2FS8A

Human beta-tryptase ii with inhibitor cra-29382
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
243
structure length
243
Chain Sequence
IVGGQEAPRSKWPWQVSLRVHGPYWMHFCGGSLIHPQWVLTAAHCVGPDVKDLAALRVQLREQHLYYQDQLLPVSRIIVHPQFYTAQIGADIALLELEEPVKVSSHVHTVTLPPASETFPPGMPCWVTGWGDVDNDERLPPPFPLKQVKVPIMENHICDAKYHLGAYTGDDVRIVRDDMLCAGNTRRDSCQGDSGGPLVCKVNGTWLQAGVVSWGEGCAQPNRPGIYTRVTYYLDWIHHYVPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Tryptase beta-2
publication title Structure-guided design of Peptide-based tryptase inhibitors.
pubmed doi rcsb
source organism Homo sapiens
total genus 50
structure length 243
sequence length 243
chains with identical sequence B, C, D
ec nomenclature ec 3.4.21.59: Tryptase.
pdb deposition date 2006-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fs8A02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2fs8A01
1ZPCA 5EW2H 4FUDA 1KXEA 2Y6TA 2BOHB 4AG2A 2Y5HA 3BEFB 2KAIB 3EYDA 1YM0A 2GP9B 2UUJB 3W95A 1PPCE 3TPIZ 2XRCA 3ZZ8A 1GDUA 3NZIA 1FJSA 1S6HA 4YM9A 2JH5D 4CBOA 1C9TA 2V3HH 2WPLS 2ZPSA 4Y79A 1OWJA 5DG6A 1F92A 1WU1A 2SGAA 4TPIZ 3SJ8A 2OC0A 3ZZ9A 1HGTH 1BJUA 4AFZA 1BMLA 2C8WB 3T25A 1A2CH 3F6UH 1MBMA 4BNRA 1BQYA 3F9HA 1IQIA 1QA0A 1SB1H 3FZZA 2FOGA 1Y5UT 4WH6A 1TBRH 2EI7A 1EAUA 4TYDA 1GHAG 3UR6A 3ZZDA 1UCYK 3A86A 3GDVA 1D3TB 5F8ZA 3BTHE 1YPGH 1WUNH 2ODPA 2KAIA 3E1XB 1FY8E 2HALA 2VWOA 1LHCH 4MVNA 1RGQA 1PPGE 5C5OA 3RM2H 1EPTB 1RTFB 2BVSH 2FOEA 2EEKA 1TONA 4K8YA 1QRZA 3T62A 1O2GH 3ZZAA 1H9IE 3Q00A 2R0LA 2UUKB 1KSNA 1RTKA 1VCWA 1YCPM 3KQDA 5ETXA 1C1PA 3EA9A 1YBWA 2OBOA 1BTXA 1F2SE 5FCRA 1B7XB 3EDXB 4YOJA 2ZQ2A 1BZXE 1RS0A 2ZZUH 1QA7A 1SGTA 2QF0A 2P59A 1Z6EA 3BN9A 2YNAA 3LC5A 4X6MA 2STAE 3M7TA 1Z8JB 1WTHD 3GCHC 1W13U 1C4Y2 2GZ7A 1O5AB 1DM4B 1EPTA 3GOVB 1KDQB 1HJ9A 1LHDH 2JH0D 2EI6A 1HAVB 1BJVA 3GYMA 3D62A 1GDNA 3EA8A 3RXBA 1K21H 1BDAA 3UREA 4GVUA 2ZNKH 5A09A 2ANWA 1QBNA 2XBVA 1GDQA 4AGJA 2ILNA 2VWNA 2F9VA 2SFAA 4FVDA 1SLVB 2DE8A 2BVXH 1AVGH 4DGJA 1YPJH 3ZZ3A 4H42U 4LZ1H 4K60A 1NROH 1AZ8A 3LGYA 1MAYA 3LPRA 4DOQA 1KDQA 1NFWA 1FIWA 1P2NA 1XKBC 1W10U 4NSYA 3HPTB 1HAVA 2D8WA 1K1JA 1Z8IB 2C93B 2WYGA 5E2PA 1AB9C 1C5QA 5DKMA 1W7GH 5JDUB 3GDSA 5EW1H 3P95A 4FUJA 3O8BA 4DW2U 3RMLH 1FV9A 4CBNA 3DFLA 5EG4A 1PQ8A 2R0KA 1ESAA 2GDEH 1NC6A 2TGPZ 3Q3YA 4Y10E 8GCHF 2SGDE 1C5PA 2SGPE 1XX9A 4AX9H 1GGDC 1UTNA 1OOKB 2ASUB 3VB5A 2QGRA 1L1JA 1G3DA 5ESBA 4A1VA 4K1SA 3EAJA 3SV7A 2PWXA 5DP8A 1FXYA 2ZGHA 2D1JA 1T8OA 3HGPA 1UVTH 1SGDE 1TWXB 1KLJH 4Y7AA 5SGAE 1NRSH 4ISLA 2FOCA 1TA2A 1BBRE 1GHWH 3RU4E 1PPHE 1HAGE 3UIRA 1ESTA 3SU2A 2BXUH 1K1MA 2ZWLH 4AZ2B 3MU8A 3TLOA 5DP3A 1Y5AT 2FMJA 1KXFA 1C5VA 1P3EA 1MUEB 5DP7A 1BIOA 2FWWA 4HZHA 4JYUH 2XNIA 1T8MA 1JRTA 1OS8A 3LC3A 1Y3WA 2FDAA 1GL1A 1T32A 3K6YA 1A0JA 2EC9H 3IITA 8ESTE 2O8LA 2UWLA 5FAHA 1V3XA 4YLUA 3ZVDA 1OSSA 2FX6A 1GJ4H 3AW0A 1FY5A 1V2WT 5EPNA 1E38B 2PKAB 1LKBA 3A7VA 4FU9A 2AS9A 1KLTA 5DP5A 2A2XH 1CBWB 2PV9B 1A46H 3A7ZA 1SLWB 4ZMAH 3AASA 5JBTA 2WINI 1L4ZA 2A4QA 2K1QA 1ZLRA 1L1GA 2JETC 2BZAA 5K0HA 2YOLA 2VJ1A 1J9CH 3CS7A 4GPGA 5H4IB 2BLOA 3LJOA 3PWCA 1V2QT 4Q2KA 3ESTA 4ABDA 2G55A 3A7YA 1W12U 3A8BA 2G5VA 1TABE 1WQSA 1GBTA 2F9BH 1UTOA 4NIYA 4ABAA 1ZTKA 4I8GA 3Q3XA 3DHKH 1CGJE 2THFB 2G00A 4O3TA 4ISNA 1FAKH 1S6FA 3SU5A 4U2WA 1HXFH 1OYTH 2Q1JA 5JB8S 2ZCLP 3BF6H 1TQ0B 4JYTA 3KF2A 4Y76A 1QB6A 1IQGA 1P2IA 1QQ4A 5LPRA 1O2KA 2FM2A 1QFKH 3HATH 4NGAH 1LDTT 3SNAA 3FFGA 1DFPA 1O34A 1O3JA 1L4DA 1OP2A 1UHBB 2A4GA 5EXNA 1EAXA 2DE9A 1C2HA 5FCKA 1Z71A 2BDIA 1ETSH 1ZHMA 4RN6A 7ESTE 1CU1A 1XUHA 4XFQA 3RXAA 1IAUA 1PQAA 4Y71A 2SGFE 4SGBE 1HV7A 3LGVA 1QB9A 3SQEE 1O31A 3HKJB 3A83A 3OX7U 2FXRA 1J8AA 2O9QA 4X2YA 1BRBE 1VGCC 5A0CA 1A0LA 4BAMB 4Y0YE 1LKAA 4XSKU 3BV9B 1A0HB 1DUEA 3QGNB 3PMJA 4X8TH 5C2ZA 1GI3A 2XW9A 3TJVA 2VB0A 3RXCA 3MU0A 1HLTH 1UHBA 3PYHA 4F4OC 1EB2A 1VITG 3LH1A 1AKSB 5C67A 1MTSA 2F83A 1KTTB 3UR9A 1O39A 1C5LH 3T27A 1MKXH 1T8LA 1GHZA 1YYY1 3TGJE 1GJ7B 3PB1E 1K1IA 5G4BA 2HNTF 2UUFB 3UWJH 3VGCB 1LVMA 4MNVA 1BTYA 1OYQA 2BD5A 4JZ1A 5E0HA 3RXMA 1P03A 4NFEA 1TALA 1TOMH 4WJG2 4FUBA 1KXBA 1BTUA 4MPVA 2JH6D 2GVFA 4X1NU 3M3VA 5A0AE 3SU6A 1CVWH 1ZTLA 1P10A 1ZSJA 3SU3A 4CRCA 2ALVA 3GY5A 2PR3A 5J4QA 1GBAA 2F9UA 3S9AA 4K5ZA 4K8BA 5F03A 1AKSA 5GCHF 3MOCA 3MH4A 1FLEE 3U69H 6CHAB 1DPOA 5CMXH 3EE0B 4K1TA 1WQVH 1FY3A 1Y3YA 1JBUH 2HNTE 3QDZB 4ISOA 4ISHH 1ZHPA 3A87A 3RU4T 3BEUA 2QXGA 1V2OT 1U6QA 3M61U 4MLFB 1TGBA 1VGCB 3PLBA 2FIRH 3KGPA 1V2PT 3D65E 4I8KA 4GCHG 3UFAA 3UOPA 1O33A 4R0IA 4Z0KA 5AFYH 1DY8A 2GGVB 1HJAB 5PTPA 1TPPA 4Q80A 3GCTG 4AB9A 5C5NA 2AGIX 1ANCA 1TNGA 2P93A 1DWDH 3MNBA 1DANH 1O2VA 3MO9A 2BTCE 3QGJA 1SC8U 5DO4H 3TJUA 3SORA 2QAAA 1GJ5H 1GJ9B 1ZYOA 2CHAC 1QTFA 4NIWA 1WBGB 2HPPH 1AFEH 1MTNC 1OWEA 1K1OA 4A5TS 1ELCA 4IN2A 3SJIA 3MNXA 1GCTB 1KIGH 1O32A 4KELA 4X6OA 3M5MA 1JIRA 1DT2A 1YPEH 3FP6E 3ZV8A 4X8VH 1G36A 1OWHA 2OC7A 2VIDA 3N7OA 2WUCA 4ABEA 3OY6U 4ZH8A 4D76A 2Y82A 1GI6A 3AW1A 3KHVA 3BTGE 1AE8H 4IC5A 3KQEA 3U8RH 1LHGH 2B9LA 5L2YH 1SR5C 3UUZA 1TQ7B 5DPAA 5EQQA 3L3TA 3M37A 2QV1A 1M9UA 3ATMA 3HK6B 4OS7A 3E3TA 1HPGA 3AAUA 1SGPE 1VITF 4I33A 