3RXJA

Crystal structure of trypsin complexed with 4-guanidinobenzoic acid
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxjA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxjA02
4R0IA 3SI4H 3RMLH 1C2JA 2OUAA 1ACBE 4NWKA 4LK4A 1HIAB 3RXAA 1V2JT 4UEHH 5L2ZH 4Y8YA 1BTZA 2BD5A 3WY8A 4U01A 2PHBA 2ZG0H 2F9PA 5H4IB 1FPHH 3A82A 1AI8H 3VB5A 1BMNH 1DT2A 1TGTA 3S0NA 1CO7E 1MKXH 1GI5A 2BQ7B 2YNBA 1FAXA 4CHAB 4MNWA 1TB6H 2BVRH 1ELCA 3QK1A 1TNHA 3MH5A 4M7GA 5FPTA 2G8TA 2ZWLH 4X2VA 1N1LA 1KDQB 1SGCA 2JETB 4OS4A 3VEQB 4X2YA 1NU7B 2ANMH 4MDSA 1SOTA 1YPJH 3N7OA 1BB0B 2Z7FE 2AMPA 3RU4E 5A0BA 3RXRA 1NRNH 1YCPK 2XBXA 3LIWA 1SI5H 1Z8IB 4B71A 1EQ9A 2FOEA 1P2KA 2Z6BD 3KQBA 2H9HA 1XM1A 5AVDA 3GY5A 2BMGB 1FIZA 4ZHLU 2ZU1A 3BEFB 3BG8A 2WYJA 3LKWA 1XUJA 1HPGA 2ZU2A 3TJVA 3F1SB 2PWXA 3OU0A 4CRDA 2VINA 4K2YA 3ZZ5A 4ZKNU 1GPZA 1DITH 1C5ZB 2FS9A 1SGIB 1FY1A 2BVXH 1V2WT 2BOHB 4ZH8A 1FY5A 2ZGHA 1QB1A 4ZROA 2P3TB 1OOKB 3RXCA 5F8TA 2CGAA 1GJDB 4IMQA 2ANKH 1UTLM 2HNTC 2UWPA 5DP3A 3ZYEA 5IYTA 1IAUA 1O30A 3BTTE 2BDCA 3RXFA 1B0EA 2R2MB 1D6WA 1HAZB 1GJCB 2VU8E 4H4FA 1EJAA 3GYMA 1ZMLA 3ITIA 2QXJA 3PB1E 2B9LA 1SFIA 2BD4A 2C8XB 1O3NA 3O8CA 2ZDMA 4WF8A 5GPIB 1UK3A 1UVOA 2SNWA 3GCNA 2ZFPH 1BJVA 2V3OH 3URDA 4NIVA 1C5LH 5C1XA 1VJ9U 1P03A 1FPCH 3RXLA 3B8JA 5E2OA 3LGIA 1QB6A 2H2ZA 1V2MT 1SGDE 1VR1H 1XUFA 1MKWH 1ZR0A 2BDYA 1A0JA 1C1UH 1UVTH 4I8HA 2XBYA 1FJSA 1YCPM 1IOEA 3BV9B 3MOCA 1RIWB 4IN2A 1O3GA 1RXPA 2ZHQH 4GCHF 2EI8A 1A5HA 1FQ3A 5DGJA 1C1OA 2A7HA 3A81A 2HRVA 1Y5BT 3TVJB 3NK8A 3S9CA 1VCPA 1OKXA 2QF3A 3MI4A 1ZSKA 1O5CB 1DLKB 1C2GA 2XYAA 1BMLA 1PPZA 2XWBI 3T29A 1MKWK 3HATH 2Q6GA 4AB9A 2ZQ2A 3QDZB 3URCA 2VWNA 2ZU4A 4H6TA 1EX3A 5DK1A 3UREA 5C3NA 1TBQH 1EAWA 1HAXB 5F8ZA 1IQNA 1BTPA 3W95A 3BG4B 2V35A 1MMJN 4INKA 1AB9B 2NU2E 2AS9A 3DD2H 1GGDC 1ELDE 2ZP0H 3GY4A 1BRCE 1C1PA 1LVBA 4OGYA 1C2KA 1W2KH 2Y7ZA 3A7TA 1GBCA 3EQ0H 2DUCA 3S9AA 2OQ5A 1CT4E 1OP2A 1KYNA 1IQMA 1EAUA 4GVUA 1HAVA 2FO9A 3RMNH 1BOQA 1ZSLA 1NZQH 4K5ZA 3K2UA 1P12E 2Z94A 4K1SA 1KXFA 5HM9A 1O2IA 3I77A 1P2NA 1O2MA 2G55A 2TPIZ 2C4FH 4ISHH 5TJXA 1A46H 2W26A 1CGJE 4E7RG 5DPAA 4MPUA 1VJAU 2OBQA 2D2DA 2ZECA 3GY7A 2FODA 3GY3A 2DE8A 3A7VA 1NC6A 2F9OA 1W11U 1KIGH 4WXVA 1OWJA 5FHTA 4OGXA 1ELTA 2BTCE 1GMDG 3MNSA 1T4UH 4FUEA 4ZXXH 3DFLA 2BOKA 3QLPH 5A8XA 4I8LA 5C5NA 1F2SE 1YC0A 4AX9H 1RD3B 3A87A 4X1PU 2W7SA 1JIRA 1TONA 2Y80A 1P11E 2A4OA 2R0LA 4TY7A 4IBLH 5L2YH 3BTEE 4DVAU 2VIDA 2SFAA 3TNTA 2ZFQH 1V6DA 2ZFRH 1GG6C 1J17T 1KXCA 1BCUH 2QIQA 3B9FH 3EDXB 4ABJA 1O5GH 5FX5A 2IN2A 4OS7A 3RMOH 1SLVB 1P01A 1QTFA 1GBKA 2GZ8A 2WPIS 2BYAX 3NUMA 2GCHF 1FDPA 1V2PT 4KTCA 1Y3VA 3JZ1B 5LPRA 2AEIH 3MH4A 3SU5A 1TMTH 1ZYOA 4HI3A 1J16A 3RXDA 5A2MH 3M7UA 2AMDA 3M3VA 3S9BA 4U2WA 2PSXA 1RRKA 1UMAH 2FEQH 1O2OA 3H7OA 3E8LA 2BB4A 1G3BA 3EYDA 3LOXA 5ESTE 2FYRA 3KQDA 4A92A 1GBTA 1C2IA 2CHAB 3PMBB 5C1YA 2B0FA 1THPB 2VB0A 2W3KA 4YLQH 5LPFA 1HGTH 1VITG 2PGQB 1LHGH 1SGFA 4O3TA 1QL7A 2IJOB 2CJIA 1V2NT 2NU4E 1V2KT 2ZHEH 4Y71A 2ZCHP 3FFGA 2A2XH 3QO6A 3VGCB 1ETRH 5AHGH 1OP8A 4JZFH 1O3LA 1ZRKA 1C4Y2 1EZQA 2BD3A 3A8AA 2XXLA 3GCTG 4WXIA 4XOJA 1PPEE 4JMYA 3F9HA 2ZDKA 2O8LA 1JRSA 2ZKSA 3I78A 4I8JA 3BSQA 2FP7B 3ENSB 1IQFA 2THFB 2BDGA 1GHYH 1VGCB 3M5OA 2O8TA 2O8WA 1F7ZA 4JK6A 1EXFA 1RJXB 1O3JA 3D65E 1ETSH 1HB0B 3GY6A 4X6MA 1RTLA 2CV3A 1O2GH 3SHCH 4E06H 1LQEA 4JZDH 3TNSA 4CBNA 5FPSA 3R3GB 4X8TH 2BX3A 1ESTA 3SI3H 2VIVA 3A85A 1KTSB 1UVPA 1XUGA 4GLYA 1ORFA 3UNSA 1FZZA 3AW1A 1EOJA 4GPGA 4ISIH 2ZFSA 1O2RA 1C5YB 5BRRE 1EKBB 1EP5A 4GCHG 3D49H 3U98H 2YNAA 1GI1A 3BTHE 4I32A 1SG8B 7GCHF 4NA7A 4TPYA 2XC5A 3GDVA 3EA8A 3BEIB 1MUEB 2BHGA 4FUBA 5F03A 4SGBE 3ELAH 2FOBA 1G2LA 2ZHFH 4X8VH 1S5SA 3SQHE 1AFQB 1P02A 1L4DA 4RKOB 3HKJB 1NRRH 1CHOF 4BTIB 1O2NA 2G52A 3ZZ7A 1SPJA 4FXGH 4OS5A 1THSH 2GKVE 2A4RA 1LMWB 1GBJA 2QYIA 1GHBF 3A89A 3M5LA 2GV6A 1K9OE 4FVDA 2I6SA 3RC4A 1XXFA 3E0NB 4UONA 2F9VA 1S84A 2XCNA 1AE5A 4GHTA 3LDXH 3KGPA 1ZTLA 3Q3KA 3ESTA 4X8SH 3S69A 3E1XB 1TPAE 4Y6DA 2BY7X 4IC6A 3MTYA 1O2HA 1K2I1 5EG4A 5F8XA 1F0UA 1ZPCA 4B1TA 3LJOA 2R0KA 4DW2U 4LZ4B 2WV5A 3U8TH 5E2PA 1F5KU 3TLOA 4CHAC 3RC6A 1AY6H 3ZZCA 1TPSA 1C2MA 5K7RA 1W13U 1LHEH 1GBIA 4DIIH 1BUIA 5JPMH 3RXSA 3SV9A 1UTQA 1O2YA 1O37A 3MO3A 2SNVA 4FVBA 1K1OA 2W7UA 4WJG2 1P2MA 1YP9A 4NIYA 1G36A 1BTXA 1KLTA 1QRWA 4ZKSU 3SV7A 3PMJA 3ZVAA 1BBRE 5DP9A 3RXTA 1YLCA 1KXAA 4YTAA 1DUEA 5AFYH 1ZJDA 5L6NH 2B8OH 1HRTH 2RA3A 1XKBC 3MH7A 1EP6A 4MQAA 2EEKA 1QRZA 1J15A 3UNQA 4INLA 2GVFA 1FUJA 3FP8E 4YT6H 3OSYA 1GHAG 4FUGA 6CHAC 3A7XA 3AW0A 3ZZ4A 3U1IB 3QUMP 1E36B 2OC7A 1D3TB 2XC0A 1HAPH 4NFEA 1O3CA 1O5AB 1BTYA 1Z8JB 4ZHAA 1QFKH 4NZQA 2Z3EA 1K1LA 1SSXA 2Z9IA 1DM4B 6GCHG 1N8OB 1GI0A 1OWEA 2NWNA 3UNRA 5ETXA 4BAQB 1C4V2 1TOMH 3FVFB 3SU2A 3T62A 5AFZH 2QC2A 3LGUA 2ASUB 2XNIA 4WMFA 2Q6DA 3SUGA 3RU4D 3V0XA 2J9NA 2QXGA 3OX7U 1T4VH 3RC5A 1XXDA 1GVKB 2W3IA 4MNXA 2W5EA 4TPIZ 1H1BA 2DE9A 1AHTH 1HXFH 3F68H 4GAWA 1TFXA 3SJOA 4DCDA 2G00A 1XUIA 4BAHB 1L0ZA 1BRUP 1O36A 4KELA 1DY8A 4SGAE 3BTGE 2R2WU 5K0HA 1AMHA 3L6PA 1OPHB 1ZSJA 