3RXJA

Crystal structure of trypsin complexed with 4-guanidinobenzoic acid
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxjA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxjA02
4MPWA 5DP3A 1AVWA 3KL6A 1NFXA 2TGAA 2QA9E 1P05A 1BTUA 1UHBA 1ZHMA 2F91A 2XW9A 5AHGH 1FIZA 3ENSB 1CGJE 4GHQA 5DP5A 1SHHB 1V2PT 1O30A 2VWLA 2BLOA 1SOTA 2GV6A 1SOZA 3Q00A 4DCDA 3FZDA 3RDZA 3V13A 1MBMA 4YM9A 4H4FA 4IMQA 3PMJA 4LXBH 1VGCB 1YPLH 5EODA 2NU4E 2A7JA 5GPIB 1O2WA 5C67A 1P9SA 2BB4A 1NTPA 1XMNB 3H5CB 5JB8S 3T25A 2JH6D 3GY8A 1GI2A 1ZPCA 1LPKB 4X6MA 1QBNA 3B9FH 2SNVA 4D7GA 2VVVA 1AKSB 1SGRE 4MTBA 4XBBA 5HXFA 1K9OE 5C3NA 2HPQH 3LGTA 1O2GH 1AFQB 2JH0D 1WTHD 4XE4A 3RU4D 2ZHEH 2G52A 1MQ5A 2R9PA 5FXLA 3TU7H 1ELGA 1NFYA 1AD8H 2ZCHP 1FIWA 2H5DA 5EW2H 1Y5AT 2TGPZ 2BY7X 1G2MA 1TOMH 1HBTH 1U6QA 4ABBA 1G9IE 3PO1B 4A5TS 2ZHWH 4NWKA 4YT7H 7LPRA 3C1KA 2I6SA 1ACBE 4FU9A 1ANDA 4JMYA 1TGSZ 3KQDA 5FHTA 3GCTF 1FY3A 5LH8A 2D2DA 2Y5GA 2VGCB 1HLTH 5ETXA 2O8UA 1K28D 1O3PB 1SQOA 4NA7A 2A4OA 1KXBA 2HPPH 1T31A 2VWMA 4Q7XA 2Z6BD 1GBEA 2Z9GA 1P2QA 5GIBA 3T62A 3M35A 1O2ZA 1ETRH 3W95A 2W7UA 1EPTA 6CHAC 2ZGHA 3RU4T 4AG2A 5TCCA 2YNAA 3LGIA 1C2KA 5IDKA 3PROA 1V2TT 3RC6A 2ZFPH 1L0ZA 1MZAA 1SC8U 3FZZA 2ZNKH 4UFGH 1TB6H 4ABHA 2THFB 4TPIZ 2VWOA 5T6DA 1D3DB 1JIMA 1QURH 4I31A 1MD7A 2XBXA 2VWNA 2ZPQA 1BT7A 2GZ8A 3TGKE 1YP9A 2J95A 1UVPA 8LPRA 1JRSA 4WXIA 3ZZ9A 3P70B 1C5XB 5EPYA 4X2XA 3BTKE 1W14U 2ZKSA 1UTOA 3SU4A 1AO5A 1HIAA 4FUJA 1F0TA 1V2OT 4MDSA 1AE8H 2AS9A 1J17T 2C8YB 1TWXB 1CU1A 1O2NA 2PKSC 4X6PA 2W7SA 3OTJE 2BHGA 3SV2H 1O5GH 1QBOA 4D9RA 1GI5A 1D3TB 2A4GA 4INKA 1TBQH 2Z9LA 3CP7A 1THRH 1EAXA 3FVFB 4GHTA 4I32A 4BXSA 4JCNA 2ANYA 1O3AA 3V0XA 3SUFA 1Y5UT 4MNWA 1UCYE 8ESTE 1NRSH 1P3EA 2BDIA 3UNQA 1TIOA 2QXGA 3W94A 4XFQA 1OKXA 1YPJH 2ZDVH 4H6SB 3QTOH 3JZ1B 3ZVGA 5HYOA 4VGCC 1P2NA 3RMNH 1ZHPA 1ZTLA 4K5ZA 1IQLA 3MO9A 1GJBB 3HK6B 2ALVA 4AN7A 1AWHB 1FAXA 1Z6EA 2RA0A 5T6GA 2C8ZB 1GHYH 1O37A 3OY6U 1BBRH 2A45B 1ZPBA 1BUIA 1ZSJA 1EOLA 3F9FA 5DK1A 3GY6A 1ZPZA 4CHAC 2R0KA 1VZQH 4X8UH 1C5OH 1Y3UA 3UOUA 4O3UA 1GHVH 7GCHF 3S9CA 3PLKA 1PPZA 1IHSH 1K1MA 5DGJA 5C5OA 1IQKA 3BG8A 2OCVB 1DWBH 4TY7A 1AZ8A 1ELVA 1F2SE 2GCTB 3TJUA 3O8DA 3CENA 1GDQA 1KY9A 3GICB 1PQAA 2H2ZA 4DY7B 2YNBA 3NK8A 1K1NA 3A80A 3RXSA 1GCTB 2Z9JA 1T8MA 3D49H 2O8TA 3VPKA 1LTOA 1HXEH 8GCHG 4FUFA 2ZGBH 3D23A 2ZC9H 4F49A 2TIOA 3A82A 4TWWA 3A8DA 1BRBE 3NXPA 5JYIA 2ZO3H 1DICA 2FIRH 3P95A 1GI4A 2BMGB 1CT4E 2ZPSA 4K1TA 1TNHA 2FM2A 3NKKA 1FY8E 1AB9C 2PFEA 5CMXH 1WSSH 3TNTA 4AOQA 3RMOH 1GGDB 1FJSA 1HJAC 2ZCLP 3RXUA 2V0BA 3SI4H 3SQEE 3GCTG 1IQHA 2OC1A 1EXFA 3P17H 4BOHA 1OS8A 1QIXB 1O3OA 2P3FH 2EI8A 3M5LA 1O3FA 1W0YH 4SGAE 5HMAA 3SO3A 5C1UA 5H4IB 3SV8A 4ZHMU 4JZFH 1C2MA 1O2VA 1CGIE 2A2XH 3V3MA 1SGFA 3ZVEA 4Q2KA 1FMGA 4O03A 3UIRA 4H6TA 1ZMJA 3F6UH 3EQ0H 1UO6A 2R2WU 3SJ9A 1C2FA 1C2JA 1SLXB 4K8BA 2ZDLA 3NWUA 3VGCB 1AE5A 2W3IA 1C2HA 1GHAF 2QYIA 1AQ7A 3C27B 3A7WA 4RKJB 3VB5A 1N6XA 2YOLA 1GI9B 4BNRA 1UVOA 2ANKH 1FZZA 1BRUP 1DY9A 1C5PA 1C2GA 4U32A 2DE9A 2ZDKA 2BD8A 1L4ZA 2CXVA 2FOFA 3CS0A 1H4WA 1YCPM 1ELBA 3KIDU 1QJ1B 3SV6A 1ZGIA 1GJ8B 2ANMH 2D26C 3GYMA 5A0BA 1PPGE 4DJZB 1Z7KA 3BEIB 3MNCA 5C1YA 4TYDA 2SGPE 4JZEH 5HGGA 1XUIA 4IGDA 3B8JA 2NU1E 4X2VA 5A2MH 4O97A 6LPRA 1DITH 4D76A 3NCLA 3SU2A 2CN0H 2UUFB 4ISOA 2ZDNA 3O8RA 3TH4H 1GVKB 1NO9H 2HRVA 4R8TB 2C90B 3KGPA 3U8RH 2HNTE 3M7QA 1HAXB 2CGAA 4OS2A 2CHAC 5J4SA 2OD3B 3Q3XA 3SJ8A 4CRBA 1FY5A 2AGGX 4NSVA 1KDQB 5F8XA 2ZFSA 1WUNH 3PM3A 2G5NA 4ZKRU 4D9QA 2PKAA 1TRYA 2Z3EA 1BB0B 1G3BA 2J92A 1W2KH 1A5IA 2PUXB 4GLYA 3KHVA 2BM2A 1TNJA 1G32B 3ITIA 2O8WA 3I78A 3ATMA 2BX3A 1EUFA 1WU1A 1IQNA 3SZNA 2PKSB 4FU8A 2Y6TA 3VXFH 1YM0A 1SVPA 4CBOA 2PWXA 4WMEA 4UE7H 3UR9A 3A7ZA 1SGNE 3SV7A 4AFUA 1TX7A 3FAOA 3QX5H 1LCYA 2ASUB 1NRQH 2UWPA 2PGBB 4E7RG 5A0CA 1SLWB 3K65B 3URDA 2XTTB 1IHTH 1HYLA 3ZZ4A 4NIXA 3F68H 3KEEA 4FVDA 1FAKH 3SHAH 1NU9A 3ZVDA 1P0SH 2UWOA 2W3KA 4AYYB 4DIIH 1B0EA 4ISHH 1G3DA 2ZDAH 2OQUA 4MLFB 3TGIE 1BZXE 4I8HA 3I77A 2FS9A 3H7TA 4AZ2B 2JETB 2R3YA 1RGQA 2C8XB 1ARBA 4K3JA 1P57B 2DE8A 2VU8E 1NESE 1BRAA 5EG4A 4CR5A 4IC5A 4FUBA 3LOXA 1P12E 3GY5A 2Y7ZA 2GZ9A 5DP8A 2ZFFH 3MMGA 1GBLA 1TONA 1EQ9A 2VVCA 5E0HA 5GDSH 1AB9B 4E06H 1A5GH 1ABJH 1SI5H 2ZHFH 4NGAH 3HK3B 1O3CA 3E8LA 1YKTA 1O3MA 5A0AE 2XC4A 1DUAA 4OS4A 1SB1H 2B8OH 1H1BA 1TX8A 2AYWA 1YPHC 2HWLB 2NWNA 3SI3H 1TX6A 3BTDE 2RDLA 1M9UA 2AEIH 3T5FH 1C5RA 1A5HA 1ESAA 1L1JA 1Y3WA 3P8OA 1UK3A 1XXFA 2NU0E 3MOCA 1BMAA 4BAHB 1Y5BT 1PQ7A 3RU4E 1D6WA 3LU9B 1CHOF 5C2ZA 1O0DH 4NFEA 2QIQA 3A7VA 1TABE 1MAYA 1DFPA 2JETC 1YPKH 3RM2H 1W8BH 1GL1A 3EAJA 5EQQA 4ABIA 4IN1A 3P8FA 1V3XA 1DANH 1BMNH 3GDVA 1FY4A 1D3QB 1YPHE 2FX4A 1E38B 3RXGA 1S6HA 1EB1H 2SGEE 3ZZBA 1Y3YA 4X0WU 1O31A 5EQSA 1MD8A 1GI7B 1XKBC 3FP7E 5EXLA 2WPLS 3SW2B 1DM4B 2FXRA 5C5NA 5FPSA 3P8GA 3QWCH 3BTHE 2STAE 1ZMNA 1ELDE 4CBNA 2CF9H 8GCHF 1RTLA 2Y81A 1GHXH 3VB4A 1EX3A 1GJDB 1VGCC 2ZFTA 1C2EA 1QY6A 1OWDA 2HGTH 1TMUH 5F6MA 3A8AA 3TH2H 1ARCA 4MVNA 1DVAH 2ZU4A 1FONA 2FMJA 3BG4B 3T29A 3RXEA 4X2YA 