4FUIA

Crystal structure of the urokinase
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
246
structure length
246
Chain Sequence
IIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTIALPSMYNDPQFGTSCEITGFGKEQSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords Urokinase-type plasminogen activator
publication title Crystal Structure of the Urokinase
rcsb
source organism Homo sapiens
total genus 59
structure length 246
sequence length 246
ec nomenclature ec 3.4.21.73: U-plasminogen activator.
pdb deposition date 2012-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fuiA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4fuiA01
4B76A 1QJ6B 4IC5A 1G2MA 1DS2E 5F8XA 1BIOA 2FESH 1C1PA 1O3KA 4ZHLU 4Y7BA 3SU2A 1MD7A 1QB6A 1NROH 1UVPA 1A2CH 1RXPA 1O3BA 1TRYA 1P9SA 4KTSA 3QGJA 1C1WH 1TGNA 1GJ8B 4RN6A 1TA6A 1ETSH 2ANWA 3MNCA 2SGQE 1ANEA 2VH6A 4BAHB 1P04A 1EB2A 4FUBA 4BANB 1SQOA 2O8UA 2PLXA 1N6XA 1C9TA 1ZMJA 1BHXB 1BJVA 1AB9B 2ZGHA 3BG4B 3RU4E 4E7NA 1RTFB 2FS9A 2ZU4A 2HOBA 2XBYA 3E0PB 1ELVA 4DW2U 5L30H 1BTYA 4LZ4B 1AFQB 1C1RA 1AFQC 2W7UA 4X2XA 3GYLB 4I8LA 3BN9A 1GJ4H 1BRCE 2XCNA 3R3GB 3QWCH 3S9CA 3NK8A 3TNTA 4AG1A 4E05H 1SLVB 4WWYA 2WPIS 2PTCE 3BF6H 4CRFA 1O2HA 2BM2A 4BNRA 1DWEH 2HPPH 3PWBA 1OP8A 1QURH 4R0IA 2WYJA 4YT6H 2G51A 1ZRKA 3BTME 4RKOB 3LT3A 1CE5A 4UONA 1SGCA 4VGCB 2H5DA 2ANKH 3IITA 1N8OB 1S82A 2HVXA 1N8OC 1AI8H 2CGAA 5JPMH 2AGEX 2XWAA 4KP0A 1K1LA 2SFAA 1GI3A 3P6ZB 5IDKA 5TCAA 3RXKA 3K6YA 2BD3A 2ZHWH 1SGNE 1DOJA 3MTYA 1GMHG 4I33A 3I29A 4X8UH 3ZZ8A 4I8KA 4RSPA 2P8OB 5HGGA 1W0ZU 1GHVH 4ZKRU 1TX6A 2F91A 2P8OC 2GT7A 4NA9H 2ZU3A 2G5NA 1YGCH 4MLFB 4AB9A 1BA8B 1LKBA 1NS3A 1O2UA 3SV2H 4ESTE 1B0EA 1HXEH 2XTTB 1Y3YA 1FV9A 4JZDH 5C1UA 1YM0A 1V2VT 1XMNB 1W13U 3ZVDA 2ZDMA 1QHRB 2PGQB 4E06H 1O2RA 5LGOA 2AH4X 2BYAX 2ZKSA 3RP2A 1CGHA 4X2YA 2PSXA 2XNIA 1HDTH 1FY3A 1EP5A 4XE4A 3NKKA 1P2IA 4ABAA 3QO6A 2HLCA 1QQUA 3TK9A 1A7SA 3AVZA 3KGPA 1OWEA 3P8GA 2WUBA 3UNSA 3RC4A 4X1RU 5GDSH 2BVRH 5EODA 3MO9A 1NRSH 4WH6A 5TCCA 4ABJA 3GY6A 3P95A 1B0FA 2OC8A 2BOKA 3SUGA 1GWAA 1G9IE 1TBRH 4X2VA 1SB1H 1TRNA 3QN7A 1P10A 4A1XA 5K0HA 1E36B 4B2AA 3SQHE 4YOIA 1IQFA 1XVMA 1V6DA 3SGQE 1MMJN 1L2EA 3TH3H 1P57B 1PQAA 1DXPA 3LJJA 4SGBE 4X1NU 1Y3VA 4INLA 3MU8A 2A32A 2R9PA 1V2WT 4I31A 1IQJA 3QZQA 4YZUA 1LTOA 1E35B 1E37B 1Z1IA 1DWCH 2H6MA 3ENSB 2UWOA 3TU7H 4Y8XA 3P70B 1YLDA 1PQ5A 4J1YA 4ZROA 5GWZA 3S9AA 2FWWA 2PR3A 1EJAA 1OWDA 3LONA 2PHBA 5HM2A 1GCDA 5C2ZA 1HLTH 1TQ0B 5H4IB 3RUOA 3A8BA 1F0TA 3O8BA 1Z8GA 4AB8A 1RGQA 4AFUA 2UUKB 4H4FA 4NCYA 4A1TA 3AW0A 3VFEA 1O5AB 1UCYK 5C5OA 1LVBA 1SLXB 1XUHA 2A31A 1Z8JB 3S9BA 2BY9X 8KME2 3MNSA 1F7ZA 1IQNA 4NA8A 3TH2H 1GI5A 7ESTE 5A0AE 1HNEE 1TQ7B 4OS7A 3RMOH 2G5VA 3S7KB 2BVSH 4JK6A 4YO9A 2V3OH 2XBWA 1O2IA 2VIPA 1O32A 4DJZB 1LPZB 1XUFA 1GVLA 4Y0YE 2OC0A 5L6NH 1ZTKA 1YPHE 3I77A 4YLUA 3SNAA 1Y5AT 1C5XB 3VB4A 2ZDAH 3PLKA 1Y3UA 3P17H 4AOQA 3LGUA 5LPEA 4I8JA 1GDUA 9LPRA 2ZP0H 3HK3B 4TWYA 1UTNA 5EXMA 2FOCA 2FI4E 2BD5A 3AW1A 2CMYA 4MNXA 1O33A 3A84A 3LJOA 4WMDA 2SGPE 2Z3EA 2NWNA 2XC0A 2P3FH 4WMEA 5JBAS 1OYTH 4LXBH 3ZVCA 4KGAA 1DVAH 1NT1A 1MKWH 1O5DH 3T25A 4K1TA 3UY9A 1GBAA 1NFWA 4MPXA 3E0NB 1H4WA 3BEFB 1BTUA 3PV4A 4ABBA 1O2OA 3RXJA 2A5IA 4NA7A 5EXLA 1KXFA 1GBDA 2WPKS 4XOJA 2W5EA 5LH8A 2J38A 1SFIA 4CH2B 3PO1B 3EA7A 1TE0A 2ILNA 3PO1C 4H6TA 1NY22 1NN6A 2UWLA 3URDA 2BDYA 1P3EA 1SPJA 3MH7A 2FPZA 3A89A 4K1SA 2G4TA 1ZTJA 4FUGA 1NESE 2GCTB 3CP7A 2GCTC 4FUDA 1HCGA 1O39A 3GDVA 1S6FA 3DA9B 2Q6DA 3RXUA 3KNXA 7KMEH 1TMBH 1H9LB 1MD8A 1GMCG 2ZTZA 2XCFA 1L4ZA 2C8WB 2WPMS 3SU6A 1AWHB 1PQ8A 1P12E 1S0QA 1YC0A 3VXEH 1Z8IB 3UWIA 1IHSH 2SGAA 5FAHA 1CGJE 1FY5A 1L1JA 3QUMP 1YCPM 1SSXA 1V2OT 1QBOA 3QLPH 3IG6B 3RDZA 2WPHS 2ZHEH 3RXTA 4YM9A 2QA9E 1O37A 1Q2WA 3MI4A 1DY8A 1UCYE 1AE8H 3A8CA 2TGPZ 4XBCA 5DP6A 2B5TB 1UTPA 2ZDVH 1W0YH 3OU0A 1KXCA 3C1KA 4FXGH 8GCHG 1CBWC 4BTTB 2O8WA 3A7WA 5EQQA 1QL8A 1O3DA 1GI0A 1HAGE 4OGYA 1TBQH 2XW9A 2ZWLH 4DURA 5HXFA 1DUAA 1P2MA 4D9RA 3BTKE 1GJ9B 3L3TA 4Y10E 1ZMNA 5AVDA 3M7QA 1TX8A 1P2QA 2HALA 3SV6A 2QY0B 1NRQH 3F9HA 1BMNH 4TY7A 3D49H 3RU4T 5EW2H 1SGYE 1SOTA 3M7TA 3RXDA 3P92A 4ZHMU 3K65B 3OSYA 3QK1A 2TGAA 1ZTLA 2A7CA 3BV9B 2NU2E 2ZCLP 1GBJA 3RC6A 2AIQA 1OWIA 4CRCA 4Y0ZE 2ZQ2A 5DP4A 1O5GH 1XXFA 1MU8B 3ITIA 4NSYA 3SHCH 5AFZH 2QXIA 4JZEH 1V2RT 2M5TA 3DT0H 1AZZA 2Z3DA 2Y6TA 2WUCA 1LDTT 2AGIX 2J92A 2VIWA 1YKTA 4HI3A 3SHAH 1CHOF 1QRXA 5EU8A 1TPAE 3MU0A 4ZKNU 1C1UH 1AKSB 5C5NA 1GBBA 1O3OA 4GCHG 5G4BA 5K7RA 5CHAB 2ALVA 1P03A 1BMAA 5CHAC 5DO4H 4K60A 3R0FA 4ABHA 1UK4A 1EZSC 3CS7A 2Y7XA 3ZVBA 3EDXB 1TGTA 2BDGA 4I7YH 1EXFA 1IOEA 1WCZA 2GMTC 4IN1A 3DD2H 1P01A 1LVYA 3SU3A 4A6LA 5JBBS 4ISHH 1ZPBA 1O3CA 4X6NA 1UTMA 3RXMA 3NCLA 3ZZ6A 1W10U 3BEIB 2IJOB 1TNKA 2OC1A 1SL3A 1CVWH 2ZU5A 4NWLA 1O2VA 1P2KA 2OTVA 1ABIH 1LHGH 5EQRA 4AYVB 1VCQA 2XRCA 3H7OA 2V3HH 1CSOE 1C5VA 2FM2A 1EPTA 4CR9A 2XC4A 1BT7A 1SVPA 1GHWH 1AU8A 3W95A 4X6OA 3EE0B 4B75A 4ABGA 4IN2A 1D9IA 3LH3A 1MBQA 1A3EH 1J16A 1ELBA 2J94A 2ZGXH 3E1XB 5FPTA 3RM0H 1GBMA 2FOAA 2P59A 4NIXA 4I8GA 1XXDA 3NZIA 3T5FH 1NTPA 1QJ7B 