1SQRA

Solution structure of the 50s ribosomal protein l35ae from pyrococcus furiosus. northeast structural genomics consortium target pfr48.
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
87
structure length
87
Chain Sequence
MRIKGVVLSYRRSKENQHNNVMIIKPLDVNSREEASKLIGRLVLWKSPSGKILKGKIVRVHGTKGAVRARFEKGLPGQALGDYVEIV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 50S ribosomal protein L35Ae
publication title Solution Structure of the 50S Ribosomal Protein L35AE from Pyrococcus furiosus: Northeast Structural Genomics Consortium Target PfR48
rcsb
source organism Pyrococcus furiosus
total genus 8
structure length 87
sequence length 87
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01247 Ribosomal_L35Ae Ribosomal protein L35Ae
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.190 Mainly Beta Beta Barrel Thrombin, subunit H translation elongation factor selb, chain A, domain 4 1sqrA00
4ACAA 4AC9A 2LP6A 4ACBA 1SQRA
chains in the Genus database with same CATH superfamily
2F9VA 1VGCB 3GYLB 3ZZCA 1C1QA 1CU1A 2A45B 2KZ4A 2WYJA 1O3IA 2IOTA 3RP2A 2H1UA 2JJ2D 3QTOH 1V2MT 3KQDA 4GCHG 1L1JA 4TWYA 2PUQH 2ZHDA 2FPZA 4I86A 3KNXA 3DCLA 1WOFA 4M9FA 1P2JA 1ZTJA 1W3CA 4GHTA 1XUHA 5EJZA 2BD4A 1O2QA 3QO6A 1EATA 4JZDH 1P2KA 1GJ5H 4IW4E 4X6NA 4NSVA 2ZGXH 4AX9H 1C5LH 1GVZA 2JJ1D 2FOGA 3F6UH 2CF9H 1BITA 4A7IB 2AGGX 3VB5A 1K0HA 2VINA 2A4OA 2AHME 1SSXA 3UQVA 2UUFB 4ZHAA 3LH3A 2AIQA 4K8YA 3RU4E 5JBTA 2P8OB 2WHXA 3PMJA 1UJ1A 1UTNA 1NC6A 5JBAS 4TPIZ 3OU0A 1TGSZ 2BDYA 5FPSA 1GGDB 1O3LA 3DA9B 1O3JA 4H4FA 5FXLA 2XOKD 1TLDA 3A80A 2EEKA 1CA8B 1YBWA 1HXFH 4HG6A 3A88A 1Q2WA 4XE4A 2FODA 3CNRA 2WPIS 2V3HH 1ELEE 3BG4B 1QRZA 5HYOA 2OUAA 4XBCA 1COWD 2XC0A 3MQKC 1ZJDA 4THNH 1N1LA 2VIOA 4ACAA 5HM9A 2SGAA 4B74A 3M7UA 5LPFA 2G81E 5HM2A 1V2WT 3T26A 3GDSA 4NWLA 1C2IA 1S83A 2VWOA 4GHQA 2BDCA 1A5GH 2VJ1A 5G4BA 1QL7A 1G3DA 3UIRA 1BHXB 1ZOMA 3NZIA 2W5EA 1O2KA 1OWHA 1SB1H 3PV2A 1IQMA 1K1OA 1W10U 4DY7B 2A4QA 2A7HA 1TABE 3RXKA 1YCPH 1HNEE 1CHOG 1DWCH 1ESTA 4QT8C 1CSOE 2G00A 4XSKU 3C1KA 3P8NA 3EE0B 1GHAG 3AAVA 1PQAA 1BBRH 1EAXA 2ANKH 3V12A 7ESTE 1D3DB 2BQ6B 2WZQA 1ESAA 4XFQA 4Q4LA 2LELA 1GL0E 3TU7H 1YLNA 3FANA 4FUDA 1OHHD 4ASHA 2VIPA 1LQEA 1AZ8A 4WH6A 2C90B 3BEFB 5SGAE 1H8DH 2LPRA 3PB1E 1Y3XA 1BMAA 4OM9A 1KIGH 5A0BA 1TWXB 3E3TA 2G4TA 1OKXA 1TNKA 1LTOA 3FFGA 2ODQA 1AB9B 2WV4A 2YOLA 4ABJA 1ETSH 2V3OH 2BD7A 2JIZD 1GI5A 3KF2A 4GSOA 4J2YB 1G2LA 5EJ1A 2O9QA 1IQEA 4K3JA 2QXJA 1O2GH 4LXBH 1G3EA 2FYQA 3GCHC 1PFXC 1AWHB 1S81A 2H9TH 3LIWA 4Q7YA 2BY6X 4ACBA 1TX8A 3UFAA 1EOJA 4MDSA 1A0LA 2BXTH 1HBTH 4NCYA 4DJZB 1WTHD 1UVTH 4KKDA 4NIVA 3OSYA 3MU8A 2B0FA 3S7HB 5E0JA 1GHBF 1NRNH 3TLOA 2J2UA 5K7RA 1T31A 3MNBA 5AF9H 2BVSH 3FP6E 2R3YA 1O2YA 1TQ7B 1C1PA 1OP8A 2FOAA 3U69H 4F49A 1SGIB 4I8JA 4Z1MD 1C2FA 3FKSD 3UOUA 4F48B 1V2NT 3GISB 4GVUA 2ZTXA 4YESB 2UWPA 5F03A 1YYY1 2F91A 3TPIZ 1GJCB 5F6MA 3PRDA 3RXRA 5C67A 3KHVA 2D26C 3BTFE 3OE7D 1EASA 3LT3A 4MNVA 1C5SA 5C17A 1C5MD 4IMQA 1GG6C 1HAZB 1O3FA 2P93A 1KLJH 5LH8A 4SGBE 1V2LT 3U8TH 4ISHH 1EPTB 3OY6U 1T8OA 2ZCLP 3IITA 1S5SA 1UTLM 3OEED 1H1BA 3O8RA 1ZTLA 1ORFA 2KCAA 3L3TA 5EW1H 1O3KA 1HAVB 4OS4A 5GDSH 1NN6A 3MO3A 2YNAA 4FU7A 2AIPA 4LOYH 3BTQE 1TPAE 4WMFA 5EU8A 1OP0A 3AK5A 1C4U2 3TJNA 1HB0B 3F68H 3KQ5A 1ZHRA 2PSXA 1TONA 1GJDB 2Q6GA 3SO3A 3BN9A 2R0LA 1FMGA 4D76A 3PTBA 3K6YA 4U30A 1GI4A 3N7EA 1AGJA 1O39A 5FCKA 1EPTA 3A7YA 3LGWA 3SV9A 1J15A 2VWLA 3VGCC 2BY5X 1K2I1 4X1SU 1C5TA 1DWEH 1HAVA 1V2ST 2FYRA 3KL6A 4P00A 2CF8H 5IDKA 3SW2B 4D7FA 2QC2A 3O8BA 5J4SA 4INHA 3GY3A 1ABJH 1L1NA 1BJUA 1BRAA 2OK5A 1YCPK 3H7OA 3SJOA 4CRDA 2A32A 1ELBA 4UFFH 1GHXH 1W7GH 2C93B 3TK9A 2I6QA 1A0HB 2GV7A 3RXHA 4IMZA 5CHBA 3LDXH 4ZKRU 4NIXA 5T6FA 2ZDVH 2SNWA 4DIHH 2CGAA 1A2CH 3DSPA 1ACBE 3EGKH 3FP7E 2FZZA 3RU4T 1BBRK 1QBOA 1A5IA 2FLRH 3E6PH 1IQKA 4BAQB 1GBHA 3FZZA 3HKIB 4YTAA 3A7WA 1JIMA 1IQLA 1DSTA 1SOZA 1TX6A 2ZU3A 4B2CA 1SGQE 3KEEA 1HV7A 1EP6A 5EG4A 2ZFSA 5DP6A 2BYAX 1A0JA 2H9HA 3SYJA 2WUBA 1RGQA 5HIZA 2HGTH 4JK5A 4VGCB 5ESTE 3Q00A 1MBQA 1G37A 4KGAA 2G52A 5FBIA 1FY3A 3H5CB 2XC5A 2SGPE 4DVAU 1BTZA 3U8RH 1W0KD 1FPCH 3JZ2B 3B23B 1YPHC 4XD7D 1P2NA 1FJSA 1CT0E 3HPTB 2ZA5A 3RXUA 1P2IA 1O2XA 2FI5E 5PTPA 5JB8S 1RTLA 3TK6A 1P2OA 1TGNA 1QB6A 3HGPA 1BTUA 2FTMA 2HOBA 5EQSA 2BY7X 3ZV9A 1GJ8B 1CHOF 3QLPH 1E34B 3SU0A 1YPEH 1LHCH 1ZMLA 4RKOB 4Z0KA 1MD8A 2ZU4A 3QWCH 1JOUB 3ZZDA 3GY5A 1F2SE 2FOMB 1A4WH 3SNCA 4XBBA 2ESTE 2VVUA 1O2UA 1HDTH 1LHGH 1XUIA 4F4OC 5CHAB 1OYQA 3AVZA 2VH0A 4DGJA 3AAUA 5DP8A 1DT2A 4ESTE 1GDUA 3M5LA 2KAIB 1C5ZB 2O8TA 2HPQH 1LVYA 1O3BA 4LZ1H 3M7TA 2RDEA 1GBDA 3BIUH 1ZPZA 1YF4A 1W0YH 4J1YA 3VB6A 3ZZ5A 1RJXB 1HPGA 2BXUH 3RXMA 2OINA 2VB0A 1GMDF 1MTSA 5H4IB 4FU8A 1K1NA 1F0SA 3DT0H 4NFFA 3A7XA 4HI3A 3LGVA 3P17H 1KDQB 1RIWB 2ZU2A 1F0TA 1ZSKA 4MPWA 1C2LA 5K0HA 1IQIA 1O5AB 3E0PB 4ABAA 4BTIB 5KEDA 2KAIA 4K69A 5EIYA 1UHBB 1GVKB 2IPQX 3SUFA 3HGNA 4X0WU 5HKKD 1H8IH 1DITH 1KY9A 2CK3D 1K28D 1PPHE 3F2GA 3OYPA 1KXCA 1C4Y2 3TH2H 5JYIA 1H8ED 4FUGA 4NFEA 2B9LA 3GCTG 7GCHG 2C8YB 1AVGH 1HAIH 1D3TB 3I77A 1T4UH 2HVXA 1BQYA 4ZCNA 1HLTH 5AFZH 4BTTB 3TGIE 4JYUH 1TX7A 2GDDA 1KDQA 1WU1A 1ELFA 1DM4B 3A7VA 3PO1B 3S9BA 2KFWA 1GHZA 2PUXB 1LDTT 1F7ZA 2ZHEH 4WMEA 1EFRD 4X6MA 1UHBA 2R2WU 2ZZUH 5TCCA 1FIWA 2ZKSA 2DUCA 3A89A 3RMNH 1O32A 4CRGA 2BDAA 3EQ0H 2ZCKP 4BXSA 1FLEE 3SV7A 1P9SA 2GCHF 