1O2KA 1SGNE 3BTME 3Q3XA 5JBBS 1CA8B 2GV7A 3SUDA 3ATMA 1EAIA 1C1RA 2UUKB 1P3CA 1Y59T 3UOPA 1P9SA 1ZZZA 3MU0A 2J2UA 1GBMA 1QA7A 1YF4A 1QQUA 3JZ2B 4IC5A 4NZLA 1NT1A 1WTGH 4OS6A 5GJ4B 1HAVB 2ZGXH 4XBDA 2JH0D 2SGPE 1SLXB 1W8BH 4DG4A 1TGBA 4HZHA 4MPVA 3ZVGA 5FCRA 2ALVA 3CS7A 1CHGA 1IQLA 1DVAH 1GMDF 3D62A 3ZYDA 4XBBA 3GICB 1YPKH 1SHYA 1VCQA 2OD3B 1AUJA 1A7SA 5TCAA 1CQQA 3CS0A 1G3CA 3A8CA 1ANEA 4AB8A 3KL6A 4ZHMU 2ODYB 3PV4A 2GP9B 5JBAS 3O8DA 1EASA 3RXMA 1UTPA 5A0AE 3ZZ9A 2CXVA 8ESTE 1SQOA 2SGFE 1NRQH 2ZC9H 1Y3WA 3T28A 1Z8GA 3SOSA 3V7TA 1TX7A 5C5OA 2VWLA 1NFXA 3BTQE 2FOFA 4DURA 1NFUA 5HM2A 4ASHA 1TX6A 4B73A 1AB9C 2STAE 1ETTH 4HFPB 3GISB 3TH3H 1DXPA 1GBDA 1BRAA 1C1WH 2TGDA 1MH0A 1Z8RA 2Y6TA 1DE7H 2FDAA 3MO6A 3Q3YA 2RG3A 1GHWH 1TNKA 9LPRA 4B76A 1GJ8B 2WINI 5GCHG 1K1IA 3BF6H 1AFEH 1LKAA 1OP0A 4NIXA 3RLWH 1G2MA 1VCWA 1HIAA 2A5IA 2WYGA 2IPHA 2FXRA 1ANCA 3OYPA 1TRMA 5A0CA 1JBUH 4BOHA 1OYQA 3S7HB 4A1VA 1PQ7A 4NSVA 2FX4A 1GCDA 1MTSA 1KXDA 3P8NA 3SN8A 4CRGA 2A2QH 1C5RA 3SV2H 2P3FH 1GJ5H 1DICA 4F49A 3ZZ8A 1GHAF 4THNH 3VFEA 2TBSA 3PM3A 1K1NA 3GY2A 1V2ST 3MU4A 3MNXA 2ZCLP 1GI4A 4K69A 4JK5A 1ZMNA 1PQ5A 2OTVA 1KDQA 1CGHA 1Y5UT 3GOVB 4FUHA 3PO1B 4ABGA 1S82A 3UTUH 4AGJA 2GMTC 5HYOA 2VWOA 3K6ZA 2V0BA 4KP0A 3OY5U 1Y5AT 2JH6D 2SGEE 2UUYA 1GI2A 2NU1E 3SJIA 1G30B 4I8GA 1EATA 1GDUA 2ODQA 2R3UA 1NM6A 3SU0A 1WSSH 1LTOA 2ZTXA 1TRYA 1HCGA 4OS1A 1P10A 1LO6A 1TWXB 1H8DH 2ALPA 1TLDA 3LGTA 5G4BA 1LPZB 4ISOA 3AASA 1HJ8A 4RKJB 4X2XA 3VXFH 3E6PH 4XSKU 4NG9H 1TNIA 1AGJA 1INCA 2CF8H 2A31A 4Z6AH 3SNBA 1KTTB 1ELAA 5T3HA 1TBRH 3LGYA 5FPYA 1YPLH 1C1NA 1TIOA 3ZVEA 1GBBA 3SZNA 3A84A 1GMHF 4X6OA 1SQTA 2D8WA 1AE8H 5EXMA 1A5GH 4TWWA 4B2BA 1C9PA 1HJ9A 1YKTA 1C5OH 4FUCA 4DJZB 4O03A 3RUOA 4YT7H 2BLVA 1W10U 1L2EA 3C1KA 1C2LA 1SQAA 3U9AH 3ATLA 1GBFA 2XC4A 1GVZA 2QN5T 1IQHA 4OS2A 1QR3E 1CE5A 1ZJKA 1WCZA 4IMZA 5GDSH 2UUFB 1DPOA 1UCYK 1B0FA 2QCYA 2H1UA 3RLYH 1TPOA 2PGBB 1AZ8A 1SGPE 2ZDVH 4J1YA 2Z9LA 4UE7H 2RA0A 4VGCC 3VB6A 2ZHWH 1XKAC 3SO3A 3UQVA 1ZLRA 1DWCH 3EGKH 2AGEX 1FV9A 1S85A 3KN2A 1S0QA 2B5TB 5I46H 1C1QA 1ZMJA 2BDIA 1MD7A 1NESE 4FUDA 1CA0B 2PKAB 5E0GA 2PTNA 3E3TA 2P8OB 2FOMB 1TRNA 1J9CH 2F91A 2VIWA 4B74A 1IHSH 3MNBA 2RDLA 3A88A 4K8YA 3BEUA 1P0SH 1O2UA 5EXNA 1SLUB 3OTJE 2VGCC 1W0YH 2R9PA 1GDNA 3ATKA 1KXEA 4ZKOU 3F6UH 5IDKA 2STBE 1GI6A 3HPTB 2H6MA 1O3MA 4Q7ZA 1VITH 2PUXB 3PWBA 4AFUA 1O2XA 3F9FA 3VB3A 4U30A 5GIBA 2VH6A 5C20A 1GI3A 2ZDAH 3AVZA 1H8IH 3E0PB 1UHBA 4K1TA 1FNIA 2QA9E 3S7KB 3M7QA 3STJA 2Z3CA 4E05H 1BTUA 4BAMB 1HLTH 1HBTH 1AVWA 5F6MA 4DIHH 1BJUA 2FI4E 4MPXA 4NA9H 1EJMA 4QT8C 4LZ1H 4ABAA 1PPFE 5FAHA 1LCYA 2FWWA 1GHZA 1E34B 3SGQE 2FOGA 1ELFA 4BAKB 1O0DH 1AUTC 4I31A 3ZVDA 4CH2B 1A61H 4F4OC 3MH6A 1K1PA 1DXWA 2ZU5A 2EI7A 1GBAA 1FLEE 2BZAA 2KAIA 2ZEBA 2P3UB 1SOZA 1GBEA 2VVVA 1ZPBA 1UHBB 1GJ9B 3M61U 1OYTH 7GCHG 1C5WB 4NSYA 4MTBA 4A1XA 1AKSA 1L1JA 1V2TT 4FU9A 3O8BA 1QL8A 3KNXA 5FX6A 2Q6FA 1SLWB 1YPMH 4UFDH 2AIQA 3RXPA 1ID5H 4NA8A 1P2IA 1UK4A 1BHXB 3MO9A 1SGYE 1GJ4H 3Q77A 1O3EA 4RN6A 1P8VC 1G37A 1KY9A 1O2ZA 2SGDE 3ZZ3A 1H9HE 1OSSA 1GMHG 3QGJA 1PFXC 3QN7A 3M35A 3TK9A 1PPCE 4VGCB 4CREA 3SJ8A 2OC8A 4X6PA 4ABBA 2OLGA 3O8RA 3KF2A 1K1MA 2EI6A 4YOIA 1Q2WA 1EB1H 8GCHF 2FI3E 2FOAA 2J38A 1SGEE 2HPPH 1O31A 3SU1A 3SBKA 1TX8A 1A3BH 4ZXYH 5DO4H 3GCTF 2A7CA 2PTCE 3V13A 2P16A 2JKHA 3SUFA 4CR5A 1QBOA 2C8YB 1OWDA 4U32A 4Y8ZA 1GBLA 1RTFB 1FY8E 3BTDE 1UCYE 3RXOA 5EPYA 1PPHE 1CHOG 3SQEE 1GHXH 2K1QA 5HMAA 5EOKA 3A83A 1TYNA 2ZTZA 5DKMA 2C3SA 1LHFH 1ELEE 2QV1A 3L33A 1UTMA 1AIXH 1LHDH 2OC0A 1QGFA 4Y7BA 3TITA 2C90B 1NROH 4NGAH 2BD9A 3BTKE 3RXQA 1UVUH 1JXPA 1YPHE 2JETC 2QAAA 2ILNA 2Z9KA 1NY22 6LPRA 3A7ZA 3ZZAA 1A1RA 2HOBA 1RIWC 1Z71A 2VWMA 1BITA 1HNEE 3P8OA 1Y3YA 3RP2A 1HXEH 9ESTA 1TGNA 3UQOA 1ELBA 1J8AA 5FXLA 4Y10E 1SMFE 5FCKA 4FU8A 1O33A 4MVNA 1PPBH 1TNGA 1YPHC 1VGCC 2XW9A 1SC8U 1D6RA 2VNTA 1P57B 4E7NA 3M36A 5LGOA 2ZGBH 3ODFA 1TABE 3NKKA 4BNRA 1LDTT 1ZRBA 1WAYB 5GWZA 1QIXB 1P09A 2C93B 3STIA 2VJ1A 1CGIE 4DT7B 5ESBA 1TA2A 1YPEH 2C8ZB 3HK3B 1WQSA 2AH4X 3PTBA 1ELVA 4A5TS 2BVSH 3SU4A 1SGQE 3ODDA 5CHAC 3A8BA 3Q76A 4BXWA 2ZU3A 2V6NA 4XE4A 1AQ7A 1VITF 4X1QU 4ABHA 3W94A 4NWLA 3ZVCA 1MQ6A 4ZAEA 1N8OC 1QJ1B 2AIPA 1MU8B 2PV9B 1KLJH 3VB4A 4UFGH 1MD8A 1NTPA 1O3DA 1FAKH 1UJ1A 3KCGH 4AN7A 2BQ6B 2O8UA 1MBQA 3UPEA 5A8ZA 1BZXE 1NFWA 3V3MA 5J4SA 4Y76A 2AERH 5FBIA 2SGQE 1ZHPA 3QTVH 1B5GH 4XFQA 3UUZA 2FTMA 3LC5A 5EQRA 3M3SA 2HLCA 2P59A 1OS8A 1VZQH 1N6XA 3ATWA 1P2OA 1MKXK 4Y0ZE 3RDZA 2XCFA 1T8OA 4NIWA 1ZHMA 4IW4E 1QL9A 2P94A 1FMGA 6CHAB 2P95A 1EUFA 2ZGJA 1DX5M 1GG6B 2FZZA 4BTTB 3UWIA 5JB8S 2CN0H 3KEEA 2A0QB 3QWCH 4WVPE 4ABIA 5EPNA 4Y8XA 1E35B 2QF0A 2BXUH 2GD4B 3A80A 4TWYA 2BDBA 2Y5GA 3FZDA 2FYQA 2ANYA 1C5UA 1PQAA 1MQ5A 3HGPA 3TIUA 3M37A 2H5DA 2OBOA 4I7YH 2P93A 4PROA 2OP9A 3RM0H 1TE0A 2EA3A 3EA9A 3EAJA 1NRSH 5EU8A 3EE0B 1ZGIA 2FI5E 1IQIA 4DY7B 4GHQA 3DT0H 1YLDA 3LONA 2OXSA 1AVXA 1K22H 2BM2A 1MZDA 3BN9A 5GXPA 5SGAE 3RXGA 1Y8TA 3LPRA 1W7XH 1C1VH 1GCTB 1RS0A 2A45B 3LH3A 1BBRK 3SU6A 5T6GA 3MU5A 2PKSC 