3EA9A

Crystal structure of sars-cov main protease quadruple mutant stif/a with one molecule in one asymmetric unit
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
301
structure length
301
Chain Sequence
SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNPNYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGAAALEDEATPFDVVRQCS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords 3C-like proteinase
publication title crystal structure of SARS-CoV Mpro quadruple mutant
rcsb
source organism Sars coronavirus
total genus 81
structure length 301
sequence length 301
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2008-08-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 3ea9A03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ea9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 3ea9A02
1ELAA 4KTUA 1IQJA 2SGFE 2C90B 1VJAU 3IG6B 5G4BA 2SGDE 3TH3H 2GTBA 1D3QB 3ZV8A 2VH6A 1C1TA 1MD7A 4ABFA 3RXDA 5HM9A 3KN2A 4K1EA 1GI7B 4XFQA 1HGTH 2FX4A 3EBNA 1G2LA 2ZHEH 4OS4A 2C8ZB 3M61U 4IBLH 2QXGA 4I7YH 4LZ1H 5LGOA 1P10A 4GUXA 5C67A 1V2RT 3F9FA 2D8WA 1VITG 2BX3A 3PM3A 4FUFA 2F9UA 3PO1C 5L30H 3TJUA 1GI8B 4M7GA 1K1LA 4I8LA 1ELVA 3UREA 2O8WA 1HFDA 4TY7A 1MTNC 1QRZA 1Y5BT 1A0JA 2BDHA 4ZH8A 2FX6A 1DICA 4X6NA 1GMCG 2O8TA 1P2QA 1QCPA 2PUXB 4J2YB 1AVXA 1S5SA 1O2JA 3S9AA 1RIWB 3FP7E 1P2KA 2A0QB 4CH8B 3UFAA 7GCHG 1D6WA 3BN9A 4Z6AH 4ZKRU 1O37A 3I78A 3UR6A 2JH0D 1ANBA 9LPRA 2FODA 1DDJA 1TNLA 2OC0A 5TJXA 2G52A 4U30A 1WCZA 4A5TS 1FAXA 2A5IA 4RKOB 1AVGH 1BTZA 2ODYB 1QRXA 3NK8A 3RXBA 4Y6DA 4ZXXH 1ZYOA 2H1UA 1H8DH 3UPEA 1FIWA 2B5TB 1KLJH 3OY5U 2HNTF 1A46H 2J95A 3AASA 1E38B 3UR9A 1T32A 5HMAA 3A7TA 4Y7BA 3LDXH 5T6GA 2BX4A 1MZDA 2GZ8A 1NU7B 2AS9A 1ESTA 1O2VA 2FIRH 4AFUA 1L0ZA 1SGNE 3KEEA 1J9CH 1CT4E 1C5UA 1BBRH 2B8OH 2FOHA 2K7XA 1MKXH 1K1NA 3GCHC 2A4RA 2P93A 1TBZH 3MH5A 1MKWK 3NWUA 2ANKH 1QY6A 1WTGH 1O32A 4F4OC 1HAIH 1FNIA 2SGAA 1MBQA 2FPZA 1O2KA 2R3YA 1QFKH 8KME2 3E16B 4MPXA 1W0ZU 1MAYA 1N8OC 5F8XA 3PMJA 3A86A 4DCDA 4FUDA 3H7TA 1DVAH 3MMGA 3GCOA 1HJ9A 2V3HH 3P6ZB 1UJ1A 3S9CA 1P2NA 5GPIB 1OWDA 1QHRB 1MH0A 1O0DH 2G8TA 2FTLE 1B0EA 7LPRA 2J38A 4Q7YA 3KIDU 5A2MH 2FLBH 5FCRA 1BRUP 4A1VA 4R8TB 4PROA 3UTUH 3GY6A 5LH8A 3KQCA 3SNAA 2BDAA 1TX7A 1DPOA 3Q00A 2V6NA 3A82A 4K8BA 1GHBF 1ELFA 1JWTA 4MNYA 1F0TA 1AO5A 2P8OB 5T3HA 1XVMA 5T6FA 2A7CA 2G5NA 1FY4A 3SJKA 3SUDA 2Y80A 2ZNKH 1LHGH 1O3KA 2BTCE 3MU5A 2Y82A 2VJ1A 2R2MB 3M7UA 3VB5A 5AHGH 3SQHE 1J17T 4AX9H 3MOCA 1EX3A 2VVCA 4X2WA 3NPSA 3LONA 1MZAA 5FX5A 1HJ8A 1O3HA 2JETB 2C4FH 4FXGH 1CA0B 1ETRH 4JYUH 5K0HA 4YLUA 1BTUA 1YPHE 3MNCA 5HXFA 1W10U 1QBNA 2XC4A 3UIRA 1O5CB 2QC2A 3SNBA 1XKAC 2BDYA 1GHVH 1O5EH 2AMPA 5EPYA 2OUAA 3LC5A 4FUHA 1ZZZA 1V3XA 1ABIH 3ENSB 1O5GH 3LGTA 1XUIA 1TRNA 1SMFE 1O5BB 2ZIQH 1AUTC 4Y8XA 4UFDH 1LQEA 1O2XA 6LPRA 1C1PA 1A4WH 5A8XA 3PTBA 5TCCA 1O3LA 1SBWA 5LPFA 1V2WT 2ZHDA 2I6QA 5GCHG 1C1VH 3NKKA 1AQ7A 4IW4E 3QZQA 2FOMB 5C1XA 2ZPQA 1ARBA 1AFQC 1OXGA 2VGCC 1AIXH 4BTTB 1GHZA 4D9RA 2H9TH 2Y5GA 1XMNB 3BTFE 3TGJE 3OYPA 3UNQA 1P11E 5DJ7A 1PQ8A 1ZJDA 1Z71A 3DD2H 2OC7A 1GHXH 4DIIH 3RXAA 5DP8A 1F5KU 1MBMA 3IITA 4ZHLU 1YPHC 2GP9B 3E8LA 3VXEH 1O2OA 3RMOH 1V2NT 5T6DA 1SC8U 3E6PH 3TITA 2BZ6H 2FOAA 3HGNA 3HKJB 4FVDA 1LPKB 1Z7KA 5EQQA 1GDUA 2XW9A 2A5AA 2H5DA 1T4UH 2WUCA 1GJBB 2M5TA 5JDUB 3FZDA 1G9IE 1Q3XA 2PW8H 1GG6C 3MNSA 1HBTH 4NA7A 4NFEA 1ZPZA 3UOPA 1LPGB 1CGHA 2HWLB 4B73A 1C5OH 1EAWA 1O2ZA 1LKBA 4GHQA 1GCTB 3TU7H 1IQLA 1MUEB 4HFPB 3TK6A 2TGDA 4NIVA 1KIGH 1O2UA 1V2ST 4MTBA 4YOIA 1G3CA 1ZHRA 4WXIA 4WMEA 1QA7A 2Q1JA 2PKSC 1KTTB 2NU0E 8LPRA 3E1XB 1AN1E 2VWMA 1HJAB 1GBLA 3ZVFA 2ODQA 3ZZ7A 1C1OA 5HGGA 2OLGA 1CHGA 1O3PB 3EGKH 3RXLA 2R0KA 1JIRA 2ZZUH 3BTDE 1J15A 3QTVH 3AW0A 2J34A 4Y10E 1TBRH 3Q3XA 3M36A 4YZUA 1C1QA 3UQVA 4AYYB 2AERH 2DUCA 3FVFB 1HAXB 1FY8E 2G81E 2CV3A 2GT8A 4CRFA 2BXTH 1DANH 2ZFSA 2Y5FA 1Y5UT 1V2LT 3SU5A 1K9OE 3DA9B 1UTQA 6CHAB 2ZGHA 1GI5A 1GI9B 2HNTE 3LKWA 1A5GH 1FN8A 2WPLS 1D3TB 5DP4A 2BY7X 3SV6A 3U1IB 2XBXA 1C2FA 3ZZAA 1GI4A 1SGDE 1L1JA 4BXSA 2OBQA 2BY5X 6GCHG 4IMZA 3O8CA 2BZAA 1Z6JH 4CHAB 1PQ7A 3Q3KA 2Y81A 5E0GA 1EKBB 2VIOA 2Y5HA 2UWPA 2PSXA 1P05A 1DE7H 1L2EA 3MU1A 4JZFH 1P03A 2VIVA 3F68H 3ZZCA 4Y79A 1HB0B 3NXPA 1DWEH 1KLTA 2BDCA 3ODDA 3HK3B 4ISHH 2WINI 3U1JB 1C2MA 2UUJB 7KMEH 2FESH 2CHAB 2F3CE 2F91A 1TB6H 1ZOMA 2HVXA 2P94A 3AVZA 2K1QA 2ZFPH 1BBRE 2ZI2H 2OXSA 5BRRE 4BXWA 3AAVA 1IOEA 2XRCA 1O3EA 1C5NH 2VIQA 4GSOA 2QXHA 1G3DA 2R2WU 2ZTXA 1BRCE 1GBCA 4FUIA 1WTHD 2W7UA 5C1UA 2BB4A 1ESBA 2SGEE 4X8VH 3D65E 5LPRA 3H7OA 4ZHAA 3V12A 2XCNA 3RMLH 5A0CA 1AB9B 1QL8A 1AZ8A 1DXWA 3RM0H 1AWHB 2WUBA 3LGVA 4Y8YA 3BG8A 1D4PB 3ZZDA 1YP9A 2BY8X 1AE5A 1HRTH 3RLYH 1P2IA 4B75A 4D8NA 1MKWH 1NY22 1C1SA 5JB9S 1GL0E 1K22H 2ZDMA 4IN2A 2VIDA 1BRAA 1S84A 1UTLM 2ZCKP 1GJDB 2LPRA 4FUBA 1YF4A 1KXBA 3BEUA 4U32A 3RM2H 2ZA5A 1XXFA 1T8OA 4GPGA 3T26A 4CBNA 1TRYA 1A7SA 1QJ1B 3FFGA 4ZUHA 1LVOA 1WAYB 1C2LA 4NZLA 3EA8A 4WJG2 1OSSA 1EB2A 2BMGB 2FXRA 3RXQA 3V0XA 1FUJA 3T25A 1C2EA 4WWYA 3TH4H 3QLPH 4MLFB 1C2GA 3MO9A 1V2MT 2C8XB 1VGCC 3M5OA 1GI0A 5EGMA 1CU1A 2PGBB 1G3EA 4FUEA 