3RXJA

Crystal structure of trypsin complexed with 4-guanidinobenzoic acid
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Cationic trypsin
publication title In-crystal affinity ranking of fragment hit compounds reveals a relationship with their inhibitory activities
doi rcsb
total genus 57
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2011-05-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxjA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3rxjA02
5FCKA 4FXGH 3EQ0H 5EU8A 3S9CA 1F5LA 2R2MB 1W11U 3FAOA 1TX8A 3R3GB 1C5QA 3M5OA 1YCPM 3GY4A 1HUTH 1TNLA 4ZMAH 4FUCA 1RFNA 1T8NA 4X1NU 5FAHA 1CGJE 3ZYDA 3ODFA 3AAVA 3UWIA 2V3HH 1NS3A 1NT1A 1BRUP 3U1JB 3GY5A 3GY3A 2ZDNA 3LGIA 5HMAA 5J4SA 2BLOA 3RLWH 1MCTA 2WPKS 2J2UA 2VIWA 1P05A 3BTHE 2XBVA 3PWBA 4Z0KA 1GJ5H 1SR5C 2Z9IA 4CHAB 1IHTH 4R8TB 1E37B 8KME2 2BQ6B 1GMCG 1MTVA 1FNIA 1TNJA 4ISHH 1TBQH 3IWMA 4HI3A 1VJAU 2OUAA 2SGQE 3FANA 4IC5A 5GXPA 1Z71A 1YPJH 1AKSB 4B76A 3QWCH 5AF9H 4JMYA 3S69A 1LDTT 4BAOB 1O3DA 5L6NH 1ACBE 1OWJA 1YPLH 3BSQA 1P9SA 1ARBA 2GKVE 2OINA 2BOKA 1O2NA 1MH0A 1XVOA 2ZHFH 3QGJA 3NWUA 2ZF0H 3VXEH 5JB8S 1O3EA 2G81E 1Q3XA 1BMMH 2CJIA 1ZR0A 4JYUH 1IQJA 2UUJB 1MU8B 1MAYA 1ESBA 4GSOA 5K0HA 5E0GA 2EA3A 1Y8TA 1GJDB 5E2OA 1C5LH 1WV7H 3RMMH 4ABAA 1MZAA 1CU1A 3G01A 3A83A 3TPIZ 1AVWA 2ZNKH 2SGDE 1DS2E 2Q6FA 4Y8XA 3UQOA 1QBVH 1W0ZU 8ESTE 3Q3XA 3VGCC 3IITA 1BA8B 4RSPA 1TOMH 1MKXH 2C8YB 1PFXC 1D3TB 4U32A 1QL8A 2VVCA 1G3CA 1O34A 2CGAA 1SGCA 3GY2A 4SGBE 1GCDA 1GMDG 2R0LA 3L33A 3MNBA 1SFQB 2AIPA 1GMHF 2ZO3H 1EPTC 2HNTC 1HDTH 1MTWA 2NU1E 1O3PB 1EZXC 1XUJA 2FOAA 1P2OA 3A84A 4TPIZ 3M3SA 5A8YA 1HCGA 3I78A 1V2ST 3PROA 6GCHG 3FP7E 1IQMA 2A4QA 1HAVB 1J8AA 5JBBS 5EGMA 1BTHH 3SOSA 1LVMA 4INKA 1MUEB 3UOPA 3ZVFA 2BDAA 3RMOH 1O3IA 2VVVA 5EXLA 1UVSH 3HGNA 2GX4A 1BUIA 2XBXA 1C2HA 2WPIS 2P8OC 3OSYA 1EATA 3RXVA 3A7WA 4KKDA 2AFQB 3ZZAA 1NRRH 1BTZA 1IQLA 1V2PT 1YGCH 1C2GA 2H1UA 3SI4H 1NN6A 4CR9A 1C5WB 4OS6A 1ID5H 1L2EA 3VB3A 1W13U 3SUDA 1MBMA 4WH8A 1FN6A 1O0DH 1AWFH 4KTUA 3KIDU 4YLUA 4AN7A 4H6TA 1NFWA 3BEIB 4I32A 1GHAF 4GAWA 1H9LB 1LQDB 3MH7A 3LGWA 1V2RT 2BDBA 4O97A 1O3NA 1NPMA 4YOGA 3S9BA 1O35A 2UWPA 4AOQA 4YM9A 4MPUA 1GG6C 1QRZA 2PKSC 3B8JA 1GHBF 3F9GA 3PO1C 3TK5A 4NZLA 1DXPA 4CH2B 4ZHMU 2CMYA 1BTWA 1DY9A 4K5ZA 3BG4C 3LIWA 1PQAA 3MNXA 4MLFB 1AHTH 3SZNA 5EPNA 4E7RG 3D49H 1VITF 4ISNA 1C9TA 1RGQA 4IS5A 4U01A 1DOJA 2PLXA 1MMJN 2C8ZB 1T8MA 3SV7A 1HB0B 1EZUC 2H9TH 3TNTA 1AO5A 4CRAA 4B75A 2OQUA 2QA9E 1UHBB 9LPRA 1C5YB 4TPYA 2A5KA 1GBBA 2Y7XA 2VU8E 1ETSH 2ZU3A 2B9LA 4XSKU 2R0KA 1P3EA 5AHGH 4JYTA 1LHEH 1V2MT 2GCTB 1MD8A 2R9PA 4X1PU 4XOJA 1HBTH 2F9OA 1CA8B 1UCYE 1YPHE 2QAAA 4I31A 3Q77A 4LZ4B 2V0BA 1A3EH 2RA3A 4CRGA 4JK6A 1K9OE 3AAUA 1BB0B 1GHWH 1BQYA 5J4QA 4CR5A 4UE7H 2A1DB 4DY7B 1O5AB 1XXFA 2A4OA 1JOUB 1O2VA 4VGCC 1TPAE 4IMZA 1OYQA 2TGPZ 3MH4A 2GDEH 2Y5FA 1OP8A 1ELAA 1AE8H 2UUYA 2G8TA 3VB7A 2HOBA 1MKXK 1SL3A 2J34A 1CGIE 1D3DB 1GHVH 1GJ8B 1SGFG 1C5MD 2ZWLH 3B9FH 2VWOA 1AFQC 4NIYA 2VGCC 3A7ZA 3NPSA 1W14U 1C5XB 3O8RA 5GCHG 2QF0A 5F8ZA 1A0LA 1OWHA 3K6ZA 1D6RA 1UTQA 5EQRA 4Y79A 3CP7A 1ETTH 4X8VH 4GVUA 4ZH8A 1GJ4H 4F49A 1FJSA 2O8MA 1O3GA 3KQBA 1PPBH 4GUXA 2STAE 1KXAA 1E38B 3URCA 1ELEE 1P9UA 4XBCA 3RXMA 3V0XA 3HATH 1O5FH 1LQEA 1BTXA 2ILNA 1C2IA 3LOXA 4O03A 3V13A 2B0FA 2FPZA 1TPSA 1UK2A 2A7JA 1L4ZA 2ZDAH 3ZZCA 3FP8E 1HJAC 3RXLA 2VB0A 3V3MA 1S84A 1TONA 2AS9A 2PKAB 2GD4B 3M5NA 1YCPH 3VXFH 4B2CA 5L30H 3D62A 1EJMA 1RIWB 3NUMA 5EOKA 2FDAA 1SGQE 3SNEA 5K7RA 4O9VA 5FPYA 1GHXH 1IQNA 2G4UA 2CHAC 1EAXA 5A0CA 4HZHA 4AB8A 5DKMA 3LGYA 4BNRA 1J15A 3LH3A 1X7AC 3BTQE 3E0PB 1F0TA 1SHHB 2XBYA 4ISLA 3SQHE 1NFYA 3SU0A 4RN6A 2F3CE 4AZ2B 1UVOA 4UONA 4XBBA 4NCYA 4NA7A 2OQ5A 4AG1A 4X2YA 4NSVA 2A4GA 1SBWA 5CMXH 3RXRA 2BD5A 1GI0A 1AVXA 3TVJB 1C4U2 1YKTA 4MVNA 1F2SE 2FOBA 3CS0A 1XX9A 3QTOH 4YT6H 5LPEA 2P3FH 3PYHA 1O32A 4NGAH 2PUQH 4DJZB 4DT7B 2I6QA 1C5VA 1NESE 1Z1JA 3C27B 2J4IA 1TMBH 4BAHB 1FV9A 2BD4A 2QXIA 3WY8A 3KEEA 1O5BB 4CRDA 4XE4A 2QXGA 5CHAC 1XUFA 4H6SB 1A1RA 3O8DA 2C93B 2JKHA 4FUIA 3ZZ6A 1TGBA 1J17T 1QRXA 4X1RU 2XRCA 1GMCF 1HXFH 2XC4A 3PM3A 4JZFH 3RXEA 2WPMS 3TJVA 3O8CA 2KAIB 1MBQA 3F9HA 1O5GH 2VJ1A 2LNCA 4HGCA 1LPZB 1BDAA 4FUGA 3VEQB 4UFEH 2EI6A 1TRNA 2ZU1A 1K2I1 2J9NA 3RM0H 4X0WU 1D3PB 5C5OA 1EJAA 1T7CA 3D65E 1KY9A 1N8OC 1IOEA 1EZQA 2H6MA 1TFXA 2ZG0H 2BDCA 4WWYA 5FCRA 5DJ7A 1AD8H 4X8TH 3JZ1B 1GJCB 2W7UA 1P2NA 3ZZ7A 3A86A 4H42U 1WAYB 4JZIA 1QNJA 1G2MA 1ZHMA 1T8OA 3P6ZB 1SC8U 3DFLA 1BRCE 1SLWB 5A09A 1BHXB 1CHOG 1TWXB 5E2PA 3ZZ9A 4NFFA 3TGIE 3QK1A 1ZHRA 2BD8A 2JETC 1FIWA 1O2ZA 3F9FA 4D9RA 3E16B 1BIOA 1S6HA 2O8WA 1UTNA 2ZCLP 1PYTC 1AKSA 2TGDA 1TE0A 1GBDA 1UCYH 1AE5A 1XUIA 4K8BA 4IBLH 1SGTA 2ZHEH 2HGTH 2ALPA 6CHAB 3PLBA 4B74A 2ODYB 3MFJA 4X8UH 3HK6B 5EQQA 4E05H 4A1TA 2QIQA 2UUKB 5GWZA 1P02A 1GMDF 3M61U 4RKOB 2Y80A 1CHGA 3A81A 7ESTE 2WPLS 1AZ8A 2HALA 1CT0E 1TALA 1DWEH 5EXNA 4A5TS 1O2OA 7GCHG 1O36A 4HFPB 3ZVDA 1TB6H 1XVMA 2UWLA 1MTSA 1ZTKA 6GCHF 1T8LA 2K1QA 1GL1A 3A85A 4YESB 1J9CH 1LTOA 3SHAH 5FX5A 3T62A 2ZQ2A 4ZKSU 4FVDA 