2FS8A

Human beta-tryptase ii with inhibitor cra-29382
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tryptase beta-2
publication title Structure-guided design of Peptide-based tryptase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 50
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2006-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fs8A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fs8A01
1L2EA 1GBDA 3VXEH 1L0ZA 4NA8A 1GJCB 1TX7A 1D6RA 1HV7A 1TIOA 4BANB 1ZSKA 3QDZB 4NIXA 3HGPA 5GCHF 5FCKA 4Q7YA 3DHKH 3PMHB 2ZPSA 1K2I1 2CF8H 1A5HA 1KLTA 1OS8A 3RMMH 2RA0A 3LOXA 4ABEA 3A8CA 2QN5T 3PLBA 2C93B 1T4UH 5DP8A 3K9XB 1F7ZA 1O3PB 2VGCC 2ZQ2A 4NGAH 3GISB 2ZEBA 3ZZ6A 1KXFA 2ZDVH 1L1NA 3KN2A 1ESAA 1P3CA 2FOAA 2J2UA 3FP6E 4I8KA 4X6NA 1BRBE 2GZ9A 3GDVA 2R0LA 5I25A 4A1VA 5DG6A 1RRKA 4B76A 1DS2E 3NCLA 1PQ8A 2OLGA 2NU4E 3UR9A 3S69A 1LMWB 1ZTKA 4K8YA 4GHTA 1FPCH 1V2JT 1HGTH 1TOCB 1V2QT 2BMGB 9LPRA 1VITG 2ALVA 1FJSA 2BDHA 2BD8A 1RIWB 3PLKA 4NIYA 5T6DA 2ZU3A 1HDTH 2SGDE 2VIWA 1A0HB 1VITF 3GCOA 1AZ8A 6LPRA 1O36A 2SGEE 2GDEH 5FPTA 2FWWA 1G32B 1GI7B 1YM0A 4KTSA 1HAVB 4MTBA 1O3CA 1HB0B 1VR1H 3A7TA 1EZQA 1MTNC 1BMNH 3W94A 1SGNE 4WH8A 1ZHMA 3RXDA 1OWEA 2ZGCA 2BM2A 1HJ9A 4IBLH 1GPZA 4K1TA 2G4TA 3C27B 3S7HB 5IYTA 8LPRA 4Y8YA 1YPHE 2ZGHA 2QA9E 2C8YB 1LQEA 1OWKA 2XBXA 5LH8A 2BDYA 3RXVA 3EA7A 1J9CH 1D3DB 3RXIA 3PV4A 3TNTA 3RC4A 3QO6A 1CQQA 1XX9A 2IOTA 1JIMA 1Y3UA 1C9PA 1O3BA 4Y11E 4Y79A 3C1KA 1EQ9A 4TPIZ 2ZCLP 4A92A 4BAQB 5F8TA 1BTUA 5DPAA 5JYIA 5JDUB 2PFEA 2ANYA 2CHAB 2ODPA 1QCPA 1YYY1 5BRRE 1THPB 2O8MA 3VPKA 1DANH 4SGBE 1IQMA 3LGUA 1GBAA 2ZGJA 3LGIA 1J16A 2OQUA 4FU7A 2PTCE 1P9UA 2QYIA 2OBOA 1JRSA 1HYLA 1P2IA 1GI8B 2VINA 1CT0E 3PTNA 2G5VA 1DWCH 4ZAEA 1O2LA 1AU8A 3RXGA 1HBTH 2R3UA 3D23A 1QL7A 2QGRA 1NM6A 2ODYB 5GPIB 4AYYB 3TGKE 3UUZA 1Y3YA 1MQ6A 4Y6DA 3TH3H 4GCHG 4TWWA 3H7TA 1BBRH 1Q2WA 1T8OA 3RXBA 4H6SB 1GJ7B 1O3OA 1GBTA 4FUIA 2P95A 2JETB 1ZPCA 3BTTE 2A31A 1YPJH 1OPHB 1TABE 5G4BA 2A7HA 2FIRH 1KXAA 1WQVH 5EQRA 1C2HA 1OYQA 4U01A 1TGNA 4WWYA 3Q00A 1BHXF 3SJ9A 3PMBB 4FUCA 4BAHB 4LZ1H 4K1EA 4FXGH 5EW1H 1EZUC 1HAGE 1TRNA 2Z94A 3SU1A 1A3EH 1D3TB 3P92A 1O3FA 1VJ9U 3UOPA 1MZDA 9ESTA 2WPLS 3E16B 4O9VA 3A8BA 1AHTH 1C2EA 1O5AB 5EGMA 1LKAA 1Q3XA 1EP5A 3GICB 1YPEH 5JB8S 1FMGA 2RA3A 2H2ZA 2HNTF 1O3AA 1PPBH 3RM2H 3CP7A 3A82A 5FBIA 3P17H 1SFQB 4H6TA 5E0GA 1BOQA 5EQSA 2HPPH 4ABAA 4NZLA 1CT2E 2OD3B 1MTVA 3GCHC 1GMHG 1K1OA 1GHVH 2DE8A 4AORA 1H9IE 3SGBE 3IWMA 1DUAA 5C67A 2GCTB 3AAUA 4YTAA 3SW2B 1GMHF 4O03A 1MTNB 4KELA 1F5LA 1C5TA 5DK1A 2O8TA 5F03A 4H42U 2FMJA 4FUJA 1PQ7A 4IGDA 1Q31A 4GLYA 3ZVAA 2G8TA 1P05A 4X8VH 2GDDA 2ANKH 3E6PH 1LPGB 2ZU4A 1GL1A 2BYAX 2JKHA 4I8JA 4NA9H 1NO9H 2RDLA 1P09A 3QTVH 4H4FA 1MKXH 4X8SH 1FAKH 4KKDA 3M5OA 1O32A 2QF0A 8ESTE 1MQ5A 2HNTC 1P10A 3UNQA 3KQEA 1ZR0A 1QQ4A 3MFJA 3M5LA 3GDSA 2P94A 1FZZA 1OYTH 3CENA 4K2YA 4CRBA 1DY9A 1KTTB 1AZZA 1T4VH 1G3DA 2J92A 4NSVA 5DP5A 1CHOG 3ATLA 4D7GA 2SNWA 5EXMA 1NRQH 4RKJB 2DUCA 3MH4A 1S0RA 2ZU1A 4LOYH 3F68H 1CBWC 4JMYA 4K8BA 1ACBE 1QJ6B 2EI6A 1EATA 1UCYE 1CHOF 3M5MA 1C5RA 1UK2A 1TRMA 1ABJH 1YBWA 1ZZZA 1EB2A 4O97A 1DUEA 4Y0YE 5ABWA 3B23B 4BXWA 4IMZA 5FXLA 4BTIB 2A5AA 2XC0A 2GT8A 2FPZA 1V2RT 1GI5A 2GV7A 4F49A 4FUGA 2FEQH 2FYQA 3ATWA 1BCUH 4NWLA 4GVUA 1AI8H 4A1TA 1GI6A 1P03A 1O0DH 4ZXXH 4NZQA 2QXIA 1Y8TA 3GYLB 2C8WB 3BN9A 1H9HE 1V3XA 3BV9B 1O3JA 4OS1A 3VB6A 1WBGB 1SGPE 3ZZ7A 1NRRH 1P2JA 1GMDF 2F83A 4NFEA 5HYOA 2A1DB 4B2CA 3F1SB 1IQGA 1QB6A 1TQ7B 2ZGXH 1O2WA 1P0SH 3K65B 4JZIA 3STIA 4D8NA 4Z6AH 1EJAA 4BOHA 7KMEH 2DE9A 1F0RA 4CHAB 3ZZ9A 4OGXA 3SU4A 3PWBA 1TPSA 2WUCA 5C2ZA 4ZHMU 2ODQA 2ZHFH 2NU0E 3P8GA 4HFPB 1PJPA 3ZZ8A 1F92A 1KDQB 3GCHB 4X2YA 1O38A 3MU1A 5HM2A 3P8OA 4X6PA 1EASA 4X1QU 1J14A 3SJOA 1RXPA 4JYTA 1BHXB 3NPSA 2PKSC 3LGWA 1EJNA 3ZVFA 2OINA 1IQFA 2AEIH 1UTQA 1ELBA 2OBQA 3LC5A 3SU0A 1JRTA 1EAWA 2BLVA 2F9UA 1OP8A 1UO6A 1C5NH 1W14U 4FUDA 4INKA 1SGEE 1XKAC 4X2WA 2BLWA 1ESTA 1F5RA 3OSYA 2BZ6H 1ZMJA 1C2MA 2F9VA 1OWJA 5DP6A 3U69H 3QZRA 2CGAA 1BTYA 1O3GA 3MHWU 1GHWH 3O8BA 4CBOA 1O3KA 3EA9A 1EAIA 3B9FH 3U9AH 1MU8B 3ATMA 3Q77A 1C1WH 4Q2KA 4KGAA 1O2GH 4A1XA 1O5DH 3E1XB 1GJ6A 1SB1H 1ELGA 1WOFA 1XVMA 2A5IA 2PUQH 3RC6A 1CBWB 1ZHRA 1ZTLA 2GZ7A 3RUOA 2Z9KA 1S81A 3GCTG 2A7JA 5ESTE 3D49H 4GHQA 1BUIA 5JPMH 4ABJA 1V2TT 5C5NA 2ZFRH 2OP9A 4INLA 1BBRE 1YGCH 1WAYB 1WU1A 4XFQA 3PMJA 2R9PA 2W3KA 1T8LA 2F9BH 4UFDH 4D7FA 2VJ1A 3LGTA 1IQNA 1SL3A 4XE4A 3A81A 1UTNA 5DGJA 2UUFB 1FIWA 1HRTH 2XTTB 1NESE 2B9LA 3IG6B 1ELAA 2GMTC 1AE8H 1RD3B 4FVDA 1YPGH 2XRCA 3H7OA 3RXHA 1HLTH 4PROA 3HK3B 3F9FA 3SUGA 1ELCA 1J8AA 5EOKA 1Z1IA 1QFKH 3SNDA 2B5TB 2IJOB 1W8BH 1NY22 1TA2A 3FZDA 3TPIZ 2ZP0H 3AW0A 3MNCA 3V7TA 2CN0H 3RM0H 1SC8U 2FODA 2VH0A 3A7ZA 5GXPA 3LH3A 3RXUA 1AMHA 4AGJA 2TBSA 5T3HA 4J1YA 1KIGH 1TGCA 1BQYA 2OUAA 1GVLA 3R3GB 3F6UH 1NRNH 1SGRE 2O9QA 1WQSA 3ZYEA 1B0EA 1LTOA 1QL8A 5L30H 2BQ7B 2PKSB 1WV7H 3BIUH 1O3NA 5AVDA 1HIAB 2VWNA 1C2KA 2XCFA 1CE5A 3MTYA 2HWLB 1LVYA 3HK6B 3EDXB 3KIDU 3ZZ3A 3G01A 4AZ2B 2W7UA 2WPIS 4MQAA 