3EA9A

Crystal structure of sars-cov main protease quadruple mutant stif/a with one molecule in one asymmetric unit
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
301
structure length
301
Chain Sequence
b'SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEATPFDVVRQCS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title crystal structure of SARS-CoV Mpro quadruple mutant
rcsb
source organism Sars coronavirus
molecule tags Hydrolase
total genus 81
structure length 301
sequence length 301
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3ea9A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ea9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ea9A02
2RDLA 1C5RA 1ZSLA 3TJNA 2ZO3H 8GCHG 1ORFA 2FX4A 1QRWA 2CN0H 4ZKOU 2OC7A 1HBTH 5C3NA 1FIZA 4A92A 4DIHH 3D23A 2VWOA 3TPIZ 3ATWA 1P12E 3ZVDA 1YKTA 1Y3XA 2ZPSA 5HYOA 2HPPH 4K8BA 4X1PU 1BQYA 4NFFA 1Y3UA 2C3SA 4MPXA 2ZU5A 1NRQH 3RXMA 2BMGB 1FV9A 4NZQA 1BTPA 3A7WA 3BIVH 3ZYEA 1O0DH 3ZZ5A 1P9SA 1Y5AT 2AGEX 5HGGA 4E05H 3QZQA 4IC6A 1O37A 1PPCE 4ASHA 3KQBA 2TGAA 1VCWA 3ZV9A 1TX7A 2WV4A 3QZRA 4TY7A 3TJVA 1TNKA 5FHTA 3LIWA 4GPGA 2GD4B 4UEHH 1ZYOA 1YPLH 1GVLA 2EA3A 1XVMA 2STBE 1EX3A 4U01A 4JK5A 1O32A 1BTXA 1GVZA 1C1PA 1SGFA 5B6OA 2WYGA 1TGSZ 4U32A 4K1SA 1NESE 4I7YH 3S69A 2XCNA 5JB9S 4LZ4B 9LPRA 1FI8A 4Q7ZA 3U98H 3IWMA 4TWWA 1F5RA 4MNXA 1LTOA 4UONA 1OKXA 3M36A 4JZDH 4Y11E 2ZG0H 1UJ1A 1TBRH 4O3TA 2FZZA 2ZDKA 1ZRBA 3TU7H 4FU7A 1C2HA 4GLYA 1EZQA 4A7IB 3RMMH 2BDBA 3M5OA 1AZ8A 2QF0A 4IN2A 1DICA 2ULLA 3TH4H 1AN1E 1WTHD 4X2YA 1ZHMA 2UUYA 1MQ6A 1A3BH 2GZ8A 4WH8A 3PO1C 5JBAS 1HJAB 1UVSH 2ZPRA 2IJOB 1JOUB 1O5EH 1QL7A 1VJ9U 5E2PA 1WV7H 1TPAE 3KGPA 1FAXA 2PKAA 1P2MA 2TGTA 2BOKA 4H6TA 3QN7A 1BT7A 2V3OH 4A6LA 4BAOB 3I78A 3TK9A 1O3OA 1BTHH 1SQOA 5FPTA 3H7TA 3F9HA 1W8BH 3ODFA 1MCTA 1L1JA 1SQAA 5C67A 2OD3B 4WJG2 1DUEA 3PM3A 8KME2 2PR3A 2Z9JA 2BD3A 3KQCA 2ANMH 3LKWA 8LPRA 3TH2H 4AB9A 3A85A 1TE0A 1C9PA 1TABE 2G81E 1MU6B 2VU8E 3BTFE 5AFZH 2G5NA 1CHOG 1GBHA 1J16A 2EC9H 1QY6A 3ZVGA 2RCEA 2ZGCA 3HATH 4JYTA 3VB3A 1MQ5A 2BDIA 1CGHA 1O30A 2HLCA 1O39A 2O8TA 2AGIX 7LPRA 1O38A 1E35B 4UFEH 3RXAA 4BXSA 1PFXC 3LGIA 1YPHE 1Q2WA 1QJ6B 2Z3DA 2FPZA 1BB0B 3Q3KA 1B0EA 1GI9B 2FOBA 4ZXXH 1SGCA 1IHTH 3SUGA 2ZFSA 1P8VC 4A1XA 2W26A 1C5YB 3A7VA 1T32A 2VVUA 3MH6A 3SJIA 1C5WB 3RC6A 1FN6A 1S84A 2GX4A 3BEUA 3NWUA 2SGAA 2ANYA 2ZGHA 4F4OC 4CRDA 4FUIA 1G9IE 5J4QA 3ZZAA 2R2WU 3FVFB 3E90B 2FLRH 2ZA5A 3P95A 3A8CA 4UE7H 3SO3A 4CR9A 3SV6A 4B1TA 2BY9X 2ODYB 2HNTF 5C5NA 3ZV8A 4BTTB 3ZVEA 2BLQA 4LXBH 4CBOA 1EJMA 1XUHA 5JDUB 4ZHMU 1GJ9B 1XUKA 1C5PA 1QB1A 2G00A 1O3GA 1OXGA 2Y7ZA 4UFDH 1JIRA 3E3TA 4A1TA 5FPYA 4ABFA 3QUMP 3MO6A 3O8BA 1QNJA 4KP0A 1MMJN 2HNTC 2Y5FA 3OY5U 1GBAA 1O2OA 3U8RH 3QX5H 4CREA 2WUCA 4WF8A 3S9AA 3LDXH 2FDAA 2FESH 2GCHG 1EKBB 2AGGX 5HM9A 3A88A 1BBRH 1AB9C 4O3UA 1P04A 5LPFA 3DFJA 1W2KH 4Y0YE 4CRFA 1N8OB 2W5EA 1C1MA 4Y6DA 2GZ9A 1C1WH 3F6UH 2PSYA 2P59A 2ZDNA 3KHVA 4X0WU 4AFUA 2A4QA 1ZTJA 3TNSA 1WQSA 2F9VA 4AGJA 1GHWH 3GCNA 5H4IB 1ACBE 2ZU2A 1O2PA 2BLVA 1JIMA 2SGPE 4YM9A 1IAUA 1RGQA 2Q1JA 1HAVA 1EAIA 1GJ8B 2AMQA 2W7UA 2SNWA 3M3TA 1YLDA 1T7CA 3FP8E 1TGNA 2GTBA 3M7TA 3ZZ9A 3VB4A 2GMTC 4AN7A 1ETTH 2NWNA 5GCHF 1LKAA 1A61H 2ZGXH 3STJA 5FCRA 3URCA 1QL9A 1T4VH 4WY3A 1W12U 4CH2B 3ZZDA 1MAYA 3LC5A 5JBTA 1TRYA 1P09A 3AASA 1AZZA 1GGDB 1PYTC 1YGCH 2CHAC 5DGJA 4CRGA 5T6GA 2AIQA 2WPHS 1BIOA 5EPYA 4FU8A 5CMXH 1OWIA 3M3SA 4Z0KA 1PPGE 2Y81A 5F8XA 2GV7A 2VGCC 3UNQA 1EP6A 1ID5H 2PHBA 2PLXA 4BXWA 1ESBA 1GBIA 5EQSA 2OC8A 1DSTA 3UFAA 1Q3XA 3UTUH 2ZGBH 1RTLA 1OOKB 4JYVH 7GCHF 5GXPA 4ISHH 3OTJE 3ESTA 4B71A 3BTGE 3E0PB 1V2MT 3SHCH 1CA0B 2Z3CA 4BAHB 1JXPA 1AB9B 2A2QH 3RMOH 2Y82A 2SFAA 4YOGA 4I32A 1EJAA 1RIWC 1SLXB 1DWDH 3P6ZB 1NPMA 3PYHA 2EI6A 3RXBA 4ZROA 1RS0A 3BTQE 1YPHC 5DO4H 1V6DA 1GMCG 2AYWA 1FPHH 1KDQA 2GCTB 1LVOA 1QBOA 4PROA 1JMOH 2W3KA 1GMHF 1GDUA 1PPEE 3QTOH 4CRCA 1LHDH 3MH7A 1C1NA 1O3CA 2BXUH 3W95A 1BITA 1QR3E 1UCYK 2PGBB 4Z6AH 3GDUA 3TITA 1O3FA 5FX6A 2ZQ1A 4ZKRU 5EOKA 3DA9B 1NFXA 2VNTA 3VXFH 1EPTC 1MBMA 2JH6D 1Z8JB 5A8XA 2ZFQH 1PJPA 3DT0H 3ODDA 4LOYH 1ELTA 3V13A 2CF9H 3PMJA 4BANB 1Y8TA 3Q3YA 4RKJB 1DVAH 4GAWA 2QGRA 2JH5D 1K9OE 3SHAH 1A1RA 1GI6A 4OS1A 3V0XA 1QGFA 3ZVAA 5A0AE 1IQMA 1GCTC 5LPEA 2ZZUH 1KIGH 1MKXH 1QJ1B 2H5CA 2LIZA 3GY4A 4YT6H 1O2NA 4MNYA 2JETB 1SGRE 2ZCHP 3PWCA 1K2I1 3SUDA 2F83A 1C2GA 1CT4E 4E06H 2BX3A 1W7GH 2P8OC 3HGNA 3MHWU 1A5GH 1Y5UT 1YPGH 3TGIE 4DURA 1QBVH 2BD5A 4X6PA 4XDEA 1UVUH 1DLEA 4YLUA 3SJ8A 4WXVA 1WBGB 2JH0D 5C1UA 4K2YA 4B73A 1VGCC 4ABEA 4YLQH 3Q77A 1TPSA 5L2YH 2BD4A 1NFUA 1GHYH 1BMLA 3T62A 1C1RA 2AEIH 4JYUH 5CE1A 2QV1A 3DFLA 3RLYH 1V2PT 1C5MD 1CA8B 3B23B 4ABBA 1H9HE 1SBWA 3SNAA 4MPWA 3VGCB 2A5IA 3SBKA 1V2VT 3BG4C 1P2KA 5EW2H 4IC5A 4ZXYH 3IITA 2BQ6B 3EA7A 4IN1A 4WVPE 1KXCA 4X6OA 4CRBA 2C8XB 1TGTA 2G52A 3T25A 6CHAB 2GT8A 1C1VH 1S6HA 5F03A 4INKA 3S9CA 1F2SE 4JZEH 2BY5X 3U8TH 3VFEA 1DY9A 4OGXA 3HK6B 2ZU1A 2FI5E 4I8JA 1KXAA 4NIYA 2J9NA 1EZUC 4ABDA 4DJZB 5A8YA 3K6YA 1KXDA 3LT3A 4B75A 3F9EA 2P3TB 3T26A 1D4PB 1F7ZA 2CJIA 1YCPK 4MNVA 2BVRH 