2QY0B 1CT0E 4XSKU 3D49H 5FCKA 4F49A 1G32B 1Q2WA 2GZ9A 3L6PA 2ZCHP 1PPGE 1AFEH 1QJ7B 4ABEA 1RGQA 1RRKA 8GCHG 1HAPH 3QUMP 3SUGA 3V3MA 4B1TA 4ABGA 4DGJA 1TAWA 1ZPCA 1TALA 2CN0H 3BIVH 2PUQH 2PKAB 5FBEA 3BTHE 4IS5A 3EDXB 1EZXC 4ABJA 3ZZ8A 4I8KA 1GHAF 1KY9A 1QB9A 4FUGA 2WPKS 1A2CH 2PKAA 3RMNH 1TPPA 2V35A 4H6TA 1MQ5A 1CSOE 4MQAA 1YM0A 4YT6H 2FI5E 2FYQA 1WQVH 2BD5A 1B7XB 2QV1A 5EXMA 3SU6A 2FOCA 3PMAB 1FV9A 1V2PT 1EAUA 3UUZA 1KXEA 1T8LA 4AFSA 3MNXA 1RIWC 1AMHA 1GDQA 1KLIH 3P95A 1DOJA 4I8GA 3LIWA 3O8DA 4RSPA 2CGAA 3PROA 1K1JA 3RXIA 3TK5A 3BF6H 2SFAA 2UWLA 3BTQE 3SGQE 4A1XA 4E7RG 3A7XA 1OWHA 2ANYA 3LH3A 1IQNA 4IC5A 3MU0A 1NC6A 3TH2H 1BMAA 4UEHH 3MI4A 1SQAA 2OD3B 2EA3A 1WV7H 1DLEA 2GV6A 3IWMA 3U8TH 4YESB 1OYQA 1SOTA 2KAIB 5A8ZA 2AIPA 2XC5A 2OQ5A 5CHAB 2FS9A 1FAKH 1C5XB 4AZ2B 1EB1H 2JH6D 4IC6A 2PHBA 1S82A 3BSQA 1OWKA 2GZ7A 4TYDA 4B2BA 1AHTH 1E36B 2KAIA 3FP6E 4H4FA 1O2WA 4ABHA 1TNHA 3SV2H 1BT7A 1AVWA 1QTFA 4FVBA 1SQTA 4ZKSU 2OQUA 5JBAS 3ZV9A 1DWDH 4TWYA 1ESAA 5DP6A 5J4QA 1YPEH 1SGIB 1JIMA 1O2PA 4AG2A 1P8VC 4NIXA 1G36A 4BAMB 1K21H 3FP8E 1NFXA 1SGTA 1J14A 1EXFA 1E0FD 1O3JA 2O8UA 2VINA 4AB9A 3G01A 2Z3CA 1GBEA 2ODPA 2FOGA 3BTKE 2ZU2A 2ZU5A 2O9QA 5IYTA 1IQIA 4O3UA 4D76A 1G2MA 1UTOA 1XVOA 1C5TA 2J4IA 1NO9H 4CRDA 1RD3B 1GBHA 3GICB 3UY9A 2AMQA 5AFYH 1W14U 1VCPA 3B8JA 3TVJB 4GVUA 2F9OA 1SFIA 1RTLA 4WH8A 1SGFG 5I25A 1BZXE 1PPEE 1SLVB 2BY9X 3RXRA 1SSXA 3EQ0H 2XCFA 3RXFA 1K1PA 4FUCA 3SJIA 5A8YA 1TNJA 2XC0A 1UO6A 1N6XA 1DSTA 3SU4A 1T8NA 3RXVA 4X2XA 4Z0KA 3RLWH 1ANCA 1K1MA 1RXPA 3GDSA 5PTPA 1F0RA 1E35B 1F92A 2GCTB 4AYVB 5DO4H 1S81A 3RMMH 1GL1A 4SGBE 2IJOB 1O3GA 2P8OC 4ISLA 3GY3A 5BPEA 1BTXA 1TLDA 2YNBA 1YCPK 2FYRA 2VWLA 1QB6A 3ZVDA 4YM9A 1K1OA 2QGRA 5H4IB 1HAOH 4NSVA 1GPZA 4XBCA 2G55A 2BOKA 2TPIZ 2ZO3H 4JK5A 2JETC 5EW2H 1ELCA 2GDEH 4HGCA 1FMGA 3KQDA 2WPIS 3ODFA 1CA0C 1O2SA 2PFEA 1P12E 2FEQH 1UCYK 2CMYA 1YGCH 3QO6A 2QA9E 1S0QA 1SB1H 1MD8A 1DWBH 5C5NA 3EYDA 4DOQA 2XTTB 3MNBA 3TPIZ 4HZHA 3LJJA 5FXLA 1LQDB 3LGUA 1BA8B 2AEIH 2HRVA 1EJMA 1OYTH 4OGYA 4X2VA 3VB6A 5FPYA 4K5ZA 3K2UA 2ZDVH 4NFFA 3RXSA 1TX8A 2H9EH 1WU1A 1TNKA 3SU2A 3EAJA 1ELTA 2F9VA 1AD8H 1C5WB 2VVUA 4AORA 1GHWH 2TGAA 3ZVGA 2WYJA 3HK6B 5F8ZA 5F8TA 2PR3A 1RTKA 1BIOA 1LO6A 3UWJH 4AOQA 1NRPH 3U8OH 4GCHF 4D9QA 1SGYE 1NROH 5B6OA 1FZZA 3EA7A 4K1SA 4YO9A 1NT1A 5C1YA 1O2LA 4GLYA 1TGBA 2XBWA 9ESTA 1C1NA 1Y5AT 1Z8GA 2CXVA 1O33A 5I46H 2ALVA 2BDGA 5EXLA 3VB4A 1G30B 3FANA 1V2KT 4X6OA 2W26A 1HAYB 2IOTA 2P95A 3SI4H 4K69A 4DG4A 5E0JA 4AGJA 2STBE 1Y3WA 3PMBB 2G4TA 1F0SA 2ZGBH 3U69H 1C9TA 1MQ6A 1MTUA 2F9PA 4ISNA 1TOMH 1Y3XA 2GT7A 3ZYDA 4X6PA 1RTFB 1T8MA 2HPQH 1TPOA 1GCTC 2BVXH 2ULLA 3QX5H 4X6MA 5DP7A 4I31A 1UK4A 1QNJA 1TMUH 2GGVB 2YOLA 1WUNH 2AH4X 3ZZ3A 1ZR0A 2GMTB 1GI2A 1DSUA 3SU3A 4XDEA 1O3NA 1O38A 3GY8A 1TA2A 1CHOF 2BY6X 1HJAC 2NU2E 3A7VA 3FZZA 1SPJA 4VGCB 1AI8H 3SV9A 2ZGXH 1CT2E 2BLVA 5L2ZH 2FWWA 5A0BA 1A5IA 1EQ9A 1ZPBA 3W94A 5E8EH 1VCWA 3A81A 1EZQA 3UWIA 4X1RU 1IQEA 2ZTZA 1GVZA 4JK6A 1TIOA 4OS6A 3SJOA 4WF8A 1X7AC 2B7DH 4ASHA 2BQWB 3SZNA 2AGEX 3GY4A 3ZVEA 1Q31A 4CBOA 1UTJA 3TNTA 4MPVA 1C4U2 2VU8E 1HAGE 2FOFA 3S0NA 1BMNH 2CJIA 4K1TA 1Y3VA 2AIQA 6CHAC 2A5KA 1FPCH 2VIPA 4A7IB 2J2UA 3OTJE 1GJ9B 1FY5A 1O2TA 3A88A 1XUHA 2ZKSA 2ZDAH 3T27A 4H6SB 4KTCA 5DP9A 5SGAE 1LCYA 3MH7A 2ZPSA 5FHTA 1GJ4H 2XXLA 4UONA 1NU9A 5F03A 2I6SA 5EPNA 3Q76A 1XKBC 1BTYA 1SGCA 1FONA 2G5VA 1TNGA 3MH4A 2R3UA 2FM2A 2C8WB 3ITIA 4D7GA 4ABDA 2AMDA 2ZWLH 5TCAA 1OX1A 1XUJA 3SGBE 3E90B 1XUKA 5K7RA 3F9EA 1RS0A 3MU8A 3S7HB 4QT8C 4X8SH 1JRTA 1GHBG 4KGAA 1FPHH 3A7YA 1ZSLA 4ABBA 2CHAC 3BTWE 5FAHA 2J94A 4IN1A 3P8GA 1AWFH 4RN6A 1O3IA 1NRSH 3RXTA 2HGTH 3DUXH 1UHBB 4XBBA 3A89A 3RC5A 1C4Y2 1DXPA 2XWAA 1GVLA 4GAWA 2VB0A 1DY8A 1AE8H 1UHBA 4DY7B 1P3CA 1AB9C 4Y71A 4ESTE 1BDAA 5CMXH 1O3CA 4JZIA 2ZG0H 5DP3A 1ZHMA 1BMLA 1ZMLA 2XWBI 3LGIA 3S9BA 4FU8A 1GDNA 2UUYA 5GDSH 4WXVA 1CGJE 2JKHA 2AGGX 4Q7XA 4TPIZ 1UK2A 1P04A 1SG8B 2VIWA 1YLDA 1BTWA 2THFB 3Q77A 4ZAEA 3RUOA 1C5LH 2PTCE 1W7XH 1W12U 5L2YH 4UFGH 4NWKA 5ETXA 1MKXK 3HATH 1O2GH 2WV4A 1HPGA 2SGPE 5EG4A 3GCTF 2PWXA 3AW1A 3SV8A 2NU3E 2Z9IA 2WV5A 1NM6A 4YT7H 1TMBH 4E06H 1LDTT 1TPAE 1GJCB 1LVMA 3ZZBA 1OP0A 4MVNA 4OGXA 4KKDA 1AGJA 3LPRA 4K60A 5DKMA 4RKJB 4INKA 2D26C 1C2DA 4ABIA 1ZTKA 2TGTA 1TQ0B 1NN6A 4Q7ZA 2WYGA 1NRQH 3GDUA 1O5AB 1PFXC 1VJ9U 1P02A 3KQBA 4I8JA 1AU8A 3RXUA 1SFQB 3PYHA 1ZJKA 2HNTC 3PV4A 1TGTA 3C27B 4TPYA 3V13A 1P9SA 1V6DA 1GI1A 1MMJN 2P3UB 3LC3A 1E34B 4ABAA 2GD4B 2A45B 1PQAA 1SVPA 1DFPA 3BTME 1ELDE 3ZZ4A 1UTKA 1H8IH 1TNIA 2BD3A 4X8UH 4A1TA 1IQGA 1NRRH 2EI7A 1ZLRA 1QA0A 1O31A 1GBTA 3I77A 3RXEA 3BTTE 1SGEE 4JZEH 2WPHS 1UCYH 3BEIB 3O8BA 3M3VA 2W3IA 2GX4A 3P8OA 2ZFFH 1L1NA 1OWJA 3ATLA 1JXPA 3DHKH 4IGDA 2NWNA 5LPEA 4NIYA 3URDA 4B71A 1QIXB 3MYWA 3JZ1B 1GJ8B 1NTPA 1O3FA 1C1MA 5EOKA 1LVYA 3O8RA 2ZGJA 4FUJA 3NUMA 4AG1A 1O35A 1C5YB 1Z8JB 4JZ1A 1A0LA 1G3BA 1GMHG 1QL9A 3GY2A 4BAQB 4DW2U 1NFWA 1OP8A 1T31A 3JZ2B 3PLPA 4MPUA 1P06A 4K3JA 1VITF 1BOQA 1BTHH 4AFQA 3STIA 1GJAB 2BQ7B 1HCGA 2BD8A 5CHAC 1LTOA 5JBBS 3SI3H 1KYNA 1HXFH 1O2YA 1IQMA 1D6RA 2FTMA 2ZPRA 3U9AH 3S69A 2ZU4A 