA 3LH1A 2B5TB 3F1SB 1T31A 3SV9A 3BTFE 1YPKH 1SGFA 6GCHG 1AWHB 1H1BA 1O3PB 2V3OH 2VGCB 3BV9B 1D6RA 1EB2A 1J8AA 1PPZA 3KQCA 3K65B 3B8JA 3LC3A 1HIAB 1PPCE 1GHYH 3SU0A 4MNYA 4B74A 1MBQA 4XBDA 1QRWA 1FPCH 3BIVH 1QGFA 1UVUH 2BDBA 4XOJA 1EOJA 4PROA 1RFNA 1VR1H 3T26A 1GPZA 3H5CB 4JZFH 2CHAC 1X7AC 4OS4A 2ZHFH 3I29A 3PWBA 5EPNA 1HAZB 2VWMA 2RCEA 1GJ4H 2FI5E 2FTMA 5LPEA 3K2UA 2ZTZA 3DUXH 4BANB 3ODFA 1CT0E 1FI8A 3R3GB 3OTJE 1LQEA 2IOTA 1DANH 4AYVB 1YM0A 5DP5A 4ISOA 2DUCA 1O3OA 4DIHH 4CRBA 3LGVA 1S6HA 5CHAB 1O2JA 1ARBA 3V0XA 2PKSC 4X8TH 4X0WU 1BTWA 2W3IA 2QAAA 2RG3A 3E3TA 1N6XA 1HJAC 1CU1A 3Q3XA 2BDAA 1UHBB 2BLVA 1DXWA 4MVNA 1O5FH 2R9PA 3LH3A 1BB0B 2G00A 1T4VH 3LOXA 1F0UA 1SQAA 2STBE 5L30H 2ZEBA 1EZXC 1Q31A 3Q3KA 4U30A 3LDXH 3ESTA 1GCTC 4UEHH 1SG8B 1ANBA 2EI8A 2I6QA 4FVBA 3UNSA 1WQVH 3PO1B 1F5KU 3QLPH 1RTKA 1YPHC 2QA9E 2ZU5A 1GI2A 2K1QA 1IQNA 2C93B 2XYAA 4LZ4B 1PQ5A 3AAVA 4KGAA 1GJBB 1S6FA 1VJ9U 3BG8A 1BMAA 1DWCH 4DG4A 4H42U 3A8AA 1DXPA 1OWDA 1DWDH 2BLWA 3JZ1B 4AN7A 4D7FA 4ISNA 1GI8B 4F49A 5BRRE 5C5NA 1IHTH 1RS0A 4AZ2B 3URCA 1GHWH 1V2KT 4KTUA 4AGKA 1DS2E 1ELGA 8GCHF 3PB1E 2BY8X 1DOJA 2Z3DA 1EB1H 1A5HA 4K2YA 3GDVA 3LGIA 3NKKA 1NTPA 1HAIH 2G55A 4GHTA 1OWEA 4WXVA 3SGAE 3I78A 1OWIA 3TK6A 1GMCG 5AFZH 2Z9KA 1EAUA 3EAJA 2O8MA 2OLGA 1A46H 1ELTA 1RD3B 5EOKA 2FIRH 3Q00A 4ZHAA 3RM0H 1MU8B 3ZV9A 1M9UA 1QJ6B 3UPEA 2C3SA 1DITH 3GYMA 3FZZA 1AQ7A 1TRNA 1CHGA 3P8GA 2HPQH 1LVMA 3SUGA 2JKHA 1RTLA 4MDSA 1GBCA 3V3MA 4AOQA 4B75A 1DT2A 2BZAA 4X8VH 4NIYA 4WH6A 1F7ZA 1XVMA 1NRNH 1E36B 1FY3A 2GD4B 3QGNB 1L2EA 1W2KH 1MD8A 1W14U 5C2ZA 2C8WB 1P0SH 1G9IE 1N6YA 1N8OC 1HBTH 3RXOA 4RN6A 1GG6B 3MO6A 1OP8A 1SFQB 2GV7A 1VCPA 4UFFH 5EQSA 3A85A 5FCKA 1CGJE 1Y5AT 4NWKA 2FS9A 5DKMA 3BG4C 3UNQA 5J4QA 1P9SA 4Y0ZE 1V2PT 4JMYA 1YGCH 3OSYA 1TGCA 1O3JA 2JH6D 1S81A 3HGNA 1OOKB 3P8FA 1G36A 1EQ9A 3E91A 1HXFH 2WYGA 5GCHG 2P3FH 3RXCA 3BTKE 1FMGA 1SL3A 1YPLH 3DFJA 6GCHF 2ZC9H 1FIWA 3O8BA 2ANKH 2WV4A 2BQ6B 3EA9A 5A8XA 4NZLA 1KY9A 1HAVB 1VJAU 2FTLE 1KDQA 1GHVH 1O2QA 2ODYB 1O3IA 3T62A 4Y8ZA 2PSYA 3RXAA 5DGJA 3F68H 3MU8A 1O5AB 1LPGB 4FUDA 3BN9A 3A7VA 4K3JA 2PHBA 4NGAH 4IGDA 2Z7FE 1O38A 2ILNA 2BY9X 4Y79A 1PPEE 1BMMH 1TRMA 4FUJA 4LK4A 2XCNA 3T2NA 1G3BA 2A2XH 1Z8JB 2XXLA 1UCYE 3MWIU 3CS0A 1XUFA 1CGHA 1K2I1 3QWCH 3Q76A 2VH0A 1O3LA 3T25A 3PMBB 1GBJA 4AFQA 1HAGE 4XDEA 2XWAA 3TVJB 4IN1A 5CMXH 2BOHB 4WH8A 1FN6A 1A4WH 2OBOA 3ZVAA 1MAXA 3ZZ6A 1O2VA 2PTNA 2VJ1A 5E8EH 2AMPA 3FP8E 1YCPM 1GJAB 1RIWC 4JZEH 2CGAA 2BY5X 2WPMS 3RU4D 4DCDA 2CXVA 4QT8C 3KL6A 1AZ8A 1UTPA 1UTOA 3PLPA 1O2NA 3KIDU 1VITG 1TMTH 8ESTE 4YOJA 4CBNA 3F9FA 3SI3H 1TNLA 1V2QT 4WXIA 1D3QB 4BTUB 1EZQA 2FXRA 3TK9A 7ESTE 4AORA 1K21H 1K1PA 1P06A 3D49H 2NU0E 2P59A 1GBIA 4DGJA 2HOBA 3GY6A 3A7ZA 5FPSA 1V2NT 4WWYA 1BTPA 5K7RA 2BYAX 5LPRA 2AMQA 2FLRH 5F8TA 3SV8A 3BTHE 1K1LA 1V2UT 3QUMP 4X8UH 1GMCF 2OC7A 1Y5BT 6CHAC 5AFYH 3SGBE 1MH0A 4ABAA 1MMJN 1XKAC 2SNVA 2V6NA 7GCHF 2RDLA 3SV7A 1TYNA 3T28A 1HJ9A 2ALVA 4KTCA 1C5QA 4AG1A 1PQ8A 1QB9A 4WF8A 1DSTA 9LPRA 2UWOA 1AVGH 5A0BA 5F6MA 3AASA 3ENSB 3S7KB 1MAYA 3DD2H 1O2YA 2ZFRH 1GVZA 1TB6H 1O2RA 3RUOA 2BX4A 2G81E 4Y71A 1BRUP 1C5SA 2V35A 4TWYA 1THSH 2G5VA 2B8OH 1VCWA 1TPAE 2VNTA 1EOLA 2FOAA 3ZVEA 1P10A 2O8TA 3EGKH 3A87A 1THPB 3GY3A 2IPHA 2AEIH 3VB5A 1DWBH 1HFDA 1C4Y2 1EJMA 1KLJH 1NN6A 3DA9B 3P70B 4FU9A 2EEKA 4MNVA 1FPHH 1V2MT 1K1JA 9ESTA 1OKXA 2QC2A 3RXTA 5HMAA 3QDZB 3LGWA 4U32A 3UNRA 2HVXA 1F5RA 1IQJA 2ZU3A 3F9GA 4YLQH 1QA0A 1A1RA 2Z9GA 5GCHF 2BX3A 2F3CE 1K1MA 2GMTC 1CHOG 1V2WT 2HLCA 4JYTA 1FY8E 4DVAU 3RXRA 2CMYA 1J17T 4M7GA 3UY9A 2ZCKP 4HTCH 3RLWH 6ESTA 2BM2A 1P2KA 2JH0D 3VGCC 1GVKB 2QYIA 2FOMB 2W3KA 1VGCB 4Y8XA 1P2OA 3KQDA 2J2UA 1NESE 3ZZ3A 4X6PA 4B76A 5ABWA 1GGDB 2F9PA 2TGAA 2ZCHP 1AVXA 1DX5M 2HWLB 2H2ZA 1O32A 2PUXB 1SLXB 1C9TA 1O3FA 2ZGCA 5AHGH 1W10U 1UVSH 2Y5GA 3ZZBA 3SUEA 2GDEH 1EXFA 1C2JA 5JBBS 4TY7A 3UR6A 5F03A 3P8NA 1XUHA 1GJ8B 2Z6BD 3MO9A 3O8RA 3KGPA 2SGPE 3P8OA 2OUAA 1SGQE 3DFLA 4YZUA 3ZYDA 1MU6B 1HXEH 2D1JA 2QGRA 2OC1A 3ZV8A 2QXGA 2ULLA 4NWLA 3QZRA 1Z71A 4OGYA 4X2YA 3RMNH 2QY0B 3LGUA 1CBWC 5A0AE 5T6DA 1W11U 1JIRA 1B5GH 4A1XA 2Z94A 3EQ0H 3ATMA 2CV3A 3MTYA 1SQOA 2AYWA 2BVRH 1ID5H 2AERH 1TX7A 4ZXXH 3L33A 5HGGA 4D7GA 1VITF 4ESTE 4OS7A 1B7XB 5DP7A 8GCHG 2RA0A 3NZIA 2KAIA 1P3CA 1LKAA 1SGCA 1TBQH 2BY6X 1OPHB 4ISLA 4Z0KA 2ALPA 