2J98B 2JDID 3BSQA 1BMFD 5ETXA 4YLQH 3BTME 2NU3E 1O37A 1ZPBA 3RU4D 2FOEA 2CV3A 3GICB 5DSFA 1C2HA 1K1PA 2F9NA 3RM0H 1OP2A 4WMDA 1DDJA 1UTOA 2XBYA 3CS0A 3M36A 4Y76A 2YMSC 4P02A 5J4QA 4CBOA 4B1TA 4NA9H 1BMNH 1AY6H 3MU1A 5L30H 5JPMH 2ZU5A 3RMMH 1NTPA 1TBZH 1XXDA 4CHAC 1GBMA 1YWUA 3B9FH 1V2TT 3IG6B 4H6SB 1AD8H 1ZYOA 4K5ZA 1YLCA 1QZ8A 3T5FH 2HLCA 5EPYA 1CBWC 3KYFA 4H6TA 1YPJH 2GCTC 2XBWA 1PPEE 1EXFA 5E0GA 2J98A 1HRTH 1GHWH 2WPLS 3ZVCA 4BAKB 2SFAA 1CA0C 1YM0A 1GBEA 2GT7A 3D49H 1DPOA 4NZLA 4TPYA 1TQ0B 1BCUH 1FN6A 1SKYE 1UCYH 1AIXH 1GI9B 1C5QA 2ZEBA 3A8CA 1IHTH 1O2JA 1SGFG 1V2RT 2F9OA 4AORA 1P2QA 1BDAA 4U2WA 5BRRE 3ELAH 1O2VA 2ALVA 1S6HA 1C5UA 4Y11E 1O2MA 3SNEA 1FNIA 3OAAD 2JETC 1O5FH 4GAWA 3SUEA 1MCTA 1ELCA 2VIWA 4WH8A 4FUEA 1XUJA 1YGCH 1GJAB 1O2IA 1Z1JA 3F2FA 3E1XB 2FDAA 1MAXA 3W94A 1QHRB 3A7ZA 2GD4B 3UNRA 1DSUA 3WWFA 1C2KA 1V2VT 1YKTA 2TGTA 4K1SA 1C5PA 2OD3B 1YPHE 3ATIA 1T4VH 2W7UA 3M35A 1YLDA 3P8FA 4AOQA 2Y7XA 4ZKNU 3T27A 1A3BH 3A83A 3DSGA 1ETRH 1QIXB 1NFWA 1AFEH 3FN8A 4ZKSU 2Y5HA 3GYMA 4FVBA 1C5VA 3TK5A 3V3MA 4BAHB 1ANBA 2G8TA 4ABHA 6CHAB 1A3EH 4K1EA 1MABB 3I78A 3W1EA 4AN7A 4E05H 1SHHB 1SFQB 2PGQB 1WBGB 4AYYB 1MD7A 4ISOA 1M9UA 2O8WA 1S84A 1PPFE 2PV9B 3DHKH 1G3BA 1GBBA 2A5IA 1TPSA 2WSSD 4OGXA 3ZYEA 4ABGA 4HTCH 1ANDA 1S0RA 1K1IA 1THPB 3STIA 2ZHQH 2WPJS 1L4DA 4BOHA 3NXPA 1L2EA 1KSNA 1ZSJA 3BTGE 1UK3A 3ITIA 1PQ5A 1MH0A 2A5KA 4TYDA 1HYLA 2PHBA 3PV5A 4CRAA 1RD3B 4GUXA 3SNAA 1HJ8A 1EZXC 4B6FA 2OQ5A 3F9GA 4I7YH 3BV9B 1NU9A 1TGTA 1P57B 5EOKA 3MNSA 3RMOH 3RXVA 1SL3A 2SNVA 1GI3A 1EJMA 1BRBE 4A92A 3ATMA 1BTWA 1GI6A 1E1RD 1G9IE 1V2JT 3GCOA 4Y10E 4MPUA 8ESTE 5HIYA 6GCHG 1F5KU 1TOMH 3SV6A 1ZSLA 1PQ7A 1O5EH 1TOCB 1QJ1B 3F9EA 3U1IB 3MOCA 1BJVA 4X2WA 4BAMB 5T3HA 1SOTA 2PR3A 1IHSH 4I8KA 2FMJA 1SGTA 3UPEA 3UREA 2ZF0H 1C1VH 1GBJA 3RXOA 3N7DA 1O36A 2M2AA 1ELDE 1O3PB 3SHCH 1INCA 4O97A 2OC7A 2HPPH 3ZZAA 4MPVA 1A61H 1ZGVA 3RLYH 3SNBA 2J95A 2RG3A 3EYDA 1P05A 4KP0A 1GI1A 1SGEE 5GCHF 1B5GH 3JZ1B 1KXDA 1TYNA 2BDHA 4JZFH 3EA7A 2TBSA 1AFQB 2H6MA 1W13U 4Y6DA 5A0AE 1O5BB 1C1OA 1V6DA 2HWLB 2XW9A 1S0QA 1WQSA 1WTGH 2FX6A 1GMHF 3URDA 3M3SA 2V3MA 1UCYK 1UCYE 3ZYDA 4YT6H 3BTKE 1O3EA 2VVCA 1PPGE 1CT4E 1O33A 1ZLRA 3PWCA 4HZHA 4MTBA 1QCPA 1O31A 3RC5A 1LPKB 3L33A 2NWNA 2PKSB 4AB8A 5E0HA 3AW0A 1WYKA 2ZC9H 3LONA 2QF5A 4AG2A 3CENA 4LZ4B 2ALPA 4BXWA 1UO6A 1ARCA 2JH6D 4F55A 3ODDA 1MZAA 3M3VA 1JMOH 1AO5A 1MKXH 1GBCA 2VVVA 1ANEA 4UDWH 2GP9B 5C5OA 2BD5A 4ABIA 4GLYA 2STAE 4O3UA 2PTNA 4Q7XA 4YOIA 2BLOA 4CBNA 5EQRA 1E38B 3QZQA 3SU1A 2A2QH 4BTUB 3PMAB 4O9VA 2JH0D 4LK4A 1FQ3A 2UUJB 3T25A 3TVJB 2GX4A 2QY0B 1C4V2 3ZZBA 3S9CA 2PTCE 4MPXA 3STJA 1ZRBA 3UQOA 3NK8A 1FY4A 1OPHB 1P06A 2VU8E 1MTVA 1DY9A 1LVMA 3OFND 1C1WH 5EPNA 5A8XA 2ZFQH 1HAXB 2C8XB 4CRFA 1ELAA 1UTJA 1HXEH 1FAXA 5B6OA 2QN5T 5IK2D 1QGFA 4I32A 2FP7B 1BTXA 1SGRE 4WXVA 1MTNC 1Z71A 4TWWA 3PO1C 3TJUA 1IQHA 3H09A 3B8JA 2GZ9A 3BF6H 4FETA 1P03A 1AVXA 4Q2KA 1TNGA 1C1MA 1SC8U 3U9AH 4X2XA 2XCFA 1O3NA 2Y6TA 3V13A 1WDIA 5C1YA 4X8VH 5DK1A 2ZGBH 1GBFA 2DE8A 2ZTZA 2ZDKA 2Y81A 1DANH 4R0IA 4OS6A 4FUIA 1LPZB 2PFEA 2CHAB 2VIDA 1D4PB 1GMCG 1Y3YA 4DW2U 3ZZ7A 1UVPA 4O03A 4A1VA 1MU6B 1ZGIA 4D9QA 1P12E 2TPIZ 1EP5A 2P16A 2OP9A 4R8TB 1MZDA 3PLBA 2YNBA 1K1JA 2Z94A 4NGAH 1BB0B 5FL7D 1FY8E 1P11E 1TBRH 2BOKA 2AERH 3GY6A 1O5CB 1DY8A 5C5NA 4NSYA 2HNTF 5EXLA 1BA8B 3QTVH 1GJBB 1P10A 2QE7D 3BEIB 2NU0E 3A87A 4GCHF 1OWJA 1G36A 1ANCA 2TGDA 1SHYA 4AC9A 8LPRA 2F83A 4ISLA 2OQUA 2WINI 2IJD1 3RM2H 1TRMA 2R9PA 1NESE 5ABWA 2D1JA 1UTKA 1W12U 2CJIA 3M61U 2RA3A 3F1SB 1DE7H 4NA7A 3SZEA 4JZ1A 4NWKA 1H4WA 1Z6JH 2AMDA 2QA9E 3QK1A 3M5OA 3OEHD 3PRBA 1SMFE 3T62A 3F0PA 1TALA 2ANMH 1VZQH 1BZXE 1G32B 2SGQE 1IOEA 3UR9A 1J8AA 1XUFA 1HAPH 5DP9A 2ANYA 2ZFFH 2AGEX 2GV6A 4INLA 1E79D 1NRPH 2QGRA 1HGTH 3GY4A 1ZTKA 3UUZA 5E2PA 3GY2A 1W2KH 5FX6A 5F8ZA 1ABIH 2HLDD 2J94A 1K1LA 1NU7B 5L6NH 1C1TA 1QL9A 1HJ9A 5EW2H 3A8DA 3PMHB 1SGYE 1W11U 1GJ9B 4ABEA 2J92A 2WV5A 1CE5A 1F5RA 1UK2A 1H9IE 5C0UA 4DIIH 1EZSC 2UWLA 4RT0A 1MKXK 1VGCC 3G01A 2THFB 3ZZ6A 3SQEE 5LPEA 2B8OH 1C5NH 2WUCA 3GY7A 3DFJA 3MFJA 1EQ9A 1SQRA 2P3FH 4IBLH 2Z9IA 2ZWLH 1GBKA 2AMQA 2BQWB 1LHFH 1AE8H 2FM2A 1FV9A 2VWMA 1E1QD 1AI8H 5ESBA 4IN2A 4Z6AH 2ZDAH 2BTCE 2FOFA 3BG8A 3ENSB 4B73A 3ATWA 3TITA 1QQ4A 1VITH 1XUKA 2JH5D 2ZGCA 4UFDH 3LH1A 1JBUH 3E0NB 3URCA 1TPOA 1YPGH 1NROH 2W3KA 3ZZ3A 5JB9S 3W95A 4ZAEA 3CP7A 1EB2A 1THRH 1GHAF 2BY9X 3RXJA 2VIQA 1HCGA 2DE9A 1EAIA 2LNCA 3RXEA 4D9RA 1FPHH 2QF3A 1GJ7B 1C1UH 1OWIA 1QBNA 4KELA 1NO9H 3MH7A 3VFEA 4A6LA 5GWZA 2JKHA 1LKBA 3TH3H 2P8OC 5EJLA 4OGYA 1NFUA 1OS8A 1VCWA 2BZ6H 3VXFH 1Q3XA 1E36B 5C94A 1GGDC 2ZHFH 4FUFA 2L74A 1NZQH 3Q76A 2W6JD 2PKAB 4SGAE 1NBME 3SI4H 3T2NA 4ZKOU 3VG8A 4AG1A 5TCAA 4DT7B 3F0OA 5FPYA 4XRNA 2ULLA 1K22H 3HATH 3BG4C 2GMTB 3Q3KA 1WXRA 1BUIA 1CHGA 4YT7H 3MI4A 4UEHH 1WQVH 3SN8A 5GXPA 1KXAA 1SGNE 4E7NA 4MQAA 1YPKH 4NIWA 5HXFA 1N6YA 3R0FA 2HVYB 9ESTA 1P9UA 2ZGHA 9LPRA 2G5NA 4FUBA 1VCPA 2BOHB 2NU2E 3LJJA 1HUTH 2BM2A 1S85A 3LC5A 1KLTA 1GDQA 4U32A 2VGCB 3A84A 3SORA 1SLVB 2L6OA 5I25A 4I31A 1UMAH 2Z3EA 2PKAA 1N8OB 3BTHE 2ZO3H 1TNJA 1AFQC 4ZHLU 5I46H 1IAUA 1QJ6B 2AH4X 3D23A 3TH4H 1IQGA 3OY5U 1BTYA 1XVMA 2BVRH 3SGBE 1SVPA 1Z8IB 2J4IA 4TSFD 1H9LB 3SU6A 1YCPM 3V0XA 3OX7U 3RXAA 2FS9A 1SGCA 3M3TA 1AU8A 5DN6D 3KQBA 1BRUP 1LPGB 3PLPA 1MQ6A 2HRVA 4AGKA 3ZVGA 4ISIH 4D8NA 2RA0A 3K2UA 2XRCA 