2BY5X 1BZXE 2C8XB 3MNXA 5FHTA 1JMOH 1BITA 4TYDA 2PFEA 3PLBA 2HPQH 1C2KA 3RXOA 1LVOA 1P06A 1TNJA 2BX4A 4GPGA 1ZHPA 1F0SA 2A7JA 3LGYA 3QTOH 1O31A 1XUKA 1GMDG 3LIWA 4B2CA 1DPOA 4CBNA 1AVWA 1LHCH 1HAYB 2OXSA 1AN1E 1KDQB 1LQEA 3F9EA 3BTDE 5EOKA 2C3SA 1UJ1A 1UK3A 1JIMA 2Y7ZA 3RMMH 3SZNA 1F5RA 2WYGA 3SOSA 2H2ZA 1D6RA 3VB5A 1MTWA 4GUXA 3A7TA 5EG4A 5FPYA 1C5OH 3PMHB 4BAQB 1GHXH 3DHKH 4OGXA 1P0SH 4DIIH 2ZO3H 1HJ9A 3GCHB 3A88A 9ESTA 1HAVA 2BD7A 2ALPA 1Y5UT 3BEUA 5EXNA 3RXVA 1IQLA 1TB6H 3BSQA 3FZZA 1EPTB 1J17T 1QFKH 4OS4A 1EPTC 3E3TA 3RMLH 2P3TB 2VIDA 3M36A 1C2JA 2YOLA 3FAOA 3SU0A 3E90B 1A1RA 1CQQA 3SI4H 3KHVA 2Z9GA 3V13A 2R0KA 2ZC9H 1RD3B 1OS8A 1RTKA 1GBHA 4MDSA 5A8XA 3VGCB 1K1MA 3U1IB 2O8MA 1KTSB 3VGCC 4Q80A 1RIWB 1EOLA 2NU3E 2QF0A 4Y79A 2VB0A 3S0NA 1O2XA 5A0BA 4D9QA 1HB0B 1O34A 7GCHF 4R8TB 3EGKH 4D7FA 3PB1E 2ESTE 1UHBA 3U98H 1A3BH 2BY6X 3SUFA 4BTIB 2GV6A 2D2DA 2J95A 5C67A 3URCA 4XDEA 1NRNH 3N7OA 2ZPQA 5JBCS 1BMMH 2O9QA 2FX6A 2IPHA 3D65E 4WY3A 1W3CA 3U8RH 3SU1A 4Q7ZA 4HZHA 2BY7X 1K22H 3GCOA 1V2UT 1L1GA 1C2FA 3RXIA 1DDJA 1YLCA 3FP8E 1OWJA 3IWMA 1JRSA 2EC9H 1ARCA 1N1LA 3PM3A 1V3XA 4AFSA 4FUHA 1X7AC 3JZ2B 1PPEE 2GP9B 4UDWH 5HYOA 1GJ5H 2ZPRA 5I25A 4A92A 3SJOA 3FANA 4DOQA 2CF9H 1NFUA 2ODQA 4NFFA 1U6QA 1MKWK 4O03A 4IMZA 5F6MA 3T27A 3HPTB 2JH5D 4X1QU 1EJNA 1K1PA 1G3DA 1O3AA 1SMFE 4Y8ZA 3STIA 5B6OA 3KQDA 1QIXB 5JBTA 2FOHA 3RC5A 2HGTH 5L2ZH 2KAIA 1OYQA 4IW4E 3TK5A 1AD8H 2HRVA 1O2QA 3LC3A 2TPIZ 3D62A 3GICB 4HFPB 2FLRH 2BD8A 3UR9A 1C1TA 2CJIA 3M3SA 3LH1A 1QR3E 1Y5BT 1C1VH 1AE5A 1G2LA 3ODDA 1LCYA 1J9CH 1GJ7B 2BXTH 3T26A 6ESTA 1IQKA 3F9FA 1LHDH 5A2MH 4PROA 1AIXH 3VB3A 1MTVA 2ZTXA 3B9FH 1QGFA 2RG3A 2FXRA 2ZDKA 1P05A 4AX9H 2XBVA 1HAIH 4H6SB 4HGCA 3TGKE 5C20A 1NFYA 3I78A 5T3HA 4X2WA 4CRDA 1DSTA 4GSOA 1WU1A 2FMJA 1QY6A 2F9PA 4Y71A 3LU9B 3ZVGA 3ODFA 4O3UA 1XUGA 3UIRA 3Q00A 1DWDH 2IOTA 1CGIE 2XC5A 2Y82A 2V0BA 4CBOA 1QNJA 2I6QA 4FUCA 1EAIA 1V2LT 2HNTF 1IQIA 1GBIA 2CN0H 1NRRH 5JB8S 2BDBA 4Y6DA 1ESBA 4KTUA 1F2SE 5ETXA 1UTOA 4BAMB 3FP7E 2J34A 2KAIB 1T8NA 1TA2A 4UFEH 3KN2A 4ZUHA 5ESBA 1O3LA 3NXPA 1UMAH 3M5OA 3OY5U 4MPWA 3LPRA 3M3VA 5JDUB 5DG6A 1E34B 3T62A 1ESAA 1ELAA 1GPZA 2GZ8A 3RXGA 4Z6AH 1QL7A 2BQ6B 4AFQA 3MMGA 2H5CA 1GHYH 2A4QA 3ZZ9A 1SGFG 3BTGE 1VJ9U 4A7IB 2IN2A 1EAUA 3SO3A 1HXFH 2PTNA 5F8ZA 1IQGA 1ELTA 1O3FA 1GMDF 1SGPE 2HWLB 1HJAB 2B7DH 1HJAC 2OBQA 1BRBE 2ZFRH 1FXYA 1H8IH 5EW1H 2BB4A 1QBNA 3GCTF 2A1DB 3ELAH 1TNHA 1A5HA 1A5IA 4B71A 4ABFA 1BRUP 2G52A 5ABWA 4IC6A 3ZZ4A 1F5LA 2CF8H 2ZDNA 1MCVA 2FIRH 1QJ1B 1SR5C 2DUCA 3M5LA 1L0ZA 5T6GA 1OWHA 1TONA 5EPYA 1ZRBA 1EUFA 2VU8E 2FDAA 1AVXA 1CT2E 3ZZ7A 1EP6A 2CV3A 3ZZBA 2D1JA 2PSYA 1ZR0A 1HAHH 1ID5H 1O2MA 1XKAC 2ZGBH 4I32A 4D7GA 1GL1A 1FUJA 4X8TH 1AMHA 3MH6A 3SU5A 1D6WA 3SGAE 3TGIE 1UK2A 2G55A 1OSSA 3AASA 2ZFPH 3UUZA 1BTPA 1CHGA 3TPIZ 2H9HA 1FN8A 1O2LA 1IHTH 3OTJE 2F83A 4NZQA 2ODYB 2FTMA 2TGTA 4HTCH 1TNIA 2FOMB 3MFJA 4MPVA 1VITG 2FOFA 3SN8A 5HM9A 2Z9KA 3BTWE 5IYTA 4ABIA 1ABJH 1MTSA 4BTUB 1ZHMA 2BHGA 5C3NA 2UUJB 3AAUA 2AS9A 5CE1A 1UVTH 2ZTYA 3SI3H 1Z1JA 2Z7FE 3ATKA 3UR6A 1CA8B 3L33A 1QTFA 4THNH 1LVMA 1T8LA 3UTUH 2SNWA 1GHBG 1CT0E 3ZVAA 1ANDA 1C5LH 3OYPA 5PTPA 4DVAU 4ASHA 1OP0A 1OOKB 4UD9H 1ANCA 2GDEH 2O8LA 1KIGH 3A80A 4UFGH 3GDUA 1ANBA 2FP7B 1ARBA 2RA3A 2WV4A 5EQSA 3SV7A 1ELEE 1UTKA 2ZHQH 3GY2A 4NGAH 1QA7A 4CR5A 4NG9H 1PPZA 2RCEA 1HIAA 5A09A 4F49A 2AFQB 1Q3XA 3B8JA 3KQCA 2BX3A 1AY6H 1QCPA 1NFXA 3PWCA 1BQYA 2ZFSA 2BLVA 4CHAC 3A8DA 1PYTD 1BJUA 1MAYA 1VITH 4FUEA 4WH8A 4FU9A 5GCHG 3T2NA 5E2OA 2JKHA 3ZVFA 2QV1A 1FN6A 1FIWA 4CRBA 2FS8A 1C2IA 2ANYA 1O2PA 2Z9IA 4GHQA 1GJAB 2AMPA 1GJDB 1KSNA 1O35A 1O0DH 2WPLS 3Q3KA 1GMHF 1YBWA 1A46H 3MU4A 5AFYH 1GBEA 4AORA 1C2EA 1ZGIA 3RXQA 1V2KT 1CBWB 4TPYA 3JZ1B 3M7UA 4XBDA 4B74A 4OS2A 1ORFA 2F9BH 1PPFE 2VINA 1YCPH 1C5YB 1GDQA 3TIUA 2JETB 3MU1A 3M5NA 1AQ7A 2JETC 1YF4A 1IQHA 1AUJA 5I46H 1SGRE 1GHZA 4Y7AA 1O3PB 4UFDH 3V0XA 4ZMAH 3A7VA 1N6YA 4UEHH 1VZQH 1KXEA 2BD4A 1UTJA 3RLWH 3ZVEA 4MG3A 5T6DA 3U69H 3OY6U 1TGCA 4AGKA 1C5SA 4JK5A 1KY9A 1JOUB 2GKVE 2J2UA 3B23B 4YTAA 2FEQH 1T31A 3RXPA 3LKWA 5C1XA 4JCNA 3CS0A 3BTEE 4ZXYH 1GI9B 3O8DA 2A0QB 3BIVH 2A7HA 1GJCB 2OCVB 4GHTA 3TJNA 1HAPH 2GVFA 4B1TA 1IAUA 3KQBA 1VGCB 2QXHA 1C2HA 1VGCC 1GDNA 2BXUH 1TWXB 3OX7U 2AMQA 4FUJA 2GT8A 4K1EA 3T29A 1C4U2 1ETTH 3UWJH 1C4Y2 1GJBB 3GCNA 2P94A 3P8OA 1FZZA 1K1JA 3O8RA 1TFXA 3TJOA 5GIBA 1C2GA 2VNTA 1NRPH 1G3CA 1C1OA 2FX4A 4CRGA 3ZYDA 1O2WA 6GCHG 1DWBH 1TOCB 3H7TA 1ZSKA 3HGPA 1O3NA 4Z0KA 3RXRA 5BPEA 1O5FH 1O5BB 1WTGH 2A5AA 3LGTA 1YPLH 2NU0E 2ZHFH 2C4FH 2CHAB 2EI7A 2CHAC 1HAZB 3UOUA 1BDAA 5DP9A 2BLOA 1O30A 4FUFA 2OQUA 3Q76A 2GMTB 1C1QA 2GX4A 1JIRA 2Y81A 1DT2A 3EQ0H 3HKIB 3LDXH 3PMBB 4ABDA 2EA3A 1TMTH 1OXGA 4B2BA 5A8ZA 2HNTE 1Q31A 1G3BA 3MH5A 3TGJE 2VH0A 3GY4A 2UUYA 2PKSB 2BTCE 1C2DA 1YP9A 3H5CB 2DE8A 2PKSC 1EAXA 2Z9JA 2RA0A 1MH0A 1GHAG 3SV8A 2BDAA 1UVOA 1GJ6A 2V35A 1BTZA 4LZ1H 2YNAA 1MQ5A 4RKJB 4GLYA 5GPIB 1O3MA 4O9VA 2ULLA 4FU7A 3S7HB 2H1UA 5DP8A 1NPMA 1S81A 5E0GA 1OPHB 2W3KA 3ZZCA 1KXBA 1T32A 4K69A 2ZG0H 1PPBH 3BTQE 2C93B 2QXGA 3ATWA 4AG2A 