1YPLH 1FMGA 4NWLA 3GDUA 2BM2A 4UE7H 3QZRA 3E16B 3W94A 1L0ZA 1O2SA 1F5RA 1EOLA 3TK6A 3D49H 2ZGBH 2BDBA 4AYVB 5GXPA 1SI5H 3V12A 2BLWA 2PUXB 2BD7A 1LVYA 3MO3A 3PWBA 4X1SU 4FUFA 3GY7A 1SQAA 1GBKA 3T29A 2NWNA 1Y8TA 6GCHG 5FX6A 3KQBA 3R0FA 5F8XA 3TGKE 2H9EH 4NA7A 5EXMA 3S0NA 4JZDH 2XCNA 2ZIQH 3ODFA 1ZOMA 1V2JT 1F0TA 1C5SA 3ENSB 1O2ZA 7GCHG 3LGTA 5C20A 5EPYA 3RMNH 4JZFH 3BTEE 1G32B 1ZSKA 2WPIS 1ZHRA 4Y11E 4R8TB 5GIBA 5DJ7A 1MAXA 4I32A 4ZUHA 1BCUH 1TRMA 1Z6JH 4BXSA 3RXTA 1C5MD 2ZHWH 2I6SA 4X6PA 1IQKA 3C1KA 1C9PA 2FTLE 1O2MA 1C2JA 2XBXA 3GYLB 3GCTF 5T3HA 3P92A 1HIAA 1MKXK 2TGAA 1EJMA 1FY1A 1CA8B 2WV5A 2XC4A 1NTPA 1XKAC 1RXPA 1O2JA 1G3EA 3A80A 1K9OE 3VXEH 4LXBH 1W8BH 3SI3H 2GV6A 3TK5A 1HAHH 3K9XB 4JMYA 2BDYA 1GVKB 1O3AA 5CHAB 2P16A 2A0QB 1GVZA 2TPIZ 5FX5A 3E0NB 2XTTB 1DXWA 3NKKA 3UNRA 3K2UA 3QO6A 1EPTC 2BD8A 1HUTH 1F5KU 1YPHE 3MNSA 2W7UA 3MH5A 1MH0A 3UPEA 2C8XB 3PLKA 4ABJA 1GBFA 4JK5A 2BDCA 4NZLA 1SGFA 3LGWA 2G52A 1BITA 1HJ8A 2FODA 2OCVB 1SPJA 1Z8GA 3ATWA 2P3UB 4IW4E 5TCAA 3RXHA 3LJJA 3FVFB 1S81A 2PFEA 2BQWB 3VB4A 3PTBA 1F0UA 3MYWA 1QRWA 2Z3DA 4CRAA 3SN8A 3GCNA 3P8FA 1GI1A 1CHOG 2ZGCA 2SNVA 2ZFRH 4WH8A 5BPEA 4B71A 3O8RA 1LPKB 1W0ZU 4ISIH 1F7ZA 1B5GH 1F0RA 4D8NA 4DG4A 1TPOA 2V35A 1ZRBA 3ZVGA 1PQ7A 1THSH 3RMOH 3NWUA 1O5CB 1LO6A 4UONA 3KL6A 5TCCA 1C5YB 1ELGA 4WF8A 1QL7A 2J2UA 5L6NH 2O8MA 1QL9A 1DITH 1GBCA 3STIA 1TNHA 3U1JB 1WV7H 4WMFA 4FU7A 4Y0ZE 5FPYA 1C5XB 4XBBA 1ID5H 1K2I1 3MH7A 3RLYH 5FPSA 4OGYA 1G37A 2SNWA 5FBEA 5E0GA 1SGCA 3BTWE 4BAHB 1DS2E 1P01A 3TH4H 1JRSA 1AMHA 2Z9IA 1TNKA 4CRFA 1KLIH 1BT7A 3S7HB 2Q6GA 2CF9H 3SI4H 2GDDA 1L1NA 1P2OA 2OQUA 1E36B 1GMDG 1D3QB 3RXIA 2PTCE 4E06H 2Z9KA 4INKA 1MD8A 1V2TT 2J4IA 3SHAH 1SGNE 2HOBA 2HNTC 4XBCA 3RUOA 1GI7B 1V2MT 8KME2 4BAOB 4ZROA 1GI5A 2QY0B 4X8SH 2HRVA 3PTNA 1P12E 2VVCA 1MQ5A 3RXUA 1J14A 2FOMB 1ZZZA 1UTJA 2RCEA 3EGKH 1LPZB 3PO1B 2C8YB 1PQ5A 4NFFA 3SV9A 5C1YA 3F9FA 1Y3XA 1XUIA 2O8TA 2Z9LA 1O3IA 4UEHH 4ZKSU 1P06A 4ZHLU 2XBWA 1ARCA 1B0FA 2OUAA 1TX8A 3GY2A 4A6LA 3RXPA 1T7CA 3BTME 4XE4A 1GBJA 3P8NA 2ZFFH 1EUFA 1X7AC 4UDWH 5A8YA 2ZU1A 2QC2A 4JYVH 1BBRH 1O2HA 3SJOA 2LPRA 2VIWA 1SGRE 1ZPBA 1WSSH 1SFIA 3UQVA 1EAIA 3RXOA 1CBWC 2V3OH 1FZZA 2FO9A 4MNYA 1TOCB 3U98H 4NWKA 3SU0A 4DVAU 1O5FH 1P04A 3DUXH 2ODQA 1NFXA 1O2LA 1CGHA 1A7SA 1GHAF 1NY22 1LPGB 1V2LT 2FI3E 5IYTA 1VCPA 3SNDA 1Y5BT 3F68H 4QT8C 2ZC9H 4BOHA 4FU8A 1V2UT 8LPRA 5T6FA 4AYYB 1FPCH 1T4VH 1FIZA 2H2ZA 3EA7A 2BHGA 2Y7XA 3A8CA 5A8ZA 5L2ZH 1O5BB 1JMOH 3E0PB 1BB0B 3M3SA 3RC6A 1TX7A 1NRQH 3ZYEA 1EASA 1GMHG 2XXLA 2WPJS 2RDLA 1XMNB 1CA0B 1J15A 1LCYA 2JKHA 3BG4B 7KMEH 1QBOA 2QYIA 2BDAA 2VGCB 2TRMA 1QB1A 2ZGXH 2Q6FA 1N6YA 2OBQA 4A1TA 1H9LB 3P8OA 2FOBA 3QZQA 4O3UA 1P0SH 3NUMA 4Y8YA 4K69A 4AB8A 3M7QA 5GWZA 1TLDA 3UTUH 2ANYA 1RIWB 1GMDF 1BTZA 1JXPA 4Z6AH 2H1UA 1AVXA 1IQNA 4I8JA 1TPSA 4YZUA 1MQ6A 1XXFA 3VB7A 1VJAU 4U32A 1O2IA 1A5HA 5HXFA 2R3UA 1AD8H 1DY9A 3MU1A 4WY3A 2GCTB 1V2VT 1W2KH 2B5TB 3BG8A 1A5IA 1GHVH 2GV7A 2B7DH 3S9BA 3I78A 1F0SA 4CHAB 1O3NA 2UWPA 4DT7B 1ZMJA 4WVPE 4LK4A 3QN7A 1IQEA 1DX5M 1E37B 1O2WA 2ZG0H 3VGCC 7LPRA 1Y3VA 4H4FA 1E0FD 5FPTA 2H5DA 3U8OH 3OTJE 1NS3A 1AI8H 1K22H 2F3CE 2GCHG 4KTCA 4WWYA 3A8DA 6ESTA 2ZFTA 1ABJH 1UTMA 4JK6A 4MTBA 2I6QA 4B1TA 4X6NA 3FAOA 1FY4A 2BY9X 1YPHC 5HMAA 3ZYDA 5C3NA 2J34A 2G4UA 2VNTA 1TRNA 3MTYA 1RRKA 5EGMA 1C2FA 1TNLA 1FONA 1PPEE 4JZIA 1ELVA 1CSOE 6CHAC 2PW8H 2WUBA 1P2MA 4YOGA 3URDA 1C2IA 1FUJA 2FI5E 4K2YA 1NT1A 4DJZB 3ZZCA 1ZTJA 1N8OB 5I46H 4X1RU 3WY8A 1PPZA 1C1NA 1ZGVA 4AORA 3QTVH 4ABHA 4A1XA 4E7NA 5CE1A 1P57B 3UOUA 2EA3A 2D2DA 3A82A 1TB6H 1OP0A 1EXFA 1SBWA 1TGTA 1HJAC 3ZZ5A 3A7WA 2XBYA 4FUEA 2VIQA 1SVPA 3RU4D 2HPQH 5HGGA 3BTKE 2XC0A 1C1WH 1H4WA 1AU8A 2VVUA 4OS2A 1TIOA 4YOIA 1MCVA 2Z6BD 3NCLA 1O2NA 1IQLA 3A85A 3FP8E 2ALPA 2ZDMA 3ATIA 1DSTA 2GX4A 2ZHFH 1LQDB 1D6RA 1MKWH 2XWAA 1O5GH 4MDSA 2NU2E 1GG6B 1NFYA 2P8OB 1D6WA 1EJNA 1NU9A 1BBRK 2R2WU 3P6ZB 2QIQA 1AVWA 1A61H 1YF4A 2VIOA 3FANA 1GCTC 3KNXA 1DSUA 2A7JA 4FUHA 2UWOA 1YLDA 1XUJA 4I7YH 2ZO3H 1O3OA 1OWKA 4J1YA 5JBCS 1HBTH 1YKTA 4B74A 2CV3A 1AQ7A 1ELAA 1SGEE 1TFXA 2SGQE 1W0YH 1EATA 1GHBG 1GL0E 2XWBI 3UNQA 3OYPA 1V2RT 1MTUA 1V2NT 2TGDA 2ESTE 4X2WA 5K7RA 5I25A 2A4RA 5A0BA 5LPFA 3ATLA 1KXAA 4I8HA 1CT4E 1SSXA 1GHXH 3SU4A 4RKJB 1C1MA 1TE0A 1GPZA 2BLVA 9LPRA 3VFEA 1O3BA 1GBLA 1ELDE 4INHA 1O3CA 4YLQH 2RA3A 1CT2E 3K65B 4GAWA 2PHBA 2A2QH 3AAVA 2RG3A 3LIWA 4F49A 1GJ8B 2PKSB 2TBSA 1O36A 2ZU3A 4O9VA 4X2XA 2ZHQH 4YT6H 1O3LA 3PMBB 1KXCA 2Y5FA 2IOTA 2AH4X 1XVMA 1Q31A 3VB6A 1MZAA 3OY5U 3DT0H 4WMDA 3TITA 2GMTB 2DUCA 3TNTA 1GBHA 1BRCE 5T6GA 4X8UH 3RXSA 3RXJA 3A7XA 1MBQA 3UQOA 4CH2B 2A31A 4DIIH 3BTQE 2G8TA 2ZTYA 3S9CA 2PGQB 2HLCA 1TPAE 4ABIA 1O2XA 2J94A 3L33A 1G3CA 1GBBA 9ESTA 1VITH 1O3EA 3UY9A 1IOEA 3SQHE 3PMAB 1O2UA 1TX6A 1P2KA 4OS4A 3M5OA 2BQ6B 1WYKA 1H8IH 1H8DH 2ZDNA 2PLXA 4AFUA 1NU7B 5F8TA 4IMQA 1QIXB 3TH2H 3UNSA 4MPXA 3U8TH 1GBIA 3H5CB 2G5NA 2Y7ZA 4ESTE 3GY8A 3OSYA 3ZZ6A 1QNJA 2UUYA 1DLKB 2FOAA 1Y3UA 1O2PA 5CHAC 3CENA 2GT7A 3I77A 1DWBH 4B76A 1D4PB 3LONA 2W3IA 1PPFE 5DP9A 5TJXA 1K1NA 2ZI2H 1DOJA 3T26A 2Z9JA 3KEEA 4KKDA 3BSQA 