1HAVB 1O2LA 2PW8H 1HAOH 3UR6A 2A5AA 4NA7A 1C5XB 3GY5A 5DP7A 1O2TA 2DE9A 1WCZA 1GBFA 1FY4A 2ZP0H 4BAKB 2H9HA 3RC5A 2Z3EA 4O97A 3VPKA 1OSSA 2BVXH 3RXJA 1C5TA 7KMEH 3BN9A 3QGJA 1HUTH 1AO5A 1BMMH 1CGIE 1KTTB 1NRNH 1F5LA 1LDTT 2B9LA 1BA8B 2H6MA 2BXTH 1XVOA 1FN8A 3QO6A 2FLBH 3LONA 1FNIA 3ZYDA 2OC0A 2WPLS 3MNSA 4VGCB 3QGNB 5LH8A 1AFQC 5C2ZA 2VIPA 3SI3H 1TNIA 1BRCE 4Q7YA 2YNAA 1LHEH 3ATKA 2A7HA 2G4TA 8GCHF 4Y7BA 3W94A 1ZSJA 1TNHA 3E1XB 3RM2H 2AIPA 4WMFA 3SU5A 2GDDA 3GDSA 1AY6H 3RXHA 2FP7B 2OUAA 3BV9B 2A4OA 1C2FA 2BOHB 1K22H 4SGBE 1SGNE 3PMAB 4CHAC 2ZQ2A 2F9BH 1LHFH 5EG4A 5GPIB 3ZZ7A 2ZTXA 1TQ7B 1MTNB 3GY7A 3M5MA 1Z6EA 1TOCB 2H2ZA 1O2VA 1SR5C 3RLWH 1QQ4A 5E2OA 5J4SA 1HDTH 3RXPA 2PTCE 2A4GA 1KDQB 3WY8A 1FDPA 1EXFA 3D49H 1BHXF 3A7XA 1D9IA 1BOQA 1UO6A 1M9UA 1O36A 2J2UA 3KL6A 1C5ZB 3PMHB 1HNEE 3AW1A 5CHAC 1N6XA 1AWFH 3QDZB 3ZZCA 1HJ9A 1VJAU 3GCHC 1SSXA 1A4WH 1GBKA 1OYQA 3GYLB 1CHGA 4NIWA 1BZXE 2H1UA 5A09A 1O2MA 1ZPZA 2FWWA 1OP2A 2UUJB 2F9UA 1V3XA 2C8WB 1SL3A 2Y6TA 1O3LA 5I25A 1D6RA 1FQ3A 1S85A 4DIIH 1V2TT 1A0LA 1GJBB 1W10U 4FUHA 1SVPA 4LZ1H 3RUOA 3RXKA 1SHHB 4IMQA 1E36B 4Y0ZE 2WYJA 4OS2A 1PPZA 5C5OA 2C93B 1GCDA 1KLIH 1O5GH 3SUEA 1EB1H 1X7AC 1DM4B 1ELGA 2C8ZB 1LQEA 5EGMA 1K1JA 4GCHG 2Z9LA 1C2KA 3RXEA 1UK2A 3A83A 2R3UA 4I8KA 4TPYA 3GCOA 4AOQA 3SNEA 1DLKB 4GHQA 1Y5BT 3SI4H 1EASA 1F0SA 5EU8A 1ANCA 1J9CH 2P3UB 1ANDA 5FBEA 3SGQE 1DSUA 3EE0B 3PLPA 3URDA 2R2MB 1O31A 1DE7H 2BDYA 1O2RA 2P93A 2AH4X 2Z9IA 2HPQH 3KIDU 2C90B 2UUKB 1SMFE 1G3EA 1MH0A 2CGAA 1UHBB 4IGDA 1GG6C 2VIWA 4DY7B 1CHOF 2AFQB 4ABHA 1EATA 4TYDA 4IS5A 3SV7A 1PQ7A 2VWLA 3GISB 1SLUB 3RXSA 2NU1E 4JMYA 2GDEH 3RU4D 4AFSA 4NA9H 1TFXA 3SU0A 1O3DA 1ZRKA 1IQLA 4MDSA 1EAXA 4HI3A 2FS9A 3RXUA 3EYDA 2WPIS 1C1UH 4X1SU 2W7SA 3UIRA 3ZZ6A 3GCTG 2XW9A 1BTYA 1UCYE 1G36A 1UVOA 2ZFPH 3LGVA 3A89A 2BD9A 3MU0A 3SNCA 4FUBA 1AWHB 2A4RA 4AORA 1GJ5H 1C5OH 2GV6A 1O3JA 5C20A 3Q3XA 3U9AH 2FIRH 2OC1A 1GBBA 1TPOA 2A0QB 4U30A 1ARCA 1SOTA 1NM6A 1XXFA 1MKWK 3P8OA 1TNGA 3U8OH 1ZGVA 3PTBA 4MPVA 3SU6A 4ZUHA 2UWOA 1KXBA 4H4FA 3SNDA 1BJVA 2FYRA 5DKMA 1BMAA 3TGKE 3VEQB 3KCGH 1YC0A 1LVMA 1TGBA 4WWYA 1Z71A 2SNVA 2FODA 1C5QA 1CU1A 1QJ7B 2BDGA 1SGPE 5I46H 3P8FA 3V12A 1O2GH 2VIQA 1FXYA 1EAWA 1W14U 3OU0A 3PO1B 1DXWA 5LGOA 1QURH 1OWEA 1UTKA 2QF3A 3MO9A 1NY22 1SGFG 1F0TA 1W11U 3MWIU 1TMUH 4YZUA 1P10A 1HAYB 3LGUA 2GCHF 5L2ZH 1O3EA 2AS9A 2DUCA 2WPKS 2ZFTA 4D9RA 1HAZB 4B2BA 1QFKH 1EB2A 3RU4T 1A5IA 1ZMNA 4DGJA 1ANBA 1TYNA 1C5LH 3GY8A 2NU3E 2ZEBA 4BTUB 2C4FH 2HVXA 4H42U 3ZZ4A 6ESTA 1FIWA 2YOLA 4WXIA 1QQUA 1CE5A 2BX4A 2ZHQH 1ZMJA 1TMBH 1FUJA 2G55A 2ZCLP 4INHA 1K28D 3FAOA 6GCHG 2R0LA 2FTLE 2J94A 2FYQA 4O9VA 2TBSA 3RMLH 1T31A 3ENSB 5ABWA 3O8CA 3SGAE 1ZHRA 2VVVA 1C9TA 1Y3YA 5DP9A 1C1TA 2G4UA 2GKVE 1HXFH 2G8TA 1AI8H 1ETRH 1HIAB 2BY8X 2PTNA 3D65E 3GYMA 1C4V2 3ZVCA 4NZLA 1GBJA 4Y79A 1GI4A 3A8DA 4NA8A 3T2NA 2ZU4A 5FBIA 1QIXB 1NFWA 3CENA 1EOJA 3HGPA 2I6SA 2RA0A 1UMAH 4Q2KA 1XUJA 1LKBA 5DP6A 3TGJE 3ATLA 3LOXA 1H1BA 4Y71A 2R9PA 1TMTH 2OLGA 4ISIH 1Q31A 1P9UA 1AE5A 4HTCH 1O2XA 2EEKA 2ZGJA 1ELVA 3L33A 1RTKA 2FOHA 3GOVB 1G37A 1MZDA 1NC6A 1P2QA 1YLCA 5HM2A 3PLBA 4ISOA 3RXVA 3ATMA 1MTUA 2ANKH 1MTSA 2PWXA 2BYAX 2FOMB 1GMDG 2NU0E 4DW2U 4X8TH 1Z7KA 1AFEH 3OX7U 1RFNA 1TLDA 1PYTD 2XWBI 1JWTA 1P11E 1DY8A 2BQ7B 1MCVA 3SV8A 5SGAE 3KQDA 1HLTH 3L3TA 1MU8B 2PSXA 2PKSC 1S82A 1GMCF 1EZXC 1T8NA 1IHSH 2TPIZ 1A2CH 4NIVA 1UTJA 1B0FA 4X2XA 2JKHA 1TQ0B 3Q76A 2W3IA 2RA3A 3ZZ8A 4RKOB 1VITG 1Z6JH 2ALVA 1SQTA 2Y5HA 1QA7A 4K1EA 1O3KA 4FVDA 2VH6A 1GWAA 1GJDB 5GIBA 2F9OA 2GZ7A 1GHBG 1HAPH 3BEIB 3SOSA 2ZWLH 1BRBE 4ZH8A 1O3PB 1XUFA 2ZFRH 1O35A 2LNCA 3A81A 1K21H 2QIQA 3EQ0H 1P01A 1O2WA 1MUEB 1P06A 5L30H 2Y7XA 2IN2A 2EI7A 4X6NA 1K1OA 4XBBA 3C1KA 1V2ST 4X8SH 3RP2A 2QN5T 3LC3A 1LHCH 3UQVA 2Q6FA 4SGAE 1J8AA 2CV3A 4BAQB 2GMTB 4FUDA 1P2JA 1E0FD 2O8WA 1IQKA 1OX1A 4R0IA 3NZIA 1CSOE 2QA9E 4ABIA 3SJOA 2XC4A 2WV5A 1OP8A 1VCPA 4X2VA 4Y10E 1UTNA 1MZAA 2CHAB 2OQ5A 3B8JA 4JCNA 4MLFB 4IMZA 5ETXA 3TVJB 2BDAA 3SUFA 2OBQA 3Q00A 3RXDA 2F9PA 1O34A 1OYTH 3FZZA 3LGYA 2VGCB 6LPRA 3EDXB 3UNSA 4CBNA 3BTWE 4GHTA 1DT2A 1O5DH 2A45B 4UFGH 2B7DH 3LJOA 1MTWA 4AG2A 1DWBH 4NWKA 4ZHAA 1A0JA 1L4DA 3LGWA 1BTWA 4AYYB 2OP9A 3A80A 4NG9H 5IDKA 2A1DB 1HAXB 5C1YA 1HV7A 4DG4A 1G3BA 1LPKB 2SGFE 2XRCA 2ZTYA 3SU3A 3QWCH 4M7GA 2F9NA 3AAVA 3AAUA 4YTAA 1AU8A 1GJ4H 2Q6DA 2VIVA 1RIWB 1ZJKA 1HXEH 3UUZA 1SGEE 1HAHH 2OBOA 1UHBA 3BG8A 1UTMA 4YO9A 3FANA 4B76A 1OPHB 2XCFA 4IW4E 3MNCA 5TCAA 2M5TA 2BLOA 2D1JA 3SU1A 1BBRK 1CBWC 5A0CA 2ZHWH 5EW1H 3MH4A 1GI1A 4UFFH 3D62A 1KY9A 3A7TA 2R0KA 1FY8E 4THNH 2G51A 2XWAA 3JZ2B 2OCVB 1F0UA 2ZHDA 3RXOA 4R8TB 3T5FH 3VB5A 1INCA 1Z1JA 1PPFE 3P8GA 2OTVA 1G30B 2PUXB 3HK3B 4AX9H 1W0YH 2FS8A 1EPTB 3MI4A 1C4U2 1GPZA 1L1NA 5EXNA 4UD9H 1TBZH 1GHAG 5EXMA 3SORA 4KGAA 1SLVB 1EUFA 2BTCE 2BZ6H 1GHVH 8ESTE 1BTUA 5A2MH 1RTFB 2TIOA 5DP8A 3SZNA 2B0FA 5FCKA 4RSPA 1SGYE 3G01A 4MG3A 1J17T 3RU4E 1GCTB 1ZMLA 4I8GA 2VWMA 1DUAA 2SGQE 4GSOA 3UOPA 5G4BA 1Y3VA 4FXGH 4OS7A 3BTKE 2FX6A 3SQEE 2HGTH 1LQDB 1ELEE 2G5VA 4K60A 2P8OB 3TJOA 3K2UA 3F9GA 1O2UA 1O5FH 1W7XH 