3UNRA 5L2ZH 1CO7E 4U30A 1A0JA 2ZG0H 2A7HA 2R2MB 1IQJA 1OX1A 3R3GB 1H8DH 4J1YA 2A2QH 1SMFE 3LJJA 4BAKB 2A4RA 1GL0E 1AKSA 2WV5A 4AG1A 5FAHA 4Y11E 2HOBA 1C1RA 1XXDA 1T8OA 5FPTA 4UEHH 3RXRA 1DPOA 3SU3A 3L6PA 1Y59T 4ESTE 4YOJA 4HFPB 1C2LA 2B5TB 1T8LA 4UD9H 3MU5A 2TPIZ 1OYTH 4AGJA 1K1LA 3DFJA 3BEFB 1V2VT 4MPVA 3A85A 2GV7A 1NZQH 2A0QB 2VGCC 2CJIA 2OQ5A 2QN5T 5FBIA 3S9AA 1EATA 1KXFA 1QBVH 3NPSA 5LPEA 1Z8JB 2GKVE 2P16A 3K2UA 5CE1A 3H7OA 5K7RA 5EW1H 2XBYA 2GT8A 3BF6H 2FS8A 1O5BB 1FQ3A 1VJAU 2FZZA 3LJOA 1VITG 4XBDA 4CR9A 3RXOA 3TK9A 1MMJN 3SJIA 3TK6A 1O35A 3ZVBA 1BITA 1G37A 1A0LA 4OS6A 4UFDH 4ZKNU 3IG6B 6CHAB 3NUMA 1MTWA 1RXPA 1FNIA 2GDEH 4YOIA 2A5AA 2B7DH 1KXAA 1SHYA 1G30B 2EEKA 2QY0B 1O2PA 1LHGH 3MO3A 2NU2E 1HAGE 3UPEA 3ZV8A 2OLGA 4AB8A 1QGFA 1UCYK 2XXLA 1SGDE 2OXSA 2W5EA 1L1NA 1F92A 2F9NA 2PKAB 4AGKA 3D65E 3SNEA 1BTZA 4JZDH 2SGFE 1QL7A 1A4WH 3LH3A 4NFFA 5BPEA 4IN2A 1GI6A 3AW1A 2BD4A 2FYQA 1V2ST 1AZZA 1QJ6B 5K0HA 2P94A 1A1RA 3HPTB 5F8ZA 1CA0C 1XX9A 3MU8A 3TIUA 1NFWA 2XRCA 1C4Y2 1THSH 3LT3A 1O2OA 3A7TA 4NZQA 3RXDA 4YLQH 2BDAA 4KTUA 1SGFG 2LPRA 3SNDA 2XBWA 4DW2U 1OWKA 3QGNB 1OXGA 4Y79A 3RXVA 1O5DH 3SUEA 2G55A 4U01A 3I29A 1ZHRA 4A1XA 5L2YH 1YPMH 2FTMA 1FI8A 2QGRA 1LHDH 1GI0A 2WPIS 2FOHA 3LC3A 2F9BH 3LPRA 1DXPA 3T2NA 3ELAH 1TYNA 8KME2 5JBAS 3PTNA 3RXIA 1SGTA 2FLRH 3URCA 3ZZ7A 2OUAA 1BHXF 1ZSLA 3EYDA 1KXDA 3RM0H 1V2WT 3BTTE 2P3TB 1W0ZU 1JXPA 2QXJA 2ZFRH 4X2WA 1HCGA 1HPGA 1OOKB 4WF8A 1EZQA 3PV4A 4Q80A 1GG6C 1PFXC 5F03A 4TWYA 4Y0YE 2LNCA 3ZZAA 1N1LA 1SGQE 4Y7AA 1GBKA 1Z8GA 4YOGA 1GG6B 1O3BA 1C4U2 1JIRA 2TRMA 3MH7A 1FV9A 3BTEE 5FBEA 1OWHA 2TBSA 1AFQC 2WPMS 1P2IA 1SFQB 3BTME 3TNSA 4X8SH 7ESTE 3Q3YA 4VGCB 1OWIA 3S7HB 3DUXH 5EOKA 1GMCG 3SHCH 4AFSA 1VCPA 4Z6AH 1ZYOA 1G3CA 1ZMLA 1O2JA 3BV9B 3K6ZA 1HAVA 1XKAC 2H9HA 4A1TA 3GDUA 2SFAA 1T4UH 1MBQA 1TPOA 1CQQA 1X7AC 3SUDA 1OP2A 4WH8A 3RLWH 5I25A 2Z94A 1ZSKA 1IQFA 4THNH 3SJOA 1GJ7B 3BIVH 2WYGA 3QN7A 1KLJH 1BMMH 1INCA 1AN1E 1GJCB 1C5ZB 1L1GA 1P11E 1Z1JA 2VNTA 4KP0A 3N7OA 4IC6A 4UFEH 1KTSB 3DA9B 2BQ7B 3ZZDA 2P8OC 2GTBA 2QV1A 4IW4E 1UVSH 1O3EA 3RC4A 1J8AA 3E90B 1H8IH 3RLYH 2FYRA 1GHAG 1NRPH 5TCAA 3GYLB 3LH1A 4ISLA 1BJUA 3L33A 1QR3E 2QF3A 3VGCC 1XUFA 1F5LA 1GJ4H 1DWCH 1Z6JH 3TJOA 5DP7A 3GISB 3GCHB 1RTFB 4GCHF 3MH5A 2SGQE 4Q7YA 4Y7BA 4HI3A 3QUMP 4ZKSU 1GHBF 1ZLRA 2Y5FA 1P9UA 1C5YB 1TE0A 1KXCA 5FCKA 1GBFA 1CHOG 1C1PA 1PPBH 4WJG2 2ZTZA 1GHWH 2Y5HA 1PYTC 3SJKA 1PYTD 1TNLA 3AW0A 1MU8B 3EA8A 1O5AB 2VIVA 2VB0A 1HJ8A 1XUJA 2PR3A 1HAVB 1SGYE 4B73A 1O38A 1P03A 1GMCF 5E2OA 4FUGA 1WQSA 4ABAA 2ESTE 1C5LH 4OGYA 3SNBA 1NRNH 2UUKB 1UTLM 1BTHH 1SLVB 1D6RA 3ZZ5A 1SLUB 1TPSA 3ZYDA 1GJ6A 1LPZB 3ATWA 3PMHB 4K69A 3MWIU 4I8JA 3GY2A 4AYVB 2ZGCA 4BTUB 2XCFA 4FXGH 3UY9A 1UK2A 5GXPA 3PB1E 9LPRA 2B9LA 1AUTC 2GCHF 1AHTH 1V2NT 1UTNA 3MHWU 4B75A 2ZU1A 1DT2A 1V2LT 2V3HH 1UVTH 2XC5A 4IS5A 4ZHAA 1Z8RA 1TNIA 3RXCA 3VEQB 1B7XB 5HM2A 1GWAA 3E16B 2ZGJA 2G4TA 4WXVA 1AFEH 3PYHA 3M36A 2G4UA 3VB3A 1C1TA 4AFQA 1C1MA 2J4IA 5FPYA 1FLEE 1O3DA 3E1XB 2GZ7A 3BTWE 4GCHG 1UTQA 2Y82A 4WMFA 4ABGA 2SGAA 4K2YA 7GCHG 3ATIA 2ZU5A 1NT1A 1F0RA 1K21H 1IOEA 1J15A 4NZLA 4INHA 4DG4A 2FO9A 3Q76A 1WAYB 1GMHG 4Y8ZA 2G51A 2BOHB 3ZVAA 2FX6A 1QCPA 1MKWH 1BOQA 1C4V2 1D4PB 1EP5A 4LOYH 1AVXA 3OSYA 4ASHA 1QRXA 2C8WB 3E3TA 1LVYA 2GGVB 1PPCE 1O2TA 1TNGA 1KLTA 4BAMB 3S69A 1DWDH 1QB9A 2ZWLH 1GDUA 4NIWA 1LVBA 3KCGH 3VB6A 1O5CB 4DOQA 3A83A 4JK6A 1B5GH 1HAZB 5DPAA 4X1QU 1ZRKA 2RG3A 4WWYA 1EASA 2OBQA 3ATLA 3SORA 2H1UA 4YTAA 1BBRE 4ZUHA 3A8BA 1P10A 4JYVH 1HAIH 3QZQA 1HIAB 1UK4A 1H9IE 1C5SA 1WOFA 2BDYA 3KNXA 1HUTH 1KXEA 1E0FD 2Q6GA 1PPFE 1ANCA 5JBBS 1EKBB 1GVZA 1FPCH 1S0RA 5DP6A 1GBCA 3U9AH 4R0IA 2R0LA 5JBCS 1DUEA 1DWEH 4MPUA 1D9IA 3TK5A 4XBCA 5A8XA 1UJ1A 5AVDA 3AAVA 1MZDA 2FI3E 4ZAEA 1MTUA 1QB6A 1THPB 4LZ4B 1DLEA 2OP9A 3GY4A 1PJPA 3ZZ6A 3G01A 3UUZA 3TVJB 3BIUH 1DXWA 3T26A 3E0PB 4YZUA 2XCNA 1LHFH 4Y10E 1ID5H 1GBBA 3QZRA 1PPEE 4ZHLU 3OYPA 5SGAE 1O2RA 1GGDC 1ELEE 2EA3A 1ANBA 3U1IB 1P2OA 1W11U 3ZZCA 1MH0A 3RP2A 1LKAA 3EA9A 1Q31A 3ZVCA 1BIOA 2BVXH 3MH6A 4X8TH 1C1WH 1WQVH 3QGJA 1O36A 1Z8IB 3MYWA 4ISIH 4J2YB 9ESTA 4FUEA 1TRMA 3ZZ3A 4JZ1A 2FOGA 1AVGH 2G81E 4OS5A 1NPMA 4X8VH 1YCPH 2G5VA 3RXBA 3K6YA 1P06A 2G8TA 1O3JA 3RXMA 1V2MT 1GCTC 1GI8B 1C2DA 4A7IB 2AERH 3SGBE 4D7FA 3BSQA 4WY3A 2M5TA 3GCOA 1B0FA 4ABDA 1S81A 1S82A 1O2QA 3ODDA 5DKMA 5AF9H 1O2XA 2QCYA 5AFYH 1O3HA 3U8OH 1L4DA 1C5VA 1YLCA 1KYNA 1V6DA 5LPRA 1RIWB 3DHKH 3Q77A 5B6OA 3A81A 2IN2A 2V35A 1HJAB 1P2MA 1MQ6A 2AIQA 1ETTH 1QRWA 5LGOA 5LPFA 2KAIA 2FESH 1ZZZA 1F5KU 6GCHG 1DLKB 1SGEE 1SGPE 2R3UA 4KGAA 3OU0A 2GD4B 1V2RT 4X1NU 1GVLA 1QFKH 1WBGB 2PUQH 4XSKU 1IAUA 1DE7H 2ZI2H 2VIWA 1WYKA 1CVWH 1QQUA 2J2UA 2J38A 1TBRH 3M61U 4O9VA 1DOJA 1C5TA 2O9QA 1C5WB 1EZUC 1UTMA 2J94A 1SQTA 3QK1A 4B1TA 4U2WA 3U98H 2BXUH 1HAHH 4K60A 1GHBG 5CHAB 4CREA 1VR1H 1BDAA 3UOPA 1RJXB 2AGEX 1ELFA 1GBTA 3BTGE 5FX6A 1LQEA 1O2KA 4B2AA 1DSTA 1RIWC 2QC2A 1TFXA 1VITH 1EOJA 4ZXYH 3DD2H 4BAQB 4XOJA 2BYAX 1F7ZA 2P93A 1EP6A 2AMDA 3RXHA 2BY8X 1G36A 2AMPA 