1BOQA 1XVOA 1ZPZA 1ELTA 1ESBA 1GJDB 3O8DA 1ANBA 2M5TA 1HIAB 2ULLA 1JOUB 1G3BA 2Z7FE 4TWYA 1ACBE 1TGNA 3LU9B 1GI4A 1C5RA 4BXWA 3S7KB 3UWIA 2NU1E 1ANEA 3TJOA 2LNCA 2J9NA 2WPHS 4K3JA 4ABFA 5IDKA 5EQSA 1S0QA 1WTGH 2BLQA 5DP6A 1SFQB 2ZCKP 1FNIA 3QWCH 4TPYA 3E6PH 3RC4A 4UFDH 1HAPH 4GCHF 1K1LA 1E34B 1C4V2 2FPZA 1DUAA 1TMBH 4KP0A 5JBAS 1DWEH 1NFUA 3E90B 1W11U 2BXTH 1P09A 1THPB 3V7TA 2AMPA 3H7TA 3RXEA 1SMFE 1A3EH 1OWDA 4YESB 1XM1A 3A84A 1RTLA 3G01A 3FP7E 4AN7A 5T6DA 4OS5A 4B2BA 1MKWK 4ZKOU 4NA8A 1UVPA 4CREA 2BVRH 1XXDA 1LHEH 3M36A 3RXQA 2B0FA 2A45B 1EQ9A 2ZDLA 1V2ST 4AFSA 2VIVA 1MD7A 4VGCB 1UK4A 2A1DB 2BDGA 3GY3A 1FN6A 3ZZ4A 3QUMP 1NRRH 1SQOA 3PMHB 4CRGA 1TA6A 2C4FH 3SGBE 1UVOA 2EI8A 2FLRH 1KTSB 4UFFH 1QURH 4GHQA 3KCGH 1PFXC 2BD4A 1BHXB 2J95A 1O0DH 1OWIA 2BOKA 3SNBA 3D23A 1AE5A 4ZKNU 4NIXA 2ZEBA 1O3GA 4D9QA 3A88A 3MFJA 3C27B 2F9NA 4KTSA 2BZ6H 4BAKB 1EB1H 1OX1A 2PGBB 1UVUH 3Q3KA 1O30A 3RLWH 2AMDA 1AFQC 1S82A 1EJAA 2BY6X 2G81E 4KGAA 1C1OA 2FESH 1FPHH 2XCFA 1HFDA 4GUXA 1VCQA 1TRYA 1O2YA 3RXDA 1O2TA 3SJKA 1D3DB 3V13A 4AGKA 1SHYA 4M7GA 2AIQA 2ZFSA 3LDXH 3PO1C 4BTIB 4YO9A 1GBDA 3BTFE 1QJ6B 1O38A 1QL8A 1QJ1B 4ZHMU 3AVZA 3CS0A 6GCHF 2V6NA 3M7UA 2GZ8A 2ZQ1A 4AOQA 3EQ0H 2BD9A 1C1RA 1S84A 1SOZA 4RKOB 3SUFA 2P94A 4KTUA 5EQRA 1FAXA 1TYNA 1PPBH 8GCHG 3ODDA 3GCOA 2AGEX 1UJ1A 3V3MA 7GCHF 3JZ2B 2TGTA 4D9RA 3ELAH 4HI3A 1C2LA 1C2MA 1NZQH 4LZ4B 1O35A 4BAQB 3SUGA 3ZVCA 1LQEA 1O2OA 3VXFH 1OKXA 1AHTH 3LOXA 2O8WA 5C1UA 4ZHAA 4UFEH 3B8JA 3BTTE 2OC8A 3IWMA 3NXPA 1FQ3A 3SZNA 3ZZ7A 1ZJKA 1SGQE 1C1VH 3TGIE 5FHTA 1Z8RA 1IQMA 4NCYA 1AFQB 2G51A 4GHTA 3L6PA 5AFZH 4CRDA 3TVJB 1HAYB 4A92A 1XUFA 1ELEE 2FX4A 5E8EH 4UFGH 1GI9B 2C90B 3LT3A 5DP4A 1QGFA 2R3YA 1IQHA 3QTOH 1XUKA 3SUDA 2BD2A 2R2MB 4JCNA 1ELFA 2H6MA 1UMAH 2QA9E 1JIMA 3MO6A 3A81A 3P8GA 2ZDAH 3MHWU 4J2YB 4DURA 4Y8ZA 1EZQA 3SW2B 2HWLB 4TWWA 2ANKH 2SGEE 3VPKA 4A7IB 2FYRA 3ZV9A 3K6ZA 1CA0C 3BG4C 1BUIA 1EAWA 1H9HE 4RSPA 1HXEH 1SOTA 4BTUB 3DFJA 1AUTC 1SLUB 2VGCC 1H1BA 2Z9GA 1MMJN 1YC0A 2CF8H 1UK2A 1Z7KA 1HNEE 4TY6A 2GKVE 1GJCB 2FP7B 2AEIH 1GI0A 2VINA 3NPSA 2P95A 1XUGA 1YPKH 1AGJA 2PSXA 2Z3CA 4B2CA 4YT7H 1ZJDA 3BTDE 3TK9A 1MTWA 2A4OA 1RIWC 1IHTH 4D7GA 2CJIA 1E35B 4CRBA 1C5WB 3P70B 4WXVA 2OXSA 2ANMH 1P05A 3H7OA 3MH6A 4Q7XA 4OGXA 1C2GA 1CHOF 4E7RG 3SBKA 5F6MA 1BHXF 4XDEA 1KY9A 1O3KA 2PSYA 2VIPA 1TGSZ 1ARBA 2GCTC 3GICB 3RM0H 4ZXYH 1HYLA 3HKIB 5J4SA 2C8ZB 1RFNA 1BMMH 4MG3A 1C1QA 3Q76A 4CHAC 2VVVA 2GTBA 6LPRA 2FOHA 3LGUA 5EODA 1D9IA 4IC6A 1NESE 5ABWA 4IS5A 1UK3A 1C5ZB 1SGYE 2Y80A 4IMZA 3DA9B 3DD2H 4PROA 1GI8B 2A5IA 1A1RA 2ZA5A 1O3MA 1MTVA 2NU4E 3GCHB 4ZXXH 3MNCA 2ZU2A 2ZTZA 1L2EA 1PYTD 1KXDA 1TGCA 2ZF0H 1Q2WA 2PTNA 1OPHB 3TU7H 3LKWA 3HGNA 3RXKA 1J16A 1HDTH 3SO3A 1EZXC 3T2NA 2ZHEH 4CR5A 2CN0H 2D26C 1YCPK 1EX3A 2FTMA 1ABIH 2J38A 2A32A 2OLGA 3RDZA 2Z94A 3ZVAA 3SV6A 1B0EA 2VWMA 1VJ9U 4AG1A 1TBZH 4X1QU 5GJ4B 1SG8B 1HRTH 1GJ6A 2YNBA 1GJBB 2VU8E 1O3DA 1TMTH 2J92A 3SUEA 4TY7A 2ZPQA 1N8OC 5EOKA 5LPEA 1VZQH 1ZGIA 2BX4A 3JZ1B 4Y8XA 3ZVEA 3BEIB 3F1SB 1QHRB 4OS1A 3RMMH 3RC5A 3A7TA 3ZVFA 2ZKSA 1OXGA 1LTOA 1AWFH 2OP9A 1ZSLA 2A5AA 2Z3EA 1AB9B 4B75A 1C5UA 1Q3XA 3F9EA 1C2EA 2V0BA 2ZU4A 1O37A 3P17H 1HCGA 4BTTB 1ORFA 2A7CA 5GCHG 1UTLM 2WYJA 1IQFA 2BYAX 1K28D 2O8UA 1JWTA 1BMAA 4HFPB 1C1SA 3GISB 4I8LA 4MPWA 1YPMH 1QCPA 1BMNH 4YTAA 3KIDU 2C3SA 5E0JA 2PUQH 1GG6C 5BRRE 2P8OC 3OU0A 4HTCH 4ABGA 1TMUH 3SNEA 4DY7B 1GGDB 2FS9A 2A5KA 3MWIU 2F9PA 5DK1A 4OS6A 3F9GA 4WXIA 3KQCA 2ZTXA 4U30A 1AIXH 1WCZA 2RA0A 2STBE 2BD3A 1O3FA 1BTWA 1TNIA 2PKAA 3MU4A 3PLPA 1SQTA 2P3TB 2ZDVH 4Q7YA 1C1UH 1DVAH 1GMCG 1W7XH 1DICA 2FZZA 2HVXA 3STJA 1T31A 1N6XA 4THNH 2FOFA 2W26A 5EU8A 2HGTH 1A4WH 1NPMA 2AIPA 1SL3A 1EZUC 1C5NH 4FVBA 2G4TA 5LGOA 4NG9H 2F91A 2BY8X 4UD9H 3SOSA 1S5SA 2Q6DA 1LVOA 2PKSC 4NIVA 1NN6A 2WV4A 2ZGJA 1BRAA 2OTVA 1W14U 3PV4A 1GMHF 1ZRKA 1DE7H 4Y7BA 2OD3B 1SHHB 3RXLA 2FYQA 1NO9H 1O2RA 3GY6A 4MNXA 3MMGA 2JETB 1N1LA 1C2DA 2R9PA 2IPHA 1T8NA 2A7HA 4FUIA 2GMTC 4FUGA 1MZDA 1UTPA 1AZZA 2W7SA 1GJAB 3RXFA 2ZU5A 1O5EH 3PROA 1HAOH 3TNSA 1BTHH 2P3FH 4IBLH 1OP8A 1VR1H 1UTKA 1PYTC 1EP6A 2NU0E 4FUCA 5HYOA 2VWLA 2CGAA 4B2AA 1YGCH 2IJOB 2H9TH 4X2VA 2BB4A 1MU6B 4CH8B 1C5OH 3RXRA 3GY4A 3ZVBA 1C4U2 4INLA 4JZEH 1Z1JA 3BIUH 3M5NA 2BMGB 5A8XA 4MQAA 3V0XA 1CT0E 1LVBA 3KN2A 1DLEA 1QQUA 2QF3A 5FBIA 1AUJA 4H6SB 1QR3E 2WPKS 4XOJA 5AVDA 2BX3A 5L30H 1G30B 1V2KT 3RP2A 2XYAA 1INCA 3U9AH 4U01A 1P2QA 1HAXB 3PM3A 5E2OA 4ZAEA 4O97A 1G9IE 2AGGX 5HM2A 1YP9A 3RXVA 3O8CA 2GCHF 4X0WU 1S85A 2QXHA 2ODYB 2ZFQH 4FXGH 2H9HA 3ATKA 1MCTA 1CO7E 2XC5A 2H5CA 1P9SA 3R3GB 4E05H 2AMQA 1HAIH 1ZR0A 1ZMLA 1P3CA 1NM6A 1TNJA 4X1PU 1ETTH 1GCDA 3E91A 2QXJA 1D3PB 1NRPH 4Q7ZA 1KYNA 5LH8A 4SGAE 1GMCF 5AF9H 1LMWB 1GI2A 3S69A 1UCYH 1QBVH 3QK1A 3VB3A 4ABBA 3SV8A 1F5LA 1GBMA 1S83A 1WOFA 1P02A 2ZPRA 1HB0B 3FZDA 1CE5A 3MU5A 5DGJA 5JBBS 1HAZB 1GWAA 3TH3H 3M5LA 1MU8B 1P8VC 1DWCH 2CXVA 3NK8A 3A8AA 1G2LA 2QN5T 2IN2A 1SLXB 1ANDA 2OQ5A 5GDSH 1GHYH 2B8OH 1FI8A 3SNCA 1FDPA 2BQ7B 4DCDA 3BIVH 2ZHDA 4IN1A 4D7FA 4I31A 3T5FH 2AERH 3M35A 1LHFH 1PJPA 3B9FH 1P11E 2F9OA 4VGCC 3SU1A 3ZZBA 1NRNH 