3MO6A 1QL9A 1GHBF 3PMAB 2VGCB 2VVUA 1MQ6A 2GZ9A 2VGCC 1YPHC 1VR1H 2PUXB 2V6NA 2I6SA 3PLPA 2TIOA 1P2JA 3FFGA 1ZGVA 1HBTH 2VWOA 4JYVH 5FX6A 3KEEA 4B73A 2A5KA 1MZDA 4WJG2 1NU7B 3HGNA 4JYTA 1K28D 3ZZDA 3UQVA 2H9TH 1LMWB 4JMYA 2VWMA 1MKXH 1TOMH 1H1BA 1LKAA 1BBRH 1VJAU 1GG6B 1T8OA 1TPSA 1GG6C 3F1SB 1OP2A 1QB9A 1SI5H 2BZ6H 1K1NA 8ESTE 4K8BA 1AHTH 3U9AH 1SQAA 1NZQH 1ELDE 4JZ1A 1HJ8A 2XBXA 1TABE 3TVJB 1KYNA 1G3EA 2ZEBA 3NUMA 1HV7A 2ZGCA 1TYNA 4X8SH 1TX7A 1THSH 1F5KU 2GCHG 3SJ8A 2UUFB 1O2NA 2Z9LA 4Y11E 1W11U 3FVFB 4ISIH 4QT8C 2THFB 1GMCF 1SHYA 8LPRA 2BD9A 1GBCA 5GCHF 2OLGA 3RXEA 3U8TH 3CENA 3A81A 1C5TA 1ELFA 2Y80A 2PV9B 3M35A 3MO3A 3P8FA 2BDCA 3SNCA 1O2GH 3VPKA 4ZKSU 5DJ7A 5DP7A 1T7CA 2JH6D 3PROA 1O3GA 3ZYEA 1G32B 1TPPA 2UWPA 1D4PB 1LO6A 2VJ1A 2SNVA 1WSSH 4U32A 1SG8B 1Y3XA 3MOCA 5A0CA 2NU1E 2P3UB 2GDDA 3Q77A 8GCHF 5FPSA 1B5GH 3DFJA 1LPKB 1P11E 2W26A 3G01A 1BB0B 3NWUA 4AFZA 4BXWA 2G8TA 5FX5A 1UVSH 2NU4E 3FP6E 1RJXB 5DKMA 1MBMA 1P2OA 1GI2A 1C5QA 1C5MD 3GDSA 3TITA 1NC6A 4WXIA 3STJA 1FY8E 3HKJB 2AIPA 4Q7YA 1ZJKA 2Z94A 1HAVB 3GYMA 1TRMA 1W7XH 3ZV9A 1OX1A 5JYIA 1P2NA 4LK4A 1BHXF 1FPHH 2EEKA 2Q6GA 1P8VC 2VVCA 1PPHE 2AEIH 4FU8A 1SOZA 1MCTA 1EB1H 1C2LA 3MNBA 3RXSA 1SBWA 2XWBI 1S0RA 5EGMA 3BG4C 3LGVA 2STBE 1AB9C 4ISOA 1EX3A 1HFDA 1DX5M 3MWIU 1T4UH 5F8TA 3SNEA 1TPOA 1EKBB 1C1NA 1BCUH 1OKXA 1QRWA 2Q6FA 6CHAB 1FIZA 3SNBA 2ZHDA 6CHAC 3BTFE 2WINI 2W3IA 3LC5A 3RLYH 1E38B 4MTBA 2TBSA 1GCTB 1GCTC 5E0HA 1TMUH 1GBKA 2ZU1A 6GCHF 4DT7B 5CMXH 3U1JB 1GI7B 3MHWU 4GVUA 3RXAA 1UHBB 1SGTA 1WTHD 4CREA 5DP3A 1F0RA 2VIOA 2C90B 2BOHB 4OS5A 3LGIA 1FJSA 2BDHA 4GCHF 2FYQA 4M7GA 1QRZA 1PPGE 2A2QH 4VGCC 1OWKA 4ZHAA 2ZNKH 1FAKH 5EPNA 4JYUH 1J15A 5LPFA 1D3DB 4Y76A 5LPRA 2A2XH 2C8ZB 3A7YA 2F9UA 2J9NA 3RXCA 3BIUH 4X1SU 1YPJH 2PWXA 2ZI2H 2PGBB 1K21H 1S83A 3E6PH 2A4RA 1E0FD 4IS5A 3HATH 3ZZAA 4KELA 3VB6A 4GAWA 1ETRH 1LHEH 1WQSA 1XUIA 1GBFA 5FCRA 4E7RG 1GHAF 4IGDA 3UNRA 2BY8X 1C9PA 2ZZUH 1YCPK 2ZFFH 2GTBA 1SC8U 2FOGA 3A82A 1RTLA 2AGGX 2HNTC 2WPJS 4TWWA 4UE7H 2BLQA 4YOGA 1M9UA 1SGIB 3EAJA 4ZH8A 1BRAA 4ZKOU 1ACBE 1RS0A 2ODPA 2R3UA 1YYY1 3MH4A 1AVGH 1G30B 3RU4D 1W7GH 1S84A 2ZA5A 1XX9A 1D3TB 3GY7A 5DPAA 2ZCHP 1FMGA 1SHHB 1T4VH 3D23A 4WXVA 3T28A 1CA0B 3LGWA 1O3IA 2QYIA 1CA0C 1MTNB 1TNGA 1W12U 2BQ7B 1MTNC 4MQAA 4WF8A 5TJXA 3SU4A 4AZ2B 2FZZA 3DFLA 4Q7XA 2B0FA 1C5UA 1TLDA 3BTHE 1VCWA 3QTVH 3ATMA 5A8YA 3MYWA 4NWKA 1Y8TA 3SJ9A 3RMNH 3SUEA 1V2ST 1YPEH 2P16A 4A5TS 1Z71A 4K8YA 3F6UH 1YPGH 1CHOG 1V2MT 1LPGB 1L4DA 1GI6A 1O3HA 1FY1A 4A1VA 4INKA 1O38A 2Z3CA 2GCHF 3M61U 4NFEA 4Y8YA 1ZJDA 3ATLA 2VIVA 4O3TA 1HGTH 3ZZ3A 2QGRA 1DE7H 3K2UA 1D3QB 1QB1A 4BXSA 2LPRA 2ZFQH 3HK6B 4AGJA 1H9HE 4CH8B 2QF3A 1GBTA 5F03A 2OINA 1DUEA 1KLTA 4DCDA 1A61H 4BAOB 4H42U 1ELGA 1GVZA 4JZFH 2ZECA 2GGVB 2FLBH 1FONA 1ZPZA 1EATA 1F92A 4YT7H 5FBEA 2BDIA 4X6PA 1MTUA 2WV5A 3DUXH 3P8NA 1A5GH 2SGFE 1WBGB 2R0LA 2TGDA 1Z8RA 1EZUC 2ZCKP 4FUIA 5AF9H 1ESTA 5AHGH 2Z6BD 4WVPE 2G81E 1GVKB 4LOYH 1O2SA 3S69A 2SGDE 1L1NA 4D76A 1J14A 2AYWA 1HAXB 1AUTC 5JB9S 1CO7E 1SLUB 3KQEA 1C2MA 1ZZZA 1ZYOA 4NIVA 3SJIA 1C5NH 4U30A 1NU9A 1KLIH 4MNYA 1EASA 1TAWA 2BD2A 3A7XA 1EQ9A 2Y5GA 3VB7A 1P02A 1O5CB 1C1MA 2GD4B 1ZHRA 4ISNA 3VXFH 1PFXC 2B9LA 4NIYA 2VVVA 3GY5A 4D8NA 1O5EH 3QGNB 1AWFH 1O2JA 3PYHA 3C27B 3GOVB 1DITH 1TALA 1YPKH 3KL6A 5E8EH 3PTNA 2P95A 4CHAB 2AMDA 4MNVA 1K9OE 1AGJA 1WQVH 1W2KH 1MKXK 2F9NA 2D8WA 1UTQA 1EAWA 1BBRK 3PTBA 4Q2KA 1Y3WA 1JXPA 1Z6JH 1FI8A 3O8CA 2EI8A 3TJUA 1FY4A 3L6PA 3K9XB 5FBIA 3RM2H 3NPSA 4U2WA 3V7TA 3AAVA 2BMGB 1AFEH 3M3TA 1ELCA 1HPGA 2ANMH 3UQOA 2ZDLA 4MPUA 4K2YA 2XYAA 1CT4E 1GGDB 3U8OH 1GGDC 1YPMH 2OC7A 4ZXXH 3KIDU 1A0HB 1BMLA 4YLQH 1FLEE 1TGSZ 1SGFA 3A83A 2G4UA 2SGEE 2FYRA 1DSUA 1H9IE 5FXLA 1ZLRA 2EI6A 2GV7A 4K3JA 1VCPA 3SQEE 1ZOMA 1GL0E 4OS6A 3EA8A 5C1YA 2K1QA 1AZ8A 4ABEA 3TNSA 1UVUH 2ZQ1A 3GISB 1KTTB 5BRRE 4DG4A 1XVOA 2P93A 3M37A 1SGDE 7GCHG 3BTTE 2QN5T 1HIAB 4XFQA 4X1PU 1MU6B 2YNBA 2B8OH 1RFNA 2BLWA 4TPIZ 5T6FA 1UTLM 1THPB 3EYDA 1DFPA 4YESB 1DICA 1AKSA 1INCA 3RXBA 3SJKA 1EJMA 1NM6A 3F68H 1WYKA 1EZXC 1K2I1 4X6MA 1O2TA 4DIHH 2A4GA 2OBOA 1C5WB 4XBBA 1Z6EA 4U01A 7LPRA 1SLWB 3F9GA 2FI3E 2BVXH 1FAXA 5GXPA 1V2JT 1DLEA 1NO9H 3QZRA 2QC2A 1ZSLA 1DM4B 3KCGH 1AO5A 2F9OA 1S5SA 1G37A 4X8VH 1FPCH 3MU5A 4FVDA 2FODA 2STAE 1P09A 4WMFA 1C5RA 2LNCA 3PMJA 4AYYB 1K1IA 1V2NT 2O8TA 4NSVA 4DGJA 3W94A 1TNLA 2CXVA 2ZPSA 3SBKA 1Z7KA 5DP5A 1SGQE 2QAAA 1LQDB 3ZZ5A 1IQEA 1DANH 3UNQA 1W8BH 5SGAE 3Q3XA 3WY8A 1W14U 3A7ZA 2BQWB 3SV9A 1C5PA 2OP9A 2FO9A 1BBRE 3UFAA 5J4SA 1DXWA 2ASUB 4NZLA 1HRTH 1JBUH 2FOBA 3TK6A 1ZSJA 1JWTA 2VIQA 1SGEE 2ZF0H 4SGAE 1UCYH 4AN7A 3ZV8A 2PKAA 3UOPA 1GI4A 4MNWA 1O2ZA 1ZMLA 4X0WU 2R3YA 3SGBE 1QQ4A 1KDQA 3ESTA 1TIOA 1BOQA 1PQ7A 1H8DH 1HUTH 3SUDA 2FTLE 1CU1A 2Q1JA 4KTCA 1KLJH 1XM1A 1V2PT 4BAKB 5L2YH 2FI5E 3A8AA 1V2QT 5FCKA 3BG8A 2QCYA 1PYTC 4TY6A 1VITF 1ZPCA 1THRH 4FVBA 4MVNA 2PUQH 4UFFH 2D26C 1B7XB 2J4IA 2OD3B 1XUJA 1WV7H 1SFQB 5J4QA 6LPRA 3UREA 5ESTE 2DE9A 2AERH 2A45B 1PPCE 1GBLA 5DK1A 2ZFTA 1GI8B 4ZAEA 3SW2B 1D3PB 4YOJA 2ZIQH 1SQTA 1Y59T 4O97A 5HMAA 1MAXA 1UO6A 