1WCZA 1TNLA 1QJ7B 4Y8XA 2FXRA 1GBEA 4ABIA 4CRGA 1BJVA 3ODDA 1QQUA 3VB4A 2H9EH 1O2XA 8GCHG 2BX3A 2Y5GA 1QGFA 1GI2A 2F9PA 1SGFA 5C5OA 2PSYA 4ZROA 2ZQ1A 2THFB 1Y5AT 1FDPA 1KXBA 1JBUH 2HVXA 2ZDAH 3T62A 1H4WA 3LT3A 1F0SA 1YPHC 3QLPH 3SNEA 2CV3A 1OXGA 1SGDE 4X1PU 5LPRA 4GUXA 1LKBA 1YLDA 3P95A 3RU4E 2C8XB 1FY4A 5ESBA 1IOEA 3SUFA 1GGDB 2FS9A 4MVNA 4OS2A 1N1LA 2OC1A 1O34A 2BY8X 1C4Y2 3RXPA 1A3BH 1UVTH 2PGBB 1QRWA 4X2VA 4ABFA 2NWNA 1C2IA 3DUXH 1FY8E 1SGCA 2GVFA 3N7OA 2ULLA 2BLQA 2EI8A 5I46H 1IQJA 4K3JA 1YCPK 1BMAA 2Q6FA 1D9IA 5C20A 1O31A 1S6FA 2ZU2A 1LHGH 4AG2A 4DGJA 3O8RA 3GY6A 1PQAA 4MPVA 2UWPA 1SGTA 1VCWA 4OS5A 4XBCA 3V3MA 2GMTB 2R2MB 1RTFB 2AGGX 4SGAE 1ANBA 1C4U2 2VIOA 5TCCA 3GOVB 1YF4A 2Q6GA 1ZGIA 4INHA 4B74A 4ZKOU 1GHBG 1GL0E 1HAZB 4A7IB 1QBOA 5EW2H 1GCTC 3ZVGA 1O2ZA 1P02A 2ZPRA 3SGAE 3MO6A 1GHAG 1RGQA 3BEIB 5CHAB 4IMQA 2ALPA 2AMPA 1Y59T 2VWLA 5FBEA 2J34A 2Y82A 1SVPA 5C3NA 4AN7A 1H9LB 1TFXA 2PLXA 3M7QA 3QZQA 1GHAF 1D3PB 1RTKA 1GWAA 2VIQA 3GY7A 1HAOH 3HATH 4RSPA 4DIHH 5EXNA 3PLPA 3BTEE 4K5ZA 4MNXA 1ZTJA 2PHBA 2ASUB 3MO9A 1K9OE 1O33A 3PMAB 4NIWA 1ETRH 3HPTB 1QHRB 3FAOA 1GI0A 2WV5A 1ELDE 5EODA 1DSUA 1EPTC 3RXKA 2ZHWH 1NFXA 7ESTE 1DXWA 2Z3EA 5DP9A 1A61H 3QGNB 1GBCA 1GDQA 3I78A 1P2KA 4WJG2 1INCA 4D9QA 4Q7XA 3BTKE 1ZYOA 2ZCHP 1BT7A 1EAUA 1TBZH 3TK5A 1M9UA 1BTXA 1KXEA 2EA3A 2BX4A 3NXPA 4TPYA 1YCPM 1TMUH 4X1NU 4BTTB 2WPKS 4JYVH 4ABGA 5JB9S 4RKOB 4B73A 5A8ZA 2BDCA 2XW9A 3EE0B 4JK5A 2V3HH 3VEQB 1W10U 5CE1A 1MBMA 1GJ4H 1LHFH 1MKWK 2H6MA 1HJ8A 3QK1A 1AKSB 5A8YA 1E37B 3ZZDA 1BJUA 3SOSA 3RXLA 1HFDA 4B75A 2BY9X 2AIQA 1QURH 2HLCA 1XXFA 4GPGA 1TGSZ 3FANA 1CVWH 2O8LA 1Y3WA 5DJ7A 4AOQA 4CRDA 2G81E 1SBWA 2BY6X 1TA6A 1AWFH 1LPZB 2BDIA 3FFGA 4FUEA 1HXFH 2ILNA 3UNSA 4CH2B 1IQLA 1ZJDA 5FPSA 3TLOA 1TRYA 5AFZH 3SU6A 1NFUA 1TNHA 2OC8A 1HJAC 1MTSA 1OP0A 3TITA 3V0XA 3GDUA 1SFIA 3ZVDA 4GCHF 2QAAA 3TIUA 2ZC9H 2A4GA 3M35A 1RFNA 2QXJA 1P2NA 3QUMP 3ZZ4A 1O2TA 2VGCB 4Q7ZA 4YLQH 1XUJA 3A8AA 1AD8H 2VNTA 2ZF0H 2H9TH 2TGAA 1PPEE 3TH4H 4MPWA 2Y5FA 4ISOA 3DD2H 3PO1C 3A7XA 1E36B 3QWCH 1H8IH 1QRZA 2ZFQH 4JZEH 1RTLA 3AW1A 2GKVE 5TJXA 3FP8E 2TGDA 4AFQA 1GI4A 1O5EH 2VWOA 1K1IA 4NA7A 1FONA 4UDWH 4DT7B 5E2OA 1GCTB 1O3DA 3K2UA 4DVAU 1IQIA 1AUJA 3SV6A 1C2LA 2P3UB 2BD4A 1HUTH 1CGIE 1THRH 5J4SA 3GYMA 4AB8A 1Z71A 4NCYA 5AF9H 1YLCA 1NU7B 4FU8A 4CREA 1AIXH 2B7DH 1UTMA 3LKWA 1NFYA 2FX6A 1O2RA 2D26C 1GVKB 1ZSLA 4IS5A 5B6OA 1F2SE 1UK4A 1YC0A 1L4DA 4IC5A 3UIRA 3W95A 3ZZAA 1EZXC 1MU6B 4TY7A 3MU8A 2ZHQH 4I7YH 2FYRA 1JOUB 1YPLH 1GJ8B 3E0PB 1PQ5A 3M7TA 2C90B 3KQDA 2ZFFH 4BTUB 1AO5A 1EPTB 1EUFA 1HPGA 4OS4A 4ZHLU 1ESBA 1JXPA 1LVOA 1Z8IB 4YO9A 1PPCE 3EAJA 3SN8A 1GMCG 1O2HA 1P2OA 1KXCA 5E0JA 1QRXA 4B71A 5L2ZH 3RMNH 3T27A 4R0IA 1SOZA 5HXFA 4ISNA 1TMTH 1HAIH 1GMCF 1NT1A 1VGCC 4D76A 1O37A 4YOJA 4X6OA 1GBHA 1GBBA 2FZZA 4X8UH 1XVOA 3UQOA 2BXUH 3T25A 3OX7U 4UFGH 2B8OH 2M5TA 3KNXA 3ELAH 2C4FH 3SHAH 1TMBH 2EC9H 1KDQA 4JZ1A 4X6MA 1O3MA 4IW4E 1YKTA 1WTHD 2Z3CA 1C1PA 1Y5BT 4X2XA 1A46H 4E7RG 2OC0A 1OWDA 1GG6C 3BTHE 3PB1E 1G2MA 4OS6A 4OS7A 4XSKU 1C5PA 1K1JA 1ZSJA 2FO9A 4UONA 2V6NA 1B7XB 3DT0H 1ABIH 3V12A 2Q1JA 4QT8C 2WUBA 1EXFA 3A84A 4IN2A 1UCYK 3LU9B 4NWKA 2EI7A 5L2YH 2YOLA 4X8TH 1HJAB 1NS3A 3GY2A 1VZQH 2G51A 1V2UT 2HALA 2SFAA 5DKMA 1KXDA 2AIPA 1IQHA 1V2PT 4AFSA 3MWIU 3RXJA 1F0TA 3LPRA 1KSNA 2PUXB 1P2MA 2VVCA 1TNIA 3PO1B 1FN8A 4XDEA 4YOIA 1PYTC 3QX5H 1L1GA 1TWXB 1SLVB 1BIOA 1NPMA 1V6DA 3QTOH 2XBYA 4XBDA 3R0FA 1S6HA 3MH5A 1Y5UT 3U98H 2RG3A 3RXEA 2XC4A 3A7VA 2JH0D 3F9HA 3KEEA 1JMOH 1DY8A 1P12E 1MD8A 2VVUA 2ZCKP 4I33A 2BY7X 2NU1E 3MU4A 3TVJB 2D1JA 1BMLA 5F8XA 1SMFE 3HKIB 4HTCH 1CSOE 1QA0A 5EXLA 1EJMA 4Y71A 3UWJH 4AFZA 3SI4H 1UVUH 3SBKA 3SNBA 2A2QH 3GY3A 4ISHH 3S9AA 1JWTA 2FLRH 3SORA 5JBCS 3T29A 4VGCC 2Z6BD 3ZVBA 1TNJA 1TX8A 1T31A 4WMDA 1GVZA 1S85A 1Z8GA 2P3TB 1C1TA 2FTMA 4ZMAH 1RS0A 2SGAA 2P3FH 1FY1A 1QNJA 2FOGA 2G5NA 3BTWE 1PFXC 2WPMS 2A45B 2UUKB 3E0NB 1D4PB 4Q80A 1DSTA 3NUMA 5FCRA 1A0JA 3P8NA 2R2WU 2BD5A 2CJIA 1ZMLA 2UWLA 5ETXA 3BIVH 4FUHA 4ESTE 1HAXB 1K28D 1KLJH 2P8OC 2IPHA 1SQAA 1CU1A 3GY5A 2V0BA 1SR5C 4XBBA 1HAPH 2QY0B 1VGCB 1E34B 1W11U 4WVPE 3VB3A 1CHGA 1O2PA 1ANDA 1CGHA 1DM4B 1IHSH 1DVAH 1LCYA 1UVPA 3UQVA 1V2MT 1ANEA 4FVBA 1EKBB 1KLIH 2ZHDA 1O35A 1IQEA 1BITA 3VB5A 1OOKB 2A4RA 3BG8A 3MU5A 2IN2A 2BD7A 3SNAA 5AHGH 5EU8A 3T28A 3V13A 1GG6B 1TLDA 1BDAA 1BTZA 1P01A 4CBNA 2AMQA 1N8OC 1O3HA 1HIAA 4B2BA 1PPGE 1TYNA 4Y10E 3KCGH 3M36A 3MNSA 3PYHA 1GBLA 1WYKA 3OTJE 5SGAE 1LVBA 2AGEX 2PKAB 4RN6A 1NRSH 4B2AA 5J4QA 3GCTF 2W26A 2GZ8A 3UNRA 2BZAA 1SLXB 2HGTH 2GD4B 1YPMH 1RJXB 1QIXB 3L33A 2ZFPH 1W13U 2NU3E 6GCHG 1F0UA 1V2LT 1BBRK 4I31A 2ZFTA 2FOCA 4WXIA 3L3TA 3RXCA 1MAYA 5EPNA 3TNSA 3RXSA 3EGKH 1TNGA 5A0CA 3NZIA 1G3EA 3LJJA 2BDGA 1FI8A 2AFQB 1S0QA 5HM9A 1UK3A 3BEFB 3ZV8A 5E0HA 2TRMA 1LHDH 3RXFA 1SQOA 3A85A 5K0HA 2SGPE 3UTUH 4CRFA 2ZO3H 2PR3A 3A8DA 1Z6JH 2QIQA 3SV7A 2P16A 2R3YA 1BMMH 1QA7A 4DW2U 1DOJA 4OGYA 4X1RU 1ZPZA 1LVMA 1Z8RA 4CR9A 1ZLRA 2XXLA 2SNVA 3ZZCA 3ODFA 3RDZA 1B0FA 3TK9A 3CS0A 2P93A 2BQ6B 1LO6A 2OXSA 