1K1LA 4FUGA 2Z9GA 1S83A 2VJ1A 2LPRA 2H9TH 3S0NA 3I77A 3LH1A 4I33A 1GI0A 1GBLA 2A2XH 1O2ZA 1YPKH 3SN8A 4AG1A 2ZHEH 2VIOA 5DK1A 1VGCB 1NRPH 5PTPA 1UTOA 2XBXA 1EAUA 4ISLA 1V2LT 2Z9KA 1FMGA 4K69A 1TB6H 1VCQA 4XE4A 1AKSB 1P3EA 1D3TB 2ASUB 3EBNA 3HPTB 3EGKH 2O9QA 3SU4A 1SC8U 4H6SB 1CQQA 4BOHA 5A8ZA 1UVTH 1CBWB 3GY6A 3CS0A 4DOQA 4KKDA 2ZDVH 3BG4B 2YNBA 4NWLA 1C1QA 1KSNA 1G3CA 4D9QA 5EQQA 1TGCA 2C8YB 2ZDAH 1RJXB 1DANH 3EA9A 4FUJA 2GT7A 1MD8A 4Q80A 3MNBA 3MFJA 1O3IA 1S81A 1SFQB 3ATIA 1OP0A 2XTTB 2FOEA 1C2DA 3STIA 1PQ8A 1H9IE 3MU1A 1YPJH 1IQNA 1HJAC 1YCPM 3S7KB 1ELBA 2BLWA 4HFPB 4AFQA 1C5NH 1EOLA 4AFZA 3VB7A 2V6NA 1SI5H 2BB4A 1S0QA 2ZI2H 1EZSC 4MTBA 2HOBA 3DHKH 1HIAA 4X1NU 3GICB 1AVXA 1J15A 3LGTA 1QHRB 3ELAH 4MQAA 4DVAU 5K7RA 1KXEA 4CRAA 2A7JA 1SGQE 4AYVB 2PV9B 4E7RG 1O5CB 2HNTE 1MD7A 1L0ZA 1RRKA 2OXSA 5JPMH 4ISNA 1TWXB 2D8WA 1C2IA 1GBTA 3A8BA 3BTDE 2O8LA 5K0HA 1HAGE 5E0GA 1NT1A 1ZZZA 2ZPQA 4GCHF 1TA2A 2STAE 1ZHPA 4WH6A 1TRMA 3SW2B 1MKXK 1MTVA 1GBDA 4KTUA 1NROH 1WU1A 3R0FA 1GDNA 5GDSH 1K1NA 1S5SA 2J38A 4Y8ZA 3OY6U 2BY7X 3M5LA 1V2KT 1TALA 1IQJA 1GI7B 5F8ZA 2CMYA 2XC0A 2J95A 3PROA 1NS3A 5T6FA 1AFQB 1ZPCA 1LO6A 5TCCA 3EA8A 3I29A 3M7UA 5DG6A 1CT0E 2HWLB 1ZSKA 3BEFB 2AMDA 4YOIA 1HGTH 3NXPA 5GJ4B 2ZU3A 3RXRA 1ARBA 4D8NA 3AVZA 1SLWB 1GHZA 1GJAB 1AUJA 2RG3A 1Z8GA 1ZTLA 2ESTE 5BPEA 3FP6E 1TAWA 2D2DA 5EQRA 2D26C 1Y59T 4FU9A 1O2KA 1C4Y2 1THSH 2H9EH 4CHAB 4MVNA 1NZQH 3FFGA 4CH8B 1L4ZA 3UR9A 2O8UA 3NPSA 5ESTE 1NU7B 3MMGA 1THRH 4JZ1A 1J14A 1DS2E 1G2MA 1NO9H 4JK6A 1T8OA 4X8UH 4X6MA 1GJCB 2BM2A 2I6QA 3DUXH 4ZHLU 3TIUA 1LVBA 1TX8A 1SGDE 3L6PA 1SGIB 4MNWA 3K9XB 3A8AA 3H5CB 2BVSH 4KTCA 1O3MA 5ESBA 4NSVA 2FO9A 5CHAB 3GCTF 3UNRA 1NU9A 2GVFA 3M37A 1CGJE 3GCHB 3U1JB 4B2AA 2A5KA 1BJUA 1P2NA 2FM2A 4K3JA 4Y8XA 3QLPH 2WUBA 5LPRA 1BRAA 1ELAA 1PQAA 3E8LA 1WUNH 3P70B 4NGAH 1V2RT 2XBWA 4HGCA 2QAAA 2PFEA 5E0HA 1BHXB 4INLA 1DWCH 1S6FA 5T3HA 3ZZ3A 1DDJA 2F91A 1TX6A 2ANWA 4ZKSU 2PUQH 1N8OC 1XKBC 5DP4A 4FUCA 4ZAEA 1D3DB 2Z7FE 3ZVBA 4ESTE 1QA0A 4WMEA 4GVUA 1SFIA 1A7SA 2BD2A 1TONA 3SQHE 1TRNA 3MNXA 1O3HA 1V2NT 1ABJH 2P16A 3A86A 3E6PH 1UCYH 3BSQA 1JBUH 5TJXA 1ZGIA 3E16B 4A5TS 1XKAC 1VITH 4XOJA 1P02A 3KN2A 4OS5A 1GBCA 5FPSA 5F8TA 3T29A 1N6YA 3S7HB 1SHYA 3LPRA 2A32A 2ODQA 1BCUH 5AVDA 3QK1A 1BRUP 4X2WA 3B9FH 3BIUH 1AQ7A 5FXLA 1DFPA 1UTPA 2ODPA 2VINA 4K8YA 4I31A 4YOJA 4QT8C 1HRTH 1E37B 1BUIA 2Q6GA 4JZFH 3UREA 3KNXA 1FONA 3SV9A 4OS4A 4D7FA 1OWKA 1BTZA 1T8LA 1G32B 1O3BA 1ZPBA 1A46H 1NTPA 2SGEE 2PGQB 2XBVA 3PV4A 1WQVH 2HALA 3MU5A 1XXDA 2WPMS 2UUFB 1XUGA 1C2MA 2AMPA 1A5HA 3HKJB 4YESB 3BTEE 1AIXH 2FEQH 1GG6B 1GGDC 4J1YA 4YT7H 3V7TA 5GWZA 3ZVFA 1QRXA 3P8NA 3GDVA 1PPHE 2HRVA 4OGYA 4TY6A 3TK6A 6GCHF 5DPAA 1ZR0A 1C5UA 1GL0E 1GBMA 1HJ8A 2XC5A 4U2WA 2Z6BD 1O5BB 2QXJA 1O2JA 1FY5A 3RXLA 1BBRE 1O2SA 1ABIH 1QB9A 1P57B 1EJNA 3O8RA 3JZ1B 3OYPA 1EPTA 1RD3B 1DPOA 4BTIB 1F92A 1GI3A 3MU4A 1GI8B 1JRTA 2FXRA 2ZIQH 3FP7E 3RC4A 1CA0C 3BF6H 1OWHA 1PQ5A 4ABGA 1IOEA 3H7OA 1ELFA 3M7QA 1D3PB 3SJKA 3SV2H 4WMDA 4F49A 1LPZB 2GGVB 1C5VA 1PPBH 2J34A 3SJ9A 1V2QT 1AGJA 2Z94A 3F9FA 2FTMA 1TNJA 1UVPA 5EXLA 1ZOMA 1QRZA 1QTFA 3MO3A 2GCTC 4FUFA 5E8EH 3IG6B 3A82A 4I8LA 2ZTZA 1WSSH 1O3AA 1LPGB 5EPNA 3VB6A 4X1QU 5FAHA 2CF8H 1EP5A 3QTVH 1C2EA 2FOAA 2J92A 3UWJH 1GMDF 2VVCA 5A0BA 2BD8A 4A1VA 1KLTA 2F3CE 5HXFA 1ETSH 1YCPH 1GI2A 2BD7A 4AGKA 1IQEA 9ESTA 1ESTA 1SB1H 4ABJA 3U69H 4TWYA 3LJJA 3LH3A 3C27B 1C1OA 2AERH 2BY6X 1UTLM 2BQWB 4D7GA 2V35A 1AKSA 4TPIZ 1N1LA 3HKIB 3P92A 1GJ6A 2A7CA 1O2QA 3MYWA 2QXIA 3PWBA 4NIXA 3V3MA 1FZZA 2ZDLA 5GCHG 5JBCS 4Y76A 4FVBA 1ZJDA 1HAIH 1TNLA 2FOCA 1V2OT 2THFB 3TLOA 1AMHA 1BMNH 3CS7A 1VITF 2JETC 4X8VH 2SGDE 1CT2E 1DOJA 3UWIA 2B8OH 1T8MA 1XMNB 1B7XB 1GHBF 3RXIA 4XBDA 3M5NA 1P0SH 2VWNA 1FY3A 4CR5A 1W0ZU 1NRSH 1W13U 3S9BA 1AVGH 2NU2E 1DITH 5JBBS 2KAIA 2EI8A 1G3DA 1ZLRA 3LU9B 5IYTA 5JYIA 5EODA 1LMWB 4JZIA 2A31A 2O8MA 3E91A 2P95A 3UQOA 1QB6A 2B5TB 1V2JT 1XX9A 2PKAB 1ZTKA 3K65B 1XUIA 4X1RU 1MBQA 4BNRA 1D3QB 1FPCH 2ZECA 1ESAA 7GCHG 2WINI 3A7ZA 3BTHE 3A7YA 1GJ7B 1WAYB 1CO7E 2NU4E 1YP9A 4FUEA 1UK3A 3VGCC 4NSYA 1QL8A 1TIOA 1Z8IB 4ABAA 5DJ7A 1O2YA 1SGTA 1P3CA 1THPB 1B5GH 3PTNA 3MU8A 1GI5A 1L1GA 2OINA 2FI4E 2IOTA 1KLJH 3PLKA 4LK4A 6CHAC 3GY3A 1WYKA 1P03A 5FX5A 1F5KU 4IBLH 1LVYA 1JRSA 1ELDE 3GY2A 3T27A 3KEEA 1GBEA 3A87A 3EAJA 1G2LA 1O5AB 3MH5A 1GMHG 3E0NB 3RXTA 2FOFA 1C2LA 2R3YA 3KF2A 2DE8A 4Y7AA 1WOFA 2TGDA 4BAMB 3OSYA 4NFEA 2TRMA 1D6WA 1TBQH 1S0RA 2QYIA 1A3EH 1BDAA 2ZCKP 3RXGA 1VR1H 4K5ZA 1YM0A 5HMAA 1FLEE 4XFQA 1HPGA 1YYY1 4ZKNU 4RN6A 2IPHA 1HYLA 3SU2A 2PKSB 3R3GB 2QXHA 3RM0H 3SNBA 1YPEH 1NN6A 4B74A 1H4WA 4UDWH 1WTGH 2UWPA 1K1IA 1UTQA 2P94A 3PMBB 1KXFA 1LHGH 1AUTC 1O2HA 1YBWA 2ZKSA 1OWDA 5AHGH 1A0HB 4NCYA 4VGCC 5AF9H 3N7OA 1KYNA 4J2YB 1H8DH 1VZQH 4DCDA 2FMJA 2QC2A 1K1PA 1AHTH 2V0BA 2V3HH 2BDCA 1GHAF 1TOMH 1HCGA 2OQUA 2VH0A 3M35A 5AFYH 1GHXH 2J4IA 1O3NA 5L6NH 3BTTE 3M61U 3FZDA 3MTYA 1E34B 2ZHFH 2K7XA 2QXGA 3NCLA 2P3FH 2ZF0H 4KTSA 1MAXA 2ZDMA 1OS8A 2H5DA 4K1TA 1CVWH 5E0JA 1V2UT 3AW0A 3NKKA 1SPJA 1F0RA 1C5SA 1IQIA 3TNTA 1GDQA 1FJSA 1IQGA 