3A89A 4O03A 2AFQB 1A3BH 1S0RA 3CP7A 1UCYE 4GSOA 1SGIB 1O3HA 2VH0A 1V6DA 1EOJA 2OINA 2GD4B 3TIUA 3MI4A 1DDJA 4MPUA 1RJXB 2ZCHP 1UVSH 5GPIB 5FXLA 1BA8B 1ETRH 2FEQH 1FN8A 2BDHA 1GHBF 1THRH 1EKBB 1AY6H 2WPMS 5EXLA 3SGAE 4BANB 4Y6DA 1UTQA 1K1PA 3IG6B 4CR9A 1C5TA 1AWHB 3SJ9A 1RD3B 1EZSC 1DXPA 3E8LA 3I29A 2FI4E 3LGIA 5C1XA 4GLYA 3QX5H 2VH6A 3LH3A 2CHAB 4NZQA 2BY5X 5JB9S 2GZ9A 1BRUP 1WAYB 1MTNB 5AHGH 1AO5A 1C2KA 3URCA 2Y81A 3QLPH 3RXGA 2ZFPH 5B6OA 2FS8A 3Q77A 5ESTE 2ZP0H 1CGIE 3M3TA 4LOYH 2ZDKA 1IQJA 1BTPA 1C1TA 1GBEA 3TJNA 2BY7X 4MNWA 4NA9H 1A5GH 2ZECA 3B23B 4XBDA 5JPMH 3SGQE 5HM9A 2Y5GA 2W3KA 3SV2H 1ELBA 1IHSH 3T28A 2GT8A 2AYWA 2OC1A 4NSVA 1GVLA 1O5DH 1P2JA 1O3PB 2QCYA 5JYIA 2NU3E 1CQQA 1UO6A 4ASHA 2TIOA 3ITIA 4HGCA 2FLBH 2QXIA 1QJ7B 1TAWA 1EP5A 2CMYA 4WMEA 1AN1E 1QY6A 1YCPH 4B73A 1ZMNA 5A2MH 1YLCA 1Z1IA 4K1EA 1QRXA 1T4UH 4H6TA 4AFQA 1W3CA 3VEQB 4ZKRU 3U1IB 1CHGA 4IGDA 1SGFG 1G2MA 3HK3B 3SHCH 1O2QA 1J17T 4DIHH 1Y59T 1P9UA 2W5EA 1TBQH
chains in the Genus database with same CATH superfamily
1ZPCA 5EW2H 4FUDA 1KXEA 2Y6TA 2BOHB 4AG2A 2Y5HA 3BEFB 2KAIB 3EYDA 1YM0A 2GP9B 2UUJB 3W95A 1PPCE 3TPIZ 2XRCA 3ZZ8A 1GDUA 3NZIA 1FJSA 1S6HA 4YM9A 3OTPA 2JH5D 4CBOA 1C9TA 2V3HH 2WPLS 2ZPSA 4OM9A 4Y79A 1OWJA 5DG6A 1F92A 1WU1A 2SGAA 4TPIZ 3SJ8A 2OC0A 3ZZ9A 1HGTH 1BJUA 4AFZA 1BMLA 2C8WB 3T25A 1A2CH 3F6UH 5HIZA 1MBMA 4BNRA 1BQYA 3F9HA 1IQIA 1QA0A 1SB1H 3FZZA 2FOGA 1Y5UT 4WH6A 1TBRH 2EI7A 1EAUA 4TYDA 1GHAG 3UR6A 3ZZDA 1UCYK 3A86A 3GDVA 1D3TB 5F8ZA 3BTHE 1YPGH 1WUNH 2ODPA 2KAIA 2V3MA 3E1XB 1FY8E 2HALA 2VWOA 1LHCH 4MVNA 1RGQA 1PPGE 5C5OA 3RM2H 1EPTB 1RTFB 2BVSH 2FOEA 2EEKA 1TONA 4K8YA 1QRZA 3T62A 1O2GH 3ZZAA 1H9IE 3Q00A 2R0LA 2UUKB 1KSNA 1RTKA 1VCWA 1YCPM 3KQDA 5ETXA 1C1PA 3EA9A 1YBWA 2OBOA 1BTXA 2QE7D 1F2SE 5FCRA 1B7XB 3EDXB 4YOJA 2ZQ2A 1BZXE 1RS0A 2ZZUH 1QA7A 1SGTA 2QF0A 2P59A 1Z6EA 3BN9A 2YNAA 3LC5A 4X6MA 3WWBA 2STAE 3M7TA 1Z8JB 1WTHD 3F0OA 3GCHC 1W13U 2YMSD 1C4Y2 2GZ7A 1O5AB 1DM4B 1EPTA 3GOVB 1KDQB 3U28C 1HJ9A 1LHDH 2JH0D 2EI6A 1HAVB 1BJVA 3GYMA 3D62A 1GDNA 3EA8A 3RXBA 1K21H 1BDAA 3UREA 4GVUA 2ZNKH 5A09A 2ANWA 1QBNA 2XBVA 1GDQA 4AGJA 2ILNA 2VWNA 2F9VA 2SFAA 4FVDA 1SLVB 2DE8A 2BVXH 1AVGH 4DGJA 1YPJH 3ZZ3A 4H42U 4LZ1H 4K60A 1NROH 1AZ8A 3LGYA 1MAYA 3LPRA 4DOQA 1KDQA 1NFWA 1FIWA 1P2NA 1XKBC 1W10U 4NSYA 3HPTB 1HAVA 2D8WA 1K1JA 1Z8IB 2C93B 2WYGA 5E2PA 1UW7A 1AB9C 1C5QA 5DKMA 1W7GH 5JDUB 3GDSA 2QF4A 3P95A 4FUJA 5EW1H 3O8BA 4DW2U 3RMLH 2WPDD 1FV9A 4CBNA 3DFLA 5EG4A 1PQ8A 2R0KA 1ESAA 2GDEH 1NC6A 2TGPZ 3Q3YA 4Y10E 8GCHF 2SGDE 1C5PA 2KCPA 2SGPE 1XX9A 4AX9H 1GGDC 1UTNA 1OOKB 2ASUB 3VB5A 2QGRA 5KEDA 4RI0A 1L1JA 1G3DA 5ESBA 4A1VA 4K1SA 3EAJA 3SV7A 2PWXA 5DP8A 5EJZA 1FXYA 2ZGHA 2D1JA 1T8OA 3HGPA 1UVTH 1SGDE 1TWXB 1KLJH 4Y7AA 5SGAE 1NRSH 4ISLA 2FOCA 1TA2A 1BBRE 1GHWH 3RU4E 1PPHE 1HAGE 3UIRA 1ESTA 3SU2A 2BXUH 1K1MA 2ZWLH 4AZ2B 3MU8A 3TLOA 5DP3A 1Y5AT 2FMJA 1KXFA 1C5VA 1P3EA 1MUEB 5DP7A 1BIOA 2FWWA 4HZHA 4JYUH 2XNIA 1T8MA 1JRTA 1OS8A 3LC3A 1Y3WA 2FDAA 4RT1A 1GL1A 1T32A 3K6YA 1A0JA 2EC9H 3IITA 8ESTE 2O8LA 2UWLA 5FAHA 1V3XA 4YLUA 3ZVDA 1OSSA 2FX6A 1GJ4H 3AW0A 1FY5A 1V2WT 5EPNA 1E38B 1LKBA 2PKAB 3A7VA 4FU9A 2AS9A 1KLTA 5DP5A 2A2XH 1CBWB 2PV9B 1A46H 3A7ZA 1SLWB 4ZMAH 3AASA 5JBTA 2WINI 1L4ZA 2A4QA 2K1QA 1ZLRA 1L1GA 2JETC 2BZAA 5K0HA 2YOLA 2VJ1A 1J9CH 3CS7A 4GPGA 5H4IB 2BLOA 3LJOA 3PWCA 5GNDA 1V2QT 4Q2KA 3ESTA 4ABDA 2G55A 3A7YA 1W12U 3A8BA 2G5VA 2YMSC 1FX0B 1TABE 1H8ED 2QF5A 2OK5A 1WQSA 1GBTA 2F9BH 1UTOA 3OE7D 4NIYA 4ABAA 1ZTKA 4I8GA 3Q3XA 3DHKH 1CGJE 2THFB 2G00A 4O3TA 4ISNA 1FAKH 1S6FA 3SU5A 4B6EA 4U2WA 1HXFH 1OYTH 2Q1JA 5JB8S 2ZCLP 3BF6H 1TQ0B 4JYTA 3KF2A 4Y76A 1QB6A 1IQGA 1YLNA 1P2IA 1QQ4A 5LPRA 1O2KA 2FM2A 1QFKH 3HATH 4NGAH 1LDTT 5EJLA 3SNAA 3FFGA 1DFPA 1O34A 1O3JA 1L4DA 1OP2A 1UHBB 2A4GA 1OHHD 5EXNA 1EAXA 2DE9A 1C2HA 5FCKA 1Z71A 2BDIA 4AC9A 1ETSH 1ZHMA 4RN6A 7ESTE 1CU1A 1XUHA 4XFQA 3RXAA 1IAUA 1PQAA 4Y71A 2SGFE 4SGBE 1HV7A 3LGVA 1QB9A 3SQEE 1O31A 3HKJB 3A83A 3OX7U 2FXRA 1J8AA 2O9QA 5C0TA 4X2YA 1BRBE 1VGCC 5A0CA 1A0LA 4BAMB 4Y0YE 1LKAA 4XSKU 3BV9B 1A0HB 1DUEA 3QGNB 3PMJA 4X8TH 5C2ZA 1GI3A 1E79D 2XW9A 3TJVA 2VB0A 3RXCA 3MU0A 1HLTH 1UHBA 3PYHA 4F4OC 1EB2A 1VITG 3LH1A 1AKSB 5C67A 1MTSA 2F83A 1KTTB 3UR9A 1O39A 1C5LH 3T27A 1MKXH 1T8LA 1GHZA 5IK2D 1YYY1 3TGJE 1GJ7B 3PB1E 1K1IA 5G4BA 2HNTF 2UUFB 3UWJH 3VGCB 1LVMA 4MNVA 1BTYA 1OYQA 2BD5A 4JZ1A 5E0HA 3DSOA 1P03A 3RXMA 4NFEA 1TALA 3F2HA 1TOMH 4WJG2 4FUBA 1KXBA 1BTUA 4MPVA 2JH6D 2GVFA 4X1NU 2F43B 3M3VA 5A0AE 3SU6A 1CVWH 5HKKD 1ZTLA 1P10A 1ZSJA 3SU3A 4CRCA 2ALVA 3GY5A 4FETA 2PR3A 5J4QA 1GBAA 2F9UA 3DSGA 3S9AA 4K5ZA 4K8BA 5F03A 1AKSA 5GCHF 3MOCA 3MH4A 1FLEE 3U69H 6CHAB 1DPOA 5CMXH 3EE0B 4K1TA 1WQVH 1FY3A 1Y3YA 1JBUH 2HNTE 3QDZB 4ISOA 3FO8D 4ISHH 1ZHPA 3A87A 3KQ5A 3RU4T 3BEUA 2QXGA 1V2OT 2JDID 1U6QA 3M61U 4MLFB 1TGBA 1VGCB 3PLBA 2FIRH 3KGPA 1V2PT 3D65E 4I8KA 4GCHG 3UFAA 3UOPA 1O33A 4R0IA 4Z0KA 5AFYH 1DY8A 2GGVB 1HJAB 5PTPA 1TPPA 4Q80A 3GCTG 4AB9A 5C5NA 2AGIX 1ANCA 1TNGA 2P93A 3N7EA 1DWDH 3MNBA 1DANH 1O2VA 3MO9A 2BTCE 3QGJA 1SC8U 5DO4H 3TJUA 4RT0A 3SORA 1W0KD 2QAAA 1GJ5H 1GJ9B 1ZYOA 