1L4ZA

X-ray crystal structure of the complex of microplasminogen with alpha domain of streptokinase in the presence cadmium ions
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
248
structure length
248
Chain Sequence
PSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDAGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase/blood clotting
molecule keywords Plasminogen
publication title Effects of deletion of streptokinase residues 48-59 on plasminogen activation.
pubmed doi rcsb
source organism Homo sapiens
total genus 53
structure length 248
sequence length 248
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1l4zA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1l4zA01
3U1JB 3OYPA 2OBOA 3QGJA 3IITA 1O38A 1OS8A 2Q6GA 4ABEA 3GY2A 3B9FH 3HK3B 2PFEA 1PJPA 3BEIB 1IQHA 1K1NA 1P06A 1O3KA 1TX8A 4Y71A 2XWAA 1AZ8A 3DD2H 5EPYA 2A2QH 1AWFH 7GCHG 2ZQ1A 3PM3A 4INLA 2NWNA 1F5RA 1EZQA 4FU9A 1BTUA 2TGTA 2Q1JA 5K7RA 1GMHF 2QN5T 3Q3XA 1OYTH 1PQAA 1FI8A 1GMCG 2OBQA 2QV1A 1C5XB 1G36A 3TNTA 3RXQA 3A82A 3ODDA 1GVKB 1UVUH 3GY7A 3A7YA 1C1UH 1TRMA 3L6PA 2BQWB 2HNTC 1AB9C 2HOBA 1HUTH 1YPJH 1QIXB 2FMJA 4Y76A 2FESH 1SGFA 2G5NA 4X8UH 2CGAA 4I8GA 1LVYA 2SGFE 2ZFTA 4X8VH 4CHAB 4ZHLU 1OWJA 1F0RA 1IQLA 2QA9E 3KGPA 6ESTA 1O37A 4ESTE 3RU4E 3VEQB 1NPMA 2C4FH 5C3NA 8GCHG 2SGQE 1A7SA 1PQ8A 1GI4A 2DE8A 1THSH 1EPTB 1QBVH 3MU5A 2R2WU 5FPTA 1O2GH 3UNQA 1GBEA 1AVXA 4I31A 3RXIA 4AFUA 4A1XA 1O35A 5HM2A 4Y10E 1IQFA 2Z9GA 1O2SA 1OX1A 1GHAG 4CREA 1HAPH 1K1JA 4JYUH 4KTCA 4X1RU 1O5EH 2ZPSA 3PV4A 4VGCB 5DGJA 1O2MA 1LVMA 2BVSH 3EE0B 4ZH8A 1HFDA 2BM2A 1LPKB 1A0HB 2UUYA 3NWUA 1NROH 5FPSA 1Z8RA 1IHTH 5L6NH 2ZNKH 2OXSA 2H6MA 1TNJA 2G5VA 1MTVA 3TIUA 1FY3A 1FONA 1GJDB 2D2DA 3ATIA 4MTBA 2H9TH 4O3UA 1ARBA 1MTWA 1BQYA 1SBWA 1T8MA 5E0GA 4CH2B 3SJ8A 3QTVH 1SLUB 1TPAE 1GJ4H 2A4QA 3V13A 3SHAH 5JB8S 1DSTA 3T5FH 3F9FA 