4X2VA 1THPB 2HNTE 1OP2A 1DUEA 1SGEE 1ANEA 2VNTA 4AG2A 2PGBB 2XWAA 3QZRA 1IQGA 2VWLA 1O2XA 2SNWA 1ZOMA 2FS8A 5DPAA 5C2ZA 1BMLA 1EAWA 8LPRA 2XC5A 1CVWH 1DANH 4MDSA 1G3BA 1ZJKA 1NY22 1XKAC 1O3KA 2PSYA 1GBIA 1ETRH 2OC7A 3LH1A 4I8KA 1A5GH 4IN1A 4NA8A 3BF6H 1JMOH 1OOKB 4CBOA 3SU6A 1DWBH 1JBUH 1NROH 3TNSA 1BT7A 2FOGA 2H5CA 1GVZA 2WINI 3OTJE 2A31A 3SBKA 1KTSB 1ABIH 1LVOA 4ABDA 1TNHA 3SNAA 2THFB 4IC6A 4YO9A 1HAVA 1TA6A 1NU7B 1GBLA 2FOFA 4DIHH 4D76A 1WQVH 2PFEA 4MPVA 1OKXA 1OWKA 1TAWA 3UTUH 5DP8A 4GLYA 1XKBC 1AU8A 1QBNA 1DFPA 1AZZA 5LPRA 1GGDB 1O30A 2SNVA 4AFQA 2V35A 1SGDE 3M7TA 1C1RA 1BTYA 3PTBA 4OS7A 2O8UA 1SSXA 1ZJDA 2F9VA 5EQSA 2AEIH 2Z9JA 4WMEA 3TU7H 2EEKA 2ZPSA 2BLVA 1TABE 9ESTA 2WPJS 3BTTE 1DLKB 1NC6A 3GCHC 1MAXA 2ZA5A 1S6FA 1DWCH 4MNVA 2ESTE 3TH2H 2FLRH 2A2QH 4CRCA 1FZZA 2GZ9A 2HWLB 1HAIH 3GCOA 3A7XA 1S83A 4YOIA 4AFZA 4H4FA 1A7SA 2ZGHA 3LC3A 4KELA 3TK9A 3BG8A 1V6DA 1O2QA 2PTNA 3A80A 3M35A 4MG3A 1CSOE 1ELBA 1ZSKA 5A8ZA 2W3KA 3SW2B 2QC2A 1O2HA 3ZVEA 4DIIH 2ZECA 3URDA 3M7UA 1YPEH 3STJA 2CXVA 1HAYB 4GCHG 2ZFPH 3KGPA 2FODA 1K1NA 1CA0C 2FYRA 2ZPRA 4AFUA 1W8BH 5C20A 1O2PA 1D4PB 5T6DA 2HPQH 4ABEA 1L1JA 4SGAE 2QGRA 1FIZA 2AGEX 4GPGA 3GCTG 2BTCE 2ZGXH 1AFEH 2XWBI 4NIXA 1EOJA 3ZVCA 4X6NA 1WTHD 2ZFSA 1EUFA 3SV9A 1UHBA 3UREA 1UCYK 3MU0A 2OBOA 3CENA 5HXFA 1QR3E 4TWYA 1VITH 3R0FA 4E06H 3MMGA 1TRYA 4WMDA 5C67A 1V2OT 1NFXA 1VGCC 2W3IA 1L1GA 1TX6A 2H5DA 3FFGA 3HKJB 3U69H 1KXBA 5GCHF 4Q7XA 5F8TA 2B8OH 3OY6U 1ELDE 1RTLA 2SGAA 1KLIH 5DO4H 1MZDA 1H4WA 1E36B 2F91A 4BAQB 4JZDH 2UUFB 2OTVA 4D9QA 1GDNA 3RC6A 1SLVB 1Z8IB 1C2KA 1IQFA 4AGJA 2C3SA 5G4BA 2FLBH 4KTCA 3MYWA 4AX9H 1QRWA 1PJPA 2P3UB 1MQ6A 1EASA 3BTME 2QCYA 2ZP0H 4TY6A 3TJOA 2Z7FE 7KMEH 2H9EH 1GI8B 1UVPA 4K1EA 1C2MA 3RXKA 1PYTD 4DURA 4I8GA 5ABWA 2ALVA 3Q3KA 3BV9B 6ESTA 4IGDA 5SGAE 1Y3WA 3MHWU 1QBOA 2GCHG 2WV4A 1CBWB 2FXRA 3E90B 3TGJE 1MTNC 3A7VA 4TWWA 1GI9B 1B0FA 1GBHA 1JIMA 1GBFA 2PWXA 1SGFA 4Q2KA 1RTKA 2ZDLA 2ASUB 1KXFA 2CV3A 4MNXA 5C1YA 2ZTYA 4ZHAA 4A1VA 1AB9C 1DX5M 3DA9B 2QV1A 4BTIB 2VINA 1QB1A 1XUGA 1YLDA 4Y8ZA 1G2LA 2D8WA 4AFSA 1H8DH 5IYTA 2GTBA 1CT2E 3GDSA 1ZPCA 3MH6A 3D23A 1C5NH 4TYDA 4BXWA 3UNQA 3UWJH 8GCHG 4X6OA 3UIRA 1HJAB 4Y0ZE 1DLEA 4AB9A 2C90B 1C1MA 3EGKH 2PKAA 1HV7A 2JH6D 2D1JA 4NIWA 3ZV8A 1GBJA 2BLQA 1XUHA 2FP7B 5GPIB 2XBWA 3GYLB 4ABBA 1QQ4A 1M9UA 1SLXB 4WJG2 5A0AE 1D9IA 2VIQA 3E6PH 1C5ZB 1H8IH 1JRSA 2R2WU 2ZDKA 3ITIA 1QA0A 2ZHDA 4FUDA 1OWDA 4I8JA 1OYTH 4BOHA 1E0FD 3KHVA 4FUBA 2ZU4A 3ATWA 2PTCE 4K2YA 1H9IE 2WYJA 2TRMA 2Y5HA 2P95A 3RXQA 5T6FA 4ESTE 1HJ8A 4BAKB 1AWHB 4CHAC 4NSYA 1SPJA 1THSH 1V3XA 1BITA 1FPHH 1V2VT 2FI5E 4ASHA 2AIQA 1PPHE 1QY6A 1C1TA 4IW4E 1LO6A 2Y7ZA 4XFQA 3M36A 2LPRA 4BANB 2XYAA 1GHZA 1IQIA 1EZSC 2VVUA 2WV5A 1WTGH 3P8FA 5CE1A 1W3CA 5C3NA 3AW1A 4UDWH 1S0QA 3VFEA 2ANKH 1BMNH 1Z6JH 1BHXF 4Q7YA 1UJ1A 4BAMB 1MD7A 3PTNA 2BDHA 1LCYA 1Y3VA 5FX6A 1DDJA 1ANCA 3AVZA 3RXSA 3EDXB 1RRKA 3U8RH 1NO9H 1RD3B 1QCPA 1CHOF 3KQEA 3RXCA 1TRMA 1SGIB 1DM4B 1QIXB 2FTLE 2KAIA 1K1LA 3RM2H 2GMTB 3T27A 1FQ3A 1AQ7A 1QTFA 1AGJA 1C2DA 1ZPBA 1KLJH 1WU1A 4AYYB 1HAXB 1OS8A 2VH6A 4Y10E 3U9AH 1TGTA 3SU2A 3ATMA 1EB1H 1VCQA 2ZHWH 2Z3DA 7GCHF 2BQ7B 4NG9H 4B73A 3OU0A 2BY6X 1ZRBA 1A61H 1LVBA 3RDZA 3LPRA 3RXGA 1GJBB 2ZGBH 1C5OH 4A7IB 3MI4A 4LK4A 2TGAA 3E8LA 4IMQA 3PMHB 1HAPH 3AASA 1Z8RA 1DPOA 1KXEA 1YBWA 3RXAA 1ZMLA 2FS9A 2Y5GA 5LGOA 1FY5A 1GCTB 3GY8A 2ZDMA 2J94A 1C5SA 3A8CA 1GI7B 1SGPE 2AMPA 1W7XH 2XTTB 3RXTA 3SV2H 1UTJA 1TQ7B 2A7HA 2GVFA 5HYOA 2Z9LA 1C2EA 1ANDA 3F6UH 2TPIZ 2BM2A 3BEFB 3RLYH 4O3TA 3MH5A 1PQ5A 3RMNH 1E35B 2IPHA 1KDQB 2R3YA 2ZDVH 2BVSH 2Z9GA 1SMFE 1V2TT 2GDDA 1P03A 2PUXB 1HLTH 3SJ8A 1BCUH 4DCDA 4UD9H 1N6YA 1SGRE 1DSUA 4NWLA 1C2FA 1UK4A 4AGKA 1NM6A 3ZVBA 4CRBA 2PR3A 3UQVA 3NCLA 5HGGA 1YPGH 2ANYA 4Y11E 1O2LA 2WPHS 2AGGX 1SB1H 1C1VH 5A8XA 5EW2H 4X6MA 1GJ7B 4JZ1A 1QHRB 1P2KA 3SGAE 5IDKA 3NXPA 4UEHH 1O33A 2BY9X 3MU1A 1OSSA 3QO6A 1HGTH 1ZMNA 3A8DA 2ZFRH 3GICB 5HM2A 1Y3XA 3P8OA 3DT0H 5DK1A 3OYPA 5EXMA 4X6PA 1OX1A 1TOCB 2FOEA 4O3UA 3I77A 1GBCA 3UR9A 2H2ZA 4INHA 1GI1A 2FM2A 1U6QA 5H4IB 2FOCA 1CE5A 3E91A 1F5RA 1DT2A 2SGPE 3DHKH 1TNKA 1FY1A 2BLWA 1INCA 1Y59T 1O2YA 4NFEA 1O3OA 1JXPA 1L0ZA 3MTYA 2PGQB 1NRPH 1BJUA 3S9AA 3GOVB 3ZVGA 1H1BA 3ZV9A 2GCTC 3UFAA 1RXPA 1C4Y2 3LC5A 1ORFA 2Z6BD 4GCHF 5EPYA 4ZUHA 1ABJH 3UY9A 2OC8A 1ELVA 1XM1A 4BXSA 1P12E 2GZ7A 3T26A 1FPCH 3MU5A 4ZKRU 4LOYH 1O2MA 2BD3A 1O2GH 1ELCA 4ISIH 1LHCH 2G51A 3GCTF 1TBZH 1FUJA 1XUKA 4NIVA 1P01A 1IQEA 1A2CH 3ZZ4A 1GBKA 3RU4T 3V7TA 1FY8E 2Z94A 3LT3A 1PQ8A 2O8LA 3PWCA 3QN7A 1UVUH 3S0NA 2PW8H 5JBAS 1V2NT 1XXDA 4YZUA 2XCFA 1TX7A 2PSXA 3ZZ5A 1AUTC 3BTFE 1AVGH 1C2JA 2BY7X 3A89A 4JYVH 1P04A 2FX4A 2HVXA 3GCNA 2FTMA 1BOQA 5DGJA 1OXGA 2VH0A 1Q2WA 1W2KH 1Z6EA 3M37A 4OGXA 2ANMH 1G9IE 1QGFA 3BTDE 4MTBA 1HAHH 1VZQH 1TGCA 1O3BA 1C9PA 2F9UA 2BVRH 1C2LA 4K3JA 5DP7A 2BZAA 3T5FH 1DVAH 2CN0H 3TH3H 1C1PA 4CBNA 3V12A 1DXWA 2F9PA 3RU4E 2BYAX 1O31A 3SNDA 3LDXH 3QLPH 1PQ7A 1EKBB 1KLTA 2ZI2H 2Y6TA 5JBCS 3SUEA 1O3MA 5DP5A 2NU3E 1SVPA 3RXHA 2OC0A 5C1UA 3M3VA 1OPHB 3TK6A 1TYNA 