2CHAC 1QTFA 4NIWA 1WBGB 2HPPH 1AFEH 1MTNC 1OWEA 1K1OA 4A5TS 1ELCA 4IN2A 3SJIA 3MNXA 1GCTB 1KIGH 1O32A 4KELA 4X6OA 3M5MA 1JIRA 1DT2A 1YPEH 3FP6E 3ZV8A 4X8VH 1G36A 1OWHA 2OC7A 2VIDA 3N7OA 2WUCA 4ABEA 3OY6U 4ZH8A 4D76A 2Y82A 1GI6A 3AW1A 3KHVA 3FN8A 3BTGE 1AE8H 4IC5A 3KQEA 3U8RH 1LHGH 2B9LA 5L2YH 1SR5C 3UUZA 1TQ7B 5DPAA 5EQQA 4P00A 3L3TA 3M37A 2QV1A 1M9UA 3ATMA 3HK6B 4OS7A 3E3TA 1HPGA 3AAUA 1SGPE 1VITF 4I33A 1YPLH 1FMGA 4NWLA 3GDUA 2BM2A 2WZQA 3QZRA 4UE7H 3E16B 3W94A 3ZIAD 1L0ZA 1O2SA 1F5RA 1EOLA 3TK6A 3D49H 2ZGBH 2BDBA 4AYVB 5GXPA 1SI5H 3V12A 2BLWA 2PUXB 2BD7A 1LVYA 3MO3A 3PWBA 4X1SU 4FUFA 3GY7A 1SQAA 1GBKA 3T29A 2NWNA 1Y8TA 6GCHG 5B6LA 5FX6A 3KQBA 3R0FA 5F8XA 3TGKE 2H9EH 3GS9A 4NA7A 5EXMA 3S0NA 2XOKD 4JZDH 2XCNA 2ZIQH 3ODFA 1ZOMA 1V2JT 1F0TA 1C5SA 3ENSB 1O2ZA 7GCHG 3LGTA 5C20A 5EPYA 3RMNH 4JZFH 3BTEE 1G32B 1ZSKA 2WPIS 2LELA 1ZHRA 4Y11E 4R8TB 5GIBA 5DJ7A 1MAXA 4I32A 4ZUHA 1BCUH 1TRMA 1Z6JH 4BXSA 3RXTA 1C5MD 2ZHWH 2I6SA 4M9FA 4X6PA 1IQKA 3C1KA 1C9PA 2KCOA 1WDIA 2FTLE 1O2MA 3F2GA 1C2JA 2XBXA 3GYLB 3GCTF 5T3HA 3P92A 1HIAA 1MKXK 2TGAA 1EJMA 1FY1A 1CA8B 2WV5A 2XC4A 1NTPA 1XKAC 1RXPA 4YXWD 1O2JA 1G3EA 1MABB 3A80A 1K9OE 3VXEH 4LXBH 1W8BH 3SI3H 2GV6A 3TK5A 1HAHH 3K9XB 4JMYA 2BDYA 1GVKB 1O3AA 5CHAB 2P16A 2A0QB 2VBCA 1GVZA 2TPIZ 5FX5A 3E0NB 2XTTB 1DXWA 3NKKA 3UNRA 3K2UA 3QO6A 1EPTC 2BD8A 1HUTH 1F5KU 1YPHE 3MNSA 2W7UA 3MH5A 1MH0A 3UPEA 2C8XB 3PLKA 4ABJA 1GBFA 4Q4LA 4JK5A 2BDCA 5FL7D 5DN6D 4NZLA 1SGFA 3LGWA 2G52A 1BITA 1HJ8A 2FODA 2OCVB 1SPJA 1Z8GA 1BMFD 3ATWA 2P3UB 4IW4E 5TCAA 3RXHA 3LJJA 3FVFB 1S81A 2PFEA 2BQWB 3VB4A 3PTBA 1F0UA 3MYWA 1QRWA 2Z3DA 4CRAA 3SN8A 3GCNA 3P8FA 1GI1A 1CHOG 2ZGCA 2SNVA 2ZFRH 4WH8A 5BPEA 4B71A 5C94A 3O8RA 1LPKB 1W0ZU 4ISIH 1F7ZA 2KFWA 1B5GH 1F0RA 4D8NA 4DG4A 1TPOA 2V35A 1ZRBA 3ZVGA 1PQ7A 1THSH 3RMOH 3NWUA 1O5CB 1LO6A 4UONA 3KL6A 5TCCA 1C5YB 1ELGA 4WF8A 1QL7A 2J2UA 5L6NH 2O8MA 1QL9A 1DITH 1GBCA 3STIA 1TNHA 3U1JB 1WV7H 4WMFA 4FU7A 4Y0ZE 5FPYA 1C5XB 4XBBA 1ID5H 1K2I1 3MH7A 3RLYH 5FPSA 4Q63A 4OGYA 1G37A 2SNWA 5FBEA 5E0GA 1SGCA 3BTWE 4BAHB 2J97A 1DS2E 1P01A 3TH4H 1JRSA 1AMHA 2Z9IA 1TNKA 4CRFA 1KLIH 1BT7A 3S7HB 2Q6GA 2CF9H 5EIYA 3SI4H 2GDDA 1L1NA 1P2OA 2OQUA 1E36B 1GMDG 1D3QB 3RXIA 2PTCE 4E06H 2Z9KA 4INKA 1MD8A 1V2TT 2J4IA 3SHAH 1SGNE 2HOBA 2HNTC 4XBCA 3RUOA 1GI7B 1V2MT 8KME2 4BAOB 4ZROA 1GI5A 2QY0B 4X8SH 3OEHD 2HRVA 5EJ1A 3PTNA 1P12E 2WV9A 2VVCA 1MQ5A 3RXUA 1J14A 2FOMB 1ZZZA 1UTJA 2RCEA 3EGKH 1LPZB 3PO1B 2C8YB 1PQ5A 4NFFA 3SV9A 5C1YA 3F9FA 1Y3XA 1XUIA 2O8TA 2Z9LA 1O3IA 4UEHH 4ZKSU 3UAIC 1P06A 4ZHLU 2XBWA 1ARCA 2KCYA 1B0FA 2OUAA 5C17A 1TX8A 3GY2A 4A6LA 3WWFA 3RXPA 1T7CA 3BTME 2HVYB 4B6FA 4XE4A 1GBJA 2RFKC 3P8NA 2ZFFH 1EUFA 1X7AC 4UDWH 5A8YA 2ZU1A 2QC2A 4JYVH 1BBRH 1O2HA 3SJOA 2LPRA 2VIWA 1SGRE 1ZPBA 1WSSH 1SFIA 3KYGA 3UQVA 1EAIA 3RXOA 1CBWC 2V3OH 1FZZA 2FO9A 4MNYA 1TOCB 3U98H 4NWKA 3SU0A 4DVAU 1O5FH 1P04A 3DUXH 2ODQA 3F2FA 1NFXA 1O2LA 1CGHA 1A7SA 1GHAF 1NY22 1LPGB 1V2LT 2FI3E 5IYTA 1VCPA 3SNDA 1Y5BT 3F68H 4QT8C 2ZC9H 4BOHA 4FU8A 4XD7D 1V2UT 8LPRA 5T6FA 4AYYB 1FPCH 4ZCNA 1T4VH 2EQNA 1SKYE 1FIZA 2H2ZA 3EA7A 2BHGA 2Y7XA 3A8CA 5A8ZA 5L2ZH 1O5BB 1JMOH 3E0PB 1BB0B 3M3SA 3RC6A 1TX7A 1NRQH 3ZYEA 1EASA 1GMHG 2XXLA 2WPJS 2RDLA 1XMNB 1CA0B 1J15A 1LCYA 2JKHA 3BG4B 7KMEH 1QBOA 2QYIA 2W6JD 2BDAA 2VGCB 2TRMA 1QB1A 2ZGXH 2Q6FA 1N6YA 2OBQA 4A1TA 1H9LB 3P8OA 2FOBA 3QZQA 4O3UA 1P0SH 3NUMA 4Y8YA 4K69A 4AB8A 3M7QA 5GWZA 1TLDA 3UTUH 2ANYA 1RIWB 1GMDF 1BTZA 1JXPA 4Z6AH 2H1UA 1AVXA 1IQNA 2KR7A 4I8JA 1TPSA 4YZUA 1MQ6A 1XXFA 3VB7A 1VJAU 4U32A 1O2IA 1A5HA 5HXFA 3DCLA 2R3UA 1AD8H 1DY9A 3MU1A 4WY3A 2GCTB 4F48B 1V2VT 1W2KH 2B5TB 3BG8A 1A5IA 1GHVH 2GV7A 2B7DH 3S9BA 3I78A 1F0SA 4CHAB 1O3NA 2UWPA 4DT7B 1ZMJA 4WVPE 4LK4A 3QN7A 1IQEA 1DX5M 1E37B 1O2WA 2ZG0H 3VGCC 7LPRA 1Y3VA 4H4FA 1E0FD 5FPTA 2H5DA 3U8OH 1KMHB 3OTJE 1NS3A 1AI8H 1K22H 2F3CE 2GCHG 2M2AA 4KTCA 1E1QD 4WWYA 3A8DA 6ESTA 2ZFTA 1ABJH 1UTMA 4JK6A 4MTBA 2I6QA 4B1TA 4X6NA 3FAOA 1FY4A 4TT3D 2BY9X 1YPHC 5HMAA 3ZYDA 5C3NA 2J34A 2G4UA 2VNTA 1TRNA 3MTYA 1RRKA 2XNDD 5EGMA 1C2FA 1TNLA 1FONA 1PPEE 4JZIA 1ELVA 2K8IA 1CSOE 6CHAC 2PW8H 2WUBA 1P2MA 4YOGA 3URDA 1C2IA 3OEED 3H09A 1FUJA 2FI5E 4K2YA 1NT1A 4DJZB 3ZZCA 1ZTJA 1N8OB 5I46H 4X1RU 3WY8A 1PPZA 1C1NA 1ZGVA 4AORA 3QTVH 4ABHA 4A1XA 4E7NA 5CE1A 1P57B 3UOUA 2EA3A 2D2DA 3A82A 1TB6H 1OP0A 1EXFA 1SBWA 1TGTA 1HJAC 3ZZ5A 3A7WA 2XBYA 4FUEA 2VIQA 1SVPA 3RU4D 2HPQH 5HGGA 3BTKE 2XC0A 1C1WH 1H4WA 1AU8A 2WHXA 2VVUA 4OS2A 1TIOA 4YOIA 1SQRA 1MCVA 2Z6BD 3NCLA 1O2NA 1IQLA 2JIZD 4FOUC 3A85A 3FP8E 2ALPA 2ZDMA 3ATIA 1DSTA 2GX4A 2ZHFH 1LQDB 1D6RA 1MKWH 2XWAA 1O5GH 4MDSA 2NU2E 1GG6B 1NFYA 3NRLA 2P8OB 1D6WA 1EJNA 1NU9A 1BBRK 2R2WU 3P6ZB 2QIQA 1AVWA 1A61H 1YF4A 2VIOA 3FANA 1GCTC 3KNXA 1DSUA 2A7JA 4FUHA 2UWOA 1YLDA 1XUJA 4I7YH 2ZO3H 1O3OA 1OWKA 4J1YA 5JBCS 1HBTH 1YKTA 4B74A 2CV3A 1AQ7A 1ELAA 1SGEE 1TFXA 2SGQE 3N7DA 1W0YH 1EATA 1GHBG 1GL0E 2XWBI 3UNQA 3OYPA 1V2RT 1MTUA 1V2NT 2TGDA 2ESTE 4X2WA 5K7RA 5I25A 2A4RA 5A0BA 5LPFA 1QZ8A 3ATLA 1KXAA 4I8HA 1CT4E 1SSXA 1GHXH 3SU4A 4RKJB 2W6ID 5KECA 1C1MA 1TE0A 1GPZA 2BLVA 9LPRA 3VFEA 1O3BA 