3RXJA

Crystal structure of trypsin complexed with 4-guanidinobenzoic acid
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxjA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxjA02
3T25A 1FY4A 2P3UB 3SU4A 2ZPRA 1AVXA 2XBWA 2A4QA 1PYTD 2BYAX 5EXMA 1K9OE 1TFXA 2CMYA 2FO9A 4HI3A 1Y3XA 4CR5A 1CA0C 1YPJH 2Y7ZA 2SFAA 5EPYA 1W12U 1HDTH 1OP2A 1CGJE 1ELEE 3KQEA 1KIGH 1C5OH 1CBWC 1KXCA 1SMFE 3FZDA 1K22H 3UNRA 2TPIZ 3VB3A 3QX5H 2NU1E 1C2FA 2O8WA 2V35A 9ESTA 3TGKE 4WXVA 1RTKA 4Y7AA 1Z71A 4X6OA 6GCHG 2F3CE 2J92A 4GLYA 1DLEA 2A1DB 2PTCE 3P17H 4X8VH 1WCZA 2AERH 3LH3A 1GI3A 1ELFA 3TLOA 3Q77A 1XVMA 4B71A 1QY6A 1SGRE 3K6YA 1HAVA 2F91A 1QBOA 2XW9A 5DP5A 1MCVA 1GBLA 2BDBA 4IMQA 2UWOA 2BLQA 1F0TA 8ESTE 3AAUA 1XX9A 4SGAE 1GL1A 1EASA 2KAIA 1SGYE 1TNGA 1V2PT 3A84A 1DLKB 3D65E 1QTFA 4K1EA 1N1LA 1FJSA 4QT8C 3KCGH 3TJNA 3LGYA 2XC5A 4DIIH 1EXFA 3E3TA 1KDQA 2G00A 1FMGA 4J2YB 4TY6A 1IQEA 1C2DA 1ZMLA 2ZFPH 2D8WA 4IMZA 4FUFA 2PKAA 1V2QT 1GGDB 3GY5A 3ZZ3A 3E0PB 4Y6DA 3RDZA 3LDXH 4X1NU 1IQNA 1GVKB 3R3GB 4JMYA 1O2UA 1QURH 5T3HA 2NWNA 2ZI2H 1A3BH 1GI9B 2BXTH 2C4FH 5PTPA 3MMGA 3LIWA 5FCKA 3QWCH 1G2LA 1C5ZB 1UVUH 3ZVBA 1ZSJA 2FLBH 1DVAH 3RMMH 4UE7H 2P95A 4I32A 4IBLH 1G2MA 1GG6B 1F0SA 1G3DA 4CRDA 2V3OH 1SLXB 3SORA 1O3PB 1SG8B 4Y8YA 2XCFA 1UVOA 3PTNA 2FZZA 1CO7E 1L2EA 1UTQA 2FOCA 3SUGA 1SQOA 2BQ7B 1BDAA 3TK6A 3RLYH 4AG1A 4SGBE 3K9XB 1Z6EA 1O3JA 4MDSA 3T26A 1C1TA 3DFLA 2HNTF 4YT7H 2BD4A 3QTVH 4XSKU 1RD3B 4ZH8A 4LK4A 3G01A 1DT2A 5HYOA 1C5SA 4AORA 1TRYA 2QY0B 2UUJB 4A1TA 2FX6A 1OXGA 2BY9X 1QQUA 3SU6A 2OC8A 2ZDMA 1TPOA 4B75A 1ORFA 3P95A 4ABIA 2D2DA 2VJ1A 2ZQ2A 1GVLA 1S0RA 3TIUA 2ZTYA 1D6RA 1BHXB 1TGCA 5DP3A 1BMAA 3E0NB 3LU9B 3URCA 1KLTA 1K28D 1A7SA 1C9TA 1IHSH 2G51A 3RXPA 2ZCLP 1ZR0A 2F9VA 1MZDA 1F5KU 1A5HA 1QJ1B 3VEQB 5FX5A 1SR5C 1FI8A 1NRNH 1OP8A 1YPKH 1Y3WA 1C2IA 2QC2A 1GHAF 2Q6DA 1GJBB 1GI5A 4WVPE 6ESTA 1BRCE 1AFQB 2ZU1A 3UNSA 3E8LA 4K5ZA 4UFFH 1KXEA 1ZHMA 2XYAA 3CS7A 1O3HA 2OINA 4PROA 3BIVH 4OS1A 1VITF 3LH1A 1HXEH 1V2TT 6LPRA 2WPIS 4ABFA 5JBAS 5EPNA 2ILNA 3SUDA 2EI6A 1W7GH 1S85A 5FPSA 2BXUH 2DUCA 2BX4A 2BQ6B 1GCTC 1ZRKA 1EPTB 1GMHF 3UPEA 4MTBA 4OS2A 1LVYA 1RFNA 2BDYA 2CF9H 4DG4A 1C2LA 3T5FH 4B74A 1T31A 1C5UA 3EE0B 2FIRH 5GDSH 2Q6FA 2FI5E 2ZGHA 1GHVH 1YPLH 1BBRK 1V3XA 4WMFA 3F9GA 1FN8A 1WYKA 1MU6B 1IQFA 1NTPA 2THFB 5JYIA 1V2RT 2BZ6H 5C20A 5GIBA 3LGUA 2SNWA 1ABJH 1A0HB 3MTYA 5FBEA 1K1OA 4INLA 1QB6A 4CH2B 1J14A 1L1GA 3PLKA 1LPZB 1DX5M 1A61H 2EA3A 5AVDA 1N8OB 3M61U 4ZROA 3A87A 2F9PA 1XUKA 3B8JA 1LCYA 3A7XA 1O3BA 2XTTB 1LPGB 2J4IA 2VU8E 1Z6JH 1CVWH 1E36B 3ESTA 4YLQH 1O5BB 2J38A 3IG6B 4O3TA 3JZ1B 4YO9A 3RXMA 4LZ4B 1OSSA 1NY22 4B2BA 5F6MA 1SQTA 1KLIH 3DT0H 3BTDE 3MFJA 5DP6A 2WYJA 3TH4H 1SOZA 2FI3E 2H2ZA 4NZLA 1GJAB 1AFEH 1RIWC 2VGCB 1OPHB 1K1PA 1A0JA 4NIYA 4TWYA 1JMOH 1LPKB 2ZDVH 4NA8A 3RUOA 3BF6H 2RA0A 2JETC 3S9BA 3JZ2B 1FY3A 3PLBA 1ZTKA 4JCNA 4KTSA 1ZSLA 1S5SA 4O3UA 4UFEH 3FVFB 3SZNA 1WOFA 1EAXA 4XOJA 4GUXA 1ETSH 1SBWA 3S7HB 4I33A 1AE5A 1O2RA 4AYYB 2PR3A 2B8OH 3RXKA 1GJ9B 2Z3CA 3GY8A 1UHBA 5DKMA 1QB9A 2ZWLH 3K65B 1MTNB 3BEFB 1MBMA 4YT6H 1P57B 2Y5HA 2STBE 5FPYA 3GDSA 2HNTE 2VIQA 3PB1E 1SC8U 3GOVB 2J2UA 4WF8A 3HKIB 2KAIB 1DWDH 3MH6A 1DOJA 5I25A 3SJOA 2FOBA 1P04A 1IQIA 2G81E 1GMCF 1XUJA 1FY5A 4O9VA 2BHGA 2ZTXA 1TX8A 3MO3A 2B0FA 3SV8A 2PKAB 3SGAE 1OP0A 2V6NA 4X6PA 7GCHF 4DURA 1QIXB 3V13A 3GY4A 5B6OA 1ELAA 1BTPA 1O33A 1EP5A 3E91A 3MOCA 4HZHA 3FFGA 3QZRA 1Y3YA 2WPLS 3MNXA 5DPAA 2F9OA 1QQ4A 5AFYH 1G30B 2UUFB 2GMTC 1PPFE 2XRCA 3KQBA 1MU8B 3NZIA 1C2HA 1TNJA 1GMDG 3MNSA 4K1TA 1TALA 1ESTA 4UFDH 1YF4A 4FUDA 2FX4A 4RKOB 1XXFA 1GHBG 1O2HA 1GJ8B 1S0QA 5DGJA 1UK3A 1UJ1A 2H1UA 1WUNH 4ZHMU 3SNDA 2A2XH 2H5CA 2JH5D 1VCWA 3ATWA 4JYVH 3Q3YA 4K3JA 1LHCH 1AD8H 1PPHE 5L2ZH 4X2XA 4FUBA 3AW0A 4TY7A 3TJVA 2BB4A 1C2EA 1TMUH 1K1LA 3RC5A 1OWDA 3F9HA 1SGPE 1EX3A 1FAXA 5GPIB 1TABE 4LXBH 5EXNA 5TCAA 1Q31A 5G4BA 3HKJB 2QYIA 1HJ8A 1GI6A 1UTPA 2VVCA 2WPJS 2ZIQH 4AFZA 4NFFA 2ZC9H 6CHAB 1XUHA 2ZU3A 3TVJB 1AKSA 5HM2A 2QXHA 2BY8X 3U8TH 3TU7H 1MKXK 3VB6A 1EJNA 2BDCA 3WY8A 3UQOA 3V0XA 1O2IA 5DP9A 2PGQB 2AMDA 3SJ9A 2GP9B 1W3CA 5GCHF 1F0UA 1GJ4H 1IOEA 4KELA 5DG6A 3SV6A 4FU7A 1KSNA 1C1WH 4MLFB 1FQ3A 3RXDA 3NK8A 3TJUA 1ELVA 1ABIH 3GDVA 2OTVA 2ESTE 2AGGX 3PV4A 4GPGA 3GY6A 3RXGA 1A4WH 4YLUA 1Y59T 2J34A 2FMJA 2BVSH 1FV9A 3DUXH 5FPTA 2BM2A 4YOJA 3F6UH 4ABJA 3SOSA 7KMEH 1DITH 2Z9GA 2WUBA 4D9QA 1YKTA 3SUFA 1P9UA 1A5GH 1BJUA 5LH8A 2P8OC 2ZU2A 3MU1A 1VR1H 3RC4A 2C90B 4Y71A 1DWEH 4R8TB 3LGIA 1O31A 1FNIA 3Q00A 1NFWA 1MTSA 1KLJH 2P16A 1KYNA 1H8IH 1ZTJA 2SNVA 1UK4A 3GYLB 1Y5BT 3SNAA 2G52A 2EI8A 2Y5GA 3P92A 3SNBA 1HAZB 3MNBA 4Y8ZA 3NWUA 1C5WB 5GXPA 4RKJB 1NRRH 1W13U 4GVUA 4BANB 2V0BA 1GI1A 3ATIA 3KHVA 3EA9A 5AFZH 2UWLA 2GT7A 3SBKA 2GV6A 3H5CB 2ANKH 1FIWA 1O3IA 4OS4A 1KXFA 3AASA 4CREA 1PPGE 3A8BA 1OOKB 2A45B 4U2WA 1SPJA 4AGKA 4ZAEA 2V3HH 3O8BA 4THNH 3U1IB 1C1QA 1C5VA 2AGIX 2OC0A 1JXPA 3M5NA 1SHYA 1C1PA 3L6PA 3A89A 1C1RA 1K1JA 3RXIA 1BQYA 2TGDA 3BEUA 1Z8RA 1DUEA 4UD9H 1E35B 2GKVE 3SI3H 