3RXJA

Crystal structure of trypsin complexed with 4-guanidinobenzoic acid
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxjA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxjA02
1WQVH 2W3KA 4JMYA 2Q6GA 3ESTA 2ZIQH 2RA0A 1T8NA 2VIPA 4O03A 1YCPM 3B23B 1GHYH 3SZNA 3U1JB 2PSXA 1PPEE 1NTPA 3GY4A 1A2CH 4FUBA 3I29A 1FY3A 1GBKA 1ZYOA 4YO9A 2A32A 4DURA 3GOVB 3TH2H 1N1LA 2VGCC 5JBTA 3M3VA 1O2NA 1JBUH 1SL3A 5IYTA 4I33A 3NCLA 1QQUA 3ZZ8A 1FIZA 1OPHB 1Y3YA 4RKOB 3KEEA 1EXFA 1K1MA 2G51A 4R8TB 2FDAA 4Y8ZA 3M61U 2PWXA 2F3CE 3RXSA 1ELGA 4K8YA 1DUAA 5A8YA 1O35A 2BDBA 3VB5A 1P09A 3PLBA 3SU5A 1N8OC 1XXFA 2XC5A 2B7DH 1A4WH 5A8ZA 2GMTC 1LO6A 4F49A 2G55A 1FY5A 1PPZA 1FLEE 1QRZA 4MPVA 3B8JA 1ZR0A 2BB4A 1P2IA 1QHRB 2SGQE 4IMQA 3O8CA 2NU3E 2RDLA 4GCHG 4MQAA 2PHBA 6GCHG 3E91A 2QCYA 1MBQA 4MG3A 2ZTXA 1LQEA 1ZZZA 2GCHG 1AFEH 4FU9A 4ZKOU 2BD5A 3RXRA 1TNLA 2FIRH 1BMMH 2ZDMA 3M3TA 3MWIU 1GHWH 4NG9H 1EUFA 1XKAC 3BTKE 4VGCC 3UQOA 2AIQA 4WH6A 3SU3A 4NA8A 4X1SU 1TOMH 5L30H 2RA3A 5EU8A 1Y8TA 4X8TH 3D23A 1HYLA 3D65E 3W95A 3UUZA 4D76A 3A85A 1EJNA 1WYKA 4X1RU 4A1XA 1XMNB 2A0QB 1BMAA 1MKWH 1DM4B 1SOZA 2F9BH 5CHAC 3AW1A 3KQDA 1D3QB 1QB9A 2XYAA 4Y6DA 3EA9A 2ZNKH 3D62A 1DSUA 1GJ9B 4WXVA 3GY6A 1ZRKA 2BDAA 4IN2A 2FOHA 4NWKA 5DP8A 2BVXH 3PWCA 1RRKA 2OUAA 4CRCA 4FVBA 1SGYE 1NY22 2G00A 2HRVA 3SU4A 1O3MA 1Y5UT 1Z8JB 1CO7E 2FM2A 1BB0B 2PUXB 5E0JA 2BD9A 3QDZB 1UTQA 1VGCB 4DJZB 1GHAF 1TFXA 2OCVB 4NGAH 1NT1A 2FS9A 2BY6X 3QN7A 1P2QA 4DIIH 2ODPA 1C1TA 1LMWB 3PO1B 2QXJA 4Q7ZA 1HIAA 3AAUA 4WF8A 1GJ8B 2AGEX 1O3LA 2GZ8A 3V3MA 4DCDA 1C2JA 2FI5E 2G8TA 3ZZ7A 2Z7FE 1YPGH 2J95A 4LZ4B 4WY3A 1W3CA 3MU5A 1QBNA 1VCPA 1OWIA 2OD3B 2TIOA 4UE7H 1SFQB 4RSPA 4WXIA 1V2VT 5G4BA 1DE7H 3BTTE 2VH0A 1UTPA 3CS0A 1C5OH 1UTKA 1GG6C 4Y8XA 4JYUH 1INCA 1O3FA 2HGTH 3RXAA 3QWCH 4ISIH 2FZZA 3VPKA 3RXUA 1HAHH 1HNEE 3CP7A 2ZPRA 4ZKNU 1CVWH 1SB1H 2SNWA 5J4SA 1YLCA 1C5UA 4D9QA 2OC0A 2ZCKP 5JBCS 2R9PA 4YLQH 3PMHB 1UCYH 4AG1A 5J4QA 1MTWA 4U2WA 4CRDA 5DP9A 4ABBA 1DICA 1G32B 1ZSJA 1AN1E 1K1JA 1O2PA 5E2OA 1IQGA 1XUHA 4CRAA 1EAIA 2ZHFH 3KGPA 5AFZH 1W13U 1WQSA 2OC1A 1AUTC 3PV4A 2OC7A 4B1TA 3DD2H 1DVAH 4ABFA 4R0IA 3ZVDA 4CR5A 2TGPZ 1IHTH 5T6FA 3SV6A 1PQ7A 1CSOE 1VJAU 1Z6JH 1AY6H 1AVGH 3SU1A 3NUMA 1TNIA 1OYTH 3BV9B 3NZIA 4UFFH 1C5PA 3BTEE 4I8HA 1WBGB 2SFAA 2ZFFH 1ZTLA 2AMQA 2BD4A 1LTOA 1C2IA 1BDAA 2A5IA 2SGAA 1F5RA 2ZTYA 5HM9A 1C1VH 2A2QH 2PV9B 8ESTE 1JIMA 1V2UT 2WYJA 2VIVA 1DWCH 1Y5BT 1K1NA 2R3YA 2ZDKA 1FJSA 2VVCA 3HKIB 2BLOA 1BJVA 2W7SA 3U8RH 5JB9S 1QRXA 4JK6A 4HI3A 1FIWA 4B75A 1SGPE 2QA9E 4MPUA 4NIWA 1SPJA 4ZXXH 1S0QA 2HPQH 1LQDB 2XWAA 5C3NA 4A92A 1MU8B 2FX6A 1NN6A 4YOGA 1UCYE 1F92A 1ID5H 5FPTA 4BAOB 5A0BA 1WTHD 2SGEE 4DY7B 1RD3B 2ZEBA 2W3IA 3M5MA 1QL7A 4WMDA 3RXEA 2TBSA 4BTIB 4UD9H 3RUOA 3VB6A 4CBNA 1TNGA 3STIA 3B9FH 1C5QA 2CGAA 2GTBA 1AHTH 4B2CA 1W11U 4TPIZ 2EI8A 3RXBA 3PMAB 4AFSA 1SQAA 2FOFA 2H5DA 3PWBA 1HJAB 2ANKH 1GVLA 3E16B 5H4IB 3V7TA 3ENSB 1BTWA 1O5GH 1AGJA 1KY9A 3LU9B 5DP5A 4ZUHA 1MH0A 1CGHA 2ZU5A 1O3OA 4FUJA 5GCHG 1SGRE 1SBWA 1KTSB 3BSQA 1UVPA 1G3CA 1S85A 2HNTE 1HFDA 4UFEH 4BAKB 5F8ZA 2P3FH 2RG3A 2BY9X 5DPAA 1C2KA 3LJOA 1K28D 2TRMA 5EQQA 5JB8S 1BQYA 5FXLA 1GJ6A 1P2MA 1FAKH 3ATIA 1RTFB 3LH3A 1CHOG 3RXTA 4X6PA 5PTPA 3MU1A 2TGAA 1EX3A 2F83A 3ZVEA 1J16A 1BTHH 1XUGA 2V0BA 3ZZ6A 1BMLA 4Q7YA 2TGDA 1RIWB 5DP7A 4Y76A 1ABJH 1TX8A 3SV7A 3W94A 4DT7B 3P8GA 1QBOA 2A2XH 3PLPA 1E0FD 2NU2E 4XFQA 4A1VA 1O36A 1P02A 4ABHA 1K22H 5HXFA 5E8EH 2BDHA 2QXIA 4E7RG 3EGKH 4O97A 1G9IE 3TH4H 1V2PT 1SGEE 3H7OA 2WV4A 4MNXA 5EOKA 5FBEA 1S82A 1RS0A 1FY8E 1O2ZA 3TK9A 1EAUA 3SHCH 2ZCHP 5AHGH 3EDXB 1PFXC 2O8MA 3GYLB 1OS8A 2XBVA 3QTOH 1UO6A 1QURH 1AIXH 1A61H 4XBBA 1QB6A 2WPMS 1F5KU 2ZU4A 3I78A 3EA7A 2EI7A 1XXDA 1GMHF 1V2OT 1GI4A 1QB1A 4K5ZA 2ZF0H 3SU6A 2QAAA 4OGXA 1UCYK 1P04A 2Y5GA 1M9UA 1KXDA 2VU8E 5HGGA 2R0LA 2XNIA 1UVUH 3SNCA 4AYYB 1JIRA 1ZOMA 1T4UH 1THRH 2R0KA 3T28A 5CE1A 1AVXA 3R3GB 2A4QA 1TBQH 1TAWA 1O5AB 3RXOA 2O8WA 1ETRH 3N7OA 1P57B 1QJ1B 4AOQA 4MNVA 4H6TA 1XUKA 1NZQH 1QIXB 1MBMA 1ZPBA 3LH1A 4A7IB 3GCTG 1DSTA 1TQ7B 1P0SH 2B9LA 1GMDF 3VGCB 2BLWA 3E1XB 1LHDH 3UNSA 1LHCH 1WAYB 2ZP0H 2ZECA 3TITA 5F8XA 1NESE 2CF8H 1P2NA 3ZVGA 1S84A 1IQKA 4IMZA 2BY7X 1O5EH 3FANA 3M7UA 5EPYA 4X2WA 1WU1A 2ZC9H 1UVSH 3LT3A 4ZXYH 1GI2A 3F9HA 1C9TA 1VGCC 1A7SA 3UREA 4Y7AA 4ABAA 1TGSZ 2ZGBH 2ZHDA 1SSXA 3JZ2B 2Y81A 1FV9A 4XBDA 1GJAB 4ZHAA 1FY1A 1E38B 3ATLA 2CHAB 1O3PB 5TCAA 4DGJA 3PO1C 2HOBA 4X6MA 3TJNA 3RXLA 1LPZB 4OS1A 1O37A 1P2JA 3CS7A 1QL9A 2PKAB 1BTPA 1P8VC 2NU0E 1Z71A 1ZGIA 4B76A 1EKBB 1T8MA 1HJ9A 1K1OA 2GDEH 1UHBA 2VVVA 1GI1A 2C90B 2P59A 1WSSH 1VCWA 1BZXE 1K9OE 1XUJA 3OYPA 3PLKA 5ESTE 3LGVA 4INHA 2BY5X 2H5CA 1C5RA 2F9NA 1A3EH 3OTJE 2VVUA 1V2QT 3GDSA 3HGNA 1L1NA 1S6FA 1SGIB 1IOEA 3TU7H 2ZKSA 2PR3A 4I32A 4U30A 5LPFA 1KXAA 1GWAA 3MNXA 3M36A 3IG6B 1F0UA 1FNIA 1HAOH 1HPGA 1YP9A 3LIWA 1G2MA 1E37B 1EAWA 1MKXH 1A46H 1DY9A 3UNRA 2THFB 1ZMNA 4WH8A 4LOYH 1O2SA 4AFQA 1TPOA 1ETSH 1C1RA 2BDYA 1TGCA 3TLOA 1TMBH 1C5ZB 4CRBA 1TA2A 2ULLA 