1P2MA 2WYGA 5T3HA 5A0BA 1IQHA 2Y81A 3ATLA 3LKWA 4D7FA 2GCHF 2BXUH 4UFGH 1S81A 4Y7BA 1A46H 1GBAA 4K8YA 2SGEE 1P10A 4ZROA 1Z7KA 1YCPK 4U2WA 2OCVB 1O5CB 3ZYEA 2BDGA 1RIWC 3VGCB 4D7GA 2ZGCA 2C4FH 3PMAB 2F83A 4ZHLU 3KL6A 3A8BA 3P95A 1B0EA 1N1LA 2ZEBA 4B71A 2YOLA 3BIUH 1IQKA 1EPTB 3HK3B 3MO3A 1GJAB 5DP6A 3P92A 3RMLH 1HAZB 3NKKA 3MU8A 1J16A 8GCHF 1EP5A 5ETXA 4ZKOU 5B6OA 2M5TA 4WY3A 2TGTA 1ZGIA 3ELAH 3SGQE 1CO7E 2Y82A 2XC0A 4M7GA 1EAUA 2TIOA 4CREA 1LPKB 3EYDA 1PPFE 1D3QB 2YNAA 4UFDH 4ZKNU 1WUNH 2FI3E 4I33A 1G37A 3MO6A 2DE9A 5FBIA 4E7NA 3K2UA 4X8SH 2P8OB 2NU4E 1PPZA 1KXCA 1O3AA 2P93A 5AFYH 4K60A 1ELGA 1KYNA 1N6XA 1K21H 3ZZ8A 1F5KU 1FLEE 5E0JA 1O3LA 1AMHA 1QL9A 3P17H 1T4VH 1YLCA 4DG4A 3EAJA 1SGYE 2P94A 1UTOA 1ZRKA 2EI7A 3AW0A 2V6NA 1GWAA 4FU7A 4FUHA 2RG3A 1AUJA 5ESTE 1W10U 1TGSZ 1UO6A 2PHBA 3E1XB 4FU9A 2JH0D 1GVLA 3T29A 3LGTA 3U98H 1LPGB 1GG6B 2PKSB 3PO1B 1QB6A 2IJOB 5JBTA 5JB9S 3VB4A 1TIOA 1YYY1 3GYMA 3PLPA 3TITA 5LPFA 3BG4B 1S82A 4ISOA 3VPKA 1SGNE 5E8EH 2VIVA 1D6WA 4X1SU 2ZU5A 3T2NA 5HM9A 4AYVB 3N7OA 1T31A 1VJ9U 3T25A 5E0HA 4OGYA 4Z6AH 3SQEE 1THRH 2HPPH 3E0NB 1RTFB 3EA9A 2BD2A 1A4WH 2A5IA 2FIRH 2FOMB 3OY5U 1ARCA 3K9XB 1GBEA 5EODA 4ABFA 3MNSA 3BIVH 1RJXB 3VB6A 2ZFQH 4UFFH 1Q31A 3RP2A 6CHAC 1BBRE 1EAIA 3FZZA 2Q1JA 3KQDA 1BRBE 2ANWA 2ULLA 2G4TA 2P3TB 3RXJA 2BDIA 2Q6GA 1MKWH 2AGIX 2FWWA 1F0UA 1P0SH 1O2JA 1BJVA 1XMNB 1QJ7B 1VCWA 3PMJA 2QN5T 1O37A 2CF9H 3Q76A 4LXBH 1G30B 5GDSH 4A6LA 1C4V2 4VGCB 1G3DA 1O3JA 2SGFE 1DSTA 1LVYA 2FEQH 2HRVA 1ZTLA 4YLQH 1V2UT 3B23B 1LKAA 3PB1E 3TGKE 1ANBA 1SQOA 1QQUA 4OS4A 5FBEA 2OBQA 2PV9B 3A7TA 3T28A 1EXFA 4JCNA 1AFQB 5BRRE 2A7CA 2VGCB 1O2UA 2P59A 4A1XA 1DITH 2OC1A 3RXIA 4WVPE 1GJ6A 1HIAB 1FAXA 1TGNA 1O2WA 3ZZBA 2BD7A 2G5VA 1A5HA 1DWDH 2QF3A 4FUEA 1EQ9A 1O3FA 1GDQA 1G36A 3UNRA 4YOJA 1FXYA 1DE7H 2AERH 1KIGH 3UUZA 1UMAH 3Q00A 5DG6A 1HFDA 1K1MA 1ZHPA 4OS5A 5A2MH 1IHSH 2W5EA 4F4OC 3ESTA 1S0RA 2J92A 4XBDA 6LPRA 1ZPZA 5TJXA 2ZPQA 3FZDA 2O8TA 5T6GA 2V3OH 2ZCKP 3BTGE 4ABJA 1QB9A 3P70B 4WH6A 3ZZDA 2XXLA 2BDYA 5F8XA 1GGDC 2A4RA 4J2YB 1W7GH 3LJOA 2ZC9H 3BTKE 1KDQA 1SQTA 1LHDH 1YF4A 1G32B 3M5LA 2G52A 4ZAEA 5FXLA 2GV6A 2W7SA 3DUXH 1MU6B 4RKJB 3QGNB 3ODDA 5TCCA 2EC9H 3RXBA 2CHAB 1LMWB 1WSSH 1O2SA 2UWOA 2BY8X 3MU4A 3DD2H 1KSNA 4K69A 3TH4H 2GP9B 3QDZB 3BN9A 1HRTH 4Q7ZA 4DW2U 5GJ4B 2Z9KA 4Y0YE 1QURH 2BY5X 1C1QA 4B1TA 4Y8YA 2F9BH 3ENSB 5I46H 2AYWA 4GHTA 1FDPA 3BEUA 3LONA 4JK5A 1S85A 1O2RA 4PROA 1AIXH 2SFAA 1DICA 4X2WA 2FX6A 2AH4X 4YTAA 2AMDA 4KGAA 5F6MA 1SHYA 1HYLA 3U8OH 2EI8A 3RXPA 4OS1A 1NRNH 1LHFH 4DGJA 4KP0A 1MTUA 2DUCA 1T32A 2BX3A 1C1UH 1DY8A 4WXIA 2GZ8A 5CHAB 2G00A 2ZHQH 3LGVA 1H9HE 2B7DH 4NWKA 1NRSH 3EA7A 4B2AA 1FN8A 1V2WT 2ZFFH 1A0JA 1ZYOA 3U8TH 1Z8GA 4LZ1H 1C5TA 1NZQH 3HKIB 1TNGA 3FP6E 2WUBA 1FI8A 3H7TA 3JZ2B 4GHQA 1KTTB 4INLA 5DP4A 2RA0A 5DP3A 3SORA 3SO3A 1JWTA 3L3TA 4OS2A 3LGUA 1ZMJA 1P09A 2BX4A 1WCZA 1HAOH 2DE8A 3CS7A 4CH8B 2I6SA 5BPEA 1C1OA 1G3EA 3SV8A 3A87A 1EX3A 3PLKA 1HAGE 1MKWK 2FOHA 3TJNA 2VIOA 2OXSA 1C5RA 1N8OB 4JZEH 1K1JA 4WXVA 4MNYA 1P57B 1UTKA 2VIDA 3W95A 4Y76A 4QT8C 1EOLA 2Q6DA 1SFIA 2QYIA 4MQAA 1FONA 3MNCA 5PTPA 3KQCA 3MO9A 1V2JT 3NZIA 5FHTA 1OWEA 4I7YH 4DVAU 1FY3A 4BTTB 1Y5BT 2JETB 1KXDA 1C1SA 1BBRH 1BZXE 2NU2E 3GY6A 1JIRA 4B2BA 1YPMH 5ESBA 5FPTA 3BTEE 1C1NA 1CBWC 2R3UA 1O3CA 3ZVAA 3DFJA 3P8GA 1ESTA 1O38A 3RXOA 1V2QT 2HNTF 3RU4D 2NU0E 1SOZA 1UK3A 3BTWE 3SU1A 1A3BH 1Z1IA 1PPCE 1Y5UT 4TY7A 1ZGVA 3SJIA 1SLUB 1NRQH 3RXDA 1P06A 1GMHG 2ZU2A 2BHGA 1QJ6B 4X2XA 1TNIA 2ZQ1A 2VWNA 1SOTA 1ZTJA 1GI2A 2QXJA 2Z3CA 1GL0E 3SJOA 2GT8A 2J38A 4HTCH 1FMGA 3I29A 1K1OA 1T4UH 2A5AA 3SNCA 4ZXYH 3K6YA 5AVDA 1QA7A 3KCGH 2TBSA 2Z3EA 4Y6DA 3RC4A 4FVBA 4THNH 1OWIA 2ZIQH 2CF8H 2GGVB 1C5UA 3TLOA 2BXTH 1O3HA 7LPRA 1QJ1B 1W0YH 2XNIA 2FO9A 4I8LA 5I25A 4ZXXH 1EPTA 2WUCA 2FMJA 1P2IA 3VB5A 1WOFA 1TMUH 5JYIA 1V2KT 4MPWA 1P3CA 3ZZ3A 1F0RA 3SUGA 1F7ZA 1F92A 1SG8B 4D8NA 1ESAA 2ZFTA 3W94A 3OX7U 1B7XB 1ZSJA 2QXHA 3ATIA 2IN2A 4J1YA 1UTLM 2NWNA 2ZCHP 5L2YH 1YC0A 3NK8A 4YT7H 1TPOA 4ABHA 2HLCA 1GHAG 4AORA 1TBRH 3EA8A 1VCPA 2XCNA 3A88A 2FZZA 1Z8JB 3SU4A 1TQ0B 1NFUA 2BD9A 1JRTA 1HPGA 3FVFB 3RXFA 2J95A 3ATKA 3IG6B 4MNWA 1YPKH 3M3TA 3SGBE 1GHBG 1BTUA 3SHCH 1ELTA 1AN1E 1AI8H 2F9NA 2ZTZA 1K22H 1O2IA 3GCHB 1K1IA 3M5MA 3MWIU 4MPXA 1C5PA 1IAUA 2RDLA 5TCAA 3M7QA 3H7OA 2AMQA 3O8BA 1AY6H 1O5EH 1VITG 2W26A 3KNXA 1TPPA 2D2DA 1EB2A 2BQWB 2GMTC 1O2KA 1YPHC 1B5GH 1TMTH 3U1IB 2GT7A 5DP9A 4ABGA 2ODQA 1EJNA 3RC5A 1FAKH 2G55A 1A5IA 1CGHA 4K1SA 3E3TA 1GVKB 1O5DH 3SUFA 2ODPA 3PMBB 1QFKH 5JDUB 1ELFA 3A8AA 4DOQA 4Y7AA 4BTUB 4K1TA 1HXEH 1BTPA 1GI5A 2XW9A 1MCVA 1SQAA 1CA0B 2VWMA 5EW1H 1NU9A 4FUJA 1OP0A 4IN2A 1GI3A 3H5CB 2D26C 2GV7A 3S7HB 2FI4E 1DUAA 2BOHB 4Q80A 4FUFA 1K1PA 1UTPA 1GBTA 3GDUA 1BBRK 4ABIA 1HNEE 4X1QU 1WQSA 2BVXH 4CRFA 2FESH 1O2TA 3UNSA 4XDEA 2STBE 2B5TB 3LU9B 4U30A 2ZGJA 4Y71A 1GCTC 1HJ9A 1P11E 1K28D 3F1SB 3UOUA 2P16A 3F68H 3F9EA 1BRAA 1GJ9B 2A0QB 2H9HA 1O39A 1GPZA 1VGCB 3GDVA 1YM0A 4A92A 1TLDA 3A82A 3SI3H 3RXUA 1ZZZA 4KTSA 2VIPA 1L4DA 3SNBA 1PPGE 1ZLRA 2IOTA 4FU8A 1SI5H 3RUOA 3SV6A 2A2XH 5L2ZH 5C5NA 4I8HA 3UR6A 2ZTXA 1LKBA 1WBGB 3GY7A 5AFZH 2ZZUH 1J14A 5JPMH 2BZ6H 1S5SA 1UVTH 1FY4A 3S7KB 2FYQA 1TA2A 4R0IA 1P2JA 5GIBA 3EE0B 3C1KA 3MOCA 3QX5H 3HPTB 1Y3UA 4NZQA 3SU5A 2G5NA 2BB4A 5LH8A 2QY0B 1ZSLA 4NA9H 2ZKSA 3QUMP 1P2QA 2BMGB 3P8NA 5F03A 1C1WH 5C1XA 3KN2A 3TIUA 1NTPA 1Y5AT 1VR1H 2A45B 1RS0A 2OP9A 3SU3A 2YNBA 1Y3YA 3UPEA 1MTNB 3SJKA 3STIA 4WF8A 1HIAA 3QZQA 2A32A 3L6PA 1BMAA 3HGPA 1MQ5A 1EP6A 3GISB 2JH5D 1QL7A 1W12U 2O9QA 2C8WB 3A7YA 5FPSA 1A0HB 3SJ9A 1GI4A 1AB9B 3TJUA 1LHGH 3KF2A 1YP9A 1F0SA 3Q3YA 1WYKA 2OLGA 1CT4E 2RCEA 1PPEE 1P8VC 5EG4A 1UTMA 1L1NA 1GDUA 1GI6A 3PV4A 1CQQA 2OD3B 1GBMA 3QTVH 4WMFA 1GHYH 1E34B 3K65B 3SN8A 1V2LT 2C8XB 3LJJA