1A2CH 3H7OA 1Y5AT 3GCTF 4B73A 1EOJA 3VB5A 1LQDB 1JBUH 1MAXA 4M7GA 3BTTE 3TH2H 1TPPA 4OS6A 2FI4E 5EW1H 5I46H 1RXPA 7LPRA 1UTJA 3DFJA 1W11U 1GBEA 3HGPA 2ZHFH 1O2YA 3UWJH 3MH5A 3IITA 1YPHE 1LVMA 5LGOA 4MNYA 4O97A 1TGNA 1ZGIA 1UHBB 1E37B 3NCLA 3B9FH 1YYY1 5FX6A 2BLVA 1YP9A 1NC6A 2FOGA 3GCOA 1QHRB 1GVZA 1MBQA 1LDTT 3BTKE 5L2YH 3ZVGA 3A83A 1TGTA 1BTZA 2CV3A 3LGTA 2QF0A 4DCDA 1EP6A 3EGKH 3M37A 1SLWB 1RTLA 2RDLA 2DE9A 2BY6X 2QXGA 1UTKA 1UTNA 1G3CA 1FIZA 2SGFE 2ULLA 4GAWA 3ZZ7A 2R0LA 1GGDC 4IC6A 1MAYA 2ANWA 1INCA 3EA8A 1VCPA 1BIOA 1LO6A 3E1XB 3ATMA 1DXPA 4Y7BA 8GCHF 3UQVA 1G3BA 8KME2 3T2NA 1P8VC 3ZVCA 1A0LA 2QGRA 2Y5FA 3UR9A 2BMGB 1HXFH 2J9NA 4ZKRU 1P2QA 2OC1A 4NIXA 1IQLA 1T4UH 1WQSA 1H9IE 1QB1A 3MU4A 1P2MA 2ZTZA 4FU8A 1C5RA 2PHBA 1GG6C 1FONA 5GWZA 1TQ0B 4DIHH 4I8GA 1ARCA 2H6MA 3UREA 1L0ZA 4AFQA 2JH6D 2IOTA 2O8UA 1HAGE 4B2CA 3PO1B 1AVGH 1W14U 3SV7A 4X8SH 4NA7A 1MTUA 1TGBA 2I6QA 4CBNA 1TE0A 1QA7A 1W7XH 4B2AA 1P3EA 1V2ST 4JZEH 2ZGXH 1CT4E 2VB0A 2UUKB 3LJJA 3QTOH 2ZHWH 1L4DA 4H4FA 1DWBH 1O5DH 4BTUB 1OWJA 5DK1A 4ISLA 1THRH 1HB0B 2PTNA 5E0JA 2BDHA 1KXDA 2FWWA 3GY3A 4ZHAA 1TBZH 4H42U 1O2ZA 2CHAB 4ABAA 1MKWH 1C4U2 1UCYK 4K8YA 3S9CA 2NU2E 1BTYA 1GBMA 4U01A 3M7TA 1Z1JA 3QGNB 2QIQA 4WJG2 3OYPA 3TK5A 1OYQA 3RXSA 1ZPCA 3EQ0H 2GVFA 2CF8H 1O2WA 4UFGH 5ESTE 3BTME 2W26A 2ZF0H 3CENA 2XWBI 4TPIZ 2GGVB 4J1YA 3E6PH 3MO9A 1YC0A 4XE4A 1QL9A 4E7RG 1UTLM 1U6QA 2G55A 1TMTH 2GDEH 4GCHG 1EJMA 4JK6A 2Z7FE 2QAAA 1C1SA 3KQDA 1Y3UA 1C5PA 1AHTH 2R3UA 1D9IA 4O03A 1AKSB 3UOPA 3N7OA 4FUEA 2BDAA 2FS9A 1TBQH 1AFQC 1ELCA 1PPBH 3H7TA 4B1TA 2A31A 1FUJA 1Z8GA 4OS7A 1FPCH 1WSSH 2SGQE 1C4Y2 2B5TB 4GHQA 1MD8A 3A7VA 3AW1A 5C1YA 3VXFH 4FU9A 1AE8H 1O0DH 1S82A 4DY7B 1HRTH 4ISHH 4ZHLU 2GD4B 4GHTA 5LPEA 1NT1A 1NFUA 3S9AA 2NU0E 1O5FH 1HLTH 1AWHB 1QJ6B 2RG3A 2ZFRH 1PQ8A 2K1QA 1EPTC 1FY8E 1GWAA 4VGCB 4WH6A 1CHOG 1D3TB 2XC0A 5CMXH 1DE7H 3RMLH 1IHTH 1P0SH 5E8EH 1EATA 4ZXXH 2WUCA 2FOMB 3DHKH 1DPOA 1P10A 1S84A 1D6WA 2FOFA 1NFXA 3BTWE 4AZ2B 1P2IA 1QR3E 1WU1A 4NIVA 4TPYA 2TIOA 4YESB 3TJOA 1W10U 3RXCA 1ESBA 5HXFA 3MNCA 1ANBA 1F92A 1BZXE 1EB2A 5BRRE 1J8AA 1T7CA 3PLPA 1D4PB 1TGSZ 2CGAA 1NS3A 2G5VA 2ZZUH 4AGJA 2CN0H 1P09A 2ZU5A 2VIWA 3MYWA 1N8OC 2O8LA 2PKSB 3MU0A 4FUIA 2C8YB 4H6TA 3FP6E 4NCYA 3M3TA 1HPGA 3KGPA 3OY5U 2VINA 4NA9H 4I8LA 2BQWB 4Z6AH 1CGHA 1ZYOA 1GBIA 1IQKA 2GCHG 5J4SA 1O2MA 1K1MA 1AY6H 5HM9A 1J16A 3RP2A 2H9HA 1GCDA 1GDUA 2A32A 4BAQB 5JDUB 4Y76A 4MPWA 1G9IE 1C1OA 2BDGA 1GHWH 2VGCC 2ZDLA 5JBCS 3P8GA 3GCHB 2ZGJA 3VGCB 1O3LA 1SGFG 1BJVA 4TWWA 2OQUA 1GHYH 4E7NA 3P8NA 1GDQA 4Y0ZE 1F7ZA 1GDNA 5JB9S 1N6YA 3B23B 3RU4D 1GBBA 3BV9B 1NU7B 1EOLA 1HJ9A 1NM6A 4Y0YE 2AIPA 1BTWA 1E38B 3UR6A 3A8DA 1LQEA 3BTHE 1BMLA 3U9AH 5F03A 1B5GH 2Z9JA 3CP7A 1EB1H 1E0FD 1TNHA 2AIQA 3S7KB 1AO5A 1THSH 2OCVB 4X1SU 5FBIA 1C2KA 1MTNC 5TCCA 3ZVEA 9LPRA 5EG4A 1OKXA 1BOQA 3RM2H 2QXIA 4CRGA 2HPPH 3KQCA 1GBAA 2Z9LA 1ETRH 4D8NA 4NSYA 3VB7A 2G5NA 1QL7A 1QRZA 4Q7ZA 3M35A 1SGTA 2AH4X 5F8TA 2F9BH 2IPHA 3RXQA 1XM1A 5FAHA 2OBQA 1GHXH 1NPMA 4Y79A 1DY9A 1MQ5A 3PWCA 3RXBA 1VITH 1OX1A 2P3TB 1HIAA 1FDPA 3FAOA 4U32A 4ABEA 4IC5A 4B76A 3RXEA 1SGQE 1Q3XA 1O2JA 1LHEH 2B9LA 1L1NA 4RN6A 1HAVB 1UCYE 1EZSC 3ZZBA 5K7RA 3SQEE 4IN1A 3EYDA 3VFEA 1GI8B 3K6ZA 2ANMH 1DUAA 4MPXA 2HPQH 2ZFTA 4CBOA 1KXBA 2BVRH 3P8OA 1QJ7B 1A5IA 5ETXA 1ELDE 3SN8A 3PMJA 1W8BH 2BDIA 1FXYA 2VWLA 4MNXA 3GY7A 1AN1E 2R2WU 3M7QA 2Y81A 2TGAA 4CRFA 1VGCB 1HCGA 5L30H 2VIPA 3D62A 1EAWA 5EQQA 1KDQB 3SU3A 2CXVA 4AG2A 2ZG0H 2A7HA 4INKA 2A4OA 1ZMNA 3HGNA 1ELGA 1HAXB 1RIWB 1G36A 2A7JA 5ESBA 4YZUA 1HBTH 4ABBA 4CHAC 4A7IB 2ZHQH 4IS5A 5EW2H 2VNTA 3SJ8A 1ACBE 2PW8H 5EQRA 1FZZA 1BT7A 1DXWA 1TNKA 2QCYA 4OGYA 1O3OA 3RMNH 3SGQE 5C5NA 4FXGH 1D3DB 3OU0A 6GCHF 4NWKA 1O2QA 2HLCA 1PPZA 4AOQA 2IJOB 3ITIA 1WTGH 1J9CH 3NUMA 6CHAC 5C1UA 1NRPH 2QF3A 1DWCH 3TPIZ 2BD7A 1O2PA 2FM2A 1SVPA 1GBDA 2TGPZ 4AFSA 1NROH 1O2VA 2A0QB 1C5TA 2FTMA 1HAPH 2UWPA 3I29A 4A6LA 2H9TH 3A7YA 2LPRA 2G4UA 4Q7XA 4BOHA 2GCTB 3Q3XA 1QGFA 3MH7A 4ZUHA 3MWIU 1LHDH 3UIRA 5IYTA 1PFXC 1ZJKA 4AB9A 2XWAA 2BD9A 3TGIE 4LOYH 2WV4A 4E06H 1LVOA 1A3EH 2AEIH 4MNWA 2P93A 1O30A 4XBCA 2OUAA 2BOKA 4X8UH 4AN7A 4F49A 1WBGB 3QUMP 3ZVFA 1O2GH 1AI8H 3LJOA 1P06A 3U8OH 3A88A 3HPTB 5ABWA 1XXDA 3M36A 1GHAG 2A4RA 3ZZ5A 2QV1A 1CGIE 1T8OA 4A1VA 1GJ5H 3OY6U 1UO6A 1CSOE 2GMTB 1TNIA 1JOUB 2OQ5A 1K1IA 3QDZB 1L1JA 1VITG 1G32B 3BSQA 1V6DA 1O2SA 3C27B 1HUTH 2BOHB 1QBNA 3PMHB 7ESTE 1ZRBA 1BBRE 2YOLA 4D9RA 2OC7A 4FUJA 4H6SB 1SGCA 2ZFFH 5CHAB 1C5QA 3V7TA 1GMHG 4DVAU 4F4OC 4Y11E 2BD8A 4INHA 1OS8A 2ZO3H 1QRWA 1VJ9U 1TAWA 1O3GA 4JYUH 3NKKA 2PGBB 1GJ6A 4ZKSU 1UVTH 1MTWA 2ZGCA 1EZQA 5C1XA 2FPZA 1V2MT 1O5AB 3U69H 3S0NA 1YM0A 3BTGE 3UTUH 1THPB 2P3FH 1UTOA 1PPEE 2G8TA 2RA3A 4ISOA 4Q80A 4D7FA 1JRSA 3EDXB 2XXLA 1C2MA 4YM9A 5EOKA 1XVOA 3UWIA 4KP0A 5DJ7A 1TX6A 3U1JB 1UMAH 1MH0A 1O3EA 2BD3A 1BRAA 1H9LB 1QNJA 4MPVA 4CRAA 2TGTA 1B0FA 1ZSKA 3VB4A 4Y10E 3GY2A 1ZLRA 4JZIA 3T27A 4CRCA 4DGJA 4JK5A 1OWIA 1Z8JB 3AAVA 3TH3H 1P03A 5HMAA 2A4GA 4BAMB 5EODA 2ZHEH 2QA9E 