4SGBE 2P95A 2PV9B 1O2MA 3MNBA 2Q1JA 2ZIQH 1Z71A 3MFJA 4YLUA 4RKOB 1T8NA 4JZIA 1O39A 3A7YA 3BN9A 3UQVA 2IJOB 5A8ZA 1OPHB 4NIYA 2FI4E 3L3TA 1J9CH 1A0HB 1XVMA 3B23B 3MU0A 4WH6A 1EPTB 2Y7XA 5EXMA 2FDAA 1TALA 5T3HA 1YGCH 1EJNA 1O3NA 4Y0ZE 5TJXA 1NN6A 1CT0E 5L6NH 1LQDB 5DP4A 3RXAA 1LHCH 4I33A 1Q3XA 2XWAA 1GBAA 5PTPA 1J16A 1T7CA 2D1JA 4ZKOU 4CRDA 3M5NA 1LVMA 3E6PH 1MKWK 4QT8C 1WTGH 2Z3DA 1GPZA 1TAWA 1E37B 1NY22 1TA6A 1YF4A 1TGCA 4AFZA 2H9EH 1FXYA 5DO4H 1HV7A 4OS7A 4BTIB 4Y71A 4I8GA 1A2CH 3EGKH 3SQHE 2P3UB 4NCYA 1O32A 1C1VH 3RUOA 4A6LA 3LDXH 4LZ1H 2VH6A 3M7UA 1C5QA 5E8EH 3ESTA 1QL9A 2Q6DA 3UFAA 1IQMA 5EXNA 3QTVH 1WCZA 5FCRA 4X6OA 3STJA 2ILNA 2P59A 3PMBB 3HATH 1CBWC 2G00A 4IBLH 3AVZA 2ODPA 4NIVA 2A4QA 4MG3A 4LK4A 4AX9H 1BQYA 1C9TA 4K1EA 3CS7A 1P01A 3U69H 3ZV9A 1SGCA 3UTUH 2O8LA 3MI4A 2V3OH 3GDSA 3K9XB 1K1OA 1AGJA 3QDZB 1ZRBA 2GMTC 4B2BA 1TGNA 1KDQA 1FN6A 5C20A 1ESTA 2XNIA 5I46H 1BTXA 3RXFA 1YLDA 1HNEE 4DURA 2ZPRA 2ZU3A 1GBJA 2ODQA 3RXTA 2FODA 3SOSA 1UTJA 1HJ9A 3ODFA 1L2EA 1EZSC 3BG4C 3U8TH 1E34B 4Y8XA 1TGBA 2A31A 1K22H 2XBVA 4DVAU 4GPGA 1AUJA 4H42U 2UUJB 2HNTF 1C1QA 1HXFH 3TJNA 2JKHA 1NFUA 1H9LB 1O2HA 4GUXA 5IYTA 2ZU2A 2H9TH 4CRAA 4UFFH 1G3EA 2TGDA 2D8WA 2H5CA 3JZ2B 3RMLH 3F9GA 5FX5A 2FOEA 1S0QA 3PLPA 1ESBA 2A1DB 4I7YH 3MH4A 1SPJA 3PLBA 2ZTYA 2HNTC 3D62A 2FOMB 3RXPA 3T27A 4FUCA 2FOBA 1O5EH 5GJ4B 3M3VA 1CE5A 2XWBI 3SGAE 2FP7B 1AU8A 2GT7A 2VH0A 3O8CA 1CHGA 2ZP0H 2EI7A 4D8NA 1TMBH 4FUDA 1GDNA 1O33A 3F1SB 2QXHA 4KELA 3SN8A 1CT2E 2GVFA 3MU1A 4I8KA 2F9PA 1N8OC 1TQ7B 1ANEA 1RRKA 2XYAA 1O5FH 3DFLA 2Z9IA 1T32A 2BXTH 3AASA 2BY9X 2BDCA 3R0FA 1RFNA 3SGQE 3ATKA 1ZR0A 1MAXA 2GDDA 1F5RA 3M5OA 4NSYA 2H6MA 2SNWA 3P6ZB 1A46H 2TGTA 1LDTT 1O3LA 3DT0H 1VCWA 2BLVA 1UHBB 1EJMA 1EZXC 1LHEH 1LO6A 2BQ6B 3T28A 1K1IA 1O2YA 1SL3A 3LONA 3WY8A 2CMYA 3TGJE 1A61H 1E35B 4ISNA 4FUHA 1P04A 3KF2A 3GY3A 1HGTH 2WPHS 5JB9S 4MNVA 5EU8A 1C5MD 1NM6A 1ABIH 2A5IA 1GBHA 5DJ7A 4CH2B 5ABWA 4B74A 1TPPA 3M3SA 1ZTJA 4Z0KA 1KTTB 3LC5A 5EQRA 6GCHF 4MQAA 2BDGA 3EA7A 1N6YA 1W7XH 4KTSA 2WUCA 2O8MA 2VJ1A 2ZHDA 2FWWA 1N8OB 2BY5X 4WVPE 3UR6A 3ZZ8A 3SV9A 1FUJA 3TITA 1LPGB 1O2LA 2UWLA 1OSSA 2JH5D 2EC9H 1AIXH 3PO1C 1RS0A 2BD3A 1SQAA 2J34A 1ORFA 1TGTA 1ETSH 2K1QA 1LKBA 1WV7H 2VIPA 4X1RU 1VITF 1NC6A 3A89A 1F0SA 2BDHA 3RMMH 4DT7B 1QNJA 1QHRB 3V12A 4Y76A 4BANB 2OINA 1BA8B 2A7CA 1W13U 4JYTA 4ZROA 4RSPA 1AWFH 1A3EH 2C93B 2GCTC 2WPKS 2FLBH 1O3KA 3OX7U 1C5NH 5ESTE 2Z7FE 2WINI 4GSOA 1YPGH 1GI3A 4HZHA 3MO6A 3UNSA 5DP9A 3IWMA 3MTYA 1KLIH 3A7XA 2STBE 1O2SA 1HAYB 4A92A 1IQGA 4CRCA 1D3PB 1FDPA 3TPIZ 1TMTH 1V2UT 1NRRH 1ZJKA 1PPHE 2PSYA 2GX4A 3MNSA 2Z9KA 3F9HA 3ZVFA 1C1NA 4X1PU 1JRTA 1QL8A 1TOCB 3GY7A 3MNXA 2ALPA 3FP8E 3GOVB 3UREA 1HAOH 1OWJA 1GJ9B 1YPEH 1O3GA 4OS1A 2OC8A 1A3BH 1MCVA 2ODYB 2IPHA 1S85A 3U1JB 2B0FA 2BTCE 3TLOA 1QJ7B 1W12U 1HDTH 1MTVA 3RXQA 1P2JA 1BJVA 2I6QA 2BVSH 2ZFQH 1Y3VA 1YBWA 2A32A 1CA0B 1XM1A 1AMHA 3KN2A 1EB2A 1TLDA 4A1VA 3FP6E 5JDUB 1V2JT 1K2I1 1EAUA 1UTKA 3QO6A 1MCTA 1TPAE 4PROA 3M3TA 2PLXA 1MTNC 1XUKA 1JOUB 1AI8H 1W7GH 1W10U 2BY6X 2CF8H 3KQBA 1A7SA 2ZHQH 2XC0A 3GCHC 4YESB 2WUBA 5DG6A 1MKXK 2CV3A 2AIPA 5A8YA 4WMDA 1GMDF 1MTSA 1RTKA 3TJVA 5C1XA 1VJ9U 1OYQA 1S84A 2QXIA 5F8TA 5A09A 1BMLA 4ZMAH 1QB1A 3UQOA 1FPHH 1Q2WA 2BZ6H 2BD7A 4GVUA 1GJ5H 1NS3A 1SFIA 1EAIA 1K1JA 1ZTKA 1HB0B 2OTVA 1KSNA 3LIWA 1C1UH 2FOCA 5BRRE 4X6NA 1O2UA 2PGQB 1C1SA 2VVUA 1ELAA 2OC0A 4ABEA 1MU6B 4Q7ZA 1SBWA 3HGNA 3Q3KA 1BRCE 1JWTA 1BTYA 2HLCA 1O34A 1Y3XA 2F9OA 2GMTB 3SU5A 2ZTXA 1S6FA 4OGXA 4NA8A 2OC7A 4NWLA 2FI5E 7KMEH 1CA8B 3LKWA 5J4QA 3IITA 1PQ5A 1CSOE 2EI6A 4UONA 1O3IA 1GBIA 4JK5A 4M7GA 3E91A 2FPZA 3SUGA 3PWCA 4X1SU 1P2KA 3AAUA 4YT6H 2BZAA 2Y80A 3PMAB 2ANWA 4AB9A 2HALA 2J9NA 1O2IA 1OWEA 2FEQH 2OBOA 2PTCE 4ZH8A 3RC5A 3UWIA 2BD9A 2ZA5A 3LGUA 4IMZA 1S83A 2GP9B 2F83A 3TH3H 4KTCA 1DY8A 1GMDG 1BTWA 4K8YA 1OP0A 2F9UA 4MNXA 1SR5C 3HKIB 1DS2E 1P09A 1UMAH 1DX5M 3MU4A 3KQCA 3VFEA 3SNCA 1FY1A 2A5KA 2ZEBA 1Z1IA 1TBZH 2ZGXH 2P8OB 2RA3A 2BVRH 1ZJDA 1TQ0B 3SU0A 2AH4X 1W3CA 3M5MA 3RXKA 3GCNA 2GCHG 3P92A 4GAWA 4CRGA 5ESBA 2NU3E 1YCPK 4ZXXH 2PHBA 2VIDA 1GBMA 3LGVA 3O8BA 2V6NA 4KKDA 3SU1A 1XUHA 1GI1A 2BDBA 1ELCA 2PTNA 5CHAC 1V2KT 5E0JA 1HRTH 4YO9A 1C5UA 1T4VH 1TRNA 2CHAB 2AGIX 2ZECA 4MPXA 3BTFE 2C4FH 2UUYA 1FN8A 1UTPA 2BQWB 4TPYA 2HVXA 1C2IA 4B2CA 3BTQE 2PSXA 4BAOB 1ZGVA 3QLPH 3M7TA 1Y8TA 2BD2A 2SGDE 1P8VC 3A8CA 3A88A 2RCEA 1J14A 4RN6A 3A87A 1BHXB 4MNYA 4ABJA 4E7NA 1MKXH 1QQ4A 2ZZUH 1TNKA 1JBUH 1GHZA 5T6FA 1EPTC 1XUGA 1CBWB 3F9EA 5EGMA 4B76A 1JMOH 1MUEB 1OP8A 5GCHG 2F9VA 4Y6DA 3A86A 3KQEA 5G4BA 4BXWA 1F0UA 2AFQB 3FFGA 2ZQ1A 1YYY1 4K1SA 1GJAB 1G2LA 2W26A 3OY5U 1YC0A 2Z3CA 5GWZA 1KIGH 5E0GA 2VIQA 1S5SA 1IQEA 3UWJH 3S9BA 5HM9A 2BD5A 4I8LA 1XVOA 1BBRK 1QA0A 1QRZA 1VCQA 2VINA 5JBTA 1DSUA 2ULLA 2IOTA 2KAIB 3PTBA 3FANA 3RXLA 2C3SA 1LMWB 4HGCA 2BLQA 1HAPH 3SNAA 4E05H 2VIOA 3NZIA 1BCUH 4FUIA 1QA7A 1SSXA 1SG8B 2WYJA 1E36B 3HKJB 1ELTA 5AFZH 4CRFA 3V7TA 2ZF0H 1GBDA 2AMQA 2FOAA 3SBKA 2Q6FA 4O3TA 1UCYH 1PQ8A 4UDWH 4XDEA 3LGYA 1EAWA 2DUCA 3ZYEA 4NA9H 4B71A 1MTNB 1NU7B 3HGPA 3P8NA 4JYUH 2BLWA 3EDXB 1DDJA 3LGWA 2WV4A 4DGJA 4F4OC 6ESTA 1C9PA 1H9HE 3EE0B 1ZOMA 4AORA 2FTLE 3M37A 2ZCKP 2ZQ2A 2F3CE 4NG9H 4CH8B 3VB7A 1RD3B 1LVOA 1EJAA 1GCDA 1IQIA 4INLA 1P02A 3BEUA 3PWBA 2PW8H 1C1OA 1CGHA 2WPJS 4TY6A 4Y8YA 4ABFA 3SU6A 4FU7A 3S0NA 4FVBA 3VXEH 5GCHF 2QAAA 2BOKA 1AY6H 1QTFA 1K1PA 1P3CA 3E0NB 3STIA 5JPMH 5E2PA 2BX4A 3RXJA 4BTTB 1SGIB 1UVUH 1NROH 1V2QT 3A84A 4CHAB 3S7KB 4HTCH 1TA2A 2ZDMA 4DIHH 1HFDA 2QF0A 1BTPA 5L30H 5EPNA 1GMHF