2A5IA 3U69H 4ZAEA 2CHAB 4A92A 1CT4E 3M7TA 5FAHA 3U1IB 3ZVBA 3V12A 2FOHA 2J92A 1RRKA 2ZDLA 3NXPA 3KHVA 1MBMA 3VFEA 3HKIB 2FODA 7KMEH 1H4WA 1CSOE 1E0FD 1HRTH 4JYVH 4A7IB 1RGQA 4D8NA 2TPIZ 3HK6B 1O2LA 3RDZA 1O2WA 1BTXA 3PLBA 3UREA 1LO6A 1LHCH 1Z8RA 1MTNB 1D4PB 3TJVA 3VB7A 1FAXA 1AN1E 3MMGA 1C1WH 1WOFA 1PPGE 1BRAA 1KIGH 1ZHRA 3WY8A 3ATIA 1DPOA 2XBWA 1MZDA 4D9RA 3KEEA 4TWWA 2FI4E 1ARCA 4YOGA 3TJUA 1EZUC 1W12U 3MU0A 1SGTA 1D3PB 2OBQA 2PKAB 4K60A 4I32A 1UVPA 1P04A 1P03A 1BRBE 1BTUA 2H1UA 2W7SA 3RXMA 1DM4B 4X1QU 2ZDVH 4ABIA 1WAYB 1C1RA 3A7WA 2YOLA 4FUBA 2TGPZ 1HDTH 4K8YA 1LTOA 2BVXH 1XUGA 2JH5D 2ZIQH 5CE1A 2VWOA 1O37A 3QO6A 3GCNA 4I33A 2C8XB 1ANEA 3LU9B 1LHFH 1WTHD 3PLKA 1AI8H 2BB4A 1DY9A 1C5YB 1FNIA 1EAIA 3SHAH 1CHOF 1BHXF 1CA8B 1QJ7B 2PWXA 4FU7A 6LPRA 1Q2WA 2QF0A 1Z7KA 1AKSA 1ZMNA 2FOCA 3RU4T 4SGBE 1IOEA 1K1IA 3QTOH 2AGEX 1CA0C 4NFEA 4THNH 1WU1A 4D76A 1T8NA 3M5LA 3EA7A 4H6SB 4RKJB 3RMMH 1ZJDA 2BD9A 2VIDA 1C5OH 3R0FA 4O3TA 5F8ZA 1J15A 2P16A 1O3EA 3SNEA 2H5CA 1C2LA 1MUEB 1F92A 2AIPA 5JPMH 5T6FA 1GJ5H 4JK6A 5FX5A 3RXFA 1MQ6A 2XW9A 2HNTE 5JB8S 1NFXA 1CVWH 5E2OA 2AH4X 2FPZA 4UFGH 3LPRA 5EW2H 1O5EH 4Y10E 3ZZ7A 1OWKA 1MQ5A 3SORA 3U8TH 3RXGA 1N8OB 4Q80A 4X6MA 5EQQA 4ISIH 1TABE 4DIIH 1AB9C 1BBRH 1MKWH 5TJXA 4A5TS 1Y8TA 1SGYE 5I25A 2R0KA 1EPTB 1L1GA 4E06H 3S9CA 2ZTXA 4CREA 2GDDA 3P95A 4X2XA 1NZQH 2HNTF 1BUIA 1FV9A 5FHTA 3BG4B 4BXSA 3SGQE 4D9QA 1IQFA 1TGNA 2BDGA 4BXWA 2H9TH 1YCPH 1Z1JA 1ZMJA 3SOSA 4E7RG 1MD7A 4JYUH 4B73A 1BTYA 1C1NA 3GICB 5DPAA 2AGGX 1AUTC 3F9EA 1HAHH 2H9EH 4JZ1A 3M37A 4RKOB 1BMLA 4JZDH 3L3TA 4XBCA 5G4BA 1AY6H 2ZP0H 1QFKH 1YKTA 4CHAB 1UTMA 1NRPH 4GHQA 2LNCA 5ESTE 3UOPA 4WY3A 1C5XB 4HZHA 1BT7A 3A8CA 3AVZA 1JRTA 4GLYA 1NY22 3FFGA 4A6LA 3M5OA 4LXBH 1HUTH 2EI7A 4H4FA 1TIOA 1TQ7B 2R2MB 1W7GH 2BDHA 3JZ2B 2ZPSA 3RMLH 3SU6A 1EAWA 3M7UA 4K1TA 1DLEA 1Z8GA 1UTLM 1TE0A 4H6TA 1ZRBA 4FU8A 1O35A 1LVBA 1S0QA 2ZFSA 7GCHG 2NWNA 2W7UA 3PTNA 4WMDA 3SU4A 1YLCA 2OTVA 1S0RA 2A45B 2GZ7A 3A84A 4Y0YE 3A88A 3ZZDA 2P3UB 4E7NA 4I8JA 3SZNA 1N1LA 1V2JT 5DP4A 1AD8H 2UUJB 3OY6U 2ZFFH 2WYJA 1O2ZA 5HXFA 1XMNB 4NIVA 4UFDH 3UR9A 1O2SA 4DT7B 4BTTB 3RC6A 3STJA 1NRQH 1KXBA 2CN0H 5EU8A 1AE8H 1C2MA 4VGCB 5CHAC 1ELCA 1KXDA 2FWWA 4ZKSU 3RXBA 1P01A 1C1PA 1GBFA 4GCHG 4X2VA 4AG2A 2UWLA 5DP6A 3U8OH 3LONA 1TGSZ 2O8UA 5JYIA 4IS5A 1P11E 3TU7H 3LC5A 1VZQH 4FUEA 1RIWB 3SV6A 3OY5U 4IW4E 2TRMA 3S9AA 1FIZA 3SNDA 2OC0A 4NCYA 1A5GH 1WBGB 2RA3A 1EP6A 3VXEH 3FP6E 3MI4A 1GI4A 2HPPH 2A0QB 4U2WA 1THRH 5DG6A 1KLTA 2WUCA 2ZKSA 3RXSA 3RU4E 2B9LA 2TGDA 4ZROA 2A4QA 3SJOA 3V7TA 1BJUA 2J34A 1Z6EA 1O3HA 1O2KA 2SGQE 3SUDA 4YOIA 4DOQA 1EKBB 1P2JA 1C2EA 3PV4A 3S7HB 5T6GA 4XSKU 1Y3WA 1RTFB 3AW1A 3LJJA 4ZH8A 5DK1A 1BITA 2VB0A 1OX1A 2PW8H 2SGEE 1U6QA 1GJDB 1W3CA 2J38A 3RXPA 1O2TA 3EA8A 2P95A 2CJIA 3I77A 1O39A 4ABHA 2FYRA 1MCTA 1NO9H 2XCFA 4B2BA 4K8BA 2Y7ZA 2ZDNA 5FPTA 1ESAA 8KME2 4WMFA 4BAKB 1P09A 1S82A 1WTGH 1KTTB 1EZSC 1UTQA 4ZHLU 2QV1A 5IDKA 5C5OA 3RP2A 1YCPK 2FOFA 5DO4H 4CBOA 3CENA 1AU8A 1D3DB 3LJOA 5EGMA 3RMOH 1JIMA 1GBTA 4O97A 1O3AA 4K1EA 2NU4E 1GMHF 1PPBH 2M5TA 2WPIS 4NSVA 1BOQA 2WUBA 4GVUA 4Q7XA 4BOHA 1IHSH 2WPLS 1YF4A 3PMHB 3M5NA 5A8YA 3VB4A 3LIWA 4FUIA 4ABGA 1H8IH 1QBNA 3BEUA 1HIAA 3GY2A 1ELBA 1GG6C 1T32A 5LGOA 4I31A 1IQMA 3EDXB 2ZU2A 5C1YA 1H8DH 2W5EA 3SQHE 1DDJA 2PUQH 4TYDA 4GUXA 1TX6A 2ZNKH 3QN7A 3TJNA 1SGIB 2YNBA 2ZGHA 4XFQA 1ZSLA 2EA3A 2CF8H 4NG9H 2QF3A 2BDIA 1BCUH 1YPEH 3VGCB 5EG4A 1O3NA 2VVUA 5PTPA 2XRCA 3SU5A 2GZ9A 3B9FH 3D62A 3TJOA 4DURA 3P6ZB 2BDCA 1PJPA 1TWXB 1INCA 1LPKB 1AHTH 2ZA5A 1ABIH 1EUFA 5GDSH 3GISB 4J1YA 1QBVH 1O2HA 2WV5A 1NFYA 1QHRB 3K6YA 1XX9A 2G52A 4NA8A 1PYTC 2OQUA 1QTFA 1C2KA 1UCYH 1UHBA 1SC8U 1K28D 3A7TA 1K1OA 5ETXA 1SR5C 1TFXA 1ZOMA 1O2IA 1QQUA 1HAPH 3ZVCA 2UUFB 4BTIB 2ESTE 3GDUA 1HYLA 1XUJA 4ZUHA 4CH2B 4CRCA 2BLQA 4YLUA 1TPPA 2P8OB 5L6NH 5DP9A 3BIUH 4U01A 3C1KA 1JRSA 5SGAE 3AW0A 4FXGH 5C3NA 2D8WA 2GCTC 2VVVA 1FDPA 2BOKA 1KYNA 4I8LA 1C5TA 1EJAA 1UO6A 1GI0A 3M3VA 1YC0A 5GPIB 4TPYA 2ZECA 1YYY1 1C1OA 3UWJH 4BAMB 4GCHF 1CO7E 1QJ1B 1T8MA 3VB6A 4IC6A 1DY8A 1MTUA 2HGTH 2XBXA 1TPOA 2O8WA 2BTCE 3F9HA 4K69A 3DT0H 2R2WU 3LKWA 1G37A 4TPIZ 3SNAA 3M61U 2WPHS 4MPUA 2G8TA 1GHBF 1LVOA 1C1TA 2XC5A 5C20A 1V2RT 2DE9A 1PQAA 1QL7A 3RXIA 1YBWA 3RXJA 1A0JA 2ANWA 4WVPE 2F83A 2BVSH 3GCHB 4O9VA 1Y3UA 