1E37B 1OYTH 4MVNA 1JWTA 1S6FA 1W14U 1XKAC 1S82A 2WPKS 1BIOA 1QA7A 2OBQA 1KTTB 4NIYA 3ZZ4A 2BDBA 4Y79A 2ZPSA 1J16A 4X8TH 3PROA 3A8AA 4JK6A 2Z9KA 2ZPRA 1CVWH 1VJ9U 2WPDD 4YM9A 3UNSA 3T29A 5EXNA 3VB3A 2C4FH 3SZNA 1AB9C 4GPGA 3PM3A 4RSPA 1UVSH 1SG8B 3QGNB 3FP8E 2A31A 3T28A 3L6PA 3TIUA 2V35A 1DWBH 1LHEH 3TNTA 5DG6A 3V7TA 4OS2A 3RC4A 1AZZA 1QRWA 1SI5H 3UTUH 2BZAA 5DJ7A 3S9AA 4YXWD 1EZQA 1ELGA 2EI6A 1V2QT 1TPPA 3TJOA 3PLKA 1LCYA 3UR6A 5DPAA 1TRYA 3CS7A 3QGJA 1VITG 1FI8A 3FOAA 3A82A 5HMAA 2A1DB 5FCRA 3FAOA 1WSSH 1THSH 1XXFA 1C2MA 1ID5H 2W3IA 1GHYH 4JYTA 1GL1A 1L0ZA 1W7XH 4WWYA 2VBCA 2QV1A 2EI7A 4I8HA 1QJ7B 1VCQA 2Z6BD 4WJG2 1ARBA 4MLFB 2OC8A 1PYTC 2BLWA 4X1RU 2FXRA 1NY22 1SQOA 5EGMA 1EJNA 5C1UA 4OS7A 4X2VA 1ZZZA 4A1XA 1P3EA 2SGEE 4BAOB 3SJIA 1RFNA 1C2DA 1X7AC 3MO6A 3H7TA 2ZDLA 1T8NA 4CR9A 4X6PA 3U8OH 1O2WA 1C1SA 2W6ID 1YC0A 4RT1A 3GDVA 3N99A 1O38A 2Z3DA 2P94A 1W0ZU 1BMMH 3NPSA 2BX4A 1A5HA 1YPLH 2AGIX 1O35A 1EPTC 3SUDA 5A0CA 2FIRH 4XOJA 5CE1A 3RUOA 1TB6H 1RS0A 2ZDMA 3VGCB 2GGVB 4Y8ZA 1C2GA 1CGIE 1SR5C 1XMNB 3TGKE 2BLQA 1V2OT 1MTWA 1DXPA 3A86A 1NM6A 1DUAA 3S7KB 1G30B 3DFLA 2BHGA 2YMSD 4X1NU 3ODFA 3ZZ9A 4B2AA 2WPMS 1TFXA 3VB4A 2F9PA 2VIVA 4X2YA 1F5LA 2M5TA 2VH6A 1Y3VA 3SV8A 2ZU1A 1RXPA 2F9UA 4ZUHA 2G55A 2ZPQA 2SGFE 1Y3UA 2ILNA 4Y71A 2A5AA 3LGTA 1K9OE 4WF8A 1HAHH 3RXTA 5B6LA 1FY5A 1LHDH 2OBOA 3K6ZA 2BB4A 2A4GA 4X1QU 1SQTA 3ZVDA 1QNJA 1AUTC 2Q6FA 2V0BA 1TMUH 3RXLA 2GZ8A 1NFYA 8GCHG 2C8WB 1O2SA 1SFIA 3E8LA 1T8LA 3MH5A 2XXLA 1GPZA 2XBVA 2QXGA 2TGAA 1JXPA 2XNIA 3EA9A 4H42U 4ZXXH 2Z9GA 4Y8XA 2WPHS 5EODA 1PQ8A 4YOJA 4RN6A 2O8UA 2ZNKH 1QL8A 1O3OA 4IGDA 2CN0H 5JDUB 3QZRA 4AFZA 3LGIA 3EE7A 1NPMA 2BY8X 4K8BA 4UFGH 2FLBH 4TT3D 5L2ZH 4UE7H 1IQNA 1P01A 4B2BA 1VKYA 2F43B 3MH4A 1BMLA 2ANWA 3ZZ8A 2Y5FA 5C3NA 4FUCA 1GJ4H 1JRSA 2HNTE 1KYNA 3PWBA 4UFEH 4E7RG 4E06H 2BD9A 1L4ZA 3BTEE 8KME2 2OCVB 2SGDE 3ZIAD 1RTKA 1WAYB 5DKMA 1P8VC 4VGCC 2QXIA 2A7CA 1A7SA 1ZMNA 1HJAB 1J14A 1LO6A 1QQUA 1BT7A 3LOXA 2BVXH 1SGFA 3R3GB 1UTPA 3BTWE 1H9HE 1KMHB 1FDPA 2XCNA 1QBVH 2FOBA 1C5WB 2Z9LA 1GDNA 3SU3A 1GI0A 1V2UT 5T6DA 1MMJN 2H2ZA 2R0KA 7GCHF 3GCTF 3ZVFA 3VB7A 2IJOB 3Q3YA 1SBWA 3E16B 2UWOA 2FI3E 1EX3A 1KXBA 4ABFA 1MBMA 3P6ZB 3SGQE 1JRTA 1BOQA 4KTSA 5CHAC 1ZPCA 2ZFTA 3GCNA 3K9XB 1CQQA 1P09A 4CH2B 1AHTH 5FHTA 2XNDD 2XTTB 1GVLA 1EKBB 2ZFPH 2ASUB 2FOCA 1D9IA 1QB1A 3NWUA 3SJ9A 1TNHA 1YY3A 2RDLA 3MO9A 2GMTC 3KQEA 2GTBA 4I8GA 4XBDA 1PPCE 1QB9A 1K1MA 1O2TA 5LGOA 1AN1E 1FN8A 2ZQ2A 3WW7A 4JCNA 1Y5AT 1HAYB 1TNLA 5KGOA 2CMYA 1RIWC 1XUGA 1NRQH 1DVAH 3SJKA 1LMWB 4IC6A 2P59A 2AEIH 2FTLE 4YO9A 2KX4A 5IYTA 2O8LA 1VITF 1AMHA 2P3TB 2ZP0H 2OC0A 2VGCC 1LKAA 1O2NA 3RC6A 2P3UB 4BNRA 1DICA 3F3BA 1W0JD 1N8OC 1G3CA 1O5DH 3FVFB 3WWBA 4B6EA 4ASUD 4ZROA 3MU0A 1HFDA 2QCYA 1RRKA 5CMXH 1C9PA 5JBBS 1GMDG 4KTCA 2XC4A 5DGJA 1T8MA 4ZMAH 1RTFB 1MTUA 1OSSA 1Z6EA 2OLGA 2FO9A 2GKVE 2A2XH 1HIAB 1ZHPA 2VNTA 3PYHA 1AQ7A 5CDFE 2H5CA 2QIQA 4ABBA 3I29A 1Y59T 3QN7A 2YMSB 1AWFH 3M5MA 1L1GA 1MU8B 2KR7A 3HKJB 3VXEH 2ZI2H 3BTTE 4CHAB 3MYWA 2XBXA 4Y0YE 2BD2A 3UNQA 3WY8A 2BDGA 1WV7H 1D3PB 1O3AA 5EQQA 1CBWB 5EXMA 4KTUA 1C5XB 1FAKH 1P0SH 1TIOA 2GCTB 3P70B 3RDZA 5TJXA 2RCEA 5DP5A 1QRXA 3D65E 3MNCA 1DFPA 2PWXA 5DP7A 2F9BH 1UTQA 1CA0B 7KMEH 4Y7AA 2AS9A 2FEQH 5FPTA 3MU4A 2R2MB 1HIAA 1DOJA 1QY6A 4X1PU 1A46H 2KCYA 1QA0A 1KTSB 1EAWA 4X8UH 2G51A 1C1RA 3U28C 5FX5A 3BIVH 1FXYA 4K60A 1GWAA 4FU9A 1FUJA 1ZRKA 1KLIH 3KYGA 1NS3A 4M7GA 2Z3CA 4NZQA 1ESBA 1NBMD 5DO4H 4FOUC 2JETB 3TGJE 2ZDNA 3GY8A 3F9FA 1LVBA 1KXFA 1MKWH 1C2EA 1O2OA 2H9EH 3IWMA 4A5TS 4OS1A 1GCTB 3RXIA 1HAOH 1TGBA 1A1RA 2J38A 1Y5BT 2I6SA 2F4LA 2GCHG 3BTDE 1C5OH 2FI4E 1F0RA 4IS5A 3SQHE 1O0DH 1OXGA 2AYWA 2C3SA 3RXGA 1P02A 3LPRA 1XVOA 1VJAU 1EAUA 1C2JA 2K8IA 1V2KT 1B7XB 8GCHF 1VR1H 1YP9A 1QFKH 2EA3A 1P2MA 3U98H 1DWDH 1HAGE 1ZMJA 1V3XA 1CT2E 3A8BA 3P8OA 3C27B 2WYGA 4DG4A 3QDZB 2Z9JA 1ELTA 3TNSA 1IQFA 3LGUA 1Y3WA 1AUJA 1BHXF 2ZIQH 2BD3A 5A8YA 1MAYA 2A0QB 1T32A 3BEUA 2ZGJA 2Y80A 4MG3A 2QF0A 5A09A 3ZVBA 2TRMA 3SHAH 1O3CA 2J34A 1NRSH 2G4UA 1WCZA 3QX5H 5C2ZA 2XWBI 2GDEH 1ZR0A 4ABDA 1TMTH 3Q3XA 3SOSA 2TIOA 3PMBB 4UONA 4JZEH 4AB9A 1OWEA 2LP6A 4DT4A 2GJGA 4DCDA 2AFQB 6GCHF 3RXPA 2NU4E 3AW1A 2O8MA 1FIZA 1P04A 1SQAA 2AMPA 5A8ZA 1O3HA 1E0FD 3ZV8A 3NUMA 2EY4C 1C1NA 4YOGA 5FBEA 1PPZA 3M5NA 6CHAC 5E2OA 1DLKB 4Q7ZA 1TE0A 4K1TA 5A2MH 5KECA 1BBRE 1CGHA 1QTFA 2FOHA 1Z8RA 3UWJH 1EZUC 3VEQB 1GI8B 7LPRA 1AKSB 1AVWA 1SGPE 2XWAA 2J97A 1CGJE 1GJ6A 1UVOA 5AVDA 4MNXA 1XM1A 4CH8B 2PGBB 3SU4A 2BLVA 5F8XA 3UOPA 4TY7A 3UAIC 1B0FA 1U6QA 3ATKA 4MNWA 1LVOA 2VWNA 1QR3E 3RXSA 4DURA 2ZHWH 1OWDA 2KCPA 1SGDE 5JBCS 4I8LA 5LPRA 4Y8YA 1Z8JB 1O30A 3ZVAA 3MWIU 1Q31A 2PLXA 2RFKC 3AASA 3TJVA 3RLWH 1O3MA 3GOVB 1DX5M 1EJAA 4ISNA 3SBKA 3SV2H 1B0EA 5GJ4B 1LQDB 5GPIB 1AKSA 1GBAA 3SNDA 1UTMA 4INKA 2A4RA 4WY3A 4YLUA 4Q80A 2V6NA 4AGJA 4WVPE 4JZIA 1C9TA 3M37A 1K21H 1TA6A 5F8TA 2IPHA 1J17T 3SI3H 1XKBC 1HJAC 2BDIA 5GIBA 5T1VA 5T6GA 3LC3A 4UD9H 2B5TB 3NRLA 2ZG0H 2FS8A 4U01A 2D8WA 3MH6A 4I33A 2HALA 4JMYA 1AE5A 3GS9A 2PW8H 4PROA 2NU1E 4XDEA 5L2YH 2EC9H 2UUKB 2OXSA 1FY1A 1FZZA 1O3GA 2FX4A 1Z1IA 1GI7B 1MKWK 2ZFRH 3LGYA 3P92A 2HNTC 4HGCA 4BANB 3LJOA 5FAHA 1Y8TA 3SUGA 3P8GA 3S69A 3ATLA 1GBLA 1GHVH 1O2RA 2Y5GA 1MQ5A 1Z7KA 2QF4A 2GVFA 1FX0B 4ZHMU 3QUMP 3O8CA 2WV9A 3D62A 4Y0ZE 1D6WA 1H8HD 4D7GA 4FXGH 4MNYA 1TNIA 3OTJE 1UVUH 4RI0A 3RXQA 