chains in the Genus database with same CATH superfamily
4MPWA 3WWFA 5DP3A 1AVWA 3KL6A 1NFXA 2TGAA 2QA9E 1P05A 1BTUA 1UHBA 1ZHMA 2F91A 2XW9A 5AHGH 1FIZA 3ENSB 1CGJE 4GHQA 5DP5A 1SHHB 1V2PT 1O30A 2VWLA 2BLOA 1SOTA 2GV6A 1SOZA 3Q00A 4DCDA 4Q63A 3FZDA 3RDZA 3V13A 1MBMA 4YM9A 4H4FA 4IMQA 3PMJA 4LXBH 1VGCB 1YPLH 5EODA 2NU4E 2A7JA 5GPIB 1O2WA 5C67A 1P9SA 2BB4A 1NTPA 1XMNB 3H5CB 3F3BA 5JB8S 3MQKC 3T25A 2JH6D 3GY8A 1GI2A 1ZPCA 1LPKB 4HG6A 1QBNA 4X6MA 3B9FH 2SNVA 4D7GA 2VVVA 1AKSB 1E79D 1SGRE 4MTBA 4XBBA 4ACAA 5HXFA 1K9OE 3NRLA 3CNRA 5C3NA 2HPQH 3LGTA 1O2GH 1AFQB 2JH0D 1WTHD 4XE4A 3RU4D 2ZHEH 2G52A 1MQ5A 2R9PA 5FXLA 3TU7H 1ELGA 1NFYA 1AD8H 2ZCHP 1FIWA 2H5DA 5EW2H 1Y5AT 2TGPZ 3EE7A 2BY7X 1G2MA 1TOMH 1HBTH 1U6QA 4ABBA 1G9IE 3PO1B 4A5TS 2ZHWH 4NWKA 4YT7H 7LPRA 3C1KA 2I6SA 1ACBE 4FU9A 1ANDA 4JMYA 1TGSZ 3KQDA 5FHTA 3GCTF 1FY3A 5LH8A 2D2DA 2Y5GA 2VGCB 2WPDD 1HLTH 5ETXA 2O8UA 1K28D 1O3PB 1SQOA 4NA7A 2A4OA 1KXBA 2HPPH 1T31A 2VWMA 4Q7XA 2Z6BD 1GBEA 2Z9GA 1P2QA 5GIBA 3T62A 3M35A 1O2ZA 1ETRH 3W95A 2W7UA 1EPTA 2L6OA 6CHAC 2ZGHA 3RU4T 4AG2A 5TCCA 2YNAA 3LGIA 1C2KA 5IDKA 3PROA 1V2TT 3RC6A 2ZFPH 1L0ZA 1MZAA 1SC8U 3FZZA 2ZNKH 4UFGH 1TB6H 4ABHA 2THFB 4TPIZ 2VWOA 5T6DA 1D3DB 1JIMA 1QURH 4I31A 1MD7A 2XBXA 2VWNA 2ZPQA 1BT7A 2GZ8A 3TGKE 1YP9A 2J95A 1UVPA 8LPRA 1JRSA 4WXIA 3ZZ9A 3P70B 1C5XB 5EPYA 4X2XA 3BTKE 1W14U 2ZKSA 1UTOA 3SU4A 1AO5A 1HIAA 4FUJA 1F0TA 1V2OT 4MDSA 1AE8H 2AS9A 1J17T 2C8YB 1TWXB 1CU1A 4RT1A 1O2NA 2PKSC 4X6PA 2W7SA 3OTJE 2BHGA 4Q4LA 3SV2H 1O5GH 1QBOA 4D9RA 1GI5A 1D3TB 2A4GA 4INKA 1YWUA 1TBQH 2Z9LA 3CP7A 1THRH 1EAXA 3FVFB 4GHTA 4I32A 4BXSA 4JCNA 2ANYA 1O3AA 3V0XA 3SUFA 1Y5UT 4MNWA 1UCYE 8ESTE 1NRSH 1P3EA 2BDIA 2HVYB 3UNQA 1TIOA 2QXGA 5C94A 3W94A 3OE7D 4XFQA 1OKXA 1YPJH 2ZDVH 4H6SB 3QTOH 3JZ1B 3ZVGA 5HYOA 4VGCC 1P2NA 1YY3A 3RMNH 1ZHPA 1ZTLA 4K5ZA 1IQLA 3MO9A 1GJBB 3HK6B 2ALVA 4AN7A 3DSPA 1AWHB 3PRBA 1FAXA 1Z6EA 3PRDA 2RA0A 2M2AA 5T6GA 2C8ZB 1GHYH 1O37A 3OY6U 1BBRH 2A45B 1ZPBA 1BUIA 1ZSJA 2KR7A 1EOLA 3F9FA 5DK1A 3GY6A 1ZPZA 4CHAC 2R0KA 1VZQH 4X8UH 1C5OH 1Y3UA 3FN8A 3UOUA 4O3UA 1GHVH 7GCHF 3S9CA 3PLKA 1PPZA 1IHSH 1K1MA 5DGJA 5C5OA 1IQKA 3BG8A 2OCVB 1DWBH 4TY7A 1AZ8A 1ELVA 1F2SE 2GCTB 3TJUA 3O8DA 3CENA 1GDQA 1KY9A 3GICB 3DSGA 1PQAA 2H2ZA 4DY7B 2YNBA 3NK8A 1K1NA 3A80A 5F53A 3RXSA 1GCTB 2Z9JA 1T8MA 2KCPA 3D49H 3AK5A 2O8TA 3VPKA 1LTOA 1HXEH 8GCHG 4FUFA 2ZGBH 3D23A 2ZC9H 5C0UA 4F49A 2TIOA 3A82A 4TWWA 3A8DA 1BRBE 3NXPA 5JYIA 2ZO3H 1DICA 2FIRH 3P95A 1GI4A 2BMGB 1CT4E 2ZPSA 4K1TA 1TNHA 2FM2A 3NKKA 1FY8E 1AB9C 2PFEA 5CMXH 1WSSH 2CK3D 3TNTA 4AOQA 3RMOH 1GGDB 1FJSA 1HJAC 2ZCLP 3RXUA 2V0BA 3SI4H 3SQEE 3GCTG 1IQHA 1EFRD 2OC1A 1EXFA 3P17H 4BOHA 1OS8A 1QIXB 1O3OA 2P3FH 2EI8A 3M5LA 3N7EA 1O3FA 1W0YH 4SGAE 5HMAA 3SO3A 5C1UA 5H4IB 3SV8A 4ZHMU 4JZFH 1C2MA 1O2VA 1CGIE 2A2XH 3V3MA 1SGFA 3ZVEA 4Q2KA 3PV2A 1FMGA 4O03A 3UIRA 4H6TA 1ZMJA 3F6UH 3EQ0H 1UO6A 2R2WU 3SJ9A 1C2FA 3FO8D 1C2JA 1SLXB 4K8BA 2ZDLA 3NWUA 3VGCB 1AE5A 2W3IA 1C2HA 3OTPA 1GHAF 2QYIA 1AQ7A 3C27B 3A7WA 4RKJB 2J5UA 3VB5A 1N6XA 2YOLA 1GI9B 4BNRA 2PP6A 1UVOA 2ANKH 1FZZA 1BRUP 1DY9A 1C5PA 1C2GA 4U32A 2DE9A 2ZDKA 2BD8A 1L4ZA 2CXVA 2FOFA 3CS0A 1H4WA 1YCPM 1ELBA 3KIDU 1QJ1B 3SV6A 3KYGA 1W0JD 1ZGIA 1GJ8B 2ANMH 4RT0A 2D26C 3GYMA 5A0BA 1PPGE 4DJZB 1Z7KA 3BEIB 3MNCA 5C1YA 4TYDA 2SGPE 4JZEH 5HGGA 1XUIA 4FETA 4IGDA 3B8JA 2NU1E 4X2VA 5A2MH 4O97A 6LPRA 1DITH 4D76A 3NCLA 3SU2A 2CN0H 2UUFB 4ISOA 2ZDNA 3O8RA 3TH4H 1GVKB 1NO9H 2HRVA 4R8TB 2C90B 3KGPA 3U8RH 2HNTE 3M7QA 1HAXB 2CGAA 4OS2A 2CHAC 5J4SA 2OD3B 3Q3XA 3SJ8A 4CRBA 1FY5A 2AGGX 4NSVA 1KDQB 5F8XA 2ZFSA 1WUNH 3PM3A 2G5NA 4ZKRU 4D9QA 2PKAA 1TRYA 2Z3EA 1BB0B 1G3BA 2J92A 1W2KH 1A5IA 2PUXB 4GLYA 3KHVA 2BM2A 1TNJA 1G32B 3ITIA 2O8WA 3I78A 3ATMA 2BX3A 1EUFA 1WU1A 1IQNA 3SZNA 2PKSB 4FU8A 2Y6TA 3VXFH 1YM0A 1SVPA 4CBOA 2PWXA 4WMEA 4UE7H 3UR9A 3A7ZA 1SGNE 3SV7A 4AFUA 1TX7A 3FAOA 3QX5H 1LCYA 2ASUB 1NRQH 2UWPA 2PGBB 4E7RG 5A0CA 1SLWB 3K65B 3URDA 3PV5A 2XTTB 1IHTH 1HYLA 3ZZ4A 4NIXA 3F68H 3KEEA 4FVDA 1FAKH 3SHAH 1NU9A 3ZVDA 1P0SH 2UWOA 2W3KA 4AYYB 4DIIH 3DSOA 1B0EA 4ISHH 1G3DA 2ZDAH 2OQUA 4MLFB 3TGIE 1BZXE 4I8HA 3I77A 2FS9A 3H7TA 4AZ2B 2JETB 2R3YA 1RGQA 2C8XB 1ARBA 4K3JA 1P57B 2DE8A 2VU8E 1NESE 1BRAA 5EG4A 4CR5A 4IC5A 4FUBA 3LOXA 1P12E 3GY5A 2Y7ZA 2GZ9A 5DP8A 2ZFFH 3MMGA 1GBLA 1TONA 1EQ9A 2VVCA 5E0HA 5GDSH 1AB9B 4E06H 1A5GH 1ABJH 1SI5H 2ZHFH 4NGAH 3HK3B 1O3CA 2WV9A 3E8LA 1YKTA 4F55A 1O3MA 5A0AE 2XC4A 1DUAA 4OS4A 1SB1H 2B8OH 1H1BA 1TX8A 2AYWA 1YPHC 2HWLB 