4WH8A 2WV4A 2ZGCA 3FAOA 2BDAA 3M3TA 2GZ7A 1FY4A 1O2TA 4RSPA 1C5MD 1G9IE 2PSYA 3VGCC 1OWIA 4XDEA 1CT2E 2G5NA 3TH4H 3KQCA 1WU1A 1HAIH 1IQEA 2TGPZ 1C5SA 1D9IA 1Z1JA 1QHRB 1UO6A 1LKBA 4Q80A 1O3AA 1ESAA 2HVXA 1GGDB 2PUQH 2BD2A 3BTWE 1SGTA 4JZEH 2WPHS 1TNLA 2PKSB 3U69H 3PMAB 4Z0KA 4BANB 2CHAC 1YBWA 4MLFB 1HUTH 3RXEA 2XTTB 4X1NU 1A4WH 7ESTE 5EQQA 4UD9H 5EQSA 1Y3UA 1RFNA 4Q7YA 4D8NA 3TGIE 3A86A 3B23B 1ESBA 1H4WA 3GYLB 1BMMH 1O2PA 1CU1A 4NFFA 2UWOA 4MNYA 3GY8A 1EPTB 4GUXA 4MNVA 2J4IA 1P06A 3LC3A 4LXBH 4D9RA 2PLXA 2Z9GA 2ZHDA 3GDUA 2AGGX 3SJ9A 3CENA 3SW2B 5HXFA 1SB1H 3H5CB 2R3YA 2BDHA 1T8NA 3FANA 3TK5A 1O3FA 4LOYH 2TGAA 1MBMA 1FIWA 3SNAA 3PMHB 2AMQA 3NWUA 1UTOA 2P8OC 1QA0A 3SGBE 1AZZA 2GMTB 4DGJA 5A09A 1QRXA 3M5NA 1C4U2 1O34A 1V2LT 2WUBA 4X1RU 4R8TB 1K1JA 2A5KA 1T8MA 1ELGA 2ZDNA 2H9TH 1EOLA 1ABJH 1DWEH 3MMGA 3H7TA 3NCLA 4YM9A 5JBCS 1O3BA 2QXHA 3TJNA 4YOJA 2PKAA 2QXIA 3U8RH 1AKSB 1W7GH 1MCTA 1WQVH 2VH0A 3P8FA 3HK6B 3UR6A 1MU6B 1GHVH 3VXEH 3NZIA 1O5EH 3T5FH 3PLKA 3P17H 1S81A 3RMMH 3G01A 5EW1H 1NPMA 3SU3A 4GSOA 6ESTA 1U6QA 2QY0B 5LH8A 1C5NH 2F83A 4ZUHA 1ARCA 4FU7A 1GWAA 1PJPA 5EW2H 1GBHA 2B7DH 2LNCA 1QURH 2ZI2H 3OY6U 1MTNB 4INHA 1XUKA 1LVMA 2BX4A 2XBWA 5T6DA 4Y79A 3UY9A 4JYUH 1GDQA 4WMEA 1NO9H 3AAUA 4AZ2B 1X7AC 2GGVB 1AO5A 4TY6A 1QJ6B 3VB7A 1NFYA 3UOUA 3LGWA 3BIVH 1NRPH 1WOFA 2VVCA 1TNJA 1ANDA 4ABDA 3BG4C 2FTLE 8KME2 2A32A 4WH6A 1D4PB 2Z9JA 2Z3DA 1DUAA 1QJ7B 3IWMA 4NCYA 4CH8B 4J2YB 3FP6E 2VIQA 1QBVH 1DY9A 1XX9A 3UWJH 4CRAA 1L4ZA 1D3PB 2G51A 1C1MA 2J34A 5CMXH 3F9EA 3LT3A 8GCHG 1WBGB 2BY8X 3P92A 5EGMA 1LPGB 4CBOA 2G4TA 2HALA 1TALA 1DANH 1E38B 2A4GA 1MTWA 3K9XB 5CE1A 2VIPA 1F92A 1HAYB 2PFEA 2WPJS 3NPSA 1UTNA 3E16B 3MHWU 1MAXA 1LVYA 1GJBB 2BLQA 2O9QA 2F9NA 1GI7B 3TK6A 2G5VA 2XWAA 2BLOA 1TQ0B 1Q3XA 5L30H 3KIDU 1GMCG 1IQKA 1BQYA 2BZ6H 3DUXH 1E37B 1C9TA 1CVWH 1YM0A 1H9IE 1KXBA 1MZAA 4B2CA 2AFQB 3T25A 4XBCA 3QGNB 3MU8A 3LGVA 3TJOA 1FY3A 1YGCH 3M5MA 4O9VA 3RXBA 4A7IB 3P95A 3U8OH 3SGAE 2Y7XA 3TH2H 1MTUA 5J4QA 1HJAB 1TMBH 2J95A 3TGJE 1IQGA 1BTWA 4B75A 4YESB 1QQ4A 1CT0E 2H5CA 2ZZUH 5C2ZA 3SORA 3ZV9A 2PR3A 3HGNA 1TBZH 3ZVFA 1GL1A 2ZA5A 1S0RA 4K60A 2FMJA 1Y3XA 3GCOA 1RTKA 4CRCA 3SHAH 3LU9B 5EXLA 2HGTH 3QX5H 1FXYA 1MTVA 4X6NA 2VVUA 2GDEH 2G81E 2NU0E 1EPTA 1A0HB 2AYWA 1F5LA 4O3UA 3GDSA 3QTOH 4D7FA 3MWIU 1ZHRA 3ZVBA 1V2RT 1D3DB 1ZGVA 1NN6A 1DWBH 1JMOH 1F0TA 1CBWC 1QY6A 5LPEA 2NU3E 2BXTH 3C27B 1ARBA 1QNJA 4JYVH 3A8DA 1TMUH 1BRBE 1L1NA 2BY6X 1B7XB 2ZNKH 2ESTE 4JYTA 3VPKA 1GJ6A 1OWHA 2UUJB 1GHBG 2ZDLA 3T2NA 2XRCA 4AG2A 1G3DA 1DFPA 3L3TA 2ZPSA 3TU7H 2AGIX 4UFFH 1PQ8A 1T8LA 4TYDA 3M7TA 1O2QA 1AD8H 3DA9B 2BD7A 3SNEA 1SGRE 2FLBH 4HGCA 1P2JA 4H6SB 1FONA 1EB2A 5DP4A 4H42U 1BIOA 1O2SA 4AFZA 2BY9X 1IHTH 3MU1A 5DJ7A 1E0FD 2F9BH 3GCHC 4YOGA 4K1EA 1XUHA 1O5DH 4MPWA 1BHXF 2GT7A 1CSOE 1G32B 1ZPZA 2Y5HA 1DS2E 2ZFTA 2ANWA 1BT7A 1F0SA 3LJJA 4AFQA 1SR5C 1XVMA 4I33A 5I25A 2BLWA 4FUFA 4KGAA 1GMCF 1LHCH 3R0FA 2ZIQH 5JYIA 1AWFH 2A5AA 3ATIA 1AU8A 3PTNA 1TQ7B 3BIUH 1T31A 2OCVB 4MG3A 1UCYH 4D76A 2C8WB 1JRTA 2Y5FA 4X2WA 1BMAA 1GI8B 3UFAA 1TAWA 2BQWB 3IG6B 1C5PA 4ZMAH 5DG6A 3SNCA 4YLUA 1YPGH 3U1JB 2HNTF 1EZUC 5HGGA 5JBTA 5E8EH 1Z1IA 2KAIB 1UVSH 3F9GA 2QGRA 1O3PB 4AORA 1DDJA 2EC9H 1MCVA 4KTUA 1AFQC 3DHKH 3E91A 4ISNA 2OQUA 1AWHB 1C5XB 4UFEH 4A6LA 5DP8A 1M9UA 1S83A 1O2LA 3PLPA 2VIOA 1C2EA 1AN1E 1XVOA 1LVOA 1G3EA 1JOUB 1THRH 1MAYA 1HAGE 1DOJA 1SFQB 1BTHH 1KSNA 3DFJA 1O38A 2PW8H 3K65B 1UTJA 1SVPA 2FX6A 3K6YA 1P9UA 4AFSA 3SJKA 2BD8A 4UDWH 4AGKA 2LPRA 2XBVA 5TCCA 2FLRH 1EAXA 1HFDA 3RXVA 2ZPRA 3GCHB 1PYTC 3MYWA 3ZZ6A 1FI8A 3PO1C 7KMEH 2A4QA 1C5VA 4KKDA 1FN8A 2WPKS 3ZV8A 4IN1A 1O2VA 1H9LB 1F0RA 2WPMS 1T7CA 1O3OA 1EZXC 1XMNB 1P2QA 3E90B 3NXPA 1A0LA 1QCPA 1LPKB 5EODA 1W0ZU 1Q31A 3HKIB 3IITA 4A1TA 2F3CE 4FUIA 7LPRA 1O39A 3SV6A 4DOQA 2BY5X 4Q2KA 3MNCA 4AG1A 2RCEA 5A8YA 2OC1A 2D26C 2HWLB 4Q7XA 1P04A 1EPTC 1HAOH 4X8UH 1Z6EA 1TGSZ 3LH1A 1V3XA 3A7YA 3TPIZ 4ISLA 1GJ7B 3A7WA 1ZTKA 3P6ZB 1C1TA 3QZQA 3EA7A 2ZFFH 4KTSA 1A5IA 1W14U 4BAOB 5AF9H 4YO9A 1A3EH 1GVLA 1O3IA 1O3KA 1K28D 2G4UA 1OXGA 1ANBA 2J92A 2F9UA 1O32A 1SL3A 3RXHA 3MFJA 4AOQA 1F5RA 2GTBA 5ABWA 3PROA 4WWYA 1DSTA 1YCPH 5PTPA 5FBEA 1TGCA 2GCHG 3SNDA 2FOHA 3UIRA 4WMDA 2FIRH 1QB9A 2FM2A 4D9QA 2CF9H 2Y82A 2JH5D 2GT8A 2Y81A 2TIOA 1PPGE 2O8MA 2IOTA 5E0HA 2OINA 3AAVA 5B6OA 8LPRA 5E0JA 4JCNA 1GCTC 1MTNC 3P70B 1O2WA 2SGAA 2WUCA 2FS8A 1DWDH 3P8GA 1HYLA 4BXSA 4D7GA 2GCTC 1UK2A 4Y0YE 1P3EA 3QZRA 1C5TA 2ZO3H 4HTCH 5DP5A 2WPLS 3TJUA 1SBWA 3SUEA 1GJAB 1CA0C 1OX1A 1V2UT 3FP7E 1HAHH 3RXKA 2HNTE 1RGQA 4ZKRU 3CP7A 2ZF0H 3D23A 3UR9A 2A1DB 5DP6A 1TPPA 2GX4A 3BTFE 3PLBA 2ZCKP 3Q00A 1HDTH 5JB9S 4X1SU 5GCHF 5C1UA 1C2FA 1BA8B 1ZTJA 2D1JA 5JDUB 1GI9B 1O5FH 4ABEA 2FPZA 1DLEA 1PYTD 1WYKA 2HPQH 4IGDA 5DP7A 1HV7A 4JZ1A 3RM2H 4I8KA 2FESH 1EZSC 3ZZDA 3V12A 2GCTB 1NU9A 2ZTYA 1V2VT 1KLIH 1SHHB 2A7JA 1O35A 1ZOMA 4IS5A 3TGKE 1BBRH 2GZ9A 4CRFA 2M5TA 1UTKA 1N6YA 1TOCB 2V3HH 1D3QB 3PWCA 4YZUA 1SGFG 1GL0E 2FOCA 2UWLA 4BTUB 3T26A 3RU4T 4Y11E 1EJNA 1CBWB 4X0WU 5BPEA 1O2JA 4ABFA 1O3HA 5C67A 3PYHA 2Q1JA 2I6QA 4Y7AA 2ULLA 3RXUA 1BDAA 1C2HA 1J14A 2ZPQA 1ABIH 1FN6A 4K3JA 4WY3A 1S6HA 1L1GA 1P05A 3FZZA 5T6FA 4ESTE 3RXIA 6GCHF 1K21H 2J94A 1Z7KA 3KHVA 3RXJA 3SV8A 2TRMA 1JWTA 1C2DA 1NS3A 1A2CH 1WUNH 1TA6A 2YOLA 3T27A 1OWKA 2CMYA 4FUJA 5CHAB 2GDDA 1S6FA 4JZIA 3KQEA 1JIMA 4B2AA 1W12U 1IQJA 1Z6JH 1HJAC 1LQDB 1O5BB 2VGCB 1W3CA 3I29A 1YYY1 4AYYB 1AVGH 3ZZBA 1T32A 1V2QT 4K8BA 1WTHD 2ZQ1A 4CR9A 4AYVB 2TGTA 1C1SA 1V2OT 1DSUA 1QBNA 2H9EH 2ODPA 1C5QA 4O97A 4CRBA 1WV7H