chains in the Genus database with same CATH superfamily
5FCKA 4FXGH 3EQ0H 5EU8A 3S9CA 1F5LA 2R2MB 1W11U 3FAOA 1TX8A 3R3GB 1C5QA 3M5OA 1YCPM 3GY4A 2KCYA 1HUTH 1TNLA 4ZMAH 4FUCA 1RFNA 1T8NA 4X1NU 5FAHA 1CGJE 3ZYDA 3ODFA 3AAVA 3UWIA 2WZQA 2V3HH 1NS3A 1NT1A 2HLDD 1BRUP 3U1JB 3GY5A 2LELA 3GY3A 2ZDNA 3LGIA 5HMAA 5J4SA 2BLOA 3RLWH 1MCTA 2WPKS 2J2UA 2VIWA 1P05A 3BTHE 2XBVA 3PWBA 4Z0KA 1GJ5H 1SR5C 2Z9IA 4CHAB 1IHTH 4R8TB 1E37B 8KME2 2BQ6B 1GMCG 3PV5A 1MTVA 1FNIA 1TNJA 4ISHH 1TBQH 3IWMA 4HI3A 1VJAU 2OUAA 3PRDA 2SGQE 3FANA 4IC5A 4Q63A 5GXPA 1Z71A 1YPJH 1AKSB 4B76A 3QWCH 5AF9H 4JMYA 3S69A 1LDTT 4BAOB 1O3DA 3PRBA 5L6NH 1ACBE 1OWJA 1YPLH 3BSQA 1P9SA 1ARBA 2GKVE 2OINA 2BOKA 1O2NA 1MH0A 1XVOA 2ZHFH 3QGJA 3NWUA 2ZF0H 3VXEH 5JB8S 1O3EA 2G81E 1Q3XA 1BMMH 2CJIA 1ZR0A 4JYUH 1IQJA 2UUJB 1MU8B 1MAYA 1ESBA 4GSOA 5K0HA 5E0GA 2EA3A 1Y8TA 1GJDB 5E2OA 1C5LH 5HKKD 1WV7H 3RMMH 4ABAA 1MZAA 1CU1A 3G01A 3A83A 3TPIZ 1AVWA 2ZNKH 2SGDE 1DS2E 1YWUA 2Q6FA 4Y8XA 3UQOA 1QBVH 1W0ZU 8ESTE 3Q3XA 3VGCC 3IITA 1BA8B 4RSPA 1TOMH 1MKXH 2C8YB 1PFXC 1D3TB 4U32A 1QL8A 2VVCA 1G3CA 1O34A 2CGAA 1SGCA 5F53A 3GY2A 4SGBE 1EFRD 1GCDA 1GMDG 2R0LA 3L33A 3MNBA 1SFQB 2AIPA 1GMHF 2ZO3H 1EPTC 2HNTC 1HDTH 1MTWA 2NU1E 1O3PB 1EZXC 1XUJA 2FOAA 1P2OA 3A84A 2KM0A 4TPIZ 3M3SA 2XNDD 5A8YA 1HCGA 3I78A 1V2ST 3PROA 5C0TA 6GCHG 3FP7E 1IQMA 2YMSD 2PP6A 2A4QA 1HAVB 1J8AA 5JBBS 5EGMA 4XRNA 1BTHH 3SOSA 2VBCA 1UW7A 1LVMA 4INKA 1MUEB 3UOPA 3ZVFA 2BDAA 3RMOH 1O3IA 2VVVA 5EXLA 1UVSH 3HGNA 2GX4A 1BUIA 2XBXA 1C2HA 2WPIS 2P8OC 3OSYA 1EATA 3RXVA 3A7WA 4KKDA 2AFQB 3ZZAA 1NRRH 1BTZA 2K8IA 1IQLA 1V2PT 1YGCH 1C2GA 2H1UA 3SI4H 1NN6A 4CR9A 1C5WB 4OS6A 1ID5H 1L2EA 3VB3A 1W13U 3SUDA 1MBMA 4WH8A 1W0JD 1FN6A 1O0DH 1AWFH 4KTUA 3KIDU 4YLUA 3UAIC 4AN7A 4H6TA 1NFWA 3BEIB 4I32A 1GHAF 4GAWA 1H9LB 1LQDB 3MH7A 3LGWA 1V2RT 2BDBA 4O97A 1O3NA 1NPMA 4YOGA 1SQRA 2QE7D 3S9BA 1O35A 2UWPA 4AOQA 4YM9A 4MPUA 1GG6C 1QRZA 2PKSC 3B8JA 1GHBF 3DSGA 3F9GA 3PO1C 3TK5A 4NZLA 1DXPA 4CH2B 4ZHMU 2CMYA 1BTWA 1DY9A 4K5ZA 3BG4C 3LIWA 1PQAA 3MNXA 4MLFB 1AHTH 3SZNA 5EPNA 4E7RG 3D49H 1VITF 4ISNA 1C9TA 1RGQA 4IS5A 4U01A 1DOJA 2PLXA 1MMJN 2C8ZB 1T8MA 3SV7A 1HB0B 1EZUC 2H9TH 3TNTA 1AO5A 4CRAA 4B75A 2OQUA 2QA9E 1UHBB 9LPRA 1C5YB 4TPYA 2A5KA 1GBBA 2Y7XA 2VU8E 1ETSH 2ZU3A 2B9LA 4XSKU 2R0KA 1P3EA 5AHGH 4JYTA 1LHEH 1V2MT 2GCTB 1MD8A 2R9PA 4X1PU 4XOJA 1HBTH 2F9OA 1CA8B 1UCYE 1YPHE 2QAAA 4I31A 3Q77A 4LZ4B 2V0BA 1A3EH 2RA3A 4CRGA 4JK6A 1K9OE 3AAUA 1BB0B 1GHWH 5B6LA 1BQYA 5J4QA 4CR5A 4UE7H 2A1DB 4DY7B 1O5AB 1XXFA 2A4OA 3N7DA 1JOUB 1O2VA 4VGCC 1TPAE 4IMZA 1OYQA 2TGPZ 3MH4A 2GDEH 2Y5FA 1OP8A 1ELAA 1AE8H 2UUYA 2G8TA 3VB7A 2HOBA 1MKXK 1SL3A 2J34A 1CGIE 1D3DB 1GHVH 1GJ8B 1SGFG 1C5MD 2ZWLH 3B9FH 3DSPA 2VWOA 1AFQC 4NIYA 2JJ2D 2VGCC 3A7ZA 3NPSA 1W14U 1C5XB 3O8RA 5GCHG 2QF0A 5F8ZA 1A0LA 1OWHA 3K6ZA 1D6RA 1UTQA 5EQRA 3DCLA 4Y79A 3CP7A 1ETTH 4X8VH 4GVUA 4ZH8A 1GJ4H 4F49A 1FJSA 2O8MA 1O3GA 3KQBA 1PPBH 4GUXA 2STAE 1KXAA 1E38B 3URCA 1ELEE 1P9UA 4XBCA 3RXMA 3V0XA 3HATH 1O5FH 1LQEA 1BTXA 2ILNA 1C2IA 3LOXA 4O03A 3V13A 2B0FA 2FPZA 1TPSA 1UK2A 2A7JA 1L4ZA 2ZDAH 3ZZCA 3FP8E 1HJAC 3RXLA 2VB0A 2IPQX 1S84A 3V3MA 1TONA 2KCPA 2AS9A 2PKAB 2GD4B 3M5NA 1YCPH 3VXFH 4B2CA 5L30H 3D62A 1EJMA 1RIWB 3NUMA 5EOKA 2FDAA 1SGQE 3SNEA 5K7RA 4O9VA 5FPYA 1GHXH 1IQNA 2G4UA 2CHAC 1EAXA 5A0CA 4RI0A 4HZHA 4AB8A 4ACBA 5DKMA 3LGYA 4BNRA 1J15A 3LH3A 1X7AC 3BTQE 3E0PB 1F0TA 1SHHB 2XBYA 3FKSD 4ISLA 1NFYA 3SQHE 3SU0A 4RN6A 4B6FA 2F3CE 4AZ2B 1UVOA 4UONA 4XBBA 4NCYA 4NA7A 2OQ5A 4AG1A 4X2YA 4NSVA 2A4GA 1SBWA 5CMXH 3RXRA 2BD5A 1GI0A 1AVXA 3TVJB 1C4U2 1YKTA 4MVNA 1F2SE 2FOBA 3CS0A 1XX9A 3QTOH 4YT6H 5LPEA 4RT0A 3W1EA 2P3FH 3PYHA 1O32A 4NGAH 2PUQH 4DJZB 4DT7B 2I6QA 1C5VA 1NESE 1Z1JA 3C27B 3FOAA 2J4IA 1TMBH 4BAHB 1FV9A 2BD4A 2QXIA 3WY8A 3KEEA 1O5BB 4CRDA 4XE4A 2QXGA 3OE7D 5CHAC 1XUFA 4H6SB 1A1RA 3O8DA 2C93B 2JKHA 4FUIA 3ZZ6A 1TGBA 3F0OA 1J17T 1QRXA 4X1RU 2XRCA 2J5UA 1GMCF 1HXFH 2XC4A 3PM3A 4JZFH 3RXEA 2WPMS 3TJVA 3O8CA 2KAIB 1MBQA 3F9HA 1O5GH 2VJ1A 2LNCA 4HGCA 2KR7A 1LPZB 1BDAA 4FUGA 3VEQB 4UFEH 2EI6A 1TRNA 2ZU1A 1K2I1 2J9NA 3RM0H 4X0WU 1D3PB 5C5OA 1EJAA 4RT1A 1T7CA 3D65E 1KY9A 1N8OC 1IOEA 1EZQA 2H6MA 1TFXA 2ZG0H 2BDCA 4WWYA 5FCRA 5DJ7A 3WW7A 1AD8H 4X8TH 3JZ1B 1GJCB 2W7UA 1P2NA 3ZZ7A 3A86A 4H42U 1WAYB 4JZIA 1QNJA 1G2MA 1ZHMA 1T8OA 3P6ZB 1SC8U 3DFLA 1BRCE 