1GBLA 1ELDE 4INHA 1O3CA 4YLQH 2RA3A 1CT2E 3K65B 4GAWA 2PHBA 2A2QH 3AAVA 2RG3A 3LIWA 4F49A 1GJ8B 2PKSB 2TBSA 1O36A 2ZU3A 4O9VA 4X2XA 2ZHQH 4YT6H 1O3LA 3PMBB 1KXCA 2Y5FA 2IOTA 2AH4X 1XVMA 1Q31A 3VB6A 1MZAA 3OY5U 3KYFA 3DT0H 4WMDA 3TITA 2GMTB 2DUCA 3TNTA 1GBHA 3CNRA 1BRCE 5T6GA 4X8UH 3RXSA 3RXJA 3A7XA 1MBQA 3UQOA 4CH2B 2A31A 4DIIH 3BTQE 2G8TA 2ZTYA 3S9CA 2PGQB 2HLCA 1TPAE 5C0UA 4ABIA 1O2XA 2J94A 3L33A 1G3CA 1GBBA 9ESTA 2JJ1D 1VITH 1O3EA 3UY9A 1IOEA 3SQHE 3PMAB 1O2UA 1TX6A 1P2KA 4OS4A 3M5OA 2BQ6B 1WYKA 1H8IH 1H8DH 2ZDNA 2PLXA 4AFUA 1S6LA 1NU7B 5F8TA 4IMQA 1QIXB 3TH2H 3UNSA 4MPXA 3U8TH 1GBIA 3H5CB 2G5NA 2Y7ZA 4ESTE 3GY8A 3OSYA 3ZZ6A 1QNJA 2UUYA 1DLKB 2FOAA 3PRDA 1Y3UA 1O2PA 5CHAC 3CENA 2GT7A 3I77A 1DWBH 4B76A 2KM0A 1D4PB 3LONA 2W3IA 1PPFE 5DP9A 5TJXA 1K1NA 2ZI2H 1DOJA 3T26A 2Z9JA 3KEEA 4KKDA 3BSQA 1BOQA 1XVOA 1ZPZA 1ELTA 1ESBA 1GJDB 3O8DA 1ANBA 2M5TA 1HIAB 2ULLA 1JOUB 1G3BA 2Z7FE 4TWYA 1ACBE 1TGNA 2J98B 3LU9B 3WW7A 1GI4A 1C5RA 4BXWA 3S7KB 3UWIA 2NU1E 1ANEA 3TJOA 2LNCA 2J9NA 2WPHS 4K3JA 4ABFA 5IDKA 5EQSA 1S0QA 1YY3A 1WTGH 2BLQA 5DP6A 1SFQB 2ZCKP 1FNIA 3QWCH 4TPYA 3E6PH 3RC4A 2EY4C 4UFDH 1HAPH 4GCHF 1K1LA 1E34B 1C4V2 2FPZA 1DUAA 1TMBH 4KP0A 5JBAS 1DWEH 1NFUA 3E90B 1W11U 2BXTH 1P09A 1H8HD 1THPB 3V7TA 2AMPA 3H7TA 3RXEA 1SMFE 1A3EH 3W1EA 1OWDA 4YESB 1XM1A 3A84A 1RTLA 3G01A 3FP7E 4AN7A 2J98A 5T6DA 4OS5A 4B2BA 1MKWK 4ZKOU 4NA8A 1UVPA 4CREA 2BVRH 1XXDA 1LHEH 3M36A 3RXQA 2B0FA 2A45B 1EQ9A 2ZDLA 1V2ST 4AFSA 2VIVA 1MD7A 4VGCB 1UK4A 2A1DB 2BDGA 3GY3A 1FN6A 3ZZ4A 3QUMP 1NRRH 1SQOA 3PMHB 4CRGA 1TA6A 2C4FH 4TSFD 3SGBE 1UVOA 2EI8A 2FLRH 1KTSB 4XRNA 4UFFH 1QURH 4GHQA 3KCGH 1PFXC 2BD4A 3DSPA 1BHXB 2J95A 1O0DH 1OWIA 2BOKA 3SNBA 3D23A 1AE5A 4ZKNU 4NIXA 2ZEBA 1O3GA 4D9QA 3A88A 3MFJA 3C27B 2F9NA 4KTSA 2BZ6H 4BAKB 1EB1H 1OX1A 2PGBB 2HLDD 1UVUH 3Q3KA 1O30A 3RLWH 2AMDA 1AFQC 1S82A 2IJD1 1EJAA 2BY6X 2AHME 2G81E 4KGAA 1C1OA 2FESH 1FPHH 2XCFA 1HFDA 4GUXA 1VCQA 1TRYA 1O2YA 3RXDA 1O2TA 3SJKA 1D3DB 3V13A 4ACAA 4F55A 4AGKA 1SHYA 4M7GA 2AIQA 2ZFSA 3LDXH 3PO1C 4BTIB 4YO9A 1GBDA 3BTFE 1QJ6B 1O38A 1QL8A 2L74A 1QJ1B 4ZHMU 1E1RD 3AVZA 3CS0A 6GCHF 2V6NA 3M7UA 2GZ8A 2ZQ1A 4AOQA 3EQ0H 2BD9A 1C1RA 1S84A 4HG6A 1SOZA 1W0JD 4RKOB 3SUFA 2P94A 4KTUA 5EQRA 1FAXA 1VKYA 1TYNA 1PPBH 8GCHG 3ODDA 3GCOA 2AGEX 1UJ1A 3V3MA 7GCHF 3JZ2B 2TGTA 4D9RA 3ELAH 4HI3A 1C2LA 1C2MA 1NZQH 4LZ4B 1O35A 4BAQB 3SUGA 3ZVCA 1LQEA 1O2OA 3VXFH 1OKXA 1AHTH 3LOXA 2O8WA 5C1UA 4ZHAA 4UFEH 3B8JA 3BTTE 3PV2A 2OC8A 3IWMA 3NXPA 1FQ3A 3SZNA 3ZZ7A 1ZJKA 1SGQE 1C1VH 3TGIE 5FHTA 1Z8RA 1IQMA 5CHBA 4NCYA 1AFQB 2G51A 4GHTA 3L6PA 5AFZH 4CRDA 3TVJB 1HAYB 4A92A 1XUFA 1ELEE 2FX4A 5E8EH 4Z1MD 4UFGH 1GI9B 2C90B 3LT3A 5DP4A 2KZ4A 1QGFA 2R3YA 1IQHA 3QTOH 1XUKA 3SUDA 2BD2A 2R2MB 4JCNA 1ELFA 2H6MA 1UMAH 2QA9E 1JIMA 3MO6A 3A81A 3P8GA 2ZDAH 3MHWU 4J2YB 4DURA 4Y8ZA 3PRBA 1EZQA 3SW2B 2HWLB 3FKSD 4TWWA 2ANKH 2SGEE 3VPKA 4A7IB 2FYRA 3ZV9A 3K6ZA 1CA0C 3BG4C 1BUIA 1EAWA 1H9HE 4RSPA 1HXEH 1SOTA 4BTUB 3DFJA 1AUTC 1SLUB 2VGCC 1H1BA 2Z9GA 1MMJN 2CF8H 1YC0A 1UK2A 1Z7KA 1HNEE 2V7QD 4TY6A 2GKVE 1GJCB 2FP7B 2AEIH 1GI0A 2VINA 3NPSA 2P95A 1XUGA 1YPKH 1AGJA 2PSXA 2Z3CA 4B2CA 4YT7H 1ZJDA 3BTDE 3TK9A 1MTWA 2RDEA 2A4OA 3SZEA 4ACBA 1RIWC 1IHTH 4D7GA 3VG8A 3OAAD 2CJIA 1E35B 4CRBA 1C5WB 3P70B 4WXVA 2OXSA 2ANMH 1P05A 3H7OA 3OFND 3AK5A 3MH6A 4Q7XA 4OGXA 1C2GA 1CHOF 4E7RG 1WXRA 2KCAA 2WSSD 3SBKA 5F6MA 1BHXF 4XDEA 1KY9A 1O3KA 2PSYA 2VIPA 1TGSZ 1ARBA 2GCTC 3GICB 3RM0H 4ZXYH 1HYLA 3HKIB 5J4SA 2C8ZB 1RFNA 1BMMH 4MG3A 1C1QA 3Q76A 4CHAC 2VVVA 2GTBA 6LPRA 2FOHA 3LGUA 5EODA 1D9IA 4IC6A 1NESE 5ABWA 4IS5A 1UK3A 1C5ZB 1SGYE 2Y80A 4IMZA 3DA9B 4I86A 3DD2H 4PROA 2IPQX 1GI8B 2A5IA 1A1RA 4DT4A 2ZA5A 1O3MA 1MTVA 2NU4E 3GCHB 4ZXXH 3MNCA 2ZU2A 2ZTZA 1L2EA 1PYTD 1KXDA 1TGCA 2ZF0H 1Q2WA 2PTNA 1OPHB 3TU7H 3LKWA 3HGNA 3RXKA 1J16A 1HDTH 3SO3A 1EZXC 3T2NA 2ZHEH 4CR5A 2CN0H 2D26C 1YCPK 1EX3A 2FTMA 1ABIH 2J38A 2A32A 2OLGA 3RDZA 2Z94A 3ZVAA 3SV6A 1B0EA 2VWMA 1VJ9U 4AG1A 5HIYA 1TBZH 4X1QU 5GJ4B 1SG8B 1HRTH 1GJ6A 2YNBA 1GJBB 2VU8E 1O3DA 1TMTH 2J92A 3SUEA 4TY7A 2ZPQA 1N8OC 5EOKA 5LPEA 1VZQH 1ZGIA 2BX4A 3JZ1B 4Y8XA 3ZVEA 3BEIB 3F1SB 1QHRB 4OS1A 3RMMH 3RC5A 3A7TA 3ZVFA 2ZKSA 1OXGA 1LTOA 1AWFH 2OP9A 1ZSLA 2A5AA 2Z3EA 1AB9B 4B75A 1C5UA 1Q3XA 3F9EA 1C2EA 2V0BA 2ZU4A 1O37A 3P17H 1HCGA 4BTTB 1ORFA 2A7CA 5GCHG 1UTLM 2WYJA 1IQFA 2BYAX 1K28D 2O8UA 1JWTA 1BMAA 4HFPB 1C1SA 3GISB 4P02A 4I8LA 4MPWA 1YPMH 1NBME 1QCPA 1BMNH 4YTAA 3KIDU 2C3SA 5E0JA 2PUQH 1GG6C 5BRRE 2P8OC 3OU0A 4HTCH 4ABGA 2F4LA 1TMUH 3SNEA 4DY7B 1GGDB 2FS9A 2A5KA 3MWIU 2F9PA 5DK1A 4OS6A 3F9GA 4WXIA 3KQCA 2ZTXA 4U30A 1AIXH 1WCZA 2RA0A 2STBE 1K0HA 2BD3A 1O3FA 1BTWA 1TNIA 2PKAA 3MU4A 3PLPA 1SQTA 3SYJA 2P3TB 2ZDVH 4Q7YA 1C1UH 1DVAH 5CDFE 1GMCG 1W7XH 1DICA 2FZZA 2HVXA 3STJA 1T31A 1N6XA 4THNH 2FOFA 2W26A 5EU8A 2HGTH 1A4WH 1NPMA 2AIPA 1SL3A 1EZUC 1C5NH 4FVBA 2G4TA 5LGOA 4NG9H 5KGOA 2F91A 2BY8X 3EE7A 4UD9H 1YWUA 3SOSA 1S5SA 2Q6DA 1LVOA 2PKSC 4NIVA 1NN6A 2WV4A 2ZGJA 1BRAA 2OTVA 1W14U 3PV4A 1GMHF 1ZRKA 2GJGA 1DE7H 4Y7BA 3F0PA 2OD3B 1SHHB 3RXLA 2FYQA 1NO9H 1O2RA 3GY6A 4MNXA 3MMGA 2JETB 1N1LA 