1C2IA 4NFFA 3EE0B 1T8OA 5JBCS 4AGJA 5FXLA 1G2MA 1A7SA 1IQGA 2NU1E 2R3UA 2VVCA 1JWTA 2ZGJA 2D2DA 2JETB 2WPJS 2VIWA 3U1JB 1V6DA 2FOBA 2TGTA 3A7XA 2TBSA 2O9QA 3RXEA 1HCGA 2VIQA 4UDWH 5K0HA 3MOCA 1AO5A 2G4UA 1C2GA 3GY7A 1C2HA 1SPJA 1DVAH 1V2TT 3MFJA 2GKVE 2HALA 3O8CA 3E8LA 1TBRH 1TGBA 1TQ0B 1O3GA 2H6MA 1C1QA 1P05A 3RC4A 1GHZA 2SFAA 2Y6TA 3UUZA 4NIXA 2GX4A 5BPEA 3T29A 2QXHA 3Q77A 1BMNH 3UTUH 1GCDA 5L2ZH 1TRYA 1JXPA 1L4ZA 1G32B 3HKJB 1Z6JH 1UTJA 2VWNA 2R0LA 4OS6A 2QN5T 4BAQB 3GCTG 1RXPA 3FAOA 1HAOH 2ZGBH 1XM1A 3PMJA 3OU0A 2ODPA 4NA9H 3SNCA 3QGJA 4AB8A 1HNEE 1BHXB 1CQQA 2I6SA 2SGAA 3SU3A 2XNIA 3A82A 4X1NU 5LH8A 3QTVH 3GY5A 1DSUA 4IMQA 1HAVA 2BY7X 1MKXH 2ZZUH 3F6UH 3E90B 4OS2A 1O31A 1QB1A 5JBAS 1HB0B 3NWUA 2Y81A 3U98H 1QL9A 2A31A 4MTBA 1QCPA 2EI6A 2Y7XA 1GBHA 5J4SA 2P3TB 2Q6FA 5EODA 1MZAA 2P94A 2ZHQH 1OWHA 2BD7A 4KP0A 2ZWLH 1HV7A 4UFEH 1C5UA 1NROH 2A1DB 2F9BH 1PFXC 3P17H 3MU4A 1NM6A 2ZFPH 1YPJH 2ZTYA 3ATLA 5EW1H 5T3HA 4Q2KA 3SI4H 4OS1A 1ACBE 1HGTH 2PKSB 4JCNA 1ZZZA 3BF6H 1ZR0A 5JBTA 1C5MD 4CR9A 2ZG0H 1KDQB 1VGCC 1ORFA 3TIUA 1HJAB 5C1XA 4ASHA 4UONA 1GJ6A 4X1RU 1GGDC 2GV6A 4NIWA 3M7QA 3A83A 2BQWB 2THFB 3ZZ8A 1EJNA 4GAWA 3SHCH 1GDQA 1TAWA 4RSPA 3M3TA 3RXQA 1LHDH 3BTEE 3ZVFA 1GCTB 1VITH 1SGNE 1TOMH 1KXAA 2GGVB 4A1VA 1HPGA 3ATKA 2BXUH 3RXHA 1FAKH 1GHAG 4INKA 4YESB 2D26C 1NFUA 1CGIE 5EQRA 4Y7BA 3M5MA
chains in the Genus database with same CATH superfamily
1FONA 2GCHG 1SLVB 5I46H 1LHGH 3MNXA 1O2OA 5AVDA 1AFQC 4WMEA 1NRSH 2STAE 1ELDE 1SI5H 1FXYA 1SGEE 4K1SA 2IN2A 1FY4A 4I8HA 1JBUH 3MNBA 4J2YB 1UTKA 4YTAA 1SGDE 1NU7B 1W0ZU 3T5FH 1C2DA 3SJKA 1O2MA 1C4U2 3PMAB 1PQ7A 4I8KA 4AYYB 1W0YH 1AFEH 2A32A 5GJ4B 1TMUH 2VWLA 1GI1A 2FM2A 4I7YH 1L0ZA 2BXTH 3IWMA 1ZHPA 3SW2B 3U8RH 5FX6A 3PRDA 3KNXA 2OQ5A 3BSQA 3AAUA 2C90B 1L1JA 3UIRA 1GMDG 1H9HE 2PLXA 5KEDA 1F2SE 2K0QA 1GJ9B 3A89A 1ZRKA 1C5PA 3N7OA 1ZGVA 1OP2A 1J14A 3T27A 2QF5A 4Y76A 1FJSA 2BHGA 1ANDA 2Z9IA 2GTBA 1ZPZA 5JDUB 1GDUA 1ZGIA 3W95A 5EXNA 1O3KA 1A3EH 3TH3H 1P02A 5DP8A 1IQHA 1P2IA 1G3EA 5HYOA 4CRAA 1TMBH 4ISHH 2OK5A 2HNTC 4FETA 3MHWU 2ZFTA 1ANCA 3A86A 3GOVB 5HM2A 5C67A 4LZ1H 1S83A 1F0RA 1QRXA 1SGRE 3CS7A 3MNSA 1O5DH 4FUHA 3NPSA 1MTNC 1WV7H 3W94A 1GMHG 1O36A 4OS5A 1SFIA 1G3CA 4ZHMU 1FY5A 3BTWE 3CP7A 1F5LA 1XUIA 2ZQ2A 4NSYA 4MPWA 1ZTKA 1ZTLA 5GXPA 2YNAA 1O2PA 1KXCA 2SNWA 3RC5A 1ESTA 1ZPBA 4X2WA 1O3DA 4CR5A 1KLIH 1MKXK 3H7TA 8LPRA 1YPHE 3LGYA 1GBBA 3GCTF 2EC9H 1EP5A 1C4V2 1ELVA 1AIXH 4MPXA 1GJCB 2HRVA 4O03A 2XC4A 1TGTA 2LPRA 1IQEA 1MTSA 2A2QH 2IJOB 1A3BH 2ZGXH 1QRZA 4O3UA 4Y11E 4YT7H 1YWUA 5DSFA 3P92A 3QK1A 5EJZA 2BMGB 3EYDA 3FOAA 1AVWA 1D9IA 1ZTJA 2ZCLP 1ZHMA 5GWZA 4KKDA 1EAXA 3S9BA 1V2ST 2V0BA 4A1TA 1JMOH 1V2LT 1AGJA 2PR3A 3UFAA 2VGCC 1C9PA 4HFPB 4P00A 4MPVA 1IQIA 2NU2E 1C5LH 1T4UH 4X6NA 5A09A 4B6FA 4FUGA 4B2AA 1E35B 2WINI 1XVOA 4DJZB 2PV9B 4AFSA 3RM2H 1ZMLA 2G4TA 2ZDAH 2ANMH 2XBYA 3U9AH 4AFZA 3RXVA 3Q3YA 3O8DA 1OSSA 1OYQA 2XWBI 2DE8A 3ZZAA 3ODDA 1SGPE 3KF2A 2QIQA 2KCPA 1QBOA 1QURH 1BRCE 1XXDA 4JK5A 5E0GA 1HAYB 4Q7YA 3ZZCA 1NU9A 4HI3A 1H9IE 1B0FA 4ZKRU 1S85A 2FP7B 3E0NB 1WCZA 1H9LB 1G2LA 3BEIB 1FY1A 1SLUB 3VB3A 2P93A 3RXLA 1A0LA 4DW2U 1TOCB 3TGKE 1ZSKA 1H8ED 1GBAA 2FX6A 5C94A 1TNIA 1C1UH 5EXMA 4XRNA 3MO3A 4X6OA 3PTBA 1GHAF 1DUEA 1WUNH 1O5CB 4KTSA 2XBVA 3MNCA 2SGFE 1BZXE 4Y6DA 2QCYA 5C1UA 5FPYA 4ZCNA 2GCHF 2F9OA 1GHBG 2V3HH 1C5VA 3BTME 3ZVGA 1EPTC 1E1RD 1ETSH 2ZPQA 4K5ZA 1UVOA 3SO3A 3NK8A 3MH5A 4X8SH 7LPRA 3PO1C 3L6PA 3UWIA 1L4DA 2BZ6H 1GBDA 1Y3YA 2F9UA 3TGIE 3MU5A 2EY4C 1FZZA 2FX4A 3DHKH 1F0TA 5JB9S 2G5NA 1S5SA 3BTDE 4BNRA 2ZHWH 4GSOA 1TBZH 2C8ZB 1BTZA 2PTCE 4ABDA 1TPSA 5EJ1A 3D65E 4ZKOU 1S84A 4IC5A 2Z3CA 1P2NA 3UB0A 4CHAC 1GMDF 3K6ZA 3B23B 6CHAB 2ZU4A 2W6ID 1MCVA 3UQOA 1F0SA 1G30B 3ZYEA 1UK2A 3MH6A 2GZ8A 4GPGA 3RXKA 1LVYA 2KAIB 1E37B 1C5ZB 1BBRK 1MKWK 3BTQE 1T7CA 2VINA 5E0HA 2ZF0H 1O34A 5A8ZA 2A4RA 1SGFG 2UUKB 1O3MA 3MH7A 3GCOA 1SVPA 1PPFE 2FMJA 3S0NA 1W13U 1Y3VA 2PKAA 3MU1A 1O3BA 3TITA 1C5NH 1NPMA 3PWCA 1XXFA 5B6OA 2GCTB 1TA2A 2AFQB 1UTNA 5E0JA 4AFUA 2Q1JA 1J9CH 2AIQA 4ZKNU 1SOZA 3TNSA 2PGQB 1SB1H 5A0CA 1GBEA 1TNJA 1O5GH 4SGAE 1C2FA 3E6PH 2WPKS 4X1SU 1OWJA 2VIPA 2ZQ1A 1MTWA 2J97A 1ZJKA 1WYKA 1FN8A 3URDA 2FOEA 2VU8E 1SSXA 4CRFA 1O3CA 2ZDMA 4VGCC 2VH6A 1ZYOA 2WV9A 2G51A 2TIOA 3A8DA 2GMTB 3HGPA 1TONA 2GVFA 1HAXB 1ZSJA 