2NWNA 4P00A 3SI3H 1TX6A 3BTDE 2RDLA 1M9UA 2AEIH 3T5FH 1C5RA 1A5HA 1ESAA 1L1JA 1Y3WA 3P8OA 1UK3A 1XXFA 4B6EA 2NU0E 3MOCA 1BMAA 4BAHB 1Y5BT 1PQ7A 3RU4E 1D6WA 3LU9B 1CHOF 5C2ZA 1O0DH 4NFEA 2QIQA 3A7VA 1TABE 1MAYA 1DFPA 2F43B 1YLNA 2JETC 1YPKH 3RM2H 2VBCA 1W8BH 1GL1A 3EAJA 4M9FA 5EQQA 4ABIA 1E1RD 4IN1A 3P8FA 5HIYA 1V3XA 1DANH 1BMNH 3GDVA 1FY4A 1D3QB 1YPHE 2FX4A 1E38B 3RXGA 1S6HA 1EB1H 2SGEE 3OEED 3ZZBA 1Y3YA 4X0WU 1O31A 5EQSA 1MD8A 1GI7B 1XKBC 3FP7E 5EXLA 2WPLS 3SW2B 1DM4B 2FXRA 5C5NA 5FPSA 3P8GA 3QWCH 3BTHE 2STAE 1ZMNA 1ELDE 4CBNA 2CF9H 8GCHF 1RTLA 2Y81A 1GHXH 3VB4A 1EX3A 1GJDB 2RFKC 1VGCC 2ZFTA 1C2EA 1QY6A 1OWDA 2HGTH 1TMUH 5F6MA 2F4LA 3A8AA 3TH2H 1ARCA 4MVNA 1DVAH 2ZU4A 1FONA 2FMJA 4RI0A 3BG4B 3T29A 3RXEA 4X2YA 3UNRA 5L2ZH 1CO7E 4U30A 1A0JA 2ZG0H 2A7HA 2R2MB 1IQJA 1OX1A 3R3GB 1H8DH 4J1YA 5DSFA 2EY4C 2A2QH 1SMFE 3LJJA 4BAKB 2A4RA 1GL0E 1AKSA 2WV5A 4AG1A 5FAHA 4Y11E 2HOBA 1C1RA 1XXDA 1T8OA 5FPTA 4UEHH 3RXRA 1DPOA 3SU3A 3L6PA 2KX4A 4XRNA 1Y59T 4ESTE 1E1QD 4YOJA 4HFPB 1C2LA 2B5TB 2L74A 1T8LA 4UD9H 3MU5A 5GNDA 2TPIZ 1OYTH 4AGJA 1K1LA 3DFJA 3BEFB 1V2VT 4MPVA 3A85A 2GV7A 1NZQH 2A0QB 2VGCC 2CJIA 2AHME 2OQ5A 2QN5T 5FBIA 3S9AA 1EATA 1KXFA 1QBVH 3NPSA 5LPEA 1Z8JB 2GKVE 2P16A 3K2UA 5CE1A 3H7OA 5K7RA 5EW1H 2XBYA 2GT8A 3BF6H 2FS8A 1O5BB 1FQ3A 1VJAU 2FZZA 3LJOA 1VITG 4XBDA 4CR9A 3RXOA 3TK9A 1MMJN 3SJIA 3TK6A 1O35A 3ZVBA 5IK2D 1BITA 3KQ5A 1G37A 1A0LA 4OS6A 4UFDH 4ZKNU 3IG6B 6CHAB 3NUMA 1MTWA 1RXPA 1FNIA 2GDEH 4YOIA 2A5AA 2B7DH 5KEDA 1H8HD 1KXAA 1SHYA 1G30B 2EEKA 2QY0B 1O2PA 1LHGH 3H09A 3VG8A 3MO3A 2NU2E 1HAGE 3UPEA 3ZV8A 2OLGA 4AB8A 1QGFA 3W1EA 1UCYK 2OXSA 1SGDE 2XXLA 2W5EA 1L1NA 1F92A 2F9NA 1FX0B 2PKAB 4AGKA 3D65E 3SNEA 1BTZA 3SZEA 4JZDH 2SGFE 1QL7A 1A4WH 3LH3A 4NFFA 5BPEA 4IN2A 1GI6A 3AW1A 3DCLA 2BD4A 2FYQA 1V2ST 1AZZA 2LELA 1QJ6B 5K0HA 2P94A 2WSSD 1A1RA 3HPTB 5F8ZA 1CA0C 1XX9A 3MU8A 3TIUA 1NFWA 2XRCA 1C4Y2 1THSH 3LT3A 1O2OA 3A7TA 4NZQA 3RXDA 4YLQH 2BDAA 4KTUA 1SGFG 2LPRA 3SNDA 2XBWA 4DW2U 1OWKA 3QGNB 1OXGA 4Y79A 3RXVA 1O5DH 3SUEA 2G55A 4U01A 3I29A 1ZHRA 4A1XA 5L2YH 1YPMH 2FTMA 1FI8A 2QGRA 1LHDH 1GI0A 2WPIS 2FOHA 3LC3A 2F9BH 3LPRA 1DXPA 3T2NA 3ELAH 1TYNA 8KME2 5JBAS 3PTNA 3RXIA 1SGTA 2FLRH 3URCA 3ZZ7A 2OUAA 1BHXF 1ZSLA 3EYDA 1KXDA 3RM0H 1V2WT 3BTTE 2P3TB 1W0ZU 1JXPA 2QXJA 2ZFRH 4X2WA 1HCGA 1HPGA 1OOKB 4WF8A 1EZQA 3PV4A 4Q80A 1GG6C 1PFXC 5F03A 4TWYA 4Y0YE 2XOKD 4ZCNA 2LNCA 3ZZAA 1N1LA 1SGQE 4Y7AA 1GBKA 1Z8GA 4YOGA 1GG6B 1O3BA 1C4U2 1JIRA 2TRMA 3MH7A 1COWD 1FV9A 3BTEE 5FBEA 1OWHA 2TBSA 1AFQC 2WPMS 1P2IA 1SFQB 3BTME 3OEHD 3TNSA 4X8SH 7ESTE 3Q3YA 4VGCB 1OWIA 3S7HB 3DUXH 5EOKA 1GMCG 3SHCH 4AFSA 1VCPA 4Z6AH 1ZYOA 1G3CA 1QZ8A 1ZMLA 1O2JA 3BV9B 5DN6D 3K6ZA 1HAVA 1XKAC 2H9HA 4A1TA 3GDUA 2SFAA 2K0QA 1T4UH 1MBQA 1TPOA 2YMSC 1CQQA 5HIZA 1X7AC 3SUDA 1OP2A 4WH8A 3RLWH 5I25A 2Z94A 1SKYE 1ZSKA 1IQFA 4THNH 3SJOA 1GJ7B 3BIVH 2J98A 2WYGA 3QN7A 4B6FA 1KLJH 1BMMH 1INCA 1AN1E 1GJCB 1C5ZB 1L1GA 1P11E 1Z1JA 2VNTA 4KP0A 3N7OA 4IC6A 4UFEH 3U28C 1KTSB 2WHXA 3DA9B 2BQ7B 3ZZDA 2P8OC 2GTBA 4OM9A 2QV1A 4IW4E 1UVSH 1O3EA 3RC4A 1J8AA 4TSFD 3E90B 1H8IH 3RLYH 2FYRA 1GHAG 1NRPH 5TCAA 2LP6A 3GYLB 3LH1A 1BJUA 4ISLA 3L33A 1QR3E 2QF3A 3VGCC 1XUFA 1F5LA 1GJ4H 1DWCH 1Z6JH 3TJOA 5DP7A 3GISB 3GCHB 1RTFB 4GCHF 3MH5A 2SGQE 4Q7YA 4Y7BA 4HI3A 3QUMP 4ZKSU 1GHBF 1ZLRA 2Y5FA 1P9UA 1C5YB 1TE0A 1KXCA 5FCKA 1GBFA 1CHOG 1C1PA 1PPBH 4WJG2 2ZTZA 1GHWH 2Y5HA 1PYTC 3SJKA 1PYTD 1TNLA 3AW0A 3F2HA 1MU8B 3EA8A 1O5AB 2V7QD 2VIVA 2HLDD 2VB0A 1HJ8A 1XUJA 2PR3A 1HAVB 1SGYE 4B73A 1O38A 1P03A 1GMCF 5E2OA 4FUGA 1WQSA 4ABAA 2ESTE 1C5LH 4OGYA 3SNBA 1NRNH 2UUKB 1UTLM 1BTHH 3GS9A 1SLVB 3F0OA 1D6RA 3ZZ5A 1SLUB 1TPSA 3ZYDA 1GJ6A 1LPZB 3ATWA 3PMHB 4K69A 3MWIU 4I8JA 3GY2A 4AYVB 2ZGCA 4BTUB 2XCFA 4FXGH 3UY9A 1UK2A 5GXPA 3PB1E 9LPRA 2B9LA 1AUTC 2GCHF 1AHTH 1V2NT 1UTNA 3MHWU 4B75A 2ZU1A 1DT2A 1V2LT 2V3HH 1UVTH 2XC5A 4IS5A 4ZHAA 1Z8RA 1TNIA 3RXCA 3VEQB 1B7XB 5HM2A 1GWAA 3E16B 2ZGJA 2G4TA 4WXVA 1AFEH 3PYHA 3M36A 2G4UA 3VB3A 1C1TA 4AFQA 1C1MA 2J4IA 5FPYA 1FLEE 1O3DA 3E1XB 2GZ7A 3BTWE 4GCHG 1UTQA 2Y82A 4WMFA 4ABGA 2SGAA 4K2YA 7GCHG 3ATIA 2ZU5A 1NT1A 1F0RA 1K21H 1IOEA 1J15A 4NZLA 4INHA 4DG4A 2FO9A 3Q76A 1WAYB 1GMHG 2JDID 4Y8ZA 2G51A 2BOHB 3ZVAA 2FX6A 1QCPA 1MKWH 1BOQA 1C4V2 1D4PB 1EP5A 4LOYH 1AVXA 3OSYA 4ASHA 1QRXA 2C8WB 3E3TA 1UW7A 1LVYA 2GGVB 1PPCE 1O2TA 1TNGA 1KLTA 4BAMB 3F2FA 1DWDH 3S69A 1QB9A 2ZWLH 1GDUA 5T1VA 4NIWA 1LVBA 3KCGH 3VB6A 1O5CB 4DOQA 3A83A 4JK6A 1B5GH 1HAZB 5DPAA 4X1QU 1ZRKA 2RG3A 5C17A 4WWYA 1EASA 1WDIA 2OBQA 3ATLA 3SORA 2H1UA 4YTAA 1BBRE 4ZUHA 3A8BA 1P10A 4JYVH 1HAIH 3QZQA 1HIAB 1UK4A 1H9IE 1C5SA 1WOFA 3OAAD 2BDYA 3KNXA 1HUTH 1KXEA 1E0FD 2Q6GA 1PPFE 1ANCA 5JBBS 1EKBB 1GVZA 1FPCH 1S0RA 5DP6A 1GBCA 3U9AH 4R0IA 2R0LA 5JBCS 1DUEA 1DWEH 4MPUA 1D9IA 3TK5A 4XBCA 5A8XA 1UJ1A 5AVDA 3AAVA 1MZDA 2FI3E 4ZAEA 1MTUA 1QB6A 1THPB 2W6ID 1DLEA 2OP9A 4LZ4B 3GY4A 1PJPA 3ZZ6A 3G01A 3UUZA 3TVJB 3BIUH 1DXWA 3T26A 3E0PB 4YZUA 2XCNA 1LHFH 4Y10E 1ID5H 1GBBA 3QZRA 1PPEE 4ZHLU 3OYPA 5SGAE 1O2RA 1GGDC 