1C2DA 2R9PA 2IPHA 1T8NA 2PP6A 2A7HA 4FUIA 2GMTC 4FUGA 1MZDA 1UTPA 1AZZA 2W7SA 1GJAB 3RXFA 2ZU5A 1O5EH 3PROA 1HAOH 3TNSA 1BTHH 2P3FH 4IBLH 1OP8A 1VR1H 1UTKA 2YMSB 1PYTC 1EP6A 2NU0E 5F53A 4FUCA 5HYOA 2VWLA 2CGAA 4B2AA 1YGCH 2IJOB 2H9TH 4X2VA 3N99A 2BB4A 1MU6B 4CH8B 1C5OH 2K0QA 3RXRA 3GY4A 3ZVBA 1C4U2 4INLA 4JZEH 1Z1JA 3BIUH 3M5NA 2JJ2D 2BMGB 5A8XA 4MQAA 3V0XA 1CT0E 1LVBA 3KN2A 1DLEA 1QQUA 2QF3A 5FBIA 1AUJA 4H6SB 1QR3E 2WPKS 4XOJA 5AVDA 2BX3A 3F3BA 5L30H 1G30B 1NBMD 1V2KT 3RP2A 2XYAA 1INCA 3UB0A 3U9AH 4U01A 1P2QA 1HAXB 3PM3A 5E2OA 4ZAEA 4O97A 1G9IE 2AGGX 5HM2A 1YP9A 3RXVA 3O8CA 2GCHF 4X0WU 1S85A 2QXHA 2ODYB 2ZFQH 4FXGH 2H9HA 3ATKA 1MCTA 1CO7E 2XC5A 2H5CA 1P9SA 3R3GB 4E05H 2AMQA 1HAIH 1ZR0A 3FOAA 1ZMLA 1P3CA 1NM6A 1TNJA 4X1PU 1ETTH 1GCDA 3E91A 2QXJA 1D3PB 1NRPH 4Q7ZA 1KYNA 5LH8A 4SGAE 1GMCF 5AF9H 1LMWB 1GI2A 3S69A 4ASUD 1UCYH 1QBVH 3QK1A 3VB3A 4ABBA 3SV8A 1F5LA 1GBMA 1S83A 1WOFA 1P02A 2ZPRA 1HB0B 3FZDA 1CE5A 3MU5A 5DGJA 5JBBS 1HAZB 1GWAA 3TH3H 3M5LA 1MU8B 1P8VC 1DWCH 2CXVA 3NK8A 3A8AA 1G2LA 2QN5T 2IN2A 1SLXB 1ANDA 2OQ5A 5GDSH 2L6OA 1GHYH 2B8OH 1FI8A 3SNCA 1FDPA 2BQ7B 4DCDA 2J5UA 3BIVH 2ZHDA 4IN1A 4D7FA 5T1VA 4I31A 3T5FH 2AERH 3M35A 1LHFH 1PJPA 3B9FH 3PV5A 1P11E 2F9OA 4VGCC 3SU1A 3ZZBA 1NRNH 3A89A 4O03A 2AFQB 1A3BH 1S0RA 3CP7A 1UCYE 5DSFA 4GSOA 1SGIB 1O3HA 2VH0A 1V6DA 1EOJA 2OINA 2GD4B 3TIUA 3MI4A 1DDJA 4MPUA 1RJXB 2ZCHP 1UVSH 5GPIB 5FXLA 1BA8B 1ETRH 2FEQH 1FN8A 2BDHA 2KX4A 1GHBF 1THRH 1EKBB 1AY6H 2WPMS 5EXLA 3SGAE 4BANB 4Y6DA 1UTQA 1K1PA 3IG6B 4CR9A 1C5TA 1AWHB 3SJ9A 1RD3B 1EZSC 1DXPA 3E8LA 2LP6A 3I29A 2FI4E 3LGIA 5C1XA 4GLYA 3QX5H 2VH6A 3LH3A 2CHAB 4NZQA 2BY5X 5JB9S 2GZ9A 1BRUP 1WAYB 1MTNB 5AHGH 1AO5A 1C2KA 3URCA 2Y81A 3QLPH 3RXGA 2ZFPH 5B6OA 2FS8A 3Q77A 5ESTE 2ZP0H 1CGIE 3M3TA 4LOYH 2ZDKA 1IQJA 1BTPA 1C1TA 1GBEA 3TJNA 2BY7X 4MNWA 4NA9H 1A5GH 2ZECA 3B23B 1COWD 4XBDA 5JPMH 3SGQE 5HM9A 2Y5GA 2W3KA 3SV2H 1ELBA 1IHSH 3T28A 2GT8A 2AYWA 3MQKC 2OC1A 4NSVA 1GVLA 1O5DH 1P2JA 1O3PB 2QCYA 5JYIA 2NU3E 1EFRD 1CQQA 1UO6A 4ASHA 2TIOA 3ITIA 4HGCA 2FLBH 2QXIA 2CK3D 1QJ7B 1TAWA 1EP5A 2CMYA 4WMEA 1AN1E 1QY6A 1YCPH 4B73A 1ZMNA 5A2MH 1YLCA 1Z1IA 4K1EA 1QRXA 1T4UH 4H6TA 4AFQA 1W3CA 3VEQB 4ZKRU 3U1IB 1CHGA 4IGDA 1SGFG 1G2MA 3HK3B 3SHCH 1O2QA 1J17T 4DIHH 1Y59T 1P9UA 2W5EA 1TBQH
chains in the Genus database with same CATH topology
1ZPCA 5EW2H 4FUDA 1KXEA 2Y6TA 2BOHB 4AG2A 2Y5HA 3BEFB 2KAIB 3EYDA 1YM0A 2GP9B 2UUJB 3W95A 1PPCE 3TPIZ 2XRCA 3ZZ8A 1GDUA 3NZIA 1FJSA 1S6HA 4YM9A 2JH5D 4CBOA 1C9TA 2V3HH 2WPLS 2ZPSA 4Y79A 1OWJA 5DG6A 1F92A 1WU1A 2SGAA 4TPIZ 3SJ8A 2OC0A 3ZZ9A 1HGTH 1BJUA 4AFZA 1BMLA 2C8WB 3T25A 1A2CH 3F6UH 1MBMA 4BNRA 1BQYA 3F9HA 1IQIA 1QA0A 1SB1H 3FZZA 2FOGA 1Y5UT 4WH6A 1TBRH 2EI7A 1EAUA 4TYDA 1GHAG 3UR6A 3ZZDA 1UCYK 3A86A 3GDVA 1D3TB 5F8ZA 3BTHE 1YPGH 1WUNH 2ODPA 2KAIA 3E1XB 1FY8E 2HALA 2VWOA 1LHCH 4MVNA 1RGQA 1PPGE 5C5OA 3RM2H 1EPTB 1RTFB 2BVSH 2FOEA 2EEKA 1TONA 4K8YA 1QRZA 3T62A 1O2GH 3ZZAA 1H9IE 3Q00A 2R0LA 2UUKB 1KSNA 1RTKA 1VCWA 1YCPM 3KQDA 5ETXA 1C1PA 3EA9A 1YBWA 2OBOA 1BTXA 1F2SE 5FCRA 1B7XB 3EDXB 4YOJA 2ZQ2A 1BZXE 1RS0A 2ZZUH 1QA7A 1SGTA 2QF0A 2P59A 1Z6EA 3BN9A 2YNAA 3LC5A 4X6MA 2STAE 3M7TA 1Z8JB 1WTHD 3GCHC 1W13U 1C4Y2 2GZ7A 1O5AB 1DM4B 1EPTA 3GOVB 1KDQB 1HJ9A 1LHDH 2JH0D 2EI6A 1HAVB 1BJVA 3GYMA 3D62A 1GDNA 3EA8A 3RXBA 1K21H 1BDAA 3UREA 4GVUA 2ZNKH 5A09A 2ANWA 1QBNA 2XBVA 1GDQA 4AGJA 2ILNA 2VWNA 2F9VA 2SFAA 4FVDA 1SLVB 2DE8A 2BVXH 1AVGH 4DGJA 1YPJH 3ZZ3A 4H42U 4LZ1H 4K60A 1NROH 1AZ8A 3LGYA 1MAYA 3LPRA 4DOQA 1KDQA 1NFWA 1FIWA 1P2NA 1XKBC 1W10U 4NSYA 3HPTB 1HAVA 2D8WA 1K1JA 1Z8IB 2C93B 2WYGA 5E2PA 1AB9C 1C5QA 5DKMA 1W7GH 5JDUB 3GDSA 5EW1H 3P95A 4FUJA 3O8BA 4DW2U 3RMLH 1FV9A 4CBNA 3DFLA 5EG4A 1PQ8A 2R0KA 1ESAA 2GDEH 1NC6A 2TGPZ 3Q3YA 4Y10E 8GCHF 2SGDE 1C5PA 2SGPE 1XX9A 4AX9H 1GGDC 1UTNA 1OOKB 2ASUB 3VB5A 2QGRA 1L1JA 1G3DA 5ESBA 4A1VA 4K1SA 3EAJA 3SV7A 2PWXA 5DP8A 1FXYA 2ZGHA 2D1JA 1T8OA 3HGPA 1UVTH 1SGDE 1TWXB 1KLJH 4Y7AA 5SGAE 1NRSH 4ISLA 2FOCA 1TA2A 1BBRE 1GHWH 3RU4E 1PPHE 1HAGE 3UIRA 1ESTA 3SU2A 2BXUH 1K1MA 2ZWLH 4AZ2B 3MU8A 3TLOA 5DP3A 1Y5AT 2FMJA 1KXFA 1C5VA 1P3EA 1MUEB 5DP7A 1BIOA 2FWWA 4HZHA 4JYUH 2XNIA 1T8MA 1JRTA 1OS8A 3LC3A 1Y3WA 2FDAA 1GL1A 1T32A 3K6YA 1A0JA 2EC9H 3IITA 8ESTE 2O8LA 2UWLA 5FAHA 1V3XA 4YLUA 3ZVDA 1OSSA 2FX6A 1GJ4H 3AW0A 1FY5A 1V2WT 5EPNA 1E38B 2PKAB 1LKBA 3A7VA 4FU9A 2AS9A 1KLTA 5DP5A 2A2XH 1CBWB 2PV9B 1A46H 3A7ZA 1SLWB 4ZMAH 3AASA 5JBTA 2WINI 1L4ZA 2A4QA 2K1QA 1ZLRA 1L1GA 2JETC 2BZAA 5K0HA 2YOLA 2VJ1A 1J9CH 3CS7A 4GPGA 5H4IB 2BLOA 3LJOA 3PWCA 1V2QT 4Q2KA 3ESTA 4ABDA 2G55A 3A7YA 1W12U 3A8BA 2G5VA 1TABE 1WQSA 1GBTA 2F9BH 1UTOA 4NIYA 4ABAA 1ZTKA 4I8GA 3Q3XA 3DHKH 1CGJE 2THFB 2G00A 4O3TA 4ISNA 1FAKH 1S6FA 3SU5A 4U2WA 1HXFH 1OYTH 2Q1JA 5JB8S 2ZCLP 3BF6H 1TQ0B 4JYTA 3KF2A 4Y76A 1QB6A 1IQGA 1P2IA 1QQ4A 5LPRA 1O2KA 2FM2A 1QFKH 3HATH 4NGAH 1LDTT 3SNAA 3FFGA 1DFPA 1O34A 1O3JA 1L4DA 1OP2A 1UHBB 2A4GA 5EXNA 1EAXA 2DE9A 1C2HA 5FCKA 1Z71A 2BDIA 1ETSH 1ZHMA 4RN6A 7ESTE 1CU1A 1XUHA 4XFQA 3RXAA 1IAUA 1PQAA 4Y71A 2SGFE 4SGBE 1HV7A 3LGVA 1QB9A 3SQEE 1O31A 3HKJB 3A83A 3OX7U 