1SLWB 5A09A 1BHXB 4F55A 1CHOG 1TWXB 5E2PA 3ZZ9A 4NFFA 3TGIE 3QK1A 3WWBA 1ZHRA 2BD8A 2JETC 1FIWA 1O2ZA 3F9FA 4D9RA 3E16B 1BIOA 1S6HA 2O8WA 1UTNA 4AC9A 2ZCLP 1PYTC 1AKSA 2TGDA 1TE0A 1GBDA 1UCYH 1AE5A 1XUIA 2KFWA 4K8BA 4IBLH 1SGTA 3DSOA 2ZHEH 2HGTH 2ALPA 6CHAB 3PLBA 4B74A 2ODYB 3MFJA 4X8UH 3HK6B 5EQQA 4E05H 4A1TA 2QIQA 2UUKB 5GWZA 1P02A 1GMDF 3M61U 4RKOB 2Y80A 1CHGA 4OM9A 3A81A 7ESTE 2WPLS 1AZ8A 2HALA 1CT0E 1TALA 1DWEH 5EXNA 4A5TS 1O2OA 7GCHG 1O36A 4HFPB 2J97A 2J98B 3ZVDA 1TB6H 1XVMA 2UWLA 1MTSA 2WV9A 1ZTKA 6GCHF 1T8LA 2K1QA 1GL1A 3A85A 4YESB 1J9CH 1LTOA 3SHAH 5FX5A 3T62A 2ZQ2A 4ZKSU 2WPDD 4FVDA 4X2VA 1THPB 2HNTE 1OP2A 1DUEA 1SGEE 1ANEA 2VNTA 4AG2A 2PGBB 2XWAA 3QZRA 1IQGA 2VWLA 1O2XA 2SNWA 1ZOMA 2FS8A 5DPAA 5C2ZA 1BMLA 5CDFE 1EAWA 8LPRA 2XC5A 1CVWH 1DANH 4MDSA 1G3BA 1ZJKA 1NY22 1XKAC 1O3KA 2PSYA 1ETRH 1GBIA 2OC7A 3LH1A 4I8KA 1A5GH 4IN1A 4NA8A 3BF6H 1JMOH 1OOKB 4CBOA 3SU6A 1DWBH 1JBUH 1NROH 3TNSA 1BT7A 2FOGA 2H5CA 1GVZA 2WINI 3OTJE 2KCOA 2A31A 3SBKA 1KTSB 1ABIH 1LVOA 3FN8A 4ABDA 1TNHA 3SNAA 2THFB 4IC6A 4YO9A 1HAVA 1TA6A 1NU7B 1GBLA 4XD7D 2FOFA 4DIHH 4D76A 2JJ1D 1WQVH 2PFEA 4MPVA 1OKXA 1OWKA 1TAWA 3UTUH 4ACAA 5DP8A 4GLYA 1XKBC 1AU8A 1QBNA 1DFPA 1AZZA 5LPRA 1GGDB 1O30A 2SNVA 1E1QD 3H09A 4AFQA 2V35A 1SGDE 3M7TA 1C1RA 1BTYA 3PTBA 4OS7A 2O8UA 1SSXA 1ZJDA 2F9VA 5EQSA 1E79D 2AEIH 2Z9JA 4WMEA 3TU7H 2EEKA 2ZPSA 2BLVA 1TABE 9ESTA 2WPJS 3BTTE 1DLKB 1NC6A 3GCHC 1MAXA 2ZA5A 1S6FA 1DWCH 4MNVA 2ESTE 3TH2H 2FLRH 2A2QH 4CRCA 1FZZA 2GZ9A 2HWLB 1HAIH 3GCOA 3A7XA 1S83A 4YOIA 4AFZA 4H4FA 1A7SA 2ZGHA 3LC3A 4KELA 3TK9A 3BG8A 1V6DA 1O2QA 2PTNA 3A80A 3M35A 4MG3A 2L6OA 1CSOE 1ELBA 1ZSKA 5A8ZA 2W3KA 4YXWD 3SW2B 2QC2A 1O2HA 3ZVEA 4DIIH 5T1VA 2ZECA 3URDA 3MQKC 1SKYE 3M7UA 1YPEH 3STJA 2CXVA 1HAYB 1YLNA 4GCHG 2ZFPH 3KGPA 2FODA 1K1NA 1CA0C 2FYRA 2ZPRA 4AFUA 1W8BH 5C20A 1O2PA 1D4PB 5T6DA 2HPQH 2WSSD 4DT4A 4ABEA 1L1JA 4SGAE 2QGRA 1FIZA 2AGEX 4GPGA 3GCTG 2BTCE 2ZGXH 1AFEH 2XWBI 4NIXA 1EOJA 3ZVCA 4X6NA 1WTHD 2ZFSA 1EUFA 3SV9A 1UHBA 3UREA 1UCYK 3MU0A 2OBOA 3CENA 5HXFA 1QR3E 4TWYA 1VITH 3R0FA 4E06H 3MMGA 1TRYA 4WMDA 5C67A 1V2OT 1NFXA 1VGCC 2W3IA 1L1GA 1TX6A 2H5DA 3FFGA 3HKJB 3U69H 1KXBA 5GCHF 4Q7XA 5F8TA 2B8OH 3OY6U 1ELDE 1RTLA 2SGAA 1KLIH 5DO4H 1MZDA 1H4WA 1E36B 2F91A 4BAQB 4JZDH 2UUFB 2OTVA 4D9QA 1GDNA 3RC6A 1SLVB 1Z8IB 1C2KA 1IQFA 4AGJA 2C3SA 5G4BA 2FLBH 4KTCA 3MYWA 4AX9H 1QRWA 1PJPA 2P3UB 1MQ6A 1EASA 3BTME 2QCYA 2ZP0H 4TY6A 3TJOA 2Z7FE 7KMEH 3GS9A 5C17A 2H9EH 1GI8B 2HVYB 1UVPA 4K1EA 1C2MA 3RXKA 1PYTD 4DURA 4I8GA 5ABWA 2ALVA 3Q3KA 3BV9B 2F43B 6ESTA 4IGDA 5SGAE 1Y3WA 3MHWU 1QBOA 2GCHG 2WV4A 1CBWB 2FXRA 3E90B 3TGJE 1MTNC 3A7VA 4TWWA 1GI9B 1B0FA 1GBHA 1JIMA 1GBFA 2PWXA 1SGFA 4Q2KA 1RTKA 2ZDLA 2ASUB 1KXFA 3OEED 2CV3A 4MNXA 5C1YA 2ZTYA 4ZHAA 4A1VA 1AB9C 1DX5M 3DA9B 2QV1A 4BTIB 2VINA 1QB1A 1XUGA 1YLDA 4Y8ZA 1G2LA 2D8WA 4AFSA 1H8DH 5IYTA 2GTBA 1CT2E 3GDSA 1ZPCA 1YY3A 3MH6A 3D23A 1C5NH 4TYDA 4BXWA 3UNQA 3UWJH 8GCHG 4X6OA 3UIRA 1HJAB 4Y0ZE 1DLEA 4AB9A 2C90B 2AHME 3KQ5A 1C1MA 3EGKH 2PKAA 1HV7A 2JH6D 2D1JA 4NIWA 3ZV8A 1GBJA 2BLQA 1XUHA 2FP7B 5GPIB 2XBWA 3GYLB 4ABBA 1QQ4A 1M9UA 1SLXB 4WJG2 5A0AE 1D9IA 2VIQA 3E6PH 5KEDA 1C5ZB 1H8IH 1JRSA 2R2WU 2ZDKA 3ITIA 1QA0A 2ZHDA 4FUDA 1OWDA 4I8JA 1OYTH 4BOHA 1E0FD 3KHVA 3N99A 4FUBA 2ZU4A 3ATWA 2PTCE 2RDEA 4K2YA 1H9IE 2WYJA 2TRMA 2Y5HA 2P95A 3RXQA 5T6FA 4ESTE 1HJ8A 4BAKB 1AWHB 4CHAC 4NSYA 1SPJA 1THSH 1V3XA 1BITA 1FPHH 1V2VT 2FI5E 4ASHA 2AIQA 1PPHE 1QY6A 1C1TA 4IW4E 1LO6A 2Y7ZA 4XFQA 3M36A 2LPRA 4BANB 2XYAA 1GHZA 1IQIA 1EZSC 2VVUA 2WV5A 1WTGH 4F48B 3P8FA 5CE1A 1W3CA 5C3NA 3AW1A 4UDWH 1S0QA 3VFEA 2ANKH 1BMNH 1Z6JH 1BHXF 4Q7YA 1UJ1A 4BAMB 1MD7A 3PTNA 2BDHA 1LCYA 1Y3VA 5FX6A 1DDJA 1ANCA 3AVZA 3RXSA 3EDXB 1RRKA 3U8RH 1NO9H 1RD3B 1QCPA 1CHOF 3KQEA 3RXCA 1TRMA 1SGIB 1DM4B 1QIXB 2FTLE 2KAIA 1K1LA 3RM2H 2GMTB 3T27A 1FQ3A 1AQ7A 1QTFA 1AGJA 1C2DA 1ZPBA 1KLJH 1WU1A 4AYYB 2WHXA 1HAXB 1OS8A 2VH6A 4Y10E 3U9AH 3WWFA 1TGTA 3SU2A 3ATMA 1EB1H 1VCQA 2ZHWH 2Z3DA 3NRLA 7GCHF 5EJ1A 2BQ7B 4NG9H 4B73A 3OU0A 1S6LA 2BY6X 1ZRBA 1A61H 1LVBA 3RDZA 3LPRA 3RXGA 1GJBB 2ZGBH 1C5OH 4A7IB 3MI4A 4LK4A 2TGAA 3E8LA 4IMQA 3PMHB 1HAPH 3AASA 1Z8RA 1DPOA 1KXEA 1YBWA 3RXAA 1ZMLA 2FS9A 2Y5GA 5LGOA 1FY5A 1GCTB 4HG6A 3GY8A 2YMSB 5HIYA 2ZDMA 2J94A 1C5SA 3A8CA 1GI7B 1SGPE 2AMPA 1W7XH 2XTTB 3RXTA 3SV2H 1UTJA 1TQ7B 2A7HA 2GVFA 5HYOA 2Z9LA 1C2EA 1ANDA 3F6UH 2TPIZ 2BM2A 3BEFB 3RLYH 4O3TA 3MH5A 1PQ5A 3RMNH 1E35B 2IPHA 1KDQB 2R3YA 2ZDVH 5EIYA 2IJD1 2BVSH 2Z9GA 1SMFE 1V2TT 2GDDA 1P03A 2PUXB 2J98A 1HLTH 3SJ8A 1BCUH 4DCDA 4UD9H 1N6YA 4Z1MD 1SGRE 1DSUA 4NWLA 1C2FA 1UK4A 4AGKA 1NM6A 5KECA 3ZVBA 4CRBA 2PR3A 3UQVA 3NCLA 5HGGA 1YPGH 2ANYA 4Y11E 1O2LA 2WPHS 2AGGX 1SB1H 1C1VH 2GJGA 5A8XA 5EW2H 4X6MA 1GJ7B 4JZ1A 1QHRB 1P2KA 3SGAE 5IDKA 3NXPA 4UEHH 1O33A 2BY9X 3MU1A 1OSSA 3QO6A 1HGTH 1ZMNA 3A8DA 2ZFRH 3GICB 5HM2A 1Y3XA 3P8OA 3DT0H 1H8ED 5DK1A 3OYPA 5EXMA 4X6PA 1OX1A 1TOCB 2F4LA 2FOEA 4O3UA 3I77A 1GBCA 3UR9A 2H2ZA 4INHA 1GI1A 2FM2A 1U6QA 5H4IB 2FOCA 1CE5A 3E91A 1F5RA 1DT2A 2SGPE 3DHKH 1TNKA 1FY1A 2BLWA 1INCA 