1SOZA 2XYAA 1XM1A 4I8HA 1YPMH 2QY0B 3T28A 1MTNC 5JB8S 1KTSB 2VB0A 1AVWA 3CP7A 3K6ZA 3NUMA 1W3CA 2GP9B 3RMNH 5BRRE 3PB1E 5DP5A 1HFDA 3SGBE 2BZAA 4DT7B 3NK8A 1LCYA 4ZMAH 5DP3A 4KELA 4GUXA 1UK4A 1TA6A 1DXPA 4OS6A 1RXPA 3A84A 3ZZBA 1O2IA 1Z8RA 4O03A 4B2CA 1H8IH 4Q7XA 3TH3H 4AB8A 1P2IA 1V2WT 3VXEH 2QCYA 3TK5A 1EQ9A 1TPPA 2VIDA 3TJUA 1MKWH 1HB0B 2ILNA 2XBYA 2Y5GA 3UOUA 1H9LB 1DWEH 1U6QA 1Y3WA 1FAKH 4D76A 1ANEA 4AZ2B 5F6MA 3F1SB 2BHGA 1IQHA 3KQEA 1AE8H 1Z1IA 4HZHA 3U1IB 3M3VA 1NFYA 7ESTE 2ALPA 1AD8H 2ZNKH 4E7NA 1NRRH 1K1MA 4XBCA 1FY1A 1GL1A 3O8DA 2XNIA 1P2OA 2TGPZ 1P05A 2UWLA 4XSKU 2ZC9H 3F68H 3P17H 4MPUA 2FOGA 2CXVA 1ELCA 3RXFA 1IQFA 3RXQA 1O33A 3UY9A 2XXLA 1T4UH 3RXCA 1E38B 2FI3E 3ITIA 3DD2H 3MOCA 1C1SA 2ZFFH 2K1QA 1QCPA 2BDHA 1DX5M 4Y8YA 5T6DA 1QBNA 1YF4A 2Y80A 1SG8B 3RDZA 1GVKB 3UPEA 2KAIB 1OWJA 3BTME 1C2JA 1L2EA 2WPJS 5C1XA
chains in the Genus database with same CATH superfamily
2RDLA 1C5RA 1ZSLA 3TJNA 2ZO3H 8GCHG 1ORFA 2FX4A 1QRWA 2CN0H 4ZKOU 2OC7A 1HBTH 5C3NA 1FIZA 4A92A 4DIHH 3D23A 2VWOA 3TPIZ 3ATWA 1P12E 3ZVDA 1YKTA 1Y3XA 3FOAA 2ZPSA 5HYOA 2HPPH 4K8BA 4X1PU 1BQYA 4NFFA 1Y3UA 2C3SA 4MPXA 2ZU5A 1NRQH 3RXMA 2BMGB 1FV9A 4NZQA 1BTPA 3A7WA 3BIVH 3ZYEA 1O0DH 3ZZ5A 1P9SA 1Y5AT 2AGEX 5HGGA 4E05H 3QZQA 4IC6A 1O37A 1PPCE 4ASHA 3KQBA 2TGAA 1VCWA 3ZV9A 1TX7A 1WXRA 2WV4A 3QZRA 4TY7A 3TJVA 1TNKA 5FHTA 3LIWA 4GPGA 2GD4B 4UEHH 1ZYOA 1YPLH 5GNDA 1GVLA 2EA3A 1XVMA 3N99A 2STBE 1EX3A 4U01A 4JK5A 1O32A 1BTXA 1GVZA 1C1PA 1SGFA 5B6OA 2WYGA 1TGSZ 4U32A 4K1SA 1NESE 4I7YH 3S69A 2XCNA 2LELA 5JB9S 4LZ4B 9LPRA 1FI8A 2K8IA 4Q7ZA 3U98H 3IWMA 4TWWA 1F5RA 4MNXA 1LTOA 4UONA 1OKXA 3M36A 4JZDH 4Y11E 2ZG0H 1UJ1A 1TBRH 4O3TA 2FZZA 2ZDKA 1ZRBA 3TU7H 4FU7A 1C2HA 4GLYA 1EZQA 4A7IB 3RMMH 2BDBA 3M5OA 1AZ8A 2QF0A 4IN2A 1DICA 2ULLA 3TH4H 1AN1E 1WTHD 4X2YA 1ZHMA 2UUYA 5C17A 1MQ6A 1A3BH 2GZ8A 4WH8A 3PO1C 1KMHB 5JBAS 1HJAB 1UVSH 2ZPRA 2IJOB 1JOUB 1O5EH 1QL7A 1VJ9U 5E2PA 1WV7H 1BMFD 1TPAE 3KGPA 1VKYA 1FAXA 2PKAA 1P2MA 2TGTA 2BOKA 4H6TA 3QN7A 1BT7A 2V3OH 4A6LA 4BAOB 3I78A 3TK9A 1O3OA 1BTHH 1SQOA 5FPTA 3H7TA 3F9HA 1W8BH 3ODFA 1MCTA 1L1JA 1SQAA 5C67A 2OD3B 4WJG2 1DUEA 3PM3A 8KME2 2PR3A 2Z9JA 2BD3A 3KQCA 2ANMH 3LKWA 8LPRA 3TH2H 4AB9A 3A85A 1TE0A 2PP6A 1C9PA 1TABE 2G81E 1MU6B 2VU8E 3BTFE 5AFZH 2G5NA 1CHOG 1GBHA 1J16A 2EC9H 1QY6A 3ZVGA 2RCEA 2ZGCA 2KM0A 3HATH 4JYTA 3VB3A 1MQ5A 2BDIA 1CGHA 1O30A 2HLCA 1O39A 2O8TA 2AGIX 7LPRA 1O38A 1E35B 4UFEH 3RXAA 4BXSA 4ZCNA 1PFXC 3LGIA 1YPHE 1Q2WA 1QJ6B 2Z3DA 2FPZA 1BB0B 3Q3KA 1B0EA 1GI9B 2FOBA 4ZXXH 5CDFE 1SGCA 1IHTH 3SUGA 2ZFSA 1P8VC 4A1XA 2W26A 1C5YB 3A7VA 1T32A 2VVUA 3GS9A 3MH6A 3SJIA 1C5WB 3RC6A 1FN6A 1S84A 2GX4A 3BEUA 3NWUA 2SGAA 2ANYA 2ZGHA 4F4OC 4CRDA 5EJZA 4FUIA 1G9IE 2QF5A 2YMSC 5J4QA 3ZZAA 2JDID 2R2WU 3FVFB 3E90B 2FLRH 2ZA5A 3P95A 3A8CA 4UE7H 3SO3A 4CR9A 3SV6A 4B1TA 2BY9X 2ODYB 2HNTF 2QE7D 5C5NA 3ZV8A 4BTTB 3ZVEA 2BLQA 4LXBH 4CBOA 1EJMA 1XUHA 5JDUB 4ZHMU 1GJ9B 1XUKA 1C5PA 1QB1A 2G00A 1O3GA 4DT4A 1OXGA 2YMSD 2Y7ZA 4UFDH 2IPQX 1JIRA 3H09A 3E3TA 4A1TA 5FPYA 4ABFA 3QUMP 3MO6A 3O8BA 1QNJA 4KP0A 1MMJN 2HNTC 2Y5FA 3OY5U 1GBAA 1O2OA 1YWUA 3PV2A 3U8RH 3QX5H 4CREA 2WUCA 4WF8A 3S9AA 3LDXH 2FDAA 3F2HA 2FESH 2GCHG 1EKBB 2AGGX 2KFWA 5HM9A 3A88A 1BBRH 1AB9C 4O3UA 1P04A 5LPFA 3DFJA 1W2KH 4Y0YE 4CRFA 1N8OB 2W5EA 1C1MA 4Y6DA 2GZ9A 1C1WH 3F6UH 2PSYA 2P59A 2ZDNA 3KHVA 4X0WU 3VG8A 4AFUA 2A4QA 1ZTJA 3TNSA 1WQSA 2F9VA 1WDIA 4AGJA 1GHWH 3GCNA 5H4IB 1ACBE 2ZU2A 1O2PA 2BLVA 1JIMA 2SGPE 4YM9A 1IAUA 1RGQA 2Q1JA 1HAVA 1EAIA 1GJ8B 2AMQA 2W7UA 2SNWA 3M3TA 1YLDA 1T7CA 3FP8E 3F0PA 1TGNA 2GTBA 3M7TA 3ZZ9A 3VB4A 1E79D 2GMTC 4AN7A 1ETTH 2NWNA 5GCHF 1LKAA 1A61H 2ZGXH 2YMSB 3STJA 5FCRA 3URCA 1QL9A 1T4VH 4WY3A 1W12U 4CH2B 3ZZDA 1MAYA 3LC5A 5JBTA 1TRYA 1P09A 3AASA 1AZZA 1GGDB 1PYTC 1YGCH 2CHAC 5DGJA 4CRGA 5T6GA 2AIQA 2WPHS 1BIOA 5EPYA 4FU8A 5CMXH 1OWIA 3M3SA 4Z0KA 1PPGE 2Y81A 5F8XA 2GV7A 2VGCC 3UNQA 1EP6A 1ID5H 2PHBA 2PLXA 4BXWA 1ESBA 1GBIA 5EQSA 2OC8A 1DSTA 3UFAA 1Q3XA 4ACBA 5DSFA 4F48B 3UTUH 2ZGBH 1RTLA 1OOKB 4JYVH 4RI0A 7GCHF 5GXPA 4ISHH 3OTJE 3ESTA 4B71A 3BTGE 3E0PB 1V2MT 3SHCH 1CA0B 2Z3CA 4BAHB 1JXPA 1AB9B 2A2QH 3RMOH 2Y82A 2SFAA 4YOGA 4I32A 1EJAA 1RIWC 1SLXB 1DWDH 3P6ZB 1NPMA 3PYHA 2EI6A 3RXBA 4ZROA 1RS0A 3BTQE 1YPHC 5DO4H 1V6DA 1GMCG 2AYWA 1FPHH 1KDQA 2GCTB 1LVOA 1QBOA 3CNRA 4PROA 1JMOH 5F53A 2W3KA 2JJ2D 1GMHF 1GDUA 1PPEE 3QTOH 4CRCA 5B6LA 1LHDH 3MH7A 1C1NA 1O3CA 2BXUH 3W95A 1BITA 1QR3E 1UCYK 2PGBB 4Z6AH 3GDUA 3TITA 1O3FA 5FX6A 2ZQ1A 4ZKRU 5EOKA 3DA9B 1NFXA 2VNTA 5EJ1A 3VXFH 1EPTC 1MBMA 2JH6D 1Z8JB 5A8XA 2ZFQH 1PJPA 3DT0H 3ODDA 4LOYH 1ELTA 3V13A 2CF9H 3PMJA 4BANB 1Y8TA 3Q3YA 4RKJB 1DVAH 4GAWA 2QGRA 2JH5D 1K9OE 3SHAH 1FX0B 1A1RA 1GI6A 4OS1A 3V0XA 1QGFA 3ZVAA 5A0AE 1IQMA 1GCTC 5LPEA 2ZZUH 3PRBA 1KIGH 1MKXH 1QJ1B 2H5CA 2LIZA 3GY4A 4YT6H 1O2NA 4MNYA 2JETB 2K0QA 1SGRE 2ZCHP 3PWCA 1K2I1 3SUDA 2F83A 1C2GA 1CT4E 4E06H 2BX3A 1W7GH 2P8OC 3HGNA 3MHWU 1A5GH 1Y5UT 1YPGH 3TGIE 4DURA 1QBVH 2BD5A 4X6PA 4XDEA 1UVUH 1DLEA 4YLUA 3SJ8A 4WXVA 1WBGB 2JH0D 5FL7D 1YY3A 5C1UA 4K2YA 4B73A 1VGCC 4ABEA 4YLQH 3Q77A 1TPSA 