1D3QB 5C20A 2QXHA 3GCHB 3NCLA 1O5GH 4IN1A 4AYVB 6ESTA 3N7OA 3UY9A 3M7QA 2B7DH 1TA2A 1UW7A 1O34A 2Q6DA 2UUYA 1MCVA 2FESH 2Y82A 1O2LA 3PV4A 4K2YA 2PKSC 5GCHG 2BD8A 2D2DA 1D6RA 3MMGA 2W26A 3E91A 3FZDA 1TRNA 4NG9H 2XYAA 1G2MA 1SLWB 6LPRA 3EA8A 3DUXH 1GI2A 1GMCF 3KIDU 1CO7E 2J5UA 3ZVEA 1DUEA 2EQNA 1GMHG 4CRBA 2V7QD 4Y7BA 1IQJA 3SU5A 1DXWA 2ZTYA 2PP6A 1MTNB 1DLEA 2K0QA 4AFUA 3P95A 1ZHMA 3HK6B 1N6XA 2K1QA 2GZ7A 1OOKB 1W8BH 2IN2A 1SPJA 5E8EH 2QYIA 1FONA 1SLXB 2H5DA 3MTYA 3SU2A 3K65B 1DS2E 1PPBH 3DSOA 3RMLH 1OX1A 4JYVH 2EI8A 1GG6B 3EDXB 3Q77A 3OTPA 2F3CE 1NRRH 2KCOA 3ESTA 4IC5A 2J9NA 1KXEA 1GCDA 3A81A 4FVDA 3U1JB 3VPKA 4TY6A 4CR5A 2W7SA 2A7JA 1EOLA 1BTPA 1TGCA 3UWIA 3RXBA 1YPMH 5C1XA 3A7TA 3KGPA 3F2HA 4AFSA 1BRCE 1J9CH 2C8ZB 3A85A 4B71A 1E35B 4CRCA 5AFYH 2TGPZ 1EB1H 2ZECA 2Y7ZA 4ZXYH 2G5VA 3GDUA 1EUFA 3KN2A 4WXIA 4ZH8A 4AZ2B 4RKJB 5DP4A 3F9HA 1Z8GA 3LU9B 3RXCA 1SLUB 4YZUA 1GHBG 1GBTA 5GNDA 5F53A 3HK3B 1ETTH 2Z7FE 3LKWA 5HGGA 3NKKA 2STBE 3E90B 2CHAC 3O8DA 3RXDA 1TAWA 4O3TA 3PTNA 3KQCA 3S0NA 3MU5A 1BTHH 1UK4A 4NA8A 2ODPA 1JIRA 4AFQA 1QURH 1O2HA 3FO8D 4FUHA 5DP3A 5AHGH 1O3DA 2GT8A 1GBIA 3KCGH 4HFPB 4X6OA 3RXFA 1GCTC 3DD2H 1Y5UT 1NFXA 1T7CA 3SGAE 2P95A 2ZQ1A 1C5YB 4B76A 4DOQA 2BMGB 2BX3A 4B75A 3UB0A 1P3CA 1V2PT 1NT1A 1PYTD 2QAAA 3MNXA 1WUNH 1C5RA 2ZCHP 5BPEA 4CREA 2PSYA 4OS5A 1S6LA 2KM0A 2ODYB 2OTVA 1MUEB 1ELVA 2OC1A 1F92A 1OWKA 3EAJA 1O2ZA 1XX9A 3MHWU 2R3UA 2CXVA 3SJ8A 1F0UA 2BQ7B 5C0TA 1TMBH 4A1TA 4FUJA 4Q63A 2FWWA 1TBQH 1ZJKA 1PJPA 4X8SH 2Q1JA 1O2PA
chains in the Genus database with same CATH topology
4ACAA 4AC9A 2LP6A 4ACBA 1SQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ACA A;  4AC9 A;  2LP6 A;  4ACB A;  1SQR A; 
#chains in the Genus database with same CATH topology
 2F9V A;  1VGC B;  3GYL B;  3ZZC A;  1C1Q A;  1CU1 A;  2A45 B;  2KZ4 A;  2WYJ A;  1O3I A;  2IOT A;  3RP2 A;  2H1U A;  2JJ2 D;  3QTO H;  1V2M T;  3KQD A;  4GCH G;  1L1J A;  4TWY A;  2PUQ H;  2ZHD A;  2FPZ A;  4I86 A;  3KNX A;  3DCL A;  1WOF A;  4M9F A;  1P2J A;  1ZTJ A;  1W3C A;  4GHT A;  1XUH A;  5EJZ A;  2BD4 A;  1O2Q A;  3QO6 A;  1EAT A;  4JZD H;  1P2K A;  1GJ5 H;  4IW4 E;  4X6N A;  4NSV A;  2ZGX H;  4AX9 H;  1C5L H;  1GVZ A;  2JJ1 D;  2FOG A;  3F6U H;  2CF9 H;  1BIT A;  4A7I B;  2AGG X;  3VB5 A;  1K0H A;  2VIN A;  2A4O A;  2AHM E;  1SSX A;  3UQV A;  2UUF B;  4ZHA A;  3LH3 A;  2AIQ A;  4K8Y A;  3RU4 E;  5JBT A;  2P8O B;  2WHX A;  3PMJ A;  1UJ1 A;  1UTN A;  1NC6 A;  5JBA S;  4TPI Z;  3OU0 A;  1TGS Z;  2BDY A;  5FPS A;  1GGD B;  1O3L A;  3DA9 B;  1O3J A;  4H4F A;  5FXL A;  2XOK D;  1TLD A;  3A80 A;  2EEK A;  1CA8 B;  1YBW A;  1HXF H;  4HG6 A;  3A88 A;  1Q2W A;  4XE4 A;  2FOD A;  3CNR A;  2WPI S;  2V3H H;  1ELE E;  3BG4 B;  1QRZ A;  5HYO A;  2OUA A;  4XBC A;  1COW D;  2XC0 A;  3MQK C;  1ZJD A;  4THN H;  1N1L A;  2VIO A;  4ACA A;  5HM9 A;  2SGA A;  4B74 A;  3M7U A;  5LPF A;  2G81 E;  5HM2 A;  1V2W T;  3T26 A;  3GDS A;  4NWL A;  1C2I A;  1S83 A;  2VWO A;  4GHQ A;  2BDC A;  1A5G H;  2VJ1 A;  5G4B A;  1QL7 A;  1G3D A;  3UIR A;  1BHX B;  1ZOM A;  3NZI A;  2W5E A;  1O2K A;  1OWH A;  1SB1 H;  3PV2 A;  1IQM A;  1K1O A;  1W10 U;  4DY7 B;  2A4Q A;  2A7H A;  1TAB E;  3RXK A;  1YCP H;  1HNE E;  1CHO G;  1DWC H;  1EST A;  4QT8 C;  1CSO E;  2G00 A;  4XSK U;  3C1K A;  3P8N A;  3EE0 B;  1GHA G;  3AAV A;  1PQA A;  1BBR H;  1EAX A;  2ANK H;  3V12 A;  7EST E;  1D3D B;  2BQ6 B;  2WZQ A;  1ESA A;  4XFQ A;  4Q4L A;  2LEL A;  1GL0 E;  3TU7 H;  1YLN A;  3FAN A;  4FUD A;  1OHH D;  4ASH A;  2VIP A;  1LQE A;  1AZ8 A;  4WH6 A;  2C90 B;  3BEF B;  5SGA E;  1H8D H;  2LPR A;  3PB1 E;  1Y3X A;  1BMA A;  4OM9 A;  1KIG H;  5A0B A;  1TWX B;  3E3T A;  2G4T A;  1OKX A;  1TNK A;  1LTO A;  3FFG A;  2ODQ A;  1AB9 B;  2WV4 A;  2YOL A;  4ABJ A;  1ETS H;  2V3O H;  2BD7 A;  2JIZ D;  1GI5 A;  3KF2 A;  4GSO A;  4J2Y B;  1G2L A;  5EJ1 A;  2O9Q A;  1IQE A;  4K3J A;  2QXJ A;  1O2G H;  4LXB H;  1G3E A;  2FYQ A;  3GCH C;  1PFX C;  1AWH B;  1S81 A;  2H9T H;  3LIW A;  4Q7Y A;  2BY6 X;  4ACB A;  1TX8 A;  3UFA A;  1EOJ A;  4MDS A;  1A0L A;  2BXT H;  1HBT H;  4NCY A;  4DJZ B;  1WTH D;  1UVT H;  4KKD A;  4NIV A;  3OSY A;  3MU8 A;  2B0F A;  3S7H B;  5E0J A;  1GHB F;  1NRN H;  3TLO A;  2J2U A;  5K7R A;  1T31 A;  3MNB A;  5AF9 H;  2BVS H;  3FP6 E;  2R3Y A;  1O2Y A;  1TQ7 B;  1C1P A;  1OP8 A;  2FOA A;  3U69 H;  4F49 A;  1SGI B;  4I8J A;  4Z1M D;  1C2F A;  3FKS D;  3UOU A;  4F48 B;  1V2N T;  3GIS B;  4GVU A;  2ZTX A;  4YES B;  2UWP A;  5F03 A;  1YYY 1;  2F91 A;  3TPI Z;  1GJC B;  5F6M A;  3PRD A;  3RXR A;  5C67 A;  3KHV A;  2D26 C;  3BTF E;  3OE7 D;  1EAS A;  3LT3 A;  4MNV A;  1C5S A;  5C17 A;  1C5M D;  4IMQ A;  1GG6 C;  1HAZ B;  1O3F A;  2P93 A;  1KLJ H;  5LH8 A;  4SGB E;  1V2L T;  3U8T H;  4ISH H;  1EPT B;  3OY6 U;  1T8O A;  2ZCL P;  3IIT A;  1S5S A;  1UTL M;  3OEE D;  1H1B A;  3O8R A;  1ZTL A;  1ORF A;  2KCA A;  3L3T A;  5EW1 H;  1O3K A;  1HAV B;  4OS4 A;  5GDS H;  1NN6 A;  3MO3 A;  2YNA A;  4FU7 A;  2AIP A;  4LOY H;  3BTQ E;  1TPA E;  4WMF A;  5EU8 A;  1OP0 A;  3AK5 A;  1C4U 2;  3TJN A;  1HB0 B;  3F68 H;  3KQ5 A;  1ZHR A;  2PSX A;  1TON A;  1GJD B;  2Q6G A;  3SO3 A;  3BN9 A;  2R0L A;  1FMG A;  4D76 A;  3PTB A;  3K6Y A;  4U30 A;  1GI4 A;  3N7E A;  1AGJ A;  1O39 A;  5FCK A;  1EPT A;  3A7Y A;  3LGW A;  