1GBCA 2H9TH 2ZHWH 2JETB 2FX4A 5JBAS 1ARCA 1D6RA 4X1NU 4YOIA 3S9BA 1VJ9U 2FS8A 8KME2 2JH0D 1SGCA 1D6WA 1NC6A 1ZHPA 1TRYA 1SGQE 2XW9A 4CH8B 1C2DA 3SJKA 2Z6BD 4AB8A 3KL6A 5F6MA 1F5LA 1SR5C 1HAVA 4KTCA 9ESTA 1C5VA 3UTUH 2PSYA 1GHVH 1AB9B 3SUGA 1UK3A 1CA0B 3F6UH 4CREA 1ZMJA 1O2RA 1FI8A 1T4VH 1TLDA 3RU4E 3RP2A 3KCGH 1GCDA 4E06H 2XBYA 3TJOA 4WJG2 2WINI 1LPKB 1GDUA 3SUDA 2KAIA 1MZAA 1FZZA 4YTAA 4FUFA 1SFIA 3C1KA 1C5SA 2OQ5A 2D8WA 4Y0YE 4BAHB 1MTNB 2FOMB 4NIYA 1ANCA 3GY3A 5LPRA 1O2UA 4K69A 3DFJA 3BTHE 4BTTB 3GCNA 2D26C 5K0HA 3Q77A 3BF6H 3GY7A 1YPHE 3A87A 2P95A 4X1QU 3ZV8A 3A7WA 3ELAH 2AEIH 3CENA 3I77A 1GPZA 2ZHQH 3KN2A 3RMOH 2A5KA 1O2MA 2GV7A 5LH8A 3TJUA 5GJ4B 1W2KH 5AVDA 5JDUB 3TGIE 3F9GA 1O3BA 3U8OH 2BX3A 3UQVA 2PKAA 1HXEH 1EPTB 1T8LA 2ZU1A 2FESH 1ZHRA 2XC4A 4WVPE 1GI8B 3BEIB 6CHAB 2H9EH 2VWNA 2ZDNA 3H5CB 2BVRH 2BXTH 3MNCA 5L2YH 3Q3XA 3SQEE 1LKAA 3GDUA 4K3JA 1Y3VA 3SHAH 1SQOA 3UFAA 1TONA 1YLDA 1YGCH 3VXEH 2ILNA 1NRPH 2ZZUH 1HJAC 4DOQA 2QGRA 1QQ4A 1L1GA 4TYDA 1RXPA 1GBAA 4XBCA 1DWBH 2V35A 2XBWA 6GCHF 2BOKA 1MTVA 3ZZ5A 3T62A 2Q6FA 1BTUA 1Y3UA 5IDKA 1ELBA 3V0XA 1TRNA 3FZZA 2VIWA 1IAUA 1AVWA 2P8OB 4BXWA 4FUIA 3QTVH 1C2FA 2H1UA 2HLCA 1SGTA 2A7HA 3Q76A 2GX4A 2Z3CA 3SOSA 5AF9H 2ALVA 3KNXA 3MI4A 4CHAB 4XSKU 4BAMB 1P11E 1OYQA 2FI3E 1FPHH 2O8UA 1MD7A 1AFQB 3RXVA 1RIWC 2ZGHA 1C2MA 4IC5A 5LPEA 4A5TS 3RXHA 3FVFB 2VWMA 2ZCLP 1O2YA 2IJOB 1JXPA 5I46H 1OP8A 7GCHG 3URCA 5JPMH 3A8CA 1EZUC 1GBHA 5A0CA 4GSOA 1KXEA 1HUTH 1GHXH 1OSSA 2O8LA 2ZQ2A 5BRRE 1AKSB 3BEFB 1C5LH 2QV1A 3VEQB 3UWIA 5SGAE 2BDIA 2ESTE 3MU4A 1KXCA 2NU1E 4I8JA 1SOTA 4BAQB 3A8DA 2WPHS 5EW1H 4BNRA 1K21H 1BTYA 3BTWE 3RXCA 2WPLS 2FEQH 1MKXK 1GVZA 3L3TA 3SBKA 1O39A 2FTLE 1BTXA 1HCGA 2ANYA 2XBXA 4OS7A 2FMJA 4JYVH 1HAPH 4MDSA 2SGPE 3P92A 2ZO3H 1O3JA 1K1LA 2AFQB 3STJA 4ABGA 1DX5M 1OP2A 1BIOA 2OP9A 3RXGA 2FOEA 1C1WH 1WV7H 1H4WA 5FCRA 1QA0A 3MH5A 1MU6B 4BOHA 1V2ST 2V3OH 1PYTC 2QXHA 1YPHC 1HAZB 4FUGA 4JZIA 1TA6A 1ZTKA 4GUXA 5DP6A 1RFNA 1GI9B 2ZFQH 3GCHB 4MPWA 3BTGE 1QR3E 3BIUH 3S0NA 1ZRBA 3F1SB 3SJOA 1HB0B 4Z6AH 3PROA 1QGFA 3HK6B 3ZVBA 3VGCC 1ELAA 4HFPB 4NZLA 1PPCE 3ZZCA 3GY5A 1NFUA 3P17H 1W0ZU 2ZDLA 3K6ZA 3RLWH 3UR9A 3MYWA 4RKJB 2QF3A 1NFXA 3OY5U 5FX6A 3DUXH 1DWEH 3SU0A 1OKXA 1TYNA 4FXGH 2R2MB 3P8NA 5A8XA 1TPPA 4Y11E 1V2WT 3SORA 1MQ5A 3GDVA 2ZQ1A 1QBVH 2CHAC 4KTSA 2ZFSA 1MD8A 1AQ7A 1OWKA 2AIPA 3MH6A 1BTZA 4X6NA 2PTCE 3EAJA 2BDCA 2A7JA 1EASA 1Y3WA 2EI6A 1P9SA 1ESBA 1C2GA 1P3EA 1Z8IB 4FVDA 3URDA 1F2SE 4MTBA 2QIQA 5HMAA 2C8YB 1TBZH 3U98H 5T6DA 4QT8C 3U8TH 3RC4A 1RTLA 1W10U 1F0TA 1SHHB 4FUEA 1ZLRA 4X2VA 4MLFB 3TNSA 2BZ6H 1QNJA 3OY6U 1VZQH 1T32A 2A1DB 5FCKA 2Q1JA 1HV7A 3RXMA 4NSVA 1W14U 4I31A 1TOCB 2J2UA 3KHVA 5E2PA 1NPMA 8GCHG 4ZROA 2PUQH 4DIHH 2A4OA 3S69A 2AH4X 1DS2E 2VIQA 1DT2A 3LGYA 5GWZA 3SJ8A 1RJXB 1NRNH 3U9AH 3P8FA 1QFKH 2ZFTA 4THNH 3ZZDA 4ABIA 1V2NT 1TPSA 5DKMA 9LPRA 3T5FH 1O5CB 1HDTH 2QXGA 2BQWB 3NXPA 1QTFA 4CR9A 2OC8A 3ATMA 3RXFA 3NWUA 1WUNH 2GDDA 2VIOA 2GGVB 1Z8GA 3DFLA 3LJJA 1DANH 3NPSA 3U1IB 2XXLA 4D9RA 2JETC 4UONA 3IWMA 3PM3A 4O9VA 1O3IA 1FXYA 1V2KT 5TJXA 1BRCE 2A31A 1A5GH 3U69H 4IC6A 3AASA 5AFYH 4NIXA 3RXQA 4JCNA 3QK1A 2UUFB 1W7XH 3LGTA 2ODYB 1GI0A 2ZPSA 3GY2A 4DVAU 4M7GA 5E0HA 4I8GA 1O3GA 2ANWA 1LCYA 1KDQB 1G3BA 2FPZA 4B74A 1KSNA 1AB9C 1UTJA 3ZV9A 1C5NH 1CA0C 1DLEA 2GCTB 3SUFA 4BTUB 4H4FA 4XE4A 2BOHB 3EQ0H 3IITA 1C5MD 3KQBA 4X6OA 2TGTA 1ESAA 4B2AA 2WV5A 5A09A 1GI6A 3D49H 4E7NA 1ACBE 2BVSH 2Z94A 2FOGA 4DW2U 4TPYA 1P06A 3BEUA 1MTNC 2JH5D 3AAVA 6ESTA 2G4TA 1ELVA 1GJDB 5JBBS 2D1JA 1AI8H 4OS4A 3G01A 4B71A 5GCHF 3VFEA 3LC5A 4JZEH 1C1NA 2CXVA 3RXPA 1H8DH 1GCTB 3KIDU 4FU7A 4YT7H 4A1TA 1IQLA 2ZDVH 3RXJA 2BYAX 2SGDE 1YC0A 3ZZBA 3PYHA 1UTLM 1CU1A 1QA7A 1Z1JA 1YBWA 3M7QA 2JKHA 2HALA 1CHOF 1HXFH 1Z8RA 1ZPCA 3V12A 1EPTC 3SNEA 1A5HA 1FDPA 1TQ0B 1GDQA 1UVOA 2XC0A 6CHAC 1JMOH 1L0ZA 1JOUB 4ZHMU 2Y7ZA 4JYTA 3OU0A 5FAHA 1EB2A 1QY6A 1LVYA 1LVMA 2GKVE 2H2ZA 4IN1A 5B6OA 1ZMLA 2VWLA 1DXWA 1LVBA 1MTUA 2RCEA 4IS5A 4H6SB 1GBTA 2FWWA 1GMHG 1SHYA 1DWDH 1MMJN 1GBBA 3MO3A 1EZSC 4YZUA 1H1BA 1SMFE 4K60A 1GBEA 2ZTZA 1Q3XA 1AUJA 1CE5A 4HZHA 3A86A 1GI7B 2WPKS 4ESTE 3VB7A 1NU9A 3RMMH 2XRCA 1WCZA 3RU4T 2B5TB 1DITH 2H9HA 1JRTA 3M5LA 2AGGX 1RGQA 2P8OC 1IQJA 4FUDA 1E35B 4Y8YA 1V6DA 4U01A 2EEKA 1BBRH 3SV2H 1EB1H 1VR1H 5C5NA 1E36B 4CHAC 3SGBE 4TY6A 1XKBC 2DE8A 1C5YB 2LPRA 3SGQE 1AFQC 2ZWLH 4K1EA 4PROA 3ZVFA 1NU7B 2FLBH 2WPJS 1TWXB 3VB3A 2WUBA 3A88A 3C27B 5A0AE 1DY8A 4MVNA 2Y5HA 2FI4E 5EG4A 1CBWB 3KQCA 4D7GA 4YLUA 3RLYH 2J38A 3T2NA 2ANMH 1FN8A 1KIGH 5C1UA 3MOCA 5EODA 4ZKSU 4Y71A 2VIDA 2O8TA 1J15A 3BTFE 5E0GA 3M5NA 1SG8B 3LC3A 1EZQA 3ZZAA 2A7CA 3SN8A 5I25A 4IW4E 2OINA 3RDZA 5FBIA 4GAWA 1GMCF 1TB6H 1IQFA 3F9EA 3MNBA 1AWHB 3SI4H 3A81A 1IQNA 2ZPQA 1EJMA 3ODDA 3QUMP 1O2WA 2B8OH 2YOLA 3R0FA 1QL8A 1U6QA 1YPEH 3P8OA 2FXRA 1PPGE 1DLKB 1OXGA 2C8XB 4AGKA 4OS5A 4X1PU 5TCCA 1W7GH 1C2HA 3M37A 1TIOA 1MZDA 2G5VA 2SNVA 1P9UA 2Z3EA 1ZJDA 3H7TA 2BZAA 1GGDB 2PGQB 3FAOA 3UR6A 3TJVA 5GDSH 3BTQE 1IQEA 1HJ8A 1VITF 5FX5A 