5L2YH 2BD4A 1NFUA 1GHYH 1BMLA 4XRNA 3T62A 1C1RA 2AEIH 4JYUH 5CE1A 2QV1A 2CK3D 4FOUC 3DFLA 3RLYH 1V2PT 1C5MD 1CA8B 3B23B 4ABBA 1H9HE 1SBWA 3SNAA 4MPWA 3VGCB 2A5IA 3SBKA 3MQKC 1V2VT 2J98B 3BG4C 1P2KA 5EW2H 4IC5A 4ZXYH 3IITA 2BQ6B 3EA7A 4IN1A 4WVPE 1KXCA 4X6OA 4CRBA 2C8XB 1TGTA 2G52A 3T25A 6CHAB 2GT8A 1C1VH 1S6HA 5F03A 4INKA 3S9CA 3F0OA 1F2SE 4JZEH 2BY5X 3DSGA 3U8TH 3VFEA 1DY9A 4OGXA 3HK6B 2ZU1A 2FI5E 2L6OA 4I8JA 1KXAA 4NIYA 2J9NA 1EZUC 4ABDA 4DJZB 5A8YA 3K6YA 1KXDA 3LT3A 4B75A 3F9EA 2P3TB 3T26A 1D4PB 1F7ZA 2CJIA 1YCPK 4MNVA 2BVRH 1HAVB 1O2LA 2PW8H 1HAOH 3UR6A 2A5AA 4NA7A 1C5XB 3GY5A 5DP7A 1O2TA 2DE9A 1WCZA 5EJLA 1GBFA 1FY4A 2ZP0H 4BAKB 2H9HA 3RC5A 2Z3EA 4O97A 3VPKA 1OSSA 2BVXH 3RXJA 1C5TA 2J5UA 7KMEH 3BN9A 3QGJA 1HUTH 3OEED 1AO5A 1BMMH 1CGIE 1KTTB 1NRNH 1F5LA 1LDTT 2B9LA 1BA8B 2H6MA 2BXTH 1NBMD 1XVOA 1FN8A 3QO6A 2FLBH 3LONA 3OTPA 1FNIA 3ZYDA 2OC0A 2WPLS 3MNSA 3FKSD 4VGCB 3QGNB 5LH8A 1AFQC 3SYJA 5C2ZA 4F55A 2VIPA 3SI3H 1TNIA 1BRCE 1W0JD 4Q7YA 2YNAA 1LHEH 3ATKA 2A7HA 2G4TA 4RT1A 8GCHF 4Y7BA 3W94A 1ZSJA 1TNHA 3E1XB 3RM2H 2AIPA 4WMFA 3SU5A 2GDDA 3GDSA 1AY6H 3RXHA 2EY4C 2FP7B 2OUAA 3BV9B 2A4OA 1C2FA 2BOHB 1K22H 4SGBE 1SGNE 3PMAB 4CHAC 2ZQ2A 2F9BH 1LHFH 5EG4A 5GPIB 3ZZ7A 2ZTXA 1TQ7B 1MTNB 3GY7A 3M5MA 1Z6EA 1TOCB 5C94A 2H2ZA 3PV5A 1O2VA 1SR5C 3RLWH 1QQ4A 5E2OA 1H8HD 5J4SA 1HDTH 3RXPA 2PTCE 2A4GA 1KDQB 3WY8A 1FDPA 1EXFA 3D49H 1BHXF 3A7XA 1D9IA 1BOQA 1UO6A 1M9UA 1O36A 2J2UA 3KL6A 1C5ZB 3PMHB 1HNEE 3AW1A 5CHAC 1N6XA 1AWFH 3QDZB 3ZZCA 1E1RD 1HJ9A 1VJAU 3GCHC 1SSXA 1A4WH 1GBKA 1OYQA 3GYLB 1CHGA 2L74A 1BZXE 4NIWA 2H1UA 5A09A 1O2MA 1ZPZA 2FWWA 1OP2A 2UUJB 2F9UA 1V3XA 2C8WB 1SL3A 2Y6TA 1O3LA 5I25A 1D6RA 1FQ3A 1S85A 4DIIH 1V2TT 1A0LA 1GJBB 1QZ8A 1W10U 4FUHA 1SVPA 3N7DA 4LZ1H 3RUOA 3RXKA 1SHHB 4IMQA 1E36B 4Y0ZE 2WYJA 4OS2A 1PPZA 5C5OA 2C93B 1GCDA 1KLIH 1O5GH 3ZIAD 3SUEA 1EB1H 1X7AC 1DM4B 1ELGA 2C8ZB 1LQEA 3F2GA 5EGMA 1K1JA 4GCHG 2Z9LA 2WSSD 1C2KA 3RXEA 1UK2A 3A83A 2R3UA 4I8KA 4TPYA 3GCOA 4AOQA 2V3MA 3SNEA 1DLKB 4GHQA 1Y5BT 3SI4H 1EASA 1F0SA 5EU8A 1ANCA 1J9CH 2P3UB 1ANDA 5FBEA 3SGQE 1DSUA 3EE0B 3PLPA 3URDA 2R2MB 1O31A 1DE7H 2BDYA 1O2RA 2P93A 2AH4X 2Z9IA 2HPQH 3KIDU 2C90B 2UUKB 1SMFE 2J97A 1G3EA 3DCLA 1MH0A 2CGAA 1UHBB 4IGDA 1GG6C 2VIWA 4DY7B 1CHOF 2AFQB 4ABHA 2V7QD 1EATA 4TYDA 4IS5A 3SV7A 1PQ7A 5CHBA 2VWLA 4I86A 3GISB 1SLUB 3RXSA 2NU1E 4JMYA 2GDEH 3RU4D 4AFSA 4NA9H 1TFXA 3SU0A 1COWD 1O3DA 1ZRKA 1IQLA 4MDSA 1EAXA 2JJ1D 4HI3A 2FS9A 3RXUA 3EYDA 2WPIS 1C1UH 4X1SU 2W7SA 3UIRA 3ZZ6A 3GCTG 2XW9A 1BTYA 1UCYE 1G36A 1UVOA 2ZFPH 3LGVA 3A89A 2KCOA 2BD9A 3MU0A 3SNCA 4FUBA 1AWHB 2A4RA 4AORA 1GJ5H 1C5OH 2GV6A 1O3JA 5C20A 3Q3XA 3U9AH 2FIRH 2IJD1 2OC1A 1GBBA 1TPOA 2A0QB 4U30A 1ARCA 1SOTA 1NM6A 1XXFA 1MKWK 3P8OA 1TNGA 3U8OH 1ZGVA 3PTBA 4MPVA 3SU6A 4ZUHA 2UWOA 1KXBA 4H4FA 3SNDA 1BJVA 2FYRA 5DKMA 1BMAA 3TGKE 3VEQB 3KCGH 1YC0A 1LVMA 1TGBA 4WWYA 1Z71A 2SNVA 2FODA 1C5QA 1CU1A 1QJ7B 2BDGA 1SGPE 5I46H 3P8FA 3V12A 1O2GH 2VIQA 1FXYA 1EAWA 1W14U 3OU0A 3PO1B 1DXWA 5LGOA 1QURH 1OWEA 1UTKA 2QF3A 3MO9A 1NY22 1SGFG 1F0TA 1W11U 3MWIU 1TMUH 4YZUA 1P10A 1HAYB 3LGUA 3PRDA 2GCHF 5L2ZH 1O3EA 2AS9A 2DUCA 1K0HA 2WPKS 2ZFTA 4D9RA 1HAZB 4B2BA 1QFKH 1EB2A 3RU4T 2OK5A 1A5IA 1ZMNA 4DGJA 1ANBA 1TYNA 1C5LH 3GY8A 2J98A 2NU3E 2ZEBA 4BTUB 2C4FH 2HVXA 4H42U 3ZZ4A 6ESTA 1FIWA 2YOLA 4WXIA 1QQUA 1CE5A 2BX4A 2ZHQH 1ZMJA 1TMBH 1FUJA 2G55A 2ZCLP 4INHA 1K28D 3FAOA 6GCHG 2R0LA 2FTLE 2J94A 2FYQA 4O9VA 2TBSA 3RMLH 1T31A 3OEHD 3ENSB 5ABWA 3O8CA 3SGAE 1ZHRA 2VVVA 1C9TA 1Y3YA 5DP9A 1C1TA 2G4UA 1HXFH 2GKVE 2G8TA 1AI8H 1ETRH 1HIAB 2BY8X 2PTNA 3D65E 3GYMA 1C4V2 3ZVCA 4NZLA 1GBJA 4Y79A 1GI4A 3A8DA 4NA8A 3T2NA 2ZU4A 5FBIA 1QIXB 1NFWA 3CENA 1EOJA 3HGPA 2I6SA 1H8ED 1UMAH 2RA0A 4Q2KA 1XUJA 1LKBA 5DP6A 3TGJE 3ATLA 3LOXA 1H1BA 4Y71A 2R9PA 1TMTH 2OLGA 4ISIH 3DSPA 1Q31A 1P9UA 1AE5A 4HTCH 1O2XA 2EEKA 2ZGJA 1ELVA 3L33A 1RTKA 2FOHA 3GOVB 1G37A 3F2FA 1MZDA 1NC6A 1P2QA 1YLCA 5HM2A 3PLBA 4ASUD 4ISOA 3RXVA 3ATMA 1MTUA 4ACAA 2ANKH 1MTSA 2PWXA 2BYAX 2FOMB 1GMDG 2NU0E 4DW2U 4X8TH 1Z7KA 1AFEH 3OX7U 1RFNA 1TLDA 1PYTD 2XWBI 1JWTA 3OFND 4TSFD 1P11E 1DY8A 2BQ7B 1MCVA 3SV8A 5SGAE 3KQDA 1HLTH 3L3TA 1MU8B 2PSXA 3NRLA 2PKSC 1S82A 1GMCF 1EZXC 1T8NA 1IHSH 2TPIZ 1A2CH 4NIVA 1UTJA 1B0FA 4X2XA 2JKHA 1TQ0B 3Q76A 2W3IA 2RA3A 3ZZ8A 4RKOB 1VITG 1Z6JH 2ALVA 1SQTA 2Y5HA 1QA7A 4K1EA 1O3KA 4FVDA 2VH6A 1GWAA 1GJDB 5GIBA 2F9OA 2GZ7A 1GHBG 1HAPH 2W6ID 3BEIB 3SOSA 2ZWLH 1BRBE 1MABB 4ZH8A 1O3PB 1XUFA 2ZFRH 1O35A 2LNCA 3A81A 1K21H 2QIQA 3EQ0H 1P01A 1O2WA 2KX4A 1MUEB 1P06A 5L30H 2Y7XA 2IN2A 2EI7A 4X6NA 1K1OA 4XBBA 3C1KA 1V2ST 4X8SH 3RP2A 2QN5T 3LC3A 1LHCH 3UQVA 2Q6FA 4SGAE 1J8AA 2CV3A 4BAQB 2GMTB 4FUDA 1P2JA 1E0FD 2O8WA 1IQKA 1OX1A 2KCYA 4R0IA 3NZIA 1CSOE 2QA9E 4ABIA 3SJOA 2XC4A 2WV5A 1OP8A 3EE7A 1VCPA 4X2VA 4Y10E 1UTNA 1MZAA 2CHAB 2OQ5A 3B8JA 4JCNA 4MLFB 4IMZA 5ETXA 3TVJB 2BDAA 3SUFA 2OBQA 3Q00A 3RXDA 2F9PA 1O34A 1OYTH 3FZZA 3LGYA 2VGCB 6LPRA 1OHHD 3EDXB 3UNSA 4CBNA 3BTWE 4GHTA 1DT2A 1O5DH 2A45B 4UFGH 2B7DH 2JIZD 3LJOA 1MTWA 4AG2A 1DWBH 4NWKA 4ZHAA 1A0JA 1L4DA 3LGWA 5C0UA 1BTWA 3FO8D 