chains in the Genus database with same CATH superfamily
4R0IA 3SI4H 3RMLH 1C2JA 2OUAA 1ACBE 4NWKA 4LK4A 1HIAB 3RXAA 4F48B 1V2JT 4UEHH 5L2ZH 4Y8YA 1BTZA 2BD5A 3WY8A 4U01A 2PHBA 2ZG0H 2F9PA 3F2HA 1FPHH 5H4IB 3A82A 1AI8H 3VB5A 1BMNH 1DT2A 1TGTA 3S0NA 1CO7E 1MKXH 1GI5A 2BQ7B 2YNBA 1FAXA 4CHAB 4MNWA 1TB6H 2BVRH 1ELCA 3QK1A 1TNHA 3MH5A 4M7GA 5FPTA 2G8TA 2ZWLH 4X2VA 1N1LA 1KDQB 1SGCA 2JETB 4OS4A 3VEQB 4X2YA 1NU7B 2ANMH 4MDSA 1SOTA 1YPJH 3N7OA 1BB0B 2Z7FE 2AMPA 3RU4E 5A0BA 3RXRA 5FL7D 1NRNH 1YCPK 2XBXA 3LIWA 1SI5H 1Z8IB 4B71A 1EQ9A 2FOEA 1P2KA 2Z6BD 3KQBA 2H9HA 1XM1A 5AVDA 3GY5A 2BMGB 1FIZA 4ZHLU 2ZU1A 3BEFB 3BG8A 3CNRA 2WYJA 3LKWA 1XUJA 1HPGA 2ZU2A 3TJVA 3F1SB 2PWXA 3OU0A 4CRDA 2VINA 4K2YA 3ZZ5A 4ZKNU 1GPZA 1DITH 1C5ZB 2FS9A 4Q4LA 1SGIB 1FY1A 2BVXH 3FOAA 1V2WT 2BOHB 4ZH8A 1FY5A 2ZGHA 1QB1A 4ZROA 2P3TB 1OOKB 3RXCA 5F8TA 2CGAA 1GJDB 4IMQA 2ANKH 1UTLM 2HNTC 2UWPA 5DP3A 3ZYEA 5IYTA 1IAUA 1O30A 3BTTE 2BDCA 3OTPA 3RXFA 1B0EA 2R2MB 1D6WA 1HAZB 1GJCB 2VU8E 4H4FA 1EJAA 3GYMA 1ZMLA 3ITIA 2QXJA 3PB1E 2B9LA 1SFIA 2BD4A 2C8XB 1O3NA 3O8CA 1KMHB 2ZDMA 4WF8A 5GPIB 1UK3A 1UVOA 2SNWA 3GCNA 2ZFPH 1BJVA 2V3OH 3URDA 4NIVA 1C5LH 5C1XA 1VJ9U 1P03A 1FPCH 3RXLA 3B8JA 5E2OA 3LGIA 1QB6A 2H2ZA 1V2MT 1SGDE 1VR1H 1XUFA 1MKWH 1ZR0A 2BDYA 1A0JA 1C1UH 1UVTH 1H8ED 3DCLA 4I8HA 2XBYA 1FJSA 1YCPM 1IOEA 1VKYA 3BV9B 3MOCA 1RIWB 4IN2A 1O3GA 1RXPA 2ZHQH 4GCHF 2EI8A 1A5HA 1FQ3A 5DGJA 1C1OA 2A7HA 3A81A 2HRVA 1Y5BT 3TVJB 3NK8A 3S9CA 1VCPA 1OKXA 2QF3A 3MI4A 1ZSKA 3SYJA 1O5CB 1DLKB 1C2GA 2XYAA 1BMLA 1PPZA 2XWBI 3T29A 1MKWK 3HATH 2Q6GA 4AB9A 2ZQ2A 3QDZB 3URCA 2VWNA 2ZU4A 3N7EA 1EX3A 4H6TA 5DK1A 3UREA 5C3NA 1TBQH 1EAWA 1HAXB 5F8ZA 5KECA 1IQNA 1BTPA 4YXWD 3W95A 3BG4B 2V35A 1MMJN 4INKA 1AB9B 2NU2E 2AS9A 3DD2H 1GGDC 1ELDE 4ASUD 2ZP0H 2YMSD 3GY4A 1BRCE 1C1PA 1LVBA 4OGYA 1C2KA 1WXRA 1W2KH 2Y7ZA 3A7TA 1GBCA 3EQ0H 2DUCA 3S9AA 2OQ5A 1CT4E 1OP2A 1KYNA 1IQMA 1EAUA 4GVUA 1HAVA 2FO9A 3RMNH 1BOQA 1ZSLA 1NZQH 4K5ZA 3K2UA 1P12E 2Z94A 4K1SA 1KXFA 5HM9A 1O2IA 3I77A 1P2NA 1O2MA 2G55A 2TPIZ 2C4FH 4ISHH 5TJXA 1A46H 2W26A 1CGJE 4E7RG 5DPAA 4MPUA 1VJAU 2OBQA 2D2DA 2ZECA 3GY7A 2FODA 3GY3A 2DE8A 3A7VA 1NC6A 2F9OA 1W11U 1KIGH 4WXVA 1OWJA 5FHTA 4OGXA 1ELTA 2BTCE 1GMDG 3MNSA 1T4UH 4FUEA 4ZXXH 3DFLA 2BOKA 2V3MA 3QLPH 5A8XA 4I8LA 5C5NA 1F2SE 1YC0A 2F43B 1RD3B 4AX9H 3A87A 2XNDD 4X1PU 2W7SA 1JIRA 1TONA 2Y80A 1P11E 2A4OA 2R0LA 4TY7A 4IBLH 3KYFA 3BTEE 5L2YH 4DVAU 2VIDA 2SFAA 3TNTA 2ZFQH 1V6DA 2ZFRH 1GG6C 2KCAA 1J17T 1KXCA 1BCUH 2QIQA 3B9FH 3EDXB 3OEED 1O5GH 4ABJA 5FX5A 2IN2A 4OS7A 3RMOH 1SLVB 1P01A 1QTFA 1GBKA 2GZ8A 2WPIS 2BYAX 3NUMA 2GCHF 3KYGA 1FDPA 1V2PT 4KTCA 1Y3VA 3JZ1B 5LPRA 2AEIH 3MH4A 3SU5A 1TMTH 1ZYOA 4HI3A 1J16A 3RXDA 5A2MH 3M7UA 2AMDA 3M3VA 3S9BA 4U2WA 2PSXA 1RRKA 1UMAH 2FEQH 1O2OA 3H7OA 3E8LA 2BB4A 1G3BA 3EYDA 3LOXA 5ESTE 5IK2D 2FYRA 3KQDA 4A92A 1GBTA 1C2IA 2CHAB 3PMBB 5C1YA 2B0FA 1THPB 2VB0A 3NRLA 1E1QD 2W3KA 4YLQH 5LPFA 1HGTH 2K8IA 1VITG 2PGQB 1LHGH 1SGFA 4O3TA 1QL7A 2IJOB 5HKKD 2CJIA 1V2NT 2NU4E 2M2AA 1V2KT 2ZHEH 4Y71A 3F0OA 2ZCHP 3FFGA 2A2XH 3QO6A 3VGCB 1ETRH 5AHGH 1OP8A 4JZFH 1O3LA 1ZRKA 2IPQX 1C4Y2 1EZQA 2BD3A 3A8AA 2XXLA 3GCTG 4WXIA 4XOJA 1PPEE 4JMYA 3F9HA 2ZDKA 2O8LA 1JRSA 2ZKSA 3I78A 4I8JA 3BSQA 2FP7B 3ENSB 1IQFA 2THFB 4P00A 2BDGA 1GHYH 1VGCB 3M5OA 2O8TA 2O8WA 1F7ZA 4JK6A 1EXFA 1RJXB 1O3JA 3D65E 1ETSH 1HB0B 3GY6A 4X6MA 1RTLA 2CV3A 1O2GH 2QF4A 3SHCH 2QF5A 4E06H 1LQEA 4JZDH 3TNSA 4CBNA 5FPSA 3R3GB 4X8TH 2BX3A 1ESTA 3SI3H 2VIVA 3A85A 2IJD1 1KTSB 1UVPA 1XUGA 4GLYA 5CHBA 1ORFA 3UNSA 1FZZA 3AW1A 1EOJA 4GPGA 4ISIH 2ZFSA 1O2RA 1C5YB 5BRRE 1EKBB 1EP5A 4GCHG 3D49H 3U98H 2YNAA 1GI1A 2F4LA 1SKYE 3BTHE 4I32A 1SG8B 7GCHF 4NA7A 4TPYA 2AHME 2XC5A 3GDVA 3EA8A 3BEIB 1MUEB 2BHGA 4FUBA 5F03A 4SGBE 3ELAH 2FOBA 1G2LA 2ZHFH 4X8VH 1S5SA 3SQHE 1AFQB 1P02A 1L4DA 4RKOB 3HKJB 1NRRH 1CHOF 1E1RD 4BTIB 1O2NA 2G52A 3ZZ7A 1YY3A 1SPJA 4FXGH 4OS5A 1THSH 2GKVE 2A4RA 1LMWB 1GBJA 2QYIA 1GHBF 3A89A 3M5LA 2GV6A 1K9OE 4FVDA 2I6SA 3RC4A 3U28C 1XXFA 3E0NB 4UONA 2F9VA 1S84A 2XCNA 1AE5A 4GHTA 3LDXH 3KGPA 1ZTLA 3Q3KA 3ESTA 4X8SH 3S69A 3E1XB 1TPAE 4Y6DA 2BY7X 4IC6A 3MTYA 1O2HA 1K2I1 5EG4A 5F8XA 1F0UA 1ZPCA 4B1TA 3LJOA 2R0KA 4DW2U 4LZ4B 2WV5A 3N99A 3U8TH 5E2PA 1F5KU 3TLOA 4CHAC 3RC6A 1AY6H 3ZZCA 1TPSA 1C2MA 5K7RA 1W13U 1LHEH 1GBIA 4DIIH 1BUIA 5JPMH 3RXSA 3SV9A 1UTQA 1O2YA 1O37A 3MO3A 2SNVA 4FVBA 1K1OA 2W7UA 4WJG2 1P2MA 1YP9A 4NIYA 1G36A 1BTXA 2WHXA 1KLTA 1QRWA 4ZKSU 3SV7A 3PMJA 3ZVAA 1BBRE 4HG6A 5DP9A 3RXTA 