3QGNB 1BBRE 3A7YA 2Z9LA 3T25A 4ABJA 1GHBG 3GCHC 4K1SA 1XM1A 1S81A 1EZXC 3BG4B 2Y82A 1D4PB 1OX1A 2GD4B 3A84A 1SGFA 7ESTE 1BA8B 1O2GH 1EATA 1P3CA 2FLRH 4Z0KA 1GBMA 3RXKA 1MQ6A 4TWWA 1ANBA 4KP0A 3UOPA 4AZ2B 3L33A 3SNBA 4YM9A 2GT7A 1KXBA 1H9HE 1Q31A 2R3UA 2QY0B 4H42U 2F9OA 1NRRH 1C5WB 2ASUB 4Y10E 1TALA 1XUIA 3SGAE 2DE9A 1FUJA 3HGPA 2QN5T 3F9FA 4ZAEA 4A6LA 3TIUA 4I8KA 2A4RA 1BJUA 3SI3H 1Y59T 2GP9B 2YNBA 2ALPA 1EOJA 3BG8A 3A80A 1GJ4H 2BDGA 1C5XB 2Y5FA 1CGJE 1N6YA 2I6QA 2C3SA 5F03A 4U32A 3T26A 1ABIH 2BY8X 2FYRA 1P2OA 1C1UH 1THSH 2XCNA 2XTTB 4D8NA 2FOAA 1ELTA 5GIBA 4NA9H 1TRMA 3BTME 2AMPA 1B0FA 2XCFA 1AE8H 2AMDA 3FP8E 2FTMA 2GVFA 4X8VH 4UEHH 4AG2A 1HIAB 5ABWA 1TPAE 1TNKA 2BLVA 3ZYEA 4AORA 4ZHLU 1S83A 3A82A 1XUFA 4J1YA 4XDEA 2BD2A 2DUCA 1SGNE 1EP5A 3S7KB 1B7XB 4NIVA 1YPLH 1SQTA 1S5SA 3A7ZA 4E05H 1OWDA 2VJ1A 1A0HB 1C2EA 1O2LA 1S6HA 1THPB 1ANEA 4OS6A 2F91A 1BBRK 1J8AA 4ISLA 3P6ZB 4JZDH 3FP6E 3SO3A 3TH3H 1G2LA 3K9XB 1V2JT 1UTMA 2OBOA 1J9CH 1LHGH 3E90B 3WY8A 1TNHA 3O8DA 2Z9KA 3EA8A 8LPRA 2A5AA 7LPRA 3Q00A 3S9CA 4GCHF 3LGIA 1BITA 2J92A 1W12U 1A0JA 3A8BA 1V3XA 1FONA 2GCTC 1YF4A 2GCHF 1YPMH 2BD7A 2PW8H 2Z9JA 1O2TA 4HGCA 4GHQA 1FPCH 3MO6A 2QYIA 2UWPA 2Z3DA 2CMYA 3TNTA 1RTKA 5A2MH 1SLXB 2J34A 1NS3A 3VXFH 1C4V2 4NA7A 1T8OA 3EE0B 3LOXA 3MTYA 4ABDA 4KKDA 1A3BH 2W5EA 2GZ9A 3MHWU 2STAE 1P01A 2QF0A 3HK3B 1O5BB 3M7TA 5C1XA 1ZPZA 3FZDA 1OWJA 2W7UA 1CHGA 2BMGB 2J94A 1GCTC 1G3EA 1O0DH 3TGJE 1OWEA 3LPRA 1O2HA 1C1MA 2WUCA 3TGKE 1UVTH 1O2QA 1IQIA 3MU0A 1QRWA 2P3UB 4Y79A 1NM6A 1O2OA 3QGJA 4YT6H 1GHAG 4WWYA 4CBOA 2PKSB 1AZ8A 4FUCA 3ITIA 3NK8A 2AGIX 2C8WB 4Q7XA 4UFDH 1GJBB 3FP7E 1MCTA 3AW0A 4AX9H 1O3DA 1SGFG 4MNWA 2I6SA 3V13A 2WYGA 3LONA 2FO9A 4KELA 3QZRA 1GI3A 3SQHE 1S0RA 1O5DH 2H6MA 1KLTA 1EOLA 4AYVB 1T31A 3A7XA 3K2UA 3M35A 7GCHF 1FN6A 1NFWA 4ZKRU 3A8AA 1Z6EA 2HPPH 1EQ9A 1GBDA 1PQ8A 4LZ1H 1O3AA 1HGTH 4GHTA 3T27A 2OTVA 3BN9A 1F0SA 4UDWH 3S7HB 1PQ5A 3OX7U 3M3SA 3RXDA 1ELFA 5C5OA 5DGJA 3K65B 4J2YB 1O30A 1PPBH 4JZFH 1EPTA 5DO4H 1IQMA 2CN0H 3RC5A 5DP3A 1HBTH 3SV8A 1AWFH 3PMBB 1PPFE 1YCPH 1FMGA 1ARBA 1NRSH 2VWOA 5GXPA 2Y6TA 1C2LA 1K1IA 4B2BA 3SV9A 2W26A 5EQRA 2CF9H 4I7YH 1BRUP 1KLJH 1ELDE 1SI5H 2IPHA 1L2EA 3PB1E 1TNJA 4NFEA 4FUHA 1E34B 4ISHH 1EP6A 5ETXA 3LGWA 1CBWC 2OBQA 4BXSA 2FOCA 2F9VA 3UNQA 3K6YA 1O2VA 1OWHA 1G36A 1YM0A 1GVKB 4NFFA 2UUJB 1D9IA 3O8BA 1HAIH 1WTGH 2VNTA 2WPIS 1UTOA 4TY7A 3F68H 3P70B 2J9NA 4BANB 3S9AA 1ZJKA 1OP0A 3PTNA 2HVXA 1W0YH 2D2DA 4NWLA 5DP4A 4AFZA 3RU4D 1DUEA 1ZTJA 1UMAH 1C5TA 4X8UH 1L1JA 2TPIZ 4X2YA 3RXIA 1DFPA 1O32A 4Q2KA 1J17T 4GVUA 3SJIA 3E8LA 1Y3XA 4HTCH 1GJ7B 2XWBI 3A83A 2YNAA 1GGDC 5F8TA 1YYY1 4SGBE 5EXLA 1TGTA 1B0EA 1BOQA 1O3KA 3GYMA 1SLUB 2IOTA 1DPOA 2GV6A 2UWLA 1AKSA 2GT8A 1PYTD 1VITH 1D3TB 1QCPA 3BG4C 1JWTA 2VGCB 4ASHA 3AVZA 1CT2E 1FY4A 1C1PA 1AZZA 1GJCB 2PGBB 1FAXA 5ESBA 3RM2H 2NU4E 5K7RA 3GICB 4SGAE 8GCHF 1DDJA 1CQQA 1O31A 3GCOA 5T6GA 1AU8A 1O3EA 4IBLH 4X0WU 3ZYDA 1UJ1A 3E0PB 1GBIA 1Z1IA 4JZ1A 1F0RA 3P95A 1N8OB 3SUEA 2AYWA 3MNSA 1O34A 2GMTB 4O3UA 1BUIA 1O2XA 1Y5AT 4MNYA 5L6NH 1ELEE 4TWYA 2PFEA 2ZGJA 2BX4A 1XVMA 3SU2A 1P03A 1NFYA 1AO5A 2ZU2A 4FU8A 1O38A 2V6NA 1BCUH 3T29A 1MKWK 4GPGA 3NKKA 1YPJH 3SNAA 1CT0E 2G5NA 3MFJA 1BT7A 2BM2A 1BHXF 3ZZ4A 1P12E 1O33A 3SNDA 4I8LA 1J14A 2P94A 2OXSA 4ABEA 4K2YA 2VB0A 5BPEA 2K1QA 5C67A 4NZQA 1G37A 4VGCB 4AN7A 3ATKA 4XOJA 3PTBA 1UK2A 2AS9A 1IHSH 1TX7A 5EPNA 2M5TA 3PMJA 1O3NA 1QJ7B 2FODA 4UFGH 4JK5A 3UOUA 6LPRA 1G30B 1O2KA 3MU8A 4O3TA 3UY9A 5EW2H 1NRQH 1V2TT 3UIRA 5CHAB 1SVPA 2P93A 1A5IA 4X2XA 4Y0ZE 3DA9B 2AERH 4RN6A 1NROH 1DXPA 1YPKH 2OLGA 1O2JA 3QX5H 5EXNA 1B5GH 1MCVA 2G4UA 3L6PA 2ZFRH 1GDNA 4AGJA 1MUEB 1TBRH 1UHBB 1GJ5H 3UWJH 1P10A 1KYNA 1ETTH 3DHKH 5FHTA 1TGBA 3ZVCA 4INKA 5C20A 3E6PH 2PTNA 1HAGE 3TVJB 2UUYA 3O8RA 1F7ZA 1AD8H 1P2KA 1YCPK 4Q80A 1VCQA 5FPSA 3BIVH 1MAXA 3ZVAA 5EGMA 1WOFA 3RMLH 5DJ7A 1JRSA 1XX9A 2IN2A 1ZSKA 2NWNA 3KQEA 3Q3KA 1YKTA 4OGYA 3RC6A 1V2LT 1GBJA 1EJAA 1ELCA 1QJ6B 1A1RA 5EQSA 4ISNA 1LVOA 1SLWB 3RM0H 1GL0E 1H8IH 1PPHE 2QC2A 3LGUA 4ISOA 4F4OC 4LXBH 1OOKB 2EC9H 1SC8U 4CH2B 3QZQA 3A7TA 2FYQA 5CMXH 2ZDAH 3HPTB 4DG4A 2Z9GA 4CRGA 1ZHMA 1C1SA 2GZ7A 4INLA 1LHFH 1O3HA 5C2ZA 2J4IA 2VINA 1GMDG 1GG6B 4ZH8A 2ZA5A 4K8BA 1LDTT 1BMNH 2R2WU 1H9LB 3MH4A 4KTUA 4X8SH 1GBFA 4Y7BA 3GISB 2ZI2H 4WMEA 1TMTH 3LKWA 3EYDA 1PQAA 2BHGA 3M5OA 5C1YA 1HAVB 5DK1A 1TX6A 2UUKB 3KF2A 5LGOA 1C4Y2 1KDQA 4YOJA 1L4DA 2VH6A 2PKSC 1BRBE 1MAYA 1CA8B 2Y7XA 1GL1A 1CGIE 2A45B 2ZHEH 3GCTF 4GLYA 2CJIA 1HAYB 1T7CA 4WMFA 1TE0A 2KAIB 5HM2A 1IQHA 1GMCG 1ESTA 1ZSLA 2Q6DA 1SGDE 2EA3A 1TGNA 1AE5A 2BTCE 5L2ZH 5JYIA 1O2IA 2C93B 1A0LA 1Q2WA 2F9UA 4YESB 1ZGVA 1C1OA 2ODQA 3TK6A 3GY8A 3FFGA 2P3TB 1V2MT 1C4U2 4AFUA 2A4GA 2O9QA 4B73A 3ZZ3A 3QLPH 1XVOA 2STBE 1KXFA 3SJ9A 3RMNH 2PLXA 1HLTH 1KLIH 1D3PB 2BD8A 2HNTC 3LDXH 3A7VA 1EAXA 3MH7A 3MMGA 2ZGXH 2HWLB 1VITG 3OSYA 2HNTF 4K1TA 1GHZA 1ORFA 7KMEH 2FP7B 2Z9IA 4LK4A 2LNCA 2BQ6B 1K2I1 1GBLA 1HAXB 2ZFPH 2F9PA 3DT0H 3TPIZ 5FPYA 4IGDA 5GPIB 3ODFA 1L4ZA 2G81E 4D7FA 1UK4A 2ZGCA 1GI5A 1AMHA 3ATWA 2G52A 4AB9A 1C9PA 1H9IE 1TABE 3VB4A 2C4FH 3ZZ9A 1ANDA 1P05A 1DOJA 2JH6D 4ZMAH 3HKJB 1FQ3A 1UTNA 3TK5A 1LHEH 1TMUH 5EXMA 1Z7KA 1HRTH 2BQ7B 2CV3A 2B0FA 3Q3YA 2ZG0H 2BLQA 2ZU3A 1GHBF 1G3DA 5DG6A 3E0NB 5HYOA 2FOBA 1MTSA 4MPXA 2Y80A 1BRAA 1X7AC 3JZ1B 1NO9H 1D3DB 3BTDE 4CRFA 1C1QA 1K1PA 1CT4E 2SGFE 4NSYA 2P16A 1W8BH 3UPEA 3HATH 5T3HA 4OS2A 2OQUA 2UWOA 3A89A 2BXUH 1KTTB 2C8ZB 1SLVB 1N6XA 1V2RT 1BHXB 4KGAA 3QO6A 3SW2B 1O5FH 3MO9A 3E3TA 1LKBA 1LPGB 2BD3A 1PJPA 4NCYA 2V3HH 1O3CA