4AYYB 2OP9A 3A80A 4NG9H 5IDKA 2A1DB 1HAXB 5C1YA 1HV7A 4DG4A 1G3BA 1LPKB 2SGFE 2XRCA 2ZTYA 3SU3A 3QWCH 4M7GA 2F9NA 3AAVA 4YXWD 3AAUA 4YTAA 1AU8A 1GJ4H 2Q6DA 2VIVA 1RIWB 1ZJKA 1HXEH 2F43B 1SGEE 3UUZA 1HAHH 2OBOA 1UHBA 3BG8A 1UTMA 4YO9A 3FANA 4B76A 1OPHB 2XCFA 4IW4E 3MNCA 5TCAA 2M5TA 2BLOA 2D1JA 3SU1A 1BBRK 1CBWC 5A0CA 2ZHWH 5EW1H 5DN6D 3MH4A 1GI1A 4UFFH 3D62A 1KY9A 3A7TA 2R0KA 1FY8E 4THNH 2G51A 2XWAA 3JZ2B 2OCVB 1F0UA 2ZHDA 4AC9A 3RXOA 4R8TB 3T5FH 3VB5A 1INCA 5T1VA 1Z1JA 1PPFE 3P8GA 2OTVA 1G30B 2PUXB 3HK3B 4AX9H 1W0YH 2FS8A 1EPTB 3MI4A 2WHXA 1C4U2 1GPZA 1L1NA 5EXNA 4UD9H 2F4LA 1TBZH 1GHAG 5EXMA 3SORA 4KGAA 1SLVB 1EUFA 2BTCE 2BZ6H 1GHVH 8ESTE 1BTUA 5A2MH 1RTFB 2TIOA 5DP8A 3SZNA 2B0FA 5FCKA 4RSPA 1SGYE 3G01A 4MG3A 1J17T 3RU4E 4HG6A 1GCTB 3F3BA 1ZMLA 4I8GA 2VWMA 1DUAA 2SGQE 4GSOA 3UOPA 5G4BA 1Y3VA 4FXGH 4OS7A 3BTKE 2FX6A 3SQEE 2HGTH 1LQDB 1ELEE 2G5VA 4K60A 2P8OB 3TJOA 3K2UA 3F9GA 1O2UA 1O5FH 1W7XH 1K1LA 4FUGA 2Z9GA 1S83A 2VJ1A 2LPRA 2H9TH 3S0NA 3I77A 3LH1A 4I33A 1GI0A 1GBLA 2A2XH 1O2ZA 1YPKH 3SN8A 4AG1A 2ZHEH 2VIOA 5DK1A 1VGCB 1NRPH 5PTPA 1UTOA 2XBXA 1EAUA 4ISLA 1S6LA 1V2LT 2Z9KA 5KECA 1FMGA 4K69A 1TB6H 1VCQA 4XE4A 1AKSB 1P3EA 1D3TB 2ASUB 3EBNA 3HPTB 3EGKH 2O9QA 3SU4A 1SC8U 4H6SB 1CQQA 4BOHA 5A8ZA 1UVTH 1CBWB 3GY6A 3CS0A 4DOQA 4KKDA 5KGOA 2ZDVH 3BG4B 2YNBA 4NWLA 1C1QA 1KSNA 1G3CA 4D9QA 5EQQA 1TGCA 2C8YB 2ZDAH 1RJXB 1DANH 3EA9A 4FUJA 2GT7A 1MD8A 4Q80A 3MNBA 2HLDD 3MFJA 1O3IA 1S81A 1SFQB 3ATIA 1OP0A 2XTTB 2FOEA 1C2DA 3STIA 4B6FA 1PQ8A 1H9IE 3MU1A 1YPJH 1IQNA 1HJAC 1YCPM 3S7KB 1ELBA 2BLWA 4HFPB 4AFQA 1C5NH 1EOLA 4AFZA 3VB7A 2V6NA 1SI5H 2BB4A 1S0QA 2ZI2H 1EZSC 4MTBA 2HOBA 3DHKH 1HIAA 4X1NU 3GICB 1AVXA 1J15A 3WW7A 3LGTA 1QHRB 3ELAH 4MQAA 4DVAU 5K7RA 1KXEA 4CRAA 2A7JA 1SGQE 4AYVB 2PV9B 4E7RG 1O5CB 2HNTE 1MD7A 1L0ZA 1RRKA 2OXSA 5JPMH 4ISNA 1TWXB 2D8WA 1C2IA 1GBTA 3KYGA 3A8BA 3BTDE 2O8LA 5K0HA 1HAGE 5E0GA 1NT1A 1ZZZA 1SKYE 2QF4A 2ZPQA 4GCHF 1TA2A 2STAE 5C0TA 1ZHPA 2WPDD 4WH6A 1TRMA 3SW2B 1MKXK 1MTVA 1GBDA 4KTUA 1NROH 1WU1A 3R0FA 1GDNA 5GDSH 1K1NA 1S5SA 2J38A 4Y8ZA 3OY6U 2BY7X 3M5LA 2EQNA 1V2KT 1TALA 1IQJA 1GI7B 5F8ZA 2CMYA 2XC0A 2J95A 3PROA 1NS3A 5T6FA 1AFQB 1ZPCA 1LO6A 5TCCA 3EA8A 3I29A 3M7UA 1SQRA 5DG6A 1CT0E 2HWLB 2HVYB 1ZSKA 3BEFB 2AMDA 4YOIA 1HGTH 3NXPA 5GJ4B 2ZU3A 3RXRA 1ARBA 4D8NA 3AVZA 1SLWB 1GHZA 1GJAB 1AUJA 2RG3A 1Z8GA 1ZTLA 2ESTE 5BPEA 3FP6E 1TAWA 2D2DA 5EQRA 2D26C 1Y59T 4FU9A 1O2KA 1C4Y2 1THSH 2H9EH 4CHAB 4MVNA 1NZQH 5HIYA 3FFGA 4CH8B 1L4ZA 3UR9A 2O8UA 3NPSA 5ESTE 3UB0A 1NU7B 3MMGA 1THRH 4JZ1A 1J14A 1DS2E 1G2MA 1NO9H 4JK6A 1T8OA 4X8UH 4X6MA 1GJCB 2BM2A 2I6QA 3DUXH 4ZHLU 3TIUA 1LVBA 1TX8A 1SGDE 3L6PA 1SGIB 4MNWA 3K9XB 3A8AA 3H5CB 2BVSH 4KTCA 1O3MA 5ESBA 4NSVA 2FO9A 5CHAB 3GCTF 3UNRA 1NU9A 2GVFA 4P02A 3M37A 1CGJE 3GCHB 3U1JB 4B2AA 2A5KA 1BJUA 1P2NA 2FM2A 4K3JA 4Y8XA 3QLPH 2WUBA 5LPRA 1BRAA 3WWFA 1ELAA 1PQAA 3E8LA 1WUNH 3P70B 2GJGA 4NGAH 1V2RT 2XBWA 4HGCA 2QAAA 2PFEA 5E0HA 1BHXB 4INLA 1DWCH 1S6FA 5T3HA 3ZZ3A 1DDJA 2F91A 1TX6A 2ANWA 4ZKSU 2PUQH 1N8OC 1XKBC 5DP4A 4FUCA 4ZAEA 1D3DB 2M2AA 2Z7FE 3ZVBA 1QA0A 4ESTE 4WMEA 4GVUA 1SFIA 2RFKC 1A7SA 2BD2A 1TONA 3SQHE 4OM9A 1TRNA 3MNXA 1O3HA 1V2NT 1ABJH 2P16A 3A86A 2LP6A 3E6PH 1UCYH 3BSQA 1JBUH 5TJXA 1ZGIA 3E16B 4A5TS 1XKAC 1VITH 4XOJA 1P02A 3KN2A 4OS5A 1GBCA 5FPSA 5F8TA 3T29A 1N6YA 3S7HB 1SHYA 3LPRA 2A32A 2ODQA 1BCUH 2XOKD 5AVDA 3QK1A 1BRUP 4X2WA 3B9FH 3BIUH 1AQ7A 5FXLA 1DFPA 1UTPA 2ODPA 2VINA 3KQ5A 4I31A 4YOJA 4K8YA 4QT8C 1HRTH 1E37B 1BUIA 2Q6GA 4JZFH 3UREA 3KNXA 1FONA 3SV9A 4OS4A 4D7FA 1OWKA 2AHME 1BTZA 1T8LA 1G32B 1O3BA 1ZPBA 1A46H 4P00A 1NTPA 2SGEE 2PGQB 2XBVA 3PV4A 1WQVH 2HALA 3MU5A 1XXDA 2WPMS 2UUFB 1XUGA 1C2MA 2AMPA 1A5HA 3HKJB 4YESB 3BTEE 1AIXH 2FEQH 1GG6B 1GGDC 4Q63A 4J1YA 4YT7H 3V7TA 5GWZA 3ZVFA 1QRXA 3P8NA 3GDVA 1PPHE 2HRVA 4OGYA 4TY6A 3TK6A 6GCHF 5DPAA 1ZR0A 1C5UA 1GL0E 1GBMA 1HJ8A 2XC5A 4U2WA 2KCPA 2Z6BD 1O5BB 2QXJA 1O2JA 1FY5A 3RXLA 1BBRE 1O2SA 1ABIH 1QB9A 1P57B 1EJNA 3O8RA 3JZ1B 3OYPA 1EPTA 1RD3B 1DPOA 4BTIB 1F92A 1GI3A 3MU4A 1GI8B 1JRTA 2FXRA 2ZIQH 3FP7E 3RC4A 1CA0C 3BF6H 1OWHA 1PQ5A 4ABGA 1IOEA 5KEDA 3H7OA 1ELFA 3M7QA 1D3PB 3SJKA 3SV2H 4WMDA 4F49A 1LPZB 2GGVB 1C5VA 1PPBH 2J34A 3SJ9A 1V2QT 1AGJA 2Z94A 3F9FA 2FTMA 1TNJA 1UVPA 5EXLA 1ZOMA 4B6EA 1QRZA 1QTFA 5HIZA 3MO3A 2GCTC 4FUFA 5E8EH 3IG6B 3A82A 4I8LA 2ZTZA 1WSSH 1O3AA 1LPGB 5EPNA 3VB6A 4X1QU 5FAHA 2CF8H 1EP5A 3QTVH 1C2EA 2FOAA 2J92A 3UWJH 3OE7D 3KYFA 1GMDF 2VVCA 5A0BA 2BD8A 4A1VA 1KLTA 2F3CE 5HXFA 1ETSH 1YCPH 1GI2A 2BD7A 4AGKA 1IQEA 9ESTA 1ESTA 1SB1H 4ABJA 3UAIC 3U69H 4TWYA 3LJJA 3LH3A 3C27B 1C1OA 2AERH 2BY6X 1UTLM 2BQWB 4D7GA 2V35A 1AKSA 4TPIZ 1N1LA 3HKIB 3P92A 1GJ6A 2A7CA 1O2QA 3MYWA 2QXIA 3PWBA 4NIXA 3V3MA 1FZZA 2ZDLA 5GCHG 5JBCS 4Y76A 4FVBA 1ZJDA 1HAIH 1TNLA 2FOCA 1V2OT 2THFB 3TLOA 1AMHA 1BMNH 3CS7A 1VITF 2JETC 4X8VH 2SGDE 1NBME 1CT2E 1DOJA 3UWIA 2B8OH 1T8MA 1XMNB 1B7XB 1GHBF 3RXIA 4XBDA 3M5NA 1P0SH 2VWNA 1FY3A 2VBCA 4CR5A 1W0ZU 1NRSH 1W13U 3S9BA 1AVGH 2NU2E 1DITH 5JBBS 2KAIA 2EI8A 4TT3D 1G3DA 1ZLRA 3LU9B 5IYTA 5JYIA 5EODA 1LMWB 4JZIA 2A31A 2O8MA 