1K2I1 1QB1A 3DFJA 2ESTE 1PQ5A 2PV9B 1H9HE 1GMCF 4FU9A 3ZYEA 3SV7A 3UNRA 1QJ6B 3ZZ6A 3MO6A 1IHTH 5E2PA 1MU8B 2QYIA 1GBDA 4A92A 1DUAA 2BD7A 2RCEA 3SJ8A 7GCHF 1HYLA 4U01A 4AFZA 3VGCB 4OS1A 3QGJA 5C2ZA 5JYIA 1DLKB 2ZFQH 1W0YH 2H6MA 1SLWB 3A7WA 2NU4E 2A4QA 4UD9H 3TJNA 3L3TA 5DP5A 1TBQH 2G51A 3F6UH 2OBOA 3T5FH 2DE9A 2HLCA 1GI6A 3EE0B 3ZVCA 1LHCH 1TGSZ 1S6HA 4NZQA 1NZQH 1SOZA 2W3KA 2NU1E 3V7TA 4MDSA 1EPTB 1KXAA 1EUFA 1XM1A 1YKTA 1FI8A 1ZSKA 2Z9JA 1BRBE 5FPSA 1U6QA 1C5SA 3P8NA 2D2DA 1GVKB 1TE0A 3RP2A 4NWLA 1G37A 1EPTA 1BITA 3PWBA 3RXHA 6ESTA 2RA0A 1BHXF 1BJUA 3U98H 2XBVA 3A8BA 2LNCA 5L6NH 3N7OA 2D1JA 3VFEA 3DFLA 2QF3A 4YOGA 4Y0ZE 1OWEA 1SI5H 1A5HA 1O39A 1F7ZA 2GCTC 5DG6A 5DK1A 1MTWA 1THRH 3ZZ9A 2FLRH 4JMYA 5AVDA 5EQRA 1A3BH 1OPHB 1C5ZB 2HALA 2ZDLA 2JH5D 1V2JT 2A2QH 3BG4B 1EAXA 1ZHPA 1O2NA 3SN8A 2UUFB 4UDWH 1C2IA 5GXPA 3SNDA 1YPMH 1CGIE 1F5RA 1GHYH 2EI6A 4CR5A 5CE1A 5A0AE 1CA8B 1F2SE 1Z8RA 2BM2A 1GGDB 3KF2A 3A7ZA 2Z7FE 1W2KH 1P57B 1ZGIA 4I8HA 4X1SU 3C1KA 3RXGA 1IQHA 1GJ5H 1MAXA 3PLKA 4LZ4B 5C5OA 1HUTH 4DIHH 4BNRA 1ETSH 4Y11E 4SGAE 3ZVAA 1DUEA 1FIZA 1XX9A 2A7JA 2BD2A 4X1QU 1GBKA 2ALPA 1C4V2 3RC4A 1TYNA 1CBWB 1JMOH 3L33A 2BQ6B 1IHSH 3BTGE 4KTSA 1C5MD 2G00A 2H2ZA 1EZUC 1HAVB 2VVVA 1MTSA 3CENA 3SU1A 3SO3A 3GOVB 1RFNA 1D3DB 4KELA 2A7HA 1MTVA 1HNEE 2AFQB 2EC9H 4AN7A 1HAVA 4X2YA 2QN5T 2ZDNA 2QXIA 5ESTE 1GBJA 1THSH 2BOHB 2FMJA 3RU4T 4BAHB 1FJSA 3QN7A 4MPWA 1EZSC 3OX7U 1LPZB 1Y8TA 1HIAB 1BUIA 1SHHB 1EJAA 2C93B 2UUKB 2P3FH 5C20A 2BLOA 3RC6A 1SLXB 1ORFA 2ANWA 3TJVA 1ZRBA 5EW1H 1KXFA 1ZMNA 2BD9A 3LGYA 2GCHG 1W8BH 1HIAA 3LH1A 2ZDKA 3ATMA 1MCVA 1ANEA 4D7FA 3TLOA 1Y3YA 2BD4A 3R0FA 3F9GA 1SLUB 2ASUB 1D3PB 1H9IE 1O2MA 3CP7A 4CREA 1QURH 4CRGA 3K6YA 1GMDG 3A8DA 1BTPA 1LMWB 2VWNA 4MNVA 1GHAG 1N1LA 2SNVA 1WBGB 2CF9H 2FO9A 3BTEE 1E37B 3RXPA 2FOEA 2A4GA 2W7SA 1A3EH 1YPJH 3M5NA 3M5LA 3T28A 2R9PA 4X1PU 5AFZH 1P09A 4E05H 2TRMA 5GCHF 5DPAA 2Q6GA 3E91A 1N6YA 2ZQ1A 2OCVB 4YLQH 3SQEE 2BYAX 1V2TT 5J4SA 2V3OH 1S6FA 2OTVA 2VH0A 4MNXA 5E0HA 1UVUH 2FP7B 2B0FA 2GMTC 5FPTA 4O97A 3EA9A 4WMDA 1PPZA 4MG3A 1GI3A 3T2NA 1OOKB 2FI4E 1TONA 3LU9B 1OWIA 2BDIA 1SQOA 2B9LA 3A85A 3QZRA 4VGCC 4YTAA 3GDVA 4X1NU 8ESTE 4MNWA 1TPSA 3PO1B 4ZXYH 4X0WU 1JOUB 2PSYA 3FAOA 1TX6A 2YNAA 1B5GH 3WY8A 1S85A 2IPHA 4B2AA 3F9HA 1MTNB 1TRMA 1THPB 1TMTH 3UOUA 3SHCH 1DT2A 1YPLH 1XUGA 3RDZA 4IMQA 1UVOA 7ESTE 2W5EA 3M37A 1T7CA 1ZMJA 1PPBH 3TGKE 4NIWA 3SHAH 1P9UA 3E0PB 1UCYE 4XOJA 4JYVH 1C2JA 2FDAA 1IAUA 1P2MA 4AB8A 4NCYA 2PTNA 1CQQA 2AYWA 1ABJH 4LOYH 1GBMA 2Z3EA 1O2RA 4ZKOU 4CRCA 2OC8A 1Y3UA 1BQYA 2VWOA 1KDQB 2H9HA 4JYTA 4CH2B 3RXJA 5JBTA 1BMMH 2ZECA 1C5PA 5GJ4B 3BV9B 3M3SA 1DM4B 1INCA 3SGAE 4Y0YE 1ARCA 1KDQA 1ACBE 3MTYA 3TK9A 2RA3A 4INLA 3MH6A 1GWAA 2TBSA 4ISIH 1ANDA 4OS7A 1L1GA 2A2XH 2ZCLP 1C2KA 3K6ZA 5JBCS 1MCTA 3RXCA 3S7KB 4J1YA 4Y7AA 3GCHB 1W7GH 4WH6A 2ZP0H 3D62A 3SNEA 1YCPM 1UTPA 4GHTA 3P17H 3MWIU 1F5LA 2ZF0H 1O3OA 1PYTD 4JCNA 1K1IA 4CRBA 4ZMAH 3QGNB 1GJ6A 3RXOA 1A1RA 1ZGVA 6GCHF 1C1RA 1N8OB 2UWOA 4CR9A 2Z6BD 4NA8A 1EOLA 1DS2E 2BVRH 1ZTLA 1MU6B 1GBAA 3NCLA 1EAIA 4BAOB 1M9UA 2A4OA 2PGQB 1OS8A 1UVTH 2AGIX 1FDPA 3LGWA 1P2JA 2VNTA 4UFEH 3SUEA 2PLXA 4DJZB 2Q6DA 3NZIA 4O9VA 1S0RA 2TGPZ 2BLWA 2Z9KA 1SGRE 2Z94A 2V0BA 1KTSB 4Y8ZA 1DWCH 1O3AA 2ZHWH 1YPKH 4Y76A 4OS2A 3P70B 1V2QT 3LOXA 3VPKA 4CHAC 1Z6EA 1ZRKA 1DY9A 1PJPA 2G4UA 3E3TA 4THNH 2XYAA 1VCQA 5EXNA 1RJXB 4BTUB 3RU4D 3KHVA 1NFYA 3UQOA 3ATIA 4FU7A 2ZGCA 1ELEE 1LKAA 3HPTB 5EQSA 1TGNA 4BOHA 1QRWA 3QTOH 1VR1H 3OU0A 1Z1JA 4GCHG 1LHFH 3MHWU 1FLEE 3ESTA 1D9IA 1TWXB 2TIOA 3P8FA 4R0IA 1H1BA 1AZZA 1UK3A 1EATA 1GBBA 1SGPE 2ZU3A 2ILNA 2BDBA 1XUFA 4WVPE 1H4WA 4WMFA 1QL7A 4DURA 1FXYA 1L4ZA 4LXBH 1A61H 3MU4A 1HAHH 1JBUH 1XXDA 5C3NA 1P2OA 2RG3A 3LT3A 1O3BA 4B74A 3M5MA 4YOJA 1O36A 1DX5M 2J9NA 3VB7A 1AY6H 2WPJS 1HDTH 5JB8S 1GMHF 2Z3DA 1O3MA 3K9XB 3RXMA 1WOFA 1V2OT 2SNWA 2CF8H 5ABWA 3T29A 1YLCA 3CS0A 3M7QA 1TGCA 1W11U 3E0NB 4Q2KA 4X8TH 1AFQB 1SR5C 3STJA 2VGCB 3SOSA 2OINA 1O2QA 1UVSH 3MFJA 1P0SH 2LIZA 4O03A 3TIUA 3A83A 1O34A 3A8AA 2XBYA 1SGFA 1KXDA 2FOBA 2O8MA 3Q3YA 3R3GB 3SUFA 1OKXA 4WY3A 1CHOG 1EP5A 4ZHMU 1BBRK 1EASA 1C5RA 1O5DH 1FQ3A 3QK1A 4O3TA 3SJ9A 1Z8IB 2A31A 8GCHF 3B9FH 2BXUH 4K8YA 1WSSH 4BAKB 5IDKA 1TA6A 1VZQH 2ZTYA 2EI8A 5AF9H 1B0FA 3P92A 4ISOA 1UTNA 3GISB 1ID5H 3ZZ5A 1NESE 4A6LA 1GG6B 1C9PA 1LHEH 3ATWA 1BHXB 3GYLB 3H5CB 3M35A 1HXEH 1PPCE 1IQKA 1JRSA 5EU8A 1WYKA 4U2WA 4DVAU 1QQUA 1Y59T 1QBVH 1W13U 1LHDH 2O8LA 1F0UA 1UTMA 2Y6TA 4BANB 2QIQA 3HGPA 1GBFA 1TFXA 4XBDA 4HI3A 1C2HA 2P3TB 2PKSB 4I32A 3VXFH 1O3DA 1YCPH 2A1DB 1L4DA 5FBIA 1SL3A 3VGCC 1ETTH 3HKIB 2F9NA 4UE7H 2H5CA 1NPMA 2BLQA 2GV7A 3CS7A 3KCGH 4CRAA 3OY6U 2IN2A 2XNIA 5HYOA 1C1UH 1UMAH 1CVWH 3OSYA 1EOJA 3SORA 4NA9H 3I29A 4E7NA 1GBIA 2F9BH 1VITH 1DITH 3GY5A 3KGPA 1EPTC 3RXKA 2Z9GA 1PPHE 3A84A 4HTCH 3UNSA 2ZFTA 5HM2A 2FI3E 3GYMA 1C5QA 3SW2B 3MO3A 2STAE 2ZC9H 2QCYA 3PMHB 2Y7XA 3K65B 2HOBA 1HAZB 5JPMH 1O2HA 3U8RH 4BTIB 2Z9LA 1TQ7B 1TABE 1O2IA 4ZKNU 2Y7ZA 1UVPA 2QAAA 3KQEA 3SNCA 1EJNA 3BG4C 4ZROA 1T4VH 2R0LA 2WPMS 3T62A 3VB3A 1NFUA 1S83A 1SHYA 1YPGH 1J16A 3KL6A 