2BZAA 1A0JA 2A4OA 3ATIA 3LOXA 3E91A 1BTHH 2PW8H 3UPEA 1C5ZB 3Q3YA 4INHA 1XKBC 5E0JA 3VEQB 3V3MA 1WAYB 5DGJA 2G00A 1GI1A 3QX5H 2VWLA 4JZIA 3E8LA 1BUIA 1C4V2 2FOEA 1S6HA 3QDZB 4CRAA 1TBZH 4OS1A 1JRTA 3SORA 2ZGJA 3FZDA 2PKAB 2OUAA 1O36A 3TH4H 4F4OC 3EA9A 3TLOA 1C1SA 1QBVH 2Y5HA 2RDLA 1T8MA 3RXFA 1O2YA 3KF2A 3A87A 1WOFA 4IMQA 3RXHA 1FQ3A 2Y5FA 3TJVA 3GCTG 4DY7B 1MZAA 2ZU2A 1K1OA 5E2PA 1KXAA 2C8YB 1HYLA 1HAOH 1EZQA 3K6ZA 4I8HA 3A86A 2W7SA 1A4WH 4XSKU 1KXDA 2F3CE 4BOHA 2XXLA 1LHFH 3GY8A 2QXJA 2R2WU 1WUNH 3GCHC 1P9UA 1F0UA 1V2TT 3M5MA 4IBLH 1RRKA 1O2KA 5GJ4B 1BTXA 1MUEB 1DY9A 1BTWA 1TGBA 2R2MB 1S85A 2JH0D 1J8AA 2OQ5A 3V12A 1O3EA 1G36A 1FNIA 1DLKB 1FDPA 2GZ7A 4ISLA 3GY3A 3E16B 2QIQA 2VWNA 1QA0A 3RXLA 4KKDA 1A0LA 3A85A 3SNDA 1IQMA 2F9VA 4NIWA 2H9EH 1P3CA 1O3JA 2TRMA 1EOJA 4K5ZA 1PJPA 4J2YB 1RIWC
chains in the Genus database with same CATH superfamily
4B76A 1QJ6B 4IC5A 1G2MA 1DS2E 5F8XA 1BIOA 2FESH 1C1PA 1O3KA 4ZHLU 4Y7BA 3SU2A 1MD7A 1QB6A 1NROH 1UVPA 1A2CH 1RXPA 1O3BA 1TRYA 1P9SA 4KTSA 3QGJA 1C1WH 1TGNA 1GJ8B 4RN6A 1TA6A 1ETSH 4RT0A 2ANWA 3MNCA 2SGQE 1ANEA 2VH6A 4BAHB 1P04A 1EB2A 4FUBA 4BANB 1SQOA 2O8UA 2PLXA 1N6XA 1C9TA 1ZMJA 1BHXB 1BJVA 1AB9B 2ZGHA 3BG4B 3RU4E 4E7NA 1RTFB 2FS9A 2ZU4A 3U28C 2HOBA 2XBYA 3E0PB 1ELVA 4DW2U 5L30H 1BTYA 4LZ4B 1AFQB 1C1RA 1AFQC 2W7UA 4X2XA 3GYLB 4I8LA 3BN9A 1GJ4H 1BRCE 2XCNA 3R3GB 3QWCH 3S9CA 3NK8A 3TNTA 4AG1A 4E05H 1SLVB 4WWYA 2WPIS 2PTCE 3BF6H 4CRFA 1O2HA 2BM2A 4BNRA 1DWEH 2HPPH 3PWBA 1OP8A 1QURH 4R0IA 2WYJA 4YT6H 2G51A 1ZRKA 3H09A 3BTME 4RKOB 3LT3A 2PP6A 1CE5A 4UONA 1SGCA 3OE7D 2H5DA 4VGCB 2ANKH 3IITA 1N8OB 2OK5A 1S82A 2HVXA 1N8OC 1AI8H 2CGAA 5JPMH 2AGEX 2XWAA 4KP0A 1K1LA 2RDEA 2SFAA 1GI3A 2IJD1 3P6ZB 5IDKA 5TCAA 3RXKA 3K6YA 2F4LA 2BD3A 2ZHWH 1SGNE 1DOJA 3MTYA 1GMHG 4I33A 4RT1A 3I29A 4X8UH 3ZZ8A 4I8KA 4RSPA 2P8OB 5HGGA 1W0ZU 1GHVH 4ZKRU 1TX6A 2F91A 2P8OC 3WWBA 2GT7A 4NA9H 2ZU3A 2G5NA 1YGCH 4MLFB 2L6OA 4AB9A 1BA8B 1LKBA 1NS3A 1O2UA 3SV2H 4ESTE 1B0EA 1HXEH 2XTTB 1Y3YA 1FV9A 4JZDH 5C1UA 1YM0A 1V2VT 1XMNB 1W13U 3ZVDA 2ZDMA 1QHRB 2PGQB 4E06H 1O2RA 5LGOA 2AH4X 2BYAX 2ZKSA 3RP2A 1CGHA 4X2YA 2PSXA 2XNIA 1HDTH 1FY3A 1EP5A 4XE4A 3NKKA 1P2IA 4ABAA 3QO6A 2HLCA 1QQUA 3TK9A 1A7SA 3AVZA 3KGPA 1OWEA 3P8GA 2WUBA 3UNSA 3RC4A 4X1RU 5GDSH 2IPQX 2BVRH 5KGOA 5EODA 3MO9A 1NRSH 2W6ID 4WH6A 5TCCA 4ABJA 3GY6A 3P95A 1B0FA 2OC8A 2BOKA 3SUGA 1GWAA 1G9IE 1TBRH 4X2VA 1SB1H 1TRNA 3QN7A 1P10A 4A1XA 5K0HA 1E36B 4B2AA 3SQHE 2AHME 4YOIA 1IQFA 1XVMA 1V6DA 3SGQE 1MMJN 1L2EA 3TH3H 1P57B 1PQAA 1DXPA 3LJJA 4SGBE 4X1NU 1Y3VA 4INLA 3MU8A 2A32A 2R9PA 2LP6A 1V2WT 4I31A 1IQJA 3QZQA 4YZUA 1LTOA 1E35B 1E37B 1Z1IA 1DWCH 2H6MA 3ENSB 2UWOA 3TU7H 4Y8XA 3P70B 1YLDA 1PQ5A 4J1YA 4ZROA 5GWZA 3S9AA 2FWWA 2PR3A 1EJAA 1OWDA 3LONA 2PHBA 5HM2A 1GCDA 5C2ZA 1HLTH 1TQ0B 5H4IB 3RUOA 3A8BA 2LELA 1F0TA 3O8BA 1Z8GA 4AB8A 2J98A 1RGQA 4AFUA 2UUKB 4H4FA 4NCYA 4A1TA 3AW0A 3VFEA 1O5AB 1UCYK 5C5OA 1LVBA 1SLXB 1XUHA 2A31A 1Z8JB 3S9BA 2BY9X 8KME2 3MNSA 1F7ZA 1IQNA 4NA8A 3TH2H 1GI5A 7ESTE 3F2HA 5A0AE 1HNEE 1TQ7B 4OS7A 3RMOH 2G5VA 3S7KB 3UB0A 2BVSH 4JK6A 4YO9A 2V3OH 2XBWA 1O2IA 2VIPA 1O32A 4DJZB 1LPZB 1XUFA 1GVLA 4Y0YE 2OC0A 5L6NH 1ZTKA 1YPHE 3I77A 4YLUA 3SNAA 1Y5AT 1C5XB 3VB4A 5B6LA 2ZDAH 3PLKA 1Y3UA 3P17H 4AOQA 3LGUA 5LPEA 3VG8A 4I8JA 1GDUA 9LPRA 2ZP0H 3HK3B 4TWYA 1UTNA 5EXMA 2FOCA 2FI4E 2BD5A 3AW1A 2CMYA 3OAAD 4MNXA 1O33A 3A84A 3LJOA 4WMDA 2SGPE 2Z3EA 2NWNA 2XC0A 2WHXA 2P3FH 4WMEA 5JBAS 1OYTH 4LXBH 3ZVCA 4KGAA 1DVAH 1NT1A 1MKWH 1O5DH 3T25A 4K1TA 3UY9A 1GBAA 1NFWA 3DCLA 4MPXA 3E0NB 1H4WA 3BEFB 1BTUA 3PV4A 4ABBA 1O2OA 3RXJA 2A5IA 4NA7A 5EXLA 1KXFA 1GBDA 2WPKS 4XOJA 2W5EA 5LH8A 2J38A 1SFIA 4CH2B 3PO1B 1KMHB 3EA7A 1TE0A 2ILNA 3PO1C 4H6TA 1NY22 1NN6A 2UWLA 3URDA 3PV2A 2BDYA 4ACBA 1P3EA 1SPJA 3MH7A 2FPZA 3A89A 4K1SA 2G4TA 1ZTJA 4FUGA 1NESE 1OHHD 2GCTB 3CP7A 2GCTC 4FUDA 1HCGA 1O39A 3GDVA 1S6FA 3DA9B 2Q6DA 3RXUA 3KNXA 7KMEH 3FOAA 1TMBH 1H9LB 1E1QD 1MD8A 1GMCG 2ZTZA 2WZQA 2XCFA 1L4ZA 2C8WB 2WPMS 3SU6A 1AWHB 1PQ8A 1P12E 1S0QA 1YC0A 3VXEH 1Z8IB 3UWIA 1IHSH 2SGAA 5FAHA 1CGJE 1FY5A 1L1JA 3QUMP 5DSFA 4TT3D 4B6FA 1YCPM 1SSXA 1V2OT 1QBOA 3QLPH 3IG6B 3RDZA 2WPHS 2ZHEH 3RXTA 4YM9A 2QA9E 2JDID 1O37A 1Q2WA 3MI4A 1DY8A 1UCYE 1AE8H 3A8CA 2TGPZ 4XBCA 5DP6A 2B5TB 1UTPA 2ZDVH 1W0YH 3OU0A 1KXCA 3C1KA 4FXGH 8GCHG 1CBWC 4BTTB 2O8WA 3A7WA 5EQQA 1QL8A 1O3DA 1GI0A 1HAGE 4OGYA 1TBQH 2XW9A 2ZWLH 4DURA 5HXFA 1DUAA 1P2MA 4D9RA 3BTKE 1GJ9B 3L3TA 4Y10E 1ZMNA 5AVDA 3M7QA 1TX8A 1P2QA 2HALA 3SV6A 3F2GA 2QY0B 1NRQH 3F9HA 1BMNH 4TY7A 3D49H 3RU4T 5EW2H 1SGYE 1SOTA 3M7TA 3RXDA 3P92A 4ZHMU 3K65B 3OSYA 3QK1A 2TGAA 1ZTLA 2A7CA 4F55A 3BV9B 2NU2E 2ZCLP 1GBJA 3RC6A 2AIQA 1OWIA 4CRCA 4Y0ZE 4YXWD 2ZQ2A 5DP4A 1O5GH 1XXFA 1MU8B 1H8ED 3ITIA 2EY4C 4NSYA 3SHCH 5AFZH 2QXIA 4JZEH 4FOUC 1V2RT 1UW7A 2M5TA 3DT0H 1AZZA 2Z3DA 2Y6TA 2WUCA 1LDTT 2AGIX 2J92A 2VIWA 1YKTA 4HI3A 3SHAH 1CHOF 3OTPA 1QRXA 2JJ2D 2K0QA 5EU8A 1TPAE 3MU0A 4ZKNU 1C1UH 1AKSB 5C5NA 1GBBA 1O3OA 4GCHG 2KM0A 5G4BA 5K7RA 5CHAB 2ALVA 1P03A 1BMAA 5CHAC 5DO4H 4K60A 3R0FA 4ABHA 1UK4A 1EZSC 1YY3A 3CS7A 