3E91A 2P95A 3UQOA 1QB6A 1YLNA 2B5TB 1V2JT 1XX9A 2PKAB 1ZTKA 3K65B 1XUIA 4X1RU 1MBQA 4BNRA 1D3QB 1FPCH 2ZECA 1ESAA 7GCHG 2WINI 3A7ZA 3BTHE 3A7YA 1GJ7B 1WAYB 1CO7E 2NU4E 1YP9A 4FUEA 5EIYA 1UK3A 3VGCC 4NSYA 4XD7D 1QL8A 1TIOA 1Z8IB 4ABAA 5DJ7A 1O2YA 2RDEA 1SGTA 1P3CA 1THPB 1B5GH 3PTNA 3MU8A 1GI5A 1L1GA 2OINA 2FI4E 2IOTA 1KLJH 3PLKA 4LK4A 6CHAC 3GY3A 1WYKA 1P03A 5FX5A 1F5KU 4IBLH 1LVYA 1JRSA 1ELDE 3GY2A 3T27A 3KEEA 1UW7A 1GBEA 3A87A 3EAJA 1G2LA 1O5AB 3MH5A 1GMHG 3E0NB 3RXTA 2FOFA 1C2LA 2R3YA 3AK5A 3KF2A 2DE8A 4Y7AA 1WOFA 2TGDA 4BAMB 3OSYA 4NFEA 2TRMA 1D6WA 1TBQH 1S0RA 2QYIA 2W6JD 1A3EH 1BDAA 2ZCKP 3RXGA 1VR1H 4K5ZA 1YM0A 5HMAA 1FLEE 4XFQA 1HPGA 1YYY1 3WWBA 4ZKNU 4RN6A 4Z1MD 2IPHA 1HYLA 3OAAD 3SU2A 2PKSB 3R3GB 2QXHA 3RM0H 3SNBA 1YPEH 1NN6A 4B74A 1H4WA 4UDWH 1WTGH 2UWPA 1K1IA 1UTQA 2P94A 3PMBB 1KXFA 1LHGH 1AUTC 1O2HA 1YBWA 2ZKSA 1OWDA 5AHGH 1A0HB 4NCYA 4VGCC 5AF9H 3N7OA 1KYNA 4J2YB 1H8DH 3DSOA 2XNDD 1VZQH 4DCDA 2FMJA 2QC2A 1K1PA 1AHTH 2V0BA 2V3HH 2BDCA 1GHAF 1TOMH 3SZEA 3W1EA 1HCGA 2OQUA 2VH0A 3M35A 5AFYH 1GHXH 2J4IA 1O3NA 5L6NH 3BTTE 3M61U 3FZDA 3MTYA 1E34B 2ZHFH 2K7XA 2QXGA 3NCLA 2P3FH 2ZF0H 4KTSA 1MAXA 2ZDMA 1OS8A 2H5DA 5IK2D 4K1TA 1CVWH 5E0JA 1V2UT 3AW0A 3NKKA 1SPJA 1F0RA 5HKKD 1C5SA 1IQIA 3TNTA 1GDQA 1FJSA 1IQGA 1SOZA 2XYAA 1XM1A 4I8HA 1YPMH 2QY0B 3T28A 1MTNC 5JB8S 1KTSB 2VB0A 1AVWA 3CP7A 3K6ZA 3NUMA 1W3CA 2GP9B 3RMNH 5BRRE 1W0KD 3PB1E 5DP5A 1HFDA 3SGBE 2BZAA 4DT7B 3NK8A 1LCYA 4ZMAH 5DP3A 4KELA 4GUXA 1UK4A 1TA6A 4M9FA 1DXPA 4OS6A 1RXPA 3A84A 3ZZBA 1O2IA 3N7EA 1Z8RA 4O03A 4B2CA 1H8IH 4Q7XA 2KR7A 3TH3H 4AB8A 1P2IA 1V2WT 3VXEH 2QCYA 3TK5A 1EQ9A 1TPPA 3FN8A 2VIDA 2WZQA 3TJUA 1MKWH 1HB0B 2ILNA 2XBYA 2Y5GA 3UOUA 1H9LB 1DWEH 1U6QA 1Y3WA 1FAKH 4D76A 1ANEA 4AZ2B 4RT0A 5F6MA 3F1SB 2BHGA 1IQHA 3KQEA 1AE8H 1Z1IA 4HZHA 3U1IB 3M3VA 1NFYA 7ESTE 2ALPA 1AD8H 2KCAA 2ZNKH 4E7NA 2KZ4A 1NRRH 4FETA 1K1MA 4XBCA 1FY1A 1GL1A 3O8DA 2XNIA 1P2OA 1EFRD 2TGPZ 1P05A 2UWLA 4XSKU 1E1QD 2ZC9H 3F68H 3P17H 4MPUA 4Q4LA 2FOGA 2CXVA 1ELCA 3RXFA 1IQFA 3RXQA 1O33A 2WV9A 2XXLA 1T4UH 3RXCA 3UY9A 1E38B 2FI3E 3ITIA 3DD2H 3MOCA 1C1SA 2ZFFH 2K1QA 1QCPA 3U28C 2BDHA 1DX5M 4Y8YA 5T6DA 1QBNA 1YF4A 2Y80A 1SG8B 3RDZA 1GVKB 3UPEA 2KAIB 1OWJA 3BTME 1C2JA 1L2EA 2WPJS 5C1XA
chains in the Genus database with same CATH topology
2RDLA 1C5RA 1ZSLA 3TJNA 2ZO3H 8GCHG 1ORFA 2FX4A 1QRWA 2CN0H 4ZKOU 2OC7A 1HBTH 5C3NA 1FIZA 4A92A 4DIHH 3D23A 2VWOA 3TPIZ 3ATWA 1P12E 3ZVDA 1YKTA 1Y3XA 2ZPSA 5HYOA 2HPPH 4K8BA 4X1PU 1BQYA 4NFFA 1Y3UA 2C3SA 4MPXA 2ZU5A 1NRQH 3RXMA 2BMGB 1FV9A 4NZQA 1BTPA 3A7WA 3BIVH 3ZYEA 1O0DH 3ZZ5A 1P9SA 1Y5AT 2AGEX 5HGGA 4E05H 3QZQA 4IC6A 1O37A 1PPCE 4ASHA 3KQBA 2TGAA 1VCWA 3ZV9A 1TX7A 2WV4A 3QZRA 4TY7A 3TJVA 1TNKA 5FHTA 3LIWA 4GPGA 2GD4B 4UEHH 1ZYOA 1YPLH 1GVLA 2EA3A 1XVMA 2STBE 1EX3A 4U01A 4JK5A 1O32A 1BTXA 1GVZA 1C1PA 1SGFA 5B6OA 2WYGA 1TGSZ 4U32A 4K1SA 1NESE 4I7YH 3S69A 2XCNA 5JB9S 4LZ4B 9LPRA 1FI8A 4Q7ZA 3U98H 3IWMA 4TWWA 1F5RA 4MNXA 1LTOA 4UONA 1OKXA 3M36A 4JZDH 4Y11E 2ZG0H 1UJ1A 1TBRH 4O3TA 2FZZA 2ZDKA 1ZRBA 3TU7H 4FU7A 1C2HA 4GLYA 1EZQA 4A7IB 3RMMH 2BDBA 3M5OA 1AZ8A 2QF0A 4IN2A 1DICA 2ULLA 3TH4H 1AN1E 1WTHD 4X2YA 1ZHMA 2UUYA 1MQ6A 1A3BH 2GZ8A 4WH8A 3PO1C 5JBAS 1HJAB 1UVSH 2ZPRA 2IJOB 1JOUB 1O5EH 1QL7A 1VJ9U 5E2PA 1WV7H 1TPAE 3KGPA 1FAXA 2PKAA 1P2MA 2TGTA 2BOKA 4H6TA 3QN7A 1BT7A 2V3OH 4A6LA 4BAOB 3I78A 3TK9A 1O3OA 1BTHH 1SQOA 5FPTA 3H7TA 3F9HA 1W8BH 3ODFA 1MCTA 1L1JA 1SQAA 5C67A 2OD3B 4WJG2 1DUEA 3PM3A 8KME2 2PR3A 2Z9JA 2BD3A 3KQCA 2ANMH 3LKWA 8LPRA 3TH2H 4AB9A 3A85A 1TE0A 1C9PA 1TABE 2G81E 1MU6B 2VU8E 3BTFE 5AFZH 2G5NA 1CHOG 1GBHA 1J16A 2EC9H 1QY6A 3ZVGA 2RCEA 2ZGCA 3HATH 4JYTA 3VB3A 1MQ5A 2BDIA 1CGHA 1O30A 2HLCA 1O39A 2O8TA 2AGIX 7LPRA 1O38A 1E35B 4UFEH 3RXAA 4BXSA 1PFXC 3LGIA 1YPHE 1Q2WA 1QJ6B 2Z3DA 2FPZA 1BB0B 3Q3KA 1B0EA 1GI9B 2FOBA 4ZXXH 1SGCA 1IHTH 3SUGA 2ZFSA 1P8VC 4A1XA 2W26A 1C5YB 3A7VA 1T32A 2VVUA 3MH6A 3SJIA 1C5WB 3RC6A 1FN6A 1S84A 2GX4A 3BEUA 3NWUA 2SGAA 2ANYA 2ZGHA 4F4OC 4CRDA 4FUIA 1G9IE 5J4QA 3ZZAA 2R2WU 3FVFB 3E90B 2FLRH 2ZA5A 3P95A 3A8CA 4UE7H 3SO3A 4CR9A 3SV6A 4B1TA 2BY9X 2ODYB 2HNTF 5C5NA 3ZV8A 4BTTB 3ZVEA 2BLQA 4LXBH 4CBOA 1EJMA 1XUHA 5JDUB 4ZHMU 1GJ9B 1XUKA 1C5PA 1QB1A 2G00A 1O3GA 1OXGA 2Y7ZA 4UFDH 1JIRA 3E3TA 4A1TA 5FPYA 4ABFA 3QUMP 3MO6A 3O8BA 1QNJA 4KP0A 1MMJN 2HNTC 2Y5FA 3OY5U 1GBAA 1O2OA 3U8RH 3QX5H 4CREA 2WUCA 4WF8A 3S9AA 3LDXH 2FDAA 2FESH 2GCHG 1EKBB 2AGGX 5HM9A 3A88A 1BBRH 1AB9C 4O3UA 1P04A 5LPFA 3DFJA 1W2KH 4Y0YE 4CRFA 1N8OB 2W5EA 1C1MA 4Y6DA 2GZ9A 1C1WH 3F6UH 2PSYA 2P59A 2ZDNA 3KHVA 4X0WU 4AFUA 2A4QA 1ZTJA 3TNSA 1WQSA 2F9VA 4AGJA 1GHWH 3GCNA 5H4IB 1ACBE 2ZU2A 1O2PA 2BLVA 1JIMA 2SGPE 4YM9A 1IAUA 1RGQA 2Q1JA 1HAVA 1EAIA 1GJ8B 2AMQA 2W7UA 2SNWA 3M3TA 1YLDA 1T7CA 3FP8E 1TGNA 2GTBA 3M7TA 3ZZ9A 3VB4A 2GMTC 4AN7A 1ETTH 2NWNA 5GCHF 1LKAA 1A61H 2ZGXH 3STJA 5FCRA 3URCA 1QL9A 1T4VH 4WY3A 1W12U 4CH2B 3ZZDA 1MAYA 3LC5A 5JBTA 1TRYA 1P09A 3AASA 1AZZA 1GGDB 1PYTC 1YGCH 2CHAC 5DGJA 4CRGA 5T6GA 2AIQA 2WPHS 1BIOA 5EPYA 4FU8A 5CMXH 1OWIA 3M3SA 4Z0KA 1PPGE 2Y81A 5F8XA 2GV7A 2VGCC 3UNQA 