4K60A 2WYGA 1QR3E 1W0YH 3SV2H 1ZRKA 6ESTA 2JH6D 4LZ4B 4DIIH 1NZQH 1Z6EA 1BRUP 1H8DH 4JK6A 5JBTA 5PTPA 3TGJE 1JIRA 1TNKA 5FAHA 4JCNA 1V2OT 1Y3XA 2ZTXA 2VB0A 1XXDA 3P6ZB 1FNIA 3MH6A 4CH8B 1ELEE 1THSH 4Y76A 4MPUA 1MKXK 3D65E 3GCNA 3OY5U 1C5YB 1ZMNA 8GCHF 3K6YA 3SJIA 2BD2A 1AVWA 3ENSB 2BOKA 5BPEA 1W12U 1DFPA 3UOUA 1ELFA 2K1QA 1GJAB 1OP2A 3BF6H 3VB7A 1FIZA 1IAUA 3VFEA 1DT2A 2OC7A 1O2UA 1LHCH 3SNCA 4MPXA 3B8JA 1C2DA 3RXTA 2FTLE 2VH6A 1K1MA 1LPKB 2A4QA 5GIBA 3OY6U 2FM2A 3P8FA 1N8OB 1G9IE 4AG1A 2ZWLH 3RP2A 5DO4H 1EOJA 1UTLM 1O5FH 2FI4E 1HNEE 1C2FA 2QF3A 1AN1E 2B0FA 1K21H 5TCAA 5H4IB 1C5WB 4CRCA 4ABHA 2BTCE 4Y8ZA 5FX6A 1GI9B 5A0AE 5A0BA 1BA8B 3NKKA 1AE5A 4BAKB 2H1UA 3AAVA 1P8VC 1AKSA 1K22H 2PGQB 2SGQE 3KQBA 2ZDMA 3Q3KA 2W3IA 3TJOA 2FLBH 2FDAA 1FXYA 3UY9A 3ITIA 3SV8A 2JETC 3M3SA 4FUFA 4YESB 2TGTA 1GJ5H 3VGCC 3AASA 3SGQE 4Z0KA 1C1OA 3HKJB 1GHXH 3UFAA 2Z3DA 2WPHS 4X1SU 1XUKA 3E3TA 3KGPA 4Y0ZE 1UHBA 2Z9JA 1ZJKA 3KHVA 1P11E 1GHBF 2ZI2H 1GCDA 2VIDA 2BY5X 1BTWA 1AVXA 1ELTA 1W7XH 3M3VA 3RXAA 2WV4A 5AFYH 2FX4A 1BB0B 1TGTA 7LPRA 1AGJA 2QXGA 4ZHAA 2GX4A 4DURA 1FUJA 1UMAH 4NIVA 1P06A 4UFEH 3A83A 1W7GH 3KL6A 2ZHEH 1O2YA 4ABDA 1B5GH 3FZZA 2YNAA 3OU0A 1TONA 1WSSH 3M7UA 2A4OA 1ID5H 1ORFA 4WH6A 3Q3XA 1GHZA 1A0LA 2ANMH 2BDAA 5JBBS 4KTCA 3TGIE 1GJDB 1TBQH 5C1UA 2XC5A 1QB9A 1A4WH 2KAIA 1EZSC 1E35B 3LONA 5CMXH 3A7YA 1C1RA 2GCTC 6CHAC 2R0KA 1WUNH 1C1NA 4U32A 1WTGH 1XUIA 1N6XA 1O2JA 1CO7E 1EP6A 4XOJA 3RXRA 1AWHB 3S7KB 3SO3A 2FI3E 4FUBA 1DXPA 3ATIA 4AYVB 2AMDA 2STBE 2Y7ZA 1G37A 1NU9A 1BRAA 4AFUA 1ZOMA 1V2NT 8KME2 1Y3VA 3M61U 1TE0A 2PTNA 2TIOA 4BAMB 1SG8B 4K1SA 2F3CE 3LGYA 1OSSA 1KTSB 3JZ2B 1A7SA 1D3QB 3MNBA 2ZTYA 1AFQC 1K1NA 3A86A 3DFJA 1G36A 1GBIA 2QCYA 1EPTA 1TPAE 1UHBB 1SLUB 5A2MH 3ZV9A 1V2VT 2W5EA 1TB6H 1PPFE 1V2WT 4UE7H 2UWOA 4YOGA 4B1TA 1GBKA 1AB9C 2WINI 2OCVB 5GJ4B 4MLFB 5FX5A 2H5CA 1UVSH 1CT4E 2D8WA 1P9SA 1BZXE 2ZA5A 2I6SA 1EAXA 4NSYA 4BXSA 4Y7AA 1SPJA 1O5GH 3MU0A 1PYTD 3U1IB 2BDBA 3LJOA 3LIWA 1FY5A 1AUTC 1ZGVA 5C1YA 3I29A 4I8HA 4I8LA 1TBRH 1QBNA 1AVGH 1HAYB 3U8OH 2A2XH 4UD9H 2ZZUH 1SGYE 1YPKH 3LH1A 4DY7B 3E90B 4GAWA 1O2OA 2KAIB 3SU3A 3MO3A 2Y5HA 4ZUHA 1C1SA 1O2QA 1FY3A 1P57B 3VGCB 4Y7BA 1C5SA 5T6GA 1GBMA 2J38A 1SOTA 3MYWA 1DWEH 3SQHE 2Y6TA 1OWHA 1Z1JA 2BQWB 1MD7A 3MMGA 2ZPQA 1VCQA 3EA8A 3M37A 3M5NA 1D6WA 5GDSH 1C5QA 1W2KH 1VJAU 1QJ1B 1V2ST 4TYDA 4IN1A 3UPEA 3NWUA 2PSXA 3TJNA 5FPYA 3SJ8A 1O2IA 1TPPA 1SGQE 2ZNKH 1OX1A 3URCA 4MG3A 2VU8E 1OKXA 3K6ZA 3EYDA 2J95A 5A8XA 4ZH8A 2STAE 1AQ7A 1BTHH 4JYUH 3RLYH 4CHAC 4ZKNU 1CA0C 2CXVA 5DP7A 1O3LA 4ZKRU 4O3UA 4UEHH 3PTBA 3TH2H 1C4V2 3MNXA 4F4OC 2AERH 2Y7XA 4YT6H 2AYWA 2FS8A 1ETSH 2FOMB 3ZVCA 4I32A 2XCNA 1U6QA 4X0WU 1O2VA 3A89A 3TU7H 6CHAB 2BHGA 2XYAA 5HMAA 2FI5E 1UTPA 2XNIA 4E05H 2A5KA 3O8DA 5EQQA 1TOMH 4YLUA 1N6YA 1UVOA 1FQ3A 1QB1A 1T8NA 2QV1A 3MI4A 1DE7H 1GDUA 3FP7E 1NN6A 1FN6A 3ZZBA 3M3TA 3SJKA 2GCHG 4NFFA 1EOLA 2XBVA 5IDKA 3ATKA 4HI3A 5LPEA 2F9OA 2FOHA 2GCHF 4DOQA 3SHCH 1KYNA 1ZPBA 3BSQA 1O5CB 3T5FH 1MUEB 4D9RA 3SUEA 1GBFA 1TALA 1YP9A 1AFQB 4MNWA 1AFEH 2YNBA 1MBQA 3RXOA 1SGIB 4ZXYH 1C9TA 1UTKA 2BD9A 1FPHH 2PW8H 3F9EA 5DP3A 1HAHH 3IITA 3KF2A 3RU4D 3S9BA 1T8MA 5F6MA 3NK8A 1AB9B 3SU5A 4M7GA 1E38B 1FV9A 3CS7A 4ISLA 5A09A 4J2YB 2LNCA 4AGKA 1BRCE 1XUGA 2G4UA 3Q76A 1HCGA 2UUYA 2VVVA 1C5ZB 2QXHA 1MTWA 1DDJA 1P2QA 2FP7B 2P59A 3MOCA 1YCPH 2G55A 3P70B 1S82A 3O8CA 5LGOA 1SQTA 1GDNA 1XUFA 1C2JA 5E2PA 1GJ9B 4MNVA 1ARBA 2ZDKA 4WMEA 2C8ZB 2VIPA 1G3CA 2XWBI 4FU9A 1HXEH 2BLOA 1BTPA 4U2WA 3PROA 2HPQH 2FOBA 1MTUA 2G00A 1XM1A 1DWBH 3RC5A 1ZHPA 3D62A 1G2LA 3LGVA 2BD3A 4DCDA 2F91A 4MNYA 1GMDG 4AX9H 5FHTA 3TJVA 4CR5A 1NRPH 1LQDB 1O2KA 2OTVA 3UREA 1O30A 2Z7FE 1C1UH 7GCHG 4I8GA 3VXFH 3U1JB 4ASHA 2XWAA 2HOBA 3STJA 1W0ZU 3EQ0H 2BB4A 3KQCA 2PKAA 7GCHF 2ANWA 3F9GA 3TJUA 3S0NA 1S83A 1UTJA 1XKBC 1L4ZA 5HGGA 2W7SA 2D2DA 1A1RA 3BG4C 2J9NA 2HRVA 2A0QB 1QY6A 3QN7A 1ANCA 1C5MD 1DWDH 1T7CA 4A5TS 2WPJS 1CA0B 1SLWB 2JH5D 1SSXA 1UTOA 3TK6A 4UFFH 1C5XB 1MZAA 4HGCA 2G52A 1C5OH 3ZYDA 2HNTE 1CA8B 1C2GA 3RLWH 1DLKB 4K69A 3DA9B 3JZ1B 1C5VA 3DFLA 1QTFA 1XUHA 4KTUA 4ABBA 2RCEA 2VIVA 2TGPZ 1E0FD 3SV9A 2BVSH 1PPHE 2PWXA 1UJ1A 3U8RH 2GT7A 4ISIH 4WY3A 1O2MA 1C5UA 2GGVB 1W3CA 2GTBA 1C1MA 1J17T 2O8WA 3BTQE 5DP4A 4A6LA 2XBWA 1QL9A 1GJBB 3SQEE 3BTGE 1MKWH 2FOFA 1TAWA 1O39A 3MH7A 1DITH 1A5IA 2UUJB 3ESTA 3AVZA 5F8ZA 2ZDNA 1DICA 3E91A 1MH0A 3SI3H 3E8LA 4AB9A 1GHYH 1TPOA 3HGNA 3I77A 4JZDH 4MDSA 4WF8A 3A80A 1QBVH 3QGJA 1C1QA 2VWMA 1NC6A 1K1LA 1IQKA 1PPZA 1X7AC 1C5LH 1O2NA 2H5DA 2PV9B 4R8TB 1TQ0B 1S5SA 5LPFA 2O8UA 4TWYA 3UWIA 1S84A 4KP0A 4CRAA 1L1JA 2FOEA 1GGDC 2Q6DA 3L6PA 3UR6A 1SGFG 4IC6A 2CMYA 3URDA 3OYPA 3BTDE 3LC3A 3BTFE 3S9CA 1SHHB 2NU2E 5L6NH 4DG4A 2EEKA 6GCHF 2BXTH 2ZU5A 5EPYA 4THNH 1FLEE 3SZNA 3U8TH 4BNRA 4WXVA 2ZFSA 1LHEH 2BVXH 1TX6A 1EX3A 1EB1H 2C3SA 2GV6A 4DJZB 2TPIZ 1NROH 1Z8JB 2OQ5A 1C1VH 2ZIQH 3ZZ5A 3RMLH 4E06H 1AY6H 1FAXA 1OWIA 1NFWA 1MAXA 2ZTZA 1XMNB 1VCPA 1F5KU 4VGCB 1RIWC 1A2CH 5CHAC 2AS9A 4YZUA 4BAOB 5JBAS 3BG4B 2LPRA 1GBJA 1T32A 3PWCA 2AGIX 5K7RA 1G30B 2ZDLA 1O2SA 3FVFB 2SGFE 1K1PA 2WYJA 1G3BA 3A88A 4HZHA 4LXBH 1ETTH 4GSOA 5C1XA 5T6FA 1O3EA 2ZGBH 3GY8A 1H1BA 3GY4A 1DPOA 1GI1A 2J94A 4LK4A 1DX5M 2A32A 3PM3A 1VITH 3SUDA 1NTPA 1Z7KA 3RXQA 2Z9LA 1TGBA 2P8OB 3H5CB 4TY6A 1SHYA 2FESH 2V35A 1DLEA 1MCTA 5E8EH 2QC2A 2ZG0H 5EG4A 1CGJE 2BOHB 1GI3A 2Z9GA 4YT7H 3BTME 4ZKSU 3BEUA 2ESTE 1SI5H 3A7WA 2Z9IA 3SU2A 4YM9A 2V3OH 1MMJN 1O5BB 3T2NA 2H9HA 3LDXH 1ARCA 1MCVA 1P04A 1LDTT 3Q3YA 3RXMA 4JZFH 2J4IA 2F9NA 1J15A 2ZKSA 1P3EA 3A87A 2CHAC 1O3IA 4O3TA 1A5GH 2A7CA 2GP9B 3T26A 1KY9A 2CF9H 1HAVA 2AH4X 4E7NA 1V2KT 5GWZA 4NG9H 1IHTH 4U30A 3WY8A 2Y80A 2BVRH 2ZECA 2I6QA 1ZRBA 3ZVEA 1ELVA 3RMOH 1UCYH 4WMFA 5GCHG 2Y81A 3RU4T