1Y59T 1O2YA 4NFEA 1O3OA 1JXPA 1L0ZA 3MTYA 2PGQB 1NRPH 1BJUA 3S9AA 3GOVB 3ZVGA 1H1BA 5EJZA 3ZV9A 2GCTC 3UFAA 1RXPA 1C4Y2 3LC5A 1ORFA 2Z6BD 4GCHF 5EPYA 4ZUHA 1ABJH 3UY9A 2OC8A 1ELVA 1XM1A 4BXSA 1P12E 2GZ7A 3T26A 1FPCH 3MU5A 4ZKRU 4LOYH 1O2MA 2BD3A 1O2GH 1ELCA 4ISIH 1LHCH 2G51A 3GCTF 1TBZH 1FUJA 1XUKA 4NIVA 1P01A 1IQEA 4I86A 1A2CH 3ZZ4A 1GBKA 3RU4T 3V7TA 1K0HA 1FY8E 2Z94A 3LT3A 1PQ8A 2O8LA 3PWCA 3QN7A 1UVUH 3S0NA 2PW8H 5JBAS 1V2NT 1XXDA 4YZUA 2XCFA 1TX7A 2PSXA 3ZZ5A 1AUTC 3BTFE 1AVGH 1C2JA 2BY7X 3A89A 4JYVH 1P04A 2FX4A 2HVXA 3GCNA 3VG8A 2FTMA 1BOQA 5DGJA 1OXGA 1VKYA 2VH0A 1Q2WA 1W2KH 1Z6EA 3F0PA 3M37A 4OGXA 2ANMH 1G9IE 1QGFA 3BTDE 4MTBA 1HAHH 1VZQH 1TGCA 1O3BA 1C9PA 2F9UA 2BVRH 3KYFA 1C2LA 4K3JA 5DP7A 2BZAA 3T5FH 1DVAH 2CN0H 3TH3H 1C1PA 4CBNA 3V12A 1DXWA 2F9PA 3RU4E 2BYAX 1O31A 3SNDA 2KX4A 3LDXH 3SZEA 3QLPH 1PQ7A 3SYJA 1EKBB 1KLTA 2ZI2H 2Y6TA 5JBCS 3SUEA 1O3MA 5DP5A 2NU3E 1SVPA 3RXHA 2OC0A 5C1UA 3M3VA 1OPHB 3TK6A 1TYNA 1P2MA 2WYGA 5T3HA 5A0BA 1IQHA 2Y81A 3ATLA 3LKWA 4D7FA 2GCHF 2BXUH 4UFGH 1S81A 4Y7BA 1A46H 1GBAA 4K8YA 5KGOA 1WDIA 2SGEE 1P10A 4ZROA 1Z7KA 1YCPK 4U2WA 2OCVB 1O5CB 3ZYEA 2BDGA 1RIWC 3VGCB 4D7GA 2ZGCA 2C4FH 1BMFD 3PMAB 2F83A 4ZHLU 3KL6A 3A8BA 3P95A 1B0EA 1N1LA 2ZEBA 4B71A 2YOLA 3BIUH 1IQKA 1EPTB 3HK3B 3MO3A 1GJAB 5DP6A 3P92A 3RMLH 1HAZB 3NKKA 3MU8A 1J16A 8GCHF 1EP5A 3OEHD 5ETXA 4ZKOU 5B6OA 3CNRA 2M5TA 4WY3A 2TGTA 1ZGIA 3ELAH 3SGQE 1CO7E 2Y82A 2XC0A 4M7GA 1EAUA 2TIOA 4CREA 1LPKB 3EYDA 1PPFE 1D3QB 2YNAA 4UFDH 4ZKNU 1WUNH 2FI3E 4I33A 1G37A 3MO6A 2DE9A 5FBIA 5C0UA 4E7NA 3K2UA 4X8SH 2P8OB 2NU4E 1PPZA 1KXCA 1O3AA 2P93A 5AFYH 4K60A 1ELGA 3ZIAD 1KYNA 1N6XA 1K21H 3ZZ8A 1F5KU 1FLEE 5E0JA 5GNDA 1O3LA 1AMHA 1QL9A 5EJLA 3P17H 1T4VH 1YLCA 4DG4A 3EAJA 1SGYE 2P94A 1UTOA 1ZRKA 2EI7A 3AW0A 2JIZD 2V6NA 1GWAA 4FU7A 4FUHA 2RG3A 1AUJA 5ESTE 1W10U 1TGSZ 1UO6A 2PHBA 3E1XB 4FU9A 2JH0D 1GVLA 3T29A 3LGTA 3U98H 1LPGB 1GG6B 2PKSB 3PO1B 1QB6A 2IJOB 2KZ4A 5JBTA 5JB9S 3VB4A 1TIOA 1YYY1 3GYMA 3PLPA 3TITA 5LPFA 3BG4B 1S82A 4ISOA 3VPKA 3F3BA 1SGNE 5E8EH 2VIVA 1D6WA 4X1SU 2ZU5A 3T2NA 5HM9A 4AYVB 3N7OA 1T31A 1VJ9U 3OAAD 3T25A 5E0HA 4OGYA 4Z6AH 3SQEE 1THRH 2HPPH 3E0NB 1RTFB 3EA9A 2BD2A 1A4WH 2A5IA 2FIRH 2FOMB 3OY5U 1ARCA 4FETA 3K9XB 1GBEA 5EODA 4ABFA 3MNSA 3BIVH 1RJXB 3VB6A 2ZFQH 4UFFH 1Q31A 3RP2A 6CHAC 1BBRE 1EAIA 3FZZA 2Q1JA 3KQDA 1BRBE 2ANWA 2ULLA 2G4TA 2P3TB 3RXJA 2BDIA 2Q6GA 3N7EA 1MKWH 2AGIX 2FWWA 1F0UA 1P0SH 1O2JA 1BJVA 1XMNB 1QJ7B 1VCWA 3PMJA 2QN5T 1O37A 3KYGA 2CF9H 3Q76A 4LXBH 1G30B 5GDSH 4A6LA 1C4V2 4Q4LA 4VGCB 1G3DA 1O3JA 2SGFE 1DSTA 1LVYA 2FEQH 2HRVA 1ZTLA 4YLQH 1V2UT 3B23B 1LKAA 3PB1E 2CK3D 3TGKE 1ANBA 1SQOA 1QQUA 4OS4A 5FBEA 2OBQA 2PV9B 3A7TA 3T28A 1EXFA 2OK5A 4JCNA 1AFQB 3OTPA 5BRRE 2A7CA 2VGCB 1O2UA 2P59A 4A1XA 1DITH 2OC1A 3RXIA 4WVPE 1GJ6A 1HIAB 1FAXA 1TGNA 3AK5A 1O2WA 3ZZBA 2BD7A 2G5VA 1A5HA 4TSFD 1DWDH 2QF3A 2W6ID 4FUEA 1EQ9A 1O3FA 5DN6D 1GDQA 1G36A 3UNRA 4YOJA 1FXYA 1DE7H 2AERH 1KIGH 3UUZA 1UMAH 3Q00A 5DG6A 1HFDA 1K1MA 1W0KD 1ZHPA 4OS5A 1IHSH 5A2MH 2W5EA 4F4OC 3ESTA 1S0RA 2J92A 4XBDA 6LPRA 1ZPZA 5TJXA 2ZPQA 1NBME 2O8TA 3FZDA 5T6GA 2V3OH 3F2HA 2ZCKP 3BTGE 4ABJA 1QB9A 3P70B 4WH6A 3ZZDA 2XXLA 2BDYA 5F8XA 1GGDC 2A4RA 4J2YB 1W7GH 3LJOA 2ZC9H 3BTKE 1KDQA 1SQTA 1LHDH 1YF4A 1G32B 3M5LA 2G52A 4ZAEA 5FXLA 2GV6A 2W7SA 3DUXH 1MU6B 4RKJB 3QGNB 3ODDA 5TCCA 2EC9H 3RXBA 2CHAB 2L74A 1LMWB 5FL7D 1WSSH 1O2SA 2UWOA 5C94A 2BY8X 3MU4A 3DD2H 1KSNA 4K69A 3TH4H 3PV2A 1MABB 2GP9B 3QDZB 3BN9A 1HRTH 4Q7ZA 4DW2U 5GJ4B 2Z9KA 4Y0YE 1QURH 2BY5X 1C1QA 4B1TA 4Y8YA 3EE7A 2F9BH 3ENSB 5I46H 2AYWA 4GHTA 1FDPA 3BEUA 3LONA 4JK5A 1S85A 1O2RA 4PROA 1AIXH 2SFAA 1DICA 4X2WA 2FX6A 2AH4X 4YTAA 2AMDA 4KGAA 5F6MA 1SHYA 1HYLA 3U8OH 2RFKC 2EI8A 3RXPA 4OS1A 1NRNH 1LHFH 4DGJA 4KP0A 1MTUA 2DUCA 1T32A 2M2AA 2BX3A 1C1UH 1DY8A 4WXIA 2GZ8A 5CHAB 2G00A 2ZHQH 3LGVA 1H9HE 2B7DH 4NWKA 1NRSH 3EA7A 4B2AA 1FN8A 1V2WT 2ZFFH 1A0JA 1ZYOA 3U8TH 1Z8GA 4LZ1H 1C5TA 4P02A 1COWD 1NZQH 3HKIB 1TNGA 3FP6E 2WUBA 1FI8A 3H7TA 3JZ2B 2V3MA 4GHQA 1KTTB 4INLA 5DP4A 2RA0A 5DP3A 3SORA 3SO3A 1JWTA 3L3TA 4OS2A 3LGUA 1ZMJA 1P09A 2BX4A 1WCZA 1HAOH 3OFND 2DE8A 3CS7A 4CH8B 2I6SA 4ASUD 5BPEA 1C1OA 1G3EA 3SV8A 3A87A 1EX3A 3PLKA 1HAGE 1MKWK 2FOHA 3TJNA 2VIOA 2OXSA 1C5RA 1N8OB 2QF5A 4JZEH 1K1JA 4WXVA 4MNYA 4M9FA 1P57B 1UTKA 2VIDA 3W95A 4Y76A 4QT8C 1EOLA 2Q6DA 1SFIA 2QYIA 4MQAA 1FONA 4P00A 3MNCA 5PTPA 3KQCA 3MO9A 1V2JT 3NZIA 5FHTA 1OWEA 4I7YH 4DVAU 1FY3A 4BTTB 1Y5BT 2JETB 1KXDA 1C1SA 1BBRH 1BZXE 3F2FA 2NU2E 3GY6A 1JIRA 4B2BA 1YPMH 5ESBA 5FPTA 3BTEE 1C1NA 1CBWC 2R3UA 1O3CA 3ZVAA 3DFJA 5IK2D 3P8GA 1ESTA 1O38A 3RXOA 1V2QT 2HNTF 3RU4D 2NU0E 1SOZA 1H8HD 1UK3A 3BTWE 3SU1A 1A3BH 1Z1IA 1PPCE 1Y5UT 4TY7A 5HIZA 1ZGVA 3SJIA 1SLUB 1NRQH 3RXDA 1P06A 1GMHG 2ZU2A 2EY4C 2BHGA 1QJ6B 4X2XA 1TNIA 2ZQ1A 2VWNA 1SOTA 1ZTJA 1GI2A 2QXJA 2Z3CA 1GL0E 3SJOA 4ZCNA 2GT8A 2J38A 4HTCH 1FMGA 3I29A 1K1OA 1T4UH 2A5AA 3SNCA 4ZXYH 3K6YA 5AVDA 1QA7A 3KCGH 1QZ8A 2TBSA 2Z3EA 4Y6DA 3RC4A 4FVBA 4THNH 1OWIA 2ZIQH 2EQNA 2CF8H 2GGVB 1KMHB 1C5UA 3TLOA 2BXTH 5DSFA 1O3HA 