2Y7XA 3ZVBA 3EDXB 1TGTA 2BDGA 4I7YH 1EXFA 1IOEA 1WCZA 2GMTC 4IN1A 3DD2H 1P01A 1LVYA 3SU3A 4A6LA 5JBBS 4ISHH 1ZPBA 1O3CA 4X6NA 1UTMA 3RXMA 3NCLA 3ZZ6A 1W10U 3BEIB 2IJOB 1TNKA 2OC1A 1SL3A 1CVWH 2ZU5A 4NWLA 1O2VA 1P2KA 2OTVA 1ABIH 1LHGH 5EQRA 4AYVB 1VCQA 2XRCA 3H7OA 2V3HH 1CSOE 4I86A 1C5VA 2FM2A 1EPTA 4CR9A 2XC4A 1BT7A 1SVPA 1GHWH 1AU8A 3W95A 4X6OA 3EE0B 4B75A 4ABGA 4IN2A 1D9IA 3LH3A 1MBQA 1A3EH 1J16A 1ELBA 2J94A 2ZGXH 3E1XB 5FPTA 3RM0H 5HKKD 1GBMA 2FOAA 2P59A 4ASUD 4NIXA 4I8GA 1XXDA 3NZIA 3T5FH 1NTPA 1QJ7B 2BY5X 1BZXE 2C8XB 3MNXA 5FHTA 1JMOH 1BITA 4TYDA 2PFEA 3PLBA 2HPQH 1C2KA 3RXOA 1LVOA 1P06A 1TNJA 2BX4A 4GPGA 1ZHPA 1F0SA 2A7JA 3LGYA 3QTOH 1O31A 1XUKA 1GMDG 3LIWA 4B2CA 1DPOA 4CBNA 1AVWA 1LHCH 1HAYB 2OXSA 1AN1E 1KDQB 1LQEA 3F9EA 3BTDE 5EOKA 2C3SA 1UJ1A 1UK3A 1JIMA 2Y7ZA 3RMMH 3SZNA 1F5RA 2WYGA 3SOSA 2H2ZA 1D6RA 3VB5A 1MTWA 4GUXA 3A7TA 5EG4A 5FPYA 1C5OH 3PMHB 4BAQB 1K0HA 1GHXH 3DHKH 4OGXA 1P0SH 4DIIH 2ZO3H 1HJ9A 3GCHB 3A88A 9ESTA 1HAVA 2BD7A 2ALPA 1Y5UT 3BEUA 5EXNA 3RXVA 3N7EA 1IQLA 5KEDA 1TB6H 3BSQA 3FZZA 1EPTB 1J17T 1QFKH 3PRBA 4OS4A 1EPTC 3E3TA 3RMLH 2P3TB 2VIDA 3M36A 1C2JA 2YOLA 3FAOA 3SU0A 3E90B 1A1RA 1CQQA 3SI4H 3KHVA 2Z9GA 3V13A 2R0KA 2ZC9H 1RD3B 1OS8A 1RTKA 1GBHA 3KQ5A 4MDSA 3VGCB 5A8XA 1K1MA 3U1IB 2O8MA 1KTSB 3VGCC 4Q80A 1RIWB 1EOLA 2NU3E 2QF0A 4Y79A 2VB0A 3S0NA 1O2XA 5A0BA 4D9QA 1HB0B 1O34A 7GCHF 4R8TB 3EGKH 4D7FA 3PB1E 2ESTE 5EIYA 1UHBA 3U98H 1A3BH 2BY6X 3SUFA 4BTIB 2GV6A 2D2DA 2J95A 5C67A 3URCA 4XDEA 1NRNH 3N7OA 2ZPQA 5JBCS 1BMMH 2O9QA 2FX6A 2IPHA 3D65E 4WY3A 1W3CA 3U8RH 3SU1A 4Q7ZA 4HZHA 2BY7X 1COWD 1K22H 3GCOA 1V2UT 1L1GA 1C2FA 3RXIA 1DDJA 1YLCA 3FP8E 1OWJA 3IWMA 1JRSA 2EC9H 1ARCA 1N1LA 3PM3A 1V3XA 4AFSA 4FUHA 1X7AC 3JZ2B 1PPEE 2GP9B 4UDWH 5HYOA 1GJ5H 2ZPRA 5I25A 4A92A 3SJOA 3FANA 4DOQA 2CF9H 1NFUA 2ODQA 4NFFA 1U6QA 1MKWK 4O03A 4IMZA 5F6MA 3T27A 3HPTB 2JH5D 4X1QU 1EJNA 1K1PA 1G3DA 1O3AA 1SMFE 4Y8ZA 3STIA 5B6OA 3KQDA 1QIXB 5JBTA 2FOHA 3RC5A 2HGTH 3EE7A 5L2ZH 2KAIA 4Q63A 1OYQA 4IW4E 3TK5A 1AD8H 2HRVA 1O2QA 3LC3A 2TPIZ 3D62A 3GICB 4HFPB 2FLRH 2BD8A 3UR9A 1C1TA 2CJIA 3NRLA 3M3SA 3LH1A 3N99A 1QR3E 1Y5BT 1C1VH 1AE5A 1G2LA 3ODDA 1LCYA 1J9CH 1GJ7B 2BXTH 3T26A 6ESTA 1IQKA 3F9FA 1LHDH 5A2MH 4PROA 1AIXH 3VB3A 1MTVA 2ZTXA 3B9FH 1QGFA 2RG3A 2FXRA 2ZDKA 1P05A 4AX9H 2XBVA 1HAIH 4H6SB 4HGCA 3TGKE 5C20A 1NFYA 3I78A 5T3HA 4X2WA 4CRDA 1DSTA 4GSOA 1WU1A 2FMJA 1QY6A 1FX0B 2F9PA 4Y71A 3WW7A 3LU9B 3ZVGA 3ODFA 4O3UA 1SKYE 1XUGA 3UIRA 3Q00A 1DWDH 2IOTA 1CGIE 2XC5A 2Y82A 2V0BA 4CBOA 1QNJA 2I6QA 4FUCA 1EAIA 1V2LT 2HNTF 2KR7A 1IQIA 1GBIA 2CN0H 1NRRH 5JB8S 2BDBA 4Y6DA 3FO8D 1ESBA 2CK3D 4KTUA 1F2SE 5ETXA 1UTOA 4BAMB 3FP7E 2J34A 2KAIB 1T8NA 1TA2A 4UFEH 3KN2A 4ZUHA 5ESBA 1O3LA 3NXPA 1UMAH 3M5OA 3OY5U 4MPWA 3LPRA 3M3VA 5JDUB 5DG6A 1E34B 2QF4A 3T62A 1ESAA 1ELAA 1GPZA 2GZ8A 3RXGA 4Z1MD 4Z6AH 1QL7A 2BQ6B 4AFQA 3MMGA 2H5CA 1GHYH 2A4QA 3ZZ9A 1SGFG 3BTGE 1VJ9U 4A7IB 2IN2A 1EAUA 3SO3A 1HXFH 3W1EA 2PTNA 5F8ZA 1IQGA 1ELTA 1O3FA 4AC9A 3OEED 1GMDF 1SGPE 2HWLB 1HJAB 2B7DH 3F0PA 1HJAC 2OBQA 1BRBE 2ZFRH 1FXYA 1H8IH 5EW1H 2BB4A 1QBNA 3GCTF 2A1DB 3ELAH 1TNHA 1A5HA 1A5IA 4B71A 4ABFA 1BRUP 2G52A 5ABWA 4IC6A 3ZZ4A 1F5LA 2CF8H 2ZDNA 2L74A 1MCVA 2FIRH 1QJ1B 1SR5C 5KECA 2DUCA 3M5LA 1L0ZA 5T6GA 1OWHA 1TONA 5EPYA 1ZRBA 1EUFA 2VU8E 2FDAA 1AVXA 1CT2E 3ZZ7A 1EP6A 4XRNA 2CV3A 3ZZBA 2D1JA 2PSYA 1ZR0A 1HAHH 1ID5H 1O2MA 1XKAC 2ZGBH 4I32A 4D7GA 1GL1A 1FUJA 4X8TH 1AMHA 3MH6A 3SU5A 1D6WA 3SGAE 3TGIE 1UK2A 2G55A 1OSSA 3AASA 2ZFPH 3UUZA 1MABB 1BTPA 1CHGA 3TPIZ 2H9HA 1FN8A 1O2LA 1IHTH 3OTJE 2F83A 4NZQA 2ODYB 2FTMA 2TGTA 4HTCH 1TNIA 2FOMB 3MFJA 4MPVA 1VITG 2FOFA 3SN8A 5HM9A 2Z9KA 3BTWE 5IYTA 4ABIA 1ABJH 1MTSA 4BTUB 4ACAA 1ZHMA 2BHGA 5C3NA 2UUJB 3AAUA 2AS9A 5CE1A 1UVTH 2ZTYA 3SI3H 1Z1JA 2Z7FE 3ATKA 3UR6A 1CA8B 3L33A 1QTFA 4THNH 1LVMA 1T8LA 3UTUH 2SNWA 1GHBG 1CT0E 3ZVAA 1ANDA 1C5LH 3OYPA 5PTPA 3SYJA 4DVAU 4ASHA 1OP0A 1OOKB 4UD9H 1E79D 1ANCA 2GDEH 2O8LA 1KIGH 3A80A 4UFGH 3GDUA 2QF5A 1ANBA 2FP7B 1ARBA 2RA3A 2WV4A 5EQSA 3SV7A 1ELEE 1UTKA 2ZHQH 3KYFA 2J98B 3GY2A 4NGAH 1QA7A 4CR5A 4NG9H 1PPZA 2RCEA 1HIAA 5A09A 4F49A 2AFQB 2JIZD 1Q3XA 3B8JA 3KQCA 2BX3A 1AY6H 1QCPA 1NFXA 3PWCA 1BQYA 3FN8A 2ZFSA 2BLVA 4CHAC 3A8DA 1PYTD 1BJUA 1MAYA 1VITH 4FUEA 4WH8A 4FU9A 2GJGA 3DSPA 5GCHG 3T2NA 5E2OA 2JKHA 3ZVFA 5C94A 2QV1A 1FN6A 1FIWA 4CRBA 2FS8A 1C2IA 2ANYA 1O2PA 2Z9IA 4GHQA 1GJAB 2AMPA 1GJDB 1KSNA 1O35A 1O0DH 2WPLS 3Q3KA 1GMHF 1YBWA 1A46H 3MU4A 5AFYH 1GBEA 4AORA 1C2EA 1ZGIA 2KCYA 3RXQA 1V2KT 1CBWB 4TPYA 3JZ1B 3AK5A 3M7UA 4XBDA 4B74A 4OS2A 1ORFA 2F9BH 1PPFE 2VINA 1YCPH 1C5YB 1GDQA 3TIUA 2JETB 3MU1A 3M5NA 1AQ7A 2JETC 1YF4A 1IQHA 1AUJA 5I46H 1SGRE 1GHZA 1YLNA 1O3PB 4UFDH 4Y7AA 3V0XA 4ZMAH 5C17A 3A7VA 1N6YA 4UEHH 1VZQH 2WPDD 1KXEA 2BD4A 3OFND 1UTJA 3F0OA 3RLWH 1YWUA 3ZVEA 4MG3A 5T6DA 3U69H 3OY6U 1TGCA 4AGKA 1C5SA 4JK5A 1KY9A 1JOUB 2GKVE 2J2UA 3B23B 4YTAA 2FEQH 1T31A 3RXPA 3LKWA 5C1XA 4JCNA 3CS0A 3BTEE 4ZXYH 1GI9B 3O8DA 2A0QB 3BIVH 1H8HD 2A7HA 1GJCB 2OCVB 4GHTA 3TJNA 1HAPH 2GVFA 3PV5A 1IAUA 3KQBA 4B1TA 1VGCB 2QXHA 1C2HA 1VGCC 1GDNA 