chains in the Genus database with same CATH superfamily
1L2EA 1GBDA 1NBME 3VXEH 1L0ZA 4NA8A 1GJCB 1TX7A 1D6RA 1HV7A 1TIOA 4BANB 1ZSKA 3QDZB 4NIXA 3HGPA 5GCHF 5FCKA 2XOKD 4Q7YA 3DHKH 3PMHB 2RDEA 2ZPSA 1K2I1 2CF8H 1A5HA 1KLTA 1OS8A 3RMMH 2RA0A 3LOXA 4ABEA 3A8CA 2QN5T 3PLBA 2C93B 1T4UH 5DP8A 3K9XB 1F7ZA 1O3PB 5EJZA 2VGCC 2ZQ2A 4NGAH 3GISB 2ZEBA 4YXWD 3ZZ6A 1KXFA 2ZDVH 1L1NA 3KN2A 1ESAA 1P3CA 2FOAA 2J2UA 3FP6E 4I8KA 4X6NA 1BRBE 2GZ9A 3GDVA 2R0LA 5I25A 4A1VA 5DG6A 1RRKA 4B76A 1DS2E 3NCLA 1PQ8A 2OLGA 2NU4E 3UR9A 3S69A 5B6LA 1LMWB 1ZTKA 4K8YA 4GHTA 1FPCH 1V2JT 1HGTH 1TOCB 1V2QT 2BMGB 9LPRA 2EY4C 1VITG 2ALVA 1FJSA 3F2HA 2BDHA 2BD8A 1RIWB 3PLKA 4I86A 4NIYA 5T6DA 2ZU3A 1HDTH 2SGDE 2VIWA 1A0HB 1VITF 4F55A 3GCOA 4FETA 1AZ8A 6LPRA 1O36A 2SGEE 2GDEH 5FPTA 2FWWA 1G32B 1GI7B 1YM0A 4KTSA 1HAVB 4MTBA 1O3CA 1HB0B 1VR1H 3A7TA 1EZQA 1EFRD 1MTNC 1BMNH 3W94A 1SGNE 4WH8A 1ZHMA 3RXDA 1E1RD 2KR7A 1OWEA 2GJGA 2ZGCA 2BM2A 1HJ9A 4IBLH 1GPZA 4K1TA 2G4TA 3C27B 4TT3D 3S7HB 5IYTA 8LPRA 4Y8YA 1YPHE 2ZGHA 2QA9E 2C8YB 1LQEA 1OWKA 2XBXA 5LH8A 2BDYA 3RXVA 3H09A 3EA7A 1J9CH 1D3DB 3RXIA 3PV4A 3TNTA 3RC4A 3QO6A 1CQQA 1XX9A 2IOTA 1JIMA 1Y3UA 1C9PA 1O3BA 4Y11E 4Y79A 3C1KA 1EQ9A 4TPIZ 2ZCLP 4A92A 4BAQB 5F8TA 1BTUA 2OK5A 5DPAA 5JYIA 5JDUB 3OE7D 2PFEA 2ANYA 1SKYE 4RI0A 2CHAB 2ODPA 1QCPA 1YYY1 5BRRE 1THPB 2O8MA 3VPKA 1DANH 4SGBE 1IQMA 3LGUA 1GBAA 2ZGJA 3LGIA 1J16A 2OQUA 4FU7A 2PTCE 1P9UA 2QYIA 2OBOA 1JRSA 1HYLA 1P2IA 1GI8B 2VINA 1CT0E 3PTNA 2G5VA 1DWCH 4ZAEA 1O2LA 1AU8A 3RXGA 1HBTH 2R3UA 3D23A 1QL7A 2QGRA 1NM6A 2ODYB 5GPIB 4AYYB 3TGKE 3UUZA 1Y3YA 1MQ6A 4Y6DA 3DSGA 3TH3H 4GCHG 4TWWA 3H7TA 1BBRH 1Q2WA 4AC9A 5GNDA 1T8OA 3RXBA 4H6SB 1GJ7B 1O3OA 1GBTA 4FUIA 2P95A 3GS9A 2JETB 1ZPCA 3BTTE 2A31A 1YPJH 1OPHB 1TABE 5G4BA 2A7HA 2FIRH 1KXAA 1WQVH 3OEHD 5EQRA 1C2HA 1OYQA 4U01A 1TGNA 4WWYA 3Q00A 1BHXF 3SJ9A 3PMBB 4FUCA 4BAHB 4LZ1H 4K1EA 4FXGH 5EW1H 2F43B 1EZUC 1HAGE 3SYJA 1TRNA 2Z94A 3SU1A 1A3EH 1D3TB 3P92A 1O3FA 1VJ9U 3UOPA 1MZDA 9ESTA 2WPLS 3E16B 4O9VA 3A8BA 1AHTH 1C2EA 1O5AB 5EGMA 1LKAA 1Q3XA 1EP5A 3GICB 1YPEH 5JB8S 1FMGA 2RA3A 2H2ZA 2HNTF 1O3AA 1PPBH 3RM2H 3CP7A 3A82A 5FBIA 2WSSD 3P17H 1SFQB 4H6TA 5E0GA 1BOQA 5EQSA 2HPPH 4ABAA 4NZLA 1CT2E 2OD3B 1MTVA 3GCHC 1GMHG 1K1OA 1GHVH 2DE8A 2J98A 4AORA 1H9IE 3SGBE 3IWMA 1DUAA 5C67A 3ZIAD 5EJLA 2GCTB 3AAUA 4YTAA 1UW7A 3SW2B 1GMHF 2KFWA 4O03A 1MTNB 4KELA 1F5LA 1C5TA 5DK1A 2O8TA 5F03A 2QF4A 2FMJA 4FUJA 1PQ7A 4H42U 1Q31A 4GLYA 4IGDA 4P02A 3ZVAA 2G8TA 1P05A 4X8VH 2GDDA 2ANKH 3E6PH 1LPGB 2ZU4A 1GL1A 2BYAX 2JKHA 4I8JA 4NA9H 5C0UA 1NO9H 2RDLA 1P09A 3QTVH 4H4FA 1MKXH 4X8SH 2WPDD 1FAKH 4KKDA 3M5OA 1O32A 2QF0A 8ESTE 1MQ5A 2HNTC 3W1EA 1P10A 3UNQA 3KQEA 1ZR0A 2LELA 5IK2D 1QQ4A 3MFJA 3M5LA 3GDSA 2P94A 1FZZA 1OYTH 3CENA 2JIZD 4K2YA 4CRBA 1DY9A 1KTTB 1AZZA 1T4VH 1G3DA 2J92A 4NSVA 5DP5A 1CHOG 3ATLA 4D7GA 2SNWA 5EXMA 1NRQH 2J97A 2DUCA 4RKJB 3MH4A 1S0RA 2ZU1A 4LOYH 3F68H 1CBWC 4JMYA 4K8BA 1ACBE 1QJ6B 2EI6A 1EATA 1UCYE 5F53A 1CHOF 4Q63A 3M5MA 1C5RA 1UK2A 1TRMA 1ABJH 1YBWA 1ZZZA 1EB2A 4O97A 1DUEA 4Y0YE 5ABWA 3B23B 4BXWA 3F2GA 4IMZA 5FXLA 4BTIB 2A5AA 2XC0A 2GT8A 2FPZA 1V2RT 1GI5A 2GV7A 4F49A 4FUGA 2FEQH 2FYQA 3ATWA 1BCUH 4NWLA 2J98B 4GVUA 1AI8H 4A1TA 1GI6A 1P03A 1O0DH 4ZXXH 4NZQA 2QXIA 1Y8TA 3GYLB 2C8WB 3BN9A 1H9HE 1V3XA 3BV9B 1O3JA 4OS1A 3VB6A 1WBGB 3DCLA 1SGPE 3ZZ7A 3WWFA 1NRRH 1P2JA 1GMDF 2F83A 4NFEA 5HYOA 2A1DB 4B2CA 3F1SB 1IQGA 1QB6A 1S6LA 1TQ7B 2ZGXH 1O2WA 1P0SH 3K65B 4JZIA 3STIA 4D8NA 4Z6AH 1EJAA 4BOHA 7KMEH 2DE9A 1F0RA 4CHAB 3ZZ9A 4OGXA 3SU4A 3PWBA 1TPSA 2WUCA 5C2ZA 4ZHMU 2ODQA 2ZHFH 2NU0E 3P8GA 4HFPB 1PJPA 3ZZ8A 1F92A 1KDQB 3GCHB 4X2YA 1O38A 3MU1A 5HM2A 3P8OA 4X6PA 1EASA 4X1QU 1J14A 3SJOA 1RXPA 4JYTA 1BHXB 3U28C 3NPSA 2PKSC 3LGWA 1EJNA 3ZVFA 2OINA 2HVYB 1IQFA 2AEIH 1UTQA 1ELBA 2OBQA 3LC5A 4B6EA 3SU0A 1JRTA 1EAWA 2BLVA 2F9UA 1OP8A 1UO6A 1C5NH 1W14U 4FUDA 4INKA 1SGEE 1XKAC 1H8ED 1FX0B 4X2WA 2BLWA 1ESTA 1F5RA 3OSYA 2BZ6H 1ZMJA 1C2MA 2F9VA 1W0KD 1OWJA 5DP6A 3U69H 3QZRA 2CGAA 1BTYA 1O3GA 3MHWU 2VBCA 1GHWH 3O8BA 4CBOA 1O3KA 3EA9A 1EAIA 3B9FH 3U9AH 1MU8B 3ATMA 3Q77A 1C1WH 4Q2KA 4KGAA 1O2GH 4A1XA 1O5DH 3E1XB 1GJ6A 1SB1H 1ELGA 1WOFA 1XVMA 2K0QA 2A5IA 2PUQH 3RC6A 1CBWB 1ZHRA 1ZTLA 2GZ7A 3RUOA 2Z9KA 1S81A 3GCTG 5HIYA 2A7JA 5ESTE 3D49H 4GHQA 1BUIA 5JPMH 4ABJA 2KM0A 1V2TT 5C5NA 2ZFRH 2OP9A 4INLA 1BBRE 