1ELEE 2EA3A 1ANBA 3N7DA 4TT3D 3U1IB 1P2OA 1W11U 3ZZCA 1MH0A 3RP2A 1LKAA 3EA9A 1Q31A 3ZVCA 1BIOA 2BVXH 3MH6A 4X8TH 1C1WH 1WQVH 3QGJA 1O36A 1Z8IB 3MYWA 4ISIH 5B6LA 4J2YB 9ESTA 4FUEA 2EQNA 1TRMA 3ZZ3A 4JZ1A 2FOGA 1AVGH 2G81E 4OS5A 1NPMA 2GJGA 4X8VH 1YCPH 2G5VA 3RXBA 3K6YA 1P06A 2G8TA 1O3JA 3RXMA 1V2MT 1GCTC 1GI8B 1C2DA 4A7IB 4AC9A 3N99A 2AERH 3SGBE 4D7FA 3BSQA 4WY3A 2M5TA 3GCOA 1B0FA 4ABDA 2KCOA 1S81A 1S82A 1O2QA 3ODDA 5DKMA 5AF9H 1O2XA 2QCYA 5AFYH 1O3HA 3U8OH 1WXRA 1L4DA 1C5VA 1YLCA 1KYNA 1VKYA 1V6DA 5LPRA 1RIWB 3DHKH 2YMSB 3Q77A 5B6OA 3A81A 2IN2A 2V35A 2OK5A 1HJAB 1P2MA 1MQ6A 2AIQA 1ETTH 1QRWA 5LGOA 5LPFA 2KAIA 2FESH 1ZZZA 1F5KU 2JIZD 6GCHG 1DLKB 1SGEE 1SGPE 2R3UA 4YXWD 4KGAA 3ZIAD 3OU0A 2W6JD 4DT4A 2GD4B 1V2RT 4X1NU 1GVLA 1QFKH 1WBGB 2PUQH 4XSKU 1IAUA 1DE7H 2ZI2H 2VIWA 1WYKA 1CVWH 1QQUA 2J2UA 2J38A 1TBRH 3M61U 4O9VA 1DOJA 1C5TA 2O9QA 1C5WB 1EZUC 1UTMA 2J94A 1OHHD 1SQTA 3QK1A 4B1TA 4U2WA 3U98H 2BXUH 1HAHH 5EIYA 4K60A 1GHBG 1BMFD 5CHAB 4CREA 1VR1H 1BDAA 3UOPA 1K0HA 1RJXB 2AGEX 1ELFA 1GBTA 3BTGE 5FX6A 1LQEA 1O2KA 4B2AA 1DSTA 1RIWC 2QC2A 1TFXA 1VITH 1EOJA 4ZXYH 3DD2H 4BAQB 4XOJA 2BYAX 1F7ZA 2P93A 1EP6A 2AMDA 3RXHA 2BY8X 1G36A 2AMPA 4SGBE 2P95A 2PV9B 1O2MA 3MNBA 2IJD1 2Q1JA 2ZIQH 1Z71A 3MFJA 4YLUA 4RKOB 1T8NA 4JZIA 1O39A 3A7YA 3BN9A 5KECA 3UQVA 2IJOB 5A8ZA 1S6LA 1OPHB 4NIYA 2FI4E 3L3TA 2JJ1D 1J9CH 1A0HB 2K8IA 1XVMA 3B23B 3MU0A 4WH6A 1EPTB 2Y7XA 5EXMA 2FDAA 1TALA 5T3HA 1YGCH 1EJNA 1O3NA 4Y0ZE 5TJXA 1NN6A 1CT0E 5CDFE 5L6NH 1LQDB 5DP4A 2KCAA 3RXAA 1LHCH 4I33A 1Q3XA 2XWAA 1GBAA 5PTPA 1J16A 1T7CA 2D1JA 4ZKOU 4CRDA 3M5NA 1LVMA 3E6PH 1MKWK 4QT8C 1WTGH 2Z3DA 1GPZA 1TAWA 1E37B 1NY22 1TA6A 1YF4A 1TGCA 4AFZA 2H9EH 1FXYA 5DO4H 1HV7A 4OS7A 4BTIB 4Y71A 4I8GA 1A2CH 3EGKH 3SQHE 2P3UB 4NCYA 1O32A 1C1VH 3RUOA 4I86A 4A6LA 3LDXH 3KYFA 4LZ1H 2VH6A 3M7UA 1C5QA 5E8EH 3ESTA 1QL9A 2Q6DA 3UFAA 1IQMA 5EXNA 3QTVH 1WCZA 5FCRA 2WZQA 4X6OA 3STJA 2ILNA 2P59A 3PMBB 3HATH 1CBWC 2G00A 4IBLH 3AVZA 2ODPA 4NIVA 1SQRA 2A4QA 4MG3A 4LK4A 4XD7D 4AX9H 1BQYA 1C9TA 4K1EA 3CS7A 1P01A 3U69H 3WWBA 3ZV9A 1SGCA 3UTUH 2O8LA 3MI4A 2V3OH 3GDSA 3K9XB 1K1OA 1AGJA 3QDZB 1ZRBA 2GMTC 5EJZA 4B2BA 1TGNA 1KDQA 1FN6A 5C20A 1ESTA 2XNIA 5I46H 1BTXA 3RXFA 1YLDA 1HNEE 4DURA 2ZPRA 2ZU3A 1GBJA 2ODQA 3RXTA 3UB0A 2FODA 3SOSA 1UTJA 1HJ9A 3ODFA 1L2EA 1EZSC 3BG4C 3U8TH 1E34B 4Y8XA 1TGBA 2A31A 1K22H 2XBVA 4DVAU 4GPGA 1AUJA 4H42U 2UUJB 2HNTF 1C1QA 1HXFH 3TJNA 2JKHA 1NFUA 1H9LB 1O2HA 4GUXA 5IYTA 2ZU2A 2H9TH 4CRAA 4UFFH 1G3EA 2TGDA 2D8WA 2H5CA 3JZ2B 3RMLH 3F9GA 2QE7D 5FX5A 2FOEA 1S0QA 3PLPA 1ESBA 2A1DB 5CHBA 4I7YH 3MH4A 1SPJA 3PLBA 2ZTYA 2HNTC 3D62A 2FOMB 3RXPA 3T27A 4FUCA 2FOBA 1O5EH 5GJ4B 2RDEA 3M3VA 1CE5A 2XWBI 3SGAE 2FP7B 1AU8A 2GT7A 2VH0A 3O8CA 1CHGA 2ZP0H 2EI7A 4D8NA 1TMBH 4FUDA 1GDNA 1O33A 3F1SB 2QXHA 4KELA 3SN8A 5KGOA 1CT2E 2GVFA 3MU1A 4I8KA 2F9PA 1N8OC 1TQ7B 1ANEA 1RRKA 2XYAA 1O5FH 3DFLA 2Z9IA 1T32A 2BXTH 3AASA 2BY9X 2BDCA 3R0FA 1RFNA 3SGQE 3ATKA 1ZR0A 1MAXA 2GDDA 1F5RA 3M5OA 4NSYA 2H6MA 2SNWA 3SYJA 3P6ZB 1A46H 2TGTA 1LDTT 1O3LA 4ACBA 3DT0H 1VCWA 2BLVA 1UHBB 1EJMA 1H8ED 1EZXC 1LHEH 1LO6A 2BQ6B 3FOAA 1K1IA 1O2YA 1SL3A 3LONA 3T28A 3WY8A 2CMYA 3TGJE 1A61H 1E35B 4ISNA 4FUHA 1P04A 3KF2A 3GY3A 1HGTH 2WPHS 5JB9S 4MNVA 5EU8A 1C5MD 1NM6A 1ABIH 2KZ4A 2A5IA 1GBHA 5DJ7A 4CH2B 5ABWA 4B74A 2KCYA 1TPPA 3M3SA 1ZTJA 4Z0KA 1KTTB 3LC5A 5EQRA 6GCHF 4MQAA 2BDGA 3EA7A 1N6YA 1W7XH 4KTSA 2WUCA 2O8MA 2VJ1A 2ZHDA 2FWWA 1N8OB 2BY5X 4WVPE 3UR6A 3ZZ8A 3SV9A 1FUJA 3TITA 1LPGB 1O2LA 2UWLA 1OSSA 3OFND 2JH5D 2EC9H 1AIXH 3PO1C 1RS0A 2BD3A 1SQAA 2QF5A 2J34A 2J98B 1ORFA 1TGTA 1ETSH 2K1QA 1LKBA 1WV7H 2VIPA 4X1RU 1VITF 1NC6A 3A89A 1F0SA 2BDHA 3RMMH 4DT7B 1QNJA 1QHRB 3V12A 2J97A 4Y76A 4BANB 2OINA 1BA8B 2A7CA 1W13U 4JYTA 4ZROA 4RSPA 1AWFH 1A3EH 2C93B 2GCTC 2WPKS 2FLBH 1O3KA 3OX7U 1C5NH 5ESTE 2Z7FE 2WINI 4GSOA 1YPGH 1GI3A 4HZHA 3MO6A 3UNSA 5DP9A 3IWMA 3MTYA 3FKSD 4ASUD 1KLIH 3A7XA 2STBE 1O2SA 5FL7D 1HAYB 1MABB 4A92A 1IQGA 4CRCA 1D3PB 1FDPA 3TPIZ 1NBME 1TMTH 1V2UT 1NRRH 1ZJKA 1PPHE 2PSYA 2GX4A 3MNSA 2Z9KA 3F9HA 3ZVFA 1C1NA 4X1PU 1JRTA 1QL8A 1TOCB 3F0PA 3GY7A 3MNXA 2ALPA 3FP8E 3GOVB 3UREA 1HAOH 1OWJA 1GJ9B 1YPEH 1O3GA 4OS1A 2JJ2D 2OC8A 1A3BH 1MCVA 2ODYB 2IPHA 1S85A 3U1JB 2B0FA 2BTCE 3TLOA 1QJ7B 1W12U 1HDTH 1MTVA 3RXQA 1P2JA 1BJVA 2I6QA 2BVSH 2ZFQH 1Y3VA 1YBWA 2A32A 1CA0B 1XM1A 1AMHA 3KN2A 1EB2A 1TLDA 4A1VA 3FP6E 5JDUB 1V2JT 1K2I1 1EAUA 1UTKA 2KM0A 3QO6A 1MCTA 1TPAE 4PROA 3M3TA 2PLXA 1MTNC 1XUKA 1JOUB 1AI8H 1W7GH 1W10U 2BY6X 2CF8H 3KQBA 1A7SA 2ZHQH 2XC0A 3GCHC 4YESB 2WUBA 5DG6A 1MKXK 2CV3A 2AIPA 5A8YA 4WMDA 1GMDF 1MTSA 1RTKA 3TJVA 5C1XA 1VJ9U 1OYQA 1S84A 2QXIA 4P02A 5F8TA 5A09A 3UAIC 1BMLA 4ZMAH 1QB1A 3UQOA 1FPHH 1Q2WA 2BZ6H 2BD7A 4GVUA 1GJ5H 1NS3A 1SFIA 1EAIA 1K1JA 1ZTKA 3WW7A 1HB0B 2OTVA 1KSNA 3LIWA 1C1UH 2FOCA 5BRRE 4X6NA 1O2UA 2PGQB 1C1SA 2VVUA 1ELAA 2OC0A 4ABEA 1MU6B 4Q7ZA 1SBWA 3HGNA 3Q3KA 1BRCE 1JWTA 1BTYA 2HLCA 1O34A 1Y3XA 2QF4A 2F9OA 2GMTB 3SU5A 2ZTXA 1S6FA 4OGXA 4NA8A 2OC7A 4NWLA 2FI5E 7KMEH 