2FXRA 1J8AA 2O9QA 4X2YA 1BRBE 1VGCC 5A0CA 1A0LA 4BAMB 4Y0YE 1LKAA 4XSKU 3BV9B 1A0HB 1DUEA 3QGNB 3PMJA 4X8TH 5C2ZA 1GI3A 2XW9A 3TJVA 2VB0A 3RXCA 3MU0A 1HLTH 1UHBA 3PYHA 4F4OC 1EB2A 1VITG 3LH1A 1AKSB 5C67A 1MTSA 2F83A 1KTTB 3UR9A 1O39A 1C5LH 3T27A 1MKXH 1T8LA 1GHZA 1YYY1 3TGJE 1GJ7B 3PB1E 1K1IA 5G4BA 2HNTF 2UUFB 3UWJH 3VGCB 1LVMA 4MNVA 1BTYA 1OYQA 2BD5A 4JZ1A 5E0HA 3RXMA 1P03A 4NFEA 1TALA 1TOMH 4WJG2 4FUBA 1KXBA 1BTUA 4MPVA 2JH6D 2GVFA 4X1NU 3M3VA 5A0AE 3SU6A 1CVWH 1ZTLA 1P10A 1ZSJA 3SU3A 4CRCA 2ALVA 3GY5A 2PR3A 5J4QA 1GBAA 2F9UA 3S9AA 4K5ZA 4K8BA 5F03A 1AKSA 5GCHF 3MOCA 3MH4A 1FLEE 3U69H 6CHAB 1DPOA 5CMXH 3EE0B 4K1TA 1WQVH 1FY3A 1Y3YA 1JBUH 2HNTE 3QDZB 4ISOA 4ISHH 1ZHPA 3A87A 3RU4T 3BEUA 2QXGA 1V2OT 1U6QA 3M61U 4MLFB 1TGBA 1VGCB 3PLBA 2FIRH 3KGPA 1V2PT 3D65E 4I8KA 4GCHG 3UFAA 3UOPA 1O33A 4R0IA 4Z0KA 5AFYH 1DY8A 2GGVB 1HJAB 5PTPA 1TPPA 4Q80A 3GCTG 4AB9A 5C5NA 2AGIX 1ANCA 1TNGA 2P93A 1DWDH 3MNBA 1DANH 1O2VA 3MO9A 2BTCE 3QGJA 1SC8U 5DO4H 3TJUA 3SORA 2QAAA 1GJ5H 1GJ9B 1ZYOA 2CHAC 1QTFA 4NIWA 1WBGB 2HPPH 1AFEH 1MTNC 1OWEA 1K1OA 4A5TS 1ELCA 4IN2A 3SJIA 3MNXA 1GCTB 1KIGH 1O32A 4KELA 4X6OA 3M5MA 1JIRA 1DT2A 1YPEH 3FP6E 3ZV8A 4X8VH 1G36A 1OWHA 2OC7A 2VIDA 3N7OA 2WUCA 4ABEA 3OY6U 4ZH8A 4D76A 2Y82A 1GI6A 3AW1A 3KHVA 3BTGE 1AE8H 4IC5A 3KQEA 3U8RH 1LHGH 2B9LA 5L2YH 1SR5C 3UUZA 1TQ7B 5DPAA 5EQQA 3L3TA 3M37A 2QV1A 1M9UA 3ATMA 3HK6B 4OS7A 3E3TA 1HPGA 3AAUA 1SGPE 1VITF 4I33A 1YPLH 1FMGA 4NWLA 3GDUA 2BM2A 4UE7H 3QZRA 3E16B 3W94A 1L0ZA 1O2SA 1F5RA 1EOLA 3TK6A 3D49H 2ZGBH 2BDBA 4AYVB 5GXPA 1SI5H 3V12A 2BLWA 2PUXB 2BD7A 1LVYA 3MO3A 3PWBA 4X1SU 4FUFA 3GY7A 1SQAA 1GBKA 3T29A 2NWNA 1Y8TA 6GCHG 5FX6A 3KQBA 3R0FA 5F8XA 3TGKE 2H9EH 4NA7A 5EXMA 3S0NA 4JZDH 2XCNA 2ZIQH 3ODFA 1ZOMA 1V2JT 1F0TA 1C5SA 3ENSB 1O2ZA 7GCHG 3LGTA 5C20A 5EPYA 3RMNH 4JZFH 3BTEE 1G32B 1ZSKA 2WPIS 1ZHRA 4Y11E 4R8TB 5GIBA 5DJ7A 1MAXA 4I32A 4ZUHA 1BCUH 1TRMA 1Z6JH 4BXSA 3RXTA 1C5MD 2ZHWH 2I6SA 4X6PA 1IQKA 3C1KA 1C9PA 2FTLE 1O2MA 1C2JA 2XBXA 3GYLB 3GCTF 5T3HA 3P92A 1HIAA 1MKXK 2TGAA 1EJMA 1FY1A 1CA8B 2WV5A 2XC4A 1NTPA 1XKAC 1RXPA 1O2JA 1G3EA 3A80A 1K9OE 3VXEH 4LXBH 1W8BH 3SI3H 2GV6A 3TK5A 1HAHH 3K9XB 4JMYA 2BDYA 1GVKB 1O3AA 5CHAB 2P16A 2A0QB 1GVZA 2TPIZ 5FX5A 3E0NB 2XTTB 1DXWA 3NKKA 3UNRA 3K2UA 3QO6A 1EPTC 2BD8A 1HUTH 1F5KU 1YPHE 3MNSA 2W7UA 3MH5A 1MH0A 3UPEA 2C8XB 3PLKA 4ABJA 1GBFA 4JK5A 2BDCA 4NZLA 1SGFA 3LGWA 2G52A 1BITA 1HJ8A 2FODA 2OCVB 1SPJA 1Z8GA 3ATWA 2P3UB 4IW4E 5TCAA 3RXHA 3LJJA 3FVFB 1S81A 2PFEA 2BQWB 3VB4A 3PTBA 1F0UA 3MYWA 1QRWA 2Z3DA 4CRAA 3SN8A 3GCNA 3P8FA 1GI1A 1CHOG 2ZGCA 2SNVA 2ZFRH 4WH8A 5BPEA 4B71A 3O8RA 1LPKB 1W0ZU 4ISIH 1F7ZA 1B5GH 1F0RA 4D8NA 4DG4A 1TPOA 2V35A 1ZRBA 3ZVGA 1PQ7A 1THSH 3RMOH 3NWUA 1O5CB 1LO6A 4UONA 3KL6A 5TCCA 1C5YB 1ELGA 4WF8A 1QL7A 2J2UA 5L6NH 2O8MA 1QL9A 1DITH 1GBCA 3STIA 1TNHA 3U1JB 1WV7H 4WMFA 4FU7A 4Y0ZE 5FPYA 1C5XB 4XBBA 1ID5H 1K2I1 3MH7A 3RLYH 5FPSA 4OGYA 1G37A 2SNWA 5FBEA 5E0GA 1SGCA 3BTWE 4BAHB 1DS2E 1P01A 3TH4H 1JRSA 1AMHA 2Z9IA 1TNKA 4CRFA 1KLIH 1BT7A 3S7HB 2Q6GA 2CF9H 3SI4H 2GDDA 1L1NA 1P2OA 2OQUA 1E36B 1GMDG 1D3QB 3RXIA 2PTCE 4E06H 2Z9KA 4INKA 1MD8A 1V2TT 2J4IA 3SHAH 1SGNE 2HOBA 2HNTC 4XBCA 3RUOA 1GI7B 1V2MT 8KME2 4BAOB 4ZROA 1GI5A 2QY0B 4X8SH 2HRVA 3PTNA 1P12E 2VVCA 1MQ5A 3RXUA 1J14A 2FOMB 1ZZZA 1UTJA 2RCEA 3EGKH 1LPZB 3PO1B 2C8YB 1PQ5A 4NFFA 3SV9A 5C1YA 3F9FA 1Y3XA 1XUIA 2O8TA 2Z9LA 1O3IA 4UEHH 4ZKSU 1P06A 4ZHLU 2XBWA 1ARCA 1B0FA 2OUAA 1TX8A 3GY2A 4A6LA 3RXPA 1T7CA 3BTME 4XE4A 1GBJA 3P8NA 2ZFFH 1EUFA 1X7AC 4UDWH 5A8YA 2ZU1A 2QC2A 4JYVH 1BBRH 1O2HA 3SJOA 2LPRA 2VIWA 1SGRE 1ZPBA 1WSSH 1SFIA 3UQVA 1EAIA 3RXOA 1CBWC 2V3OH 1FZZA 2FO9A 4MNYA 1TOCB 3U98H 4NWKA 3SU0A 4DVAU 1O5FH 1P04A 3DUXH 2ODQA 1NFXA 1O2LA 1CGHA 1A7SA 1GHAF 1NY22 1LPGB 1V2LT 2FI3E 5IYTA 1VCPA 3SNDA 1Y5BT 3F68H 4QT8C 2ZC9H 4BOHA 4FU8A 1V2UT 8LPRA 5T6FA 4AYYB 1FPCH 1T4VH 1FIZA 2H2ZA 3EA7A 2BHGA 2Y7XA 3A8CA 5A8ZA 5L2ZH 1O5BB 1JMOH 3E0PB 1BB0B 3M3SA 3RC6A 1TX7A 1NRQH 3ZYEA 1EASA 1GMHG 2XXLA 2WPJS 2RDLA 1XMNB 1CA0B 1J15A 1LCYA 2JKHA 3BG4B 7KMEH 1QBOA 2QYIA 2BDAA 2VGCB 2TRMA 1QB1A 2ZGXH 2Q6FA 1N6YA 2OBQA 4A1TA 1H9LB 3P8OA 2FOBA 3QZQA 4O3UA 1P0SH 3NUMA 4Y8YA 4K69A 4AB8A 3M7QA 5GWZA 1TLDA 3UTUH 2ANYA 1RIWB 1GMDF 1BTZA 1JXPA 4Z6AH 2H1UA 1AVXA 1IQNA 4I8JA 1TPSA 4YZUA 1MQ6A 1XXFA 3VB7A 1VJAU 4U32A 1O2IA 1A5HA 5HXFA 2R3UA 1AD8H 1DY9A 3MU1A 4WY3A 2GCTB 1V2VT 1W2KH 2B5TB 3BG8A 1A5IA 1GHVH 2GV7A 2B7DH 3S9BA 3I78A 1F0SA 4CHAB 1O3NA 2UWPA 4DT7B 1ZMJA 4WVPE 4LK4A 3QN7A 1IQEA 1DX5M 1E37B 1O2WA 2ZG0H 3VGCC 7LPRA 1Y3VA 4H4FA 1E0FD 5FPTA 2H5DA 3U8OH 3OTJE 1NS3A 1AI8H 1K22H 2F3CE 2GCHG 4KTCA 4WWYA 3A8DA 6ESTA 2ZFTA 1ABJH 1UTMA 4JK6A 4MTBA 2I6QA 4B1TA 4X6NA 3FAOA 1FY4A 2BY9X 1YPHC 5HMAA 3ZYDA 5C3NA 2J34A 2G4UA 2VNTA 1TRNA 3MTYA 1RRKA 5EGMA 1C2FA 1TNLA 1FONA 1PPEE 4JZIA 1ELVA 1CSOE 6CHAC 2PW8H 2WUBA 1P2MA 4YOGA 3URDA 1C2IA 1FUJA 2FI5E 4K2YA 1NT1A 4DJZB 3ZZCA 1ZTJA 1N8OB 5I46H 4X1RU 3WY8A 1PPZA 1C1NA 1ZGVA 4AORA 3QTVH 4ABHA 4A1XA 4E7NA 5CE1A 1P57B 3UOUA 2EA3A 2D2DA 3A82A 1TB6H 1OP0A 1EXFA 1SBWA 1TGTA 1HJAC 3ZZ5A 3A7WA 2XBYA 4FUEA 2VIQA 1SVPA