1EP6A 1ID5H 2PHBA 2PLXA 4BXWA 1ESBA 1GBIA 5EQSA 2OC8A 1DSTA 3UFAA 1Q3XA 3UTUH 2ZGBH 1RTLA 1OOKB 4JYVH 7GCHF 5GXPA 4ISHH 3OTJE 3ESTA 4B71A 3BTGE 3E0PB 1V2MT 3SHCH 1CA0B 2Z3CA 4BAHB 1JXPA 1AB9B 2A2QH 3RMOH 2Y82A 2SFAA 4YOGA 4I32A 1EJAA 1RIWC 1SLXB 1DWDH 3P6ZB 1NPMA 3PYHA 2EI6A 3RXBA 4ZROA 1RS0A 3BTQE 1YPHC 5DO4H 1V6DA 1GMCG 2AYWA 1FPHH 1KDQA 2GCTB 1LVOA 1QBOA 4PROA 1JMOH 2W3KA 1GMHF 1GDUA 1PPEE 3QTOH 4CRCA 1LHDH 3MH7A 1C1NA 1O3CA 2BXUH 3W95A 1BITA 1QR3E 1UCYK 2PGBB 4Z6AH 3GDUA 3TITA 1O3FA 5FX6A 2ZQ1A 4ZKRU 5EOKA 3DA9B 1NFXA 2VNTA 3VXFH 1EPTC 1MBMA 2JH6D 1Z8JB 5A8XA 2ZFQH 1PJPA 3DT0H 3ODDA 4LOYH 1ELTA 3V13A 2CF9H 3PMJA 4BANB 1Y8TA 3Q3YA 4RKJB 1DVAH 4GAWA 2QGRA 2JH5D 1K9OE 3SHAH 1A1RA 1GI6A 4OS1A 3V0XA 1QGFA 3ZVAA 5A0AE 1IQMA 1GCTC 5LPEA 2ZZUH 1KIGH 1MKXH 1QJ1B 2H5CA 2LIZA 3GY4A 4YT6H 1O2NA 4MNYA 2JETB 1SGRE 2ZCHP 3PWCA 1K2I1 3SUDA 2F83A 1C2GA 1CT4E 4E06H 2BX3A 1W7GH 2P8OC 3HGNA 3MHWU 1A5GH 1Y5UT 1YPGH 3TGIE 4DURA 1QBVH 2BD5A 4X6PA 4XDEA 1UVUH 1DLEA 4YLUA 3SJ8A 4WXVA 1WBGB 2JH0D 5C1UA 4K2YA 4B73A 1VGCC 4ABEA 4YLQH 3Q77A 1TPSA 5L2YH 2BD4A 1NFUA 1GHYH 1BMLA 3T62A 1C1RA 2AEIH 4JYUH 5CE1A 2QV1A 3DFLA 3RLYH 1V2PT 1C5MD 1CA8B 3B23B 4ABBA 1H9HE 1SBWA 3SNAA 4MPWA 3VGCB 2A5IA 3SBKA 1V2VT 3BG4C 1P2KA 5EW2H 4IC5A 4ZXYH 3IITA 2BQ6B 3EA7A 4IN1A 4WVPE 1KXCA 4X6OA 4CRBA 2C8XB 1TGTA 2G52A 3T25A 6CHAB 2GT8A 1C1VH 1S6HA 5F03A 4INKA 3S9CA 1F2SE 4JZEH 2BY5X 3U8TH 3VFEA 1DY9A 4OGXA 3HK6B 2ZU1A 2FI5E 4I8JA 1KXAA 4NIYA 2J9NA 1EZUC 4ABDA 4DJZB 5A8YA 3K6YA 1KXDA 3LT3A 4B75A 3F9EA 2P3TB 3T26A 1D4PB 1F7ZA 2CJIA 1YCPK 4MNVA 2BVRH 1HAVB 1O2LA 2PW8H 1HAOH 3UR6A 2A5AA 4NA7A 1C5XB 3GY5A 5DP7A 1O2TA 2DE9A 1WCZA 1GBFA 1FY4A 2ZP0H 4BAKB 2H9HA 3RC5A 2Z3EA 4O97A 3VPKA 1OSSA 2BVXH 3RXJA 1C5TA 7KMEH 3BN9A 3QGJA 1HUTH 1AO5A 1BMMH 1CGIE 1KTTB 1NRNH 1F5LA 1LDTT 2B9LA 1BA8B 2H6MA 2BXTH 1XVOA 1FN8A 3QO6A 2FLBH 3LONA 1FNIA 3ZYDA 2OC0A 2WPLS 3MNSA 4VGCB 3QGNB 5LH8A 1AFQC 5C2ZA 2VIPA 3SI3H 1TNIA 1BRCE 4Q7YA 2YNAA 1LHEH 3ATKA 2A7HA 2G4TA 8GCHF 4Y7BA 3W94A 1ZSJA 1TNHA 3E1XB 3RM2H 2AIPA 4WMFA 3SU5A 2GDDA 3GDSA 1AY6H 3RXHA 2FP7B 2OUAA 3BV9B 2A4OA 1C2FA 2BOHB 1K22H 4SGBE 1SGNE 3PMAB 4CHAC 2ZQ2A 2F9BH 1LHFH 5EG4A 5GPIB 3ZZ7A 2ZTXA 1TQ7B 1MTNB 3GY7A 3M5MA 1Z6EA 1TOCB 2H2ZA 1O2VA 1SR5C 3RLWH 1QQ4A 5E2OA 5J4SA 1HDTH 3RXPA 2PTCE 2A4GA 1KDQB 3WY8A 1FDPA 1EXFA 3D49H 1BHXF 3A7XA 1D9IA 1BOQA 1UO6A 1M9UA 1O36A 2J2UA 3KL6A 1C5ZB 3PMHB 1HNEE 3AW1A 5CHAC 1N6XA 1AWFH 3QDZB 3ZZCA 1HJ9A 1VJAU 3GCHC 1SSXA 1A4WH 1GBKA 1OYQA 3GYLB 1CHGA 4NIWA 1BZXE 2H1UA 5A09A 1O2MA 1ZPZA 2FWWA 1OP2A 2UUJB 2F9UA 1V3XA 2C8WB 1SL3A 2Y6TA 1O3LA 5I25A 1D6RA 1FQ3A 1S85A 4DIIH 1V2TT 1A0LA 1GJBB 1W10U 4FUHA 1SVPA 4LZ1H 3RUOA 3RXKA 1SHHB 4IMQA 1E36B 4Y0ZE 2WYJA 4OS2A 1PPZA 5C5OA 2C93B 1GCDA 1KLIH 1O5GH 3SUEA 1EB1H 1X7AC 1DM4B 1ELGA 2C8ZB 1LQEA 5EGMA 1K1JA 4GCHG 2Z9LA 1C2KA 3RXEA 1UK2A 3A83A 2R3UA 4I8KA 4TPYA 3GCOA 4AOQA 3SNEA 1DLKB 4GHQA 1Y5BT 3SI4H 1EASA 1F0SA 5EU8A 1ANCA 1J9CH 2P3UB 1ANDA 5FBEA 3SGQE 1DSUA 3EE0B 3PLPA 3URDA 2R2MB 1O31A 1DE7H 2BDYA 1O2RA 2P93A 2AH4X 2Z9IA 2HPQH 3KIDU 2C90B 2UUKB 1SMFE 1G3EA 1MH0A 2CGAA 1UHBB 4IGDA 1GG6C 2VIWA 4DY7B 1CHOF 2AFQB 4ABHA 1EATA 4TYDA 4IS5A 3SV7A 1PQ7A 2VWLA 3GISB 1SLUB 3RXSA 2NU1E 4JMYA 2GDEH 3RU4D 4AFSA 4NA9H 1TFXA 3SU0A 1O3DA 1ZRKA 1IQLA 4MDSA 1EAXA 4HI3A 2FS9A 3RXUA 3EYDA 2WPIS 1C1UH 4X1SU 2W7SA 3UIRA 3ZZ6A 3GCTG 2XW9A 1BTYA 1UCYE 1G36A 1UVOA 2ZFPH 3LGVA 3A89A 2BD9A 3MU0A 3SNCA 4FUBA 1AWHB 2A4RA 4AORA 1GJ5H 1C5OH 2GV6A 1O3JA 5C20A 3Q3XA 3U9AH 2FIRH 2OC1A 1GBBA 1TPOA 2A0QB 4U30A 1ARCA 1SOTA 1NM6A 1XXFA 1MKWK 3P8OA 1TNGA 3U8OH 1ZGVA 3PTBA 4MPVA 3SU6A 4ZUHA 2UWOA 1KXBA 4H4FA 3SNDA 1BJVA 2FYRA 5DKMA 1BMAA 3TGKE 3VEQB 3KCGH 1YC0A 1LVMA 1TGBA 4WWYA 1Z71A 2SNVA 2FODA 1C5QA 1CU1A 1QJ7B 2BDGA 1SGPE 5I46H 3P8FA 3V12A 1O2GH 2VIQA 1FXYA 1EAWA 1W14U 3OU0A 3PO1B 1DXWA 5LGOA 1QURH 1OWEA 1UTKA 2QF3A 3MO9A 1NY22 1SGFG 1F0TA 1W11U 3MWIU 1TMUH 4YZUA 1P10A 1HAYB 3LGUA 2GCHF 5L2ZH 1O3EA 2AS9A 2DUCA 2WPKS 2ZFTA 4D9RA 1HAZB 4B2BA 1QFKH 1EB2A 3RU4T 1A5IA 1ZMNA 4DGJA 1ANBA 1TYNA 1C5LH 3GY8A 2NU3E 2ZEBA 4BTUB 2C4FH 2HVXA 4H42U 3ZZ4A 6ESTA 1FIWA 2YOLA 4WXIA 1QQUA 1CE5A 2BX4A 2ZHQH 1ZMJA 1TMBH 1FUJA 2G55A 2ZCLP 4INHA 1K28D 3FAOA 6GCHG 2R0LA 2FTLE 2J94A 2FYQA 4O9VA 2TBSA 3RMLH 1T31A 3ENSB 5ABWA 3O8CA 3SGAE 1ZHRA 2VVVA 1C9TA 1Y3YA 5DP9A 1C1TA 2G4UA 2GKVE 1HXFH 2G8TA 1AI8H 1ETRH 1HIAB 2BY8X 2PTNA 3D65E 3GYMA 1C4V2 3ZVCA 4NZLA 1GBJA 4Y79A 1GI4A 3A8DA 4NA8A 3T2NA 2ZU4A 5FBIA 1QIXB 1NFWA 3CENA 1EOJA 3HGPA 2I6SA 2RA0A 1UMAH 4Q2KA 1XUJA 1LKBA 5DP6A 3TGJE 3ATLA 3LOXA 1H1BA 4Y71A 2R9PA 1TMTH 2OLGA 4ISIH 1Q31A 1P9UA 1AE5A 4HTCH 1O2XA 2EEKA 2ZGJA 1ELVA 3L33A 1RTKA 2FOHA 3GOVB 1G37A 1MZDA 1NC6A 1P2QA 1YLCA 5HM2A 3PLBA 4ISOA 3RXVA 3ATMA 1MTUA 2ANKH 1MTSA 2PWXA 2BYAX 2FOMB 1GMDG 2NU0E 4DW2U 4X8TH 1Z7KA 1AFEH 3OX7U 1RFNA 1TLDA 1PYTD 2XWBI 1JWTA 1P11E 1DY8A 2BQ7B 1MCVA 3SV8A 5SGAE 3KQDA 1HLTH 3L3TA 1MU8B 2PSXA 2PKSC 1S82A 1GMCF 1EZXC 1T8NA 1IHSH 2TPIZ 1A2CH 4NIVA 1UTJA 1B0FA 4X2XA 2JKHA 1TQ0B 3Q76A 2W3IA 2RA3A 3ZZ8A 4RKOB 1VITG 1Z6JH 2ALVA 1SQTA