2BXUH 1TWXB 3OX7U 2AMQA 4FUJA 2GT8A 4K1EA 3T29A 1C4U2 1ETTH 3UWJH 4RI0A 1C4Y2 1GJBB 3GCNA 2P94A 3P8OA 4M9FA 1FZZA 1K1JA 3O8RA 1TFXA 3TJOA 1BMFD 5GIBA 1C2GA 2VNTA 1NRPH 1G3CA 1C1OA 2FX4A 5EJLA 4CRGA 3ZYDA 3OEHD 1O2WA 6GCHG 1DWBH 1TOCB 3H7TA 1ZSKA 3HGPA 1O3NA 4Z0KA 3RXRA 5BPEA 1O5FH 1O5BB 1WTGH 2A5AA 3LGTA 1YPLH 2NU0E 2ZHFH 2KFWA 2C4FH 2CHAB 2EI7A 2CHAC 1HAZB 2W6JD 3UOUA 1BDAA 4XD7D 2BLOA 5DP9A 1O30A 4FUFA 2OQUA 3Q76A 2GMTB 1C1QA 2GX4A 1JIRA 2Y81A 1DT2A 3EQ0H 3HKIB 3LDXH 3PMBB 4ABDA 2EA3A 3N7DA 1TMTH 4DT4A 1OXGA 4B2BA 5A8ZA 2HNTE 1Q31A 1G3BA 3MH5A 3TGJE 2VH0A 3GY4A 2UUYA 2PKSB 2BTCE 1C2DA 1YP9A 3H5CB 2DE8A 2PKSC 1EAXA 2Z9JA 4P00A 2RA0A 1MH0A 1GHAG 3SV8A 2BDAA 1UVOA 1GJ6A 2V35A 1BTZA 4LZ1H 2YNAA 1MQ5A 4RKJB 4GLYA 5GPIB 1O3MA 4O9VA 2ULLA 4FU7A 4B6EA 3S7HB 2H1UA 2QE7D 5DP8A 1NPMA 1S81A 5E0GA 3DSGA 1OPHB 2W3KA 3ZZCA 1KXBA 1T32A 4K69A 2ZG0H 1PPBH 3BTQE 2C93B 2QXGA 3ATWA 4AG2A 3MO6A 1QL9A 1GHBF 3PMAB 2VGCB 2VVUA 1MQ6A 2GZ9A 2VGCC 1YPHC 1VR1H 2PUXB 2V6NA 2I6SA 3PLPA 2TIOA 1P2JA 3FFGA 1ZGVA 2J5UA 1HBTH 2VWOA 4JYVH 5FX6A 3KEEA 4B73A 2A5KA 1MZDA 4WJG2 1NU7B 3HGNA 4JYTA 1K28D 3ZZDA 3UQVA 2H9TH 1LMWB 4JMYA 2VWMA 1MKXH 1TOMH 1H1BA 1LKAA 1BBRH 1VJAU 1GG6B 1T8OA 1TPSA 3F2FA 1GG6C 3F1SB 1OP2A 1QB9A 1SI5H 2BZ6H 1K1NA 8ESTE 4K8BA 1AHTH 2WSSD 3PRDA 3U9AH 1SQAA 1NZQH 1ELDE 4JZ1A 1HJ8A 2XBXA 1TABE 3TVJB 1KYNA 1G3EA 2ZEBA 3NUMA 1HV7A 2ZGCA 1TYNA 5GNDA 4X8SH 1TX7A 1THSH 1F5KU 2GCHG 3SJ8A 2UUFB 1O2NA 2Z9LA 4Y11E 1W11U 3FVFB 4ISIH 4QT8C 2THFB 1GMCF 1SHYA 8LPRA 2BD9A 1EFRD 1GBCA 2OLGA 5GCHF 3RXEA 3U8TH 3CENA 3A81A 1C5TA 1ELFA 2Y80A 2PV9B 3M35A 3MO3A 3P8FA 2BDCA 3SNCA 1O2GH 3VPKA 4ZKSU 5DJ7A 5DP7A 1T7CA 2JH6D 3PROA 1O3GA 3ZYEA 1G32B 1TPPA 2UWPA 1D4PB 1LO6A 2VJ1A 2SNVA 1WSSH 4U32A 1SG8B 1Y3XA 3MOCA 5T1VA 5A0CA 2NU1E 2P3UB 2GDDA 3Q77A 8GCHF 5FPSA 1B5GH 3DFJA 1LPKB 1P11E 2W26A 3G01A 1BB0B 3NWUA 4AFZA 4BXWA 2G8TA 5FX5A 1UVSH 2NU4E 3FP6E 1RJXB 5DKMA 1MBMA 1P2OA 1GI2A 1C5QA 1VKYA 1C5MD 3GDSA 3TITA 1NC6A 4WXIA 3STJA 1FY8E 3HKJB 2AIPA 4Q7YA 5HIYA 1ZJKA 2Z94A 1HAVB 3GYMA 1TRMA 1W7XH 3ZV9A 1OX1A 5JYIA 1P2NA 4LK4A 2K8IA 1BHXF 1FPHH 2EEKA 2Q6GA 1P8VC 2VVCA 1PPHE 2AEIH 4FU8A 1SOZA 1MCTA 1EB1H 2YMSD 1C2LA 3MNBA 3RXSA 1SBWA 2XWBI 2V3MA 1S0RA 5EGMA 3BG4C 3LGVA 2STBE 1AB9C 4ISOA 2EQNA 1EX3A 1HFDA 1DX5M 3MWIU 1T4UH 5F8TA 3SNEA 1TPOA 1EKBB 1C1NA 1WDIA 1BCUH 1OKXA 1QRWA 2Q6FA 6CHAB 1FIZA 3SNBA 2ZHDA 6CHAC 3BTFE 2WINI 2W3IA 2F43B 3LC5A 3RLYH 1E38B 4MTBA 2TBSA 2XNDD 1GCTB 1GCTC 5E0HA 1TMUH 1GBKA 2V7QD 2ZU1A 6GCHF 4DT7B 5CMXH 3U1JB 1GI7B 3MHWU 4GVUA 3RXAA 1UHBB 1SGTA 1WTHD 4CREA 5DP3A 1F0RA 2VIOA 2C90B 5F53A 2BOHB 4OS5A 1WXRA 3LGIA 1FJSA 2BDHA 2VBCA 4GCHF 2FYQA 4M7GA 1QRZA 1PPGE 2A2QH 4VGCC 1OWKA 2JJ1D 4ZHAA 2M2AA 2ZNKH 1FAKH 5EPNA 4JYUH 1J15A 5LPFA 1D3DB 4Y76A 5LPRA 2A2XH 2C8ZB 5CHBA 3A7YA 2F9UA 2J9NA 3RXCA 3BIUH 4X1SU 1YPJH 2PWXA 2ZI2H 2PGBB 1K21H 1S83A 3E6PH 2A4RA 1E0FD 4IS5A 2WV9A 3HATH 3ZZAA 4KELA 3VB6A 5EJ1A 4GAWA 1ETRH 1LHEH 1WQSA 1XUIA 1GBFA 5FCRA 4E7RG 1GHAF 4IGDA 3UNRA 2BY8X 1C9PA 2ZZUH 1YCPK 2ZFFH 2GTBA 1SC8U 3SZEA 2FOGA 3A82A 1RTLA 2AGGX 2HNTC 2WPJS 4TWWA 4UE7H 2BLQA 4YOGA 1M9UA 1SGIB 3EAJA 4ZH8A 1BRAA 4ZKOU 1ACBE 1RS0A 2ODPA 2R3UA 1YYY1 3MH4A 1AVGH 1G30B 3RU4D 1W7GH 1S84A 2ZA5A 1W0JD 1XX9A 1D3TB 3GY7A 5DPAA 2ZCHP 1FMGA 1SHHB 1T4VH 3D23A 4WXVA 3T28A 4FETA 1CA0B 3LGWA 1O3IA 2QYIA 1CA0C 1MTNB 1TNGA 1W12U 2BQ7B 1MTNC 4MQAA 4WF8A 5TJXA 3SU4A 4AZ2B 2FZZA 3DFLA 4Q7XA 2B0FA 4Q4LA 1C5UA 4ZCNA 2KZ4A 1TLDA 3BTHE 1VCWA 3QTVH 3ATMA 5A8YA 3MYWA 4NWKA 1Y8TA 3SJ9A 3RMNH 3CNRA 3SUEA 1V2ST 1YPEH 2P16A 4A5TS 1Z71A 4K8YA 3F6UH 1YPGH 1CHOG 1V2MT 5C0UA 1LPGB 1L4DA 1GI6A 1O3HA 2YMSB 1FY1A 4A1VA 4INKA 2YMSC 1O38A 2Z3CA 2GCHF 3M61U 5DN6D 4NFEA 4Y8YA 1ZJDA 3ATLA 2VIVA 4O3TA 1HGTH 3ZZ3A 2QGRA 1DE7H 3K2UA 1D3QB 1QB1A 2KCAA 4BXSA 2LPRA 2ZFQH 3HK6B 4AGJA 1H9HE 4CH8B 2QF3A 1GBTA 5F03A 2OINA 1DUEA 1KLTA 4DCDA 1A61H 4BAOB 4H42U 1ELGA 1GVZA 4JZFH 2ZECA 2GGVB 2FLBH 1FONA 1ZPZA 1EATA 1F92A 4YT7H 5FBEA 2BDIA 4X6PA 1MTUA 2WV5A 3DUXH 3P8NA 1A5GH 2SGFE 4F48B 1WBGB 2R0LA 2TGDA 1Z8RA 1EZUC 2ZCKP 4FUIA 5AF9H 1ESTA 5AHGH 2Z6BD 4WVPE 2G81E 1GVKB 4LOYH 1O2SA 3S69A 2SGDE 1L1NA 4D76A 1J14A 2AYWA 1HAXB 1AUTC 5JB9S 1CO7E 1SLUB 3KQEA 2KCOA 5C0TA 1C2MA 1ZZZA 1ZYOA 4NIVA 2J97A 3SJIA 1C5NH 4U30A 1NU9A 1KLIH 4MNYA 4TSFD 1EASA 1TAWA 2BD2A 3A7XA 1EQ9A 2Y5GA 3VB7A 1P02A 1O5CB 1C1MA 2GD4B 1ZHRA 2KCPA 4ISNA 3VXFH 1W0KD 1PFXC 2B9LA 4NIYA 3UAIC 2VVVA 3GY5A 4D8NA 1O5EH 3QGNB 1AWFH 1O2JA 3PYHA 3C27B 3GOVB 1DITH 4OM9A 1TALA 1YPKH 3KL6A 5E8EH 3PTNA 2P95A 4CHAB 2AMDA 4MNVA 1K9OE 1AGJA 1E1RD 1WQVH 1W2KH 1MKXK 2F9NA 2D8WA 1UTQA 1EAWA 1BBRK 3PTBA 4Q2KA 1Y3WA 1JXPA 1Z6JH 1FI8A 3O8CA 2EI8A 3TJUA 1FY4A 3L6PA 3K9XB 5FBIA 1SQRA 3RM2H 3NPSA 4U2WA 3V7TA 3AAVA 2BMGB 1AFEH 3M3TA 3ZIAD 1ELCA 1HPGA 2ANMH 3UQOA 2ZDLA 4MPUA 4K2YA 2XYAA 1CT4E 1GGDB 3U8OH 1GGDC 1YPMH 2OC7A 4ZXXH 3KIDU 1A0HB 1BMLA 4YLQH 1FLEE 1TGSZ 1SGFA 3A83A 2G4UA 2SGEE 2FYRA 1DSUA 5CDFE 1H9IE 5FXLA 1ZLRA 2EI6A 2GV7A 4K3JA 1VCPA 3SQEE 1ZOMA 1GL0E 4OS6A 3EA8A 5C1YA 2K1QA 1AZ8A 4ABEA 3TNSA 1UVUH 2ZQ1A 