2FLBH 3ZVDA 1QQ4A 3TH2H 3V13A 1UVTH 2Y5FA 3HATH 1AZZA 2OD3B 1C5RA 2OXSA 1IQLA 2ODQA 1ETRH 1ETTH 2A5KA 2AS9A 2OCVB 1AWFH 2OC8A 4I8GA 1RJXB 1Z8IB 1UMAH 3H7OA 4OM9A 2CK3D 1TLDA 1O2GH 2A7JA 3TH4H 4FUFA 1FX0B 1ABJH 3F0PA 3SN8A 1UK3A 1EATA 2FI3E 1SLWB 1ELFA 2O8LA 1ELAA 1TNGA 4BAHB 3MYWA 1BIOA 3PRBA 4IBLH 1V2OT 4B1TA 3QZQA 4B6EA 1P3EA 1GL0E 2J94A 3C27B 2A5AA 1O2UA 1KTSB 4B2CA 2Y82A 3SJIA 1AKSB 3A81A 1O33A 2NU3E 3F3BA 3IITA 4KELA 1YLNA 4MG3A 2ZO3H 1LDTT 1DFPA 1O2XA 1C1VH 2J4IA 3SYJA 3NUMA 1EPTA 1XUKA 3S69A 1AUJA 3E0PB 3SBKA 1GHXH 1HJ8A 2F9NA 2OP9A 5FBIA 3TK5A 4YM9A 1A2CH 1L1NA 2Y80A 1O0DH 3A7YA 2FZZA 2FEQH 2H9HA 2A4GA 1NBMD 3BTGE 1K1NA 1D6WA 1CBWB 2ZPRA 1VKYA 3PROA 1SQTA 1QIXB 3UQVA 1DICA 2B7DH 1QA7A 3A8BA 5ESBA 5GIBA 3KQBA 4BAOB 4Y8YA 5CDFE 2RFKC 2VIVA 2J95A 3SJ9A 4FVDA 4XE4A 1FLEE 1W8BH 4TY6A 1OXGA 1CE5A 3FKSD 5FBEA 3SU2A 2SGDE 3M3SA 1J16A 1V2VT 1HLTH 4B71A 1SHHB 1H8HD 4INLA 4CRGA 4ABJA 3FZDA 2GP9B 2ZDKA 1BQYA 1Q3XA 3KQEA 3G01A 2ZI2H 1AE5A 1LPZB 1GI7B 3ATWA 1GI3A 2J9NA 3SJ8A 1P2QA 3FANA 4FUCA 4MNWA 3MH4A 1OP0A 3BEFB 5FCRA 1GBMA 2LELA 3E16B 1OYTH 1GI5A 2XTTB 1GI9B 1BJVA 2UWPA 3NRLA 1SMFE 1PYTD 4Y7AA 4R8TB 1SOTA 1A5IA 1EX3A 1B0EA 5DP3A 1DWEH 1C5WB 1Y5UT 1GDNA 2BD4A 3BTTE 4NZQA 3RXDA 3ZZ9A 1Z1IA 1A0HB 2FYQA 4X1PU 3VEQB 1SBWA 2XC0A 1A61H 4OGXA 2C8YB 1WQSA 1P2MA 5F8XA 3HPTB 1K22H 5DJ7A 1ZPCA 1BA8B 2BLOA 3TLOA 2CF9H 1P57B 4IMZA 4ACBA 2FESH 1O30A 1MTVA 2W26A 3HK3B 4E05H 4F4OC 1TX8A 3A80A 1EASA 4MQAA 4ZXYH 2Z9LA 1QL8A 2A4OA 2GT8A 3SUFA 3SV2H 2Y5HA 1TA6A 2FS8A 1ZLRA 2BQ7B 2FOGA 3GY4A 1OS8A 3OYPA 1GBKA 2VIOA 1KSNA 2Q6GA 1AMHA 3DCLA 1IQKA 3SNBA 3GYLB 2AMDA 4IN2A 4INHA 3STIA 5L2YH 1SHYA 3M35A 1NRRH 5EXLA 4CRDA 1LHEH 1GBLA 1K9OE 1AFQB 3SU1A 2GJGA 3IG6B 2P8OC 1JOUB 3KCGH 2UUYA 2IPQX 2A7HA 3ITIA 2H5DA 2ZHDA 2Z9JA 1BTHH 1XKBC 4MNXA 2A7CA 2FDAA 1V3XA 3GDSA 2F91A 1GI6A 1VCQA 1D3TB 2ZU1A 3ZZ5A 1GJ7B 1Y3XA 2OINA 3ZZ4A 5H4IB 4YT6H 4ABBA 4Z6AH 3TPIZ 4ABEA 3FVFB 3E1XB 3TGJE 1NT1A 3GY8A 2BD2A 3RXUA 5TCCA 5IK2D 1CA0B 5IYTA 3VPKA 4CH8B 1DUAA 1O5BB 2PGBB 1QR3E 1GWAA 3LGTA 1LQDB 3FP7E 3RLYH 1UCYK 2ASUB 2C4FH 2PFEA 1LMWB 1ESBA 1C1MA 5EPYA 1TNHA 1YPMH 1W7XH 2R3YA 1CT2E 2BD8A 4NA7A 2JIZD 4ZMAH 3GCHC 1KXEA 5HM9A 1DLKB 1GVLA 4HGCA 4R0IA 1FQ3A 1IAUA 1C1SA 1NC6A 2ZFQH 1TALA 3TNTA 2GT7A 2JETC 3K9XB 1WSSH 4AX9H 2EQNA 3ELAH 2ANYA 5LPFA 4JZIA 1AB9B 3PYHA 4WJG2 1YP9A 3UOUA 2F9VA 3EE7A 2HLDD 3FN8A 2BDYA 4Q7ZA 1E34B 2QXJA 4ABFA 4UE7H 1QB6A 5KGOA 1KXFA 1Y59T 2FO9A 4XBBA 3OX7U 1QNJA 4AB9A 1BDAA 1UJ1A 1GL1A 3NCLA 3PM3A 4TT3D 3D23A 3LT3A 3VXFH 1UK4A 4LOYH 1QY6A 1DE7H 2AGIX 3M36A 4DY7B 2Z3EA 1YPGH 4YO9A 1BBRE 3SQEE 1LCYA 5E2PA 1LKBA 4MLFB 2JJ1D 1P9UA 3QX5H 4UD9H 1FUJA 2BD3A 1NFWA 2ZHEH 2QXIA 1E38B 1UW7A 5AF9H 1P8VC 2B0FA 2PSXA 1ELEE 5TCAA 5A2MH 2Q6DA 1TNKA 3KN2A 1NS3A 2BD5A 1YLDA 1G3DA 1P12E 1PPHE 1T8LA 3LH1A 2B5TB 3F1SB 1T31A 3SV9A 3BTFE 1YPKH 1SGFA 6GCHG 1AWHB 1H1BA 1O3PB 2V3OH 2VGCB 3BV9B 1D6RA 1EB2A 1J8AA 1PPZA 3KQCA 3K65B 3B8JA 3LC3A 1HIAB 1PPCE 1GHYH 3SU0A 4MNYA 4B74A 1MBQA 4XBDA 4FOUC 1QRWA 1FPCH 3BIVH 1QGFA 1UVUH 2BDBA 4XOJA 1EOJA 4PROA 1RFNA 1VR1H 3T26A 1GPZA 3H5CB 4JZFH 2CHAC 1X7AC 4OS4A 2ZHFH 3AK5A 3I29A 3PWBA 5EPNA 1HAZB 2VWMA 2RCEA 1GJ4H 2FI5E 2FTMA 5LPEA 3K2UA 2ZTZA 3DUXH 4BANB 3ODFA 4HG6A 1CT0E 1FI8A 3R3GB 3OTJE 1LQEA 2IOTA 1DANH 4AYVB 1YM0A 5DP5A 4ISOA 2DUCA 1O3OA 3MQKC 4DIHH 4CRBA 3LGVA 1S6HA 1MABB 5CHAB 1O2JA 1ARBA 3V0XA 2PKSC 4X8TH 4X0WU 1BTWA 2W3IA 4Q63A 2QAAA 2RG3A 3E3TA 1N6XA 1HJAC 1CU1A 3Q3XA 2BDAA 1UHBB 2BLVA 1DXWA 4MVNA 1O5FH 2R9PA 3LH3A 1BB0B 2G00A 1T4VH 3LOXA 1F0UA 3F0OA 1SQAA 2STBE 5L30H 2ZEBA 1EZXC 1Q31A 3Q3KA 4U30A 3LDXH 3ESTA 1GCTC 4UEHH 1SG8B 1ANBA 2EI8A 2I6QA 4FVBA 3UNSA 1WQVH 3PO1B 1F5KU 3QLPH 1RTKA 1YPHC 1K0HA 2QA9E 2RDEA 2ZU5A 1GI2A 2K1QA 1IQNA 2C93B 2XYAA 4LZ4B 1PQ5A 3AAVA 4KGAA 3VG8A 1GJBB 1BMFD 1S6FA 1VJ9U 3BG8A 2WHXA 1BMAA 1DWCH 4DG4A 4H42U 3A8AA 1DXPA 1OWDA 1DWDH 2BLWA 3JZ1B 4AN7A 4D7FA 4ISNA 1GI8B 4F49A 5BRRE 5C5NA 1IHTH 1RS0A 4AZ2B 3URCA 1GHWH 2AHME 1V2KT 4KTUA 4AGKA 1DS2E 1ELGA 8GCHF 3PB1E 2BY8X 1DOJA 2Z3DA 1EB1H 1A5HA 4K2YA 3GDVA 3LGIA 3NKKA 1NTPA 1HAIH 2G55A 4GHTA 1OWEA 4WXVA 3SGAE 3I78A 1OWIA 3TK6A 1GMCG 5AFZH 2Z9KA 1EAUA 3EAJA 2O8MA 2OLGA 1A46H 1ELTA 1RD3B 5EOKA 2FIRH 3Q00A 4ZHAA 3RM0H 1MU8B 3ZV9A 1M9UA 1QJ6B 3UPEA 2C3SA 1DITH 3GYMA 3FZZA 1AQ7A 