1YGCH 1WAYB 1WU1A 4XFQA 3PMJA 2R9PA 2W3KA 1T8LA 2F9BH 2M2AA 4UFDH 4D7FA 3SZEA 2VJ1A 3LGTA 1IQNA 1SL3A 4XE4A 3A81A 1UTNA 3CNRA 5DGJA 2UUFB 1FIWA 1HRTH 2XTTB 1NESE 2B9LA 3IG6B 1ELAA 4Z1MD 2GMTC 1AE8H 1RD3B 4FVDA 1YPGH 2XRCA 3H7OA 3RXHA 1HLTH 4PROA 3HK3B 3FOAA 3F9FA 3SUGA 1ELCA 1J8AA 5EOKA 1Z1IA 1QFKH 3SNDA 2B5TB 2IJOB 1W8BH 1NY22 1TA2A 3FZDA 3TPIZ 4ASUD 2ZP0H 3AW0A 3MNCA 3V7TA 2CN0H 3RM0H 1SC8U 2FODA 2VH0A 3A7ZA 5GXPA 3LH3A 3RXUA 1AMHA 4AGJA 2TBSA 3OFND 5T3HA 4J1YA 1KIGH 1TGCA 1BQYA 2OUAA 1GVLA 3R3GB 3F6UH 1NRNH 4RT1A 1SGRE 2O9QA 4XD7D 1WQSA 3ZYEA 1B0EA 1LTOA 1E1QD 1QL8A 5L30H 2BQ7B 2PKSB 1WV7H 3BIUH 1O3NA 5AVDA 1HIAB 2VWNA 1C2KA 2XCFA 1CE5A 3MTYA 2HWLB 1LVYA 3HK6B 3EDXB 3KIDU 3ZZ3A 3G01A 4AZ2B 2W7UA 2WPIS 4MQAA 1WCZA 1TNLA 1QJ7B 4Y8XA 2FXRA 1GBEA 4ABIA 4CRGA 1BJVA 3ODDA 1QQUA 3VB4A 2H9EH 1O2XA 8GCHG 2BX3A 2Y5GA 1QGFA 1GI2A 2F9PA 3FO8D 1SGFA 5C5OA 2PSYA 4ZROA 2ZQ1A 2THFB 1Y5AT 1FDPA 1KXBA 1JBUH 2HVXA 2ZDAH 3T62A 1H4WA 2V7QD 3LT3A 1F0SA 1E79D 1YPHC 3QLPH 3SNEA 5KECA 2CV3A 1OXGA 1SGDE 4X1PU 5LPRA 4GUXA 1LKBA 1BMFD 1YLDA 3P95A 3RU4E 2C8XB 1FY4A 5ESBA 1IOEA 3SUFA 1GGDB 2FS9A 4MVNA 4OS2A 1N1LA 2OC1A 1O34A 2BY8X 1C4Y2 3RXPA 1A3BH 1UVTH 2PGBB 1QRWA 4X2VA 4ABFA 2NWNA 1C2IA 3DUXH 3F2FA 2QF5A 1FY8E 1SGCA 2GVFA 3N7OA 2ULLA 2BLQA 2EI8A 5I46H 1IQJA 4K3JA 1YCPK 1BMAA 2Q6FA 1D9IA 5C20A 1O31A 1S6FA 2ZU2A 1LHGH 4AG2A 4DGJA 3O8RA 3GY6A 1PQAA 4MPVA 4ACAA 2UWPA 1SGTA 1VCWA 4OS5A 4XBCA 3V3MA 2GMTB 2R2MB 1RTFB 2AGGX 4SGAE 1ANBA 1C4U2 2VIOA 5TCCA 3GOVB 1YF4A 2Q6GA 1ZGIA 4INHA 4B74A 4ZKOU 1GHBG 1GL0E 1HAZB 4A7IB 1QBOA 5EW2H 1GCTC 3ZVGA 1O2ZA 1P02A 2ZPRA 3SGAE 3MO6A 1GHAG 1RGQA 3BEIB 5CHAB 4IMQA 2ALPA 2AMPA 1Y59T 2VWLA 5FBEA 2J34A 2Y82A 1SVPA 5C3NA 1SQRA 4AN7A 1H9LB 1TFXA 2PLXA 3M7QA 3QZQA 2RFKC 1GHAF 1D3PB 1RTKA 1GWAA 2VIQA 3GY7A 1HAOH 3HATH 4RSPA 1MABB 4DIHH 5EXNA 3PLPA 3BTEE 4K5ZA 4MNXA 1ZTJA 2PHBA 2ASUB 3MO9A 1K9OE 1O33A 3PMAB 3DSPA 4NIWA 1ETRH 3HPTB 1QHRB 3FAOA 1GI0A 2WV5A 1ELDE 5EODA 1DSUA 1EPTC 3RXKA 2ZHWH 1NFXA 7ESTE 1DXWA 2Z3EA 5DP9A 1A61H 3QGNB 1GBCA 1GDQA 3I78A 1P2KA 4WJG2 1INCA 4OM9A 4D9QA 4Q7XA 3BTKE 1ZYOA 2ZCHP 1BT7A 1EAUA 1TBZH 3TK5A 1M9UA 1BTXA 5EJ1A 1KXEA 2EA3A 2BX4A 3NXPA 3UAIC 4TPYA 1YCPM 1TMUH 4X1NU 4BTTB 2JJ2D 2WPKS 4JYVH 4ABGA 5JB9S 2KCAA 4RKOB 4B73A 5A8ZA 2BDCA 2XW9A 3EE0B 4JK5A 2V3HH 3VEQB 1W10U 5CE1A 1MBMA 1GJ4H 1LHFH 1MKWK 2H6MA 1HJ8A 3QK1A 1AKSB 5A8YA 1E37B 3ZZDA 1BJUA 3SOSA 3RXLA 4B6FA 1HFDA 4B75A 2BY9X 2AIQA 1QURH 5T1VA 2HLCA 1XXFA 4GPGA 1TGSZ 3FANA 1CVWH 3FN8A 2O8LA 1Y3WA 5DJ7A 4AOQA 4CRDA 2G81E 1SBWA 2BY6X 1TA6A 1AWFH 1LPZB 2KCYA 2BDIA 3FFGA 4FUEA 1HXFH 2ILNA 3UNSA 4CH2B 1IQLA 1ZJDA 5FPSA 3TLOA 2L74A 1TRYA 3FKSD 5AFZH 3SU6A 1NFUA 1TNHA 2OC8A 1VKYA 1HJAC 1MTSA 1OP0A 3TITA 3V0XA 3GDUA 1SFIA 2F4LA 2K8IA 3ZVDA 4GCHF 2KX4A 2QAAA 3TIUA 2ZC9H 2A4GA 3M35A 1RFNA 2QXJA 1P2NA 3QUMP 3ZZ4A 1O2TA 2VGCB 4Q7ZA 4YLQH 1XUJA 3A8AA 1AD8H 2VNTA 2ZF0H 2H9TH 2TGAA 1PPEE 3TH4H 4MPWA 2Y5FA 4ISOA 3DD2H 3PO1C 3A7XA 1E36B 3QWCH 1H8IH 1QRZA 2ZFQH 4JZEH 1RTLA 3AW1A 2GKVE 4Q4LA 5TJXA 3FP8E 2TGDA 4AFQA 1GI4A 1O5EH 5CHBA 2VWOA 1K1IA 4NA7A 1FONA 4UDWH 4DT7B 5E2OA 1GCTB 1O3DA 3K2UA 4DVAU 1IQIA 1AUJA 3SV6A 1C2LA 2P3UB 2BD4A 1HUTH 1CGIE 1THRH 5J4SA 3GYMA 4AB8A 1Z71A 4NCYA 5AF9H 1YLCA 1NU7B 4FU8A 4CREA 1AIXH 2B7DH 1UTMA 3LKWA 1NFYA 2FX6A 4RT0A 1O2RA 2D26C 4DT4A 5HKKD 1GVKB 1ZSLA 4IS5A 5B6OA 1F2SE 5EIYA 1UK4A 1YC0A 1L4DA 4IC5A 3UIRA 3W95A 3ZZAA 1EZXC 1MU6B 4TY7A 3MU8A 2ZHQH 4I7YH 2FYRA 1JOUB 1YPLH 1GJ8B 3E0PB 1PQ5A 3M7TA 5HIZA 2C90B 3KQDA 2ZFFH 4BTUB 1AO5A 1EPTB 2WZQA 1EUFA 1HPGA 4OS4A 4ZHLU 1ESBA 1JXPA 1LVOA 1Z8IB 4YO9A 1PPCE 3EAJA 3SN8A 1GMCG 1O2HA 1P2OA 1KXCA 5E0JA 1QRXA 4B71A 5L2ZH 3RMNH 3T27A 4R0IA 4FOUC 1SOZA 5HXFA 4ISNA 1TMTH 1HAIH 1GMCF 1NT1A 1VGCC 4D76A 1O37A 4YOJA 4X6OA 1GBHA 2WHXA 1GBBA 2FZZA 4X8UH 2L6OA 1XVOA 3UQOA 2BXUH 3T25A 3OX7U 4UFGH 2B8OH 2M5TA 3KNXA 3ELAH 2C4FH 3SHAH 1TMBH 2EC9H 1KDQA 4JZ1A 4X6MA 1O3MA 4IW4E 1YKTA 1WTHD 2YMSC 2Z3CA 1C1PA 1Y5BT 4X2XA 1COWD 1A46H 4E7RG 2OC0A 1OWDA 1GG6C 3BTHE 3PB1E 1G2MA 4OS6A 4OS7A 4XSKU 1C5PA 1K1JA 1ZSJA 2FO9A 4UONA 2V6NA 1B7XB 3DT0H 1ABIH 3V12A 1H8HD 2Q1JA 4QT8C 2WUBA 1NBMD 2KCPA 1EXFA 3A84A 4IN2A 1UCYK 3LU9B 4NWKA 2EI7A 5L2YH 2YOLA 4X8TH 1HJAB 1NS3A 2PP6A 1VZQH 3GY2A 2G51A 1V2UT 2HALA 2SFAA 5DKMA 1KXDA 2AIPA 1IQHA 1V2PT 4AFSA 3MWIU 3RXJA 1F0TA 3LPRA 1KSNA 2PUXB 1P2MA 2VVCA 1TNIA 3PO1B 1FN8A 4XDEA 4YOIA 1PYTC 3QX5H 1L1GA 1TWXB 1SLVB 1BIOA 1NPMA 1V6DA 3QTOH 2XBYA 4XBDA 3R0FA 1S6HA 3MH5A 1Y5UT 3U98H 2RG3A 3RXEA 2XC4A 3A7VA 2JH0D 3F9HA 3KEEA 1JMOH 1DY8A 1P12E 1MD8A 2VVUA 2ZCKP 4I33A 2BY7X 2NU1E 3MU4A 3TVJB 2D1JA 1BMLA 5F8XA 1SMFE 3HKIB 4HTCH 1CSOE 1QA0A 5EXLA 1EJMA 4Y71A 3UWJH 4AFZA 3SI4H 1UVUH 3SBKA 3SNBA 2A2QH 3GY3A 4ISHH 3S9AA 1JWTA 2FLRH 3SORA 2LP6A 3T29A 5JBCS 4VGCC 2Z6BD 3ZVBA 1TNJA 1TX8A 1T31A 4WMDA 1GVZA 1S85A 1Z8GA 2P3TB 1C1TA 2FTMA 4ZMAH 1RS0A 2SGAA 2P3FH 1FY1A 1QNJA 2FOGA 2G5NA 3BTWE 1PFXC 2WPMS 2A45B 2UUKB 3E0NB 1D4PB 4Q80A 1DSTA 3NUMA 5FCRA 1A0JA 3P8NA 2R2WU 2BD5A 2CJIA 1ZMLA 2UWLA 5ETXA 