3GISB 1KTTB 5BRRE 4DG4A 1XVOA 2P93A 3M37A 1SGDE 7GCHG 3BTTE 2QN5T 1HIAB 4XFQA 4X1PU 1MU6B 2YNBA 2B8OH 1RFNA 2BLWA 4TPIZ 5T6FA 1UTLM 1THPB 3EYDA 3GS9A 1DFPA 5FL7D 4YESB 1DICA 1AKSA 1INCA 3RXBA 3SJKA 1EJMA 1NM6A 3F68H 1WYKA 3KYGA 1EZXC 1K2I1 4X6MA 1O2TA 4DIHH 2A4GA 2XOKD 2OBOA 1C5WB 1NBME 4XBBA 1Z6EA 4U01A 7LPRA 1SLWB 3F9GA 2FI3E 2BVXH 1FAXA 5GXPA 1V2JT 1DLEA 1NO9H 3QZRA 2QC2A 1ZSLA 1DM4B 3KCGH 3FKSD 1AO5A 2F9OA 1S5SA 1G37A 4X8VH 1FPCH 3MU5A 4FVDA 2FODA 2STAE 1P09A 4WMFA 1C5RA 2LNCA 3PMJA 3DSOA 4AYYB 1K1IA 1V2NT 2O8TA 4NSVA 4DGJA 3W94A 1TNLA 2CXVA 2ZPSA 3SBKA 1Z7KA 5DP5A 1SGQE 2QAAA 1LQDB 3ZZ5A 1IQEA 1DANH 3UNQA 1W8BH 5SGAE 3Q3XA 3WY8A 1W14U 3A7ZA 3MQKC 2BQWB 3SV9A 1C5PA 2OP9A 2FO9A 1S6LA 1BBRE 3UFAA 5J4SA 1DXWA 2ASUB 4NZLA 1HRTH 1JBUH 2FOBA 3TK6A 1ZSJA 1JWTA 2VIQA 3F3BA 1SGEE 2ZF0H 4SGAE 1UCYH 4AN7A 3ZV8A 2PKAA 3UOPA 1GI4A 4MNWA 1O2ZA 1ZMLA 4X0WU 2R3YA 3SGBE 1QQ4A 1KDQA 3ESTA 1TIOA 1BOQA 1PQ7A 1H8DH 1HUTH 3SUDA 2FTLE 1CU1A 2Q1JA 4KTCA 5IK2D 1KLJH 1XM1A 1V2PT 4BAKB 5L2YH 2FI5E 4HG6A 3A8AA 1V2QT 5FCKA 3BG8A 2QCYA 1PYTC 4TY6A 1VITF 1ZPCA 1THRH 4FVBA 4MVNA 2PUQH 4UFFH 2D26C 1B7XB 2J4IA 2OD3B 1XUJA 1WV7H 1SFQB 5J4QA 6LPRA 3UREA 5ESTE 2DE9A 2AERH 2A45B 1NBMD 1PPCE 1GBLA 5DK1A 2ZFTA 2KX4A 1GI8B 4ZAEA 3SW2B 1D3PB 4YOJA 2ZIQH 1SQTA 1Y59T 4O97A 5HMAA 1MAXA 1UO6A 2BZAA 1A0JA 2A4OA 3ATIA 3LOXA 3E91A 1BTHH 2PW8H 3UPEA 1C5ZB 1QZ8A 3Q3YA 4INHA 1XKBC 5E0JA 3VEQB 3V3MA 1WAYB 5DGJA 2G00A 5EJZA 1GI1A 3QX5H 2VWLA 4JZIA 3E8LA 1BUIA 1C4V2 2FOEA 1S6HA 3QDZB 4CRAA 1TBZH 4OS1A 1JRTA 3SORA 2ZGJA 3FZDA 2PKAB 2OUAA 1O36A 3WWFA 3TH4H 4F4OC 3EA9A 3TLOA 1C1SA 1QBVH 2Y5HA 2RDLA 1T8MA 3RXFA 1O2YA 3KF2A 3A87A 1WOFA 4IMQA 3RXHA 1FQ3A 2Y5FA 3TJVA 3GCTG 4DY7B 1MZAA 2ZU2A 1K1OA 5E2PA 1KXAA 2C8YB 1HYLA 1HAOH 1EZQA 3K6ZA 4I8HA 3A86A 2W7SA 1A4WH 4XSKU 1KXDA 2F3CE 4BOHA 2HLDD 2XXLA 1LHFH 3GY8A 2QXJA 2R2WU 1WUNH 3GCHC 1P9UA 1F0UA 1V2TT 3M5MA 4IBLH 1RRKA 1O2KA 5GJ4B 1BTXA 1MUEB 1DY9A 4P02A 1BTWA 1TGBA 2R2MB 1S85A 2RFKC 2JH0D 1J8AA 2OQ5A 3V12A 1O3EA 1G36A 1FNIA 1DLKB 1FDPA 2GZ7A 4ISLA 2HVYB 3GY3A 3E16B 2QIQA 2VWNA 1QA0A 3RXLA 4KKDA 1A0LA 3A85A 3SNDA 1IQMA 2F9VA 4NIWA 2H9EH 1P3CA 5HIZA 1O3JA 2TRMA 1EOJA 4K5ZA 1PJPA 4J2YB 1RIWC
chains in the Genus database with same CATH topology
4B76A 1QJ6B 4IC5A 1G2MA 1DS2E 5F8XA 1BIOA 2FESH 1C1PA 1O3KA 4ZHLU 4Y7BA 3SU2A 1MD7A 1QB6A 1NROH 1UVPA 1A2CH 1RXPA 1O3BA 1TRYA 1P9SA 4KTSA 3QGJA 1C1WH 1TGNA 1GJ8B 4RN6A 1TA6A 1ETSH 2ANWA 3MNCA 2SGQE 1ANEA 2VH6A 4BAHB 1P04A 1EB2A 4FUBA 4BANB 1SQOA 2O8UA 2PLXA 1N6XA 1C9TA 1ZMJA 1BHXB 1BJVA 1AB9B 2ZGHA 3BG4B 3RU4E 4E7NA 1RTFB 2FS9A 2ZU4A 2HOBA 2XBYA 3E0PB 1ELVA 4DW2U 5L30H 1BTYA 4LZ4B 1AFQB 1C1RA 1AFQC 2W7UA 4X2XA 3GYLB 4I8LA 3BN9A 1GJ4H 1BRCE 2XCNA 3R3GB 3QWCH 3S9CA 3NK8A 3TNTA 4AG1A 4E05H 1SLVB 4WWYA 2WPIS 2PTCE 3BF6H 4CRFA 1O2HA 2BM2A 4BNRA 1DWEH 2HPPH 3PWBA 1OP8A 1QURH 4R0IA 2WYJA 4YT6H 2G51A 1ZRKA 3BTME 4RKOB 3LT3A 1CE5A 4UONA 1SGCA 4VGCB 2H5DA 2ANKH 3IITA 1N8OB 1S82A 2HVXA 1N8OC 1AI8H 2CGAA 5JPMH 2AGEX 2XWAA 4KP0A 1K1LA 2SFAA 1GI3A 3P6ZB 5IDKA 5TCAA 3RXKA 3K6YA 2BD3A 2ZHWH 1SGNE 1DOJA 3MTYA 1GMHG 4I33A 3I29A 4X8UH 3ZZ8A 4I8KA 4RSPA 2P8OB 5HGGA 1W0ZU 1GHVH 4ZKRU 1TX6A 2F91A 2P8OC 2GT7A 4NA9H 2ZU3A 2G5NA 1YGCH 4MLFB 4AB9A 1BA8B 1LKBA 1NS3A 1O2UA 3SV2H 4ESTE 1B0EA 1HXEH 2XTTB 1Y3YA 1FV9A 4JZDH 5C1UA 1YM0A 1V2VT 1XMNB 1W13U 3ZVDA 2ZDMA 1QHRB 2PGQB 4E06H 1O2RA 5LGOA 2AH4X 2BYAX 2ZKSA 3RP2A 1CGHA 4X2YA 2PSXA 2XNIA 1HDTH 1FY3A 1EP5A 4XE4A 3NKKA 1P2IA 4ABAA 3QO6A 2HLCA 1QQUA 3TK9A 1A7SA 3AVZA 3KGPA 1OWEA 3P8GA 2WUBA 3UNSA 3RC4A 4X1RU 5GDSH 2BVRH 5EODA 3MO9A 1NRSH 4WH6A 5TCCA 4ABJA 3GY6A 3P95A 1B0FA 2OC8A 2BOKA 3SUGA 1GWAA 1G9IE 1TBRH 4X2VA 1SB1H 1TRNA 3QN7A 1P10A 4A1XA 5K0HA 1E36B 4B2AA 3SQHE 4YOIA 1IQFA 1XVMA 1V6DA 3SGQE 1MMJN 1L2EA 3TH3H 1P57B 1PQAA 1DXPA 3LJJA 4SGBE 4X1NU 1Y3VA 4INLA 3MU8A 2A32A 2R9PA 1V2WT 4I31A 1IQJA 3QZQA 4YZUA 1LTOA 1E35B 1E37B 1Z1IA 1DWCH 2H6MA 3ENSB 2UWOA 3TU7H 4Y8XA 3P70B 1YLDA 1PQ5A 4J1YA 4ZROA 5GWZA 3S9AA 2FWWA 2PR3A 1EJAA 1OWDA 3LONA 2PHBA 5HM2A 1GCDA 5C2ZA 1HLTH 1TQ0B 5H4IB 3RUOA 3A8BA 1F0TA 3O8BA 1Z8GA 4AB8A 1RGQA 4AFUA 2UUKB 4H4FA 4NCYA 4A1TA 3AW0A 3VFEA 1O5AB 1UCYK 5C5OA 1LVBA 1SLXB 1XUHA 2A31A 1Z8JB 3S9BA 2BY9X 8KME2 3MNSA 1F7ZA 1IQNA 4NA8A 3TH2H 1GI5A 7ESTE 5A0AE 1HNEE 1TQ7B 4OS7A 3RMOH 2G5VA 3S7KB 2BVSH 4JK6A 4YO9A 2V3OH 2XBWA 1O2IA 2VIPA 1O32A 4DJZB 1LPZB 1XUFA 1GVLA 4Y0YE 2OC0A 5L6NH 1ZTKA 1YPHE 3I77A 4YLUA 3SNAA 1Y5AT 1C5XB 3VB4A 2ZDAH 3PLKA 1Y3UA 3P17H 4AOQA 3LGUA 5LPEA 4I8JA 1GDUA 9LPRA 2ZP0H 3HK3B 4TWYA 1UTNA 5EXMA 2FOCA 2FI4E 2BD5A 3AW1A 2CMYA 4MNXA 1O33A 3A84A 3LJOA 4WMDA 2SGPE 2Z3EA 2NWNA 2XC0A 2P3FH 4WMEA 5JBAS 1OYTH 4LXBH 3ZVCA 4KGAA 1DVAH 1NT1A 1MKWH 1O5DH 3T25A 4K1TA 3UY9A 1GBAA 1NFWA 4MPXA 3E0NB 1H4WA 3BEFB 1BTUA 3PV4A 4ABBA 1O2OA 3RXJA 2A5IA 4NA7A 5EXLA 1KXFA 1GBDA 2WPKS 4XOJA 2W5EA 5LH8A 2J38A 1SFIA 4CH2B 3PO1B 3EA7A 1TE0A 2ILNA 3PO1C 4H6TA 1NY22 1NN6A 2UWLA 3URDA 2BDYA 1P3EA 1SPJA 3MH7A 2FPZA 3A89A 4K1SA 2G4TA 1ZTJA 4FUGA 1NESE 2GCTB 3CP7A 2GCTC 4FUDA 1HCGA 1O39A 3GDVA 1S6FA 