4JZDH 1O5FH 1ZTJA 3D23A 3QWCH 4B2CA 1WQSA 3PB1E 1GCDA 3AAUA 3A8CA 1GGDC 2ZU1A 1YC0A 1QGFA 1EP6A 1NS3A 1V2UT 1FY1A 5EODA 2FZZA 1QR3E 3A87A 2QXJA 2ZFRH 4NGAH 5E2OA 3VEQB 2HPPH 1ELGA 2GKVE 1FY3A 2P59A 3W95A 3GY7A 4NG9H 3B23B 2ZEBA 1ZSJA 1IQFA 2OC1A 2Q6FA 1C1WH 2QF0A 1KSNA 4LK4A 1YYY1 1CBWC 1LVBA 1PPFE 1OP2A 1P3EA 1HV7A 2GCHF 2RDLA 2ZHFH 5ESBA 1BB0B 3KNXA 3GCTG 4UFFH 3RU4E 3BIUH 2BVSH 2ZHQH 1GMDF 3PWCA 1PYTC 2ANMH 2ZQ2A 1YBWA 2GVFA 2P16A 1KXCA 3A80A 5DGJA 2SGQE 1QQ4A 1CE5A 1O30A 1FN6A 4AGKA 1V2VT 3M7TA 3LJOA 2A32A 1C5VA 2FS8A 4H42U 5GWZA 4I33A 2DE8A 1H9LB 1HLTH 1BJVA 1QBOA 3ELAH 4TWWA 4NSYA 4KP0A 1NRNH 1Z1IA 5A09A 3ATKA 3SBKA 1AKSB 3M3TA 1BCUH 3QDZB 3TGIE 1AUJA 4OS5A 3SU0A 5FX6A 2BHGA 1P01A 4B76A 1SGQE 4TY6A 2J92A 4K2YA 3GCNA 1AKSA 1J8AA 4INHA 3F1SB 1GJ7B 4DT7B 2OP9A 3ZVBA 1K28D 3TNSA 1A0HB 1W3CA 2C3SA 3PLBA 5GIBA 1CO7E 1ELBA 4Q80A 4XE4A 5F6MA 3URCA 3TJOA 2GDDA 3DT0H 2EEKA 1TOCB 3PTNA 3BEFB 2F83A 1VGCB 2C8YB
chains in the Genus database with same CATH superfamily
1ELAA 4KTUA 1IQJA 2SGFE 2C90B 1VJAU 3IG6B 5G4BA 2SGDE 3TH3H 2GTBA 1D3QB 3ZV8A 2VH6A 1C1TA 1MD7A 4ABFA 3RXDA 5HM9A 3KN2A 4K1EA 1GI7B 4XFQA 1HGTH 2FX4A 3EBNA 1G2LA 2ZHEH 4OS4A 2C8ZB 3M61U 4IBLH 2QXGA 4I7YH 4LZ1H 5LGOA 1P10A 4GUXA 5C67A 1V2RT 3F9FA 2D8WA 1VITG 2BX3A 3PM3A 4FUFA 2F9UA 3PO1C 5L30H 3TJUA 1GI8B 4M7GA 1K1LA 4I8LA 1ELVA 3UREA 2O8WA 1HFDA 4TY7A 1MTNC 1QRZA 1Y5BT 1A0JA 2BDHA 4ZH8A 2FX6A 1DICA 4X6NA 1GMCG 2O8TA 1P2QA 1QCPA 2PUXB 4J2YB 1AVXA 4OM9A 1S5SA 1O2JA 3S9AA 1RIWB 3FP7E 1P2KA 2A0QB 4CH8B 3UFAA 7GCHG 1D6WA 3BN9A 4Z6AH 4ZKRU 1O37A 3I78A 3UR6A 2JH0D 1ANBA 9LPRA 2FODA 1DDJA 1TNLA 2OC0A 5TJXA 2G52A 4U30A 1WCZA 2IJD1 4A5TS 1FAXA 2A5IA 4RKOB 1AVGH 1BTZA 2ODYB 1QRXA 3NK8A 3RXBA 4Y6DA 4ZXXH 1ZYOA 2H1UA 1H8DH 3UPEA 1FIWA 2B5TB 1KLJH 3OY5U 2HNTF 1A46H 2J95A 3AASA 1E38B 3UR9A 1T32A 5HMAA 3A7TA 4Y7BA 3LDXH 5T6GA 2KCYA 2BX4A 1MZDA 2GZ8A 1NU7B 2AS9A 1ESTA 1O2VA 4DT4A 2FIRH 4AFUA 1L0ZA 1SGNE 3KEEA 1J9CH 1CT4E 1C5UA 1BBRH 2B8OH 2FOHA 4P00A 2K7XA 1MKXH 1K1NA 3GCHC 2A4RA 2P93A 1TBZH 3MH5A 1MKWK 3NWUA 2ANKH 1QY6A 1WTGH 1O32A 4F4OC 1HAIH 1FNIA 2SGAA 1MBQA 2FPZA 1O2KA 2R3YA 1QFKH 8KME2 3E16B 2HVYB 4MPXA 1W0ZU 1MAYA 1N8OC 5F8XA 3PMJA 3A86A 4DCDA 4FUDA 3H7TA 1DVAH 3MMGA 3GCOA 1HJ9A 2V3HH 3P6ZB 1UJ1A 3S9CA 1P2NA 5GPIB 1OWDA 1QHRB 1MH0A 1O0DH 2G8TA 2FTLE 1B0EA 7LPRA 2J38A 4Q7YA 3KIDU 5A2MH 2FLBH 5FCRA 1BRUP 4A1VA 4R8TB 4PROA 3UTUH 3GY6A 5LH8A 3KQCA 3SNAA 2BDAA 1TX7A 1DPOA 3Q00A 2V6NA 3A82A 3CNRA 4K8BA 1GHBF 1ELFA 1JWTA 4MNYA 1F0TA 1AO5A 2P8OB 5T3HA 1XVMA 5T6FA 2A7CA 2G5NA 1FY4A 3SJKA 3SUDA 2Y80A 2ZNKH 3W1EA 1LHGH 1O3KA 2BTCE 3MU5A 2Y82A 2VJ1A 2R2MB 3M7UA 3VB5A 5AHGH 3SQHE 1J17T 4AX9H 3MOCA 1EX3A 2VVCA 4X2WA 3NPSA 3LONA 1MZAA 5FX5A 1HJ8A 1O3HA 2JETB 2C4FH 4FXGH 1CA0B 1ETRH 4JYUH 1EFRD 5K0HA 4YLUA 1BTUA 1YPHE 3MNCA 5HXFA 1W10U 1QBNA 2XC4A 3UIRA 1O5CB 2QC2A 3SNBA 1XKAC 2BDYA 1GHVH 1O5EH 2AMPA 5EPYA 2OUAA 3VG8A 3LC5A 4FUHA 1ZZZA 1V3XA 1ABIH 3ENSB 1O5GH 3LGTA 1XUIA 1TRNA 1SMFE 5KECA 1O5BB 2ZIQH 2VBCA 1AUTC 4Y8XA 4UFDH 1LQEA 1O2XA 6LPRA 1C1PA 1A4WH 2F4LA 5A8XA 3PTBA 5TCCA 1S6LA 1O3LA 1SBWA 5LPFA 1V2WT 2ZHDA 2I6QA 5GCHG 1C1VH 3NKKA 1AQ7A 5HIZA 4IW4E 3QZQA 2FOMB 5C1XA 2ZPQA 1ARBA 1AFQC 1OXGA 3MQKC 2VGCC 1AIXH 4BTTB 1GHZA 4D9RA 2H9TH 2RFKC 2Y5GA 1XMNB 3BTFE 3TGJE 3OYPA 2WSSD 3UNQA 1P11E 5DJ7A 1PQ8A 1ZJDA 1Z71A 3DD2H 2OC7A 1GHXH 4DIIH 4P02A 5DP8A 3RXAA 1F5KU 1MBMA 3IITA 3WWFA 4ZHLU 1YPHC 2GP9B 3E8LA 3VXEH 5EJZA 1O2OA 3RMOH 1V2NT 5T6DA 1SC8U 3E6PH 3TITA 2BZ6H 2FOAA 3HGNA 3HKJB 4FVDA 2WV9A 1LPKB 1Z7KA 5EQQA 1GDUA 2XW9A 2A5AA 2H5DA 1T4UH 2WUCA 1GJBB 2M5TA 5JDUB 3FZDA 1G9IE 1Q3XA 3OAAD 2PW8H 1GG6C 3MNSA 1HBTH 4NA7A 4NFEA 1ZPZA 3UOPA 1LPGB 1QZ8A 1CGHA 2HWLB 4B73A 1C5OH 1EAWA 1O2ZA 1LKBA 4GHQA 1GCTB 3TU7H 1IQLA 4ASUD 1MUEB 4HFPB 4Q4LA 3TK6A 2TGDA 4NIVA 1KIGH 1O2UA 1V2ST 4MTBA 4YOIA 1G3CA 1ZHRA 4WXIA 4WMEA 1QA7A 2Q1JA 2PKSC 1KTTB 5F53A 2NU0E 8LPRA 3E1XB 1AN1E 2VWMA 4TT3D 1HJAB 1GBLA 3ZVFA 1FX0B 2ODQA 3ZZ7A 1C1OA 5HGGA 2OLGA 1CHGA 1O3PB 3EGKH 3RXLA 2R0KA 4RT0A 1JIRA 2ZZUH 3BTDE 3FKSD 1J15A 3QTVH 3AW0A 2J34A 4Y10E 1TBRH 2QF4A 3Q3XA 3M36A 4YZUA 1C1QA 3UQVA 4AYYB 2AERH 2DUCA 3FVFB 1HAXB 1FY8E 2G81E 2CV3A 2GT8A 4CRFA 2BXTH 1DANH 2ZFSA 2OK5A 2Y5FA 1Y5UT 1V2LT 3SU5A 1K9OE 3DA9B 1UTQA 3ZIAD 6CHAB 2ZGHA 1GI5A 3NRLA 1GI9B 2HNTE 3LKWA 1A5GH 1FN8A 2WPLS 3H09A 1D3TB 5DP4A 2BY7X 3SV6A 3U1IB 2XBXA 1C2FA 3ZZAA 1GI4A 1SGDE 1L1JA 4BXSA 2OBQA 2BY5X 6GCHG 4IMZA 1SKYE 3O8CA 2BZAA 1Z6JH 2J97A 3PV2A 4CHAB 1PQ7A 1MABB 3Q3KA 2Y81A 5E0GA 1EKBB 2VIOA 2Y5HA 2UWPA 2PSXA 1P05A 1DE7H 1L2EA 3MU1A 4JZFH 1P03A 3DSPA 3EE7A 2VIVA 3F68H 2JJ2D 3ZZCA 4Y79A 4YXWD 1HB0B 3NXPA 1DWEH 1KLTA 2BDCA 3ODDA 3HK3B 4ISHH 2WINI 3U1JB 1C2MA 2UUJB 3DSGA 7KMEH 2FESH 2CHAB 2F3CE 2F91A 1TB6H 1ZOMA 2JDID 2HVXA 4AC9A 2P94A 3AVZA 2K1QA 2ZFPH 1BBRE 2ZI2H 2OXSA 5BRRE 4BXWA 3AAVA 1IOEA 2XRCA 1O3EA 1C5NH 2VIQA 4GSOA 2QXHA 1G3DA 2R2WU 2ZTXA 1BRCE 1GBCA 4FUIA 1WTHD 2W7UA 5C1UA 2BB4A 1ESBA 2SGEE 4X8VH 3D65E 5LPRA 3H7OA 4ZHAA 3V12A 2XCNA 3RMLH 5A0CA 1AB9B 1QL8A 1AZ8A 1DXWA 3RM0H 1AWHB 2WUBA 3LGVA 4Y8YA 3BG8A 