2YMSC 3SZEA 1TRNA 1CHGA 3P8GA 2HPQH 1LVMA 3SUGA 2JKHA 1RTLA 4MDSA 1GBCA 3V3MA 4AOQA 4B75A 1DT2A 2BZAA 4X8VH 4NIYA 5HIZA 4WH6A 1F7ZA 1XVMA 4DT4A 1NRNH 1E36B 1FY3A 2GD4B 3QGNB 1L2EA 1W2KH 1MD8A 1W14U 5C2ZA 2C8WB 1P0SH 1G9IE 1N6YA 1N8OC 1HBTH 3RXOA 4RN6A 4TSFD 1GG6B 3MO6A 1OP8A 1SFQB 2GV7A 1VCPA 4UFFH 5EQSA 3A85A 5FCKA 1CGJE 1Y5AT 4NWKA 2FS9A 5DKMA 3BG4C 3UNQA 5J4QA 1P9SA 4Y0ZE 1V2PT 4JMYA 1YGCH 3OSYA 1TGCA 1O3JA 2JH6D 1S81A 3HGNA 1OOKB 3P8FA 1G36A 1EQ9A 3E91A 1HXFH 2WYGA 5GCHG 2P3FH 3RXCA 3BTKE 1FMGA 1SL3A 1YPLH 3DFJA 6GCHF 2ZC9H 1FIWA 3O8BA 2ANKH 2WV4A 3WW7A 2BQ6B 3EA9A 5A8XA 4NZLA 3OEED 4I86A 1KY9A 1HAVB 2WZQA 1VJAU 2FTLE 1KDQA 2JJ2D 1GHVH 1O2QA 2ODYB 1O3IA 3T62A 4Y8ZA 2PSYA 3RXAA 5DGJA 3F68H 3MU8A 1O5AB 1LPGB 4FUDA 3BN9A 3A7VA 4K3JA 3PV5A 2PHBA 4NGAH 4IGDA 2KFWA 2Z7FE 1O38A 2ILNA 2BY9X 4Y79A 1PPEE 1BMMH 1TRMA 4FUJA 4LK4A 1OHHD 2XCNA 3T2NA 1G3BA 2A2XH 1Z8JB 4AC9A 2XXLA 1UCYE 3MWIU 3CS0A 1XUFA 1CGHA 1K2I1 3QWCH 3Q76A 2VH0A 1O3LA 3T25A 3PMBB 5HKKD 1GBJA 4AFQA 1HAGE 4XDEA 2XWAA 3TVJB 4IN1A 1NBME 5CMXH 2BOHB 4WH8A 1FN6A 1A4WH 2JDID 2OBOA 3ZVAA 1MAXA 3ZZ6A 1O2VA 2PTNA 2VJ1A 5E8EH 2AMPA 4RI0A 2XNDD 3FP8E 1WXRA 1YCPM 1GJAB 1RIWC 4JZEH 2CGAA 2BY5X 2WPMS 3RU4D 4DCDA 2CXVA 4QT8C 3KL6A 1AZ8A 1UTPA 3KYGA 1UTOA 3PLPA 1O2NA 3KIDU 1VITG 1TMTH 8ESTE 3GS9A 4YOJA 4CBNA 3F9FA 3SI3H 1TNLA 3N7DA 1V2QT 4WXIA 1D3QB 4BTUB 1EZQA 2FXRA 3TK9A 7ESTE 4AORA 1K21H 1K1PA 1P06A 3D49H 2NU0E 2P59A 1GBIA 4DGJA 2HOBA 3GY6A 3A7ZA 5FPSA 5C0UA 1V2NT 4WWYA 3ZIAD 1BTPA 5K7RA 2BYAX 5LPRA 2AMQA 2FLRH 5F8TA 3SV8A 3BTHE 1K1LA 1V2UT 3QUMP 4X8UH 1GMCF 2OC7A 1Y5BT 6CHAC 5AFYH 3SGBE 1MH0A 4ABAA 1MMJN 1XKAC 2SNVA 2V6NA 7GCHF 2RDLA 3SV7A 1TYNA 3T28A 1HJ9A 2ALVA 4KTCA 1C5QA 4AG1A 1PQ8A 1QB9A 4WF8A 1DSTA 9LPRA 2UWOA 1AVGH 5A0BA 5F6MA 3AASA 3ENSB 3S7KB 1MAYA 3DD2H 1O2YA 2ZFRH 1GVZA 1TB6H 1O2RA 3RUOA 2BX4A 2G81E 2M2AA 4Y71A 1BRUP 1C5SA 2V35A 4TWYA 1THSH 2G5VA 2B8OH 1VCWA 1TPAE 2VNTA 4RT0A 1EOLA 2FOAA 3ZVEA 1P10A 2O8TA 2V7QD 3EGKH 3A87A 1THPB 3GY3A 2IPHA 2AEIH 3VB5A 1DWBH 1HFDA 1C4Y2 1EJMA 1KLJH 1NN6A 3DA9B 3P70B 4FU9A 2EEKA 4MNVA 1FPHH 1V2MT 1K1JA 9ESTA 1OKXA 2QC2A 3RXTA 5HMAA 3QDZB 3LGWA 4U32A 1EFRD 3UNRA 2HVXA 1F5RA 1IQJA 2ZU3A 3F9GA 4YLQH 1QA0A 1A1RA 2Z9GA 5GCHF 2BX3A 2F3CE 1K1MA 2GMTC 1CHOG 1V2WT 2HLCA 4JYTA 1FY8E 4DVAU 3RXRA 2CMYA 1J17T 4M7GA 3UY9A 2ZCKP 4HTCH 3RLWH 6ESTA 2BM2A 1P2KA 2JH0D 3VGCC 1GVKB 2QYIA 2FOMB 2W3KA 1VGCB 4Y8XA 1P2OA 3KQDA 2J2UA 1COWD 1NESE 3ZZ3A 4X6PA 3W1EA 4B76A 1GGDB 5ABWA 2F9PA 2TGAA 2ZCHP 1AVXA 1DX5M 2HWLB 2H2ZA 1O32A 2PUXB 1SLXB 1C9TA 1O3FA 2ZGCA 5AHGH 1W10U 1UVSH 2Y5GA 3ZZBA 3SUEA 2GDEH 1EXFA 1C2JA 5JBBS 4TY7A 3UR6A 5F03A 3P8NA 1XUHA 1GJ8B 2Z6BD 3MO9A 3O8RA 3KGPA 3OAAD 2SGPE 3P8OA 2OUAA 1SGQE 3DFLA 4YZUA 3ZYDA 1MU6B 1HXEH 2D1JA 2QGRA 2OC1A 2XOKD 3ZV8A 2QXGA 2ULLA 4NWLA 4Z1MD 3QZRA 1Z71A 4OGYA 4X2YA 3RMNH 2QY0B 3LGUA 1CBWC 5A0AE 5T6DA 1W11U 4M9FA 1JIRA 1B5GH 4A1XA 2Z94A 3EQ0H 3ATMA 2CV3A 3MTYA 1SQOA 2AYWA 2BVRH 1ID5H 1E1QD 2AERH 1TX7A 4ZXXH 3L33A 5HGGA 4D7GA 1VITF 4ESTE 4OS7A 1B7XB 5DP7A 8GCHG 2RA0A 3NZIA 2KAIA 1P3CA 1LKAA 1SGCA 1TBQH 2BY6X 1OPHB 4ISLA 4Z0KA 2ALPA 2A5IA 3U69H 4ZAEA 2CHAB 4A92A 1CT4E 3M7TA 5FAHA 3U1IB 3ZVBA 3V12A 2FOHA 5CHBA 2J92A 1RRKA 2ZDLA 3NXPA 3KHVA 1MBMA 3VFEA 3HKIB 2FODA 7KMEH 1H4WA 1CSOE 1E0FD 1HRTH 5C17A 4JYVH 4A7IB 1RGQA 4D8NA 2TPIZ 3HK6B 2V3MA 1O2LA 3RDZA 1O2WA 1BTXA 1YY3A 3PLBA 3UREA 1LO6A 3OE7D 1LHCH 1Z8RA 1MTNB 1D4PB 3TJVA 3VB7A 1FAXA 1AN1E 3MMGA 1C1WH 1WOFA 1PPGE 1BRAA 1KIGH 1ZHRA 3WY8A 3ATIA 1DPOA 2XBWA 5DN6D 1MZDA 4D9RA 5F53A 3KEEA 4TWWA 2FI4E 1ARCA 4YOGA 3TJUA 1EZUC 1W12U 3MU0A 3OFND 1SGTA 1D3PB 2OBQA 2PKAB 4K60A 4I32A 1UVPA 1P04A 1P03A 1BRBE 1BTUA 5C0TA 2H1UA 2W7SA 3RXMA 1DM4B 4X1QU 2ZDVH 4ABIA 1WAYB 1C1RA 3A7WA 2YOLA 2KCYA 4FUBA 2TGPZ 1HDTH 4K8YA 1LTOA 2BVXH 1XUGA 2JH5D 3WWFA 2ZIQH 5CE1A 3N7EA 2VWOA 1O37A 3QO6A 3GCNA 4I33A 2C8XB 1ANEA 3LU9B 1LHFH 1WTHD 3PLKA 1AI8H 2BB4A 1DY9A 1C5YB 1FNIA 1EAIA 3SHAH 1CHOF 1BHXF 1CA8B 1QJ7B 1WDIA 2PWXA 4FU7A 4Q4LA 1Q2WA 6LPRA 2QF0A 1Z7KA 1AKSA 1ZMNA 2FOCA 3RU4T 4SGBE 1IOEA 1K1IA 3QTOH 2AGEX 1CA0C 4NFEA 4THNH 1WU1A 5T1VA 4D76A 1T8NA 3M5LA 3EA7A 4H6SB 4RKJB 3RMMH 1ZJDA 2BD9A 1SKYE 2VIDA 2HVYB 1C5OH 3R0FA 4O3TA 5F8ZA 1J15A 2P16A 1O3EA 3SNEA 2H5CA 1C2LA 1MUEB 2YMSB 1F92A 2AIPA 5JPMH 5T6FA 1GJ5H 4JK6A 