3DA9B 2Q6DA 3RXUA 3KNXA 7KMEH 1TMBH 1H9LB 1MD8A 1GMCG 2ZTZA 2XCFA 1L4ZA 2C8WB 2WPMS 3SU6A 1AWHB 1PQ8A 1P12E 1S0QA 1YC0A 3VXEH 1Z8IB 3UWIA 1IHSH 2SGAA 5FAHA 1CGJE 1FY5A 1L1JA 3QUMP 1YCPM 1SSXA 1V2OT 1QBOA 3QLPH 3IG6B 3RDZA 2WPHS 2ZHEH 3RXTA 4YM9A 2QA9E 1O37A 1Q2WA 3MI4A 1DY8A 1UCYE 1AE8H 3A8CA 2TGPZ 4XBCA 5DP6A 2B5TB 1UTPA 2ZDVH 1W0YH 3OU0A 1KXCA 3C1KA 4FXGH 8GCHG 1CBWC 4BTTB 2O8WA 3A7WA 5EQQA 1QL8A 1O3DA 1GI0A 1HAGE 4OGYA 1TBQH 2XW9A 2ZWLH 4DURA 5HXFA 1DUAA 1P2MA 4D9RA 3BTKE 1GJ9B 3L3TA 4Y10E 1ZMNA 5AVDA 3M7QA 1TX8A 1P2QA 2HALA 3SV6A 2QY0B 1NRQH 3F9HA 1BMNH 4TY7A 3D49H 3RU4T 5EW2H 1SGYE 1SOTA 3M7TA 3RXDA 3P92A 4ZHMU 3K65B 3OSYA 3QK1A 2TGAA 1ZTLA 2A7CA 3BV9B 2NU2E 2ZCLP 1GBJA 3RC6A 2AIQA 1OWIA 4CRCA 4Y0ZE 2ZQ2A 5DP4A 1O5GH 1XXFA 1MU8B 3ITIA 4NSYA 3SHCH 5AFZH 2QXIA 4JZEH 1V2RT 2M5TA 3DT0H 1AZZA 2Z3DA 2Y6TA 2WUCA 1LDTT 2AGIX 2J92A 2VIWA 1YKTA 4HI3A 3SHAH 1CHOF 1QRXA 5EU8A 1TPAE 3MU0A 4ZKNU 1C1UH 1AKSB 5C5NA 1GBBA 1O3OA 4GCHG 5G4BA 5K7RA 5CHAB 2ALVA 1P03A 1BMAA 5CHAC 5DO4H 4K60A 3R0FA 4ABHA 1UK4A 1EZSC 3CS7A 2Y7XA 3ZVBA 3EDXB 1TGTA 2BDGA 4I7YH 1EXFA 1IOEA 1WCZA 2GMTC 4IN1A 3DD2H 1P01A 1LVYA 3SU3A 4A6LA 5JBBS 4ISHH 1ZPBA 1O3CA 4X6NA 1UTMA 3RXMA 3NCLA 3ZZ6A 1W10U 3BEIB 2IJOB 1TNKA 2OC1A 1SL3A 1CVWH 2ZU5A 4NWLA 1O2VA 1P2KA 2OTVA 1ABIH 1LHGH 5EQRA 4AYVB 1VCQA 2XRCA 3H7OA 2V3HH 1CSOE 1C5VA 2FM2A 1EPTA 4CR9A 2XC4A 1BT7A 1SVPA 1GHWH 1AU8A 3W95A 4X6OA 3EE0B 4B75A 4ABGA 4IN2A 1D9IA 3LH3A 1MBQA 1A3EH 1J16A 1ELBA 2J94A 2ZGXH 3E1XB 5FPTA 3RM0H 1GBMA 2FOAA 2P59A 4NIXA 4I8GA 1XXDA 3NZIA 3T5FH 1NTPA 1QJ7B 2BY5X 1BZXE 2C8XB 3MNXA 5FHTA 1JMOH 1BITA 4TYDA 2PFEA 3PLBA 2HPQH 1C2KA 3RXOA 1LVOA 1P06A 1TNJA 2BX4A 4GPGA 1ZHPA 1F0SA 2A7JA 3LGYA 3QTOH 1O31A 1XUKA 1GMDG 3LIWA 4B2CA 1DPOA 4CBNA 1AVWA 1LHCH 1HAYB 2OXSA 1AN1E 1KDQB 1LQEA 3F9EA 3BTDE 5EOKA 2C3SA 1UJ1A 1UK3A 1JIMA 2Y7ZA 3RMMH 3SZNA 1F5RA 2WYGA 3SOSA 2H2ZA 1D6RA 3VB5A 1MTWA 4GUXA 3A7TA 5EG4A 5FPYA 1C5OH 3PMHB 4BAQB 1GHXH 3DHKH 4OGXA 1P0SH 4DIIH 2ZO3H 1HJ9A 3GCHB 3A88A 9ESTA 1HAVA 2BD7A 2ALPA 1Y5UT 3BEUA 5EXNA 3RXVA 1IQLA 1TB6H 3BSQA 3FZZA 1EPTB 1J17T 1QFKH 4OS4A 1EPTC 3E3TA 3RMLH 2P3TB 2VIDA 3M36A 1C2JA 2YOLA 3FAOA 3SU0A 3E90B 1A1RA 1CQQA 3SI4H 3KHVA 2Z9GA 3V13A 2R0KA 2ZC9H 1RD3B 1OS8A 1RTKA 1GBHA 4MDSA 5A8XA 3VGCB 1K1MA 3U1IB 2O8MA 1KTSB 3VGCC 4Q80A 1RIWB 1EOLA 2NU3E 2QF0A 4Y79A 2VB0A 3S0NA 1O2XA 5A0BA 4D9QA 1HB0B 1O34A 7GCHF 4R8TB 3EGKH 4D7FA 3PB1E 2ESTE 1UHBA 3U98H 1A3BH 2BY6X 3SUFA 4BTIB 2GV6A 2D2DA 2J95A 5C67A 3URCA 4XDEA 1NRNH 3N7OA 2ZPQA 5JBCS 1BMMH 2O9QA 2FX6A 2IPHA 3D65E 4WY3A 1W3CA 3U8RH 3SU1A 4Q7ZA 4HZHA 2BY7X 1K22H 3GCOA 1V2UT 1L1GA 1C2FA 3RXIA 1DDJA 1YLCA 3FP8E 1OWJA 3IWMA 1JRSA 2EC9H 1ARCA 1N1LA 3PM3A 1V3XA 4AFSA 4FUHA 1X7AC 3JZ2B 1PPEE 2GP9B 4UDWH 5HYOA 1GJ5H 2ZPRA 5I25A 4A92A 3SJOA 3FANA 4DOQA 2CF9H 1NFUA 2ODQA 4NFFA 1U6QA 1MKWK 4O03A 4IMZA 5F6MA 3T27A 3HPTB 2JH5D 4X1QU 1EJNA 1K1PA 1G3DA 1O3AA 1SMFE 4Y8ZA 3STIA 5B6OA 3KQDA 1QIXB 5JBTA 2FOHA 3RC5A 2HGTH 5L2ZH 2KAIA 1OYQA 4IW4E 3TK5A 1AD8H 2HRVA 1O2QA 3LC3A 2TPIZ 3D62A 3GICB 4HFPB 2FLRH 2BD8A 3UR9A 1C1TA 2CJIA 3M3SA 3LH1A 1QR3E 1Y5BT 1C1VH 1AE5A 1G2LA 3ODDA 1LCYA 1J9CH 1GJ7B 2BXTH 3T26A 6ESTA 1IQKA 3F9FA 1LHDH 5A2MH 4PROA 1AIXH 3VB3A 1MTVA 2ZTXA 3B9FH 1QGFA 2RG3A 2FXRA 2ZDKA 1P05A 4AX9H 2XBVA 1HAIH 4H6SB 4HGCA 3TGKE 5C20A 1NFYA 3I78A 5T3HA 4X2WA 4CRDA 1DSTA 4GSOA 1WU1A 2FMJA 1QY6A 2F9PA 4Y71A 3LU9B 3ZVGA 3ODFA 4O3UA 1XUGA 3UIRA 3Q00A 1DWDH 2IOTA 1CGIE 2XC5A 2Y82A 2V0BA 4CBOA 1QNJA 2I6QA 4FUCA 1EAIA 1V2LT 2HNTF 1IQIA 1GBIA 2CN0H 1NRRH 5JB8S 2BDBA 4Y6DA 1ESBA 4KTUA 1F2SE 5ETXA 1UTOA 4BAMB 3FP7E 2J34A 2KAIB 1T8NA 1TA2A 4UFEH 3KN2A 4ZUHA 5ESBA 1O3LA 3NXPA 1UMAH 3M5OA 3OY5U 4MPWA 3LPRA 3M3VA 5JDUB 5DG6A 1E34B 3T62A 1ESAA 1ELAA 1GPZA 2GZ8A 3RXGA 4Z6AH 1QL7A 2BQ6B 4AFQA 3MMGA 2H5CA 1GHYH 2A4QA 3ZZ9A 1SGFG 3BTGE 1VJ9U 4A7IB 2IN2A 1EAUA 3SO3A 1HXFH 2PTNA 5F8ZA 1IQGA 1ELTA 1O3FA 1GMDF 1SGPE 2HWLB 1HJAB 2B7DH 1HJAC 2OBQA 1BRBE 2ZFRH 1FXYA 1H8IH 5EW1H 2BB4A 1QBNA 3GCTF 2A1DB 3ELAH 1TNHA 1A5HA 1A5IA 4B71A 4ABFA 1BRUP 2G52A 5ABWA 4IC6A 3ZZ4A 1F5LA 2CF8H 2ZDNA 1MCVA 2FIRH 1QJ1B 1SR5C 2DUCA 3M5LA 1L0ZA 5T6GA 1OWHA 1TONA 5EPYA 1ZRBA 1EUFA 2VU8E 2FDAA 1AVXA 1CT2E 3ZZ7A 1EP6A 2CV3A 3ZZBA 2D1JA 2PSYA 1ZR0A 1HAHH 1ID5H 1O2MA 1XKAC 2ZGBH 4I32A 4D7GA 1GL1A 1FUJA 4X8TH 1AMHA 3MH6A 3SU5A 1D6WA 3SGAE 3TGIE 1UK2A 2G55A 1OSSA 3AASA 2ZFPH 3UUZA 1BTPA 1CHGA 3TPIZ 2H9HA 1FN8A 1O2LA 1IHTH 3OTJE 2F83A 4NZQA 2ODYB 2FTMA 2TGTA 4HTCH 1TNIA 2FOMB 3MFJA 4MPVA 1VITG 2FOFA 3SN8A 5HM9A 2Z9KA 3BTWE 5IYTA 4ABIA 1ABJH 1MTSA 4BTUB 1ZHMA 2BHGA 5C3NA 2UUJB 3AAUA 2AS9A 5CE1A 1UVTH 2ZTYA 3SI3H 1Z1JA 2Z7FE 3ATKA 3UR6A 1CA8B 3L33A 1QTFA 4THNH 1LVMA 1T8LA 3UTUH 2SNWA 1GHBG 1CT0E 3ZVAA 1ANDA 1C5LH 3OYPA 5PTPA 4DVAU 4ASHA 1OP0A 1OOKB 4UD9H 1ANCA 2GDEH 2O8LA 1KIGH 3A80A 4UFGH 3GDUA 1ANBA 2FP7B 1ARBA 2RA3A 2WV4A 5EQSA 3SV7A 1ELEE 1UTKA 2ZHQH 3GY2A 4NGAH 1QA7A 4CR5A 4NG9H 1PPZA 2RCEA 1HIAA 5A09A 4F49A 2AFQB 1Q3XA 3B8JA 3KQCA 2BX3A 1AY6H 1QCPA 1NFXA 3PWCA 1BQYA 2ZFSA 2BLVA 4CHAC 3A8DA 1PYTD 1BJUA 1MAYA 1VITH