chains in the Genus database with same CATH superfamily
1WQVH 2W3KA 4JMYA 2Q6GA 3ESTA 2ZIQH 2RA0A 1WXRA 1T8NA 2VIPA 4O03A 1YCPM 2OK5A 3B23B 1GHYH 3SZNA 3U1JB 2PSXA 1PPEE 1NTPA 3GY4A 1A2CH 4FUBA 3I29A 1FY3A 1GBKA 1ZYOA 4YO9A 2A32A 4DURA 3GOVB 3TH2H 1N1LA 2VGCC 3ZIAD 5JBTA 3M3VA 1O2NA 1JBUH 1SL3A 5IYTA 4I33A 3NCLA 1QQUA 3ZZ8A 1FIZA 1OPHB 1Y3YA 4RKOB 3KEEA 1EXFA 1K1MA 2G51A 4R8TB 2FDAA 4Y8ZA 3M61U 2PWXA 2F3CE 3RXSA 1ELGA 4K8YA 1DUAA 5A8YA 1O35A 2BDBA 3VB5A 1P09A 3PLBA 3SU5A 1N8OC 3DSOA 1XXFA 2XC5A 5T1VA 2B7DH 1A4WH 5A8ZA 2GMTC 1LO6A 4F49A 2G55A 4YXWD 1FY5A 1COWD 1FLEE 1PPZA 1QRZA 4MPVA 3B8JA 1ZR0A 2BB4A 1P2IA 1QHRB 2SGQE 2KCOA 4IMQA 3O8CA 2NU3E 2RDLA 4GCHG 4MQAA 2PHBA 6GCHG 3E91A 2QCYA 1MBQA 4MG3A 2ZTXA 1LQEA 1ZZZA 2GCHG 1AFEH 4FU9A 4ZKOU 2BD5A 3RXRA 1VKYA 1TNLA 2FIRH 1BMMH 2ZDMA 3M3TA 3MWIU 1GHWH 4NG9H 1EUFA 1XKAC 3BTKE 4VGCC 3UQOA 2AIQA 4WH6A 3SU3A 4NA8A 4X1SU 2CK3D 1TOMH 5L30H 2RA3A 5EU8A 1Y8TA 4X8TH 3D23A 1HYLA 3D65E 3W95A 3UUZA 4D76A 3A85A 1EJNA 1WYKA 4X1RU 4A1XA 1XMNB 2A0QB 1BMAA 1MKWH 1DM4B 1SOZA 2F9BH 5CHAC 3AW1A 3KQDA 1D3QB 5FL7D 1QB9A 2XYAA 4Y6DA 3EA9A 2ZNKH 3WWFA 3DCLA 3D62A 1DSUA 1GJ9B 4WXVA 3GY6A 1ZRKA 2BDAA 4IN2A 2FOHA 4NWKA 5DP8A 2BVXH 3PWCA 1RRKA 2PP6A 2OUAA 4CRCA 4FVBA 3DSPA 1SGYE 1NY22 2G00A 2HRVA 3SU4A 1O3MA 1Y5UT 1Z8JB 1CO7E 2FM2A 1BB0B 2PUXB 5E0JA 2BD9A 3QDZB 1UTQA 1VGCB 4DJZB 1GHAF 1TFXA 2OCVB 4NGAH 1NT1A 2FS9A 2BY6X 3QN7A 1P2QA 4DIIH 2ODPA 1C1TA 1LMWB 3PO1B 2QXJA 4Q7ZA 1HIAA 3AAUA 4WF8A 1GJ8B 2AGEX 1O3LA 2GZ8A 3V3MA 2W6JD 4DCDA 1C2JA 2FI5E 2G8TA 3ZZ7A 2Z7FE 1YPGH 2J95A 4LZ4B 4WY3A 1W3CA 3MU5A 1QBNA 1VCPA 5EIYA 1OWIA 2OD3B 2TIOA 4UE7H 1SFQB 2YMSD 4RSPA 4WXIA 1V2VT 5G4BA 1DE7H 3BTTE 2VH0A 1UTPA 3CS0A 1C5OH 1UTKA 1GG6C 4Y8XA 4JYUH 4P00A 1INCA 2KCPA 1O3FA 2HGTH 3RXAA 3QWCH 4ISIH 2FZZA 4M9FA 3VPKA 3RXUA 1HAHH 1HNEE 3CP7A 3N99A 2ZPRA 4ZKNU 1CVWH 1SB1H 3FOAA 2SNWA 5J4SA 1YLCA 1C5UA 4D9QA 2OC0A 2ZCKP 5JBCS 2R9PA 4YLQH 3PMHB 1UCYH 4AG1A 5J4QA 5KECA 1MTWA 4U2WA 4CRDA 5DP9A 4ABBA 1DICA 1G32B 1ZSJA 1AN1E 1K1JA 1O2PA 5E2OA 1IQGA 1XUHA 4CRAA 1EAIA 2ZHFH 3KGPA 5AFZH 1W13U 1WQSA 2OC1A 1AUTC 3PV4A 2OC7A 3PV5A 4B1TA 3DD2H 1DVAH 4ABFA 4R0IA 3ZVDA 4CR5A 2TGPZ 1IHTH 5T6FA 3SV6A 1PQ7A 1CSOE 4XD7D 1VJAU 1Z6JH 3W1EA 1AY6H 1AVGH 3SU1A 3NUMA 1TNIA 1OYTH 3BV9B 3NZIA 4UFFH 1C5PA 3BTEE 4I8HA 1WBGB 2SFAA 2ZFFH 1ZTLA 2AMQA 2BD4A 1LTOA 1C2IA 1BDAA 2A5IA 2SGAA 1F5RA 2ZTYA 5HM9A 1C1VH 2A2QH 2PV9B 8ESTE 1JIMA 1V2UT 2WYJA 2VIVA 1DWCH 1Y5BT 1K1NA 2R3YA 2ZDKA 1FJSA 2VVCA 3HKIB 2BLOA 1BJVA 2W7SA 3U8RH 5JB9S 1QRXA 4JK6A 4HI3A 1FIWA 4B75A 1SGPE 2QA9E 4MPUA 4NIWA 1SPJA 4ZXXH 1S0QA 2HPQH 1LQDB 2XWAA 5C3NA 4A92A 1MU8B 2FX6A 1NN6A 4YOGA 1UCYE 1F92A 1ID5H 5FPTA 4BAOB 5A0BA 1WTHD 2SGEE 4DY7B 1RD3B 2ZEBA 2W3IA 3M5MA 1QL7A 4WMDA 3RXEA 2TBSA 4BTIB 4UD9H 3RUOA 3VB6A 4CBNA 1TNGA 3STIA 3B9FH 1C5QA 2CGAA 2GTBA 1AHTH 4B2CA 1W11U 4TPIZ 2EI8A 3RXBA 3PMAB 4AFSA 1SQAA 2FOFA 2H5DA 3PWBA 1HJAB 2ANKH 1GVLA 3E16B 5H4IB 3V7TA 2KX4A 3ENSB 1BTWA 1O5GH 1AGJA 1KY9A 3LU9B 5DP5A 4ZUHA 1MH0A 1CGHA 2ZU5A 1O3OA 4FUJA 5GCHG 1SGRE 1SBWA 1KTSB 3BSQA 1UVPA 1G3CA 1S85A 4DT4A 2HNTE 1HFDA 4UFEH 4BAKB 5F8ZA 2P3FH 2RG3A 2BY9X 5DPAA 1C2KA 3LJOA 1K28D 2TRMA 5EQQA 5JB8S 1BQYA 5FXLA 1GJ6A 1P2MA 1FAKH 3ATIA 1RTFB 3LH3A 1CHOG 3EE7A 1E1QD 3RXTA 4X6PA 5PTPA 3MU1A 2TGAA 1EX3A 2F83A 3ZVEA 4ACBA 1J16A 3OFND 1BTHH 1XUGA 2V0BA 3ZZ6A 1BMLA 4Q7YA 2TGDA 1RIWB 5DP7A 4Y76A 1ABJH 1TX8A 4RI0A 3SV7A 3W94A 4DT7B 3P8GA 1QBOA 2A2XH 3PLPA 3N7DA 1E0FD 2NU2E 4XFQA 4A1VA 1O36A 1P02A 4ABHA 1K22H 5HXFA 5E8EH 2BDHA 2QXIA 4E7RG 3EGKH 4O97A 1G9IE 3TH4H 1V2PT 1SGEE 3H7OA 2WV4A 4MNXA 5EOKA 5FBEA 1S82A 1RS0A 1FY8E 1O2ZA 3TK9A 1EAUA 3SHCH 2ZCHP 5AHGH 3EDXB 1PFXC 2O8MA 3GYLB 1OS8A 2XBVA 3QTOH 1UO6A 1QURH 1AIXH 1A61H 4XBBA 1QB6A 2WPMS 1F5KU 2ZU4A 3I78A 3MQKC 3EA7A 2EI7A 1XXDA 1GMHF 1V2OT 1GI4A 1QB1A 4K5ZA 2ZF0H 3SU6A 2QAAA 4OGXA 2QF4A 1UCYK 1P04A 2Y5GA 1M9UA 1KXDA 2VU8E 5HGGA 2R0LA 2XNIA 1UVUH 3SNCA 4AYYB 1JIRA 1ZOMA 1T4UH 1THRH 2R0KA 3T28A 5CE1A 1AVXA 3R3GB 2A4QA 1TBQH 1TAWA 1O5AB 3RXOA 2O8WA 1ETRH 3N7OA 1P57B 4Z1MD 1QJ1B 4AOQA 4MNVA 4H6TA 1XUKA 1NZQH 1QIXB 1MBMA 1ZPBA 3LH1A 4A7IB 3GCTG 2VBCA 1DSTA 1TQ7B 1P0SH 2B9LA 1GMDF 3VGCB 2BLWA 3E1XB 1LHDH 3UNSA 1LHCH 1WAYB 2ZP0H 2ZECA 3TITA 5F8XA 1NESE 2CF8H 1P2NA 3ZVGA 1S84A 1IQKA 4IMZA 2BY7X 1O5EH 3FANA 3M7UA 5EPYA 4X2WA 4HG6A 1WU1A 2ZC9H 1UVSH 3FKSD 3LT3A 4ZXYH 1GI2A 3F9HA 1C9TA 1VGCC 1A7SA 4RT1A 4Y7AA 3UREA 4ABAA 1TGSZ 2ZGBH 2ZHDA 1SSXA 3JZ2B 2Y81A 