2WHXA 1D4PB 3ZZDA 1YP9A 2BY8X 1AE5A 1HRTH 3RLYH 1P2IA 3SZEA 4B75A 4D8NA 1MKWH 1NY22 1C1SA 5JB9S 1GL0E 1K22H 1W0JD 2ZDMA 4IN2A 2VIDA 1BRAA 1S84A 1UTLM 2ZCKP 1GJDB 2LPRA 3KQ5A 4FUBA 1YF4A 1KXBA 3BEUA 4U32A 3RM2H 2ZA5A 1XXFA 1T8OA 4GPGA 2EQNA 3T26A 4CBNA 2K0QA 1TRYA 1A7SA 1QJ1B 2W6ID 3FFGA 4ZUHA 1LVOA 2F43B 1WAYB 1C2LA 2YMSB 4NZLA 3EA8A 4WJG2 1OSSA 1EB2A 2BMGB 2FXRA 3RXQA 3V0XA 1FUJA 3T25A 1C2EA 3DCLA 4WWYA 3TH4H 5DN6D 3QLPH 4MLFB 5KEDA 1C2GA 3MO9A 1V2MT 2C8XB 1VGCC 3M5OA 1GI0A 5EGMA 1CU1A 2PGBB 1G3EA 4FUEA 2QY0B 1CT0E 4XSKU 3D49H 5FCKA 4F49A 1G32B 1Q2WA 2GZ9A 3L6PA 2ZCHP 1PPGE 1AFEH 1QJ7B 4ABEA 5B6LA 1RGQA 1RRKA 8GCHG 1HAPH 3QUMP 3SUGA 3V3MA 4B1TA 4ABGA 4DGJA 1TAWA 1ZPCA 1TALA 2CN0H 3BIVH 2PUQH 2PKAB 5FBEA 2GJGA 3BTHE 4IS5A 3EDXB 1EZXC 4ABJA 3ZZ8A 4I8KA 1GHAF 1KY9A 1QB9A 4FUGA 2WPKS 1A2CH 2PKAA 3RMNH 1TPPA 2V35A 4H6TA 1MQ5A 1CSOE 4MQAA 1YM0A 4YT6H 3UAIC 2FI5E 2FYQA 1WQVH 2BD5A 1B7XB 2QV1A 5EXMA 3SU6A 2FOCA 3PMAB 1FV9A 1V2PT 1EAUA 3UUZA 1KXEA 1T8LA 4AFSA 3MNXA 1RIWC 1AMHA 1GDQA 1KLIH 3P95A 1DOJA 4I8GA 3LIWA 3O8DA 4RSPA 2CGAA 3PROA 1K1JA 3RXIA 3TK5A 3BF6H 2SFAA 2UWLA 3BTQE 3SGQE 4A1XA 4E7RG 3A7XA 1OWHA 2ANYA 3LH3A 1IQNA 4IC5A 3MU0A 1NC6A 3TH2H 1BMAA 4UEHH 2KCOA 3MI4A 1SQAA 2OD3B 2EA3A 1WV7H 1DLEA 2GV6A 3IWMA 3U8TH 4YESB 1OYQA 1SOTA 2KAIB 5A8ZA 2AIPA 2XC5A 2OQ5A 5CHAB 2FS9A 1FAKH 1C5XB 4AZ2B 1EB1H 2PP6A 2JH6D 4IC6A 2PHBA 1S82A 3BSQA 1OWKA 2GZ7A 4TYDA 4B2BA 1AHTH 1E36B 2KAIA 3FP6E 4H4FA 1O2WA 4ABHA 1TNHA 3SV2H 1BT7A 1AVWA 1QTFA 4FVBA 1SQTA 4ZKSU 2OQUA 5JBAS 3ZV9A 1DWDH 4TWYA 1ESAA 2IPQX 5DP6A 5J4QA 1YPEH 1SGIB 1JIMA 1O2PA 4AG2A 1P8VC 4NIXA 1G36A 4BAMB 2KR7A 1K21H 3FP8E 1NFXA 1SGTA 1J14A 1EXFA 1E0FD 1O3JA 2O8UA 2VINA 3F2FA 4AB9A 3G01A 2Z3CA 3F0OA 1GBEA 2ODPA 2FOGA 3BTKE 2ZU2A 2ZU5A 2O9QA 5IYTA 1IQIA 4O3UA 4D76A 1G2MA 1UTOA 1XVOA 1C5TA 2J4IA 1NO9H 4CRDA 1RD3B 1GBHA 3F3BA 3GICB 3UY9A 2AMQA 5AFYH 1W14U 1VCPA 3FOAA 3B8JA 3TVJB 4GVUA 2F9OA 1SFIA 1RTLA 5KGOA 4WH8A 1SGFG 5I25A 1BZXE 1PPEE 1SLVB 2BY9X 3RXRA 1SSXA 3EQ0H 2XCFA 3RXFA 1K1PA 4FUCA 3SJIA 5A8YA 1TNJA 2XC0A 1UO6A 1N6XA 1DSTA 3SU4A 1T8NA 3RXVA 4X2XA 4Z0KA 3RLWH 1ANCA 1K1MA 1RXPA 3GDSA 5PTPA 1F0RA 2YMSD 1E35B 1F92A 2GCTB 4AYVB 5DO4H 1S81A 3RMMH 1GL1A 4SGBE 3OEED 2IJOB 1O3GA 2P8OC 4ISLA 3GY3A 5BPEA 1BTXA 1TLDA 2YNBA 1YCPK 2FYRA 2VWLA 1QB6A 3ZVDA 4YM9A 1K1OA 2QGRA 5T1VA 5H4IB 1HAOH 4NSVA 1GPZA 1YY3A 4XBCA 2G55A 2BOKA 2TPIZ 2ZO3H 4JK5A 2JETC 3F0PA 5EW2H 1ELCA 2GDEH 4HGCA 1FMGA 3KQDA 2WPIS 3ODFA 1CA0C 1O2SA 2PFEA 1P12E 2FEQH 1UCYK 2CMYA 1YGCH 3QO6A 2QA9E 1S0QA 1SB1H 1MD8A 1DWBH 5C5NA 1VKYA 3EYDA 3WWBA 4DOQA 2XTTB 3MNBA 3TPIZ 4HZHA 3LJJA 5FXLA 1LQDB 3LGUA 1BA8B 2AEIH 2HRVA 1EJMA 1OYTH 4OGYA 4X2VA 3VB6A 5FPYA 4K5ZA 3K2UA 2ZDVH 4NFFA 3RXSA 1TX8A 4I86A 2H9EH 1WU1A 1TNKA 3SU2A 1H8ED 3EAJA 1ELTA 2F9VA 1AD8H 1C5WB 2VVUA 4AORA 1GHWH 2TGAA 3ZVGA 2WYJA 3HK6B 5F8ZA 5F8TA 2PR3A 1RTKA 1BIOA 1LO6A 3UWJH 4AOQA 1NRPH 3U8OH 4GCHF 4D9QA 1SGYE 1NROH 5B6OA 1FZZA 3EA7A 4K1SA 4YO9A 1NT1A 5C1YA 1O2LA 4GLYA 1TGBA 2XBWA 9ESTA 1C1NA 1Y5AT 1Z8GA 2CXVA 1O33A 5I46H 2ALVA 2BDGA 5EXLA 1E1QD 3VB4A 1G30B 3FANA 1V2KT 4X6OA 2W26A 1HAYB 2IOTA 2P95A 3SI4H 4K69A 4DG4A 5E0JA 4AGJA 2STBE 1Y3WA 3PMBB 2G4TA 1F0SA 2ZGBH 3U69H 1C9TA 1MQ6A 1MTUA 2F9PA 4ISNA 1TOMH 1Y3XA 2GT7A 3ZYDA 4X6PA 1RTFB 1T8MA 2HPQH 1TPOA 1GCTC 2BVXH 2ULLA 3QX5H 4X6MA 1H8HD 5DP7A 4I31A 1UK4A 1QNJA 1TMUH 3GS9A 2GGVB 2YOLA 3OE7D 1WUNH 2AH4X 3ZZ3A 1ZR0A 2GMTB 1GI2A 3UB0A 1DSUA 3SU3A 4XDEA 1O3NA 1O38A 3GY8A 1TA2A 1CHOF 2BY6X 1HJAC 2NU2E 3A7VA 3FZZA 1SPJA 4VGCB 1AI8H 3SV9A 2ZGXH 1CT2E 2BLVA 5L2ZH 2FWWA 5A0BA 1A5IA 1EQ9A 1ZPBA 3W94A 5E8EH 1VCWA 3A81A 1EZQA 2JIZD 3UWIA 4X1RU 1IQEA 2ZTZA 1GVZA 4JK6A 1TIOA 4OS6A 3SJOA 4WF8A 1X7AC 2B7DH 4ASHA 2BQWB 3SZNA 2AGEX 3GY4A 3ZVEA 1Q31A 4CBOA 1UTJA 3TNTA 4MPVA 1C4U2 2VU8E 1HAGE 2FOFA 3S0NA 1BMNH 2CJIA 4K1TA 1Y3VA 2AIQA 6CHAC 2A5KA 1FPCH 2VIPA 4A7IB 2J2UA 3OTJE 1GJ9B 1FY5A 1O2TA 3A88A 1XUHA 1NBMD 2ZKSA 2ZDAH 5GNDA 3T27A 4H6SB 4KTCA 5DP9A 1YWUA 5SGAE 1LCYA 3MH7A 2ZPSA 5FHTA 1GJ4H 2XXLA 2L6OA 4XRNA 4UONA 1NU9A 5F03A 2I6SA 5EPNA 3Q76A 1XKBC 1BTYA 1SGCA 1YLNA 1FONA 2G5VA 1TNGA 3MH4A 4Q63A 2R3UA 2FM2A 2C8WB 3ITIA 4D7GA 4ABDA 2AMDA 2ZWLH 5TCAA 1OX1A 1XUJA 3SGBE 3E90B 1XUKA 5K7RA 3F9EA 4RT1A 1RS0A 3MU8A 2KZ4A 5CDFE 3S7HB 4QT8C 4X8SH 1JRTA 1GHBG 4KGAA 1FPHH 3A7YA 1ZSLA 4ABBA 2CHAC 3BTWE 5FAHA 2J94A 4IN1A 3P8GA 1AWFH 4RN6A 1O3IA 1NRSH 3RXTA 2HGTH 3DUXH 1UHBB 4XBBA 3A89A 3RC5A 1C4Y2 1DXPA 2XWAA 1GVLA 4M9FA 3FO8D 5HKKD 4GAWA 2VB0A 1DY8A 1AE8H 1E79D 1UHBA 4DY7B 1P3CA 1AB9C 4Y71A 4ESTE 1BDAA 5CMXH 1O3CA 4JZIA 2ZG0H 3N7DA 3KYFA 5DP3A 1ZHMA 4FOUC 1BMLA 1ZMLA 2XWBI 3LGIA 3S9BA 3OTPA 4FU8A 1GDNA 2UUYA 3F2GA 5GDSH 4WXVA 1CGJE 2JKHA 2AGGX 4Q7XA 4TPIZ 3PRDA 1UK2A 1P04A 3DSOA 1SG8B 2VIWA 1YLDA 1WDIA 1BTWA 2THFB 3Q77A 4ZAEA 3RUOA 1C5LH 2PTCE 1W7XH 1W12U 5L2YH 4UFGH 4NWKA 5ETXA 1MKXK 3HATH 1O2GH 2WV4A 1HPGA 2SGPE 5EG4A 3GCTF 2PWXA 3AW1A 2YMSC 3SV8A 2NU3E 2M2AA 2Z9IA 2WV5A 1NM6A 4YT7H 1TMBH 4E06H 1LDTT 1TPAE 1GJCB 1LVMA 3ZZBA 1OP0A 4MVNA 4OGXA 4KKDA 1AGJA 3LPRA 4K60A 5DKMA 4RKJB 4INKA 2D26C 1C2DA 