1ANCA 1K2I1 4X2WA 3FP7E 1ZHPA 2C8XB 1RS0A 2PUQH 4Y8XA 3STIA 4ABDA 3P70B 1P11E 2BLOA 2BTCE 1NRSH 4E05H 1GL0E 1GI4A 1P2KA 3PROA 1GBJA 1HAYB 2FOHA 2VIVA 1MKWK 1PPCE 4Q7YA 5J4QA 3U8RH 2P8OB 1ARBA 5F8ZA 1GBHA 3ZZCA 1HJAB 1QFKH 2C8WB 3KF2A 4D7GA 4MQAA 2W3IA 2M5TA 3EA7A 2WINI 1L4ZA 3SHAH 4KGAA 2GX4A 2Z9KA 1V2UT 1P2NA 5DP8A 5C67A 1DFPA 1O38A 1GJ7B 2ZDNA 2NU3E 4ZKNU 1ZOMA 1C9PA 4NIWA 1A1RA 1GMCG 4X1PU 5F8XA 5C3NA 3GCNA 4XBDA 1TA6A 3PO1C 3TITA 1QL8A 1O35A 1SGEE 4JZ1A 1DSUA 3QZQA 4Q2KA 2HGTH 4FVDA 2SGDE 3O8DA 4NSVA 7GCHG 3GICB 1HGTH 4XFQA 2P94A 3M5LA 5A0CA 1J17T 2A2QH 2LNCA 3KL6A 3D23A 1C5LH 2PFEA 2WPMS 2WPHS 3BTFE 3BIUH 2EI7A 3PTBA 1UVSH 3SU5A 2CHAC 1NRQH 1C5MD 4K60A 2F9NA 5T6DA 1O37A 1QA0A 2HRVA 1ZMJA 3KIDU 1DM4B 1K21H 2JKHA 3MU8A 4ISIH 1AQ7A 2D1JA 2R9PA 1O2KA 1AB9B 1K1NA 2FXRA 3LPRA 3SI4H 1MUEB 3BG4B 4MG3A 1SSXA 3E90B 5A8YA 4X1QU 1M9UA 1P2JA 1RRKA 1TLDA 1CQQA 5H4IB 3T62A 1YCPH 3HK6B 1SB1H 3STJA 4I8HA 2ZFSA 1CA0B 3OX7U 3SV9A 1O3NA 3M5OA 1QBVH 5L6NH 2BLWA 2VWOA 1OWKA 3ZYDA 1CBWB 3F68H 2B7DH 1DS2E 1LKBA 2W5EA 2HWLB 1T32A 2OLGA 1TOMH 1KTSB 1OYTH 1AZ8A 3ZV8A 1P02A 5JB8S 2ZPQA 3LOXA 1LVBA 3LGWA 1TPAE 5A8XA 3LONA 5LPRA 2OBOA 2ALPA 1GBFA 3LKWA 5EGMA 5FCRA 3RMOH 3A82A 1O5GH 4JYTA 2HALA 2ZEBA 3W95A 1O2TA 3URDA 2WYGA 4VGCC 2ZCHP 1BITA 1V2OT 2FOAA 1BHXF 4NGAH 1HAIH 4DW2U 1NZQH 3GYMA 4ABHA 5GCHG 5AHGH 3HATH 4K8BA 4D76A 1GJDB 1Z8IB 3L33A 1TYNA 1C1UH 2UUYA 1S6HA 2R2MB 3QK1A 5SGAE 1LKAA 1MD7A 4YOIA 3RXRA 1S83A 4UEHH 4JZDH 2ZQ1A 1O3AA 2D26C 3PMBB 3ELAH 3RXHA 4AYVB 4YOGA 1LMWB 3LGVA 3NXPA 1XKAC 1O3DA 1KTTB 2VWNA 2AYWA 1XUIA 3A85A 2ODQA 1GMDF 2VH0A 2PKSC 2HNTC 2VH6A 5C5OA 1IQJA 1AZZA 1EZUC 1VCQA 2OXSA 2Y80A 2FOEA 4AX9H 1V2KT 4HTCH 1E34B 1BUIA 3UNQA 3V12A 4HGCA 3K2UA 4R0IA 1GHBF 3ZV9A 1YCPM 1SL3A 2ZA5A 3C1KA 3BEIB 1ESAA 4ESTE 1CHGA 5E0GA 3GDUA 3UOUA 4BTIB 1AWFH 5E2OA 5HGGA 2VVVA 1C2JA 2FLRH 3MHWU 3ODDA 1C1VH 4X1RU 1JRTA 3GCHC 3NPSA 4WY3A 2VWMA 3VGCC 2TRMA 3FANA 1O36A 2C3SA 4WWYA 1H8DH 2Y6TA 2R0KA 1IAUA 3S69A 1GI0A 1Y3VA 1NFYA 3OTJE 2EEKA 3D49H 2Q6GA 1T8LA 4KKDA 1DY8A 1V2WT 1KY9A 2J95A 1NN6A 3DA9B 3QGJA 2STAE 4FUCA 1O3CA 4NG9H 1ANEA 2ODYB 1F5LA 3SQHE 2GZ8A 1H1BA 2Z3EA 4K2YA 5T6GA 3T28A 4RSPA 1CT2E 1YPEH 4WXIA 3ZVAA 5LPFA 1EKBB 1ZTLA 1QCPA 3O8RA 3GCTG 4WMEA 1UVPA 3A7TA 1UCYH 2PWXA 1O3FA 4XDEA 1IQMA 3SO3A 1ANDA 4CRBA 1W0ZU 1DSTA 3RXUA 5AF9H 4XBBA 2ZCKP 1YGCH 3O8CA 1ETTH 3F1SB 1H4WA 4IGDA 4YTAA 3SJIA 4OGXA 3UUZA 1S81A 3TGJE 5EXLA 1TQ7B 3SHCH 3A80A 5C2ZA 2JH0D 2AGEX 1OWEA 3VPKA 3VXEH 3SU1A 2XBXA 1HYLA 1P01A 1ZJDA 4UONA 1BRBE 3LC3A 5K0HA 1V2JT 3Q3KA 4I31A 2ZNKH 3RXJA 2FESH 3SGBE 1QRXA 1O5EH 1MMJN 1S6FA 2OD3B 4BAKB 2FTLE 3ZZDA 3BTEE 3LT3A 1BB0B 1TRNA 2WPKS 2G4TA 2PV9B 2VVUA 1Y8TA 5EQSA 2O8TA 1BMNH 5DP7A 1OWHA 1AIXH 2O8MA 1AGJA 1GCTB 1TONA 2Z94A 3M3SA 3RXLA 8GCHG 3UY9A 3A7ZA 4FUHA 1TX7A 4CR9A 1VGCC 2O9QA 2SGEE 1TIOA 1X7AC 2FODA 1CU1A 4WH8A 1HNEE 3ATLA 3ZYEA 2I6SA 3ZVDA 1MQ6A 2A7CA 2TBSA 3P6ZB 2FYQA 5IDKA 3AVZA 3QO6A 3V3MA 1BCUH 1TRMA 3RU4E 1Q2WA 2YNBA 3A7WA 2Z9IA 1MTVA 2F83A 1Z1IA 1P9SA 2XCNA 1GHZA 2FEQH 4X0WU 1Z7KA 1T8MA 1DANH 1TWXB 1ZGVA 2OP9A 2P59A 1SFIA 2GZ9A 1RTFB 2FS8A 3CS0A 1FY1A 2Y7XA 1O5CB 1A46H 3I77A 1XUGA 2ALVA 2A5IA 2NU4E 3TK9A 4NZQA 3M3VA 1XMNB 2ANYA 5DO4H 3R0FA 1WTHD 2BVXH 2H5DA 1GBTA 4KTUA 3RLWH 3RU4T 4IW4E 8LPRA 1GBKA 4DT7B 5DP4A 3PWBA 1G3EA 5A09A 5A0AE 1LHFH 1P3CA 2FYRA 2YNAA 2HOBA 2XBYA 1CE5A 1F2SE 3TNTA 4BAOB 2PSXA 1GBCA 4AB8A 1HAOH 1VJAU 3ENSB 3FP8E 1O2XA 4DJZB 2GV7A 2PLXA 2GCTC 4WMDA 2ZU4A 2EC9H 2JETB 5E0HA 2AMPA 2FP7B 3A8CA 1GJCB 2BZAA 1TA2A 3A8AA 1YLCA 5A2MH 4I7YH 1BBRH 5T6FA 1EUFA 1HFDA 4TYDA 1V2LT 3RXTA 1BTHH 2Z3DA 1AUTC 1YBWA 4IN2A 4MVNA 1NO9H 2C8ZB 4NFEA 1PJPA 1MCTA 1SLVB 5FHTA 4K1SA 1SGFA 1P2OA 3SUEA 3M5MA 2GDDA 1DDJA 4OS5A 2AS9A 2BX3A 2PSYA 3UFAA 3ODFA 4X2YA 4BAHB 2BY5X 2ZKSA 1O34A 1JIRA 2R3YA 5E2PA 1ZPBA 2SGPE 1P05A 1SQAA 1O39A 3SW2B 1TMBH 1F5RA 1HV7A 2ZDKA 3SU2A 1PQ5A 1FN6A 1YPHC 1SGNE 3QN7A 4BXWA 2GZ7A 1TNLA 5CHAC 4HFPB 3ZZ6A 3KEEA 4ZXYH 1FLEE 1JWTA 4DOQA 3GISB 1ZPZA 1FPHH 2XNIA 3MH4A 2ZPSA 4U30A 1BTUA 1ELBA 1O3KA 1GI2A 1KXAA 1VZQH 1RGQA 2C93B 4MNVA 1AMHA 2W3KA 3SNEA 2SGAA 1C5XB 1T4VH 2BD5A 1SI5H 1UTMA 5CE1A 1C1NA 1DICA 3ATKA 3RXFA 4FVBA 4CHAB 4ASHA 3F9EA 1W2KH 3SU0A 1YLDA 1C4V2 4I8JA 1T8NA 3T29A 1NESE 1H9HE 2ZHDA 4A5TS 1XUFA 3RXVA 3L3TA 1SFQB 3M7UA 1HAHH 2A5AA 1GPZA 2ZFQH 2ZGBH 1Y5UT 5EU8A 1BA8B 1EJAA 3U98H 2ODPA 3EAJA 2J94A 4MPUA 5JPMH 1JIMA 4X2VA 2WV5A 2XBVA 5FXLA 2ZDAH 2PUXB 4ZKOU 1J15A 1MZAA 3ZZ9A 1AUJA 5TJXA 1F0RA 2VIOA 2F9UA 4X6MA 1C1MA 5A0BA 2RCEA 3MU5A 1PYTC 3KNXA 4GCHF 3RM0H 3BTQE 1ID5H 1O32A 1WV7H 2CJIA 4NWLA 3RC6A 2FDAA 1BRUP 1V2VT 1TB6H 2A5KA 2VIDA 4AFUA 1EAIA 1UK2A 2W7SA 5GJ4B 4JZFH 3PM3A 4UDWH 1TOCB 1C5NH 4A1XA 3DD2H 2GT8A 3A86A 3LC5A 4GSOA 3RXOA 3ZZAA 2BY7X 2H9EH 2W7UA 3QLPH 5A8ZA 3MI4A 3RXAA 2ZECA 5JBBS 3FZZA 4BTTB 2GTBA 2BD2A 2XC4A 3P8FA 1GI7B 1ZHRA 1IQGA 1EAUA 1XKBC 3TNSA 3KN2A 2Q1JA 2QN5T 3E16B 1HJAC 1CHOF 3BG8A 4LZ1H 2HVXA 1W0YH 2Z6BD 1YPGH 3ZZ4A 4KTCA 3I78A 1CT0E 4ZMAH 1C2GA 3ZZ8A 1YCPK 1AU8A 1O2LA 1WQVH 1TPSA 1G37A 1ELTA 3W94A 4X8TH 1EPTA 1LTOA 2DE8A 3A81A 1PQAA 1C5YB 1V2NT 3SV2H 1O2OA 3SJKA 1TBRH 1EQ9A 4FUGA 1NU9A 2QXJA 1YPMH 1P12E 1IQHA 3SNCA 1EZXC 1ZZZA 4K69A 4ABGA 4I8KA 3BN9A 1WAYB 5JBTA 1SHHB 2IN2A 1BTXA 1B7XB 4Z0KA 3Q76A 1O2NA 1FAKH 1AVWA 1RJXB 4A92A 2Y82A 4CH8B 3OSYA 2GCHF 3PMAB 1N6XA 1SLUB 1D3QB 1D3PB 3IWMA 2ASUB 3PYHA 3MO6A 1SGIB 1HIAB 3HK3B 1SOTA 1MKXH 1AB9C 1O3MA 1PQ7A 1BMMH 2AFQB 4BNRA 3BG4C 1B0EA 1LHGH 1CA8B 4ISNA 2ZP0H 4X6NA 1SGDE 4BXSA 5BPEA 3F9FA 2AMQA