3BIVH 4FUHA 4ESTE 1HAXB 1K28D 1KLJH 2P8OC 2IPHA 1SQAA 1CU1A 3GY5A 2V0BA 1SR5C 4XBBA 3WWBA 2QY0B 1VGCB 1HAPH 1E34B 1W11U 4WVPE 3VB3A 1CHGA 1O2PA 1ANDA 1CGHA 1DM4B 1IHSH 1DVAH 1LCYA 1UVPA 3UQVA 1V2MT 1ANEA 4FVBA 1EKBB 1KLIH 2ZHDA 1O35A 1IQEA 1BITA 3VB5A 1OOKB 2A4RA 3BG8A 3MU5A 2JDID 2IN2A 2YMSB 2BD7A 3SNAA 5AHGH 5EU8A 3T28A 3V13A 1GG6B 1TLDA 1BDAA 1BTZA 1P01A 3EE7A 4CBNA 2AMQA 1N8OC 1O3HA 1HIAA 4B2BA 1PPGE 1TYNA 4Y10E 3KCGH 3M36A 3MNSA 3PYHA 1GBLA 1WYKA 3OTJE 5SGAE 1LVBA 2AGEX 2PKAB 4RN6A 1NRSH 4B2AA 5J4QA 3GCTF 2W26A 2GZ8A 3UNRA 2BZAA 1SLXB 2IJD1 2GD4B 2HGTH 1YPMH 1RJXB 3PRDA 1QIXB 3L33A 2ZFPH 1W13U 2NU3E 6GCHG 1F0UA 3AK5A 1V2LT 1BBRK 4I31A 2ZFTA 2FOCA 4WXIA 2WV9A 1YLNA 3L3TA 3RXCA 1MAYA 5EPNA 3TNSA 3RXSA 3EGKH 1TNGA 5A0CA 4ZCNA 3NZIA 1G3EA 3LJJA 2BDGA 1FI8A 2AFQB 1S0QA 5HM9A 1UK3A 3BEFB 3ZV8A 5E0HA 2TRMA 1LHDH 3RXFA 1SQOA 2J5UA 3A85A 5K0HA 2SGPE 3UTUH 4CRFA 2ZO3H 2PR3A 3A8DA 1Z6JH 2QIQA 3SV7A 2P16A 2R3YA 1BMMH 1QA7A 4DW2U 1DOJA 4OGYA 4X1RU 1ZPZA 1LVMA 1Z8RA 4CR9A 1ZLRA 2XXLA 2SNVA 3ZZCA 3ODFA 3RDZA 1B0FA 3TK9A 3CS0A 2P93A 2BQ6B 1YWUA 1LO6A 2OXSA 4K60A 2WYGA 1QR3E 1W0YH 3SV2H 1ZRKA 6ESTA 2JH6D 4LZ4B 4DIIH 1NZQH 1Z6EA 1BRUP 1H8DH 4JK6A 5DN6D 5JBTA 5PTPA 3TGJE 1JIRA 1TNKA 5FAHA 4JCNA 1V2OT 1Y3XA 2ZTXA 2VB0A 2HLDD 1XXDA 3P6ZB 1FNIA 3MH6A 4CH8B 1ELEE 1THSH 4Y76A 4MPUA 1MKXK 3D65E 3GCNA 3OY5U 1C5YB 3F0OA 1ZMNA 8GCHF 3K6YA 3SJIA 2BD2A 1AVWA 3ENSB 2BOKA 5BPEA 1W12U 1DFPA 3UOUA 1ELFA 2K1QA 1GJAB 1OP2A 3BF6H 3VB7A 1FIZA 1IAUA 3VFEA 1DT2A 3PV5A 2OC7A 1O2UA 1LHCH 3SNCA 4MPXA 3B8JA 1C2DA 3RXTA 2FTLE 2VH6A 1K1MA 1LPKB 3PRBA 2A4QA 5GIBA 3OY6U 2FM2A 3P8FA 1N8OB 1G9IE 4AG1A 2ZWLH 3RP2A 5DO4H 1EOJA 1UTLM 1O5FH 2FI4E 1HNEE 2QE7D 4TSFD 1C2FA 2QF3A 1AN1E 2B0FA 1K21H 5TCAA 5H4IB 1C5WB 4CRCA 4ABHA 2BTCE 4Y8ZA 5FX6A 1GI9B 5A0AE 5A0BA 1BA8B 3NKKA 1AE5A 4BAKB 2H1UA 3AAVA 1P8VC 1AKSA 1K22H 2PGQB 2SGQE 3KQBA 2ZDMA 3Q3KA 2W3IA 3TJOA 2FLBH 2FDAA 1FXYA 3UY9A 3ITIA 3SV8A 2JETC 3M3SA 4FUFA 4YESB 3WW7A 2TGTA 1GJ5H 3VGCC 3AASA 3SGQE 3N7EA 4Z0KA 1C1OA 3HKJB 1GHXH 3UFAA 2Z3DA 2WPHS 4X1SU 1XUKA 3E3TA 3KGPA 4Y0ZE 1UHBA 2Z9JA 1ZJKA 3KHVA 1P11E 1GHBF 2ZI2H 1GCDA 2VIDA 2BY5X 1BTWA 1AVXA 1ELTA 1W7XH 3M3VA 3RXAA 2WV4A 5AFYH 2FX4A 1BB0B 1TGTA 7LPRA 3VG8A 1AGJA 2QXGA 2XNDD 4ZHAA 2GX4A 4DURA 1FUJA 1UMAH 4NIVA 1P06A 2EQNA 4UFEH 3A83A 1W7GH 3KL6A 5KEDA 2ZHEH 1O2YA 4ABDA 4M9FA 1B5GH 3FZZA 2YNAA 3OU0A 1TONA 1WSSH 3M7UA 2A4OA 1ID5H 1ORFA 4WH6A 3Q3XA 1GHZA 1A0LA 2JJ1D 2ANMH 2BDAA 5JBBS 4KTCA 5DSFA 1GJDB 3TGIE 1TBQH 5C1UA 2XC5A 1QB9A 1A4WH 2KAIA 1EZSC 1E35B 2V3MA 3LONA 3OEED 5CMXH 3A7YA 1C1RA 2GCTC 6CHAC 2R0KA 1WUNH 1C1NA 4U32A 1WTGH 1XUIA 1N6XA 1O2JA 1CO7E 1EP6A 4XOJA 5FL7D 3RXRA 1AWHB 2YMSD 3S7KB 3SO3A 2FI3E 4FUBA 1DXPA 3ATIA 4AYVB 2AMDA 2STBE 2Y7ZA 1G37A 1NU9A 1BRAA 4AFUA 1ZOMA 1V2NT 8KME2 1Y3VA 3M61U 3N99A 1TE0A 2PTNA 2TIOA 5KGOA 4BAMB 1SG8B 2KZ4A 4K1SA 2F3CE 3LGYA 1OSSA 1KTSB 3JZ2B 1A7SA 1D3QB 3MNBA 2ZTYA 1AFQC 1K1NA 3A86A 3DFJA 1G36A 1GBIA 2QCYA 1EPTA 1TPAE 1UHBB 1SLUB 5A2MH 3KYGA 3ZV9A 1V2VT 2W5EA 1TB6H 1PPFE 1V2WT 4UE7H 2UWOA 4YOGA 4B1TA 1GBKA 1AB9C 2WINI 2OCVB 5GJ4B 4MLFB 5FX5A 2H5CA 1UVSH 1CT4E 2D8WA 1P9SA 1BZXE 1YY3A 2ZA5A 2I6SA 1EAXA 4NSYA 4BXSA 4Y7AA 1SPJA 1O5GH 3MU0A 1PYTD 3U1IB 2BDBA 3LJOA 3LIWA 1FY5A 1AUTC 1OHHD 1ZGVA 5C1YA 3I29A 4I8HA 4I8LA 1TBRH 1QBNA 1AVGH 1HAYB 3U8OH 2A2XH 4UD9H 2AHME 2ZZUH 1SGYE 1YPKH 3LH1A 4DY7B 3E90B 4GAWA 1O2OA 2KAIB 3SU3A 3MO3A 2Y5HA 4ZUHA 1C1SA 1O2QA 1FY3A 4HG6A 1P57B 3VGCB 4Y7BA 1C5SA 5T6GA 1GBMA 2J38A 1SOTA 3MYWA 2KCOA 1DWEH 3SQHE 2Y6TA 1OWHA 1Z1JA 2BQWB 2W6JD 1MD7A 3MMGA 2ZPQA 1VCQA 3EA8A 3M37A 3M5NA 1D6WA 5GDSH 1C5QA 1W2KH 1VJAU 1QJ1B 1V2ST 4TYDA 4IN1A 3UPEA 3NWUA 2PSXA 3TJNA 1KMHB 5FPYA 3SJ8A 1O2IA 1TPPA 1SGQE 2ZNKH 1OX1A 3URCA 4MG3A 2VU8E 1OKXA 3K6ZA 3EYDA 2J95A 5A8XA 4ZH8A 2STAE 1AQ7A 1BTHH 4JYUH 3RLYH 4CHAC 4ZKNU 1CA0C 2CXVA 5DP7A 1O3LA 4ZKRU 4O3UA 4UEHH 3PTBA 3TH2H 1C4V2 3MNXA 4F4OC 1QZ8A 2AERH 2Y7XA 4YT6H 1W0JD 2AYWA 2FS8A 1ETSH 2FOMB 3ZVCA 4I32A 2XCNA 1U6QA 4X0WU 1O2VA 3A89A 3NRLA 3TU7H 6CHAB 2BHGA 2XYAA 5HMAA 2CK3D 2FI5E 1UTPA 2XNIA 4E05H 2A5KA 3O8DA 5EQQA 1TOMH 4YLUA 3OTPA 1N6YA 1UVOA 1FQ3A 1QB1A 1T8NA 2QV1A 3MI4A 1DE7H 1GDUA 3FP7E 1NN6A 1FN6A 3ZZBA 3M3TA 3SJKA 2GCHG 4NFFA 1EOLA 2XBVA 5IDKA 3ATKA 4HI3A 5LPEA 2F9OA 2FOHA 2GCHF 4DOQA 3SHCH 1KYNA 1ZPBA 3BSQA 1O5CB 3T5FH 1MUEB 4D9RA 3SUEA 1GBFA 1TALA 1YP9A 1AFQB 4MNWA 1AFEH 2YNBA 1MBQA 3RXOA 1SGIB 4ZXYH 1C9TA 1UTKA 2BD9A 1FPHH 2PW8H 3F9EA 5DP3A 1HAHH 3IITA 3KF2A 3RU4D 3S9BA 1T8MA 3N7DA 5F6MA 3NK8A 1AB9B 3SU5A 4M7GA 1E38B 1FV9A 3CS7A 4ISLA 5A09A 4J2YB 2LNCA 4AGKA 1BRCE 1XUGA 2G4UA 3Q76A 1HCGA 2UUYA 2VVVA 1C5ZB 3F3BA 2QXHA 1MTWA 1DDJA 1P2QA 2FP7B 2P59A 3MOCA 1YCPH 2G55A 3P70B 1S82A 3O8CA 5LGOA 1SQTA 1GDNA 1XUFA 1C2JA 5E2PA 1GJ9B 4MNVA 5C94A 1ARBA 2ZDKA 4WMEA 2C8ZB 2VIPA 1G3CA 2XWBI 4FU9A 1HXEH 2BLOA 1BTPA 1K0HA 4U2WA 3PROA 2HPQH 2FOBA 1MTUA 2G00A 1XM1A 1DWBH 3RC5A 1ZHPA 3D62A 1G2LA 3LGVA 2BD3A 5CDFE 4DCDA 2F91A 4MNYA 1GMDG 4AX9H 5FHTA 3TJVA 4CR5A 1NRPH 1LQDB 1O2KA 2OTVA 