1YLCA 1KXAA 2XOKD 1DUEA 4YTAA 5AFYH 1ZJDA 5L6NH 2B8OH 1HRTH 2RA3A 1XKBC 3MH7A 1EP6A 4MQAA 2EEKA 1QRZA 1J15A 3UNQA 4INLA 2GVFA 1FUJA 3FP8E 4YT6H 3OSYA 1GHAG 4FUGA 6CHAC 3A7XA 3AW0A 3ZZ4A 3U1IB 3QUMP 1E36B 2JJ2D 2OC7A 4P02A 1D3TB 2XC0A 1HAPH 4NFEA 1O3CA 1O5AB 1BTYA 1Z8JB 4ZHAA 1NBME 1QFKH 4NZQA 2Z3EA 1K1LA 1SSXA 2Z9IA 1DM4B 6GCHG 5DSFA 3OEHD 1N8OB 1GI0A 1OWEA 2NWNA 3UNRA 5ETXA 4BAQB 1C4V2 1TOMH 3FVFB 3SU2A 3T62A 5AFZH 2QC2A 3LGUA 2ASUB 2XNIA 4WMFA 2Q6DA 3SUGA 3RU4D 3V0XA 2J9NA 2QXGA 3OX7U 1T4VH 3RC5A 1XXDA 1GVKB 2W3IA 4MNXA 2W5EA 4TPIZ 1H1BA 2DE9A 1AHTH 1HXFH 3F68H 4GAWA 1TFXA 3SJOA 4DCDA 2G00A 1XUIA 4BAHB 3DSPA 1L0ZA 1BRUP 1O36A 4KELA 1DY8A 2KCOA 4SGAE 3BTGE 2R2WU 5K0HA 1AMHA 3L6PA 1OPHB 1ZSJA 1O2KA 1SGNE 3BTME 3Q3XA 5JBBS 1CA8B 2GV7A 3SUDA 3ATMA 1EAIA 2VBCA 1C1RA 2UUKB 1P3CA 1Y59T 3UOPA 1P9SA 1ZZZA 3MU0A 2J2UA 1GBMA 1QA7A 3AK5A 3OAAD 1YF4A 1QQUA 3JZ2B 4IC5A 4NZLA 1NT1A 1WTGH 4OS6A 5GJ4B 1HAVB 2ZGXH 4XBDA 2JH0D 2SGPE 1SLXB 1W8BH 1YWUA 4DG4A 1TGBA 4HZHA 4MPVA 3ZVGA 5FCRA 2ALVA 3CS7A 1CHGA 1IQLA 1DVAH 1GMDF 3D62A 3ZYDA 4XBBA 3GICB 5CDFE 1YPKH 1SHYA 3WW7A 3SZEA 1VCQA 2OD3B 1AUJA 1A7SA 5TCAA 1CQQA 1E79D 3CS0A 1G3CA 3A8CA 1ANEA 4AB8A 3KL6A 4ZHMU 2ODYB 3PV4A 2GP9B 5JBAS 3O8DA 1EASA 3RXMA 1UTPA 5A0AE 3ZZ9A 2CXVA 8ESTE 1SQOA 2SGFE 1NRQH 2ZC9H 5T1VA 1Y3WA 3T28A 1Z8GA 3SOSA 3V7TA 1TX7A 5C5OA 2VWLA 1NFXA 3BTQE 2FOFA 2EY4C 4DURA 1NFUA 5HM2A 4ASHA 1TX6A 4B73A 1AB9C 2STAE 1ETTH 4HFPB 3GISB 3TH3H 1DXPA 1GBDA 1BRAA 1C1WH 2TGDA 1MH0A 1Z8RA 2Y6TA 1DE7H 2FDAA 3MO6A 3Q3YA 2RG3A 1GHWH 1TNKA 9LPRA 4B76A 1GJ8B 2WINI 5GCHG 1K1IA 3BF6H 1AFEH 1LKAA 1OP0A 4NIXA 3RLWH 1G2MA 1VCWA 1HIAA 2A5IA 2WYGA 2IPHA 2PP6A 2FXRA 1ANCA 3OYPA 1TRMA 5A0CA 1JBUH 4BOHA 1OYQA 2YMSB 3S7HB 4A1VA 1PQ7A 4NSVA 2W6JD 2FX4A 1GCDA 1MTSA 1KXDA 3P8NA 3SN8A 4CRGA 2A2QH 1C5RA 3SV2H 2P3FH 1GJ5H 1DICA 4F49A 3ZZ8A 1GHAF 4THNH 3VFEA 2TBSA 3PM3A 1K1NA 3GY2A 1V2ST 3MU4A 3MNXA 2ZCLP 1GI4A 4K69A 4JK5A 1ZMNA 1PQ5A 2OTVA 1KDQA 1CGHA 1Y5UT 3WWBA 3GOVB 4FUHA 3PO1B 4ABGA 1S82A 3UTUH 4AGJA 2GMTC 5HYOA 2VWOA 3K6ZA 2V0BA 4KP0A 3OY5U 1Y5AT 2JH6D 2SGEE 2UUYA 1GI2A 2NU1E 3SJIA 1COWD 1G30B 3PV2A 4I8GA 1EATA 1GDUA 2ODQA 2R3UA 1NM6A 3SU0A 1WSSH 1LTOA 5EIYA 2ZTXA 1TRYA 1HCGA 4OS1A 1P10A 1LO6A 1TWXB 1H8DH 2ALPA 1TLDA 3LGTA 5G4BA 1LPZB 4ISOA 3AASA 1HJ8A 4RKJB 4X2XA 3VXFH 3E6PH 4XSKU 4NG9H 1TNIA 1AGJA 1INCA 2CF8H 5F53A 2A31A 4Z6AH 3SNBA 1KTTB 1ELAA 5T3HA 1TBRH 3LGYA 5FPYA 1YPLH 1C1NA 1TIOA 3ZVEA 1UW7A 1GBBA 3SZNA 3A84A 4B6EA 1GMHF 4X6OA 1SQTA 2D8WA 1AE8H 5EXMA 1A5GH 4TWWA 4B2BA 1C9PA 1HJ9A 1YKTA 1C5OH 4FUCA 4DJZB 4O03A 3RUOA 4YT7H 2BLVA 1W10U 1L2EA 3C1KA 5DN6D 1C2LA 1SQAA 3U9AH 3ATLA 1GBFA 2XC4A 1GVZA 2QN5T 1IQHA 2KX4A 4OS2A 1QR3E 5C0TA 1CE5A 1ZJKA 1WCZA 4IMZA 5GDSH 2UUFB 1DPOA 1UCYK 1B0FA 2QCYA 2H1UA 3RLYH 1TPOA 2PGBB 1AZ8A 3PV5A 1SGPE 2ZDVH 4J1YA 2Z9LA 4UE7H 2RA0A 4VGCC 3VB6A 2ZHWH 1XKAC 3SO3A 3UQVA 1ZLRA 1DWCH 3EGKH 2AGEX 1FV9A 1S85A 3KN2A 1S0QA 2B5TB 5I46H 1C1QA 1ZMJA 2BDIA 1MD7A 1NESE 4FUDA 5KGOA 1CA0B 2PKAB 5E0GA 2PTNA 3E3TA 2P8OB 3F2GA 2FOMB 1TRNA 1J9CH 2F91A 2VIWA 4B74A 1IHSH 3MNBA 2RDLA 3A88A 4K8YA 3BEUA 1P0SH 1O2UA 5EXNA 1SLUB 3OTJE 2VGCC 1W0YH 2R9PA 1GDNA 4ZCNA 3ATKA 1KXEA 4ZKOU 3F6UH 5IDKA 1MABB 2STBE 1GI6A 3HPTB 2H6MA 1O3MA 4Q7ZA 5HIYA 1VITH 2PUXB 3PWBA 4AFUA 1O2XA 3F9FA 3VB3A 4U30A 5GIBA 2VH6A 2J97A 5C20A 1GI3A 2ZDAH 3AVZA 1H8IH 3E0PB 1UHBA 3DSGA 4K1TA 3W1EA 1FNIA 2QA9E 3S7KB 3M7QA 3STJA 2Z3CA 4E05H 1BTUA 4BAMB 1HLTH 2KM0A 1AVWA 1HBTH 5F6MA 4DIHH 1BJUA 2FI4E 4MPXA 4NA9H 1EJMA 4QT8C 4LZ1H 4ABAA 1PPFE 5FAHA 1LCYA 2FWWA 1GHZA 1E34B 3SGQE 2RFKC 2FOGA 1ELFA 4BAKB 4OM9A 1O0DH 1AUTC 4I31A 3ZVDA 4CH2B 1A61H 4F4OC 3MH6A 1K1PA 1DXWA 2ZU5A 2EI7A 1GBAA 1FLEE 2BZAA 2KAIA 2ZEBA 3UB0A 2P3UB 1SOZA 1GBEA 2VVVA 1ZPBA 1UHBB 1GJ9B 3M61U 1OYTH 7GCHG 1C5WB 4NSYA 4MTBA 4A1XA 1AKSA 1L1JA 1V2TT 4FU9A 3O8BA 3OFND 1QL8A 3KNXA 5FX6A 2Q6FA 1SLWB 1YPMH 4UFDH 2AIQA 3RXPA 1ID5H 2WV9A 2J5UA 4NA8A 1P2IA 1UK4A 1BHXB 3MO9A 1SGYE 1GJ4H 3Q77A 3FO8D 1O3EA 4RN6A 1P8VC 1G37A 1KY9A 1O2ZA 2SGDE 3ZZ3A 1H9HE 1OSSA 1GMHG 3QGJA 1PFXC 3QN7A 3M35A 3TK9A 3PRDA 1PPCE 4VGCB 4CREA 3SJ8A 2OC8A 4X6PA 4ABBA 2OLGA 3O8RA 3KF2A 1K1MA 2EI6A 4YOIA 1Q2WA 1EB1H 8GCHF 2FI3E 2FOAA 2J38A 1SGEE 2HPPH 2WZQA 1O31A 2WSSD 3SU1A 3SBKA 1TX8A 1A3BH 4ZXYH 5DO4H 3GCTF 2A7CA 2PTCE 3V13A 2P16A 2JKHA 3DSOA 3SUFA 4CR5A 1QBOA 2C8YB 1OWDA 4U32A 4Y8ZA 1GBLA 1RTFB 1FY8E 3BTDE 2LP6A 1UCYE 3RXOA 5EPYA 1PPHE 1CHOG 3SQEE 1GHXH 2K1QA 5HMAA 5EOKA 3A83A 1TYNA 2LELA 2ZTZA 5DKMA 2C3SA 1LHFH 2J98B 1ELEE 2QV1A 3L33A 1UTMA 1AIXH 1LHDH 2OC0A 1QGFA 4Y7BA 3TITA 2C90B 1NROH 4NGAH 2BD9A 3BTKE 3RXQA 1UVUH 1JXPA 1YPHE 2JETC 2QAAA 2ILNA 2Z9KA 1NY22 6LPRA 3A7ZA 2KZ4A 3ZZAA 1A1RA 2HOBA 1RIWC 1Z71A 2VWMA 1BITA 1HNEE 3P8OA 1BMFD 1Y3YA 3RP2A 1HXEH 9ESTA 1TGNA 3UQOA 1ELBA 1J8AA 5FXLA 4Y10E 1SMFE 5FCKA 4FU8A 1O33A 4MVNA 1PPBH 1TNGA 1YPHC 1VGCC 2J98A 2XW9A 1SC8U 4XRNA 1D6RA 2VNTA 1P57B 4E7NA 3M36A 5LGOA 2ZGBH 3ODFA 1TABE 3NKKA 4BNRA 1LDTT 1ZRBA 1WAYB 5GWZA 4Q63A 1QIXB 1P09A 