chains in the Genus database with same CATH superfamily
3T25A 1FY4A 2P3UB 3SU4A 2ZPRA 1AVXA 2XBWA 2A4QA 1PYTD 2BYAX 5EXMA 5EJLA 1K9OE 1TFXA 2CMYA 2FO9A 4HI3A 1Y3XA 4CR5A 1CA0C 1YPJH 2Y7ZA 2SFAA 5EPYA 1W12U 1HDTH 1OP2A 1CGJE 1ELEE 3KQEA 1KIGH 2HVYB 1C5OH 1CBWC 1KXCA 1SMFE 3FZDA 1K22H 3UNRA 2TPIZ 3VB3A 3QX5H 2NU1E 1C2FA 2O8WA 2V35A 9ESTA 3TGKE 4WXVA 1RTKA 4Y7AA 1Z71A 4X6OA 5HIYA 6GCHG 2F3CE 2J92A 4GLYA 1DLEA 2A1DB 2PTCE 3W1EA 3P17H 4X8VH 1WCZA 2AERH 3LH3A 1GI3A 1ELFA 3TLOA 3Q77A 1XVMA 2KCYA 4B71A 1QY6A 1SGRE 3F2GA 3K6YA 1HAVA 2F91A 1QBOA 2XW9A 5DP5A 1MCVA 1GBLA 2BDBA 3UB0A 4IMQA 4B6FA 2UWOA 2BLQA 1F0TA 8ESTE 3AAUA 1XX9A 4SGAE 1GL1A 1EASA 2KAIA 1SGYE 1TNGA 1V2PT 3A84A 1DLKB 3D65E 1QTFA 4K1EA 3AK5A 1N1LA 2JJ2D 1FJSA 4QT8C 3KCGH 3TJNA 3LGYA 2XC5A 4DIIH 1EXFA 3E3TA 1KDQA 2G00A 1FMGA 4J2YB 4TY6A 1IQEA 1C2DA 1ZMLA 2ZFPH 2D8WA 4IMZA 4FUFA 2PKAA 1V2QT 1GGDB 3GY5A 3ZZ3A 2KFWA 3E0PB 4Y6DA 3RDZA 3LDXH 4X1NU 1IQNA 2IPQX 1GVKB 3R3GB 4JMYA 1O2UA 1QURH 5T3HA 2NWNA 2ZI2H 1A3BH 1GI9B 2BXTH 2JDID 2C4FH 5PTPA 1MABB 3MMGA 3LIWA 5FCKA 3QWCH 1G2LA 3UAIC 1C5ZB 1UVUH 3ZVBA 1ZSJA 2FLBH 1DVAH 3RMMH 4UE7H 2P95A 4I32A 4IBLH 5EJ1A 1G2MA 1GG6B 1F0SA 1G3DA 4CRDA 2V3OH 2J98B 1SLXB 3SORA 1O3PB 1SG8B 4Y8YA 2XCFA 1UVOA 3PTNA 2FZZA 1CO7E 1L2EA 2J5UA 1UTQA 2FOCA 3SUGA 1SQOA 2BQ7B 1BDAA 3TK6A 3RLYH 4AG1A 4SGBE 3K9XB 1Z6EA 1O3JA 4MDSA 3T26A 1C1TA 3DFLA 2HNTF 4YT7H 2BD4A 3QTVH 4XSKU 1RD3B 4ZH8A 4LK4A 3G01A 1DT2A 3PRBA 5HYOA 1C5SA 4AORA 1TRYA 2QY0B 2UUJB 4A1TA 2FX6A 1OXGA 2BY9X 1QQUA 3SU6A 2OC8A 2ZDMA 1TPOA 2WHXA 4B75A 1ORFA 1E1RD 3P95A 4ABIA 2D2DA 2VJ1A 2ZQ2A 1GVLA 1S0RA 3TIUA 1H8ED 2ZTYA 1D6RA 1BHXB 1TGCA 5DP3A 1BMAA 3E0NB 3LU9B 3URCA 1KLTA 1K28D 1A7SA 1C9TA 1IHSH 2G51A 3RXPA 2ZCLP 5HKKD 1ZR0A 2F9VA 1MZDA 1F5KU 1A5HA 1QJ1B 3VEQB 5FX5A 1SR5C 1FI8A 1NRNH 1OP8A 1YPKH 1Y3WA 1C2IA 2QC2A 1GHAF 2Q6DA 1GJBB 1GI5A 4WVPE 6ESTA 1BRCE 1AFQB 2ZU1A 3UNSA 3E8LA 4K5ZA 4UFFH 1KXEA 1ZHMA 2XYAA 3CS7A 1O3HA 2OINA 4PROA 3BIVH 4OS1A 4RI0A 1VITF 3LH1A 1HXEH 3F2FA 1V2TT 6LPRA 2WPIS 4ABFA 5JBAS 5EPNA 2ILNA 3SUDA 2EI6A 1W7GH 1S85A 5FPSA 2BXUH 2DUCA 2BX4A 2BQ6B 1GCTC 1ZRKA 1EPTB 1GMHF 5C17A 2M2AA 2OK5A 3UPEA 4YXWD 4MTBA 4OS2A 1LVYA 1RFNA 2BDYA 2CF9H 4DG4A 1C2LA 3T5FH 3DCLA 4B74A 1E79D 1T31A 1C5UA 3EE0B 2FIRH 5GDSH 2AHME 2Q6FA 2FI5E 3N7EA 4B6EA 2ZGHA 1GHVH 1YPLH 1BBRK 1V3XA 4WMFA 3F9GA 1FN8A 1WYKA 1MU6B 1IQFA 1NTPA 2THFB 5JYIA 1V2RT 2BZ6H 5C20A 5GIBA 3LGUA 2SNWA 1ABJH 1A0HB 3MTYA 5FBEA 1K1OA 4INLA 1QB6A 4CH2B 1J14A 1L1GA 3PLKA 1YLNA 1LPZB 1DX5M 1A61H 2EA3A 5AVDA 1N8OB 3M61U 4ZROA 3A87A 2F9PA 1XUKA 3B8JA 1LCYA 3A7XA 1O3BA 2XTTB 1LPGB 2J4IA 2VU8E 1Z6JH 1CVWH 1E36B 3ESTA 4YLQH 1O5BB 2J38A 3IG6B 4O3TA 3JZ1B 4YO9A 3RXMA 4LZ4B 1OSSA 1NY22 4B2BA 5F6MA 1SQTA 1KLIH 3DT0H 3BTDE 3MFJA 5DP6A 2WYJA 3TH4H 1SOZA 2FI3E 2H2ZA 4NZLA 1GJAB 1AFEH 1RIWC 2VGCB 1OPHB 3PV5A 1K1PA 1A0JA 4NIYA 4TWYA 1JMOH 1LPKB 2ZDVH 4NA8A 3RUOA 3BF6H 2RA0A 2JETC 5IK2D 3S9BA 3JZ2B 1FY3A 3PLBA 1ZTKA 4JCNA 4KTSA 1ZSLA 1S5SA 4O3UA 2KCPA 4UFEH 3FVFB 3SZNA 1WOFA 1EAXA 4XOJA 4GUXA 1ETSH 3U28C 1SBWA 3S7HB 4I33A 1AE5A 1O2RA 4AYYB 2PR3A 2B8OH 3RXKA 1GJ9B 2Z3CA 3GY8A 1UHBA 5DKMA 1QB9A 2ZWLH 3K65B 1MTNB 3BEFB 1MBMA 4YT6H 1P57B 2Y5HA 2STBE 5FPYA 3GDSA 5HIZA 2HNTE 2VIQA 3PB1E 1SC8U 3GOVB 2J2UA 4WF8A 3HKIB 2KAIB 1DWDH 3MH6A 4Q63A 1DOJA 5I25A 3SJOA 2FOBA 1P04A 1IQIA 2G81E 1GMCF 1XUJA 2WV9A 1FY5A 4O9VA 2BHGA 2ZTXA 1TX8A 3OEHD 3MO3A 2B0FA 3SV8A 2PKAB 3SGAE 1OP0A 2V6NA 4X6PA 7GCHF 4DURA 1QIXB 3V13A 3GY4A 5B6OA 1ELAA 1BTPA 1O33A 1EP5A 3E91A 3MOCA 4HZHA 3FFGA 3QZRA 1Y3YA 2WPLS 3MNXA 5DPAA 2F9OA 1QQ4A 5AFYH 1G30B 2UUFB 2GMTC 1PPFE 2XRCA 3KQBA 1MU8B 3NZIA 5EJZA 1C2HA 1TNJA 1GMDG 3MNSA 4K1TA 1TALA 1ESTA 4UFDH 1YF4A 4FUDA 2FX4A 4RKOB 2L74A 1XXFA 1GHBG 1O2HA 1GJ8B 4RT0A 1S0QA 5DGJA 1UK3A 1UJ1A 2H1UA 1WUNH 4ZHMU 3KQ5A 2A2XH 2H5CA 3SNDA 5C94A 2JH5D 1VCWA 3ATWA 4JYVH 3Q3YA 4K3JA 1LHCH 1AD8H 1PPHE 5L2ZH 4X2XA 4FUBA 3AW0A 4TY7A 3TJVA 2BB4A 1C2EA 1TMUH 1K1LA 2KCAA 3RC5A 1OWDA 3F9HA 1SGPE 5T1VA 4Z1MD 1EX3A 1FAXA 5GPIB 1TABE 4LXBH 5EXNA 5TCAA 1Q31A 5G4BA 3HKJB 2QYIA 1HJ8A 1GI6A 1UTPA 2VVCA 2WPJS 2ZIQH 4AFZA 4NFFA 2ZC9H 6CHAB 1XUHA 2ZU3A 3TVJB 1AKSA 2K0QA 5HM2A 2QXHA 2BY8X 3U8TH 3TU7H 1MKXK 3VB6A 1EJNA 2BDCA 3WY8A 3UQOA 3V0XA 1O2IA 5DP9A 2PGQB 2AMDA 2CK3D 3SJ9A 2GP9B 1W3CA 5GCHF 1F0UA 1GJ4H 1IOEA 4KELA 5DG6A 3SV6A 4FU7A 1KSNA 1C1WH 4MLFB 1FQ3A 3RXDA 3NK8A 3TJUA 1ELVA 1ABIH 3GDVA 2OTVA 2ESTE 2AGGX 3PV4A 4GPGA 3GY6A 3RXGA 1A4WH 4ZCNA 4YLUA 