1CA8B 3LKWA 5J4QA 3IITA 1PQ5A 1CSOE 2EI6A 4UONA 1O3IA 1GBIA 4JK5A 4M7GA 3E91A 2FPZA 3SUGA 3PWCA 4X1SU 1P2KA 1NBMD 3AAUA 4YT6H 2BZAA 2Y80A 3PMAB 2ANWA 4AB9A 2HALA 2J9NA 1O2IA 1OWEA 2FEQH 2OBOA 2PTCE 4ZH8A 3RC5A 3UWIA 2BD9A 2ZA5A 4Z1MD 3LGUA 4IMZA 1S83A 2GP9B 2F83A 3TH3H 4KTCA 1DY8A 1GMDG 1BTWA 2KFWA 4K8YA 1OP0A 2F9UA 4MNXA 1SR5C 3HKIB 1DS2E 1P09A 5C0TA 1UMAH 1DX5M 3MU4A 3KQCA 3VFEA 3SNCA 1FY1A 2A5KA 2ZEBA 1Z1IA 1TBZH 2ZGXH 2P8OB 2RA3A 2BVRH 2YMSD 1ZJDA 1TQ0B 3SU0A 2AH4X 1W3CA 3M5MA 3RXKA 3GCNA 2GCHG 3P92A 4GAWA 4CRGA 5ESBA 2NU3E 1YCPK 4ZXXH 2PHBA 2VIDA 1GBMA 3LGVA 3O8BA 2V6NA 4KKDA 3SU1A 1XUHA 1GI1A 2BDBA 1ELCA 2PTNA 5CHAC 1V2KT 4FOUC 5E0JA 1W0KD 1HRTH 4YO9A 1C5UA 1T4VH 1TRNA 2CHAB 2AGIX 2ZECA 4MPXA 3BTFE 5HKKD 2C4FH 2UUYA 1FN8A 1UTPA 2BQWB 3F2GA 4TPYA 2HVXA 1C2IA 4B2CA 3BTQE 2PSXA 4BAOB 1ZGVA 3QLPH 3M7TA 1Y8TA 2V3MA 2BD2A 2SGDE 1P8VC 3A8CA 3A88A 2RCEA 1J14A 4RN6A 3A87A 1BHXB 4MNYA 4ABJA 4E7NA 1MKXH 1QQ4A 2ZZUH 1TNKA 1JBUH 1GHZA 5T6FA 1EPTC 1XUGA 1CBWB 3F9EA 5EGMA 4B76A 1JMOH 1MUEB 1OP8A 5GCHG 2F9VA 4Y6DA 5EJLA 3A86A 3KQEA 5G4BA 4BXWA 1F0UA 2AFQB 3FFGA 2ZQ1A 1YYY1 4K1SA 1GJAB 1G2LA 2W26A 3OY5U 1YC0A 2Z3CA 5GWZA 1KIGH 5E0GA 2VIQA 1S5SA 1IQEA 3UWJH 3S9BA 5HM9A 2BD5A 4I8LA 1XVOA 1BBRK 1QA0A 1QRZA 1VCQA 2VINA 5JBTA 1DSUA 2ULLA 2IOTA 2KAIB 3PTBA 3FANA 3RXLA 2XNDD 2C3SA 1LMWB 4HGCA 5EJ1A 2BLQA 1HAPH 3SNAA 4E05H 2VIOA 3NZIA 1BCUH 2IPQX 4FUIA 1QA7A 1SSXA 1SG8B 2WYJA 1E36B 3HKJB 1ELTA 5AFZH 4CRFA 3V7TA 2ZF0H 1GBDA 2AMQA 2FOAA 3SBKA 2Q6FA 4O3TA 4F48B 1UCYH 1PQ8A 4UDWH 4XDEA 3LGYA 1EAWA 2DUCA 3ZYEA 4NA9H 4B71A 1MTNB 1NU7B 3HGPA 3P8NA 4JYUH 2BLWA 3EDXB 1DDJA 3LGWA 2WV4A 4DGJA 4F4OC 6ESTA 1C9PA 1H9HE 3EE0B 1ZOMA 4AORA 2FTLE 3M37A 2ZCKP 2ZQ2A 2F3CE 4NG9H 4CH8B 3VB7A 1RD3B 1LVOA 1EJAA 1GCDA 1IQIA 4INLA 1P02A 3BEUA 3PWBA 2PW8H 1C1OA 1CGHA 2WPJS 4TY6A 1KMHB 4Y8YA 4ABFA 3SU6A 4FU7A 3S0NA 4FVBA 3VXEH 5GCHF 2QAAA 2BOKA 1AY6H 1QTFA 1K1PA 1P3CA 3E0NB 3STIA 5JPMH 5E2PA 2BX4A 3RXJA 4BTTB 1SGIB 1UVUH 1NROH 1V2QT 3A84A 4CHAB 3S7KB 4HTCH 1TA2A 2ZDMA 4DIHH 1HFDA 2QF0A 1BTPA 5L30H 5EPNA 1GMHF
chains in the Genus database with same CATH topology
4MPWA 5DP3A 1AVWA 3KL6A 1NFXA 2TGAA 2QA9E 1P05A 1BTUA 1UHBA 1ZHMA 2F91A 2XW9A 5AHGH 1FIZA 3ENSB 1CGJE 4GHQA 5DP5A 1SHHB 1V2PT 1O30A 2VWLA 2BLOA 1SOTA 2GV6A 1SOZA 3Q00A 4DCDA 3FZDA 3RDZA 3V13A 1MBMA 4YM9A 4H4FA 4IMQA 3PMJA 4LXBH 1VGCB 1YPLH 5EODA 2NU4E 2A7JA 5GPIB 1O2WA 5C67A 1P9SA 2BB4A 1NTPA 1XMNB 3H5CB 5JB8S 3T25A 2JH6D 3GY8A 1GI2A 1ZPCA 1LPKB 4X6MA 1QBNA 3B9FH 2SNVA 4D7GA 2VVVA 1AKSB 1SGRE 4MTBA 4XBBA 5HXFA 1K9OE 5C3NA 2HPQH 3LGTA 1O2GH 1AFQB 2JH0D 1WTHD 4XE4A 3RU4D 2ZHEH 2G52A 1MQ5A 2R9PA 5FXLA 3TU7H 1ELGA 1NFYA 1AD8H 2ZCHP 1FIWA 2H5DA 5EW2H 1Y5AT 2TGPZ 2BY7X 1G2MA 1TOMH 1HBTH 1U6QA 4ABBA 1G9IE 3PO1B 4A5TS 2ZHWH 4NWKA 4YT7H 7LPRA 3C1KA 2I6SA 1ACBE 4FU9A 1ANDA 4JMYA 1TGSZ 3KQDA 5FHTA 3GCTF 1FY3A 5LH8A 2D2DA 2Y5GA 2VGCB 1HLTH 5ETXA 2O8UA 1K28D 1O3PB 1SQOA 4NA7A 2A4OA 1KXBA 2HPPH 1T31A 2VWMA 4Q7XA 2Z6BD 1GBEA 2Z9GA 1P2QA 5GIBA 3T62A 3M35A 1O2ZA 1ETRH 3W95A 2W7UA 1EPTA 6CHAC 2ZGHA 3RU4T 4AG2A 5TCCA 2YNAA 3LGIA 1C2KA 5IDKA 3PROA 1V2TT 3RC6A 2ZFPH 1L0ZA 1MZAA 1SC8U 3FZZA 2ZNKH 4UFGH 1TB6H 4ABHA 2THFB 4TPIZ 2VWOA 5T6DA 1D3DB 1JIMA 1QURH 4I31A 1MD7A 2XBXA 2VWNA 2ZPQA 1BT7A 2GZ8A 3TGKE 1YP9A 2J95A 1UVPA 8LPRA 1JRSA 4WXIA 3ZZ9A 3P70B 1C5XB 5EPYA 4X2XA 3BTKE 1W14U 2ZKSA 1UTOA 3SU4A 1AO5A 1HIAA 4FUJA 1F0TA 1V2OT 4MDSA 1AE8H 2AS9A 1J17T 2C8YB 1TWXB 1CU1A 1O2NA 2PKSC 4X6PA 2W7SA 3OTJE 2BHGA 3SV2H 1O5GH 1QBOA 4D9RA 1GI5A 1D3TB 2A4GA 4INKA 1TBQH 2Z9LA 3CP7A 1THRH 1EAXA 3FVFB 4GHTA 4I32A 4BXSA 4JCNA 2ANYA 1O3AA 3V0XA 3SUFA 1Y5UT 4MNWA 1UCYE 8ESTE 1NRSH 1P3EA 2BDIA 3UNQA 1TIOA 2QXGA 3W94A 4XFQA 1OKXA 1YPJH 2ZDVH 4H6SB 3QTOH 3JZ1B 3ZVGA 5HYOA 4VGCC 1P2NA 3RMNH 1ZHPA 1ZTLA 4K5ZA 1IQLA 3MO9A 1GJBB 3HK6B 2ALVA 4AN7A 1AWHB 1FAXA 1Z6EA 2RA0A 5T6GA 2C8ZB 1GHYH 1O37A 3OY6U 1BBRH 2A45B 1ZPBA 1BUIA 1ZSJA 1EOLA 3F9FA 5DK1A 3GY6A 1ZPZA 4CHAC 2R0KA 1VZQH 4X8UH 1C5OH 1Y3UA 3UOUA 4O3UA 1GHVH 7GCHF 3S9CA 3PLKA 1PPZA 1IHSH 1K1MA 5DGJA 5C5OA 1IQKA 3BG8A 2OCVB 1DWBH 4TY7A 1AZ8A 1ELVA 1F2SE 2GCTB 3TJUA 3O8DA 3CENA 1GDQA 1KY9A 3GICB 1PQAA 2H2ZA 4DY7B 2YNBA 3NK8A 1K1NA 3A80A 3RXSA 1GCTB 2Z9JA 1T8MA 3D49H 2O8TA 3VPKA 1LTOA 1HXEH 8GCHG 4FUFA 2ZGBH 3D23A 2ZC9H 4F49A 2TIOA 3A82A 4TWWA 3A8DA 1BRBE 3NXPA 5JYIA 2ZO3H 1DICA 2FIRH 3P95A 1GI4A 2BMGB 1CT4E 2ZPSA 4K1TA 1TNHA 2FM2A 3NKKA 1FY8E 1AB9C 2PFEA 5CMXH 1WSSH 3TNTA 4AOQA 3RMOH 1GGDB 1FJSA 1HJAC 2ZCLP 3RXUA 2V0BA 3SI4H 3SQEE 3GCTG 1IQHA 2OC1A 1EXFA 3P17H 4BOHA 1OS8A 1QIXB 1O3OA 2P3FH 2EI8A 3M5LA 1O3FA 1W0YH 4SGAE 5HMAA 3SO3A 5C1UA 5H4IB 3SV8A 4ZHMU 4JZFH 1C2MA 1O2VA 1CGIE 2A2XH 3V3MA 1SGFA 3ZVEA 4Q2KA 1FMGA 4O03A 3UIRA 4H6TA 1ZMJA 3F6UH 3EQ0H 1UO6A 2R2WU 3SJ9A 1C2FA 1C2JA 1SLXB 4K8BA 2ZDLA 3NWUA 3VGCB 1AE5A 2W3IA 1C2HA 1GHAF 2QYIA 1AQ7A 3C27B 3A7WA 4RKJB 3VB5A 1N6XA 2YOLA 1GI9B 4BNRA 1UVOA 2ANKH 1FZZA 1BRUP 1DY9A 1C5PA 1C2GA 4U32A 2DE9A 2ZDKA 2BD8A 1L4ZA 2CXVA 2FOFA 3CS0A 