1FV9A 3F3BA 4XBDA 3OAAD 1GJAB 4ZHAA 1FY1A 1E38B 3ATLA 2CHAB 1O3PB 5TCAA 3SZEA 4DGJA 3PO1C 2HOBA 4X6MA 3TJNA 3RXLA 1LPZB 4OS1A 1O37A 1P2JA 3CS7A 1QL9A 2PKAB 1BTPA 1P8VC 2NU0E 1Z71A 1ZGIA 4B76A 1EKBB 1T8MA 1HJ9A 1K1OA 2GDEH 1UHBA 2VVVA 1GI1A 2C90B 2P59A 1WSSH 1VCWA 1BZXE 1K9OE 1XUJA 3OYPA 3PLKA 5ESTE 3LGVA 4INHA 2BY5X 2H5CA 1C5RA 2F9NA 1A3EH 3OTJE 2VVUA 2J98B 1V2QT 3GDSA 3HGNA 1L1NA 1S6FA 1SGIB 1EFRD 1IOEA 3TU7H 1KMHB 2ZKSA 3GS9A 2PR3A 4I32A 4U30A 2K0QA 5LPFA 1KXAA 1GWAA 3MNXA 3M36A 3IG6B 1F0UA 1FNIA 1HAOH 1HPGA 1YP9A 3LIWA 1G2MA 1E37B 1EAWA 1MKXH 1A46H 1DY9A 3UNRA 2THFB 1ZMNA 4WH8A 4LOYH 1O2SA 4AFQA 1TPOA 1ETSH 1C1RA 2BDYA 1TGCA 3TLOA 1TMBH 5C0TA 1C5ZB 4CRBA 1TA2A 2ULLA 1GBCA 2H9TH 2ZHWH 2JETB 2FX4A 5JBAS 1ARCA 1D6RA 4X1NU 4YOIA 3S9BA 1VJ9U 2FS8A 8KME2 2JH0D 1SGCA 1D6WA 4B6FA 1NC6A 1ZHPA 1TRYA 1SGQE 2XW9A 4CH8B 1C2DA 3SJKA 2Z6BD 4AB8A 3KL6A 5F6MA 1F5LA 1SR5C 1HAVA 4KTCA 9ESTA 1C5VA 3UTUH 2PSYA 1GHVH 1AB9B 3SUGA 1UK3A 1CA0B 3F6UH 4CREA 1ZMJA 1O2RA 1FI8A 1T4VH 1TLDA 3RU4E 3RP2A 3KCGH 1GCDA 4E06H 2XBYA 3TJOA 4WJG2 2WINI 1LPKB 1GDUA 3SUDA 2KAIA 1MZAA 2IPQX 1FZZA 4YTAA 4I86A 4FUFA 1SFIA 3C1KA 1C5SA 2OQ5A 2D8WA 4Y0YE 4BAHB 1MTNB 2FOMB 4NIYA 1ANCA 3GY3A 5LPRA 1O2UA 4K69A 3DFJA 3BTHE 4BTTB 3GCNA 2D26C 5K0HA 5F53A 3Q77A 3BF6H 3GY7A 1YPHE 3A87A 2P95A 4X1QU 3ZV8A 5HKKD 3A7WA 3ELAH 2AEIH 3CENA 3I77A 1GPZA 2ZHQH 3KN2A 3RMOH 2A5KA 1O2MA 2GV7A 5LH8A 3TJUA 5GJ4B 1W2KH 5AVDA 5JDUB 3TGIE 3F9GA 1O3BA 3U8OH 2BX3A 3UQVA 2PKAA 1HXEH 1EPTB 1T8LA 2ZU1A 2FESH 1ZHRA 2XC4A 3PRBA 4WVPE 1GI8B 5HIZA 3BEIB 6CHAB 2H9EH 2VWNA 2ZDNA 3H5CB 2BVRH 2BXTH 3MNCA 5L2YH 3Q3XA 3SQEE 1LKAA 3GDUA 4K3JA 1Y3VA 3SHAH 1SQOA 3UFAA 1TONA 1YLDA 1YGCH 3VXEH 2ILNA 1NRPH 2ZZUH 1HJAC 4DOQA 2QGRA 1QQ4A 1L1GA 4TYDA 1RXPA 1GBAA 4XBCA 1DWBH 2V35A 2XBWA 4P02A 6GCHF 2BOKA 1MTVA 3ZZ5A 4Q63A 3T62A 2Q6FA 1BTUA 1Y3UA 5IDKA 3NRLA 1ELBA 3V0XA 1TRNA 3FZZA 2VIWA 1IAUA 1AVWA 2P8OB 4BXWA 4FUIA 3QTVH 1C2FA 2H1UA 2HLCA 1SGTA 2A7HA 3Q76A 2GX4A 2Z3CA 3SOSA 5AF9H 2ALVA 3KNXA 3MI4A 4CHAB 4XSKU 4BAMB 1P11E 1OYQA 2FI3E 1FPHH 2O8UA 1MD7A 1AFQB 3RXVA 1RIWC 2ZGHA 1C2MA 4IC5A 5KEDA 5LPEA 4A5TS 2QF5A 3RXHA 3FVFB 1K0HA 2VWMA 2ZCLP 4XRNA 1O2YA 2IJOB 1JXPA 5I46H 1OP8A 7GCHG 3URCA 5JPMH 3A8CA 1EZUC 1GBHA 2LP6A 4GSOA 5A0CA 3F0PA 1KXEA 1HUTH 1GHXH 1OSSA 2O8LA 2ZQ2A 5BRRE 1AKSB 3BEFB 1C5LH 2QV1A 3VEQB 3UWIA 5SGAE 2BDIA 2ESTE 3MU4A 1KXCA 2NU1E 4I8JA 1SOTA 4BAQB 3A8DA 2WPHS 5EW1H 4BNRA 1K21H 1BTYA 3BTWE 3RXCA 2WPLS 2FEQH 1MKXK 1GVZA 3L3TA 3SBKA 1O39A 2FTLE 1BTXA 3DSGA 1HCGA 2ANYA 2XBXA 4OS7A 2FMJA 4JYVH 1HAPH 4MDSA 2SGPE 3P92A 2ZO3H 1O3JA 4F55A 1K1LA 2AFQB 3STJA 4ABGA 1DX5M 1OP2A 1BIOA 2OP9A 3RXGA 2FOEA 1C1WH 1WV7H 1H4WA 5FCRA 1QA0A 3MH5A 1MU6B 4BOHA 1V2ST 2V3OH 1PYTC 2QXHA 1YPHC 1HAZB 4FUGA 3SYJA 4JZIA 1TA6A 1ZTKA 4GUXA 5DP6A 1RFNA 1GI9B 2ZFQH 3GCHB 2M2AA 4MPWA 3BTGE 1QR3E 3BIUH 3S0NA 1ZRBA 3F1SB 3SJOA 1HB0B 4Z6AH 3PROA 1QGFA 3HK6B 3ZVBA 2WV9A 3VGCC 1ELAA 4HFPB 4NZLA 1PPCE 3ZZCA 3GY5A 1NFUA 3P17H 1W0ZU 2ZDLA 3K6ZA 3RLWH 3UR9A 3MYWA 4RKJB 2QF3A 1NFXA 3OY5U 2KCYA 5FX6A 3DUXH 1DWEH 2KZ4A 3SU0A 1OKXA 1TYNA 4FXGH 2J97A 2R2MB 3P8NA 5A8XA 1TPPA 4Y11E 1V2WT 5DSFA 3SORA 1MQ5A 3GDVA 2ZQ1A 1QBVH 2CHAC 4KTSA 2ZFSA 1MD8A 1AQ7A 1OWKA 2AIPA 3MH6A 1BTZA 4X6NA 2PTCE 3EAJA 2BDCA 2A7JA 1EASA 1Y3WA 2EI6A 1P9SA 1ESBA 1C2GA 1P3EA 1Z8IB 4FVDA 3URDA 3WW7A 1F2SE 2XNDD 4MTBA 2QIQA 5HMAA 2C8YB 1TBZH 3U98H 5T6DA 4QT8C 3U8TH 3RC4A 1RTLA 1W10U 1F0TA 1SHHB 1NBME 4FUEA 1ZLRA 4X2VA 4MLFB 3TNSA 2BZ6H 1QNJA 3OY6U 1VZQH 1T32A 2A1DB 5FCKA 2Q1JA 1HV7A 3RXMA 4NSVA 1W14U 4I31A 1TOCB 2J2UA 3KHVA 5E2PA 1NPMA 8GCHG 4ZROA 2PUQH 4DIHH 2A4OA 3S69A 2AH4X 1DS2E 2VIQA 1DT2A 3LGYA 5GWZA 3SJ8A 1RJXB 1NRNH 3U9AH 3P8FA 1QFKH 2ZFTA 4THNH 3ZZDA 5C94A 4ABIA 1V2NT 1TPSA 5DKMA 9LPRA 3T5FH 1O5CB 1HDTH 2QXGA 2BQWB 3NXPA 1QTFA 4CR9A 2OC8A 3ATMA 3RXFA 3NWUA 4RT0A 2F43B 1WUNH 2GDDA 3U28C 2VIOA 2GGVB 1Z8GA 3DFLA 3LJJA 1DANH 3NPSA 3U1IB 2XXLA 1S6LA 4D9RA 2JETC 4UONA 3IWMA 3PM3A 4O9VA 1O3IA 3UAIC 1FXYA 1V2KT 5TJXA 1BRCE 2A31A 1A5GH 3U69H 4IC6A 3AASA 5AFYH 4NIXA 3RXQA 4JCNA 3QK1A 2UUFB 1W7XH 3LGTA 2ODYB 1GI0A 2ZPSA 3GY2A 4DVAU 4M7GA 5E0HA 4I8GA 1O3GA 2ANWA 1LCYA 1KDQB 1G3BA 2FPZA 4B74A 1KSNA 1AB9C 1UTJA 3ZV9A 1C5NH 1CA0C 1DLEA 2GCTB 3SUFA 4BTUB 2KR7A 4H4FA 4XE4A 2BOHB 2YMSB 3EQ0H 3IITA 1C5MD 3KQBA 4X6OA 2TGTA 1ESAA 4B2AA 2WV5A 5A09A 1GI6A 3D49H 4E7NA 1ACBE 2BVSH 2Z94A 2FOGA 4DW2U 4TPYA 1P06A 3BEUA 1MTNC 2JH5D 3AAVA 6ESTA 2G4TA 1ELVA 1GJDB 5JBBS 2D1JA 1AI8H 4OS4A 3G01A 4B71A 5GCHF 3VFEA 3LC5A 4JZEH 1C1NA 2CXVA 3RXPA 1H8DH 1GCTB 3KIDU 5C17A 4FU7A 4YT7H 4A1TA 1IQLA 2ZDVH 3RXJA 2BYAX 2SGDE 1YC0A 3ZZBA 3PYHA 1UTLM 1CU1A 1QA7A 1Z1JA 1YBWA 3M7QA 2JKHA 2HALA 1CHOF 1HXFH 1Z8RA 1ZPCA 3V12A 1EPTC 5KGOA 3SNEA 1A5HA 1FDPA 1TQ0B 1GDQA 1UVOA 2XC0A 6CHAC 1JMOH 1L0ZA 1JOUB 4ZHMU 1QZ8A 2Y7ZA 4JYTA 3OU0A 5FAHA 1EB2A 1QY6A 1LVYA 1LVMA 2GKVE 2GJGA 2H2ZA 4IN1A 1ZMLA 2VWLA 5B6OA 1DXWA 1LVBA 1MTUA 2RCEA 4IS5A 4H6SB 1GBTA 2FWWA 1GMHG 1SHYA 1DWDH 1MMJN 1GBBA 3MO3A 1EZSC 4YZUA 