1SOTA 1C5VA 3MO9A 1MZAA 1Y3VA 2VVUA 2BXUH 4ISHH 5EU8A 1BTPA 1O3EA 3KN2A 1P04A 1YPLH 2AFQB 2TGPZ 1THRH 1CBWC 3RM0H 2BD8A 3PMAB 2Y80A 3DHKH 2GMTC 2WPHS 1LQDB 3M3VA 1BBRH 3LU9B 3NXPA 1D6WA 4E06H 3H5CB 5I25A 1ELFA 3LC3A 3HKIB 2QF0A 2F9NA 1AKSA 2G51A 4ABIA 4WVPE 1YKTA 6CHAC 3Q77A 1EAIA 2ZU2A 1GDNA 3S9BA 5JDUB 1P3EA 2OQ5A 5EOKA 6GCHG 2FP7B 2GGVB 1P0SH 1TNGA 2A0QB 4IN1A 1DWCH 1TBZH 2ZQ2A 1D6RA 4IGDA 3A89A 2BDIA 1C2LA 3PO1C 3KNXA 1C1QA 2ZFQH 4TYDA 4NFFA 1ELGA 1ELDE 1WBGB 2PLXA 3AAUA 1YC0A 1O3OA 5GCHF 3MNXA 1P2NA 4AGJA 3DFJA 4WMDA 5ETXA 1GCTB 2A4OA 3SGQE 3QLPH 3BTGE 4HGCA 3U69H 4BAHB 3P95A 1FUJA 1GL0E 2FOMB 3RXAA 5EODA 5EXLA 1MQ6A 3MI4A 1CGIE 2BLOA 1MTNC 4THNH 2BQ6B 4FUBA 3M5LA 3VB4A 2CXVA 1XX9A 1LHEH 1TALA 1XMNB 2ZP0H 4RN6A 2KAIB 1VITG 5ESBA 2GV7A 2VGCC 1UO6A 4Y79A 4U01A 1C9PA 2XC4A 3F68H 8ESTE 2OD3B 1Y3XA 4I8KA 9LPRA 1JIRA 1KTTB 2D1JA 1MU6B 4DOQA 4BAMB 4FVDA 4GSOA 5AFZH 3UR9A 1GMDG 2Z3DA 3GY6A 1P2MA 1GGDC 5IYTA 5C1YA 3EGKH 4I33A 2PKSC 1UHBB 2FS8A 1ANDA 1SL3A 2CF9H 1MD8A 2BVRH 1Y5UT 1ELEE 3ATLA 4FUJA 3FVFB 2BXTH 2ODPA 5A2MH 1OOKB 2SNVA 1X7AC 3ZYEA 2ZPRA 1ABIH 2QF3A 2GCHF 2GCTC 3BN9A 3SU6A 4NA9H 3FAOA 1C1WH 3UUZA 2VINA 4NIYA 5HGGA 3MWIU 1A1RA 2FX4A 4IBLH 3T25A 3JZ1B 3LGWA 4AYYB 1EP5A 1EB1H 2BDHA 1V2TT 1WTHD 3KHVA 1P10A 1UTQA 2B0FA 1ESBA 4AORA 4GLYA 5LPRA 1MU8B 5EQSA 1P2KA 5LGOA 1UJ1A 1Q3XA 2ZF0H 3GCTG 3QK1A 1F0SA 1HAOH 2UUKB 1A5IA 1GVZA 2ZFFH 3D65E 1PPGE 1QB9A 1TMUH 2OC0A 3RXDA 1P9UA 4X1PU 3LT3A 1VGCB 2VH6A 1G3EA 2VIVA 1EB2A 1NRNH 2XXLA 2ZHDA 3MNSA 3U8TH 2F9PA 3CS0A 5E0JA 1DE7H 1LQEA 2PKAA 1GI5A 1TABE 1NZQH 1Q31A 1YLDA 1P9SA 2BLQA 1TPPA 3LGUA 1O3MA 1PYTC 1C2HA 1VZQH 1C1OA 3AASA 3AAVA 5C20A 1P2QA 1TGNA 2PR3A 1KXCA 7ESTE 5AHGH 1NRQH 3GDUA 4UE7H 4ABGA 2AYWA 4X2WA 3PB1E 3GCHC 4DG4A 2ZEBA 1NT1A 1FY8E 4ZAEA 3RLYH 3BG4B 1TBQH 3RXVA 2PSXA 3TPIZ 1Z71A 2JH0D 4FU7A 2IPHA 5CE1A 1MBMA 4LXBH 