3SV9 A;  1J15 A;  2VWL A;  3VGC C;  2BY5 X;  1K2I 1;  4X1S U;  1C5T A;  1DWE H;  1HAV A;  1V2S T;  2FYR A;  3KL6 A;  4P00 A;  2CF8 H;  5IDK A;  3SW2 B;  4D7F A;  2QC2 A;  3O8B A;  5J4S A;  4INH A;  3GY3 A;  1ABJ H;  1L1N A;  1BJU A;  1BRA A;  2OK5 A;  1YCP K;  3H7O A;  3SJO A;  4CRD A;  2A32 A;  1ELB A;  4UFF H;  1GHX H;  1W7G H;  2C93 B;  3TK9 A;  2I6Q A;  1A0H B;  2GV7 A;  3RXH A;  4IMZ A;  5CHB A;  3LDX H;  4ZKR U;  4NIX A;  5T6F A;  2ZDV H;  2SNW A;  4DIH H;  2CGA A;  1A2C H;  3DSP A;  1ACB E;  3EGK H;  3FP7 E;  2FZZ A;  3RU4 T;  1BBR K;  1QBO A;  1A5I A;  2FLR H;  3E6P H;  1IQK A;  4BAQ B;  1GBH A;  3FZZ A;  3HKI B;  4YTA A;  3A7W A;  1JIM A;  1IQL A;  1DST A;  1SOZ A;  1TX6 A;  2ZU3 A;  4B2C A;  1SGQ E;  3KEE A;  1HV7 A;  1EP6 A;  5EG4 A;  2ZFS A;  5DP6 A;  2BYA X;  1A0J A;  2H9H A;  3SYJ A;  2WUB A;  1RGQ A;  5HIZ A;  2HGT H;  4JK5 A;  4VGC B;  5EST E;  3Q00 A;  1MBQ A;  1G37 A;  4KGA A;  2G52 A;  5FBI A;  1FY3 A;  3H5C B;  2XC5 A;  2SGP E;  4DVA U;  1BTZ A;  3U8R H;  1W0K D;  1FPC H;  3JZ2 B;  3B23 B;  1YPH C;  4XD7 D;  1P2N A;  1FJS A;  1CT0 E;  3HPT B;  2ZA5 A;  3RXU A;  1P2I A;  1O2X A;  2FI5 E;  5PTP A;  5JB8 S;  1RTL A;  3TK6 A;  1P2O A;  1TGN A;  1QB6 A;  3HGP A;  1BTU A;  2FTM A;  2HOB A;  5EQS A;  2BY7 X;  3ZV9 A;  1GJ8 B;  1CHO F;  3QLP H;  1E34 B;  3SU0 A;  1YPE H;  1LHC H;  1ZML A;  4RKO B;  4Z0K A;  1MD8 A;  2ZU4 A;  3QWC H;  1JOU B;  3ZZD A;  3GY5 A;  1F2S E;  2FOM B;  1A4W H;  3SNC A;  4XBB A;  2EST E;  2VVU A;  1O2U A;  1HDT H;  1LHG H;  1XUI A;  4F4O C;  5CHA B;  1OYQ A;  3AVZ A;  2VH0 A;  4DGJ A;  3AAU A;  5DP8 A;  1DT2 A;  4EST E;  1GDU A;  3M5L A;  2KAI B;  1C5Z B;  2O8T A;  2HPQ H;  1LVY A;  1O3B A;  4LZ1 H;  3M7T A;  2RDE A;  1GBD A;  3BIU H;  1ZPZ A;  1YF4 A;  1W0Y H;  4J1Y A;  3VB6 A;  3ZZ5 A;  1RJX B;  1HPG A;  2BXU H;  3RXM A;  2OIN A;  2VB0 A;  1GMD F;  1MTS A;  5H4I B;  4FU8 A;  1K1N A;  1F0S A;  3DT0 H;  4NFF A;  3A7X A;  4HI3 A;  3LGV A;  3P17 H;  1KDQ B;  1RIW B;  2ZU2 A;  1F0T A;  1ZSK A;  4MPW A;  1C2L A;  5K0H A;  1IQI A;  1O5A B;  3E0P B;  4ABA A;  4BTI B;  5KED A;  2KAI A;  4K69 A;  5EIY A;  1UHB B;  1GVK B;  2IPQ X;  3SUF A;  3HGN A;  4X0W U;  5HKK D;  1H8I H;  1DIT H;  1KY9 A;  2CK3 D;  1K28 D;  1PPH E;  3F2G A;  3OYP A;  1KXC A;  1C4Y 2;  3TH2 H;  5JYI A;  1H8E D;  4FUG A;  4NFE A;  2B9L A;  3GCT G;  7GCH G;  2C8Y B;  1AVG H;  1HAI H;  1D3T B;  3I77 A;  1T4U H;  2HVX A;  1BQY A;  4ZCN A;  1HLT H;  5AFZ H;  4BTT B;  3TGI E;  4JYU H;  1TX7 A;  2GDD A;  1KDQ A;  1WU1 A;  1ELF A;  1DM4 B;  3A7V A;  3PO1 B;  3S9B A;  2KFW A;  1GHZ A;  2PUX B;  1LDT T;  1F7Z A;  2ZHE H;  4WME A;  1EFR D;  4X6M A;  1UHB A;  2R2W U;  2ZZU H;  5TCC A;  1FIW A;  2ZKS A;  2DUC A;  3A89 A;  3RMN H;  1O32 A;  4CRG A;  2BDA A;  3EQ0 H;  2ZCK P;  4BXS A;  1FLE E;  3SV7 A;  1P9S A;  2GCH F;  2J98 B;  2JDI D;  3BSQ A;  1BMF D;  5ETX A;  4YLQ H;  3BTM E;  2NU3 E;  1O37 A;  1ZPB A;  3RU4 D;  2FOE A;  2CV3 A;  3GIC B;  5DSF A;  1C2H A;  1K1P A;  2F9N A;  3RM0 H;  1OP2 A;  4WMD A;  1DDJ A;  1UTO A;  2XBY A;  3CS0 A;  3M36 A;  4Y76 A;  2YMS C;  4P02 A;  5J4Q A;  4CBO A;  4B1T A;  4NA9 H;  1BMN H;  1AY6 H;  3MU1 A;  5L30 H;  5JPM H;  2ZU5 A;  3RMM H;  1NTP A;  1TBZ H;  1XXD A;  4CHA C;  1GBM A;  1YWU A;  3B9F H;  1V2T T;  3IG6 B;  4H6S B;  1AD8 H;  1ZYO A;  4K5Z A;  1YLC A;  1QZ8 A;  3T5F H;  2HLC A;  5EPY A;  1CBW C;  3KYF A;  4H6T A;  1YPJ H;  2GCT C;  2XBW A;  1PPE E;  1EXF A;  5E0G A;  2J98 A;  1HRT H;  1GHW H;  2WPL S;  3ZVC A;  4BAK B;  2SFA A;  1CA0 C;  1YM0 A;  1GBE A;  2GT7 A;  3D49 H;  1DPO A;  4NZL A;  4TPY A;  1TQ0 B;  1BCU H;  1FN6 A;  1SKY E;  1UCY H;  1AIX H;  1GI9 B;  1C5Q A;  2ZEB A;  3A8C A;  1IHT H;  1O2J A;  1SGF G;  1V2R T;  2F9O A;  4AOR A;  1P2Q A;  1BDA A;  4U2W A;  5BRR E;  3ELA H;  1O2V A;  2ALV A;  1S6H A;  1C5U A;  4Y11 E;  1O2M A;  3SNE A;  1FNI A;  3OAA D;  2JET C;  1O5F H;  4GAW A;  3SUE A;  1MCT A;  1ELC A;  2VIW A;  4WH8 A;  4FUE A;  1XUJ A;  1YGC H;  1GJA B;  1O2I A;  1Z1J A;  3F2F A;  3E1X B;  2FDA A;  1MAX A;  3W94 A;  1QHR B;  3A7Z A;  2GD4 B;  3UNR A;  1DSU A;  3WWF A;  1C2K A;  1V2V T;  1YKT A;  2TGT A;  4K1S A;  1C5P A;  2OD3 B;  1YPH E;  3ATI A;  1T4V H;  2W7U A;  3M35 A;  1YLD A;  3P8F A;  4AOQ A;  2Y7X A;  4ZKN U;  3T27 A;  1A3B H;  3A83 A;  3DSG A;  1ETR H;  1QIX B;  1NFW A;  1AFE H;  3FN8 A;  4ZKS U;  2Y5H A;  3GYM A;  4FVB A;  1C5V A;  3TK5 A;  3V3M A;  4BAH B;  1ANB A;  2G8T A;  4ABH A;  6CHA B;  1A3E H;  4K1E A;  1MAB B;  3I78 A;  3W1E A;  4AN7 A;  4E05 H;  1SHH B;  1SFQ B;  2PGQ B;  1WBG B;  4AYY B;  1MD7 A;  4ISO A;  1M9U A;  2O8W A;  1S84 A;  1PPF E;  2PV9 B;  3DHK H;  1G3B A;  1GBB A;  2A5I A;  1TPS A;  2WSS D;  4OGX A;  3ZYE A;  4ABG A;  4HTC H;  1AND A;  1S0R A;  1K1I A;  1THP B;  3STI A;  2ZHQ H;  2WPJ S;  1L4D A;  4BOH A;  3NXP A;  1L2E A;  1KSN A;  1ZSJ A;  3BTG E;  1UK3 A;  3ITI A;  1PQ5 A;  1MH0 A;  2A5K A;  4TYD A;  1HYL A;  2PHB A;  3PV5 A;  4CRA A;  1RD3 B;  4GUX A;  3SNA A;  1HJ8 A;  1EZX C;  4B6F A;  2OQ5 A;  3F9G A;  4I7Y H;  3BV9 B;  1NU9 A;  1TGT A;  1P57 B;  5EOK A;  3MNS A;  3RMO H;  3RXV A;  1SL3 A;  2SNV A;  1GI3 A;  1EJM A;  1BRB E;  4A92 A;  3ATM A;  1BTW A;  1GI6 A;  1E1R D;  1G9I E;  1V2J T;  3GCO A;  4Y10 E;  4MPU A;  8EST E;  