4XRNA 3UREA 1O30A 2Z7FE 1C1UH 7GCHG 4I8GA 3VXFH 3U1JB 3KQ5A 4ASHA 2XWAA 2HOBA 3STJA 1W0ZU 3EQ0H 2BB4A 3KQCA 2PKAA 7GCHF 2ANWA 3F9GA 3TJUA 3S0NA 3MQKC 1S83A 1UTJA 1XKBC 1L4ZA 5HGGA 2W7SA 2D2DA 1A1RA 3BG4C 2J9NA 2HRVA 2A0QB 1QY6A 3QN7A 1ANCA 1C5MD 1DWDH 1T7CA 3KYFA 4A5TS 2WPJS 1CA0B 1SLWB 2JH5D 1SSXA 1UTOA 3TK6A 4UFFH 1C5XB 1MZAA 4HGCA 2G52A 1C5OH 3ZYDA 2HNTE 1CA8B 1C2GA 3RLWH 1DLKB 4K69A 3DA9B 3JZ1B 1C5VA 3DFLA 1QTFA 1XUHA 4KTUA 4ABBA 2RCEA 2VIVA 2TGPZ 1E0FD 3SV9A 2BVSH 1PPHE 2PWXA 1UJ1A 3U8RH 2GT7A 4ISIH 4WY3A 1O2MA 1C5UA 2GGVB 1W3CA 2GTBA 1C1MA 1J17T 3PV2A 2O8WA 3BTQE 5DP4A 4A6LA 2XBWA 1QL9A 1GJBB 3SQEE 3BTGE 3F0PA 1MKWH 2FOFA 1TAWA 4F48B 1O39A 3MH7A 1DITH 1A5IA 4P00A 2UUJB 3ESTA 3AVZA 5F8ZA 2ZDNA 1DICA 3E91A 1MH0A 3SI3H 3E8LA 4AB9A 1GHYH 1TPOA 3HGNA 3I77A 4JZDH 4MDSA 4WF8A 3A80A 1QBVH 3QGJA 1C1QA 2VWMA 1NC6A 5C0TA 1K1LA 1IQKA 1PPZA 1X7AC 1C5LH 1O2NA 2H5DA 2PV9B 4R8TB 1TQ0B 1S5SA 5LPFA 2O8UA 4TWYA 3UWIA 1S84A 4KP0A 4CRAA 1L1JA 2FOEA 1GGDC 3OAAD 2Q6DA 3L6PA 3UR6A 1SGFG 4IC6A 2CMYA 3URDA 3OYPA 3BTDE 3LC3A 3BTFE 3S9CA 1SHHB 2NU2E 5L6NH 4DG4A 2EEKA 5C17A 6GCHF 2IPQX 2BXTH 2ZU5A 5EPYA 4THNH 1FLEE 3SZNA 3U8TH 4BNRA 4WXVA 2ZFSA 1LHEH 2BVXH 1TX6A 1EX3A 1EB1H 2C3SA 2GV6A 4DJZB 2TPIZ 1NROH 1Z8JB 2OQ5A 1C1VH 2ZIQH 3ZZ5A 3RMLH 4E06H 1AY6H 1FAXA 1OWIA 2W6ID 1NFWA 1MAXA 2ZTZA 1XMNB 1VCPA 1F5KU 4VGCB 1RIWC 1A2CH 5CHAC 2AS9A 4YZUA 4BAOB 5JBAS 3BG4B 2LPRA 1GBJA 1T32A 3PWCA 2AGIX 5K7RA 1G30B 2ZDLA 1O2SA 3FVFB 2SGFE 1K1PA 2WYJA 1G3BA 3A88A 4HZHA 4LXBH 1ETTH 4GSOA 5C1XA 5T6FA 1O3EA 2ZGBH 3GY8A 1H1BA 3GY4A 1DPOA 1GI1A 2J94A 4LK4A 1DX5M 2A32A 3PM3A 1VITH 3SUDA 1NTPA 1Z7KA 3RXQA 2Z9LA 1TGBA 2P8OB 3H5CB 4TY6A 1SHYA 2FESH 2V35A 1DLEA 1MCTA 5E8EH 2QC2A 2ZG0H 5EG4A 1CGJE 2BOHB 1GI3A 2Z9GA 4YT7H 3BTME 4ZKSU 3BEUA 2ESTE 1SI5H 3A7WA 2Z9IA 3SU2A 4YM9A 2V3OH 1MMJN 1O5BB 3T2NA 3UB0A 4ACBA 2H9HA 3LDXH 1ARCA 1MCVA 1WXRA 1P04A 1LDTT 3Q3YA 3RXMA 4JZFH 2J4IA 2F9NA 1J15A 1WDIA 2ZKSA 1P3EA 3A87A 2CHAC 1O3IA 4O3TA 1A5GH 2A7CA 2GP9B 3T26A 1KY9A 2CF9H 1HAVA 2AH4X 4E7NA 1V2KT 5GWZA 4NG9H 1IHTH 4U30A 3WY8A 2Y80A 2BVRH 2ZECA 2I6QA 1ZRBA 3DSOA 3ZVEA 1ELVA 3RMOH 1UCYH 4WMFA 5GCHG 2Y81A 3RU4T
chains in the Genus database with same CATH topology
1L2EA 1GBDA 3VXEH 1L0ZA 4NA8A 1GJCB 1TX7A 1D6RA 1HV7A 1TIOA 4BANB 1ZSKA 3QDZB 4NIXA 3HGPA 5GCHF 5FCKA 4Q7YA 3DHKH 3PMHB 2ZPSA 1K2I1 2CF8H 1A5HA 1KLTA 1OS8A 3RMMH 2RA0A 3LOXA 4ABEA 3A8CA 2QN5T 3PLBA 2C93B 1T4UH 5DP8A 3K9XB 1F7ZA 1O3PB 2VGCC 2ZQ2A 4NGAH 3GISB 2ZEBA 3ZZ6A 1KXFA 2ZDVH 1L1NA 3KN2A 1ESAA 1P3CA 2FOAA 2J2UA 3FP6E 4I8KA 4X6NA 1BRBE 2GZ9A 3GDVA 2R0LA 5I25A 4A1VA 5DG6A 1RRKA 4B76A 1DS2E 3NCLA 1PQ8A 2OLGA 2NU4E 3UR9A 3S69A 1LMWB 1ZTKA 4K8YA 4GHTA 1FPCH 1V2JT 1HGTH 1TOCB 1V2QT 2BMGB 9LPRA 1VITG 2ALVA 1FJSA 2BDHA 2BD8A 1RIWB 3PLKA 4NIYA 5T6DA 2ZU3A 1HDTH 2SGDE 2VIWA 1A0HB 1VITF 3GCOA 1AZ8A 6LPRA 1O36A 2SGEE 2GDEH 5FPTA 2FWWA 1G32B 1GI7B 1YM0A 4KTSA 1HAVB 4MTBA 1O3CA 1HB0B 1VR1H 3A7TA 1EZQA 1MTNC 1BMNH 3W94A 1SGNE 4WH8A 1ZHMA 3RXDA 1OWEA 2ZGCA 2BM2A 1HJ9A 4IBLH 1GPZA 4K1TA 2G4TA 3C27B 3S7HB 5IYTA 8LPRA 4Y8YA 1YPHE 2ZGHA 2QA9E 2C8YB 1LQEA 1OWKA 2XBXA 5LH8A 2BDYA 3RXVA 3EA7A 1J9CH 1D3DB 3RXIA 3PV4A 3TNTA 3RC4A 3QO6A 1CQQA 1XX9A 2IOTA 1JIMA 1Y3UA 1C9PA 1O3BA 4Y11E 4Y79A 3C1KA 1EQ9A 4TPIZ 2ZCLP 4A92A 4BAQB 5F8TA 1BTUA 5DPAA 5JYIA 5JDUB 2PFEA 2ANYA 2CHAB 2ODPA 1QCPA 1YYY1 5BRRE 1THPB 2O8MA 3VPKA 1DANH 4SGBE 1IQMA 3LGUA 1GBAA 2ZGJA 3LGIA 1J16A 2OQUA 4FU7A 2PTCE 1P9UA 2QYIA 2OBOA 1JRSA 1HYLA 1P2IA 1GI8B 2VINA 1CT0E 3PTNA 2G5VA 1DWCH 4ZAEA 1O2LA 1AU8A 3RXGA 1HBTH 2R3UA 3D23A 1QL7A 2QGRA 1NM6A 2ODYB 5GPIB 4AYYB 3TGKE 3UUZA 1Y3YA 1MQ6A 4Y6DA 3TH3H 4GCHG 4TWWA 3H7TA 1BBRH 1Q2WA 1T8OA 3RXBA 4H6SB 1GJ7B 1O3OA 1GBTA 4FUIA 2P95A 2JETB 1ZPCA 3BTTE 2A31A 1YPJH 1OPHB 1TABE 5G4BA 2A7HA 2FIRH 1KXAA 1WQVH 5EQRA 1C2HA 1OYQA 4U01A 1TGNA 4WWYA 3Q00A 1BHXF 3SJ9A 3PMBB 4FUCA 4BAHB 4LZ1H 4K1EA 4FXGH 5EW1H 1EZUC 1HAGE 1TRNA 2Z94A 3SU1A 1A3EH 1D3TB 3P92A 1O3FA 1VJ9U 3UOPA 1MZDA 9ESTA 2WPLS 3E16B 4O9VA 3A8BA 1AHTH 1C2EA 1O5AB 5EGMA 1LKAA 1Q3XA 1EP5A 3GICB 1YPEH 5JB8S 1FMGA 2RA3A 2H2ZA 2HNTF 1O3AA 1PPBH 3RM2H 3CP7A 3A82A 5FBIA 3P17H 1SFQB 4H6TA 5E0GA 1BOQA 5EQSA 2HPPH 4ABAA 4NZLA 1CT2E 2OD3B 1MTVA 3GCHC 1GMHG 1K1OA 1GHVH 2DE8A 4AORA 1H9IE 3SGBE 3IWMA 1DUAA 5C67A 2GCTB 3AAUA 4YTAA 3SW2B 1GMHF 4O03A 1MTNB 4KELA 1F5LA 1C5TA 5DK1A 2O8TA 5F03A 4H42U 2FMJA 4FUJA 1PQ7A 4IGDA 1Q31A 4GLYA 3ZVAA 2G8TA 1P05A 4X8VH 2GDDA 2ANKH 3E6PH 1LPGB 2ZU4A 1GL1A 2BYAX 2JKHA 4I8JA 4NA9H 1NO9H 2RDLA 1P09A 3QTVH 4H4FA 1MKXH 4X8SH 1FAKH 4KKDA 3M5OA 1O32A 2QF0A 8ESTE 1MQ5A 2HNTC 1P10A 3UNQA 3KQEA 1ZR0A 1QQ4A 3MFJA 3M5LA 3GDSA 2P94A 1FZZA 1OYTH 3CENA 4K2YA 4CRBA 1DY9A 1KTTB 1AZZA 1T4VH 1G3DA 2J92A 4NSVA 5DP5A 1CHOG 3ATLA 4D7GA 2SNWA 5EXMA 1NRQH 4RKJB 2DUCA 3MH4A 1S0RA 2ZU1A 4LOYH 3F68H 1CBWC 4JMYA 4K8BA 1ACBE 1QJ6B 2EI6A 1EATA 1UCYE 1CHOF 3M5MA 1C5RA 1UK2A 1TRMA 1ABJH 1YBWA 1ZZZA 1EB2A 4O97A 1DUEA 4Y0YE 5ABWA 3B23B 4BXWA 4IMZA 5FXLA 4BTIB 2A5AA 2XC0A 2GT8A 2FPZA 1V2RT 1GI5A 2GV7A 