5FX5A 3RXFA 1MQ6A 2XW9A 2HNTE 5JB8S 2L6OA 1NFXA 1CVWH 5E2OA 2AH4X 2FPZA 4UFGH 3LPRA 5EW2H 1O5EH 4Y10E 3ZZ7A 1OWKA 1MQ5A 3SORA 3U8TH 5EIYA 3RXGA 1N8OB 4Q80A 3DSOA 4X6MA 5EQQA 4ISIH 1TABE 4DIIH 1AB9C 1BBRH 1MKWH 5TJXA 4A5TS 1Y8TA 1SGYE 5I25A 2R0KA 1EPTB 1L1GA 4E06H 3S9CA 2ZTXA 4CREA 2GDDA 3P95A 4X2XA 1NZQH 1KMHB 2HNTF 2KZ4A 1BUIA 1FV9A 5FHTA 3BG4B 4BXSA 3SGQE 4D9QA 1IQFA 1TGNA 2BDGA 4BXWA 2H9TH 1YCPH 1Z1JA 1ZMJA 3SOSA 4E7RG 1MD7A 4JYUH 4B73A 1BTYA 1C1NA 3GICB 5DPAA 2AGGX 1AUTC 3F2FA 3F9EA 1HAHH 2H9EH 4JZ1A 3M37A 4RKOB 1BMLA 4JZDH 3L3TA 4XBCA 1E79D 5G4BA 1AY6H 2ZP0H 1QFKH 1YKTA 4CHAB 1UTMA 1NRPH 4GHQA 2LNCA 5ESTE 3UOPA 4WY3A 1C5XB 4HZHA 1BT7A 3A8CA 3AVZA 1JRTA 4GLYA 1NY22 2L74A 3FFGA 4A6LA 3M5OA 4LXBH 1HUTH 2EI7A 4H4FA 1TIOA 1TQ7B 2R2MB 1W7GH 2BDHA 5EJLA 3JZ2B 2ZPSA 3RMLH 3SU6A 1EAWA 3M7UA 4K1TA 1DLEA 1Z8GA 1UTLM 1TE0A 4H6TA 1ZRBA 4FU8A 1O35A 1LVBA 1S0QA 2ZFSA 7GCHG 2NWNA 2W7UA 3PTNA 4WMDA 3SU4A 1YLCA 3H09A 2OTVA 1S0RA 2A45B 2GZ7A 3A84A 4Y0YE 3A88A 3ZZDA 2P3UB 4E7NA 4I8JA 3SZNA 1N1LA 1V2JT 5DP4A 1AD8H 2UUJB 3OY6U 2ZFFH 2WYJA 1O2ZA 5HXFA 1XMNB 4NIVA 4UFDH 3UR9A 1O2SA 2F43B 4DT7B 1W0KD 4BTTB 3RC6A 3STJA 1NRQH 1KXBA 2CN0H 5EU8A 1AE8H 1C2MA 4VGCB 5CHAC 1ELCA 1KXDA 2FWWA 4ZKSU 3RXBA 5HIYA 1P01A 2QF4A 1C1PA 1GBFA 4GCHG 4X2VA 4AG2A 2UWLA 5DP6A 3U8OH 3LONA 1TGSZ 2O8UA 5JYIA 4IS5A 2KCAA 1P11E 3TU7H 3LC5A 1VZQH 4FUEA 1RIWB 2LP6A 3SV6A 3OY5U 4IW4E 2J98A 2TRMA 3S9AA 1FIZA 3SNDA 2OC0A 4NCYA 1A5GH 1WBGB 2RA3A 1EP6A 3VXEH 3FP6E 3MI4A 2PP6A 1GI4A 2HPPH 2A0QB 4U2WA 1THRH 5DG6A 1KLTA 2WUCA 2ZKSA 3RXSA 3RU4E 2B9LA 2TGDA 4ZROA 2IJD1 2A4QA 3SJOA 3V7TA 1BJUA 2J34A 3N99A 1Z6EA 1O3HA 1O2KA 4RT1A 2SGQE 3F2GA 3SUDA 4YOIA 4DOQA 2YMSD 1EKBB 1P2JA 1C2EA 3PV4A 3S7HB 5T6GA 4XSKU 1Y3WA 1RTFB 3AW1A 3LJJA 4ZH8A 3PV2A 5DK1A 1BITA 2VB0A 1OX1A 2PW8H 2SGEE 1U6QA 1GJDB 1W3CA 2J38A 3RXPA 1O2TA 3EA8A 2P95A 2CJIA 3I77A 1O39A 4ABHA 3DSGA 2FYRA 1MCTA 1NO9H 2XCFA 4B2BA 4K8BA 2Y7ZA 2ZDNA 5FPTA 1ESAA 8KME2 4WMFA 4BAKB 1P09A 1S82A 1WTGH 1KTTB 1EZSC 1UTQA 4ZHLU 2QV1A 5IDKA 5C5OA 3RP2A 1YCPK 2FOFA 5DO4H 4CBOA 3CENA 1AU8A 1D3DB 3LJOA 5EGMA 5FL7D 1JIMA 3RMOH 1GBTA 4O97A 5KECA 1O3AA 4K1EA 2NU4E 1GMHF 1PPBH 2M5TA 2WPIS 4NSVA 1BOQA 2WUBA 4GVUA 4Q7XA 4BOHA 1IHSH 2K8IA 2WPLS 1YF4A 3PMHB 3M5NA 5A8YA 3VB4A 3LIWA 4FUIA 4ABGA 1H8IH 1QBNA 3BEUA 1HIAA 3GY2A 4P02A 1ELBA 1GG6C 1T32A 5LGOA 4I31A 1IQMA 3EDXB 2ZU2A 5C1YA 1H8DH 2W5EA 3SQHE 1DDJA 2PUQH 2WPDD 4TYDA 4GUXA 1TX6A 2ZNKH 3QN7A 3TJNA 1SGIB 2YNBA 3WWBA 2ZGHA 4XFQA 1ZSLA 2EA3A 2CF8H 4NG9H 2QF3A 1SQRA 2BDIA 1BCUH 1YPEH 3VGCB 5EG4A 1O3NA 2VVUA 5PTPA 2XRCA 3SU5A 2GZ9A 3B9FH 3D62A 3TJOA 4DURA 3P6ZB 2BDCA 1PJPA 1TWXB 1INCA 1LPKB 1AHTH 2ZA5A 1ABIH 1EUFA 5GDSH 3GISB 4J1YA 1QBVH 1O2HA 2WV5A 1NFYA 1QHRB 3K6YA 1XX9A 2G52A 4NA8A 1PYTC 2OQUA 1QTFA 1C2KA 1UCYH 1UHBA 1SC8U 1K28D 3A7TA 1K1OA 5ETXA 1SR5C 1TFXA 1ZOMA 1O2IA 1QQUA 1HAPH 3ZVCA 2UUFB 4BTIB 2ESTE 3GDUA 1HYLA 1XUJA 4ZUHA 4CH2B 4CRCA 2BLQA 2J5UA 4YLUA 1TPPA 2P8OB 5L6NH 5DP9A 3BIUH 4U01A 3C1KA 1JRSA 5SGAE 3AW0A 4FXGH 5C3NA 2D8WA 2GCTC 2VVVA 1FDPA 2BOKA 1KYNA 4I8LA 1C5TA 1EJAA 1UO6A 1GI0A 3M3VA 1YC0A 5GPIB 4TPYA 2ZECA 1YYY1 1C1OA 2VBCA 3UWJH 4BAMB 4GCHF 1CO7E 1QJ1B 1T8MA 3VB6A 4IC6A 1DY8A 1MTUA 2HGTH 2XBXA 4ASUD 1TPOA 2O8WA 2KR7A 2BTCE 3F9HA 3F2HA 4K69A 3DT0H 2R2WU 3LKWA 1G37A 4TPIZ 3SNAA 3M61U 2WPHS 4MPUA 2G8TA 1GHBF 1LVOA 1C1TA 2XC5A 5C20A 1V2RT 2DE9A 1PQAA 1QL7A 2KM0A 3RXIA 1YBWA 3KYFA 3RXJA 1A0JA 2ANWA 3OEHD 4WVPE 2F83A 2BVSH 3GCHB 4O9VA 1Y3UA 1C2IA 4NFFA 3EE0B 1T8OA 5JBCS 4AGJA 2KX4A 5FXLA 1G2MA 1A7SA 1IQGA 2NU1E 2R3UA 2VVCA 1JWTA 2ZGJA 2D2DA 2JETB 2WPJS 2VIWA 3U1JB 1V6DA 2FOBA 2TGTA 4YXWD 3A7XA 2TBSA 2O9QA 3RXEA 1HCGA 2VIQA 4UDWH 5K0HA 3MOCA 3UAIC 1AO5A 2G4UA 1C2GA 3GY7A 1C2HA 1SPJA 2KCOA 1DVAH 1V2TT 3MFJA 2GKVE 2HALA 4F48B 3O8CA 3E8LA 1TBRH 1TGBA 1TQ0B 2F4LA 1O3GA 2H6MA 1C1QA 1P05A 3RC4A 1GHZA 2SFAA 2Y6TA 3UUZA 4NIXA 2GX4A 5BPEA 3KQ5A 3T29A 2QXHA 3Q77A 1BMNH 3CNRA 5GNDA 3UTUH 1GCDA 5L2ZH 1TRYA 1JXPA 1L4ZA 1G32B 3HKJB 1Z6JH 2WSSD 1UTJA 2VWNA 2R0LA 4OS6A 2QN5T 4F55A 4BAQB 3GCTG 1RXPA 3FAOA 1HAOH 2ZGBH 1XM1A 3PMJA 3OU0A 2ODPA 4NA9H 3SNCA 1S6LA 3QGJA 4AB8A 1HNEE 1BHXB 1CQQA 2I6SA 2SGAA 3SU3A 2XNIA 3A82A 4X1NU 5LH8A 3QTVH 3GY5A 1DSUA 4IMQA 1HAVA 2BY7X 1MKXH 2ZZUH 3F6UH 3E90B 4OS2A 1O31A 1QB1A 5JBAS 1HB0B 3NWUA 