7LPRA 1QJ1B 1W0YH 2XNIA 2FO9A 4I8LA 5I25A 4ZXXH 1EPTA 2WUCA 2FMJA 1P2IA 3VB5A 1WOFA 1TMUH 5JYIA 1V2KT 4MPWA 1P3CA 3F2GA 3ZZ3A 1F0RA 3SUGA 1F7ZA 1F92A 1SG8B 4D8NA 1ESAA 4B6EA 2ZFTA 3W94A 3OX7U 1B7XB 1ZSJA 2QXHA 3ATIA 2IN2A 2JDID 4J1YA 1UTLM 2NWNA 2ZCHP 5L2YH 1YC0A 3NK8A 4YT7H 1E1RD 1TPOA 4ABHA 2HLCA 1GHAG 4AORA 1TBRH 3EA8A 1VCPA 3FO8D 2XCNA 3A88A 2FZZA 1Z8JB 3SU4A 1TQ0B 1NFUA 2BD9A 1JRTA 1HPGA 3FVFB 3RXFA 2J95A 3ATKA 3IG6B 4MNWA 1YPKH 3M3TA 3SGBE 1GHBG 1BTUA 3SHCH 1ELTA 5CHBA 1WXRA 1AN1E 1AI8H 2F9NA 2ZTZA 1K22H 2K0QA 1O2IA 3GCHB 4TT3D 1K1IA 3M5MA 3MWIU 4MPXA 1C5PA 1IAUA 2RDLA 5TCAA 3M7QA 3H7OA 2AMQA 3O8BA 1AY6H 1O5EH 1VITG 2W26A 3KNXA 1TPPA 2D2DA 1EB2A 2BQWB 2GMTC 1O2KA 1YPHC 1B5GH 1TMTH 3U1IB 2GT7A 5DP9A 4ABGA 2ODQA 1EJNA 3RC5A 1FAKH 2G55A 1A5IA 1CGHA 1FX0B 4K1SA 3E3TA 1GVKB 1O5DH 3SUFA 2ODPA 4FOUC 3PMBB 1QFKH 5JDUB 1ELFA 3A8AA 4DOQA 4Y7AA 4BTUB 4K1TA 1HXEH 1BTPA 1GI5A 2XW9A 2W6JD 1MCVA 1SQAA 1CA0B 2VWMA 5EW1H 1NU9A 4FUJA 1OP0A 4IN2A 2V7QD 1GI3A 3H5CB 2D26C 2GV7A 3S7HB 2FI4E 1DUAA 2BOHB 4Q80A 4FUFA 1K1PA 1UTPA 1GBTA 3GDUA 1BBRK 4ABIA 1HNEE 4X1QU 1WQSA 2BVXH 4CRFA 2FESH 1O2TA 3UNSA 4XDEA 2STBE 2B5TB 3LU9B 4U30A 2ZGJA 4Y71A 1GCTC 1HJ9A 1P11E 2YMSC 1K28D 3F1SB 3UOUA 2P16A 3F68H 3F9EA 1BRAA 1GJ9B 2A0QB 2H9HA 1O39A 1GPZA 1VGCB 3GDVA 1YM0A 2XOKD 4A92A 1TLDA 3A82A 3SI3H 3RXUA 1ZZZA 4KTSA 2VIPA 1L4DA 3SNBA 1PPGE 1ZLRA 2IOTA 4FU8A 1SI5H 3RUOA 3SV6A 3UB0A 2A2XH 5L2ZH 5C5NA 4I8HA 3UR6A 2ZTXA 1LKBA 1WBGB 3GY7A 5AFZH 2ZZUH 1J14A 5JPMH 2BZ6H 1S5SA 1UVTH 2LP6A 1FY4A 3S7KB 2FYQA 1TA2A 4R0IA 1P2JA 5GIBA 3EE0B 3C1KA 3MOCA 3QX5H 3HPTB 1Y3UA 4NZQA 3SU5A 2G5NA 2BB4A 5LH8A 2QY0B 1ZSLA 4NA9H 2ZKSA 3QUMP 1P2QA 2BMGB 3P8NA 5F03A 1C1WH 5C1XA 3KN2A 3TIUA 2QF4A 1NTPA 1Y5AT 1VR1H 2A45B 1RS0A 2OP9A 3SU3A 2YNBA 1Y3YA 3UPEA 1MTNB 3SJKA 3STIA 4WF8A 1HIAA 3QZQA 2A32A 3L6PA 1OHHD 1BMAA 3HGPA 1MQ5A 1EP6A 3GISB 2JH5D 1QL7A 1W12U 2O9QA 2C8WB 1NBMD 3A7YA 5FPSA 1A0HB 3SJ9A 1GI4A 1AB9B 3TJUA 1LHGH 2KCAA 3KF2A 1YP9A 1F0SA 3Q3YA 1WYKA 2OLGA 1CT4E 2RCEA 1PPEE 1P8VC 5EG4A 1UTMA 3U28C 1L1NA 1GDUA 1GI6A 3PV4A 1CQQA 2OD3B 1GBMA 3QTVH 4WMFA 1GHYH 1E34B 3K65B 3SN8A 1V2LT 2C8XB 3LJJA
chains in the Genus database with same CATH topology
5FCKA 4FXGH 3EQ0H 5EU8A 3S9CA 1F5LA 2R2MB 1W11U 3FAOA 1TX8A 3R3GB 1C5QA 3M5OA 1YCPM 3GY4A 1HUTH 1TNLA 4ZMAH 4FUCA 1RFNA 1T8NA 4X1NU 5FAHA 1CGJE 3ZYDA 3ODFA 3AAVA 3UWIA 2V3HH 1NS3A 1NT1A 1BRUP 3U1JB 3GY5A 3GY3A 2ZDNA 3LGIA 5HMAA 5J4SA 2BLOA 3RLWH 1MCTA 2WPKS 2J2UA 2VIWA 1P05A 3BTHE 2XBVA 3PWBA 4Z0KA 1GJ5H 1SR5C 2Z9IA 4CHAB 1IHTH 4R8TB 1E37B 8KME2 2BQ6B 1GMCG 1MTVA 1FNIA 1TNJA 4ISHH 1TBQH 3IWMA 4HI3A 1VJAU 2OUAA 2SGQE 3FANA 4IC5A 5GXPA 1Z71A 1YPJH 1AKSB 4B76A 3QWCH 5AF9H 4JMYA 3S69A 1LDTT 4BAOB 1O3DA 5L6NH 1ACBE 1OWJA 1YPLH 3BSQA 1P9SA 1ARBA 2GKVE 2OINA 2BOKA 1O2NA 1MH0A 1XVOA 2ZHFH 3QGJA 3NWUA 2ZF0H 3VXEH 5JB8S 1O3EA 2G81E 1Q3XA 1BMMH 2CJIA 1ZR0A 4JYUH 1IQJA 2UUJB 1MU8B 1MAYA 1ESBA 4GSOA 5K0HA 5E0GA 2EA3A 1Y8TA 1GJDB 5E2OA 1C5LH 1WV7H 3RMMH 4ABAA 1MZAA 1CU1A 3G01A 3A83A 3TPIZ 1AVWA 2ZNKH 2SGDE 1DS2E 2Q6FA 4Y8XA 3UQOA 1QBVH 1W0ZU 8ESTE 3Q3XA 3VGCC 3IITA 1BA8B 4RSPA 1TOMH 1MKXH 2C8YB 1PFXC 1D3TB 4U32A 1QL8A 2VVCA 1G3CA 1O34A 2CGAA 1SGCA 3GY2A 4SGBE 1GCDA 1GMDG 2R0LA 3L33A 3MNBA 1SFQB 2AIPA 1GMHF 2ZO3H 1EPTC 2HNTC 1HDTH 1MTWA 2NU1E 1O3PB 1EZXC 1XUJA 2FOAA 1P2OA 3A84A 4TPIZ 3M3SA 5A8YA 1HCGA 3I78A 1V2ST 3PROA 6GCHG 3FP7E 1IQMA 2A4QA 1HAVB 1J8AA 5JBBS 5EGMA 1BTHH 3SOSA 1LVMA 4INKA 1MUEB 3UOPA 3ZVFA 2BDAA 3RMOH 1O3IA 2VVVA 5EXLA 1UVSH 3HGNA 2GX4A 1BUIA 2XBXA 1C2HA 2WPIS 2P8OC 3OSYA 1EATA 3RXVA 3A7WA 4KKDA 2AFQB 3ZZAA 1NRRH 1BTZA 1IQLA 1V2PT 1YGCH 1C2GA 2H1UA 3SI4H 1NN6A 4CR9A 1C5WB 4OS6A 1ID5H 1L2EA 3VB3A 1W13U 3SUDA 1MBMA 4WH8A 1FN6A 1O0DH 1AWFH 4KTUA 3KIDU 4YLUA 4AN7A 4H6TA 1NFWA 3BEIB 4I32A 1GHAF 4GAWA 1H9LB 1LQDB 3MH7A 3LGWA 1V2RT 2BDBA 4O97A 1O3NA 1NPMA 4YOGA 3S9BA 1O35A 2UWPA 4AOQA 4YM9A 4MPUA 1GG6C 1QRZA 2PKSC 3B8JA 1GHBF 3F9GA 3PO1C 3TK5A 4NZLA 1DXPA 4CH2B 4ZHMU 2CMYA 1BTWA 1DY9A 4K5ZA 3BG4C 3LIWA 1PQAA 3MNXA 4MLFB 1AHTH 3SZNA 5EPNA 4E7RG 3D49H 1VITF 4ISNA 1C9TA 1RGQA 4IS5A 4U01A 1DOJA 2PLXA 1MMJN 2C8ZB 1T8MA 3SV7A 1HB0B 1EZUC 2H9TH 3TNTA 1AO5A 4CRAA 4B75A 2OQUA 2QA9E 1UHBB 9LPRA 1C5YB 4TPYA 2A5KA 1GBBA 2Y7XA 2VU8E 1ETSH 2ZU3A 2B9LA 4XSKU 2R0KA 1P3EA 5AHGH 4JYTA 1LHEH 1V2MT 2GCTB 1MD8A 2R9PA 4X1PU 4XOJA 1HBTH 2F9OA 1CA8B 1UCYE 1YPHE 2QAAA 4I31A 3Q77A 4LZ4B 2V0BA 1A3EH 2RA3A 4CRGA 4JK6A 1K9OE 3AAUA 1BB0B 1GHWH 1BQYA 5J4QA 4CR5A 4UE7H 2A1DB 4DY7B 1O5AB 1XXFA 2A4OA 1JOUB 1O2VA 4VGCC 1TPAE 4IMZA 1OYQA 2TGPZ 3MH4A 2GDEH 2Y5FA 1OP8A 1ELAA 1AE8H 2UUYA 2G8TA 3VB7A 2HOBA 1MKXK 1SL3A 2J34A 1CGIE 1D3DB 1GHVH 1GJ8B 1SGFG 1C5MD 2ZWLH 3B9FH 2VWOA 1AFQC 4NIYA 2VGCC 3A7ZA 3NPSA 1W14U 1C5XB 3O8RA 5GCHG 2QF0A 5F8ZA 1A0LA 1OWHA 3K6ZA 1D6RA 1UTQA 5EQRA 4Y79A 3CP7A 1ETTH 4X8VH 4GVUA 4ZH8A 1GJ4H 4F49A 1FJSA 2O8MA 1O3GA 3KQBA 1PPBH 4GUXA 2STAE 1KXAA 1E38B 3URCA 1ELEE 1P9UA 4XBCA 3RXMA 3V0XA 3HATH 1O5FH 1LQEA 1BTXA 2ILNA 1C2IA 3LOXA 4O03A 3V13A 2B0FA 2FPZA 1TPSA 1UK2A 