1Y59T 2J34A 2FMJA 2BVSH 1FV9A 3DUXH 5FPTA 2BM2A 3SYJA 3NRLA 4YOJA 3F6UH 4ABJA 3SOSA 7KMEH 1DITH 2Z9GA 2WUBA 4D9QA 1YKTA 3SUFA 1P9UA 3DSOA 1A5GH 1BJUA 5LH8A 2P8OC 2ZU2A 3MU1A 1VR1H 3RC4A 2C90B 4Y71A 1DWEH 4R8TB 3LGIA 1O31A 1FNIA 3Q00A 1NFWA 1MTSA 1KLJH 2P16A 1KYNA 1H8IH 1ZTJA 2SNVA 1UK4A 3GYLB 1Y5BT 3SNAA 2G52A 2EI8A 2Y5GA 3P92A 3SNBA 1HAZB 3MNBA 4Y8ZA 3NWUA 1C5WB 1BMFD 5GXPA 4RKJB 1NRRH 1W13U 4GVUA 4BANB 2V0BA 1GI1A 3ATIA 3KHVA 3EA9A 5AFZH 2UWLA 2GT7A 3SBKA 2GV6A 3H5CB 2ANKH 1FIWA 1O3IA 4OS4A 1KXFA 3AASA 4CREA 1PPGE 5KECA 2GJGA 4Q4LA 3A8BA 1OOKB 2A45B 4U2WA 1SPJA 4AGKA 4ZAEA 2V3HH 3O8BA 4THNH 3U1IB 1C1QA 1C5VA 2AGIX 2OC0A 1JXPA 3M5NA 1SHYA 1C1PA 5EIYA 3L6PA 3A89A 1C1RA 1K1JA 3RXIA 1BQYA 2TGDA 3BEUA 1Z8RA 1DUEA 4UD9H 3H09A 1E35B 2GKVE 3SI3H 1A2CH 3H7OA 1Y5AT 3GCTF 4B73A 1EOJA 3VB5A 1LQDB 2KZ4A 1JBUH 1MAXA 3PV2A 4M7GA 3BTTE 3TH2H 1TPPA 5KEDA 4OS6A 2FI4E 5EW1H 5I46H 1RXPA 7LPRA 5DN6D 1UTJA 3DFJA 1W11U 1GBEA 1S6LA 2ZHFH 3HGPA 1O2YA 4ASUD 3UWJH 3MH5A 3IITA 1YPHE 1OHHD 1LVMA 5LGOA 4MNYA 4O97A 1TGNA 1ZGIA 1UHBB 1NBMD 1E37B 3NCLA 3B9FH 1YYY1 5FX6A 2BLVA 1YP9A 1NC6A 2FOGA 3GCOA 1QHRB 1GVZA 1MBQA 1LDTT 3BTKE 5L2YH 2QF4A 3ZVGA 3A83A 1TGTA 1BTZA 2CV3A 3LGTA 2QF0A 4DCDA 1EP6A 3EGKH 3M37A 1SLWB 1RTLA 2RDLA 2DE9A 5KGOA 2BY6X 2QXGA 1UTKA 1UTNA 1G3CA 1FIZA 2SGFE 2ULLA 2WSSD 4GAWA 2R0LA 1GGDC 4IC6A 3ZZ7A 1MAYA 2ANWA 1INCA 3EA8A 1VCPA 1BIOA 1LO6A 3E1XB 3ATMA 1DXPA 4Y7BA 8GCHF 3UQVA 1G3BA 8KME2 3T2NA 1P8VC 3ZVCA 1A0LA 2QGRA 2Y5FA 3UR9A 2BMGB 1HXFH 2J9NA 2QE7D 4ZKRU 1P2QA 2OC1A 4NIXA 1IQLA 1T4UH 1WQSA 1H9IE 1QB1A 3MU4A 1P2MA 2ZTZA 4FU8A 1C5RA 2PHBA 1GG6C 4TSFD 1FONA 5GWZA 1TQ0B 4DIHH 4I8GA 1ARCA 2H6MA 3UREA 4ACAA 1L0ZA 4AFQA 2JH6D 2IOTA 2O8UA 1HAGE 4B2CA 3PO1B 1AVGH 1W14U 3SV7A 4X8SH 4NA7A 1MTUA 1TGBA 2I6QA 4CBNA 1TE0A 1QA7A 1W7XH 3WWFA 4B2AA 1P3EA 1V2ST 4JZEH 2ZGXH 1CT4E 2VB0A 2UUKB 3LJJA 3QTOH 2ZHWH 1L4DA 4H4FA 1DWBH 1O5DH 4BTUB 1OWJA 4RT1A 5DK1A 4ISLA 1THRH 1HB0B 2PTNA 5E0JA 2BDHA 1KXDA 2FWWA 3GY3A 4ZHAA 1TBZH 4H42U 2LP6A 1O2ZA 2CHAB 4ABAA 1MKWH 1C4U2 1UCYK 4K8YA 3S9CA 2NU2E 1BTYA 1GBMA 2LELA 4U01A 3M7TA 1Z1JA 3QGNB 2QIQA 2RFKC 4WJG2 3OYPA 3TK5A 1OYQA 3RXSA 1ZPCA 3EQ0H 2GVFA 2CF8H 1O2WA 4UFGH 5ESTE 3BTME 2W26A 2ZF0H 3CENA 2XWBI 1WXRA 4TPIZ 2GGVB 4J1YA 3E6PH 3MO9A 1YC0A 4XE4A 1QL9A 4E7RG 2HLDD 1UTLM 1U6QA 2G55A 1TMTH 2GDEH 4GCHG 1EJMA 4JK6A 2Z7FE 2QAAA 1C1SA 1K0HA 3KQDA 2PP6A 1Y3UA 1C5PA 1AHTH 2R3UA 1D9IA 4O03A 1AKSB 3UOPA 3N7OA 4FUEA 2BDAA 2FS9A 4FOUC 1TBQH 1AFQC 1ELCA 1PPBH 3H7TA 4B1TA 2A31A 1FUJA 1Z8GA 4OS7A 1FPCH 1WSSH 2SGQE 1C4Y2 2B5TB 4GHQA 1MD8A 3A7VA 3AW1A 5C1YA 3VXFH 4FU9A 1AE8H 1O0DH 1S82A 4DY7B 1HRTH 4ISHH 4ZHLU 1EFRD 2GD4B 4GHTA 5LPEA 1NT1A 1NFUA 3S9AA 2NU0E 1O5FH 1HLTH 1AWHB 1QJ6B 2RG3A 2ZFRH 1PQ8A 2K1QA 1EPTC 1FY8E 1GWAA 4VGCB 2JJ1D 4WH6A 1CHOG 1D3TB 2XC0A 5CMXH 1DE7H 3RMLH 1IHTH 1P0SH 5E8EH 1EATA 4ZXXH 2WUCA 2FOMB 3DHKH 1DPOA 2QF5A 1P10A 1S84A 1D6WA 2FOFA 1NFXA 3BTWE 2KR7A 4AZ2B 1P2IA 1QR3E 3CNRA 1WU1A 4NIVA 4TPYA 2TIOA 4YESB 3TJOA 1W10U 3RXCA 1ESBA 5HXFA 3MNCA 1ANBA 1F92A 1BZXE 1EB2A 5BRRE 1J8AA 1T7CA 3PLPA 1D4PB 1TGSZ 2CGAA 1NS3A 2G5VA 2ZZUH 4AGJA 2CN0H 1P09A 2ZU5A 2VIWA 3MYWA 1N8OC 4XD7D 2O8LA 2PKSB 3MU0A 4FUIA 2C8YB 4H6TA 3FP6E 4NCYA 3F0PA 3M3TA 1HPGA 3KGPA 3OY5U 2VINA 4NA9H 4I8LA 2BQWB 4Z6AH 1CGHA 1ZYOA 1GBIA 1IQKA 2GCHG 5J4SA 1O2MA 1K1MA 1AY6H 5HM9A 1J16A 3RP2A 2H9HA 1GCDA 1GDUA 2A32A 4BAQB 5JDUB 4Y76A 4MPWA 1G9IE 1C1OA 2BDGA 1GHWH 2VGCC 2ZDLA 5JBCS 1WDIA 3P8GA 4P02A 3GCHB 2ZGJA 3VGCB 1O3LA 1SGFG 1BJVA 4TWWA 2OQUA 1GHYH 4E7NA 3P8NA 1GDQA 4Y0ZE 1F7ZA 1GDNA 5CHBA 5JB9S 1N6YA 3B23B 3RU4D 1GBBA 3BV9B 1NU7B 1EOLA 1HJ9A 1NM6A 1QZ8A 2AIPA 4Y0YE 1BTWA 5FL7D 1E38B 3UR6A 3A8DA 4DT4A 1LQEA 3BTHE 1BMLA 3U9AH 5F03A 1B5GH 2Z9JA 3CP7A 1EB1H 1E0FD 1TNHA 2AIQA 3S7KB 1AO5A 1THSH 2OCVB 4X1SU 5FBIA 1C2KA 1MTNC 5TCCA 3ZVEA 9LPRA 5EG4A 1OKXA 1BOQA 3RM2H 2QXIA 4CRGA 2HPPH 3KQCA 1GBAA 2Z9LA 1ETRH 4D8NA 4NSYA 3VB7A 2G5NA 1QL7A 1QRZA 4Q7ZA 3M35A 1SGTA 2AH4X 5F8TA 2F9BH 2IPHA 3RXQA 1XM1A 5FAHA 1UW7A 2OBQA 1GHXH 1NPMA 4Y79A 1DY9A 3DSPA 3F3BA 1MQ5A 3PWCA 3RXBA 1VITH 1OX1A 2P3TB 1HIAA 1FDPA 3FAOA 4U32A 4ABEA 4IC5A 4B76A 3RXEA 1SGQE 1Q3XA 1O2JA 1LHEH 2B9LA 1L1NA 4RN6A 1HAVB 1UCYE 1EZSC 3ZZBA 5K7RA 3SQEE 4IN1A 3EYDA 3VFEA 1GI8B 3K6ZA 2ANMH 1DUAA 4MPXA 2HPQH 2ZFTA 4CBOA 1KXBA 2BVRH 3P8OA 1QJ7B 2L6OA 1A5IA 5ETXA 1ELDE 3SN8A 3PMJA 1W8BH 2BDIA 1FXYA 2VWLA 2YMSB 4MNXA 3GY7A 1AN1E 2R2WU 3M7QA 2Y81A 2TGAA 4CRFA 4M9FA 1VGCB 1HCGA 5L30H 2VIPA 3D62A 1EAWA 5EQQA 1KDQB 3SU3A 2CXVA 4AG2A 2ZG0H 2A7HA 4INKA 2A4OA 1ZMNA 3HGNA 1ELGA 1HAXB 1RIWB 1G36A 2A7JA 5ESBA 4YZUA 1HBTH 4ABBA 4CHAC 4A7IB 2ZHQH 1FX0B 4IS5A 5EW2H 2VNTA 3SJ8A 1ACBE 3EE7A 2PW8H 5EQRA 5F53A 1FZZA 1BT7A 1DXWA 1TNKA 2QCYA 4OGYA 1O3OA 3RMNH 3SGQE 5C5NA 4FXGH 1D3DB 3OU0A 6GCHF 4NWKA 1O2QA 2HLCA 1PPZA 4AOQA 2IJOB 3ITIA 3KYFA 1WTGH 3MQKC 1J9CH 3NUMA 6CHAC 5C1UA 1NRPH 2QF3A 1DWCH 3TPIZ 2BD7A 1O2PA 2FM2A 1SVPA 1GBDA 2TGPZ 4AFSA 2XNDD 1NROH 1O2VA 2A0QB 1C5TA 2FTMA 1HAPH 2UWPA 3I29A 