2Y81A 3U98H 1QL9A 2A31A 4MTBA 1QCPA 2EI6A 2Y7XA 2W6JD 1GBHA 5J4SA 2P3TB 2Q6FA 1W0JD 5EODA 1MZAA 2P94A 2ZHQH 1OWHA 2BD7A 4KP0A 2ZWLH 1HV7A 4UFEH 1C5UA 2J98B 1NROH 3FO8D 2A1DB 2F9BH 4XD7D 1PFXC 3P17H 3U28C 3MU4A 1NM6A 2ZFPH 1YPJH 2ZTYA 3ATLA 5EW1H 5T3HA 4Q2KA 3SI4H 3DSPA 4OS1A 1ACBE 1HGTH 2PKSB 4JCNA 1QZ8A 1ZZZA 3BF6H 1ZR0A 5JBTA 1C5MD 5B6LA 4CR9A 2ZG0H 1KDQB 1VGCC 1ORFA 3TIUA 1HJAB 5C1XA 4ASHA 4UONA 1GJ6A 4X1RU 1GGDC 3OTPA 2GV6A 4NIWA 3M7QA 3A83A 2BQWB 2THFB 3ZZ8A 1EJNA 4GAWA 3SHCH 1GDQA 1TAWA 4RSPA 2QE7D 3M3TA 3RXQA 1LHDH 3BTEE 3ZVFA 4ACAA 1GCTB 1VITH 1SGNE 1TOMH 1KXAA 2GGVB 4A1VA 1HPGA 3ATKA 2BXUH 3RXHA 1FAKH 1GHAG 4INKA 4YESB 2D26C 1NFUA 1CGIE 5EQRA 4Y7BA 3M5MA
chains in the Genus database with same CATH topology
1FONA 2GCHG 1SLVB 5I46H 1LHGH 3MNXA 1O2OA 5AVDA 1AFQC 4WMEA 1NRSH 2STAE 1ELDE 1SI5H 1FXYA 1SGEE 4K1SA 2IN2A 1FY4A 4I8HA 1JBUH 3MNBA 4J2YB 1UTKA 4YTAA 1SGDE 1NU7B 1W0ZU 3T5FH 1C2DA 3SJKA 1O2MA 1C4U2 3PMAB 1PQ7A 4I8KA 4AYYB 1W0YH 1AFEH 2A32A 5GJ4B 1TMUH 2VWLA 1GI1A 2FM2A 4I7YH 1L0ZA 2BXTH 3IWMA 1ZHPA 3SW2B 3U8RH 5FX6A 3KNXA 2OQ5A 3BSQA 3AAUA 2C90B 1L1JA 3UIRA 1GMDG 1H9HE 2PLXA 1F2SE 1GJ9B 3A89A 1ZRKA 1C5PA 3N7OA 1ZGVA 1OP2A 1J14A 3T27A 4Y76A 1FJSA 2BHGA 1ANDA 2Z9IA 2GTBA 1ZPZA 5JDUB 1GDUA 1ZGIA 3W95A 5EXNA 1O3KA 1A3EH 3TH3H 1P02A 5DP8A 1IQHA 1P2IA 1G3EA 5HYOA 4CRAA 1TMBH 4ISHH 2HNTC 3MHWU 2ZFTA 1ANCA 3A86A 3GOVB 5HM2A 5C67A 4LZ1H 1S83A 1F0RA 1QRXA 1SGRE 3CS7A 3MNSA 1O5DH 4FUHA 3NPSA 1MTNC 1WV7H 3W94A 1GMHG 1O36A 4OS5A 1SFIA 1G3CA 4ZHMU 1FY5A 3BTWE 3CP7A 1F5LA 1XUIA 2ZQ2A 4NSYA 4MPWA 1ZTKA 1ZTLA 5GXPA 2YNAA 1O2PA 1KXCA 2SNWA 3RC5A 1ESTA 1ZPBA 4X2WA 1O3DA 4CR5A 1KLIH 1MKXK 3H7TA 8LPRA 1YPHE 3LGYA 1GBBA 3GCTF 2EC9H 1EP5A 1C4V2 1ELVA 1AIXH 4MPXA 1GJCB 2HRVA 4O03A 2XC4A 1TGTA 2LPRA 1IQEA 1MTSA 2A2QH 2IJOB 1A3BH 2ZGXH 1QRZA 4O3UA 4Y11E 4YT7H 3P92A 3QK1A 2BMGB 3EYDA 1AVWA 1D9IA 1ZTJA 2ZCLP 1ZHMA 5GWZA 4KKDA 1EAXA 3S9BA 1V2ST 2V0BA 4A1TA 1JMOH 1V2LT 1AGJA 2PR3A 3UFAA 2VGCC 1C9PA 4HFPB 4MPVA 1IQIA 2NU2E 1C5LH 1T4UH 4X6NA 5A09A 4FUGA 4B2AA 1E35B 2WINI 1XVOA 4DJZB 2PV9B 4AFSA 3RM2H 1ZMLA 2G4TA 2ZDAH 2ANMH 2XBYA 3U9AH 4AFZA 3RXVA 3Q3YA 3O8DA 1OSSA 1OYQA 2XWBI 2DE8A 3ZZAA 3ODDA 1SGPE 3KF2A 2QIQA 4JK5A 1QBOA 1QURH 1BRCE 1XXDA 5E0GA 1HAYB 4Q7YA 3ZZCA 1NU9A 4HI3A 1H9IE 1B0FA 4ZKRU 1S85A 2FP7B 3E0NB 1WCZA 1H9LB 1G2LA 3BEIB 1FY1A 1SLUB 3VB3A 2P93A 3RXLA 1A0LA 4DW2U 1TOCB 3TGKE 1ZSKA 1GBAA 2FX6A 1TNIA 1C1UH 5EXMA 3MO3A 4X6OA 3PTBA 1GHAF 1DUEA 1WUNH 1O5CB 4KTSA 2XBVA 3MNCA 2SGFE 1BZXE 4Y6DA 2QCYA 5C1UA 5FPYA 2GCHF 2F9OA 1GHBG 2V3HH 1C5VA 3BTME 3ZVGA 1EPTC 1ETSH 2ZPQA 4K5ZA 1UVOA 3SO3A 3NK8A 3MH5A 4X8SH 7LPRA 3PO1C 3L6PA 3UWIA 1L4DA 2BZ6H 1GBDA 1Y3YA 2F9UA 3TGIE 3MU5A 1FZZA 2FX4A 3DHKH 1F0TA 5JB9S 2G5NA 1S5SA 3BTDE 4BNRA 2ZHWH 4GSOA 1TBZH 2C8ZB 1BTZA 2PTCE 4ABDA 1TPSA 3D65E 4ZKOU 1S84A 4IC5A 2Z3CA 1P2NA 4CHAC 1GMDF 3K6ZA 3B23B 6CHAB 2ZU4A 1MCVA 3UQOA 1F0SA 1G30B 3ZYEA 1UK2A 3MH6A 2GZ8A 4GPGA 3RXKA 1LVYA 2KAIB 1E37B 1C5ZB 1BBRK 1MKWK 3BTQE 1T7CA 2VINA 5E0HA 2ZF0H 1O34A 5A8ZA 2A4RA 1SGFG 2UUKB 1O3MA 3MH7A 3GCOA 1SVPA 1PPFE 2FMJA 3S0NA 1W13U 1Y3VA 2PKAA 3MU1A 1O3BA 3TITA 1C5NH 1NPMA 3PWCA 1XXFA 5B6OA 2GCTB 1TA2A 2AFQB 1UTNA 5E0JA 4AFUA 2Q1JA 1J9CH 2AIQA 4ZKNU 1SOZA 3TNSA 2PGQB 1SB1H 5A0CA 1GBEA 1TNJA 1O5GH 4SGAE 1C2FA 3E6PH 2WPKS 4X1SU 1OWJA 2VIPA 2ZQ1A 1MTWA 1ZJKA 1WYKA 1FN8A 3URDA 2FOEA 2VU8E 1SSXA 4CRFA 1O3CA 2ZDMA 4VGCC 2VH6A 1ZYOA 2G51A 2TIOA 3A8DA 2GMTB 3HGPA 1TONA 2GVFA 1HAXB 1ZSJA 2FLBH 3ZVDA 1QQ4A 3TH2H 3V13A 1UVTH 2Y5FA 3HATH 1AZZA 2OD3B 1C5RA 2OXSA 1IQLA 2ODQA 1ETRH 1ETTH 2A5KA 2OCVB 2AS9A 1AWFH 2OC8A 4I8GA 1RJXB 1Z8IB 1UMAH 3H7OA 1TLDA 1O2GH 2A7JA 3TH4H 4FUFA 1ABJH 3SN8A 1UK3A 1EATA 2FI3E 1SLWB 1ELFA 2O8LA 1ELAA 1TNGA 4BAHB 3MYWA 1BIOA 4IBLH 1V2OT 4B1TA 3QZQA 1P3EA 1GL0E 2J94A 3C27B 2A5AA 1O2UA 1KTSB 4B2CA 2Y82A 3SJIA 1AKSB 3A81A 1O33A 2NU3E 3IITA 4KELA 4MG3A 2ZO3H 1LDTT 1DFPA 1O2XA 1C1VH 2J4IA 3NUMA 1EPTA 1XUKA 3S69A 1AUJA 3E0PB 3SBKA 1GHXH 1HJ8A 2F9NA 2OP9A 5FBIA 3TK5A 4YM9A 1A2CH 1L1NA 2Y80A 1O0DH 3A7YA 2FZZA 2FEQH 2H9HA 2A4GA 3BTGE 1K1NA 1D6WA 1CBWB 2ZPRA 3PROA 1SQTA 1QIXB 3UQVA 1DICA 2B7DH 1QA7A 3A8BA 5ESBA 5GIBA 3KQBA 4BAOB 4Y8YA 2VIVA 2J95A 3SJ9A 4FVDA 4XE4A 1FLEE 1W8BH 4TY6A 1OXGA 1CE5A 5FBEA 3SU2A 2SGDE 3M3SA 1J16A 1V2VT 1HLTH 4B71A 