5HIY A;  6GCH G;  1F5K U;  1TOM H;  3SV6 A;  1ZSL A;  1PQ7 A;  1O5E H;  1TOC B;  1QJ1 B;  3F9E A;  3U1I B;  3MOC A;  1BJV A;  4X2W A;  4BAM B;  5T3H A;  1SOT A;  2PR3 A;  1IHS H;  4I8K A;  2FMJ A;  1SGT A;  3UPE A;  3URE A;  2ZF0 H;  1C1V H;  1GBJ A;  3RXO A;  3N7D A;  1O36 A;  2M2A A;  1ELD E;  1O3P B;  3SHC H;  1INC A;  4O97 A;  2OC7 A;  2HPP H;  3ZZA A;  4MPV A;  1A61 H;  1ZGV A;  3RLY H;  3SNB A;  2J95 A;  2RG3 A;  3EYD A;  1P05 A;  4KP0 A;  1GI1 A;  1SGE E;  5GCH F;  1B5G H;  3JZ1 B;  1KXD A;  1TYN A;  2BDH A;  4JZF H;  3EA7 A;  2TBS A;  1AFQ B;  2H6M A;  1W13 U;  4Y6D A;  5A0A E;  1O5B B;  1C1O A;  1V6D A;  2HWL B;  2XW9 A;  1S0Q A;  1WQS A;  1WTG H;  2FX6 A;  1GMH F;  3URD A;  3M3S A;  2V3M A;  1UCY K;  1UCY E;  3ZYD A;  4YT6 H;  3BTK E;  1O3E A;  2VVC A;  1PPG E;  1CT4 E;  1O33 A;  1ZLR A;  3PWC A;  4HZH A;  4MTB A;  1QCP A;  1O31 A;  3RC5 A;  1LPK B;  3L33 A;  2NWN A;  2PKS B;  4AB8 A;  5E0H A;  3AW0 A;  1WYK A;  2ZC9 H;  3LON A;  2QF5 A;  4AG2 A;  3CEN A;  4LZ4 B;  2ALP A;  4BXW A;  1UO6 A;  1ARC A;  2JH6 D;  4F55 A;  3ODD A;  1MZA A;  3M3V A;  1JMO H;  1AO5 A;  1MKX H;  1GBC A;  2VVV A;  1ANE A;  4UDW H;  2GP9 B;  5C5O A;  2BD5 A;  4ABI A;  4GLY A;  2STA E;  4O3U A;  2PTN A;  4Q7X A;  4YOI A;  2BLO A;  4CBN A;  5EQR A;  1E38 B;  3QZQ A;  3SU1 A;  2A2Q H;  4BTU B;  3PMA B;  4O9V A;  2JH0 D;  4LK4 A;  1FQ3 A;  2UUJ B;  3T25 A;  3TVJ B;  2GX4 A;  2QY0 B;  1C4V 2;  3ZZB A;  3S9C A;  2PTC E;  4MPX A;  3STJ A;  1ZRB A;  3UQO A;  3NK8 A;  1FY4 A;  1OPH B;  1P06 A;  2VU8 E;  1MTV A;  1DY9 A;  1LVM A;  3OFN D;  1C1W H;  5EPN A;  5A8X A;  2ZFQ H;  1HAX B;  2C8X B;  4CRF A;  1ELA A;  1UTJ A;  1HXE H;  1FAX A;  5B6O A;  2QN5 T;  5IK2 D;  1QGF A;  4I32 A;  2FP7 B;  1BTX A;  1SGR E;  4WXV A;  1MTN C;  1Z71 A;  4TWW A;  3PO1 C;  3TJU A;  1IQH A;  3H09 A;  3B8J A;  2GZ9 A;  3BF6 H;  4FET A;  1P03 A;  1AVX A;  4Q2K A;  1TNG A;  1C1M A;  1SC8 U;  3U9A H;  4X2X A;  2XCF A;  1O3N A;  2Y6T A;  3V13 A;  1WDI A;  5C1Y A;  4X8V H;  5DK1 A;  2ZGB H;  1GBF A;  2DE8 A;  2ZTZ A;  2ZDK A;  2Y81 A;  1DAN H;  4R0I A;  4OS6 A;  4FUI A;  1LPZ B;  2PFE A;  2CHA B;  2VID A;  1D4P B;  1GMC G;  1Y3Y A;  4DW2 U;  3ZZ7 A;  1UVP A;  4O03 A;  4A1V A;  1MU6 B;  1ZGI A;  4D9Q A;  1P12 E;  2TPI Z;  1EP5 A;  2P16 A;  2OP9 A;  4R8T B;  1MZD A;  3PLB A;  2YNB A;  1K1J A;  2Z94 A;  4NGA H;  1BB0 B;  5FL7 D;  1FY8 E;  1P11 E;  1TBR H;  2BOK A;  2AER H;  3GY6 A;  1O5C B;  1DY8 A;  5C5N A;  4NSY A;  2HNT F;  5EXL A;  1BA8 B;  3QTV H;  1GJB B;  1P10 A;  2QE7 D;  3BEI B;  2NU0 E;  3A87 A;  4GCH F;  1OWJ A;  1G36 A;  1ANC A;  2TGD A;  1SHY A;  4AC9 A;  8LPR A;  2F83 A;  4ISL A;  2OQU A;  2WIN I;  2IJD 1;  3RM2 H;  1TRM A;  2R9P A;  1NES E;  5ABW A;  2D1J A;  1UTK A;  1W12 U;  2CJI A;  3M61 U;  2RA3 A;  3F1S B;  1DE7 H;  4NA7 A;  3SZE A;  4JZ1 A;  4NWK A;  1H4W A;  1Z6J H;  2AMD A;  2QA9 E;  3QK1 A;  3M5O A;  3OEH D;  3PRB A;  1SMF E;  3T62 A;  3F0P A;  1TAL A;  2ANM H;  1VZQ H;  1BZX E;  1G32 B;  2SGQ E;  1IOE A;  3UR9 A;  1J8A A;  1XUF A;  1HAP H;  5DP9 A;  2ANY A;  2ZFF H;  2AGE X;  2GV6 A;  4INL A;  1E79 D;  1NRP H;  2QGR A;  1HGT H;  3GY4 A;  1ZTK A;  3UUZ A;  5E2P A;  3GY2 A;  1W2K H;  5FX6 A;  5F8Z A;  1ABI H;  2HLD D;  2J94 A;  1K1L A;  1NU7 B;  5L6N H;  1C1T A;  1QL9 A;  1HJ9 A;  5EW2 H;  3A8D A;  3PMH B;  1SGY E;  1W11 U;  1GJ9 B;  4ABE A;  2J92 A;  2WV5 A;  1CE5 A;  1F5R A;  1UK2 A;  1H9I E;  5C0U A;  4DII H;  1EZS C;  2UWL A;  4RT0 A;  1MKX K;  1VGC C;  3G01 A;  2THF B;  3ZZ6 A;  3SQE E;  5LPE A;  2B8O H;  1C5N H;  2WUC A;  3GY7 A;  3DFJ A;  3MFJ A;  1EQ9 A;  1SQR A;  2P3F H;  4IBL H;  2Z9I A;  2ZWL H;  1GBK A;  2AMQ A;  2BQW B;  1LHF H;  1AE8 H;  2FM2 A;  1FV9 A;  2VWM A;  1E1Q D;  1AI8 H;  5ESB A;  4IN2 A;  4Z6A H;  2ZDA H;  2BTC E;  2FOF A;  3BG8 A;  3ENS B;  4B73 A;  3ATW A;  3TIT A;  1QQ4 A;  1VIT H;  1XUK A;  2JH5 D;  2ZGC A;  4UFD H;  3LH1 A;  1JBU H;  3E0N B;  3URC A;  1TPO A;  1YPG H;  1NRO H;  2W3K A;  3ZZ3 A;  5JB9 S;  3W95 A;  4ZAE A;  3CP7 A;  1EB2 A;  1THR H;  1GHA F;  2BY9 X;  3RXJ A;  2VIQ A;  1HCG A;  2DE9 A;  1EAI A;  2LNC A;  3RXE A;  4D9R A;  1FPH H;  2QF3 A;  1GJ7 B;  1C1U H;  1OWI A;  1QBN A;  4KEL A;  1NO9 H;  3MH7 A;  3VFE A;  4A6L A;  5GWZ A;  2JKH A;  1LKB A;  3TH3 H;  2P8O C;  5EJL A;  4OGY A;  1NFU A;  1OS8 A;  1VCW A;  2BZ6 H;  3VXF H;  1Q3X A;  1E36 B;  5C94 A;  1GGD C;  2ZHF H;  4FUF A;  2L74 A;  1NZQ H;  3Q76 A;  2W6J D;  2PKA B;  4SGA E;  1NBM E;  3SI4 H;  3T2N A;  4ZKO U;  3VG8 A;  4AG1 A;  5TCA A;  4DT7 B;  3F0O A;  5FPY A;  4XRN A;  2ULL A;  1K22 H;  3HAT H;  3BG4 C;  2GMT B;  3Q3K A;  1WXR A;  1BUI A;  1CHG A;  4YT7 H;  3MI4 A;  4UEH H;  1WQV H;  3SN8 A;  5GXP A;  1KXA A;  1SGN E;  4E7N A;  4MQA A;  1YPK H;  4NIW A;  5HXF A;  1N6Y A;  3R0F A;  2HVY B;  9EST A;  1P9U A;  2ZGH A;  9LPR A;  2G5N A;  4FUB A;  1VCP A;  2BOH B;  2NU2 E;  3LJJ A;  1HUT H;  2BM2 A;  1S85 A;  3LC5 A;  1KLT A;  1GDQ A;  4U32 A;  2VGC B;  3A84 A;  3SOR A;  1SLV B;  2L6O A;  5I25 A;  4I31 A;  1UMA H;  2Z3E A;  2PKA A;  1N8O B;  3BTH E;  2ZO3 H;  1TNJ A;  1AFQ C;  4ZHL U;  5I46 H;  1IAU A;  1QJ6 B;  2AH4 X;  3D23 A;  3TH4 H;  1IQG A;  3OY5 U;  1BTY A;  1XVM A;  2BVR H;  3SGB E;  1SVP A;  1Z8I B;  2J4I A;  4TSF D;  1H9L B;  3SU6 A;  