4A6LA 2H9TH 3A7YA 2LPRA 2G4UA 4Q7XA 4BOHA 2GCTB 3Q3XA 1QGFA 3MH7A 4ZUHA 3MWIU 1LHDH 3UIRA 5IYTA 1PFXC 1ZJKA 4I86A 4AB9A 2XWAA 2BD9A 3TGIE 4LOYH 2WV4A 4E06H 1LVOA 1A3EH 2AEIH 3VG8A 4MNWA 2P93A 1O30A 3PRDA 2OUAA 4XBCA 2BOKA 4X8UH 4AN7A 4F49A 1WBGB 3QUMP 3ZVFA 1O2GH 1AI8H 3LJOA 1P06A 3U8OH 3A88A 3HPTB 5ABWA 1XXDA 3M36A 1GHAG 2A4RA 3ZZ5A 2QV1A 3F0OA 3ZIAD 1CGIE 1T8OA 4A1VA 1GJ5H 3OY6U 3FN8A 1UO6A 1CSOE 2GMTB 1TNIA 1JOUB 2OQ5A 1K1IA 3QDZB 1L1JA 1VITG 1G32B 3BSQA 1V6DA 1O2SA 3C27B 1HUTH 2BOHB 1QBNA 3PMHB 7ESTE 1ZRBA 1BBRE 2YOLA 4D9RA 2OC7A 4FUJA 4H6SB 1SGCA 2ZFFH 5CHAB 1C5QA 3V7TA 1GMHG 4DVAU 4F4OC 4Y11E 2BD8A 4INHA 1OS8A 2ZO3H 1QRWA 1VJ9U 1TAWA 1O3GA 4JYUH 3NKKA 2PGBB 3KYGA 1GJ6A 4TT3D 4ZKSU 1UVTH 1MTWA 2ZGCA 1E1QD 1SKYE 1EZQA 5C1XA 2FPZA 1V2MT 1O5AB 3U69H 3S0NA 1YM0A 3BTGE 3UTUH 2KCOA 1THPB 2P3FH 1UTOA 1PPEE 2G8TA 2RA3A 4ISOA 1W0KD 4Q80A 4D7FA 1JRSA 5C0UA 3EDXB 2XXLA 1C2MA 4YM9A 5EOKA 1XVOA 3UWIA 4KP0A 5DJ7A 1TX6A 3U1JB 1UMAH 1MH0A 1O3EA 2BD3A 1BRAA 1H9LB 1QNJA 4MPVA 4CRAA 2TGTA 1B0FA 1ZSKA 3VB4A 4Y10E 3GY2A 1ZLRA 4JZIA 3T27A 4CRCA 4DGJA 4JK5A 1OWIA 1Z8JB 3AAVA 3TH3H 1P03A 5HMAA 2A4GA 4BAMB 5EODA 2ZHEH 2QA9E 1ANCA 1K2I1 4X2WA 3FP7E 1ZHPA 2C8XB 1RS0A 2PUQH 2K8IA 4Y8XA 3STIA 4ABDA 3P70B 1P11E 2BLOA 2BTCE 1NRSH 4E05H 1GL0E 1GI4A 1P2KA 3PROA 1GBJA 1HAYB 2FOHA 2VIVA 1MKWK 1PPCE 4P00A 4Q7YA 5J4QA 3U8RH 2P8OB 1ARBA 5F8ZA 1GBHA 3ZZCA 2JIZD 1HJAB 1QFKH 2C8WB 3KF2A 4D7GA 4MQAA 2W3IA 2W6ID 2M5TA 3EA7A 2WINI 1L4ZA 3SHAH 4KGAA 2GX4A 2Z9KA 1V2UT 1P2NA 5DP8A 5C67A 1DFPA 1O38A 1GJ7B 2ZDNA 2NU3E 4ZKNU 1ZOMA 1C9PA 4NIWA 1A1RA 2V7QD 3GS9A 1GMCG 4X1PU 5F8XA 5C3NA 3GCNA 4XBDA 1TA6A 3PO1C 3TITA 1QL8A 1O35A 1SGEE 4JZ1A 1DSUA 3QZQA 4Q2KA 2HGTH 2F43B 4FVDA 2SGDE 3O8DA 4NSVA 7GCHG 3GICB 1HGTH 4XFQA 2P94A 3M5LA 5A0CA 1J17T 2A2QH 2LNCA 3KL6A 3D23A 1C5LH 2PFEA 2WPMS 2WPHS 3BTFE 3BIUH 3WW7A 2EI7A 3PTBA 1UVSH 1YWUA 3SU5A 4HG6A 3F2HA 2CHAC 1NRQH 1C5MD 4K60A 2F9NA 5T6DA 1O37A 1QA0A 3DSGA 2HRVA 1ZMJA 3KIDU 1DM4B 1K21H 2JKHA 3MU8A 4ISIH 1AQ7A 2D1JA 2R9PA 1O2KA 1AB9B 1K1NA 2FXRA 3LPRA 3SI4H 1MUEB 3BG4B 4MG3A 1SSXA 3E90B 1COWD 5A8YA 4X1QU 1M9UA 5B6LA 1P2JA 1RRKA 1TLDA 1CQQA 5H4IB 3T62A 1YCPH 3HK6B 1SB1H 1NBME 3STJA 1KMHB 4I8HA 2ZFSA 1CA0B 3OX7U 3SV9A 4FETA 1O3NA 3M5OA 1QBVH 5L6NH 2BLWA 2VWOA 1OWKA 3ZYDA 1CBWB 3F68H 2B7DH 1DS2E 1LKBA 2W5EA 2HWLB 1T32A 2OLGA 1TOMH 1KTSB 1OYTH 1AZ8A 3ZV8A 1P02A 5JB8S 2ZPQA 3LOXA 1LVBA 3LGWA 1TPAE 5A8XA 3LONA 5LPRA 2OBOA 2ALPA 1GBFA 3LKWA 5EGMA 5FCRA 3RMOH 3A82A 1O5GH 4JYTA 2HALA 2IJD1 2ZEBA 1YY3A 3W95A 1O2TA 3URDA 2WYGA 4VGCC 2ZCHP 1BITA 1V2OT 2FOAA 1BHXF 4NGAH 1HAIH 4DW2U 1NZQH 3GYMA 4ABHA 5GCHG 5AHGH 3HATH 4K8BA 4D76A 4OM9A 1GJDB 1Z8IB 3L33A 1TYNA 1C1UH 2UUYA 1S6HA 2R2MB 3QK1A 5SGAE 1LKAA 1MD7A 4YOIA 3RXRA 1S83A 4UEHH 4JZDH 2ZQ1A 1O3AA 2D26C 3PMBB 3ELAH 3RXHA 4AYVB 4YOGA 1LMWB 3LGVA 3NXPA 1XKAC 1O3DA 3FKSD 1KTTB 2VWNA 2AYWA 1XUIA 3A85A 2WZQA 2ODQA 3OTPA 1GMDF 2VH0A 2PKSC 2HNTC 2VH6A 5C5OA 1IQJA 1AZZA 1EZUC 1VCQA 2OXSA 2Y80A 2FOEA 4AX9H 1V2KT 4HTCH 1E34B 1BUIA 3UNQA 3V12A 4HGCA 3K2UA 4R0IA 1GHBF 2XOKD 3ZV9A 1YCPM 1SL3A 2ZA5A 3C1KA 3BEIB 1ESAA 4ESTE 1CHGA 5E0GA 3GDUA 3UOUA 4BTIB 1AWFH 5E2OA 5HGGA 2VBCA 2VVVA 1C2JA 2FLRH 3MHWU 3ODDA 1C1VH 4X1RU 2EY4C 1JRTA 3GCHC 3NPSA 4WY3A 2VWMA 3VGCC 2TRMA 3FANA 1O36A 2C3SA 5CDFE 4WWYA 1H8DH 2Y6TA 2R0KA 1IAUA 3S69A 1GI0A 1Y3VA 1NFYA 3OTJE 2EEKA 3D49H 2Q6GA 1T8LA 4KKDA 1DY8A 1V2WT 5GNDA 1KY9A 2J95A 1NN6A 3DA9B 3QGJA 2STAE 3N7DA 4FUCA 1O3CA 4NG9H 1ANEA 2ODYB 1F5LA 3SQHE 2GZ8A 1H1BA 2Z3EA 4K2YA 5T6GA 3T28A 4RSPA 1CT2E 3FOAA 2RDEA 1YPEH 4WXIA 3ZVAA 5LPFA 1EKBB 1ZTLA 1QCPA 3O8RA 3GCTG 2J97A 4WMEA 1UVPA 3A7TA 1UCYH 2PWXA 1O3FA 4XDEA 1IQMA 3SO3A 2WPDD 1ANDA 4CRBA 2EQNA 1W0ZU 3WWBA 1DSTA 3RXUA 5AF9H 4XBBA 2ZCKP 1YGCH 3O8CA 1ETTH 3F1SB 1H4WA 4IGDA 4YTAA 3SJIA 4OGXA 3UUZA 4AC9A 1S81A 3TGJE 5EXLA 1TQ7B 2V3MA 3SHCH 3A80A 5C2ZA 2JH0D 2AGEX 1OWEA 3VPKA 3VXEH 3SU1A 2XBXA 1HYLA 1P01A 1ZJDA 4UONA 1BRBE 3LC3A 3N99A 5K0HA 1V2JT 3Q3KA 4I31A 2ZNKH 3RXJA 2FESH 3SGBE 1QRXA 4F48B 1O5EH 1MMJN 1S6FA 2OD3B 4BAKB 2FTLE 3ZZDA 3BTEE 3LT3A 1BB0B 1TRNA 2WPKS 2G4TA 2PV9B 2VVUA 1Y8TA 5EQSA 2O8TA 1BMNH 2YMSC 5DP7A 1OWHA 1AIXH 2O8MA 2KM0A 1AGJA 1GCTB 1TONA 2Z94A 3M3SA 3RXLA 8GCHG 3UY9A 3A7ZA 4FUHA 1TX7A 4CR9A 1VGCC 2O9QA 2SGEE 1TIOA 1X7AC 2FODA 1CU1A 4WH8A 1HNEE 3ATLA 3ZYEA 2I6SA 3ZVDA 1MQ6A 2A7CA 2TBSA 3P6ZB 2FYQA 5IDKA 3AVZA 3QO6A 3V3MA 1BCUH 1TRMA 3RU4E 1Q2WA 2YNBA 3A7WA 2Z9IA 1MTVA 2F83A 1Z1IA 1P9SA 2XCNA 1GHZA 2FEQH 4X0WU 4ACBA 1Z7KA 1T8MA 1DANH 2KX4A 1TWXB 1ZGVA 2OP9A 2P59A 1SFIA 2GZ9A 1RTFB 2FS8A 3CS0A 1FY1A 2Y7XA 1O5CB 1A46H 3I77A 1XUGA 2ALVA 2A5IA 2NU4E 3TK9A 4NZQA 3M3VA 1XMNB 1VKYA 2ANYA 3R0FA 5DO4H 1WTHD 2BVXH 3OFND 2H5DA 1GBTA 4KTUA 3RLWH 3RU4T 4IW4E 8LPRA 1GBKA 4DT7B 5DP4A 3PWBA 1G3EA 5A09A 5A0AE 1LHFH 1P3CA 2FYRA 2YNAA 2HOBA 2XBYA 1CE5A 1F2SE 3TNTA 4BAOB 2PSXA 1GBCA 4AB8A 1HAOH 1VJAU 3ENSB 3FP8E 1O2XA 4DJZB 2GV7A 2PLXA 2GCTC 4WMDA 2ZU4A 2EC9H 2JETB 5E0HA 1W0JD 2AMPA 2FP7B 3A8CA 1GJCB 