2C93B 3STIA 2VJ1A 1CGIE 4DT7B 5ESBA 1TA2A 1YPEH 2C8ZB 3HK3B 1WQSA 2AH4X 3PTBA 1ELVA 4A5TS 2BVSH 3SU4A 1SGQE 1K0HA 3ODDA 5CHAC 3A8BA 3Q76A 4BXWA 2ZU3A 2V6NA 4XE4A 1AQ7A 1VITF 4X1QU 4ABHA 3W94A 4NWLA 3ZVCA 1MQ6A 4ZAEA 1N8OC 1QJ1B 2AIPA 1MU8B 2PV9B 3ZIAD 1KLJH 3VB4A 4UFGH 5EJLA 3FN8A 1MD8A 1NTPA 1O3DA 1FAKH 1YLNA 1UJ1A 3KCGH 2JIZD 4AN7A 2BQ6B 2O8UA 1MBQA 3UPEA 5A8ZA 1BZXE 1NFWA 3V3MA 5J4SA 4Y76A 2AERH 5FBIA 2SGQE 1ZHPA 3QTVH 1B5GH 4XFQA 3UUZA 2FTMA 3LC5A 5EQRA 3M3SA 2HLCA 2P59A 1OS8A 1VZQH 3EE7A 1N6XA 3ATWA 1P2OA 1MKXK 4Y0ZE 3RDZA 2XCFA 1T8OA 4NIWA 1ZHMA 4IW4E 1QL9A 2P94A 1FMGA 6CHAB 2P95A 2KCPA 1EUFA 2ZGJA 1DX5M 1GG6B 2FZZA 4BTTB 3UWIA 5JB8S 2CN0H 3KEEA 2A0QB 3QWCH 4WVPE 4ABIA 5EPNA 4F55A 2L74A 4Y8XA 1E35B 2QF0A 2BXUH 2GD4B 3A80A 4TWYA 2BDBA 2Y5GA 3FZDA 2FYQA 2ANYA 1C5UA 1PQAA 1MQ5A 3HGPA 3TIUA 5C17A 3M37A 2H5DA 2OBOA 4I7YH 2P93A 4PROA 2OP9A 3RM0H 1TE0A 2EA3A 3EA9A 3EAJA 1NRSH 5EU8A 3EE0B 1ZGIA 2FI5E 1IQIA 4DY7B 4GHQA 3DT0H 1NBMD 1YLDA 3LONA 2OXSA 1AVXA 1K22H 2BM2A 1MZDA 3BN9A 5GXPA 5SGAE 3RXGA 1Y8TA 3LPRA 1W7XH 1C1VH 1GCTB 1RS0A 2A45B 3LH3A 1BBRK 3SU6A 5T6GA 3MU5A 2PKSC 5KEDA 1QZ8A 4WH8A 2WV4A 2JJ1D 2ZGCA 3FAOA 2BDAA 3M3TA 2GZ7A 1FY4A 1O2TA 4RSPA 1C5MD 1G9IE 2PSYA 4I86A 3VGCC 1OWIA 4XDEA 1CT2E 2QE7D 2JDID 2G5NA 3TH4H 3KQCA 1WU1A 1HAIH 1IQEA 2TGPZ 1C5SA 1D9IA 1Z1JA 1QHRB 1UO6A 1LKBA 2V7QD 4Q80A 1O3AA 4TSFD 1ESAA 2HVXA 1GGDB 2PUQH 2BD2A 3BTWE 1SGTA 4JZEH 2WPHS 1TNLA 2PKSB 3U69H 3PMAB 4Z0KA 4BANB 2CHAC 1YBWA 4MLFB 1HUTH 3RXEA 2L6OA 2XTTB 4X1NU 1A4WH 7ESTE 5EQQA 4UD9H 5EQSA 1Y3UA 1RFNA 4Q7YA 4D8NA 3TGIE 3A86A 3B23B 1ESBA 1H4WA 3GYLB 1BMMH 1O2PA 1CU1A 5EJ1A 4NFFA 2UWOA 4MNYA 3GY8A 1EPTB 4GUXA 4MNVA 2J4IA 1P06A 3LC3A 4LXBH 4D9RA 2PLXA 2Z9GA 2ZHDA 4RI0A 3GDUA 2AGGX 3SJ9A 3CENA 3SW2B 5HXFA 1SB1H 3H5CB 2R3YA 2BDHA 1T8NA 3FANA 3TK5A 1O3FA 4LOYH 2TGAA 3FKSD 1MBMA 1FIWA 3SNAA 3PMHB 2AMQA 3NWUA 1UTOA 3PRBA 2P8OC 1QA0A 3SGBE 1AZZA 2GMTB 4DGJA 5A09A 1QRXA 3M5NA 1C4U2 1O34A 1V2LT 2WUBA 4X1RU 4R8TB 1K1JA 2A5KA 1T8MA 1ELGA 4ACBA 2ZDNA 2H9TH 1EOLA 1ABJH 1DWEH 3MMGA 3H7TA 3NCLA 4YM9A 5JBCS 1O3BA 2QXHA 3TJNA 4YOJA 2PKAA 2QXIA 3U8RH 1AKSB 1W7GH 1MCTA 1WQVH 4M9FA 2VH0A 3P8FA 3HK6B 3UR6A 1MU6B 1S6LA 1GHVH 3VXEH 3NZIA 1O5EH 3T5FH 3PLKA 3P17H 1S81A 3RMMH 3G01A 5EW1H 1NPMA 3SU3A 4GSOA 6ESTA 1U6QA 2QY0B 5LH8A 1C5NH 2F83A 4ZUHA 1ARCA 4FU7A 1GWAA 1PJPA 5EW2H 1GBHA 2B7DH 2LNCA 1QURH 2ZI2H 3N7DA 1MTNB 3OY6U 4INHA 1XUKA 1LVMA 4FOUC 2BX4A 2XBWA 5T6DA 4Y79A 3UY9A 4JYUH 1GDQA 4WMEA 1NO9H 3AAUA 4AZ2B 1X7AC 2GGVB 1AO5A 4TY6A 1QJ6B 3VB7A 1NFYA 3UOUA 3LGWA 3BIVH 1NRPH 4DT4A 1WOFA 2VVCA 3KQ5A 1TNJA 1ANDA 4ABDA 3BG4C 2FTLE 8KME2 2A32A 4WH6A 1D4PB 2Z9JA 2Z3DA 1DUAA 1QJ7B 3IWMA 4NCYA 4CH8B 4J2YB 3FP6E 2VIQA 1QBVH 1DY9A 1XX9A 3UWJH 4RT1A 4CRAA 1L4ZA 1D3PB 2G51A 1C1MA 2J34A 5CMXH 3F9EA 3LT3A 8GCHG 1WBGB 2BY8X 3P92A 5EGMA 3H09A 1LPGB 4CBOA 2G4TA 2HALA 1TALA 1DANH 1E38B 5B6LA 2A4GA 1MTWA 3K9XB 5CE1A 2VIPA 1F92A 1HAYB 2PFEA 2WPJS 3NPSA 1UTNA 3E16B 3MHWU 1MAXA 1LVYA 1GJBB 2BLQA 5C0UA 2O9QA 1SQRA 2F9NA 1GI7B 3TK6A 2G5VA 2XWAA 2W6ID 2BLOA 1TQ0B 1Q3XA 5L30H 3KIDU 1GMCG 1IQKA 1BQYA 2BZ6H 3DUXH 1E37B 1C9TA 1CVWH 1YM0A 1H9IE 1KXBA 1MZAA 4B2CA 2AFQB 3T25A 4XBCA 3QGNB 3MU8A 3LGVA 3TJOA 1FY3A 1YGCH 3M5MA 4O9VA 3RXBA 4A7IB 3P95A 3U8OH 3SGAE 2Y7XA 3TH2H 1MTUA 5J4QA 1HJAB 1TMBH 2J95A 3TGJE 1IQGA 1BTWA 4B75A 4YESB 1QQ4A 1CT0E 2H5CA 2ZZUH 5C2ZA 3SORA 3ZV9A 2PR3A 4B6FA 3HGNA 1TBZH 3ZVFA 1GL1A 2ZA5A 1S0RA 4K60A 2FMJA 1Y3XA 3GCOA 1RTKA 4CRCA 3SHAH 3LU9B 5EXLA 2HGTH 3QX5H 1FXYA 1MTVA 4X6NA 2VVUA 2GDEH 2G81E 2NU0E 1EPTA 1A0HB 2GJGA 2AYWA 1F5LA 4O3UA 2HLDD 4TT3D 3GDSA 3QTOH 4D7FA 3MWIU 1ZHRA 3ZVBA 1V2RT 1D3DB 1ZGVA 1NN6A 1DWBH 1JMOH 1F0TA 1CBWC 1QY6A 5LPEA 2NU3E 2BXTH 3C27B 1ARBA 2HVYB 5C94A 1QNJA 4JYVH 3A8DA 1TMUH 1BRBE 1L1NA 2BY6X 1B7XB 2ZNKH 2ESTE 4JYTA 3VPKA 1GJ6A 1OWHA 2UUJB 1GHBG 2ZDLA 3T2NA 2XRCA 4AG2A 1G3DA 1DFPA 3L3TA 2ZPSA 3TU7H 2AGIX 4UFFH 1PQ8A 1T8LA 4TYDA 3M7TA 1O2QA 1AD8H 3DA9B 2BD7A 3SNEA 1SGRE 2FLBH 4HGCA 1P2JA 4RT0A 4H6SB 1FONA 1EB2A 5DP4A 4H42U 1BIOA 1O2SA 4AFZA 2BY9X 1IHTH 2YMSC 3MU1A 5DJ7A 1E0FD 2F9BH 3GCHC 4YOGA 4K1EA 1XUHA 1O5DH 4MPWA 1BHXF 2GT7A 1CSOE 1G32B 1ZPZA 2Y5HA 1DS2E 2ZFTA 2ANWA 1BT7A 1F0SA 3LJJA 4AFQA 1SR5C 1XVMA 4I33A 5I25A 2BLWA 4FUFA 4KGAA 1GMCF 1LHCH 3R0FA 2ZIQH 5JYIA 1AWFH 2A5AA 3ATIA 1AU8A 3PTNA 3OE7D 1TQ7B 3BIUH 1T31A 2OCVB 4MG3A 1UCYH 4D76A 2C8WB 1JRTA 2Y5FA 4X2WA 1BMAA 4Z1MD 1GI8B 3UFAA 1TAWA 2BQWB 3IG6B 1C5PA 5EJZA 4ZMAH 5DG6A 3SNCA 4YLUA 1YPGH 3U1JB 2HNTF 1EZUC 5HGGA 5JBTA 5E8EH 1Z1IA 2KAIB 1UVSH 3F9GA 2QGRA 1O3PB 4AORA 1DDJA 2CK3D 2EC9H 1MCVA 4KTUA 1AFQC 3DHKH 4ACAA 3E91A 4ISNA 2OQUA 1AWHB 1C5XB 4UFEH 4A6LA 5DP8A 1M9UA 1S83A 1O2LA 3PLPA 1W0JD 2VIOA 1C2EA 1AN1E 1XVOA 1LVOA 1G3EA 2KR7A 1JOUB 1THRH 1MAYA 1HAGE 1DOJA 1SFQB 1BTHH 1KSNA 3DFJA 1O38A 2PW8H 3K65B 1UTJA 1SVPA 2FX6A 3K6YA 1P9UA 4AFSA 3SJKA 2BD8A 4UDWH 4AGKA 2LPRA 2XBVA 5TCCA 2FLRH 1EAXA 1HFDA 3RXVA 2ZPRA 3GCHB 1PYTC 3MYWA 2WPDD 3ZZ6A 1FI8A 3UAIC 3PO1C 7KMEH 