1YCP M;  3V0X A;  3OX7 U;  3RXA A;  2FS9 A;  1SGC A;  3M3T A;  1AU8 A;  5DN6 D;  3KQB A;  1BRU P;  1LPG B;  3PLP A;  1MQ6 A;  2HRV A;  4AGK A;  3ZVG A;  4ISI H;  4D8N A;  2RA0 A;  3K2U A;  2XRC A;  1E37 B;  1OYT H;  4MVN A;  1JWT A;  1S6F A;  1W14 U;  1XKA C;  1S82 A;  2WPK S;  1BIO A;  1QA7 A;  2OBQ A;  1KTT B;  4NIY A;  3ZZ4 A;  2BDB A;  4Y79 A;  2ZPS A;  1J16 A;  4X8T H;  3PRO A;  3A8A A;  4JK6 A;  2Z9K A;  2ZPR A;  1CVW H;  1VJ9 U;  2WPD D;  4YM9 A;  3UNS A;  3T29 A;  5EXN A;  3VB3 A;  2C4F H;  3SZN A;  1AB9 C;  4GPG A;  3PM3 A;  4RSP A;  1UVS H;  1SG8 B;  3QGN B;  3FP8 E;  2A31 A;  3T28 A;  3L6P A;  3TIU A;  2V35 A;  1DWB H;  1LHE H;  3TNT A;  5DG6 A;  3V7T A;  4OS2 A;  3RC4 A;  1AZZ A;  1QRW A;  1SI5 H;  3UTU H;  2BZA A;  5DJ7 A;  3S9A A;  4YXW D;  1EZQ A;  1ELG A;  2EI6 A;  1V2Q T;  1TPP A;  3TJO A;  3PLK A;  1LCY A;  3UR6 A;  5DPA A;  1TRY A;  3CS7 A;  3QGJ A;  1VIT G;  1FI8 A;  3FOA A;  3A82 A;  5HMA A;  2A1D B;  5FCR A;  3FAO A;  1WSS H;  1THS H;  1XXF A;  1C2M A;  1ID5 H;  2W3I A;  1GHY H;  4JYT A;  1GL1 A;  1L0Z A;  1W7X H;  4WWY A;  2VBC A;  2QV1 A;  2EI7 A;  4I8H A;  1QJ7 B;  1VCQ A;  2Z6B D;  4WJG 2;  1ARB A;  4MLF B;  2OC8 A;  1PYT C;  2BLW A;  4X1R U;  2FXR A;  1NY2 2;  1SQO A;  5EGM A;  1EJN A;  5C1U A;  4OS7 A;  4X2V A;  1ZZZ A;  4A1X A;  1P3E A;  2SGE E;  4BAO B;  3SJI A;  1RFN A;  1C2D A;  1X7A C;  3MO6 A;  3H7T A;  2ZDL A;  1T8N A;  4CR9 A;  4X6P A;  3U8O H;  1O2W A;  1C1S A;  2W6I D;  1YC0 A;  4RT1 A;  3GDV A;  3N99 A;  1O38 A;  2Z3D A;  2P94 A;  1W0Z U;  1BMM H;  3NPS A;  2BX4 A;  1A5H A;  1YPL H;  2AGI X;  1O35 A;  1EPT C;  3SUD A;  5A0C A;  2FIR H;  4XOJ A;  5CE1 A;  3RUO A;  1TB6 H;  1RS0 A;  2ZDM A;  3VGC B;  2GGV B;  4Y8Z A;  1C2G A;  1CGI E;  1SR5 C;  1XMN B;  3TGK E;  2BLQ A;  1V2O T;  1MTW A;  1DXP A;  3A86 A;  1NM6 A;  1DUA A;  3S7K B;  1G30 B;  3DFL A;  2BHG A;  2YMS D;  4X1N U;  3ODF A;  3ZZ9 A;  4B2A A;  2WPM S;  1TFX A;  3VB4 A;  2F9P A;  2VIV A;  4X2Y A;  1F5L A;  2M5T A;  2VH6 A;  1Y3V A;  3SV8 A;  2ZU1 A;  1RXP A;  2F9U A;  4ZUH A;  2G55 A;  2ZPQ A;  2SGF E;  1Y3U A;  2ILN A;  4Y71 A;  2A5A A;  3LGT A;  1K9O E;  4WF8 A;  1HAH H;  3RXT A;  5B6L A;  1FY5 A;  1LHD H;  2OBO A;  3K6Z A;  2BB4 A;  2A4G A;  4X1Q U;  1SQT A;  3ZVD A;  1QNJ A;  1AUT C;  2Q6F A;  2V0B A;  1TMU H;  3RXL A;  2GZ8 A;  1NFY A;  8GCH G;  2C8W B;  1O2S A;  1SFI A;  3E8L A;  1T8L A;  3MH5 A;  2XXL A;  1GPZ A;  2XBV A;  2QXG A;  2TGA A;  1JXP A;  2XNI A;  3EA9 A;  4H42 U;  4ZXX H;  2Z9G A;  4Y8X A;  2WPH S;  5EOD A;  1PQ8 A;  4YOJ A;  4RN6 A;  2O8U A;  2ZNK H;  1QL8 A;  1O3O A;  4IGD A;  2CN0 H;  5JDU B;  3QZR A;  4AFZ A;  3LGI A;  3EE7 A;  1NPM A;  2BY8 X;  4K8B A;  4UFG H;  2FLB H;  4TT3 D;  5L2Z H;  4UE7 H;  1IQN A;  1P01 A;  4B2B A;  1VKY A;  2F43 B;  3MH4 A;  1BML A;  2ANW A;  3ZZ8 A;  2Y5F A;  5C3N A;  4FUC A;  1GJ4 H;  1JRS A;  2HNT E;  1KYN A;  3PWB A;  4UFE H;  4E7R G;  4E06 H;  2BD9 A;  1L4Z A;  3BTE E;  8KME 2;  2OCV B;  2SGD E;  3ZIA D;  1RTK A;  1WAY B;  5DKM A;  1P8V C;  4VGC C;  2QXI A;  2A7C A;  1A7S A;  1ZMN A;  1HJA B;  1J14 A;  1LO6 A;  1QQU A;  1BT7 A;  3LOX A;  2BVX H;  1SGF A;  3R3G B;  1UTP A;  3BTW E;  1H9H E;  1KMH B;  1FDP A;  2XCN A;  1QBV H;  2FOB A;  1C5W B;  2Z9L A;  1GDN A;  3SU3 A;  1GI0 A;  1V2U T;  5T6D A;  1MMJ N;  2H2Z A;  2R0K A;  7GCH F;  3GCT F;  3ZVF A;  3VB7 A;  2IJO B;  3Q3Y A;  1SBW A;  3E16 B;  2UWO A;  2FI3 E;  1EX3 A;  1KXB A;  4ABF A;  1MBM A;  3P6Z B;  3SGQ E;  1JRT A;  1BOQ A;  4KTS A;  5CHA C;  1ZPC A;  2ZFT A;  3GCN A;  3K9X B;  1CQQ A;  1P09 A;  4CH2 B;  1AHT H;  5FHT A;  2XND D;  2XTT B;  1GVL A;  1EKB B;  2ZFP H;  2ASU B;  2FOC A;  1D9I A;  1QB1 A;  3NWU A;  3SJ9 A;  1TNH A;  1YY3 A;  2RDL A;  3MO9 A;  2GMT C;  3KQE A;  2GTB A;  4I8G A;  4XBD A;  1PPC E;  1QB9 A;  1K1M A;  1O2T A;  5LGO A;  1AN1 E;  1FN8 A;  2ZQ2 A;  3WW7 A;  4JCN A;  1Y5A T;  1HAY B;  1TNL A;  5KGO A;  2CMY A;  1RIW C;  1XUG A;  1NRQ H;  1DVA H;  3SJK A;  1LMW B;  4IC6 A;  2P59 A;  2AEI H;  2FTL E;  4YO9 A;  2KX4 A;  5IYT A;  2O8L A;  1VIT F;  1AMH A;  2P3T B;  2ZP0 H;  2OC0 A;  2VGC C;  1LKA A;  1O2N A;  3RC6 A;  2P3U B;  4BNR A;  1DIC A;  3F3B A;  1W0J D;  1N8O C;  1G3C A;  1O5D H;  3FVF B;  3WWB A;  4B6E A;  4ASU D;  4ZRO A;  3MU0 A;  1HFD A;  2QCY A;  1RRK A;  5CMX H;  1C9P A;  5JBB S;  1GMD G;  4KTC A;  2XC4 A;  5DGJ A;  1T8M A;  4ZMA H;  1RTF B;  1MTU A;  1OSS A;  1Z6E A;  2OLG A;  2FO9 A;  2GKV E;  2A2X H;  1HIA B;  1ZHP A;  2VNT A;  3PYH A;  1AQ7 A;  5CDF E;  2H5C A;  2QIQ A;  4ABB A;  3I29 A;  1Y59 T;  3QN7 A;  2YMS B;  1AWF H;  3M5M A;  1L1G A;  1MU8 B;  2KR7 A;  3HKJ B;  3VXE H;  2ZI2 H;  3BTT E;  4CHA B;  3MYW A;  2XBX A;  4Y0Y E;  2BD2 A;  3UNQ A;  3WY8 A;  2BDG A;  1WV7 H;  1D3P B;  1O3A A;  5EQQ A;  1CBW B;  5EXM A;  4KTU A;  1C5X B;  1FAK H;  1P0S H;  1TIO A;  2GCT B;  3P70 B;  3RDZ A;  5TJX A;  2RCE A;  5DP5 A;  1QRX A;  3D65 E;  3MNC A;  1DFP A;  2PWX A;  5DP7 A;  2F9B H;  1UTQ A;  1CA0 B;  7KME H;  4Y7A A;  2AS9 A;  2FEQ H;  5FPT A;  3MU4 A;  2R2M B;  1HIA A;  1DOJ A;  1QY6 A;  4X1P U;  1A46 H;  2KCY A;  1QA0 A;  1KTS B;  1EAW A;  4X8U H;  2G51 A;  1C1R A;  3U28 C;  5FX5 A;  3BIV H;  1FXY A;  4K60 A;  1GWA A;  4FU9 A;  1FUJ A;  1ZRK A;  1KLI H;  3KYG A;  1NS3 A;  