2BZAA 1TA2A 3A8AA 1YLCA 5A2MH 4I7YH 1BBRH 5T6FA 1EUFA 1HFDA 4TYDA 1V2LT 3RXTA 1BTHH 2Z3DA 3FO8D 1AUTC 1YBWA 4IN2A 4MVNA 1NO9H 5DSFA 2C8ZB 4NFEA 1PJPA 1MCTA 1SLVB 5FHTA 4K1SA 1SGFA 1P2OA 3SUEA 3M5MA 2GDDA 1DDJA 4OS5A 2AS9A 2BX3A 2PSYA 3UFAA 3ODFA 4X2YA 4BAHB 2BY5X 2ZKSA 1O34A 1JIRA 2R3YA 5E2PA 1ZPBA 2SGPE 5C0TA 1P05A 1SQAA 1O39A 3SW2B 1TMBH 1F5RA 1HV7A 2ZDKA 3SU2A 1PQ5A 1FN6A 1YPHC 1SGNE 3QN7A 4BXWA 2GZ7A 2YMSD 1TNLA 5CHAC 4HFPB 3ZZ6A 3KEEA 4ZXYH 1FLEE 1JWTA 4DOQA 3GISB 1ZPZA 1FPHH 2W6JD 2XNIA 3MH4A 2ZPSA 4U30A 1BTUA 1ELBA 1O3KA 1GI2A 1KXAA 1VZQH 1RGQA 2C93B 4MNVA 1AMHA 2W3KA 3SNEA 2SGAA 1C5XB 1T4VH 2BD5A 1SI5H 1UTMA 5CE1A 1C1NA 1DICA 3ATKA 3RXFA 4FVBA 4CHAB 4ASHA 3F9EA 1W2KH 3SU0A 1YLDA 1C4V2 2J98A 4I8JA 1T8NA 3T29A 1NESE 1H9HE 2ZHDA 4A5TS 1XUFA 3OEED 3RXVA 3L3TA 1SFQB 3M7UA 1HAHH 2A5AA 1GPZA 2ZFQH 2ZGBH 2F4LA 1Y5UT 5EU8A 1BA8B 1EJAA 3U98H 2ODPA 1H8HD 3EAJA 2J94A 1SQRA 4MPUA 5JPMH 1JIMA 4X2VA 2WV5A 2XBVA 5FXLA 2ZDAH 2PUXB 4ZKOU 1J15A 1MZAA 3ZZ9A 1AUJA 5TJXA 1F0RA 2VIOA 2F9UA 4X6MA 1C1MA 4F55A 5A0BA 2RCEA 3MU5A 1PYTC 3KNXA 4GCHF 3RM0H 3BTQE 1ID5H 1O32A 1WV7H 2CJIA 4NWLA 3RC6A 2FDAA 1BRUP 1V2VT 1TB6H 2A5KA 2VIDA 4AFUA 1EAIA 1UK2A 2W7SA 5GJ4B 4JZFH 3PM3A 4UDWH 1TOCB 1C5NH 4A1XA 4XRNA 2GT8A 3DD2H 3A86A 3LC5A 4GSOA 3RXOA 3ZZAA 2BY7X 2H9EH 2W7UA 3QLPH 5A8ZA 3MI4A 3RXAA 2ZECA 5JBBS 3FZZA 4BTTB 2GTBA 2BD2A 2XC4A 3P8FA 1GI7B 1ZHRA 1IQGA 1EAUA 1XKBC 3TNSA 3KN2A 2Q1JA 2QN5T 3E16B 1HJAC 1CHOF 3BG8A 4LZ1H 2HVXA 1W0YH 2Z6BD 1YPGH 3ZZ4A 4KTCA 3I78A 1CT0E 4ZMAH 1C2GA 3ZZ8A 1YCPK 1AU8A 1O2LA 1WQVH 1TPSA 1G37A 1ELTA 3W94A 4X8TH 1EPTA 1LTOA 3OE7D 2DE8A 3A81A 1PQAA 1C5YB 1V2NT 3SV2H 1O2OA 3SJKA 1TBRH 1EQ9A 4FUGA 1NU9A 2QXJA 1YPMH 1P12E 1IQHA 3SNCA 1EZXC 1ZZZA 4K69A 4ABGA 4I8KA 3OAAD 3BN9A 1WAYB 5JBTA 1SHHB 2IN2A 1BTXA 1B7XB 4Z0KA 3Q76A 1O2NA 1FAKH 1AVWA 1RJXB 4A92A 2Y82A 4CH8B 3OSYA 2GCHF 3PMAB 1N6XA 1SLUB 1D3QB 1D3PB 3IWMA 3SZEA 2ASUB 3PYHA 3MO6A 1SGIB 1HIAB 3HK3B 1SOTA 1MKXH 1AB9C 1O3MA 1PQ7A 1BMMH 2AFQB 4BNRA 3BG4C 1B0EA 1LHGH 1CA8B 4ISNA 2ZP0H 4X6NA 1SGDE 4BXSA 5BPEA 3F9FA 2AMQA
chains in the Genus database with same CATH topology
3T25A 1FY4A 2P3UB 3SU4A 2ZPRA 1AVXA 2XBWA 2A4QA 1PYTD 2BYAX 5EXMA 1K9OE 1TFXA 2CMYA 2FO9A 4HI3A 1Y3XA 4CR5A 1CA0C 1YPJH 2Y7ZA 2SFAA 5EPYA 1W12U 1HDTH 1OP2A 1CGJE 1ELEE 3KQEA 1KIGH 1C5OH 1CBWC 1KXCA 1SMFE 3FZDA 1K22H 3UNRA 2TPIZ 3VB3A 3QX5H 2NU1E 1C2FA 2O8WA 2V35A 9ESTA 3TGKE 4WXVA 1RTKA 4Y7AA 1Z71A 4X6OA 6GCHG 2F3CE 2J92A 4GLYA 1DLEA 2A1DB 2PTCE 3P17H 4X8VH 1WCZA 2AERH 3LH3A 1GI3A 1ELFA 3TLOA 3Q77A 1XVMA 4B71A 1QY6A 1SGRE 3K6YA 1HAVA 2F91A 1QBOA 2XW9A 5DP5A 1MCVA 1GBLA 2BDBA 4IMQA 2UWOA 2BLQA 1F0TA 8ESTE 3AAUA 1XX9A 4SGAE 1GL1A 1EASA 2KAIA 1SGYE 1TNGA 1V2PT 3A84A 1DLKB 3D65E 1QTFA 4K1EA 1N1LA 1FJSA 4QT8C 3KCGH 3TJNA 3LGYA 2XC5A 4DIIH 1EXFA 3E3TA 1KDQA 2G00A 1FMGA 4J2YB 4TY6A 1IQEA 1C2DA 1ZMLA 2ZFPH 2D8WA 4IMZA 4FUFA 2PKAA 1V2QT 1GGDB 3GY5A 3ZZ3A 3E0PB 4Y6DA 3RDZA 3LDXH 4X1NU 1IQNA 1GVKB 3R3GB 4JMYA 1O2UA 1QURH 5T3HA 2NWNA 2ZI2H 1A3BH 1GI9B 2BXTH 2C4FH 5PTPA 3MMGA 3LIWA 5FCKA 3QWCH 1G2LA 1C5ZB 1UVUH 3ZVBA 1ZSJA 2FLBH 1DVAH 3RMMH 4UE7H 2P95A 4I32A 4IBLH 1G2MA 1GG6B 1F0SA 1G3DA 4CRDA 2V3OH 1SLXB 3SORA 1O3PB 1SG8B 4Y8YA 2XCFA 1UVOA 3PTNA 2FZZA 1CO7E 1L2EA 1UTQA 2FOCA 3SUGA 1SQOA 2BQ7B 1BDAA 3TK6A 3RLYH 4AG1A 4SGBE 3K9XB 1Z6EA 1O3JA 4MDSA 3T26A 1C1TA 3DFLA 2HNTF 4YT7H 2BD4A 3QTVH 4XSKU 1RD3B 4ZH8A 4LK4A 3G01A 1DT2A 5HYOA 1C5SA 4AORA 1TRYA 2QY0B 2UUJB 4A1TA 2FX6A 1OXGA 2BY9X 1QQUA 3SU6A 2OC8A 2ZDMA 1TPOA 4B75A 1ORFA 3P95A 4ABIA 2D2DA 2VJ1A 2ZQ2A 1GVLA 1S0RA 3TIUA 2ZTYA 1D6RA 1BHXB 1TGCA 5DP3A 1BMAA 3E0NB 3LU9B 3URCA 1KLTA 1K28D 1A7SA 1C9TA 1IHSH 2G51A 3RXPA 2ZCLP 1ZR0A 2F9VA 1MZDA 1F5KU 1A5HA 1QJ1B 3VEQB 5FX5A 1SR5C 1FI8A 1NRNH 1OP8A 1YPKH 1Y3WA 1C2IA 2QC2A 1GHAF 2Q6DA 1GJBB 1GI5A 4WVPE 6ESTA 1BRCE 1AFQB 2ZU1A 3UNSA 3E8LA 4K5ZA 4UFFH 1KXEA 1ZHMA 2XYAA 3CS7A 1O3HA 2OINA 4PROA 3BIVH 4OS1A 1VITF 3LH1A 1HXEH 1V2TT 6LPRA 2WPIS 4ABFA 5JBAS 5EPNA 2ILNA 3SUDA 2EI6A 1W7GH 1S85A 5FPSA 2BXUH 2DUCA 2BX4A 2BQ6B 1GCTC 1ZRKA 1EPTB 1GMHF 3UPEA 4MTBA 4OS2A 1LVYA 1RFNA 2BDYA 2CF9H 4DG4A 1C2LA 3T5FH 4B74A 1T31A 1C5UA 3EE0B 2FIRH 5GDSH 2Q6FA 2FI5E 2ZGHA 1GHVH 1YPLH 1BBRK 1V3XA 4WMFA 3F9GA 1FN8A 1WYKA 1MU6B 1IQFA 1NTPA 2THFB 5JYIA 1V2RT 2BZ6H 5C20A 5GIBA 3LGUA 2SNWA 1ABJH 1A0HB 3MTYA 5FBEA 1K1OA 4INLA 1QB6A 4CH2B 1J14A 1L1GA 3PLKA 1LPZB 1DX5M 1A61H 2EA3A 5AVDA 1N8OB 3M61U 4ZROA 3A87A 2F9PA 1XUKA 3B8JA 1LCYA 3A7XA 1O3BA 2XTTB 1LPGB 2J4IA 2VU8E 1Z6JH 1CVWH 1E36B 3ESTA 4YLQH 1O5BB 2J38A 3IG6B 4O3TA 3JZ1B 4YO9A 3RXMA 4LZ4B 1OSSA 1NY22 4B2BA 5F6MA 1SQTA 1KLIH 3DT0H 3BTDE 3MFJA 5DP6A 2WYJA 3TH4H 1SOZA 2FI3E 2H2ZA 4NZLA 1GJAB 1AFEH 1RIWC 2VGCB 1OPHB 1K1PA 1A0JA 4NIYA 4TWYA 1JMOH 1LPKB 2ZDVH 4NA8A 3RUOA 3BF6H 2RA0A 2JETC 3S9BA 3JZ2B 1FY3A 3PLBA 1ZTKA 4JCNA 4KTSA 1ZSLA 1S5SA 4O3UA 4UFEH 3FVFB 3SZNA 1WOFA 1EAXA 4XOJA 4GUXA 1ETSH 1SBWA 3S7HB 4I33A 1AE5A 1O2RA 4AYYB 2PR3A 2B8OH 3RXKA 1GJ9B 2Z3CA 3GY8A 1UHBA 5DKMA 1QB9A 