2A4QA 1C5VA 1WDIA 4KKDA 1FN8A 2WPKS 3ZV8A 4IN1A 1O2VA 1H9LB 1F0RA 2WPMS 1T7CA 1O3OA 1EZXC 1XMNB 1P2QA 3E90B 3NXPA 1A0LA 1QCPA 1LPKB 5EODA 1W0ZU 1Q31A 3HKIB 3IITA 3F3BA 4A1TA 2F3CE 4FUIA 7LPRA 1O39A 3VG8A 3SV6A 4DOQA 2BY5X 4Q2KA 3MNCA 4AG1A 2RCEA 5A8YA 2OC1A 2K0QA 2D26C 2HWLB 4Q7XA 1P04A 1EPTC 1HAOH 4X8UH 1Z6EA 1TGSZ 3LH1A 1V3XA 3A7YA 1W0KD 3TPIZ 4ISLA 1GJ7B 3A7WA 1ZTKA 3P6ZB 1C1TA 3QZQA 5GNDA 3EA7A 2ZFFH 4KTSA 1A5IA 1W14U 4BAOB 5AF9H 4YO9A 1A3EH 1GVLA 1O3IA 1O3KA 1K28D 2G4UA 1OXGA 1ANBA 2J92A 2F9UA 1O32A 1SL3A 3RXHA 3MFJA 4AOQA 2GTBA 1F5RA 5ABWA 3PROA 4WWYA 1DSTA 1YCPH 5PTPA 5FBEA 3MQKC 1TGCA 2GCHG 3SNDA 2FOHA 3UIRA 4WMDA 2FIRH 1QB9A 2FM2A 4D9QA 2CF9H 2Y82A 2JH5D 1FX0B 2GT8A 2Y81A 5HIZA 2TIOA 1PPGE 2O8MA 2IOTA 5E0HA 2OINA 3AAVA 5B6OA 8LPRA 5E0JA 4JCNA 1GCTC 2KFWA 1MTNC 3P70B 1O2WA 2SGAA 2WUCA 3F2FA 2FS8A 1DWDH 3P8GA 1HYLA 4BXSA 4D7GA 2GCTC 1UK2A 4Y0YE 1P3EA 3QZRA 1C5TA 2ZO3H 4HTCH 5DP5A 2WPLS 3TJUA 1SBWA 4FETA 3SUEA 1GJAB 1CA0C 1OX1A 1V2UT 3FP7E 2OK5A 1EFRD 1HAHH 3RXKA 2HNTE 1RGQA 4ZKRU 3CP7A 2ZF0H 3D23A 3UR9A 2A1DB 5DP6A 1TPPA 1H8HD 2GX4A 3BTFE 3PLBA 2ZCKP 3Q00A 1HDTH 5JB9S 4X1SU 5GCHF 5C1UA 1C2FA 1BA8B 1ZTJA 2D1JA 5JDUB 1GI9B 1O5FH 4ABEA 2FPZA 1DLEA 1PYTD 1WYKA 2HPQH 2RDEA 4IGDA 5DP7A 1HV7A 4JZ1A 3RM2H 4I8KA 2FESH 1EZSC 3ZZDA 3V12A 2GCTB 1NU9A 2ZTYA 1V2VT 1KLIH 1SHHB 2A7JA 1O35A 1ZOMA 4IS5A 3TGKE 1BBRH 3F0PA 2GZ9A 4CRFA 2M5TA 1UTKA 1N6YA 1TOCB 2V3HH 1D3QB 3PWCA 4YZUA 1SGFG 1GL0E 2FOCA 2UWLA 1OHHD 4BTUB 3T26A 3RU4T 4Y11E 1EJNA 1CBWB 4X0WU 5BPEA 1O2JA 4ABFA 1O3HA 5C67A 3PYHA 2Q1JA 2I6QA 4Y7AA 2ULLA 2EQNA 3RXUA 3WWFA 1BDAA 1C2HA 1J14A 2ZPQA 1ABIH 1FN6A 4K3JA 4WY3A 1S6HA 1L1GA 1P05A 3FZZA 5T6FA 4ESTE 3RXIA 6GCHF 1K21H 2J94A 2KCYA 1Z7KA 3KHVA 3RXJA 3SV8A 2TRMA 1JWTA 1C2DA 1NS3A 1A2CH 1WUNH 1TA6A 2YOLA 3T27A 1OWKA 2CMYA 4FUJA 5CHAB 2GDDA 4XD7D 1S6FA 4JZIA 3KQEA 1JIMA 4B2AA 1W12U 1IQJA 1Z6JH 3GS9A 1HJAC 1LQDB 1O5BB 2VGCB 1W3CA 3I29A 1YYY1 4AYYB 1AVGH 3ZZBA 1T32A 1V2QT 4K8BA 1WTHD 2ZQ1A 4CR9A 4AYVB 2TGTA 1C1SA 1V2OT 1DSUA 1QBNA 2H9EH 2ODPA 4AC9A 1C5QA 4O97A 4CRBA 1WV7H
chains in the Genus database with same CATH topology
4R0IA 3SI4H 3RMLH 1C2JA 2OUAA 1ACBE 4NWKA 4LK4A 1HIAB 3RXAA 1V2JT 4UEHH 5L2ZH 4Y8YA 1BTZA 2BD5A 3WY8A 4U01A 2PHBA 2ZG0H 2F9PA 5H4IB 1FPHH 3A82A 1AI8H 3VB5A 1BMNH 1DT2A 1TGTA 3S0NA 1CO7E 1MKXH 1GI5A 2BQ7B 2YNBA 1FAXA 4CHAB 4MNWA 1TB6H 2BVRH 1ELCA 3QK1A 1TNHA 3MH5A 4M7GA 5FPTA 2G8TA 2ZWLH 4X2VA 1N1LA 1KDQB 1SGCA 2JETB 4OS4A 3VEQB 4X2YA 1NU7B 2ANMH 4MDSA 1SOTA 1YPJH 3N7OA 1BB0B 2Z7FE 2AMPA 3RU4E 5A0BA 3RXRA 1NRNH 1YCPK 2XBXA 3LIWA 1SI5H 1Z8IB 4B71A 1EQ9A 2FOEA 1P2KA 2Z6BD 3KQBA 2H9HA 1XM1A 5AVDA 3GY5A 2BMGB 1FIZA 4ZHLU 2ZU1A 3BEFB 3BG8A 2WYJA 3LKWA 1XUJA 1HPGA 2ZU2A 3TJVA 3F1SB 2PWXA 3OU0A 4CRDA 2VINA 4K2YA 3ZZ5A 4ZKNU 1GPZA 1DITH 1C5ZB 2FS9A 1SGIB 1FY1A 2BVXH 1V2WT 2BOHB 4ZH8A 1FY5A 2ZGHA 1QB1A 4ZROA 2P3TB 1OOKB 3RXCA 5F8TA 2CGAA 1GJDB 4IMQA 2ANKH 1UTLM 2HNTC 2UWPA 5DP3A 3ZYEA 5IYTA 1IAUA 1O30A 3BTTE 2BDCA 3RXFA 1B0EA 2R2MB 1D6WA 1HAZB 1GJCB 2VU8E 4H4FA 1EJAA 3GYMA 1ZMLA 3ITIA 2QXJA 3PB1E 2B9LA 1SFIA 2BD4A 2C8XB 1O3NA 3O8CA 2ZDMA 4WF8A 5GPIB 1UK3A 1UVOA 2SNWA 3GCNA 2ZFPH 1BJVA 2V3OH 3URDA 4NIVA 1C5LH 5C1XA 1VJ9U 1P03A 1FPCH 3RXLA 3B8JA 5E2OA 3LGIA 1QB6A 2H2ZA 1V2MT 1SGDE 1VR1H 1XUFA 1MKWH 1ZR0A 2BDYA 1A0JA 1C1UH 1UVTH 4I8HA 2XBYA 1FJSA 1YCPM 1IOEA 3BV9B 3MOCA 1RIWB 4IN2A 1O3GA 1RXPA 2ZHQH 4GCHF 2EI8A 1A5HA 1FQ3A 5DGJA 1C1OA 2A7HA 3A81A 2HRVA 1Y5BT 3TVJB 3NK8A 3S9CA 1VCPA 1OKXA 2QF3A 3MI4A 1ZSKA 1O5CB 1DLKB 1C2GA 2XYAA 1BMLA 1PPZA 2XWBI 3T29A 1MKWK 3HATH 2Q6GA 4AB9A 2ZQ2A 3QDZB 3URCA 2VWNA 2ZU4A 4H6TA 1EX3A 5DK1A 3UREA 5C3NA 1TBQH 1EAWA 1HAXB 5F8ZA 1IQNA 1BTPA 3W95A 3BG4B 2V35A 1MMJN 4INKA 1AB9B 2NU2E 2AS9A 3DD2H 1GGDC 1ELDE 2ZP0H 3GY4A 1BRCE 1C1PA 1LVBA 4OGYA 1C2KA 1W2KH 2Y7ZA 3A7TA 1GBCA 3EQ0H 2DUCA 3S9AA 2OQ5A 1CT4E 1OP2A 1KYNA 1IQMA 1EAUA 4GVUA 1HAVA 2FO9A 3RMNH 1BOQA 1ZSLA 1NZQH 4K5ZA 3K2UA 1P12E 2Z94A 4K1SA 1KXFA 5HM9A 1O2IA 3I77A 1P2NA 1O2MA 2G55A 2TPIZ 2C4FH 4ISHH 5TJXA 1A46H 2W26A 1CGJE 4E7RG 5DPAA 4MPUA 1VJAU 2OBQA 2D2DA 2ZECA 3GY7A 2FODA 3GY3A 2DE8A 3A7VA 1NC6A 2F9OA 1W11U 1KIGH 4WXVA 1OWJA 5FHTA 4OGXA 1ELTA 2BTCE 1GMDG 3MNSA 1T4UH 4FUEA 4ZXXH 3DFLA 2BOKA 3QLPH 5A8XA 4I8LA 5C5NA 1F2SE 1YC0A 4AX9H 1RD3B 3A87A 4X1PU 2W7SA 1JIRA 1TONA 2Y80A 1P11E 2A4OA 2R0LA 4TY7A 4IBLH 5L2YH 3BTEE 4DVAU 2VIDA 2SFAA 3TNTA 2ZFQH 1V6DA 2ZFRH 1GG6C 1J17T 1KXCA 1BCUH 2QIQA 3B9FH 3EDXB 4ABJA 1O5GH 5FX5A 2IN2A 4OS7A 3RMOH 1SLVB 1P01A 1QTFA 1GBKA 2GZ8A 2WPIS 2BYAX 3NUMA 2GCHF 1FDPA 1V2PT 4KTCA 1Y3VA 3JZ1B 5LPRA 2AEIH 3MH4A 3SU5A 1TMTH 1ZYOA 4HI3A 1J16A 3RXDA 5A2MH 3M7UA 2AMDA 3M3VA 3S9BA 4U2WA 2PSXA 1RRKA 1UMAH 2FEQH 1O2OA 3H7OA 3E8LA 2BB4A 1G3BA 3EYDA 3LOXA 5ESTE 2FYRA 3KQDA 4A92A 1GBTA 1C2IA 2CHAB 3PMBB 5C1YA 2B0FA 1THPB 2VB0A 2W3KA 4YLQH 5LPFA 1HGTH 1VITG 2PGQB 1LHGH 1SGFA 4O3TA 1QL7A 2IJOB 2CJIA 1V2NT 2NU4E 1V2KT 2ZHEH 4Y71A 2ZCHP 3FFGA 2A2XH 3QO6A 3VGCB 1ETRH 5AHGH 1OP8A 4JZFH 1O3LA 1ZRKA 1C4Y2 