2JIZD 1H1BA 1SMFE 4K60A 1GBEA 2ZTZA 1Q3XA 1AUJA 1CE5A 4HZHA 3A86A 1GI7B 1WDIA 2WPKS 4ESTE 3VB7A 1NU9A 3RMMH 2XRCA 3F0OA 1WCZA 3RU4T 2B5TB 1DITH 2H9HA 1JRTA 3M5LA 3KQ5A 2AGGX 1RGQA 2P8OC 1IQJA 4FUDA 1E35B 4Y8YA 1V6DA 4U01A 2EEKA 1BBRH 3SV2H 1EB1H 1VR1H 1YWUA 5C5NA 1E36B 4CHAC 3SGBE 4TY6A 1XKBC 2DE8A 1C5YB 2LPRA 3SGQE 1AFQC 2ZWLH 4K1EA 4PROA 3ZVFA 1NU7B 2FLBH 2WPJS 1TWXB 3VB3A 2WUBA 3A88A 3C27B 2V7QD 5A0AE 1DY8A 4MVNA 1YY3A 2Y5HA 2FI4E 5EG4A 1CBWB 3KQCA 4D7GA 4YLUA 3RLYH 2J38A 3T2NA 2ANMH 1FN8A 1KIGH 5C1UA 3MOCA 5EODA 4ZKSU 4Y71A 2VIDA 3VG8A 2O8TA 1J15A 3BTFE 5E0GA 3M5NA 1SG8B 3LC3A 1EZQA 3ZZAA 2A7CA 3SN8A 5I25A 4IW4E 2OINA 3RDZA 5FBIA 4GAWA 1GMCF 1TB6H 1IQFA 3F9EA 3MNBA 1AWHB 1SKYE 3SI4H 3A81A 1IQNA 3N7EA 2ZPQA 1EJMA 3ODDA 3QUMP 1O2WA 2B8OH 2YOLA 3R0FA 1QL8A 1NBMD 1U6QA 1YPEH 3P8OA 2FXRA 1PPGE 1DLKB 1OXGA 3KYGA 2C8XB 4AGKA 4OS5A 4X1PU 5TCCA 1W7GH 1C2HA 1BMFD 3M37A 1TIOA 1MZDA 2G5VA 2SNVA 1P9UA 2JJ2D 1ZJDA 2Z3EA 3H7TA 2BZAA 1GGDB 2PGQB 3FAOA 3UR6A 2L74A 5GDSH 3TJVA 3BTQE 1IQEA 1HJ8A 1VITF 5FX5A 3QGNB 1BBRE 3A7YA 2Z9LA 3T25A 4ABJA 1GHBG 3GCHC 4K1SA 1XM1A 1S81A 2XOKD 1EZXC 3BG4B 2Y82A 1D4PB 1OX1A 2GD4B 3A84A 1SGFA 3FO8D 7ESTE 1BA8B 1O2GH 1EATA 1P3CA 2FLRH 4Z0KA 1GBMA 3RXKA 1MQ6A 4TWWA 1ANBA 4KP0A 3UOPA 4AZ2B 3L33A 3SNBA 1UW7A 4YM9A 2GT7A 1KXBA 1H9HE 1Q31A 5CDFE 2R3UA 2QY0B 4H42U 2F9OA 1NRRH 1C5WB 2ASUB 4Y10E 1TALA 2F4LA 1XUIA 3SGAE 2DE9A 1FUJA 3HGPA 2QN5T 3F9FA 4ZAEA 4A6LA 3TIUA 4I8KA 2A4RA 3OE7D 1BJUA 3SI3H 1Y59T 2GP9B 2YNBA 2ALPA 1EOJA 1E1RD 3BG8A 3A80A 2KCAA 1GJ4H 2BDGA 1C5XB 2Y5FA 1CGJE 1N6YA 2I6QA 2C3SA 5F03A 1W0JD 4U32A 3T26A 1ABIH 2BY8X 2FYRA 1P2OA 1C1UH 1THSH 2XCNA 2XTTB 4D8NA 2FOAA 1ELTA 5GIBA 4NA9H 1TRMA 3BTME 2AMPA 5HIYA 1B0FA 2J5UA 2XCFA 1AE8H 2AMDA 3FP8E 2FTMA 2GVFA 4X8VH 4UEHH 4AG2A 1HIAB 5ABWA 1TPAE 1TNKA 2BLVA 3ZYEA 4AORA 4ZHLU 1S83A 3A82A 1XUFA 4J1YA 4XDEA 2BD2A 2DUCA 1SGNE 1EP5A 3S7KB 1B7XB 4NIVA 1YPLH 1SQTA 1S5SA 5IK2D 3A7ZA 4E05H 1OWDA 2VJ1A 1A0HB 1C2EA 1O2LA 1S6HA 1THPB 1ANEA 4OS6A 2F91A 1BBRK 1J8AA 4ISLA 3P6ZB 4JZDH 3FP6E 2J98A 3SO3A 3TH3H 1G2LA 3K9XB 1V2JT 1UTMA 2OBOA 1J9CH 1LHGH 3E90B 3WY8A 1TNHA 3O8DA 2Z9KA 3EA8A 8LPRA 2A5AA 7LPRA 3Q00A 3S9CA 4GCHF 3LGIA 1BITA 2J92A 1W12U 1A0JA 3A8BA 1V3XA 1FONA 3PV2A 2GCTC 1YF4A 2GCHF 1YPMH 2BD7A 2PW8H 2Z9JA 1O2TA 2YMSC 5CHBA 4HGCA 3UB0A 4GHQA 1FPCH 3MO6A 2QYIA 2UWPA 2EQNA 2Z3DA 2CMYA 3TNTA 1RTKA 5A2MH 4FETA 1SLXB 2J34A 1NS3A 3VXFH 1C4V2 4NA7A 1T8OA 3EE0B 3LOXA 3MTYA 4ABDA 4KKDA 1A3BH 2W5EA 2GZ9A 3MHWU 2STAE 1P01A 2QF0A 3HK3B 4OM9A 1O5BB 3M7TA 5C1XA 1ZPZA 2QE7D 3FZDA 1OWJA 2JJ1D 2W7UA 1CHGA 2BMGB 2J94A 1GCTC 1G3EA 1O0DH 3TGJE 1OWEA 2WPDD 3LPRA 1O2HA 1C1MA 2WUCA 3TGKE 1UVTH 1O2QA 4TSFD 1IQIA 2W6ID 3MU0A 1QRWA 2P3UB 4Y79A 1NM6A 4Q4LA 1O2OA 3QGJA 4YT6H 1GHAG 4WWYA 4CBOA 2PKSB 1AZ8A 4FUCA 3CNRA 3ITIA 3NK8A 1E79D 2AGIX 2C8WB 4Q7XA 4UFDH 1GJBB 3FP7E 1MCTA 3AW0A 4AX9H 5EJZA 1O3DA 1SGFG 4MNWA 2I6SA 2IJD1 3V13A 2WYGA 3LONA 2FO9A 4KELA 3QZRA 1GI3A 3SQHE 1S0RA 1O5DH 2H6MA 2RFKC 1KLTA 1EOLA 4AYVB 1T31A 3A7XA 3K2UA 3M35A 7GCHF 1FN6A 1NFWA 4ZKRU 3A8AA 1Z6EA 2HPPH 1EQ9A 1GBDA 1PQ8A 4LZ1H 1O3AA 1HGTH 4GHTA 3T27A 2OTVA 3BN9A 1F0SA 4UDWH 3S7HB 1PQ5A 3OX7U 3M3SA 3RXDA 1ELFA 5C5OA 5DGJA 3K65B 4J2YB 1O30A 1PPBH 4JZFH 5C0UA 1EPTA 5DO4H 1IQMA 2CN0H 3RC5A 5DP3A 1HBTH 3SV8A 1AWFH 3PMBB 1PPFE 1YCPH 1FMGA 1ARBA 1NRSH 2VWOA 5GXPA 2Y6TA 1C2LA 1K1IA 4B2BA 3SV9A 2W26A 5EQRA 4ZCNA 2CF9H 4I7YH 1BRUP 1KLJH 1ELDE 1SI5H 2IPHA 1L2EA 3PB1E 1TNJA 3F2FA 4NFEA 3OEED 4FUHA 1E34B 4ISHH 1EP6A 5ETXA 3LGWA 1CBWC 2OBQA 4BXSA 2FOCA 2F9VA 3UNQA 3K6YA 1O2VA 3OEHD 1OWHA 1G36A 1YM0A 1GVKB 4NFFA 2UUJB 1D9IA 3O8BA 1HAIH 1WTGH 2VNTA 2WPIS 1UTOA 3F2GA 4TY7A 3F68H 3P70B 2J9NA 4BANB 3S9AA 1ZJKA 1OP0A 3PTNA 2HVXA 1W0YH 2D2DA 4NWLA 5DP4A 4AFZA 3RU4D 3AK5A 1DUEA 1H8HD 1ZTJA 1UMAH 1C5TA 4X8UH 1L1JA 2TPIZ 4X2YA 3RXIA 1DFPA 1O32A 4Q2KA 1J17T 4GVUA 1SQRA 3SJIA 3E8LA 1Y3XA 4HTCH 1GJ7B 2XWBI 3A83A 2YNAA 1GGDC 5F8TA 1YYY1 4SGBE 5EXLA 1TGTA 1B0EA 1BOQA 1O3KA 3GYMA 1SLUB 2IOTA 1DPOA 2GV6A 2UWLA 1AKSA 2GT8A 1PYTD 1VITH 1D3TB 1QCPA 3BG4C 1JWTA 2VGCB 4ASHA 3AVZA 1CT2E 1FY4A 1C1PA 1AZZA 1GJCB 2PGBB 1FAXA 4B6EA 5ESBA 3RM2H 2NU4E 3WWBA 5K7RA 3GICB 4SGAE 8GCHF 1DDJA 1CQQA 1O31A 3GCOA 5T6GA 1AU8A 1O3EA 4IBLH 4X0WU 3ZYDA 1UJ1A 3E0PB 1GBIA 1Z1IA 4JZ1A 1F0RA 3P95A 1N8OB 3SUEA 2AYWA 3MNSA 2JDID 1O34A 2GMTB 4O3UA 1BUIA 1O2XA 1YLNA 1Y5AT 4MNYA 5L6NH 1ELEE 4TWYA 4F48B 2PFEA 2ZGJA 2BX4A 1XVMA 3SU2A 3H09A 5B6LA 1P03A 1NFYA 1AO5A 2ZU2A 4FU8A 1O38A 2V6NA 1BCUH 3T29A 1MKWK 4GPGA 3NKKA 1YPJH 3SNAA 1CT0E 2G5NA 2LELA 3MFJA 1BT7A 2BM2A 1BHXF 3ZZ4A 1P12E 1O33A 2V3MA 3SNDA 1OHHD 1J14A 4I8LA 2P94A 2L6OA 2OXSA 4ABEA 4K2YA 2VB0A 4AC9A 5BPEA 2K1QA 5C67A 4NZQA 1G37A 4VGCB 4AN7A 3ATKA 1H8ED 4XOJA 3PTBA 1UK2A 2AS9A 1IHSH 1TX7A 2WZQA 5EPNA 5GNDA 2M5TA 3PMJA 1O3NA 1QJ7B 2FODA 4UFGH 4JK5A 3UOUA 6LPRA 1G30B 1O2KA 3MU8A 4O3TA 3UY9A 5EW2H 1NRQH 1MABB 1V2TT 3UIRA 5CHAB 1SVPA 2HVYB 2P93A 1A5IA 4FOUC 4X2XA 4Y0ZE 3DA9B 2AERH 4RN6A 1NROH 1DXPA 