2ZWLH 3K65B 1MTNB 3BEFB 1MBMA 4YT6H 1P57B 2Y5HA 2STBE 5FPYA 3GDSA 2HNTE 2VIQA 3PB1E 1SC8U 3GOVB 2J2UA 4WF8A 3HKIB 2KAIB 1DWDH 3MH6A 1DOJA 5I25A 3SJOA 2FOBA 1P04A 1IQIA 2G81E 1GMCF 1XUJA 1FY5A 4O9VA 2BHGA 2ZTXA 1TX8A 3MO3A 2B0FA 3SV8A 2PKAB 3SGAE 1OP0A 2V6NA 4X6PA 7GCHF 4DURA 1QIXB 3V13A 3GY4A 5B6OA 1ELAA 1BTPA 1O33A 1EP5A 3E91A 3MOCA 4HZHA 3FFGA 3QZRA 1Y3YA 2WPLS 3MNXA 5DPAA 2F9OA 1QQ4A 5AFYH 1G30B 2UUFB 2GMTC 1PPFE 2XRCA 3KQBA 1MU8B 3NZIA 1C2HA 1TNJA 1GMDG 3MNSA 4K1TA 1TALA 1ESTA 4UFDH 1YF4A 4FUDA 2FX4A 4RKOB 1XXFA 1GHBG 1O2HA 1GJ8B 1S0QA 5DGJA 1UK3A 1UJ1A 2H1UA 1WUNH 4ZHMU 3SNDA 2A2XH 2H5CA 2JH5D 1VCWA 3ATWA 4JYVH 3Q3YA 4K3JA 1LHCH 1AD8H 1PPHE 5L2ZH 4X2XA 4FUBA 3AW0A 4TY7A 3TJVA 2BB4A 1C2EA 1TMUH 1K1LA 3RC5A 1OWDA 3F9HA 1SGPE 1EX3A 1FAXA 5GPIB 1TABE 4LXBH 5EXNA 5TCAA 1Q31A 5G4BA 3HKJB 2QYIA 1HJ8A 1GI6A 1UTPA 2VVCA 2WPJS 2ZIQH 4AFZA 4NFFA 2ZC9H 6CHAB 1XUHA 2ZU3A 3TVJB 1AKSA 5HM2A 2QXHA 2BY8X 3U8TH 3TU7H 1MKXK 3VB6A 1EJNA 2BDCA 3WY8A 3UQOA 3V0XA 1O2IA 5DP9A 2PGQB 2AMDA 3SJ9A 2GP9B 1W3CA 5GCHF 1F0UA 1GJ4H 1IOEA 4KELA 5DG6A 3SV6A 4FU7A 1KSNA 1C1WH 4MLFB 1FQ3A 3RXDA 3NK8A 3TJUA 1ELVA 1ABIH 3GDVA 2OTVA 2ESTE 2AGGX 3PV4A 4GPGA 3GY6A 3RXGA 1A4WH 4YLUA 1Y59T 2J34A 2FMJA 2BVSH 1FV9A 3DUXH 5FPTA 2BM2A 4YOJA 3F6UH 4ABJA 3SOSA 7KMEH 1DITH 2Z9GA 2WUBA 4D9QA 1YKTA 3SUFA 1P9UA 1A5GH 1BJUA 5LH8A 2P8OC 2ZU2A 3MU1A 1VR1H 3RC4A 2C90B 4Y71A 1DWEH 4R8TB 3LGIA 1O31A 1FNIA 3Q00A 1NFWA 1MTSA 1KLJH 2P16A 1KYNA 1H8IH 1ZTJA 2SNVA 1UK4A 3GYLB 1Y5BT 3SNAA 2G52A 2EI8A 2Y5GA 3P92A 3SNBA 1HAZB 3MNBA 4Y8ZA 3NWUA 1C5WB 5GXPA 4RKJB 1NRRH 1W13U 4GVUA 4BANB 2V0BA 1GI1A 3ATIA 3KHVA 3EA9A 5AFZH 2UWLA 2GT7A 3SBKA 2GV6A 3H5CB 2ANKH 1FIWA 1O3IA 4OS4A 1KXFA 3AASA 4CREA 1PPGE 3A8BA 1OOKB 2A45B 4U2WA 1SPJA 4AGKA 4ZAEA 2V3HH 3O8BA 4THNH 3U1IB 1C1QA 1C5VA 2AGIX 2OC0A 1JXPA 3M5NA 1SHYA 1C1PA 3L6PA 3A89A 1C1RA 1K1JA 3RXIA 1BQYA 2TGDA 3BEUA 1Z8RA 1DUEA 4UD9H 1E35B 2GKVE 3SI3H 1A2CH 3H7OA 1Y5AT 3GCTF 4B73A 1EOJA 3VB5A 1LQDB 1JBUH 1MAXA 4M7GA 3BTTE 3TH2H 1TPPA 4OS6A 2FI4E 5EW1H 5I46H 1RXPA 7LPRA 1UTJA 3DFJA 1W11U 1GBEA 3HGPA 2ZHFH 1O2YA 3UWJH 3MH5A 3IITA 1YPHE 1LVMA 5LGOA 4MNYA 4O97A 1TGNA 1ZGIA 1UHBB 1E37B 3NCLA 3B9FH 1YYY1 5FX6A 2BLVA 1YP9A 1NC6A 2FOGA 3GCOA 1QHRB 1GVZA 1MBQA 1LDTT 3BTKE 5L2YH 3ZVGA 3A83A 1TGTA 1BTZA 2CV3A 3LGTA 2QF0A 4DCDA 1EP6A 3EGKH 3M37A 1SLWB 1RTLA 2RDLA 2DE9A 2BY6X 2QXGA 1UTKA 1UTNA 1G3CA 1FIZA 2SGFE 2ULLA 4GAWA 3ZZ7A 2R0LA 1GGDC 4IC6A 1MAYA 2ANWA 1INCA 3EA8A 1VCPA 1BIOA 1LO6A 3E1XB 3ATMA 1DXPA 4Y7BA 8GCHF 3UQVA 1G3BA 8KME2 3T2NA 1P8VC 3ZVCA 1A0LA 2QGRA 2Y5FA 3UR9A 2BMGB 1HXFH 2J9NA 4ZKRU 1P2QA 2OC1A 4NIXA 1IQLA 1T4UH 1WQSA 1H9IE 1QB1A 3MU4A 1P2MA 2ZTZA 4FU8A 1C5RA 2PHBA 1GG6C 1FONA 5GWZA 1TQ0B 4DIHH 4I8GA 1ARCA 2H6MA 3UREA 1L0ZA 4AFQA 2JH6D 2IOTA 2O8UA 1HAGE 4B2CA 3PO1B 1AVGH 1W14U 3SV7A 4X8SH 4NA7A 1MTUA 1TGBA 2I6QA 4CBNA 1TE0A 1QA7A 1W7XH 4B2AA 1P3EA 1V2ST 4JZEH 2ZGXH 1CT4E 2VB0A 2UUKB 3LJJA 3QTOH 2ZHWH 1L4DA 4H4FA 1DWBH 1O5DH 4BTUB 1OWJA 5DK1A 4ISLA 1THRH 1HB0B 2PTNA 5E0JA 2BDHA 1KXDA 2FWWA 3GY3A 4ZHAA 1TBZH 4H42U 1O2ZA 2CHAB 4ABAA 1MKWH 1C4U2 1UCYK 4K8YA 3S9CA 2NU2E 1BTYA 1GBMA 4U01A 3M7TA 1Z1JA 3QGNB 2QIQA 4WJG2 3OYPA 3TK5A 1OYQA 3RXSA 1ZPCA 3EQ0H 2GVFA 2CF8H 1O2WA 4UFGH 5ESTE 3BTME 2W26A 2ZF0H 3CENA 2XWBI 4TPIZ 2GGVB 4J1YA 3E6PH 3MO9A 1YC0A 4XE4A 1QL9A 4E7RG 1UTLM 1U6QA 2G55A 1TMTH 2GDEH 4GCHG 1EJMA 4JK6A 2Z7FE 2QAAA 1C1SA 3KQDA 1Y3UA 1C5PA 1AHTH 2R3UA 1D9IA 4O03A 1AKSB 3UOPA 3N7OA 4FUEA 2BDAA 2FS9A 1TBQH 1AFQC 1ELCA 1PPBH 3H7TA 4B1TA 2A31A 1FUJA 1Z8GA 4OS7A 1FPCH 1WSSH 2SGQE 1C4Y2 2B5TB 4GHQA 1MD8A 3A7VA 3AW1A 5C1YA 3VXFH 4FU9A 1AE8H 1O0DH 1S82A 4DY7B 1HRTH 4ISHH 4ZHLU 2GD4B 4GHTA 5LPEA 1NT1A 1NFUA 3S9AA 2NU0E 1O5FH 1HLTH 1AWHB 1QJ6B 2RG3A 2ZFRH 1PQ8A 2K1QA 1EPTC 1FY8E 1GWAA 4VGCB 4WH6A 1CHOG 1D3TB 2XC0A 5CMXH 1DE7H 3RMLH 1IHTH 1P0SH 5E8EH 1EATA 4ZXXH 2WUCA 2FOMB 3DHKH 1DPOA 1P10A 1S84A 1D6WA 2FOFA 1NFXA 3BTWE 4AZ2B 1P2IA 1QR3E 1WU1A 4NIVA 4TPYA 2TIOA 4YESB 3TJOA 1W10U 3RXCA 1ESBA 5HXFA 3MNCA 1ANBA 1F92A 1BZXE 1EB2A 5BRRE 1J8AA 1T7CA 3PLPA 1D4PB 1TGSZ 2CGAA 1NS3A 2G5VA 2ZZUH 4AGJA 2CN0H 1P09A 2ZU5A 2VIWA 3MYWA 1N8OC 2O8LA 2PKSB 3MU0A 4FUIA 2C8YB 4H6TA 3FP6E 4NCYA 3M3TA 1HPGA 3KGPA 3OY5U 2VINA 4NA9H 4I8LA 2BQWB 4Z6AH 1CGHA 1ZYOA 1GBIA 1IQKA 2GCHG 5J4SA 1O2MA 1K1MA 1AY6H 5HM9A 1J16A 3RP2A 2H9HA 1GCDA 1GDUA 2A32A 4BAQB 5JDUB 4Y76A 4MPWA 1G9IE 1C1OA 2BDGA 1GHWH 2VGCC 2ZDLA 5JBCS 3P8GA 3GCHB 2ZGJA 3VGCB 1O3LA 1SGFG 1BJVA 4TWWA 2OQUA 1GHYH 4E7NA 3P8NA 1GDQA 4Y0ZE 1F7ZA 1GDNA 5JB9S 1N6YA 3B23B 3RU4D 1GBBA 3BV9B 1NU7B 1EOLA 1HJ9A 1NM6A 4Y0YE 2AIPA 1BTWA 1E38B 3UR6A 3A8DA 1LQEA 3BTHE 1BMLA 3U9AH 5F03A 1B5GH 2Z9JA 3CP7A 1EB1H 1E0FD 1TNHA 2AIQA 3S7KB 1AO5A 1THSH 2OCVB 4X1SU 5FBIA 1C2KA 1MTNC 5TCCA 3ZVEA 9LPRA 5EG4A 1OKXA 1BOQA 3RM2H 2QXIA 4CRGA 2HPPH 3KQCA 1GBAA 2Z9LA 1ETRH 4D8NA 4NSYA 3VB7A 2G5NA 1QL7A 1QRZA 4Q7ZA 3M35A 1SGTA 2AH4X 5F8TA 2F9BH 2IPHA 3RXQA 1XM1A 5FAHA 2OBQA 1GHXH 1NPMA 4Y79A 1DY9A 1MQ5A 3PWCA 3RXBA 1VITH