1SHHB 4INLA 4CRGA 4ABJA 3FZDA 2GP9B 2ZDKA 1BQYA 1Q3XA 3KQEA 3G01A 2ZI2H 1AE5A 1LPZB 1GI7B 3ATWA 1GI3A 2J9NA 3SJ8A 1P2QA 3FANA 4FUCA 4MNWA 3MH4A 1OP0A 3BEFB 5FCRA 1GBMA 3E16B 1OYTH 1GI5A 2XTTB 1GI9B 1BJVA 2UWPA 1SMFE 1PYTD 4Y7AA 4R8TB 1SOTA 1A5IA 1EX3A 1B0EA 5DP3A 1DWEH 1C5WB 1Y5UT 1GDNA 2BD4A 3BTTE 4NZQA 3RXDA 3ZZ9A 1Z1IA 1A0HB 2FYQA 4X1PU 3VEQB 1SBWA 2XC0A 1A61H 4OGXA 2C8YB 1WQSA 1P2MA 5F8XA 3HPTB 1K22H 5DJ7A 1ZPCA 1BA8B 2BLOA 3TLOA 2CF9H 1P57B 4IMZA 2FESH 1O30A 1MTVA 2W26A 3HK3B 4E05H 4F4OC 1TX8A 3A80A 1EASA 4MQAA 4ZXYH 2Z9LA 1QL8A 2A4OA 2GT8A 3SUFA 3SV2H 2Y5HA 1TA6A 2FS8A 1ZLRA 2BQ7B 2FOGA 3GY4A 1OS8A 3OYPA 1GBKA 2VIOA 1KSNA 2Q6GA 1AMHA 3SNBA 1IQKA 3STIA 3GYLB 2AMDA 4IN2A 4INHA 5L2YH 1SHYA 3M35A 1NRRH 5EXLA 4CRDA 1LHEH 1GBLA 1K9OE 1AFQB 3SU1A 3IG6B 2P8OC 1JOUB 3KCGH 2UUYA 2A7HA 3ITIA 2H5DA 2ZHDA 2Z9JA 1BTHH 1XKBC 4MNXA 2A7CA 2FDAA 1V3XA 3GDSA 2F91A 1GI6A 1VCQA 1D3TB 2ZU1A 3ZZ5A 1GJ7B 1Y3XA 2OINA 3ZZ4A 5H4IB 4YT6H 4ABBA 4Z6AH 3TPIZ 4ABEA 3FVFB 3E1XB 3TGJE 1NT1A 3GY8A 2BD2A 3RXUA 5TCCA 1CA0B 5IYTA 3VPKA 4CH8B 1DUAA 1O5BB 2PGBB 1QR3E 1GWAA 3LGTA 1LQDB 3FP7E 3RLYH 1UCYK 2ASUB 2C4FH 2PFEA 1LMWB 1ESBA 1C1MA 5EPYA 1TNHA 1YPMH 1W7XH 2R3YA 1CT2E 2BD8A 4NA7A 4ZMAH 3GCHC 1KXEA 5HM9A 1DLKB 1GVLA 4HGCA 4R0IA 1FQ3A 1IAUA 1C1SA 1NC6A 2ZFQH 1TALA 3TNTA 2GT7A 2JETC 3K9XB 1WSSH 4AX9H 3ELAH 2ANYA 5LPFA 4JZIA 1AB9B 3PYHA 4WJG2 1YP9A 3UOUA 2F9VA 2BDYA 4Q7ZA 1E34B 2QXJA 4ABFA 4UE7H 1QB6A 1KXFA 1Y59T 2FO9A 4XBBA 3OX7U 1QNJA 4AB9A 1BDAA 1UJ1A 1GL1A 3NCLA 3PM3A 3D23A 3LT3A 3VXFH 1UK4A 4LOYH 1QY6A 1DE7H 2AGIX 3M36A 4DY7B 2Z3EA 1YPGH 4YO9A 1BBRE 3SQEE 1LCYA 5E2PA 1LKBA 4MLFB 1P9UA 3QX5H 4UD9H 1FUJA 2BD3A 1NFWA 2ZHEH 2QXIA 1E38B 5AF9H 1P8VC 2B0FA 2PSXA 1ELEE 5TCAA 5A2MH 2Q6DA 1TNKA 3KN2A 1NS3A 2BD5A 1YLDA 1G3DA 1P12E 1PPHE 1T8LA 3LH1A 2B5TB 3F1SB 1T31A 3SV9A 3BTFE 1YPKH 1SGFA 6GCHG 1AWHB 1H1BA 1O3PB 2V3OH 2VGCB 3BV9B 1D6RA 1EB2A 1J8AA 1PPZA 3KQCA 3K65B 3B8JA 3LC3A 1HIAB 1PPCE 1GHYH 3SU0A 4MNYA 4B74A 1MBQA 4XBDA 1QRWA 1FPCH 3BIVH 1QGFA 1UVUH 2BDBA 4XOJA 1EOJA 4PROA 1RFNA 1VR1H 3T26A 1GPZA 3H5CB 4JZFH 2CHAC 1X7AC 4OS4A 2ZHFH 3I29A 3PWBA 5EPNA 1HAZB 2VWMA 2RCEA 1GJ4H 2FI5E 2FTMA 5LPEA 3K2UA 2ZTZA 3DUXH 4BANB 3ODFA 1CT0E 1FI8A 3R3GB 3OTJE 1LQEA 2IOTA 1DANH 4AYVB 1YM0A 5DP5A 4ISOA 2DUCA 1O3OA 4DIHH 4CRBA 3LGVA 1S6HA 5CHAB 1O2JA 1ARBA 3V0XA 2PKSC 4X8TH 4X0WU 1BTWA 2W3IA 2QAAA 2RG3A 3E3TA 1N6XA 1HJAC 1CU1A 3Q3XA 2BDAA 1UHBB 2BLVA 1DXWA 4MVNA 1O5FH 2R9PA 3LH3A 1BB0B 2G00A 1T4VH 3LOXA 1F0UA 1SQAA 2STBE 5L30H 2ZEBA 1EZXC 1Q31A 3Q3KA 4U30A 3LDXH 3ESTA 1GCTC 4UEHH 1SG8B 1ANBA 2EI8A 2I6QA 4FVBA 3UNSA 1WQVH 3PO1B 1F5KU 3QLPH 1RTKA 1YPHC 2QA9E 2ZU5A 1GI2A 2K1QA 1IQNA 2C93B 2XYAA 4LZ4B 1PQ5A 3AAVA 4KGAA 1GJBB 1S6FA 1VJ9U 3BG8A 1BMAA 1DWCH 4DG4A 4H42U 3A8AA 1DXPA 1OWDA 1DWDH 2BLWA 3JZ1B 4AN7A 4D7FA 4ISNA 1GI8B 4F49A 5BRRE 5C5NA 1IHTH 1RS0A 4AZ2B 3URCA 1GHWH 1V2KT 4KTUA 4AGKA 1DS2E 1ELGA 8GCHF 3PB1E 2BY8X 1DOJA 2Z3DA 1EB1H 1A5HA 4K2YA 3GDVA 3LGIA 3NKKA 1NTPA 1HAIH 2G55A 4GHTA 1OWEA 4WXVA 3SGAE 3I78A 1OWIA 3TK6A 1GMCG 5AFZH 2Z9KA 1EAUA 3EAJA 2O8MA 2OLGA 1A46H 1ELTA 1RD3B 5EOKA 2FIRH 3Q00A 4ZHAA 3RM0H 1MU8B 3ZV9A 1M9UA 1QJ6B 3UPEA 2C3SA 1DITH 3GYMA 3FZZA 1AQ7A 1TRNA 1CHGA 3P8GA 2HPQH 1LVMA 3SUGA 2JKHA 1RTLA 4MDSA 1GBCA 3V3MA 4AOQA 4B75A 1DT2A 2BZAA 4X8VH 4NIYA 4WH6A 1F7ZA 1XVMA 1NRNH 1E36B 1FY3A 2GD4B 3QGNB 1L2EA 1W2KH 1MD8A 1W14U 5C2ZA 2C8WB 1P0SH 1G9IE 1N6YA 1N8OC 1HBTH 3RXOA 4RN6A 1GG6B 3MO6A 1OP8A 1SFQB 2GV7A 1VCPA 4UFFH 5EQSA 3A85A 5FCKA 1CGJE 1Y5AT 4NWKA 2FS9A 5DKMA 3BG4C 3UNQA 5J4QA 1P9SA 4Y0ZE 1V2PT 4JMYA 1YGCH 3OSYA 1TGCA 1O3JA 2JH6D 1S81A 3HGNA 1OOKB 3P8FA 1G36A 1EQ9A 3E91A 1HXFH 2WYGA 5GCHG 2P3FH 3RXCA 3BTKE 1FMGA 1SL3A 1YPLH 3DFJA 6GCHF 2ZC9H 1FIWA 3O8BA 2ANKH 2WV4A 2BQ6B 3EA9A 5A8XA 4NZLA 1KY9A 1HAVB 1VJAU 2FTLE 1KDQA 1GHVH 1O2QA 2ODYB 1O3IA 3T62A 4Y8ZA 2PSYA 3RXAA 5DGJA 3F68H 3MU8A 1O5AB 1LPGB 4FUDA 3BN9A 3A7VA 4K3JA 2PHBA 4NGAH 4IGDA 2Z7FE 1O38A 2ILNA 2BY9X 4Y79A 1PPEE 1BMMH 1TRMA 4FUJA 4LK4A 2XCNA 3T2NA 1G3BA 2A2XH 1Z8JB 2XXLA 1UCYE 3MWIU 3CS0A 1XUFA 1CGHA 1K2I1 3QWCH 3Q76A 2VH0A 1O3LA 3T25A 3PMBB 1GBJA 4AFQA 1HAGE 4XDEA 2XWAA 3TVJB 4IN1A 5CMXH 2BOHB 4WH8A 1FN6A 1A4WH 2OBOA 3ZVAA 1MAXA 3ZZ6A 1O2VA 2PTNA 2VJ1A 5E8EH 2AMPA 3FP8E 1YCPM 1GJAB 1RIWC 4JZEH 2CGAA 2BY5X 2WPMS