1YPKH 2OLGA 1O2JA 3QX5H 5EXNA 1B5GH 1MCVA 2G4UA 3L6PA 2ZFRH 1GDNA 4AGJA 1MUEB 1TBRH 1UHBB 1GJ5H 3UWJH 1P10A 1KYNA 1ETTH 3DHKH 5FHTA 1TGBA 3KYFA 4INKA 3ZVCA 3E6PH 5C20A 2AHME 1HAGE 2PTNA 3TVJB 2UUYA 3O8RA 1F7ZA 1AD8H 1P2KA 1YCPK 4Q80A 1VCQA 5FPSA 3BIVH 1MAXA 3ZVAA 5EGMA 1WOFA 3RMLH 5DJ7A 1JRSA 1XX9A 2IN2A 1ZSKA 3F2HA 2NWNA 3KQEA 3Q3KA 1YKTA 2EY4C 4OGYA 3RC6A 1V2LT 1GBJA 1EJAA 1ELCA 1QJ6B 1A1RA 5EQSA 4ISNA 1LVOA 1SLWB 3RM0H 1GL0E 1H8IH 1PPHE 2QC2A 3LGUA 4ISOA 4F4OC 4LXBH 1OOKB 2EC9H 1SC8U 3OTPA 2WHXA 4CH2B 3QZQA 3A7TA 2FYQA 5CMXH 2ZDAH 3HPTB 4DG4A 2Z9GA 4CRGA 1ZHMA 2WSSD 1C1SA 2GZ7A 4INLA 1LHFH 1O3HA 5C2ZA 2J4IA 2VINA 1GMDG 1GG6B 4ZH8A 2ZA5A 4K8BA 1LDTT 1BMNH 2R2WU 1H9LB 3MH4A 4KTUA 4X8SH 1GBFA 4Y7BA 3GISB 2K8IA 2ZI2H 4WMEA 1TMTH 3LKWA 3EYDA 1PQAA 2BHGA 3M5OA 5C1YA 1HAVB 5DK1A 1TX6A 2UUKB 3KF2A 5LGOA 1C4Y2 1KDQA 4YOJA 1L4DA 2VH6A 2PKSC 1BRBE 1MAYA 1CA8B 2Y7XA 1GL1A 1CGIE 2A45B 2ZHEH 3GCTF 4GLYA 2CJIA 1HAYB 1T7CA 4WMFA 1TE0A 5EJLA 2KAIB 5HM2A 1IQHA 1GMCG 1ESTA 1ZSLA 2Q6DA 1SGDE 2EA3A 1TGNA 1AE5A 2BTCE 5L2ZH 5JYIA 3FN8A 1O2IA 2C93B 1A0LA 1Q2WA 2F9UA 4YESB 1ZGVA 1W0KD 1C1OA 2ODQA 3TK6A 3GY8A 3FFGA 2P3TB 1V2MT 1C4U2 4AFUA 2A4GA 2O9QA 4B73A 3ZZ3A 3QLPH 1XVOA 2STBE 1KXFA 3SJ9A 3RMNH 2PLXA 1HLTH 1KLIH 1D3PB 2BD8A 2HNTC 3LDXH 3A7VA 1EAXA 3MH7A 3MMGA 2ZGXH 2HWLB 1VITG 3OSYA 2HNTF 4K1TA 1GHZA 1ORFA 2KFWA 7KMEH 2FP7B 2Z9IA 4LK4A 2LNCA 2BQ6B 1K2I1 1GBLA 4ACAA 1HAXB 2ZFPH 2F9PA 3DT0H 1FX0B 3TPIZ 5FPYA 4IGDA 5GPIB 3ODFA 1L4ZA 2G81E 4D7FA 1UK4A 2ZGCA 1GI5A 1AMHA 3ATWA 2G52A 4ASUD 4AB9A 1C9PA 1H9IE 1TABE 3VB4A 2C4FH 3ZZ9A 1ANDA 1P05A 1DOJA 2JH6D 4ZMAH 3HKJB 1FQ3A 1UTNA 2RDEA 3TK5A 1LHEH 1TMUH 5EXMA 1Z7KA 1HRTH 2BQ7B 2CV3A 2B0FA 3Q3YA 2ZG0H 2BLQA 2ZU3A 1GHBF 1G3DA 5DG6A 3PRDA 3E0NB 5HYOA 2FOBA 1MTSA 4MPXA 2Y80A 1BRAA 1X7AC 5EJ1A 3JZ1B 1NO9H 1D3DB 3BTDE 4CRFA 1C1QA 5DN6D 1K1PA 1CT4E 2HLDD 2SGFE 4NSYA 2P16A 1W8BH 3UPEA 3HATH 5T3HA 4OS2A 2OQUA 4TT3D 2UWOA 3A89A 2BXUH 1KTTB 2C8ZB 1SLVB 1N6XA 1V2RT 1BHXB 4KGAA 3QO6A 3SW2B 1O5FH 3MO9A 3E3TA 1LKBA 2KM0A 1LPGB 2BD3A 1PJPA 4NCYA 2V3HH 1O3CA
chains in the Genus database with same CATH topology
1WQVH 2W3KA 4JMYA 2Q6GA 3ESTA 2ZIQH 2RA0A 1T8NA 2VIPA 4O03A 1YCPM 3B23B 1GHYH 3SZNA 3U1JB 2PSXA 1PPEE 1NTPA 3GY4A 1A2CH 4FUBA 3I29A 1FY3A 1GBKA 1ZYOA 4YO9A 2A32A 4DURA 3GOVB 3TH2H 1N1LA 2VGCC 5JBTA 3M3VA 1O2NA 1JBUH 1SL3A 5IYTA 4I33A 3NCLA 1QQUA 3ZZ8A 1FIZA 1OPHB 1Y3YA 4RKOB 3KEEA 1EXFA 1K1MA 2G51A 4R8TB 2FDAA 4Y8ZA 3M61U 2PWXA 2F3CE 3RXSA 1ELGA 4K8YA 1DUAA 5A8YA 1O35A 2BDBA 3VB5A 1P09A 3PLBA 3SU5A 1N8OC 1XXFA 2XC5A 2B7DH 1A4WH 5A8ZA 2GMTC 1LO6A 4F49A 2G55A 1FY5A 1PPZA 1FLEE 1QRZA 4MPVA 3B8JA 1ZR0A 2BB4A 1P2IA 1QHRB 2SGQE 4IMQA 3O8CA 2NU3E 2RDLA 4GCHG 4MQAA 2PHBA 6GCHG 3E91A 2QCYA 1MBQA 4MG3A 2ZTXA 1LQEA 1ZZZA 2GCHG 1AFEH 4FU9A 4ZKOU 2BD5A 3RXRA 1TNLA 2FIRH 1BMMH 2ZDMA 3M3TA 3MWIU 1GHWH 4NG9H 1EUFA 1XKAC 3BTKE 4VGCC 3UQOA 2AIQA 4WH6A 3SU3A 4NA8A 4X1SU 1TOMH 5L30H 2RA3A 5EU8A 1Y8TA 4X8TH 3D23A 1HYLA 3D65E 3W95A 3UUZA 4D76A 3A85A 1EJNA 1WYKA 4X1RU 4A1XA 1XMNB 2A0QB 1BMAA 1MKWH 1DM4B 1SOZA 2F9BH 5CHAC 3AW1A 3KQDA 1D3QB 1QB9A 2XYAA 4Y6DA 3EA9A 2ZNKH 3D62A 1DSUA 1GJ9B 4WXVA 3GY6A 1ZRKA 2BDAA 4IN2A 2FOHA 4NWKA 5DP8A 2BVXH 3PWCA 1RRKA 2OUAA 4CRCA 4FVBA 1SGYE 1NY22 2G00A 2HRVA 3SU4A 1O3MA 1Y5UT 1Z8JB 1CO7E 2FM2A 1BB0B 2PUXB 5E0JA 2BD9A 3QDZB 1UTQA 1VGCB 4DJZB 1GHAF 1TFXA 2OCVB 4NGAH 1NT1A 2FS9A 2BY6X 3QN7A 1P2QA 4DIIH 2ODPA 1C1TA 1LMWB 3PO1B 2QXJA 4Q7ZA 1HIAA 3AAUA 4WF8A 1GJ8B 2AGEX 1O3LA 2GZ8A 3V3MA 4DCDA 1C2JA 2FI5E 2G8TA 3ZZ7A 2Z7FE 1YPGH 2J95A 4LZ4B 4WY3A 1W3CA 3MU5A 1QBNA 1VCPA 1OWIA 2OD3B 2TIOA 4UE7H 1SFQB 4RSPA 4WXIA 1V2VT 5G4BA 1DE7H 3BTTE 2VH0A 1UTPA 3CS0A 1C5OH 1UTKA 1GG6C 4Y8XA 4JYUH 1INCA 1O3FA 2HGTH 3RXAA 3QWCH 4ISIH 2FZZA 3VPKA 3RXUA 1HAHH 1HNEE 3CP7A 2ZPRA 4ZKNU 1CVWH 1SB1H 2SNWA 5J4SA 1YLCA 1C5UA 4D9QA 2OC0A 2ZCKP 5JBCS 2R9PA 4YLQH 3PMHB 1UCYH 4AG1A 5J4QA 1MTWA 4U2WA 4CRDA 5DP9A 4ABBA 1DICA 1G32B 1ZSJA 1AN1E 1K1JA 1O2PA 5E2OA 1IQGA 1XUHA 4CRAA 1EAIA 2ZHFH 3KGPA 5AFZH 1W13U 1WQSA 2OC1A 1AUTC 3PV4A 2OC7A 4B1TA 3DD2H 1DVAH 4ABFA 4R0IA 3ZVDA 4CR5A 2TGPZ 1IHTH 5T6FA 3SV6A 1PQ7A 1CSOE 1VJAU 1Z6JH 1AY6H 1AVGH 3SU1A 3NUMA 1TNIA 1OYTH 3BV9B 3NZIA 4UFFH 1C5PA 3BTEE 4I8HA 1WBGB 2SFAA 2ZFFH 1ZTLA 2AMQA 2BD4A 1LTOA 1C2IA 1BDAA 2A5IA 2SGAA 1F5RA 2ZTYA 5HM9A 1C1VH 2A2QH 2PV9B 8ESTE 1JIMA 1V2UT 2WYJA 2VIVA 1DWCH 1Y5BT 1K1NA 2R3YA 2ZDKA 1FJSA 2VVCA 3HKIB 2BLOA 1BJVA 2W7SA 3U8RH 5JB9S 1QRXA 4JK6A 4HI3A 1FIWA 4B75A 1SGPE 2QA9E 4MPUA 4NIWA 1SPJA 4ZXXH 1S0QA 2HPQH 1LQDB 2XWAA 5C3NA 4A92A 1MU8B 2FX6A 1NN6A 4YOGA 1UCYE 1F92A 1ID5H 5FPTA 4BAOB 5A0BA 1WTHD 2SGEE 4DY7B 1RD3B 2ZEBA 2W3IA 3M5MA 1QL7A 4WMDA 3RXEA 2TBSA 4BTIB 4UD9H 3RUOA 3VB6A 4CBNA 1TNGA 3STIA 3B9FH 1C5QA 2CGAA 2GTBA 1AHTH 4B2CA 1W11U 4TPIZ 2EI8A 3RXBA 3PMAB 4AFSA 1SQAA 2FOFA 2H5DA 3PWBA 1HJAB 2ANKH 1GVLA 3E16B 5H4IB 3V7TA 3ENSB 1BTWA 1O5GH 1AGJA 1KY9A 3LU9B 5DP5A 4ZUHA 1MH0A 1CGHA 2ZU5A 1O3OA 4FUJA 5GCHG 1SGRE 1SBWA 1KTSB 3BSQA 1UVPA 