4ABIA 1ZTKA 2TGTA 1TQ0B 1NN6A 4Q7ZA 2WYGA 1NRQH 3GDUA 1O5AB 1PFXC 1VJ9U 2AHME 1P02A 3KQBA 4I8JA 1AU8A 3RXUA 1SFQB 3PYHA 1ZJKA 2HNTC 3PV4A 1TGTA 3C27B 4TPYA 3V13A 1P9SA 1V6DA 1GI1A 1MMJN 2P3UB 3LC3A 1E34B 4ABAA 2GD4B 2A45B 1PQAA 1SVPA 1DFPA 3BTME 1ELDE 3ZZ4A 3AK5A 1UTKA 1H8IH 1TNIA 2BD3A 4X8UH 4A1TA 1IQGA 1NRRH 2EI7A 1ZLRA 1QA0A 1O31A 1GBTA 3I77A 3RXEA 3BTTE 1SGEE 4JZEH 2WPHS 1UCYH 3BEIB 3O8BA 3M3VA 2W3IA 2GX4A 3P8OA 2ZFFH 1L1NA 1OWJA 3ATLA 1JXPA 3DHKH 4IGDA 2NWNA 5LPEA 4NIYA 3URDA 4B71A 1QIXB 3MYWA 3JZ1B 1GJ8B 1NTPA 1O3FA 1C1MA 5EOKA 2XOKD 1LVYA 3O8RA 2ZGJA 4FUJA 3NUMA 4AG1A 1O35A 1C5YB 1Z8JB 4JZ1A 1A0LA 1G3BA 2KCAA 1GMHG 1QL9A 3GY2A 4BAQB 4DW2U 1NFWA 1OP8A 1T31A 3JZ2B 3PLPA 4MPUA 1P06A 4K3JA 1VITF 1BOQA 1BTHH 4AFQA 3STIA 1GJAB 2BQ7B 1HCGA 2BD8A 5CHAC 1LTOA 5JBBS 3SI3H 5C0TA 1KYNA 1HXFH 1O2YA 1IQMA 1D6RA 2FTMA 2ZPRA 3U9AH 4B6FA 3S69A 2ZU4A 1K2I1 1QB1A 3DFJA 2ESTE 1PQ5A 2PV9B 1H9HE 1GMCF 4FU9A 3ZYEA 3SV7A 3UNRA 1QJ6B 3ZZ6A 3MO6A 5DSFA 1IHTH 5E2PA 1MU8B 2QYIA 1GBDA 4A92A 1DUAA 2BD7A 2RCEA 3SJ8A 3U28C 7GCHF 1HYLA 4U01A 4AFZA 3VGCB 4OS1A 3QGJA 5C2ZA 5JYIA 1DLKB 1NBME 2ZFQH 1W0YH 2H6MA 1SLWB 3A7WA 2NU4E 2A4QA 4UD9H 3TJNA 3L3TA 5DP5A 1TBQH 2G51A 3F6UH 2OBOA 3T5FH 2DE9A 2HLCA 1GI6A 3EE0B 3ZVCA 1LHCH 1TGSZ 1S6HA 4NZQA 1NZQH 1SOZA 2W3KA 2NU1E 3V7TA 4MDSA 1EPTB 1KXAA 1EUFA 1XM1A 1YKTA 1FI8A 1ZSKA 2Z9JA 1BRBE 5FPSA 1U6QA 1C5SA 3P8NA 2D2DA 1GVKB 1TE0A 3RP2A 4NWLA 1G37A 1EPTA 1BITA 3PWBA 3RXHA 6ESTA 2RA0A 1BHXF 1BJUA 3U98H 2XBVA 3A8BA 2LNCA 5L6NH 3N7OA 2J5UA 2D1JA 3VFEA 3DFLA 2QF3A 4YOGA 4Y0ZE 1OWEA 1SI5H 1A5HA 1O39A 1F7ZA 2GCTC 5DG6A 5DK1A 1MTWA 1THRH 3ZZ9A 2FLRH 4JMYA 5AVDA 5EQRA 1A3BH 1OPHB 1C5ZB 2HALA 2ZDLA 2JH5D 1V2JT 2A2QH 4ACBA 3BG4B 1EAXA 1ZHPA 5FL7D 1O2NA 3SN8A 2UUFB 4UDWH 3OEHD 4B6EA 1C2IA 5GXPA 3SNDA 4HG6A 1YPMH 1CGIE 1F5RA 1GHYH 2EI6A 4CR5A 2JJ1D 5A0AE 5CE1A 1CA8B 1F2SE 1Z8RA 2BM2A 1GGDB 3KF2A 3A7ZA 2Z7FE 1W2KH 1P57B 1ZGIA 4I8HA 4X1SU 3C1KA 3RXGA 1IQHA 1GJ5H 1MAXA 3PLKA 4LZ4B 5C5OA 1HUTH 4DIHH 4BNRA 1ETSH 4Y11E 4SGAE 3ZVAA 1DUEA 1FIZA 1XX9A 2A7JA 2BD2A 4X1QU 1GBKA 2ALPA 1C4V2 3RC4A 2KCPA 1TYNA 1CBWB 1JMOH 3L33A 2BQ6B 1IHSH 3BTGE 4KTSA 1C5MD 2G00A 2H2ZA 1EZUC 1HAVB 2VVVA 1MTSA 3CENA 3SU1A 3SO3A 3GOVB 1RFNA 1D3DB 4KELA 2A7HA 1MTVA 1HNEE 2AFQB 5HIYA 2EC9H 4AN7A 1HAVA 4X2YA 4FETA 2EY4C 2QN5T 2ZDNA 2QXIA 5ESTE 1GBJA 1THSH 2BOHB 1WXRA 2FMJA 3RU4T 4BAHB 1FJSA 3QN7A 4MPWA 1EZSC 3OX7U 1LPZB 1Y8TA 1HIAB 1BUIA 1SHHB 1EJAA 2C93B 2UUKB 2P3FH 2XNDD 5C20A 2BLOA 3RC6A 1SLXB 1ORFA 2ANWA 3TJVA 1ZRBA 5EW1H 1KXFA 1ZMNA 2BD9A 3LGYA 2GCHG 1W8BH 1HIAA 3LH1A 2ZDKA 3ATMA 1MCVA 1ANEA 4D7FA 3TLOA 1Y3YA 2BD4A 5C17A 3R0FA 3F9GA 1SLUB 2ASUB 1D3PB 1H9IE 1O2MA 3CP7A 4CREA 1QURH 4CRGA 3K6YA 1GMDG 3A8DA 1BTPA 1LMWB 2VWNA 4MNVA 3OFND 1GHAG 1N1LA 2SNVA 1WBGB 2CF9H 2FO9A 3BTEE 1E37B 3RXPA 2FOEA 1BMFD 2A4GA 2W7SA 1A3EH 1YPJH 3M5NA 2KFWA 3M5LA 3T28A 2R9PA 4X1PU 5AFZH 1P09A 4E05H 2TRMA 5GCHF 5DPAA 2Q6GA 3E91A 1N6YA 2ZQ1A 2OCVB 4YLQH 3SQEE 2BYAX 1V2TT 5J4SA 2V3OH 1S6FA 4ACAA 2OTVA 2VH0A 4MNXA 5E0HA 1UVUH 2FP7B 2B0FA 2GMTC 5FPTA 4O97A 3EA9A 4WMDA 1PPZA 4MG3A 3PRBA 1GI3A 3T2NA 1OOKB 2FI4E 1TONA 3LU9B 1OWIA 2BDIA 1SQOA 2B9LA 3A85A 2V7QD 3QZRA 4VGCC 2HLDD 4YTAA 3GDVA 4X1NU 8ESTE 4RI0A 4MNWA 1TPSA 3PO1B 4ZXYH 4X0WU 1JOUB 2PSYA 3FAOA 1TX6A 2YNAA 1B5GH 3WY8A 1S85A 2IPHA 4B2AA 3F9HA 1MTNB 1TRMA 1THPB 1TMTH 3UOUA 3SHCH 1DT2A 1YPLH 1XUGA 3RDZA 4IMQA 1UVOA 7ESTE 2W5EA 3M37A 1T7CA 1ZMJA 1PPBH 2LELA 3TGKE 4NIWA 3SHAH 1P9UA 3E0PB 1UCYE 4XOJA 4JYVH 1C2JA 2FDAA 1IAUA 3N7EA 1P2MA 4AB8A 4NCYA 2PTNA 1CQQA 2AYWA 1ABJH 4LOYH 1GBMA 2Z3EA 1O2RA 4ZKOU 4CRCA 2OC8A 1Y3UA 1BQYA 1OHHD 2VWOA 1KDQB 2H9HA 4JYTA 4CH2B 3RXJA 5IK2D 5JBTA 1BMMH 2ZECA 1C5PA 5GJ4B 3BV9B 3M3SA 1DM4B 1INCA 2J98B 3SGAE 4Y0YE 1ARCA 1KDQA 1K0HA 1ACBE 3MTYA 3TK9A 2RA3A 4INLA 3MH6A 1GWAA 2J98A 2TBSA 4ISIH 1ANDA 4OS7A 1L1GA 2A2XH 2ZCLP 3F2HA 1C2KA 3K6ZA 5JBCS 1MCTA 3RXCA 3S7KB 4J1YA 4Y7AA 3GCHB 1W7GH 4WH6A 2ZP0H 3D62A 3SNEA 1YCPM 1UTPA 4GHTA 3P17H 3MWIU 1F5LA 2ZF0H 1O3OA 1PYTD 4JCNA 1K1IA 4CRBA 4ZMAH 3QGNB 1GJ6A 3RXOA 1A1RA 1ZGVA 4ZCNA 6GCHF 1C1RA 1N8OB 2UWOA 4CR9A 2Z6BD 4NA8A 1EOLA 1DS2E 2BVRH 2QF5A 1ZTLA 1MU6B 1GBAA 3NCLA 1EAIA 4BAOB 1M9UA 2A4OA 2PGQB 1OS8A 1UVTH 2AGIX 1FDPA 3LGWA 1P2JA 2VNTA 4UFEH 3SUEA 2PLXA 4DJZB 2Q6DA 3NZIA 4O9VA 4F48B 1S0RA 2TGPZ 2BLWA 2Z9KA 1SGRE 2Z94A 2V0BA 1KTSB 4Y8ZA 1DWCH 1O3AA 2ZHWH 1YPKH 4TSFD 4Y76A 4OS2A 3P70B 1V2QT 3LOXA 3VPKA 4F55A 4CHAC 1Z6EA 1ZRKA 1DY9A 1PJPA 2G4UA 3E3TA 4THNH 2XYAA 1VCQA 5EXNA 1RJXB 4BTUB 4Z1MD 3RU4D 3KHVA 1NFYA 2WZQA 3UQOA 3ATIA 4FU7A 2ZGCA 1ELEE 1LKAA 3HPTB 5EQSA 1TGNA 4BOHA 1QRWA 3KYGA 3QTOH 1VR1H 3OU0A 1Z1JA 4GCHG 1LHFH 3MHWU 1FLEE 3ESTA 1D9IA 1TWXB 2TIOA 3P8FA 4R0IA 1H1BA 1AZZA 2V3MA 1UK3A 1EATA 1GBBA 1SGPE 2ZU3A 2ILNA 2BDBA 1XUFA 4WVPE 1H4WA 4WMFA 1QL7A 4DURA 1FXYA 1L4ZA 4LXBH 1A61H 3MU4A 1HAHH 1JBUH 1XXDA 5C3NA 1P2OA 2RG3A 3LT3A 1O3BA 4B74A 3M5MA 1SQRA 4YOJA 1O36A 1DX5M 2J9NA 3VB7A 1AY6H 2WPJS 1HDTH 5JB8S 1GMHF 2Z3DA 1O3MA 3K9XB 3RXMA 1WOFA 1V2OT 2SNWA 2CF8H 5ABWA 3T29A 1YLCA 3CS0A 3M7QA 1TGCA 1W11U 3E0NB 2KX4A 