2A7JA 1L4ZA 2ZDAH 3ZZCA 3FP8E 1HJAC 3RXLA 2VB0A 3V3MA 1S84A 1TONA 2AS9A 2PKAB 2GD4B 3M5NA 1YCPH 3VXFH 4B2CA 5L30H 3D62A 1EJMA 1RIWB 3NUMA 5EOKA 2FDAA 1SGQE 3SNEA 5K7RA 4O9VA 5FPYA 1GHXH 1IQNA 2G4UA 2CHAC 1EAXA 5A0CA 4HZHA 4AB8A 5DKMA 3LGYA 4BNRA 1J15A 3LH3A 1X7AC 3BTQE 3E0PB 1F0TA 1SHHB 2XBYA 4ISLA 3SQHE 1NFYA 3SU0A 4RN6A 2F3CE 4AZ2B 1UVOA 4UONA 4XBBA 4NCYA 4NA7A 2OQ5A 4AG1A 4X2YA 4NSVA 2A4GA 1SBWA 5CMXH 3RXRA 2BD5A 1GI0A 1AVXA 3TVJB 1C4U2 1YKTA 4MVNA 1F2SE 2FOBA 3CS0A 1XX9A 3QTOH 4YT6H 5LPEA 2P3FH 3PYHA 1O32A 4NGAH 2PUQH 4DJZB 4DT7B 2I6QA 1C5VA 1NESE 1Z1JA 3C27B 2J4IA 1TMBH 4BAHB 1FV9A 2BD4A 2QXIA 3WY8A 3KEEA 1O5BB 4CRDA 4XE4A 2QXGA 5CHAC 1XUFA 4H6SB 1A1RA 3O8DA 2C93B 2JKHA 4FUIA 3ZZ6A 1TGBA 1J17T 1QRXA 4X1RU 2XRCA 1GMCF 1HXFH 2XC4A 3PM3A 4JZFH 3RXEA 2WPMS 3TJVA 3O8CA 2KAIB 1MBQA 3F9HA 1O5GH 2VJ1A 2LNCA 4HGCA 1LPZB 1BDAA 4FUGA 3VEQB 4UFEH 2EI6A 1TRNA 2ZU1A 1K2I1 2J9NA 3RM0H 4X0WU 1D3PB 5C5OA 1EJAA 1T7CA 3D65E 1KY9A 1N8OC 1IOEA 1EZQA 2H6MA 1TFXA 2ZG0H 2BDCA 4WWYA 5FCRA 5DJ7A 1AD8H 4X8TH 3JZ1B 1GJCB 2W7UA 1P2NA 3ZZ7A 3A86A 4H42U 1WAYB 4JZIA 1QNJA 1G2MA 1ZHMA 1T8OA 3P6ZB 1SC8U 3DFLA 1BRCE 1SLWB 5A09A 1BHXB 1CHOG 1TWXB 5E2PA 3ZZ9A 4NFFA 3TGIE 3QK1A 1ZHRA 2BD8A 2JETC 1FIWA 1O2ZA 3F9FA 4D9RA 3E16B 1BIOA 1S6HA 2O8WA 1UTNA 2ZCLP 1PYTC 1AKSA 2TGDA 1TE0A 1GBDA 1UCYH 1AE5A 1XUIA 4K8BA 4IBLH 1SGTA 2ZHEH 2HGTH 2ALPA 6CHAB 3PLBA 4B74A 2ODYB 3MFJA 4X8UH 3HK6B 5EQQA 4E05H 4A1TA 2QIQA 2UUKB 5GWZA 1P02A 1GMDF 3M61U 4RKOB 2Y80A 1CHGA 3A81A 7ESTE 2WPLS 1AZ8A 2HALA 1CT0E 1TALA 1DWEH 5EXNA 4A5TS 1O2OA 7GCHG 1O36A 4HFPB 3ZVDA 1TB6H 1XVMA 2UWLA 1MTSA 1ZTKA 6GCHF 1T8LA 2K1QA 1GL1A 3A85A 4YESB 1J9CH 1LTOA 3SHAH 5FX5A 3T62A 2ZQ2A 4ZKSU 4FVDA 4X2VA 1THPB 2HNTE 1OP2A 1DUEA 1SGEE 1ANEA 2VNTA 4AG2A 2PGBB 2XWAA 3QZRA 1IQGA 2VWLA 1O2XA 2SNWA 1ZOMA 2FS8A 5DPAA 5C2ZA 1BMLA 1EAWA 8LPRA 2XC5A 1CVWH 1DANH 4MDSA 1G3BA 1ZJKA 1NY22 1XKAC 1O3KA 2PSYA 1GBIA 1ETRH 2OC7A 3LH1A 4I8KA 1A5GH 4IN1A 4NA8A 3BF6H 1JMOH 1OOKB 4CBOA 3SU6A 1DWBH 1JBUH 1NROH 3TNSA 1BT7A 2FOGA 2H5CA 1GVZA 2WINI 3OTJE 2A31A 3SBKA 1KTSB 1ABIH 1LVOA 4ABDA 1TNHA 3SNAA 2THFB 4IC6A 4YO9A 1HAVA 1TA6A 1NU7B 1GBLA 2FOFA 4DIHH 4D76A 1WQVH 2PFEA 4MPVA 1OKXA 1OWKA 1TAWA 3UTUH 5DP8A 4GLYA 1XKBC 1AU8A 1QBNA 1DFPA 1AZZA 5LPRA 1GGDB 1O30A 2SNVA 4AFQA 2V35A 1SGDE 3M7TA 1C1RA 1BTYA 3PTBA 4OS7A 2O8UA 1SSXA 1ZJDA 2F9VA 5EQSA 2AEIH 2Z9JA 4WMEA 3TU7H 2EEKA 2ZPSA 2BLVA 1TABE 9ESTA 2WPJS 3BTTE 1DLKB 1NC6A 3GCHC 1MAXA 2ZA5A 1S6FA 1DWCH 4MNVA 2ESTE 3TH2H 2FLRH 2A2QH 4CRCA 1FZZA 2GZ9A 2HWLB 1HAIH 3GCOA 3A7XA 1S83A 4YOIA 4AFZA 4H4FA 1A7SA 2ZGHA 3LC3A 4KELA 3TK9A 3BG8A 1V6DA 1O2QA 2PTNA 3A80A 3M35A 4MG3A 1CSOE 1ELBA 1ZSKA 5A8ZA 2W3KA 3SW2B 2QC2A 1O2HA 3ZVEA 4DIIH 2ZECA 3URDA 3M7UA 1YPEH 3STJA 2CXVA 1HAYB 4GCHG 2ZFPH 3KGPA 2FODA 1K1NA 1CA0C 2FYRA 2ZPRA 4AFUA 1W8BH 5C20A 1O2PA 1D4PB 5T6DA 2HPQH 4ABEA 1L1JA 4SGAE 2QGRA 1FIZA 2AGEX 4GPGA 3GCTG 2BTCE 2ZGXH 1AFEH 2XWBI 4NIXA 1EOJA 3ZVCA 4X6NA 1WTHD 2ZFSA 1EUFA 3SV9A 1UHBA 3UREA 1UCYK 3MU0A 2OBOA 3CENA 5HXFA 1QR3E 4TWYA 1VITH 3R0FA 4E06H 3MMGA 1TRYA 4WMDA 5C67A 1V2OT 1NFXA 1VGCC 2W3IA 1L1GA 1TX6A 2H5DA 3FFGA 3HKJB 3U69H 1KXBA 5GCHF 4Q7XA 5F8TA 2B8OH 3OY6U 1ELDE 1RTLA 2SGAA 1KLIH 5DO4H 1MZDA 1H4WA 1E36B 2F91A 4BAQB 4JZDH 2UUFB 2OTVA 4D9QA 1GDNA 3RC6A 1SLVB 1Z8IB 1C2KA 1IQFA 4AGJA 2C3SA 5G4BA 2FLBH 4KTCA 3MYWA 4AX9H 1QRWA 1PJPA 2P3UB 1MQ6A 1EASA 3BTME 2QCYA 2ZP0H 4TY6A 3TJOA 2Z7FE 7KMEH 2H9EH 1GI8B 1UVPA 4K1EA 1C2MA 3RXKA 1PYTD 4DURA 4I8GA 5ABWA 2ALVA 3Q3KA 3BV9B 6ESTA 4IGDA 5SGAE 1Y3WA 3MHWU 1QBOA 2GCHG 2WV4A 1CBWB 2FXRA 3E90B 3TGJE 1MTNC 3A7VA 4TWWA 1GI9B 1B0FA 1GBHA 1JIMA 1GBFA 2PWXA 1SGFA 4Q2KA 1RTKA 2ZDLA 2ASUB 1KXFA 2CV3A 4MNXA 5C1YA 2ZTYA 4ZHAA 4A1VA 1AB9C 1DX5M 3DA9B 2QV1A 4BTIB 2VINA 1QB1A 1XUGA 1YLDA 4Y8ZA 1G2LA 2D8WA 4AFSA 1H8DH 5IYTA 2GTBA 1CT2E 3GDSA 1ZPCA 3MH6A 3D23A 1C5NH 4TYDA 4BXWA 3UNQA 3UWJH 8GCHG 4X6OA 3UIRA 1HJAB 4Y0ZE 1DLEA 4AB9A 2C90B 1C1MA 3EGKH 2PKAA 1HV7A 2JH6D 2D1JA 4NIWA 3ZV8A 1GBJA 2BLQA 1XUHA 2FP7B 5GPIB 2XBWA 3GYLB 4ABBA 1QQ4A 1M9UA 1SLXB 4WJG2 5A0AE 1D9IA 2VIQA 3E6PH 1C5ZB 1H8IH 1JRSA 2R2WU 2ZDKA 3ITIA 1QA0A 2ZHDA 4FUDA 1OWDA 4I8JA 1OYTH 4BOHA 1E0FD 3KHVA 4FUBA 2ZU4A 3ATWA 2PTCE 4K2YA 1H9IE 2WYJA 2TRMA 2Y5HA 2P95A 3RXQA 5T6FA 4ESTE 1HJ8A 4BAKB 1AWHB 4CHAC 4NSYA 1SPJA 1THSH 1V3XA 1BITA 1FPHH 1V2VT 2FI5E 4ASHA 2AIQA 1PPHE 1QY6A 1C1TA 4IW4E 1LO6A 2Y7ZA 4XFQA 3M36A 2LPRA 4BANB 2XYAA 1GHZA 1IQIA 1EZSC 2VVUA 2WV5A 1WTGH 3P8FA 5CE1A 1W3CA 5C3NA 3AW1A 4UDWH 1S0QA 3VFEA 2ANKH 1BMNH 1Z6JH 1BHXF 4Q7YA 1UJ1A 4BAMB 1MD7A 3PTNA 2BDHA 1LCYA 1Y3VA 5FX6A 1DDJA 1ANCA 3AVZA 3RXSA 3EDXB 1RRKA 3U8RH 1NO9H 1RD3B 1QCPA 1CHOF 3KQEA 3RXCA 1TRMA 1SGIB 1DM4B 1QIXB 2FTLE 2KAIA 1K1LA 3RM2H 2GMTB 3T27A 1FQ3A 1AQ7A 1QTFA 1AGJA 1C2DA 1ZPBA 1KLJH 1WU1A 4AYYB 1HAXB 1OS8A 2VH6A 4Y10E 3U9AH 1TGTA 3SU2A 3ATMA 1EB1H 1VCQA 2ZHWH 2Z3DA 7GCHF 2BQ7B 4NG9H 4B73A 3OU0A 2BY6X 1ZRBA 1A61H 1LVBA 3RDZA 3LPRA 3RXGA 1GJBB 2ZGBH 1C5OH 4A7IB 3MI4A 4LK4A 2TGAA 3E8LA 4IMQA 3PMHB 1HAPH 3AASA 1Z8RA 1DPOA 1KXEA