1V2RT 7LPRA 1ABJH 4H42U 2ODQA 4YLQH 2ZZUH 1AHTH 1NRSH 1VCQA 4JYVH 4AN7A 1JRTA 3A84A 1U6QA 1HJAB 4INHA 1Y3WA 3R3GB 4K8BA 2CMYA 3U8RH 7KMEH 2VB0A 3RLWH 1BUIA 1JMOH 1W13U 4NZLA 3RXKA 1CO7E 4K69A 1FY5A 2F83A 5LPFA 1MMJN 1LO6A 3U9AH 1T8NA 2XWBI 3A8CA 1DVAH 1Z7KA 1RFNA 2AIPA 5K0HA 4OS7A 5G4BA 1FN8A 2G4TA 1C5MD 1FJSA 3M36A 1IQKA 2ZG0H 1GHZA 2AS9A 1TX7A 1CVWH 1ORFA 3SV9A 2ALPA 3LC5A 2VIDA 4UFDH 3U1IB 2BZAA 3SW2B 3CP7A 1GI3A 1O3JA 3P8FA 3ZVCA 1W8BH 1HIAB 4A7IB 4FUEA 1RRKA 2HVXA 4JZFH 1BHXB 1NS3A 1O2OA 1HYLA 1BTXA 3AVZA 4Y6DA 3G01A 3UPEA 1O5FH 3KEEA 3AW0A 2PSYA 2WYJA 3A7XA 1N8OB 3STIA 1BRAA 1QFKH 4XOJA 1GHYH 1SLXB 4ABAA 2GT7A 4MNXA 4NZQA 2OC8A 1IHSH 2Z3CA 2STBE 1GBFA 2PWXA 4DIIH 3S0NA 1K9OE 3BEUA 2EEKA 1EZSC 2OUAA 3ESTA 4TPIZ 4CR9A 4X1QU 1QL8A 1C1RA 4WF8A 4JYTA 4Q2KA 1G3BA 4XFQA 1DUEA 1EX3A 2H9HA 1HJ9A 2BHGA 1GJ7B 4X6NA 1TAWA 1EAXA 1C2MA 1NO9H 2J94A 1DPOA 4FUDA 4Q7YA 2VU8E 2VVVA 2J92A 3BIVH 2W7UA 1K1LA 1OWIA 4BAOB 4CHAC 2FTMA 1OWHA 3P8GA 2F9BH 3URCA 1HAIH 3SO3A 3SNAA 3A85A 5DP7A 2EI6A 4AG2A 1EPTC 1EPTA 4YT7H 1ZJDA 4K1SA 3TITA 2V0BA 2TBSA 1IQIA 2BB4A 2ZTXA 3P17H 1ETTH 3MU0A 2A5IA 1O5BB 4R8TB 4JMYA 2R9PA 1ANBA 1C4U2 1O3FA 4CBOA 3VXFH 1C5YB 4X8TH 4NSYA 1FNIA 4VGCC 4ZXXH 1GHBF 2VJ1A 1AVGH 4ZMAH 3RXFA 4AFZA 2TIOA 1DANH 1SFIA 1KXEA 4F4OC 1G2MA 4ABHA 1C5ZB 1OP2A 1EZXC 1KLJH 2EC9H 1C9TA 3EAJA 2C3SA 1AFEH 1AU8A 4NA8A 1AUJA 1B7XB 3SNDA 1P8VC 5FPYA 1O2HA 2FM2A 1ZLRA 3E0NB 3QDZB 4A6LA 3KQEA 3LONA 1A3BH 2QXGA 2A7CA 2JKHA 4NSVA 1O39A 3LGYA 5GXPA 2QIQA 1MTUA 4Z6AH 1H9LB 1BMMH 3S69A 1J17T 2AEIH 1O2YA 1A3EH 1TFXA 1IQJA 5JB9S 4UFGH 3UR6A 1KYNA 1Y3UA 5A8YA 2UWLA 2F91A 4J2YB 3DUXH 4NWLA 1FLEE 1XXFA 1TOMH 1A5GH 1O36A 1TPSA 2ANMH 3ZZ6A 4B73A 1C2GA 1HAYB 1A0LA 1GI0A 1S0QA 4F49A 2OCVB 3GDSA 1CHGA 3SJIA 3A83A 1ID5H 1FN6A 1KSNA 3TU7H 4DGJA 3CENA 4ZKSU 2FI4E 2GKVE 1XUKA 1EOJA 2CHAC 1NN6A 2AMQA 1N6XA 2FOHA 