4Q2KA 4X8TH 1AFQB 1SR5C 3STJA 2VGCB 3SOSA 2OINA 1O2QA 1UVSH 3MFJA 1P0SH 2LIZA 4O03A 3TIUA 3A83A 1O34A 3A8AA 2XBYA 1SGFA 1KXDA 2FOBA 2O8MA 2RDEA 3Q3YA 3R3GB 3SUFA 1OKXA 4WY3A 1CHOG 1EP5A 3WW7A 4ZHMU 1BBRK 1EASA 1C5RA 1O5DH 1FQ3A 3QK1A 4O3TA 3SJ9A 1Z8IB 2A31A 8GCHF 3B9FH 2BXUH 4K8YA 1WSSH 4BAKB 5IDKA 1TA6A 1VZQH 2ZTYA 2EI8A 5AF9H 1B0FA 3P92A 4ISOA 1UTNA 3GISB 1ID5H 3ZZ5A 5EJLA 1NESE 4A6LA 1GG6B 1C9PA 1LHEH 3ATWA 1BHXB 1W0KD 3GYLB 3H5CB 3M35A 1HXEH 1PPCE 1IQKA 1JRSA 1UW7A 5EU8A 1WYKA 4U2WA 4DVAU 1QQUA 1Y59T 1QBVH 1W13U 1LHDH 2O8LA 1F0UA 1UTMA 2Y6TA 4BANB 2QIQA 3HGPA 1GBFA 1TFXA 4XBDA 4HI3A 1C2HA 2P3TB 2PKSB 4I32A 3VXFH 1O3DA 1YCPH 2A1DB 1L4DA 5FBIA 1SL3A 3FN8A 3VGCC 1ETTH 3HKIB 2F9NA 4UE7H 2H5CA 1NPMA 2BLQA 2GV7A 3CS7A 3KCGH 4CRAA 3OY6U 2IN2A 2XNIA 5HYOA 1C1UH 1UMAH 1CVWH 3OSYA 4XD7D 1COWD 1EOJA 3SORA 4NA9H 3I29A 5CHBA 4E7NA 5C0UA 1GBIA 2F9BH 1VITH 1DITH 3GY5A 3KGPA 1EPTC 3RXKA 2Z9GA 1E1RD 1PPHE 3A84A 4HTCH 3UNSA 2ZFTA 5HM2A 2FI3E 3GYMA 1C5QA 3SW2B 3MO3A 2STAE 2ZC9H 2QCYA 3PMHB 2Y7XA 3K65B 2HOBA 1HAZB 5JPMH 1O2HA 3PV5A 3U8RH 4BTIB 2Z9LA 1TQ7B 1TABE 1O2IA 4ZKNU 2Y7ZA 1UVPA 1KMHB 2QAAA 3KQEA 3SNCA 1EJNA 3BG4C 4ZROA 1T4VH 2R0LA 2WPMS 3T62A 3VB3A 1NFUA 5EJ1A 1S83A 1SHYA 1YPGH 1J16A 5EIYA 2L74A 5C94A 3KL6A 4JZDH 1O5FH 1ZTJA 3D23A 3QWCH 4B2CA 1WQSA 3PB1E 1GCDA 3AAUA 3A8CA 3SYJA 1GGDC 2ZU1A 1YC0A 1QGFA 1EP6A 1NS3A 1V2UT 1FY1A 5EODA 2FZZA 1QR3E 3A87A 2QXJA 2ZFRH 4NGAH 5E2OA 3VEQB 2HPPH 1ELGA 2GKVE 1FY3A 2P59A 3W95A 3GY7A 4NG9H 3B23B 2ZEBA 1ZSJA 1IQFA 2OC1A 2Q6FA 1C1WH 2QF0A 1KSNA 4LK4A 1YYY1 1CBWC 1LVBA 2QE7D 1PPFE 1OP2A 1P3EA 1HV7A 2GCHF 2RDLA 2ZHFH 5ESBA 1BB0B 3KNXA 3GCTG 2KM0A 4UFFH 3RU4E 3BIUH 2BVSH 3N99A 2ZHQH 1GMDF 3PWCA 1PYTC 2ANMH 2ZQ2A 1YBWA 2GVFA 2P16A 1KXCA 3A80A 5DGJA 2SGQE 1QQ4A 1CE5A 1O30A 1FN6A 4AGKA 1V2VT 2WPDD 3M7TA 2W6JD 3LJOA 2A32A 1C5VA 2FS8A 4H42U 5GWZA 4I33A 2DE8A 1H9LB 1HLTH 1BJVA 1QBOA 3ELAH 4TWWA 4NSYA 4KP0A 1NRNH 1Z1IA 5A09A 3ATKA 3SBKA 1AKSB 3M3TA 2CK3D 1BCUH 3QDZB 3TGIE 1AUJA 4OS5A 3SU0A 5FX6A 2BHGA 1P01A 4B76A 1SGQE 4TY6A 2J92A 4K2YA 3GCNA 1AKSA 1J8AA 4INHA 3F1SB 1GJ7B 4DT7B 2OP9A 3ZVBA 1K28D 3TNSA 1A0HB 2LP6A 1W3CA 2C3SA 3PLBA 5GIBA 1CO7E 1ELBA 4Q80A 4XE4A 5F6MA 3URCA 3TJOA 2K8IA 2GDDA 3DT0H 2EEKA 1TOCB 3PTNA 3BEFB 2F83A 1VGCB 2C8YB
chains in the Genus database with same CATH topology
1ELAA 4KTUA 1IQJA 2SGFE 2C90B 1VJAU 3IG6B 5G4BA 2SGDE 3TH3H 2GTBA 1D3QB 3ZV8A 2VH6A 1C1TA 1MD7A 4ABFA 3RXDA 5HM9A 3KN2A 4K1EA 1GI7B 4XFQA 1HGTH 2FX4A 3EBNA 1G2LA 2ZHEH 4OS4A 2C8ZB 3M61U 4IBLH 2QXGA 4I7YH 4LZ1H 5LGOA 1P10A 4GUXA 5C67A 1V2RT 3F9FA 2D8WA 1VITG 2BX3A 3PM3A 4FUFA 2F9UA 3PO1C 5L30H 3TJUA 1GI8B 4M7GA 1K1LA 4I8LA 1ELVA 3UREA 2O8WA 1HFDA 4TY7A 1MTNC 1QRZA 1Y5BT 1A0JA 2BDHA 4ZH8A 2FX6A 1DICA 4X6NA 1GMCG 2O8TA 1P2QA 1QCPA 2PUXB 4J2YB 1AVXA 1S5SA 1O2JA 3S9AA 1RIWB 3FP7E 1P2KA 2A0QB 4CH8B 3UFAA 7GCHG 1D6WA 3BN9A 4Z6AH 4ZKRU 1O37A 3I78A 3UR6A 2JH0D 1ANBA 9LPRA 2FODA 1DDJA 1TNLA 2OC0A 5TJXA 2G52A 4U30A 1WCZA 4A5TS 1FAXA 2A5IA 4RKOB 1AVGH 1BTZA 2ODYB 1QRXA 3NK8A 3RXBA 4Y6DA 4ZXXH 1ZYOA 2H1UA 1H8DH 3UPEA 1FIWA 2B5TB 1KLJH 3OY5U 2HNTF 1A46H 2J95A 3AASA 1E38B 3UR9A 1T32A 5HMAA 3A7TA 4Y7BA 3LDXH 5T6GA 2BX4A 1MZDA 2GZ8A 1NU7B 2AS9A 1ESTA 1O2VA 2FIRH 4AFUA 1L0ZA 1SGNE 3KEEA 1J9CH 1CT4E 1C5UA 1BBRH 2B8OH 2FOHA 2K7XA 1MKXH 1K1NA 3GCHC 2A4RA 2P93A 1TBZH 3MH5A 1MKWK 3NWUA 2ANKH 1QY6A 1WTGH 1O32A 4F4OC 1HAIH 1FNIA 2SGAA 1MBQA 2FPZA 1O2KA 2R3YA 1QFKH 8KME2 3E16B 4MPXA 1W0ZU 1MAYA 1N8OC 5F8XA 3PMJA 3A86A 4DCDA 4FUDA 3H7TA 1DVAH 3MMGA 3GCOA 1HJ9A 2V3HH 3P6ZB 1UJ1A 3S9CA 1P2NA 5GPIB 1OWDA 1QHRB 1MH0A 1O0DH 2G8TA 2FTLE 1B0EA 7LPRA 2J38A 4Q7YA 3KIDU 5A2MH 2FLBH 5FCRA 1BRUP 4A1VA 4R8TB 4PROA 3UTUH 3GY6A 5LH8A 3KQCA 3SNAA 2BDAA 1TX7A 1DPOA 3Q00A 2V6NA 3A82A 4K8BA 1GHBF 1ELFA 1JWTA 4MNYA 1F0TA 1AO5A 2P8OB 5T3HA 1XVMA 5T6FA 2A7CA 2G5NA 1FY4A 3SJKA 3SUDA 2Y80A 2ZNKH 1LHGH 1O3KA 2BTCE 3MU5A 2Y82A 2VJ1A 2R2MB 3M7UA 3VB5A 5AHGH 3SQHE 1J17T 4AX9H 3MOCA 1EX3A 2VVCA 4X2WA 3NPSA 3LONA 1MZAA 5FX5A 1HJ8A 1O3HA 2JETB 2C4FH 4FXGH 1CA0B 1ETRH 4JYUH 5K0HA 4YLUA 1BTUA 1YPHE 3MNCA 5HXFA 1W10U 1QBNA 2XC4A 3UIRA 1O5CB 2QC2A 3SNBA 1XKAC 2BDYA 1GHVH 1O5EH 2AMPA 5EPYA 2OUAA 3LC5A 4FUHA 1ZZZA 1V3XA 1ABIH 3ENSB 1O5GH 3LGTA 1XUIA 1TRNA 1SMFE 1O5BB 2ZIQH 1AUTC 4Y8XA 4UFDH 1LQEA 1O2XA 6LPRA 1C1PA 1A4WH 5A8XA 3PTBA 5TCCA 1O3LA 1SBWA 5LPFA 1V2WT 2ZHDA 2I6QA 5GCHG 1C1VH 3NKKA 1AQ7A 4IW4E 3QZQA 2FOMB 5C1XA 2ZPQA 1ARBA 1AFQC 1OXGA 2VGCC 1AIXH 4BTTB 1GHZA 4D9RA 2H9TH 2Y5GA 1XMNB 3BTFE 3TGJE 3OYPA 3UNQA 1P11E 5DJ7A 1PQ8A 1ZJDA 1Z71A 3DD2H 2OC7A 1GHXH 4DIIH 3RXAA 5DP8A 1F5KU 1MBMA 3IITA 4ZHLU 1YPHC 2GP9B 3E8LA 3VXEH 1O2OA 3RMOH 1V2NT 5T6DA 1SC8U 3E6PH 3TITA 2BZ6H 2FOAA 3HGNA 3HKJB 4FVDA 1LPKB 1Z7KA 5EQQA 1GDUA 2XW9A 2A5AA 2H5DA 1T4UH 2WUCA 1GJBB 2M5TA 5JDUB 3FZDA 1G9IE 1Q3XA 2PW8H 1GG6C 3MNSA 1HBTH 4NA7A 4NFEA 1ZPZA 3UOPA 1LPGB 1CGHA 2HWLB 4B73A 1C5OH 1EAWA 1O2ZA 1LKBA 4GHQA 1GCTB 3TU7H 1IQLA 1MUEB 4HFPB 3TK6A 2TGDA 4NIVA 1KIGH 1O2UA 1V2ST 4MTBA 4YOIA 1G3CA 1ZHRA 4WXIA 4WMEA 1QA7A 2Q1JA 2PKSC 1KTTB 2NU0E 8LPRA 3E1XB 1AN1E 