1G3CA 1S85A 2HNTE 1HFDA 4UFEH 4BAKB 5F8ZA 2P3FH 2RG3A 2BY9X 5DPAA 1C2KA 3LJOA 1K28D 2TRMA 5EQQA 5JB8S 1BQYA 5FXLA 1GJ6A 1P2MA 1FAKH 3ATIA 1RTFB 3LH3A 1CHOG 3RXTA 4X6PA 5PTPA 3MU1A 2TGAA 1EX3A 2F83A 3ZVEA 1J16A 1BTHH 1XUGA 2V0BA 3ZZ6A 1BMLA 4Q7YA 2TGDA 1RIWB 5DP7A 4Y76A 1ABJH 1TX8A 3SV7A 3W94A 4DT7B 3P8GA 1QBOA 2A2XH 3PLPA 1E0FD 2NU2E 4XFQA 4A1VA 1O36A 1P02A 4ABHA 1K22H 5HXFA 5E8EH 2BDHA 2QXIA 4E7RG 3EGKH 4O97A 1G9IE 3TH4H 1V2PT 1SGEE 3H7OA 2WV4A 4MNXA 5EOKA 5FBEA 1S82A 1RS0A 1FY8E 1O2ZA 3TK9A 1EAUA 3SHCH 2ZCHP 5AHGH 3EDXB 1PFXC 2O8MA 3GYLB 1OS8A 2XBVA 3QTOH 1UO6A 1QURH 1AIXH 1A61H 4XBBA 1QB6A 2WPMS 1F5KU 2ZU4A 3I78A 3EA7A 2EI7A 1XXDA 1GMHF 1V2OT 1GI4A 1QB1A 4K5ZA 2ZF0H 3SU6A 2QAAA 4OGXA 1UCYK 1P04A 2Y5GA 1M9UA 1KXDA 2VU8E 5HGGA 2R0LA 2XNIA 1UVUH 3SNCA 4AYYB 1JIRA 1ZOMA 1T4UH 1THRH 2R0KA 3T28A 5CE1A 1AVXA 3R3GB 2A4QA 1TBQH 1TAWA 1O5AB 3RXOA 2O8WA 1ETRH 3N7OA 1P57B 1QJ1B 4AOQA 4MNVA 4H6TA 1XUKA 1NZQH 1QIXB 1MBMA 1ZPBA 3LH1A 4A7IB 3GCTG 1DSTA 1TQ7B 1P0SH 2B9LA 1GMDF 3VGCB 2BLWA 3E1XB 1LHDH 3UNSA 1LHCH 1WAYB 2ZP0H 2ZECA 3TITA 5F8XA 1NESE 2CF8H 1P2NA 3ZVGA 1S84A 1IQKA 4IMZA 2BY7X 1O5EH 3FANA 3M7UA 5EPYA 4X2WA 1WU1A 2ZC9H 1UVSH 3LT3A 4ZXYH 1GI2A 3F9HA 1C9TA 1VGCC 1A7SA 3UREA 4Y7AA 4ABAA 1TGSZ 2ZGBH 2ZHDA 1SSXA 3JZ2B 2Y81A 1FV9A 4XBDA 1GJAB 4ZHAA 1FY1A 1E38B 3ATLA 2CHAB 1O3PB 5TCAA 4DGJA 3PO1C 2HOBA 4X6MA 3TJNA 3RXLA 1LPZB 4OS1A 1O37A 1P2JA 3CS7A 1QL9A 2PKAB 1BTPA 1P8VC 2NU0E 1Z71A 1ZGIA 4B76A 1EKBB 1T8MA 1HJ9A 1K1OA 2GDEH 1UHBA 2VVVA 1GI1A 2C90B 2P59A 1WSSH 1VCWA 1BZXE 1K9OE 1XUJA 3OYPA 3PLKA 5ESTE 3LGVA 4INHA 2BY5X 2H5CA 1C5RA 2F9NA 1A3EH 3OTJE 2VVUA 1V2QT 3GDSA 3HGNA 1L1NA 1S6FA 1SGIB 1IOEA 3TU7H 2ZKSA 2PR3A 4I32A 4U30A 5LPFA 1KXAA 1GWAA 3MNXA 3M36A 3IG6B 1F0UA 1FNIA 1HAOH 1HPGA 1YP9A 3LIWA 1G2MA 1E37B 1EAWA 1MKXH 1A46H 1DY9A 3UNRA 2THFB 1ZMNA 4WH8A 4LOYH 1O2SA 4AFQA 1TPOA 1ETSH 1C1RA 2BDYA 1TGCA 3TLOA 1TMBH 1C5ZB 4CRBA 1TA2A 2ULLA 1GBCA 2H9TH 2ZHWH 2JETB 2FX4A 5JBAS 1ARCA 1D6RA 4X1NU 4YOIA 3S9BA 1VJ9U 2FS8A 8KME2 2JH0D 1SGCA 1D6WA 1NC6A 1ZHPA 1TRYA 1SGQE 2XW9A 4CH8B 1C2DA 3SJKA 2Z6BD 4AB8A 3KL6A 5F6MA 1F5LA 1SR5C 1HAVA 4KTCA 9ESTA 1C5VA 3UTUH 2PSYA 1GHVH 1AB9B 3SUGA 1UK3A 1CA0B 3F6UH 4CREA 1ZMJA 1O2RA 1FI8A 1T4VH 1TLDA 3RU4E 3RP2A 3KCGH 1GCDA 4E06H 2XBYA 3TJOA 4WJG2 2WINI 1LPKB 1GDUA 3SUDA 2KAIA 1MZAA 1FZZA 4YTAA 4FUFA 1SFIA 3C1KA 1C5SA 2OQ5A 2D8WA 4Y0YE 4BAHB 1MTNB 2FOMB 4NIYA 1ANCA 3GY3A 5LPRA 1O2UA 4K69A 3DFJA 3BTHE 4BTTB 3GCNA 2D26C 5K0HA 3Q77A 3BF6H 3GY7A 1YPHE 3A87A 2P95A 4X1QU 3ZV8A 3A7WA 3ELAH 2AEIH 3CENA 3I77A 1GPZA 2ZHQH 3KN2A 3RMOH 2A5KA 1O2MA 2GV7A 5LH8A 3TJUA 5GJ4B 1W2KH 5AVDA 5JDUB 3TGIE 3F9GA 1O3BA 3U8OH 2BX3A 3UQVA 2PKAA 1HXEH 1EPTB 1T8LA 2ZU1A 2FESH 1ZHRA 2XC4A 4WVPE 1GI8B 3BEIB 6CHAB 2H9EH 2VWNA 2ZDNA 3H5CB 2BVRH 2BXTH 3MNCA 5L2YH 3Q3XA 3SQEE 1LKAA 3GDUA 4K3JA 1Y3VA 3SHAH 1SQOA 3UFAA 1TONA 1YLDA 1YGCH 3VXEH 2ILNA 1NRPH 2ZZUH 1HJAC 4DOQA 2QGRA 1QQ4A 1L1GA 4TYDA 1RXPA 1GBAA 4XBCA 1DWBH 2V35A 2XBWA 6GCHF 2BOKA 1MTVA 3ZZ5A 3T62A 2Q6FA 1BTUA 1Y3UA 5IDKA 1ELBA 3V0XA 1TRNA 3FZZA 2VIWA 1IAUA 1AVWA 2P8OB 4BXWA 4FUIA 3QTVH 1C2FA 2H1UA 2HLCA 1SGTA 2A7HA 3Q76A 2GX4A 2Z3CA 3SOSA 5AF9H 2ALVA 3KNXA 3MI4A 4CHAB 4XSKU 4BAMB 1P11E 1OYQA 2FI3E 1FPHH 2O8UA 1MD7A 1AFQB 3RXVA 1RIWC 2ZGHA 1C2MA 4IC5A 5LPEA 4A5TS 3RXHA 3FVFB 2VWMA 2ZCLP 1O2YA 2IJOB 1JXPA 5I46H 1OP8A 7GCHG 3URCA 5JPMH 3A8CA 1EZUC 1GBHA 5A0CA 4GSOA 1KXEA 1HUTH 1GHXH 1OSSA 2O8LA 2ZQ2A 5BRRE 1AKSB 3BEFB 1C5LH 2QV1A 3VEQB 3UWIA 5SGAE 2BDIA 2ESTE 3MU4A 1KXCA 2NU1E 4I8JA 1SOTA 4BAQB 3A8DA 2WPHS 5EW1H 4BNRA 1K21H 1BTYA 3BTWE 3RXCA 2WPLS 2FEQH 1MKXK 1GVZA 3L3TA 3SBKA 1O39A 2FTLE 1BTXA 1HCGA 2ANYA 2XBXA 4OS7A 2FMJA 4JYVH 1HAPH 4MDSA 2SGPE 3P92A 2ZO3H 1O3JA 1K1LA 2AFQB 3STJA 4ABGA 1DX5M 1OP2A 1BIOA 2OP9A 3RXGA 2FOEA 1C1WH 1WV7H 1H4WA 5FCRA 1QA0A 3MH5A 1MU6B 4BOHA 1V2ST 2V3OH 1PYTC 2QXHA 1YPHC 1HAZB 4FUGA 4JZIA 1TA6A 1ZTKA 4GUXA 5DP6A 1RFNA 1GI9B 2ZFQH 3GCHB 4MPWA 3BTGE 1QR3E 3BIUH 3S0NA 1ZRBA 3F1SB 3SJOA 1HB0B 4Z6AH 3PROA 1QGFA 3HK6B 3ZVBA 3VGCC 1ELAA 4HFPB 4NZLA 1PPCE 3ZZCA 3GY5A 1NFUA 3P17H 1W0ZU 2ZDLA 3K6ZA 3RLWH 3UR9A 3MYWA 4RKJB 2QF3A 1NFXA 3OY5U 5FX6A 3DUXH 1DWEH 3SU0A 1OKXA 1TYNA 4FXGH 2R2MB 3P8NA 5A8XA 1TPPA 4Y11E 1V2WT 3SORA 1MQ5A 3GDVA 2ZQ1A 1QBVH 2CHAC 4KTSA 2ZFSA 1MD8A 1AQ7A 1OWKA 2AIPA 3MH6A 1BTZA 4X6NA 2PTCE 3EAJA 2BDCA 2A7JA 1EASA 1Y3WA 2EI6A 1P9SA 1ESBA 1C2GA 1P3EA 1Z8IB 4FVDA 3URDA 1F2SE 4MTBA 2QIQA 5HMAA 2C8YB 1TBZH 3U98H 5T6DA 4QT8C 3U8TH 3RC4A 1RTLA 1W10U 1F0TA 1SHHB 4FUEA 1ZLRA 4X2VA 4MLFB 3TNSA 2BZ6H 1QNJA 3OY6U 1VZQH 1T32A 2A1DB 5FCKA 2Q1JA 1HV7A 3RXMA 4NSVA 1W14U 4I31A 1TOCB 2J2UA 3KHVA 5E2PA 1NPMA 8GCHG 4ZROA 2PUQH 4DIHH 2A4OA 3S69A 2AH4X 1DS2E 2VIQA 1DT2A 3LGYA 5GWZA 3SJ8A 1RJXB 1NRNH 3U9AH 3P8FA 1QFKH 2ZFTA 4THNH 3ZZDA 4ABIA 1V2NT 1TPSA 5DKMA 9LPRA 3T5FH 1O5CB 1HDTH 2QXGA 2BQWB 3NXPA 1QTFA 4CR9A 2OC8A 3ATMA 3RXFA 3NWUA 1WUNH 2GDDA 2VIOA 2GGVB 1Z8GA 3DFLA 3LJJA 1DANH 3NPSA 3U1IB 2XXLA 4D9RA 2JETC 4UONA 3IWMA 3PM3A 4O9VA