4F49A 4FUGA 2FEQH 2FYQA 3ATWA 1BCUH 4NWLA 4GVUA 1AI8H 4A1TA 1GI6A 1P03A 1O0DH 4ZXXH 4NZQA 2QXIA 1Y8TA 3GYLB 2C8WB 3BN9A 1H9HE 1V3XA 3BV9B 1O3JA 4OS1A 3VB6A 1WBGB 1SGPE 3ZZ7A 1NRRH 1P2JA 1GMDF 2F83A 4NFEA 5HYOA 2A1DB 4B2CA 3F1SB 1IQGA 1QB6A 1TQ7B 2ZGXH 1O2WA 1P0SH 3K65B 4JZIA 3STIA 4D8NA 4Z6AH 1EJAA 4BOHA 7KMEH 2DE9A 1F0RA 4CHAB 3ZZ9A 4OGXA 3SU4A 3PWBA 1TPSA 2WUCA 5C2ZA 4ZHMU 2ODQA 2ZHFH 2NU0E 3P8GA 4HFPB 1PJPA 3ZZ8A 1F92A 1KDQB 3GCHB 4X2YA 1O38A 3MU1A 5HM2A 3P8OA 4X6PA 1EASA 4X1QU 1J14A 3SJOA 1RXPA 4JYTA 1BHXB 3NPSA 2PKSC 3LGWA 1EJNA 3ZVFA 2OINA 1IQFA 2AEIH 1UTQA 1ELBA 2OBQA 3LC5A 3SU0A 1JRTA 1EAWA 2BLVA 2F9UA 1OP8A 1UO6A 1C5NH 1W14U 4FUDA 4INKA 1SGEE 1XKAC 4X2WA 2BLWA 1ESTA 1F5RA 3OSYA 2BZ6H 1ZMJA 1C2MA 2F9VA 1OWJA 5DP6A 3U69H 3QZRA 2CGAA 1BTYA 1O3GA 3MHWU 1GHWH 3O8BA 4CBOA 1O3KA 3EA9A 1EAIA 3B9FH 3U9AH 1MU8B 3ATMA 3Q77A 1C1WH 4Q2KA 4KGAA 1O2GH 4A1XA 1O5DH 3E1XB 1GJ6A 1SB1H 1ELGA 1WOFA 1XVMA 2A5IA 2PUQH 3RC6A 1CBWB 1ZHRA 1ZTLA 2GZ7A 3RUOA 2Z9KA 1S81A 3GCTG 2A7JA 5ESTE 3D49H 4GHQA 1BUIA 5JPMH 4ABJA 1V2TT 5C5NA 2ZFRH 2OP9A 4INLA 1BBRE 1YGCH 1WAYB 1WU1A 4XFQA 3PMJA 2R9PA 2W3KA 1T8LA 2F9BH 4UFDH 4D7FA 2VJ1A 3LGTA 1IQNA 1SL3A 4XE4A 3A81A 1UTNA 5DGJA 2UUFB 1FIWA 1HRTH 2XTTB 1NESE 2B9LA 3IG6B 1ELAA 2GMTC 1AE8H 1RD3B 4FVDA 1YPGH 2XRCA 3H7OA 3RXHA 1HLTH 4PROA 3HK3B 3F9FA 3SUGA 1ELCA 1J8AA 5EOKA 1Z1IA 1QFKH 3SNDA 2B5TB 2IJOB 1W8BH 1NY22 1TA2A 3FZDA 3TPIZ 2ZP0H 3AW0A 3MNCA 3V7TA 2CN0H 3RM0H 1SC8U 2FODA 2VH0A 3A7ZA 5GXPA 3LH3A 3RXUA 1AMHA 4AGJA 2TBSA 5T3HA 4J1YA 1KIGH 1TGCA 1BQYA 2OUAA 1GVLA 3R3GB 3F6UH 1NRNH 1SGRE 2O9QA 1WQSA 3ZYEA 1B0EA 1LTOA 1QL8A 5L30H 2BQ7B 2PKSB 1WV7H 3BIUH 1O3NA 5AVDA 1HIAB 2VWNA 1C2KA 2XCFA 1CE5A 3MTYA 2HWLB 1LVYA 3HK6B 3EDXB 3KIDU 3ZZ3A 3G01A 4AZ2B 2W7UA 2WPIS 4MQAA 1WCZA 1TNLA 1QJ7B 4Y8XA 2FXRA 1GBEA 4ABIA 4CRGA 1BJVA 3ODDA 1QQUA 3VB4A 2H9EH 1O2XA 8GCHG 2BX3A 2Y5GA 1QGFA 1GI2A 2F9PA 1SGFA 5C5OA 2PSYA 4ZROA 2ZQ1A 2THFB 1Y5AT 1FDPA 1KXBA 1JBUH 2HVXA 2ZDAH 3T62A 1H4WA 3LT3A 1F0SA 1YPHC 3QLPH 3SNEA 2CV3A 1OXGA 1SGDE 4X1PU 5LPRA 4GUXA 1LKBA 1YLDA 3P95A 3RU4E 2C8XB 1FY4A 5ESBA 1IOEA 3SUFA 1GGDB 2FS9A 4MVNA 4OS2A 1N1LA 2OC1A 1O34A 2BY8X 1C4Y2 3RXPA 1A3BH 1UVTH 2PGBB 1QRWA 4X2VA 4ABFA 2NWNA 1C2IA 3DUXH 1FY8E 1SGCA 2GVFA 3N7OA 2ULLA 2BLQA 2EI8A 5I46H 1IQJA 4K3JA 1YCPK 1BMAA 2Q6FA 1D9IA 5C20A 1O31A 1S6FA 2ZU2A 1LHGH 4AG2A 4DGJA 3O8RA 3GY6A 1PQAA 4MPVA 2UWPA 1SGTA 1VCWA 4OS5A 4XBCA 3V3MA 2GMTB 2R2MB 1RTFB 2AGGX 4SGAE 1ANBA 1C4U2 2VIOA 5TCCA 3GOVB 1YF4A 2Q6GA 1ZGIA 4INHA 4B74A 4ZKOU 1GHBG 1GL0E 1HAZB 4A7IB 1QBOA 5EW2H 1GCTC 3ZVGA 1O2ZA 1P02A 2ZPRA 3SGAE 3MO6A 1GHAG 1RGQA 3BEIB 5CHAB 4IMQA 2ALPA 2AMPA 1Y59T 2VWLA 5FBEA 2J34A 2Y82A 1SVPA 5C3NA 4AN7A 1H9LB 1TFXA 2PLXA 3M7QA 3QZQA 1GHAF 1D3PB 1RTKA 1GWAA 2VIQA 3GY7A 1HAOH 3HATH 4RSPA 4DIHH 5EXNA 3PLPA 3BTEE 4K5ZA 4MNXA 1ZTJA 2PHBA 2ASUB 3MO9A 1K9OE 1O33A 3PMAB 4NIWA 1ETRH 3HPTB 1QHRB 3FAOA 1GI0A 2WV5A 1ELDE 5EODA 1DSUA 1EPTC 3RXKA 2ZHWH 1NFXA 7ESTE 1DXWA 2Z3EA 5DP9A 1A61H 3QGNB 1GBCA 1GDQA 3I78A 1P2KA 4WJG2 1INCA 4D9QA 4Q7XA 3BTKE 1ZYOA 2ZCHP 1BT7A 1EAUA 1TBZH 3TK5A 1M9UA 1BTXA 1KXEA 2EA3A 2BX4A 3NXPA 4TPYA 1YCPM 1TMUH 4X1NU 4BTTB 2WPKS 4JYVH 4ABGA 5JB9S 4RKOB 4B73A 5A8ZA 2BDCA 2XW9A 3EE0B 4JK5A 2V3HH 3VEQB 1W10U 5CE1A 1MBMA 1GJ4H 1LHFH 1MKWK 2H6MA 1HJ8A 3QK1A 1AKSB 5A8YA 1E37B 3ZZDA 1BJUA 3SOSA 3RXLA 1HFDA 4B75A 2BY9X 2AIQA 1QURH 2HLCA 1XXFA 4GPGA 1TGSZ 3FANA 1CVWH 2O8LA 1Y3WA 5DJ7A 4AOQA 4CRDA 2G81E 1SBWA 2BY6X 1TA6A 1AWFH 1LPZB 2BDIA 3FFGA 4FUEA 1HXFH 2ILNA 3UNSA 4CH2B 1IQLA 1ZJDA 5FPSA 3TLOA 1TRYA 5AFZH 3SU6A 1NFUA 1TNHA 2OC8A 1HJAC 1MTSA 1OP0A 3TITA 3V0XA 3GDUA 1SFIA 3ZVDA 4GCHF 2QAAA 3TIUA 2ZC9H 2A4GA 3M35A 1RFNA 2QXJA 1P2NA 3QUMP 3ZZ4A 1O2TA 2VGCB 4Q7ZA 4YLQH 1XUJA 3A8AA 1AD8H 2VNTA 2ZF0H 2H9TH 2TGAA 1PPEE 3TH4H 4MPWA 2Y5FA 4ISOA 3DD2H 3PO1C 3A7XA 1E36B 3QWCH 1H8IH 1QRZA 2ZFQH 4JZEH 1RTLA 3AW1A 2GKVE 5TJXA 3FP8E 2TGDA 4AFQA 1GI4A 1O5EH 2VWOA 1K1IA 4NA7A 1FONA 4UDWH 4DT7B 5E2OA 1GCTB 1O3DA 3K2UA 4DVAU 1IQIA 1AUJA 3SV6A 1C2LA 2P3UB 2BD4A 1HUTH 1CGIE 1THRH 5J4SA 3GYMA 4AB8A 1Z71A 4NCYA 5AF9H 1YLCA 1NU7B 4FU8A 4CREA 1AIXH 2B7DH 1UTMA 3LKWA 1NFYA 2FX6A 1O2RA 2D26C 1GVKB 1ZSLA 4IS5A 5B6OA 1F2SE 1UK4A 1YC0A 1L4DA 4IC5A 3UIRA 3W95A 3ZZAA 1EZXC 1MU6B 4TY7A 3MU8A 2ZHQH 4I7YH 2FYRA 1JOUB 1YPLH 1GJ8B 3E0PB 1PQ5A 3M7TA 2C90B 3KQDA 2ZFFH 4BTUB 1AO5A 1EPTB 1EUFA 1HPGA 4OS4A 4ZHLU 1ESBA 1JXPA 1LVOA 1Z8IB 4YO9A 1PPCE 3EAJA 3SN8A 1GMCG 1O2HA 1P2OA 1KXCA 5E0JA 1QRXA 4B71A 5L2ZH 3RMNH 3T27A 4R0IA 1SOZA 5HXFA 4ISNA 1TMTH 1HAIH 1GMCF 1NT1A 1VGCC 4D76A 1O37A 4YOJA 4X6OA 1GBHA 1GBBA 2FZZA 4X8UH 1XVOA 3UQOA 2BXUH 3T25A 3OX7U 4UFGH 2B8OH 2M5TA 3KNXA 3ELAH 2C4FH 3SHAH 1TMBH 2EC9H 1KDQA 4JZ1A 4X6MA 1O3MA 4IW4E 1YKTA 1WTHD 2Z3CA 1C1PA 1Y5BT 4X2XA 1A46H 4E7RG 2OC0A 1OWDA 1GG6C 3BTHE 3PB1E 1G2MA 4OS6A 4OS7A 4XSKU 1C5PA 1K1JA 1ZSJA 2FO9A 4UONA 2V6NA 1B7XB 3DT0H 1ABIH 3V12A 2Q1JA 4QT8C 2WUBA 1EXFA 3A84A 4IN2A 1UCYK 3LU9B 4NWKA 2EI7A 5L2YH 2YOLA 4X8TH 1HJAB 1NS3A 3GY2A 1VZQH 2G51A 1V2UT 2HALA