1H4WA 1YCPM 1ELBA 3KIDU 1QJ1B 3SV6A 1ZGIA 1GJ8B 2ANMH 2D26C 3GYMA 5A0BA 1PPGE 4DJZB 1Z7KA 3BEIB 3MNCA 5C1YA 4TYDA 2SGPE 4JZEH 5HGGA 1XUIA 4IGDA 3B8JA 2NU1E 4X2VA 5A2MH 4O97A 6LPRA 1DITH 4D76A 3NCLA 3SU2A 2CN0H 2UUFB 4ISOA 2ZDNA 3O8RA 3TH4H 1GVKB 1NO9H 2HRVA 4R8TB 2C90B 3KGPA 3U8RH 2HNTE 3M7QA 1HAXB 2CGAA 4OS2A 2CHAC 5J4SA 2OD3B 3Q3XA 3SJ8A 4CRBA 1FY5A 2AGGX 4NSVA 1KDQB 5F8XA 2ZFSA 1WUNH 3PM3A 2G5NA 4ZKRU 4D9QA 2PKAA 1TRYA 2Z3EA 1BB0B 1G3BA 2J92A 1W2KH 1A5IA 2PUXB 4GLYA 3KHVA 2BM2A 1TNJA 1G32B 3ITIA 2O8WA 3I78A 3ATMA 2BX3A 1EUFA 1WU1A 1IQNA 3SZNA 2PKSB 4FU8A 2Y6TA 3VXFH 1YM0A 1SVPA 4CBOA 2PWXA 4WMEA 4UE7H 3UR9A 3A7ZA 1SGNE 3SV7A 4AFUA 1TX7A 3FAOA 3QX5H 1LCYA 2ASUB 1NRQH 2UWPA 2PGBB 4E7RG 5A0CA 1SLWB 3K65B 3URDA 2XTTB 1IHTH 1HYLA 3ZZ4A 4NIXA 3F68H 3KEEA 4FVDA 1FAKH 3SHAH 1NU9A 3ZVDA 1P0SH 2UWOA 2W3KA 4AYYB 4DIIH 1B0EA 4ISHH 1G3DA 2ZDAH 2OQUA 4MLFB 3TGIE 1BZXE 4I8HA 3I77A 2FS9A 3H7TA 4AZ2B 2JETB 2R3YA 1RGQA 2C8XB 1ARBA 4K3JA 1P57B 2DE8A 2VU8E 1NESE 1BRAA 5EG4A 4CR5A 4IC5A 4FUBA 3LOXA 1P12E 3GY5A 2Y7ZA 2GZ9A 5DP8A 2ZFFH 3MMGA 1GBLA 1TONA 1EQ9A 2VVCA 5E0HA 5GDSH 1AB9B 4E06H 1A5GH 1ABJH 1SI5H 2ZHFH 4NGAH 3HK3B 1O3CA 3E8LA 1YKTA 1O3MA 5A0AE 2XC4A 1DUAA 4OS4A 1SB1H 2B8OH 1H1BA 1TX8A 2AYWA 1YPHC 2HWLB 2NWNA 3SI3H 1TX6A 3BTDE 2RDLA 1M9UA 2AEIH 3T5FH 1C5RA 1A5HA 1ESAA 1L1JA 1Y3WA 3P8OA 1UK3A 1XXFA 2NU0E 3MOCA 1BMAA 4BAHB 1Y5BT 1PQ7A 3RU4E 1D6WA 3LU9B 1CHOF 5C2ZA 1O0DH 4NFEA 2QIQA 3A7VA 1TABE 1MAYA 1DFPA 2JETC 1YPKH 3RM2H 1W8BH 1GL1A 3EAJA 5EQQA 4ABIA 4IN1A 3P8FA 1V3XA 1DANH 1BMNH 3GDVA 1FY4A 1D3QB 1YPHE 2FX4A 1E38B 3RXGA 1S6HA 1EB1H 2SGEE 3ZZBA 1Y3YA 4X0WU 1O31A 5EQSA 1MD8A 1GI7B 1XKBC 3FP7E 5EXLA 2WPLS 3SW2B 1DM4B 2FXRA 5C5NA 5FPSA 3P8GA 3QWCH 3BTHE 2STAE 1ZMNA 1ELDE 4CBNA 2CF9H 8GCHF 1RTLA 2Y81A 1GHXH 3VB4A 1EX3A 1GJDB 1VGCC 2ZFTA 1C2EA 1QY6A 1OWDA 2HGTH 1TMUH 5F6MA 3A8AA 3TH2H 1ARCA 4MVNA 1DVAH 2ZU4A 1FONA 2FMJA 3BG4B 3T29A 3RXEA 4X2YA 3UNRA 5L2ZH 1CO7E 4U30A 1A0JA 2ZG0H 2A7HA 2R2MB 1IQJA 1OX1A 3R3GB 1H8DH 4J1YA 2A2QH 1SMFE 3LJJA 4BAKB 2A4RA 1GL0E 1AKSA 2WV5A 4AG1A 5FAHA 4Y11E 2HOBA 1C1RA 1XXDA 1T8OA 5FPTA 4UEHH 3RXRA 1DPOA 3SU3A 3L6PA 1Y59T 4ESTE 4YOJA 4HFPB 1C2LA 2B5TB 1T8LA 4UD9H 3MU5A 2TPIZ 1OYTH 4AGJA 1K1LA 3DFJA 3BEFB 1V2VT 4MPVA 3A85A 2GV7A 1NZQH 2A0QB 2VGCC 2CJIA 2OQ5A 2QN5T 5FBIA 3S9AA 1EATA 1KXFA 1QBVH 3NPSA 5LPEA 1Z8JB 2GKVE 2P16A 3K2UA 5CE1A 3H7OA 5K7RA 5EW1H 2XBYA 2GT8A 3BF6H 2FS8A 1O5BB 1FQ3A 1VJAU 2FZZA 3LJOA 1VITG 4XBDA 4CR9A 3RXOA 3TK9A 1MMJN 3SJIA 3TK6A 1O35A 3ZVBA 1BITA 1G37A 1A0LA 4OS6A 4UFDH 4ZKNU 3IG6B 6CHAB 3NUMA 1MTWA 1RXPA 1FNIA 2GDEH 4YOIA 2A5AA 2B7DH 1KXAA 1SHYA 1G30B 2EEKA 2QY0B 1O2PA 1LHGH 3MO3A 2NU2E 1HAGE 3UPEA 3ZV8A 2OLGA 4AB8A 1QGFA 1UCYK 2XXLA 1SGDE 2OXSA 2W5EA 1L1NA 1F92A 2F9NA 2PKAB 4AGKA 3D65E 3SNEA 1BTZA 4JZDH 2SGFE 1QL7A 1A4WH 3LH3A 4NFFA 5BPEA 4IN2A 1GI6A 3AW1A 2BD4A 2FYQA 1V2ST 1AZZA 1QJ6B 5K0HA 2P94A 1A1RA 3HPTB 5F8ZA 1CA0C 1XX9A 3MU8A 3TIUA 1NFWA 2XRCA 1C4Y2 1THSH 3LT3A 1O2OA 3A7TA 4NZQA 3RXDA 4YLQH 2BDAA 4KTUA 1SGFG 2LPRA 3SNDA 2XBWA 4DW2U 1OWKA 3QGNB 1OXGA 4Y79A 3RXVA 1O5DH 3SUEA 2G55A 4U01A 3I29A 1ZHRA 4A1XA 5L2YH 1YPMH 2FTMA 1FI8A 2QGRA 1LHDH 1GI0A 2WPIS 2FOHA 3LC3A 2F9BH 3LPRA 1DXPA 3T2NA 3ELAH 1TYNA 8KME2 5JBAS 3PTNA 3RXIA 1SGTA 2FLRH 3URCA 3ZZ7A 2OUAA 1BHXF 1ZSLA 3EYDA 1KXDA 3RM0H 1V2WT 3BTTE 2P3TB 1W0ZU 1JXPA 2QXJA 2ZFRH 4X2WA 1HCGA 1HPGA 1OOKB 4WF8A 1EZQA 3PV4A 4Q80A 1GG6C 1PFXC 5F03A 4TWYA 4Y0YE 2LNCA 3ZZAA 1N1LA 1SGQE 4Y7AA 1GBKA 1Z8GA 4YOGA 1GG6B 1O3BA 1C4U2 1JIRA 2TRMA 3MH7A 1FV9A 3BTEE 5FBEA 1OWHA 2TBSA 1AFQC 2WPMS 1P2IA 1SFQB 3BTME 3TNSA 4X8SH 7ESTE 3Q3YA 4VGCB 1OWIA 3S7HB 3DUXH 5EOKA 1GMCG 3SHCH 4AFSA 1VCPA 4Z6AH 1ZYOA 1G3CA 1ZMLA 1O2JA 3BV9B 3K6ZA 1HAVA 1XKAC 2H9HA 4A1TA 3GDUA 2SFAA 1T4UH 1MBQA 1TPOA 1CQQA 1X7AC 3SUDA 1OP2A 4WH8A 3RLWH 5I25A 2Z94A 1ZSKA 1IQFA 4THNH 3SJOA 1GJ7B 3BIVH 2WYGA 3QN7A 1KLJH 1BMMH 1INCA 1AN1E 1GJCB 1C5ZB 1L1GA 1P11E 1Z1JA 2VNTA 4KP0A 3N7OA 4IC6A 4UFEH 1KTSB 3DA9B 2BQ7B 3ZZDA 2P8OC 2GTBA 2QV1A 4IW4E 1UVSH 1O3EA 3RC4A 1J8AA 3E90B 1H8IH 3RLYH 2FYRA 1GHAG 1NRPH 5TCAA 3GYLB 3LH1A 4ISLA 1BJUA 3L33A 1QR3E 2QF3A 3VGCC 1XUFA 1F5LA 1GJ4H 1DWCH 1Z6JH 3TJOA 5DP7A 3GISB 3GCHB 1RTFB 4GCHF 3MH5A 2SGQE 4Q7YA 4Y7BA 4HI3A 3QUMP 4ZKSU 1GHBF 1ZLRA 2Y5FA 1P9UA 1C5YB 1TE0A 1KXCA 5FCKA 1GBFA 1CHOG 1C1PA 1PPBH 4WJG2 2ZTZA 1GHWH 2Y5HA 1PYTC 3SJKA 1PYTD 1TNLA 3AW0A 1MU8B 3EA8A 1O5AB 2VIVA 2VB0A 1HJ8A 1XUJA 2PR3A 1HAVB 1SGYE 4B73A 1O38A 1P03A 1GMCF 5E2OA 4FUGA 1WQSA 4ABAA 2ESTE 1C5LH 4OGYA 3SNBA 1NRNH 2UUKB 1UTLM 1BTHH 1SLVB 1D6RA 3ZZ5A 1SLUB 1TPSA 3ZYDA 1GJ6A 1LPZB 3ATWA 3PMHB 4K69A 3MWIU 4I8JA 3GY2A 4AYVB 2ZGCA 4BTUB 2XCFA 4FXGH 3UY9A 1UK2A 5GXPA 3PB1E 9LPRA 2B9LA 1AUTC 2GCHF 1AHTH 1V2NT 1UTNA 3MHWU 4B75A 2ZU1A 1DT2A 1V2LT 2V3HH 1UVTH 2XC5A 4IS5A 4ZHAA 1Z8RA 1TNIA 3RXCA 3VEQB 1B7XB 5HM2A 1GWAA 3E16B 2ZGJA 2G4TA 4WXVA 1AFEH 3PYHA 3M36A 2G4UA 3VB3A 1C1TA 4AFQA 1C1MA 2J4IA 5FPYA 1FLEE 1O3DA 3E1XB 2GZ7A 3BTWE 4GCHG 1UTQA 2Y82A 4WMFA 4ABGA 2SGAA