2VWMA 1HJAB 1GBLA 3ZVFA 2ODQA 3ZZ7A 1C1OA 5HGGA 2OLGA 1CHGA 1O3PB 3EGKH 3RXLA 2R0KA 1JIRA 2ZZUH 3BTDE 1J15A 3QTVH 3AW0A 2J34A 4Y10E 1TBRH 3Q3XA 3M36A 4YZUA 1C1QA 3UQVA 4AYYB 2AERH 2DUCA 3FVFB 1HAXB 1FY8E 2G81E 2CV3A 2GT8A 4CRFA 2BXTH 1DANH 2ZFSA 2Y5FA 1Y5UT 1V2LT 3SU5A 1K9OE 3DA9B 1UTQA 6CHAB 2ZGHA 1GI5A 1GI9B 2HNTE 3LKWA 1A5GH 1FN8A 2WPLS 1D3TB 5DP4A 2BY7X 3SV6A 3U1IB 2XBXA 1C2FA 3ZZAA 1GI4A 1SGDE 1L1JA 4BXSA 2OBQA 2BY5X 6GCHG 4IMZA 3O8CA 2BZAA 1Z6JH 4CHAB 1PQ7A 3Q3KA 2Y81A 5E0GA 1EKBB 2VIOA 2Y5HA 2UWPA 2PSXA 1P05A 1DE7H 1L2EA 3MU1A 4JZFH 1P03A 2VIVA 3F68H 3ZZCA 4Y79A 1HB0B 3NXPA 1DWEH 1KLTA 2BDCA 3ODDA 3HK3B 4ISHH 2WINI 3U1JB 1C2MA 2UUJB 7KMEH 2FESH 2CHAB 2F3CE 2F91A 1TB6H 1ZOMA 2HVXA 2P94A 3AVZA 2K1QA 2ZFPH 1BBRE 2ZI2H 2OXSA 5BRRE 4BXWA 3AAVA 1IOEA 2XRCA 1O3EA 1C5NH 2VIQA 4GSOA 2QXHA 1G3DA 2R2WU 2ZTXA 1BRCE 1GBCA 4FUIA 1WTHD 2W7UA 5C1UA 2BB4A 1ESBA 2SGEE 4X8VH 3D65E 5LPRA 3H7OA 4ZHAA 3V12A 2XCNA 3RMLH 5A0CA 1AB9B 1QL8A 1AZ8A 1DXWA 3RM0H 1AWHB 2WUBA 3LGVA 4Y8YA 3BG8A 1D4PB 3ZZDA 1YP9A 2BY8X 1AE5A 1HRTH 3RLYH 1P2IA 4B75A 4D8NA 1MKWH 1NY22 1C1SA 5JB9S 1GL0E 1K22H 2ZDMA 4IN2A 2VIDA 1BRAA 1S84A 1UTLM 2ZCKP 1GJDB 2LPRA 4FUBA 1YF4A 1KXBA 3BEUA 4U32A 3RM2H 2ZA5A 1XXFA 1T8OA 4GPGA 3T26A 4CBNA 1TRYA 1A7SA 1QJ1B 3FFGA 4ZUHA 1LVOA 1WAYB 1C2LA 4NZLA 3EA8A 4WJG2 1OSSA 1EB2A 2BMGB 2FXRA 3RXQA 3V0XA 1FUJA 3T25A 1C2EA 4WWYA 3TH4H 3QLPH 4MLFB 1C2GA 3MO9A 1V2MT 2C8XB 1VGCC 3M5OA 1GI0A 5EGMA 1CU1A 2PGBB 1G3EA 4FUEA 2QY0B 1CT0E 4XSKU 3D49H 5FCKA 4F49A 1G32B 1Q2WA 2GZ9A 3L6PA 2ZCHP 1PPGE 1AFEH 1QJ7B 4ABEA 1RGQA 1RRKA 8GCHG 1HAPH 3QUMP 3SUGA 3V3MA 4B1TA 4ABGA 4DGJA 1TAWA 1ZPCA 1TALA 2CN0H 3BIVH 2PUQH 2PKAB 5FBEA 3BTHE 4IS5A 3EDXB 1EZXC 4ABJA 3ZZ8A 4I8KA 1GHAF 1KY9A 1QB9A 4FUGA 2WPKS 1A2CH 2PKAA 3RMNH 1TPPA 2V35A 4H6TA 1MQ5A 1CSOE 4MQAA 1YM0A 4YT6H 2FI5E 2FYQA 1WQVH 2BD5A 1B7XB 2QV1A 5EXMA 3SU6A 2FOCA 3PMAB 1FV9A 1V2PT 1EAUA 3UUZA 1KXEA 1T8LA 4AFSA 3MNXA 1RIWC 1AMHA 1GDQA 1KLIH 3P95A 1DOJA 4I8GA 3LIWA 3O8DA 4RSPA 2CGAA 3PROA 1K1JA 3RXIA 3TK5A 3BF6H 2SFAA 2UWLA 3BTQE 3SGQE 4A1XA 4E7RG 3A7XA 1OWHA 2ANYA 3LH3A 1IQNA 4IC5A 3MU0A 1NC6A 3TH2H 1BMAA 4UEHH 3MI4A 1SQAA 2OD3B 2EA3A 1WV7H 1DLEA 2GV6A 3IWMA 3U8TH 4YESB 1OYQA 1SOTA 2KAIB 5A8ZA 2AIPA 2XC5A 2OQ5A 5CHAB 2FS9A 1FAKH 1C5XB 4AZ2B 1EB1H 2JH6D 4IC6A 2PHBA 1S82A 3BSQA 1OWKA 2GZ7A 4TYDA 4B2BA 1AHTH 1E36B 2KAIA 3FP6E 4H4FA 1O2WA 4ABHA 1TNHA 3SV2H 1BT7A 1AVWA 1QTFA 4FVBA 1SQTA 4ZKSU 2OQUA 5JBAS 3ZV9A 1DWDH 4TWYA 1ESAA 5DP6A 5J4QA 1YPEH 1SGIB 1JIMA 1O2PA 4AG2A 1P8VC 4NIXA 1G36A 4BAMB 1K21H 3FP8E 1NFXA 1SGTA 1J14A 1EXFA 1E0FD 1O3JA 2O8UA 2VINA 4AB9A 3G01A 2Z3CA 1GBEA 2ODPA 2FOGA 3BTKE 2ZU2A 2ZU5A 2O9QA 5IYTA 1IQIA 4O3UA 4D76A 1G2MA 1UTOA 1XVOA 1C5TA 2J4IA 1NO9H 4CRDA 1RD3B 1GBHA 3GICB 3UY9A 2AMQA 5AFYH 1W14U 1VCPA 3B8JA 3TVJB 4GVUA 2F9OA 1SFIA 1RTLA 4WH8A 1SGFG 5I25A 1BZXE 1PPEE 1SLVB 2BY9X 3RXRA 1SSXA 3EQ0H 2XCFA 3RXFA 1K1PA 4FUCA 3SJIA 5A8YA 1TNJA 2XC0A 1UO6A 1N6XA 1DSTA 3SU4A 1T8NA 3RXVA 4X2XA 4Z0KA 3RLWH 1ANCA 1K1MA 1RXPA 3GDSA 5PTPA 1F0RA 1E35B 1F92A 2GCTB 4AYVB 5DO4H 1S81A 3RMMH 1GL1A 4SGBE 2IJOB 1O3GA 2P8OC 4ISLA 3GY3A 5BPEA 1BTXA 1TLDA 2YNBA 1YCPK 2FYRA 2VWLA 1QB6A 3ZVDA 4YM9A 1K1OA 2QGRA 5H4IB 1HAOH 4NSVA 1GPZA 4XBCA 2G55A 2BOKA 2TPIZ 2ZO3H 4JK5A 2JETC 5EW2H 1ELCA 2GDEH 4HGCA 1FMGA 3KQDA 2WPIS 3ODFA 1CA0C 1O2SA 2PFEA 1P12E 2FEQH 1UCYK 2CMYA 1YGCH 3QO6A 2QA9E 1S0QA 1SB1H 1MD8A 1DWBH 5C5NA 3EYDA 4DOQA 2XTTB 3MNBA 3TPIZ 4HZHA 3LJJA 5FXLA 1LQDB 3LGUA 1BA8B 2AEIH 2HRVA 1EJMA 1OYTH 4OGYA 4X2VA 3VB6A 5FPYA 4K5ZA 3K2UA 2ZDVH 4NFFA 3RXSA 1TX8A 2H9EH 1WU1A 1TNKA 3SU2A 3EAJA 1ELTA 2F9VA 1AD8H 1C5WB 2VVUA 4AORA 1GHWH 2TGAA 3ZVGA 2WYJA 3HK6B 5F8ZA 5F8TA 2PR3A 1RTKA 1BIOA 1LO6A 3UWJH 4AOQA 1NRPH 3U8OH 4GCHF 4D9QA 1SGYE 1NROH 5B6OA 1FZZA 3EA7A 4K1SA 4YO9A 1NT1A 5C1YA 1O2LA 4GLYA 1TGBA 2XBWA 9ESTA 1C1NA 1Y5AT 1Z8GA 2CXVA 1O33A 5I46H 2ALVA 2BDGA 5EXLA 3VB4A 1G30B 3FANA 1V2KT 4X6OA 2W26A 1HAYB 2IOTA 2P95A 3SI4H 4K69A 4DG4A 5E0JA 4AGJA 2STBE 1Y3WA 3PMBB 2G4TA 1F0SA 2ZGBH 3U69H 1C9TA 1MQ6A 1MTUA 2F9PA 4ISNA 1TOMH 1Y3XA 2GT7A 3ZYDA 4X6PA 1RTFB 1T8MA 2HPQH 1TPOA 1GCTC 2BVXH 2ULLA 3QX5H 4X6MA 5DP7A 4I31A 1UK4A 1QNJA 1TMUH 2GGVB 2YOLA 1WUNH 2AH4X 3ZZ3A 1ZR0A 2GMTB 1GI2A 1DSUA 3SU3A 4XDEA 1O3NA 1O38A 3GY8A 1TA2A 1CHOF 2BY6X 1HJAC 2NU2E 3A7VA 3FZZA 1SPJA 4VGCB 1AI8H 3SV9A 2ZGXH 1CT2E 2BLVA 5L2ZH 2FWWA 5A0BA 1A5IA 1EQ9A 1ZPBA 3W94A 5E8EH 1VCWA 3A81A 1EZQA 3UWIA 4X1RU 1IQEA 2ZTZA 1GVZA 4JK6A 1TIOA 4OS6A 3SJOA 4WF8A 1X7AC 2B7DH 4ASHA 2BQWB 3SZNA 2AGEX 3GY4A 3ZVEA 1Q31A 4CBOA 1UTJA 3TNTA 4MPVA 1C4U2 2VU8E 1HAGE 2FOFA 3S0NA 1BMNH 2CJIA 4K1TA 1Y3VA 2AIQA 6CHAC 2A5KA 1FPCH 2VIPA 4A7IB 2J2UA 3OTJE 1GJ9B 1FY5A 1O2TA 3A88A 1XUHA 2ZKSA 2ZDAH 3T27A 4H6SB 4KTCA 5DP9A 5SGAE 1LCYA 3MH7A 2ZPSA 5FHTA 1GJ4H 2XXLA 4UONA 1NU9A 5F03A 2I6SA 5EPNA 3Q76A 1XKBC 1BTYA 1SGCA 1FONA 2G5VA 1TNGA 3MH4A 2R3UA 2FM2A 2C8WB 3ITIA 4D7GA 4ABDA 2AMDA 2ZWLH 5TCAA 1OX1A 1XUJA 3SGBE 3E90B 1XUKA 5K7RA 3F9EA 1RS0A 3MU8A 3S7HB 4QT8C 4X8SH 1JRTA 1GHBG 4KGAA 1FPHH 3A7YA 1ZSLA 4ABBA 2CHAC 3BTWE 5FAHA 2J94A 4IN1A