4M7G A;  2Z3C A;  4NZQ A;  1ESB A;  1NBM D;  5DO4 H;  4FOU C;  2JET B;  3TGJ E;  2ZDN A;  3GY8 A;  3F9F A;  1LVB A;  1KXF A;  1MKW H;  1C2E A;  1O2O A;  2H9E H;  3IWM A;  4A5T S;  4OS1 A;  1GCT B;  3RXI A;  1HAO H;  1TGB A;  1A1R A;  2J38 A;  1Y5B T;  2I6S A;  2F4L A;  2GCH G;  3BTD E;  1C5O H;  2FI4 E;  1F0R A;  4IS5 A;  3SQH E;  1O0D H;  1OXG A;  2AYW A;  2C3S A;  3RXG A;  1P02 A;  3LPR A;  1XVO A;  1VJA U;  1EAU A;  1C2J A;  2K8I A;  1V2K T;  1B7X B;  8GCH F;  1VR1 H;  1YP9 A;  1QFK H;  2EA3 A;  1P2M A;  3U98 H;  1DWD H;  1HAG E;  1ZMJ A;  1V3X A;  1CT2 E;  3A8B A;  3P8O A;  3C27 B;  2WYG A;  4DG4 A;  3QDZ B;  2Z9J A;  1ELT A;  3TNS A;  1IQF A;  3LGU A;  1Y3W A;  1AUJ A;  1BHX F;  2ZIQ H;  2BD3 A;  5A8Y A;  1MAY A;  2A0Q B;  1T32 A;  3BEU A;  2ZGJ A;  2Y80 A;  4MG3 A;  2QF0 A;  5A09 A;  3ZVB A;  2TRM A;  3SHA H;  1O3C A;  2J34 A;  1NRS H;  2G4U A;  1WCZ A;  3QX5 H;  5C2Z A;  2XWB I;  2GDE H;  1ZR0 A;  4ABD A;  1TMT H;  3Q3X A;  3SOS A;  2TIO A;  3PMB B;  4UON A;  4JZE H;  4AB9 A;  1OWE A;  2LP6 A;  4DT4 A;  2GJG A;  4DCD A;  2AFQ B;  6GCH F;  3RXP A;  2NU4 E;  3AW1 A;  2O8M A;  1FIZ A;  1P04 A;  1SQA A;  2AMP A;  5A8Z A;  1O3H A;  1E0F D;  3ZV8 A;  3NUM A;  2EY4 C;  1C1N A;  4YOG A;  5FBE A;  1PPZ A;  3M5N A;  6CHA C;  5E2O A;  1DLK B;  4Q7Z A;  1TE0 A;  4K1T A;  5A2M H;  5KEC A;  1BBR E;  1CGH A;  1QTF A;  2FOH A;  1Z8R A;  3UWJ H;  1EZU C;  3VEQ B;  1GI8 B;  7LPR A;  1AKS B;  1AVW A;  1SGP E;  2XWA A;  2J97 A;  1CGJ E;  1GJ6 A;  1UVO A;  5AVD A;  4MNX A;  1XM1 A;  4CH8 B;  2PGB B;  3SU4 A;  2BLV A;  5F8X A;  3UOP A;  4TY7 A;  3UAI C;  1B0F A;  1U6Q A;  3ATK A;  4MNW A;  1LVO A;  2VWN A;  1QR3 E;  3RXS A;  4DUR A;  2ZHW H;  1OWD A;  2KCP A;  1SGD E;  5JBC S;  4I8L A;  5LPR A;  4Y8Y A;  1Z8J B;  1O30 A;  3ZVA A;  3MWI U;  1Q31 A;  2PLX A;  2RFK C;  3AAS A;  3TJV A;  3RLW H;  1O3M A;  3GOV B;  1DX5 M;  1EJA A;  4ISN A;  3SBK A;  3SV2 H;  1B0E A;  5GJ4 B;  1LQD B;  5GPI B;  1AKS A;  1GBA A;  3SND A;  1UTM A;  4INK A;  2A4R A;  4WY3 A;  4YLU A;  4Q80 A;  2V6N A;  4AGJ A;  4WVP E;  4JZI A;  1C9T A;  3M37 A;  1K21 H;  1TA6 A;  5F8T A;  2IPH A;  1J17 T;  3SI3 H;  1XKB C;  1HJA C;  2BDI A;  5GIB A;  5T1V A;  5T6G A;  3LC3 A;  4UD9 H;  2B5T B;  3NRL A;  2ZG0 H;  2FS8 A;  4U01 A;  2D8W A;  3MH6 A;  4I33 A;  2HAL A;  4JMY A;  1AE5 A;  3GS9 A;  2PW8 H;  4PRO A;  2NU1 E;  4XDE A;  5L2Y H;  2EC9 H;  2UUK B;  2OXS A;  1FY1 A;  1FZZ A;  1O3G A;  2FX4 A;  1Z1I A;  1GI7 B;  1MKW K;  2ZFR H;  3LGY A;  3P92 A;  2HNT C;  4HGC A;  4BAN B;  3LJO A;  5FAH A;  1Y8T A;  3SUG A;  3P8G A;  3S69 A;  3ATL A;  1GBL A;  1GHV H;  1O2R A;  2Y5G A;  1MQ5 A;  1Z7K A;  2QF4 A;  2GVF A;  1FX0 B;  4ZHM U;  3QUM P;  3O8C A;  2WV9 A;  3D62 A;  4Y0Z E;  1D6W A;  1H8H D;  4D7G A;  4FXG H;  4MNY A;  1TNI A;  3OTJ E;  1UVU H;  4RI0 A;  3RXQ A;  1D3Q B;  5C20 A;  2QXH A;  3GCH B;  3NCL A;  1O5G H;  4IN1 A;  4AYV B;  6EST A;  3N7O A;  3UY9 A;  3M7Q A;  2B7D H;  1TA2 A;  1UW7 A;  1O34 A;  2Q6D A;  2UUY A;  1MCV A;  2FES H;  2Y82 A;  1O2L A;  3PV4 A;  4K2Y A;  2PKS C;  5GCH G;  2BD8 A;  2D2D A;  1D6R A;  3MMG A;  2W26 A;  3E91 A;  3FZD A;  1TRN A;  4NG9 H;  2XYA A;  1G2M A;  1SLW B;  6LPR A;  3EA8 A;  3DUX H;  1GI2 A;  1GMC F;  3KID U;  1CO7 E;  2J5U A;  3ZVE A;  1DUE A;  2EQN A;  1GMH G;  4CRB A;  2V7Q D;  4Y7B A;  1IQJ A;  3SU5 A;  1DXW A;  2ZTY A;  2PP6 A;  1MTN B;  1DLE A;  2K0Q A;  4AFU A;  3P95 A;  1ZHM A;  3HK6 B;  1N6X A;  2K1Q A;  2GZ7 A;  1OOK B;  1W8B H;  2IN2 A;  1SPJ A;  5E8E H;  2QYI A;  1FON A;  1SLX B;  2H5D A;  3MTY A;  3SU2 A;  3K65 B;  1DS2 E;  1PPB H;  3DSO A;  3RML H;  1OX1 A;  4JYV H;  2EI8 A;  1GG6 B;  3EDX B;  3Q77 A;  3OTP A;  2F3C E;  1NRR H;  2KCO A;  3EST A;  4IC5 A;  2J9N A;  1KXE A;  1GCD A;  3A81 A;  4FVD A;  3U1J B;  3VPK A;  4TY6 A;  4CR5 A;  2W7S A;  2A7J A;  1EOL A;  1BTP A;  1TGC A;  3UWI A;  3RXB A;  1YPM H;  5C1X A;  3A7T A;  3KGP A;  3F2H A;  4AFS A;  1BRC E;  1J9C H;  2C8Z B;  3A85 A;  4B71 A;  1E35 B;  4CRC A;  5AFY H;  2TGP Z;  1EB1 H;  2ZEC A;  2Y7Z A;  4ZXY H;  2G5V A;  3GDU A;  1EUF A;  3KN2 A;  4WXI A;  4ZH8 A;  4AZ2 B;  4RKJ B;  5DP4 A;  3F9H A;  1Z8G A;  3LU9 B;  3RXC A;  1SLU B;  4YZU A;  1GHB G;  1GBT A;  5GND A;  5F53 A;  3HK3 B;  1ETT H;  2Z7F E;  3LKW A;  5HGG A;  3NKK A;  2STB E;  3E90 B;  2CHA C;  3O8D A;  3RXD A;  1TAW A;  4O3T A;  3PTN A;  3KQC A;  3S0N A;  3MU5 A;  1BTH H;  1UK4 A;  4NA8 A;  2ODP A;  1JIR A;  4AFQ A;  1QUR H;  1O2H A;  3FO8 D;  4FUH A;  5DP3 A;  5AHG H;  1O3D A;  2GT8 A;  1GBI A;  3KCG H;  4HFP B;  4X6O A;  3RXF A;  1GCT C;  3DD2 H;  1Y5U T;  1NFX A;  1T7C A;  3SGA E;  2P95 A;  2ZQ1 A;  1C5Y B;  4B76 A;  4DOQ A;  2BMG B;  2BX3 A;  4B75 A;  3UB0 A;  1P3C A;  1V2P T;  1NT1 A;  1PYT D;  2QAA A;  3MNX A;  1WUN H;  1C5R A;  2ZCH P;  5BPE A;  4CRE A;  2PSY A;  4OS5 A;  1S6L A;  2KM0 A;  2ODY B;  2OTV A;  1MUE B;  1ELV A;  2OC1 A;  1F92 A;  1OWK A;  3EAJ A;  1O2Z A;  1XX9 A;  3MHW U;  2R3U A;  2CXV A;  3SJ8 A;  1F0U A;  2BQ7 B;  5C0T A;  1TMB H;  4A1T A;  4FUJ A;  4Q63 A;  2FWW A;  1TBQ H;  1ZJK A;  1PJP A;  4X8S H;  2Q1J A;  1O2P A; 
#chains in the Genus database with same CATH homology
 4ACA A;  4AC9 A;  2LP6 A;  4ACB A;  1SQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...