1EZQA 2BD3A 3A8AA 2XXLA 3GCTG 4WXIA 4XOJA 1PPEE 4JMYA 3F9HA 2ZDKA 2O8LA 1JRSA 2ZKSA 3I78A 4I8JA 3BSQA 2FP7B 3ENSB 1IQFA 2THFB 2BDGA 1GHYH 1VGCB 3M5OA 2O8TA 2O8WA 1F7ZA 4JK6A 1EXFA 1RJXB 1O3JA 3D65E 1ETSH 1HB0B 3GY6A 4X6MA 1RTLA 2CV3A 1O2GH 3SHCH 4E06H 1LQEA 4JZDH 3TNSA 4CBNA 5FPSA 3R3GB 4X8TH 2BX3A 1ESTA 3SI3H 2VIVA 3A85A 1KTSB 1UVPA 1XUGA 4GLYA 1ORFA 3UNSA 1FZZA 3AW1A 1EOJA 4GPGA 4ISIH 2ZFSA 1O2RA 1C5YB 5BRRE 1EKBB 1EP5A 4GCHG 3D49H 3U98H 2YNAA 1GI1A 3BTHE 4I32A 1SG8B 7GCHF 4NA7A 4TPYA 2XC5A 3GDVA 3EA8A 3BEIB 1MUEB 2BHGA 4FUBA 5F03A 4SGBE 3ELAH 2FOBA 1G2LA 2ZHFH 4X8VH 1S5SA 3SQHE 1AFQB 1P02A 1L4DA 4RKOB 3HKJB 1NRRH 1CHOF 4BTIB 1O2NA 2G52A 3ZZ7A 1SPJA 4FXGH 4OS5A 1THSH 2GKVE 2A4RA 1LMWB 1GBJA 2QYIA 1GHBF 3A89A 3M5LA 2GV6A 1K9OE 4FVDA 2I6SA 3RC4A 1XXFA 3E0NB 4UONA 2F9VA 1S84A 2XCNA 1AE5A 4GHTA 3LDXH 3KGPA 1ZTLA 3Q3KA 3ESTA 4X8SH 3S69A 3E1XB 1TPAE 4Y6DA 2BY7X 4IC6A 3MTYA 1O2HA 1K2I1 5EG4A 5F8XA 1F0UA 1ZPCA 4B1TA 3LJOA 2R0KA 4DW2U 4LZ4B 2WV5A 3U8TH 5E2PA 1F5KU 3TLOA 4CHAC 3RC6A 1AY6H 3ZZCA 1TPSA 1C2MA 5K7RA 1W13U 1LHEH 1GBIA 4DIIH 1BUIA 5JPMH 3RXSA 3SV9A 1UTQA 1O2YA 1O37A 3MO3A 2SNVA 4FVBA 1K1OA 2W7UA 4WJG2 1P2MA 1YP9A 4NIYA 1G36A 1BTXA 1KLTA 1QRWA 4ZKSU 3SV7A 3PMJA 3ZVAA 1BBRE 5DP9A 3RXTA 1YLCA 1KXAA 4YTAA 1DUEA 5AFYH 1ZJDA 5L6NH 2B8OH 1HRTH 2RA3A 1XKBC 3MH7A 1EP6A 4MQAA 2EEKA 1QRZA 1J15A 3UNQA 4INLA 2GVFA 1FUJA 3FP8E 4YT6H 3OSYA 1GHAG 4FUGA 6CHAC 3A7XA 3AW0A 3ZZ4A 3U1IB 3QUMP 1E36B 2OC7A 1D3TB 2XC0A 1HAPH 4NFEA 1O3CA 1O5AB 1BTYA 1Z8JB 4ZHAA 1QFKH 4NZQA 2Z3EA 1K1LA 1SSXA 2Z9IA 1DM4B 6GCHG 1N8OB 1GI0A 1OWEA 2NWNA 3UNRA 5ETXA 4BAQB 1C4V2 1TOMH 3FVFB 3SU2A 3T62A 5AFZH 2QC2A 3LGUA 2ASUB 2XNIA 4WMFA 2Q6DA 3SUGA 3RU4D 3V0XA 2J9NA 2QXGA 3OX7U 1T4VH 3RC5A 1XXDA 1GVKB 2W3IA 4MNXA 2W5EA 4TPIZ 1H1BA 2DE9A 1AHTH 1HXFH 3F68H 4GAWA 1TFXA 3SJOA 4DCDA 2G00A 1XUIA 4BAHB 1L0ZA 1BRUP 1O36A 4KELA 1DY8A 4SGAE 3BTGE 2R2WU 5K0HA 1AMHA 3L6PA 1OPHB 1ZSJA 1O2KA 1SGNE 3BTME 3Q3XA 5JBBS 1CA8B 2GV7A 3SUDA 3ATMA 1EAIA 1C1RA 2UUKB 1P3CA 1Y59T 3UOPA 1P9SA 1ZZZA 3MU0A 2J2UA 1GBMA 1QA7A 1YF4A 1QQUA 3JZ2B 4IC5A 4NZLA 1NT1A 1WTGH 4OS6A 5GJ4B 1HAVB 2ZGXH 4XBDA 2JH0D 2SGPE 1SLXB 1W8BH 4DG4A 1TGBA 4HZHA 4MPVA 3ZVGA 5FCRA 2ALVA 3CS7A 1CHGA 1IQLA 1DVAH 1GMDF 3D62A 3ZYDA 4XBBA 3GICB 1YPKH 1SHYA 1VCQA 2OD3B 1AUJA 1A7SA 5TCAA 1CQQA 3CS0A 1G3CA 3A8CA 1ANEA 4AB8A 3KL6A 4ZHMU 2ODYB 3PV4A 2GP9B 5JBAS 3O8DA 1EASA 3RXMA 1UTPA 5A0AE 3ZZ9A 2CXVA 8ESTE 1SQOA 2SGFE 1NRQH 2ZC9H 1Y3WA 3T28A 1Z8GA 3SOSA 3V7TA 1TX7A 5C5OA 2VWLA 1NFXA 3BTQE 2FOFA 4DURA 1NFUA 5HM2A 4ASHA 1TX6A 4B73A 1AB9C 2STAE 1ETTH 4HFPB 3GISB 3TH3H 1DXPA 1GBDA 1BRAA 1C1WH 2TGDA 1MH0A 1Z8RA 2Y6TA 1DE7H 2FDAA 3MO6A 3Q3YA 2RG3A 1GHWH 1TNKA 9LPRA 4B76A 1GJ8B 2WINI 5GCHG 1K1IA 3BF6H 1AFEH 1LKAA 1OP0A 4NIXA 3RLWH 1G2MA 1VCWA 1HIAA 2A5IA 2WYGA 2IPHA 2FXRA 1ANCA 3OYPA 1TRMA 5A0CA 1JBUH 4BOHA 1OYQA 3S7HB 4A1VA 1PQ7A 4NSVA 2FX4A 1GCDA 1MTSA 1KXDA 3P8NA 3SN8A 4CRGA 2A2QH 1C5RA 3SV2H 2P3FH 1GJ5H 1DICA 4F49A 3ZZ8A 1GHAF 4THNH 3VFEA 2TBSA 3PM3A 1K1NA 3GY2A 1V2ST 3MU4A 3MNXA 2ZCLP 1GI4A 4K69A 4JK5A 1ZMNA 1PQ5A 2OTVA 1KDQA 1CGHA 1Y5UT 3GOVB 4FUHA 3PO1B 4ABGA 1S82A 3UTUH 4AGJA 2GMTC 5HYOA 2VWOA 3K6ZA 2V0BA 4KP0A 3OY5U 1Y5AT 2JH6D 2SGEE 2UUYA 1GI2A 2NU1E 3SJIA 1G30B 4I8GA 1EATA 1GDUA 2ODQA 2R3UA 1NM6A 3SU0A 1WSSH 1LTOA 2ZTXA 1TRYA 1HCGA 4OS1A 1P10A 1LO6A 1TWXB 1H8DH 2ALPA 1TLDA 3LGTA 5G4BA 1LPZB 4ISOA 3AASA 1HJ8A 4RKJB 4X2XA 3VXFH 3E6PH 4XSKU 4NG9H 1TNIA 1AGJA 1INCA 2CF8H 2A31A 4Z6AH 3SNBA 1KTTB 1ELAA 5T3HA 1TBRH 3LGYA 5FPYA 1YPLH 1C1NA 1TIOA 3ZVEA 1GBBA 3SZNA 3A84A 1GMHF 4X6OA 1SQTA 2D8WA 1AE8H 5EXMA 1A5GH 4TWWA 4B2BA 1C9PA 1HJ9A 1YKTA 1C5OH 4FUCA 4DJZB 4O03A 3RUOA 4YT7H 2BLVA 1W10U 1L2EA 3C1KA 1C2LA 1SQAA 3U9AH 3ATLA 1GBFA 2XC4A 1GVZA 2QN5T 1IQHA 4OS2A 1QR3E 1CE5A 1ZJKA 1WCZA 4IMZA 5GDSH 2UUFB 1DPOA 1UCYK 1B0FA 2QCYA 2H1UA 3RLYH 1TPOA 2PGBB 1AZ8A 1SGPE 2ZDVH 4J1YA 2Z9LA 4UE7H 2RA0A 4VGCC 3VB6A 2ZHWH 1XKAC 3SO3A 3UQVA 1ZLRA 1DWCH 3EGKH 2AGEX 1FV9A 1S85A 3KN2A 1S0QA 2B5TB 5I46H 1C1QA 1ZMJA 2BDIA 1MD7A 1NESE 4FUDA 1CA0B 2PKAB 5E0GA 2PTNA 3E3TA 2P8OB 2FOMB 1TRNA 1J9CH 2F91A 2VIWA 4B74A 1IHSH 3MNBA 2RDLA 3A88A 4K8YA 3BEUA 1P0SH 1O2UA 5EXNA 1SLUB 3OTJE 2VGCC 1W0YH 2R9PA 1GDNA 3ATKA 1KXEA 4ZKOU 3F6UH 5IDKA 2STBE 1GI6A 3HPTB 2H6MA 1O3MA 4Q7ZA 1VITH 2PUXB 3PWBA 4AFUA 1O2XA 3F9FA 3VB3A 4U30A 5GIBA 2VH6A 5C20A 1GI3A 2ZDAH 3AVZA 1H8IH 3E0PB 1UHBA 4K1TA 1FNIA 2QA9E 3S7KB 3M7QA 3STJA 2Z3CA 4E05H 1BTUA 4BAMB 1HLTH 1HBTH 1AVWA 5F6MA 4DIHH 1BJUA 2FI4E 4MPXA 4NA9H 1EJMA 4QT8C 4LZ1H 4ABAA 1PPFE 5FAHA 1LCYA 2FWWA 1GHZA 1E34B 3SGQE 2FOGA 1ELFA 4BAKB 1O0DH 1AUTC 4I31A 3ZVDA 4CH2B 1A61H 4F4OC 3MH6A 1K1PA 1DXWA 2ZU5A 2EI7A 1GBAA 1FLEE 2BZAA 2KAIA 2ZEBA 2P3UB 1SOZA 1GBEA 2VVVA 1ZPBA 1UHBB 1GJ9B 3M61U 1OYTH 7GCHG 1C5WB 4NSYA 4MTBA 4A1XA 1AKSA 1L1JA 1V2TT 4FU9A 3O8BA 1QL8A 3KNXA 5FX6A 2Q6FA 1SLWB 1YPMH 4UFDH 2AIQA 3RXPA 1ID5H 4NA8A 1P2IA 1UK4A 1BHXB 3MO9A 1SGYE 1GJ4H 3Q77A 1O3EA 4RN6A 1P8VC 1G37A 1KY9A 1O2ZA 2SGDE 3ZZ3A 1H9HE