4KTSA 3NUMA 1S85A 3A7ZA 2Y5HA 1YBWA 2HNTF 2ZCKP 1CT4E 4AX9H 2C8ZB 4RKOB 4MPVA 1S0RA 4U30A 1ETSH 1IQEA 1MD7A 1YPMH 1PPFE 1SGQE 1LHCH 3RXLA 2PGBB 1WYKA 3HPTB 2BY9X 1V2ST 4X2YA 3B8JA 4ABBA 1HNEE 1PPEE 1A46H 2WYGA 4K60A 1GBKA 4IMZA 3EDXB 3RC4A 1GCTC 3T28A 3QUMP 2Y7ZA 4ISIH 1EAWA 1SFQB 1Y5BT 3Q00A 1P3CA 1P02A 1ZOMA 2VWLA 1P2IA 4ISLA 5J4QA 3IWMA 1YLCA 2FOGA 3E1XB 5BRRE 4JZ1A 4PROA 2STAE 1SQTA 1FZZA 4ZKRU 1WU1A 1N1LA 3PLPA 2QXJA 2A7JA 1C1VH 3LGIA 2BDCA 3M35A 3QX5H 2ZPQA 3EA8A 1GJ5H 3C1KA 3M3TA 4OS5A 2KAIA 5FX6A 1W0ZU 1XUHA 1FXYA 2ZGBH 2P93A 3I29A 4AB9A 2ZIQH 1C5LH 3PMJA 5ESTE 4Y0ZE 4AFQA 2P94A 4NFEA 1CHOG 1BA8B 2ZFRH 4D7FA 1UHBA 2GT8A 3PMBB 1ZMJA 1BTWA 2Q6DA 1D3QB 5C1XA 1GBCA 4XBBA 4X6MA 2FOCA 2O8TA 4BNRA 1QL7A 2EI8A 2ALVA 2Z9IA 1ANCA 5E2PA 4JZEH 5JPMH 5GDSH 2G8TA 1YPEH 3PTBA 3N7OA 3VB6A 1E0FD 1MCVA 1DWDH 2BLWA 1OPHB 2G55A 4Y7BA 5EPNA 1P57B 1AGJA 2J95A 2SGEE 3A7TA 3ZVFA 1BDAA 2GDEH 1VJ9U 1GVLA 1F0TA 2H1UA 4TY7A 3ZVDA 2EI7A 3ZZBA 1RS0A 4CRGA 1P09A 1B0FA 2W7SA 1FMGA 1YPGH 1FPCH 1NRPH 4JK5A 1O3LA 2Y81A 1O2KA 3SI4H 1ZTJA 2CN0H 4JCNA 1GI6A 1GI1A 1C2KA 1LCYA 2ZA5A 3RU4D 5HXFA 5F03A 1O2ZA 1C5OH 1AI8H 2ULLA 2J4IA 1D3TB 5GPIB 1VGCC 4YO9A 2CV3A 4DURA 2Y6TA 2BD3A 1NM6A 1HAZB 2BY8X 2BX3A 1GBTA 2Z9LA 2C93B 3RXGA 7GCHF 2WINI 3LJOA 1GG6C 4CR5A 3BTQE 5SGAE 1VCPA 2Z7FE 4LOYH 1GPZA 2OC1A 1ZTLA 1UTOA 2BD2A 3SZNA 1UCYH 1CSOE 4KGAA 4Q7XA 3QZRA 4XSKU 1GMCF 1DUAA 3ZYDA 3ZZ4A 1CA0B 2NU4E 4CRBA 5GWZA 1EJMA 3MU4A 3LJJA 2A4GA 5T6DA 1OP0A 3O8CA 1ARCA 1SLVB 5DJ7A 1EAUA 1L2EA 2PUQH 1LKAA 3BG4C 1EATA 1RIWB 1ZJKA 2ZWLH 3A86A 3UFAA 3UY9A 4Q80A 1G30B 1GJ8B 5DKMA 1CU1A 1HDTH 3B23B 1QA7A 1DWBH 1UTMA 2YNBA 4D76A 1SGCA 1RJXB 3MU8A 1BTHH 2FOFA 1HJAC 2ZDMA 2G00A 3OTJE 1OKXA 4XDEA 3SUEA 4CRAA 1LPGB 1GBHA 4WJG2 3TJNA 2ZC9H 2R2MB 4MPUA 2K1QA 3SV8A 1SC8U 3TVJB 1SHYA 1CE5A 1TX6A 4IMQA 2WPKS 2Y7XA 1QGFA 3VB5A 2XC0A 4ISNA 8GCHF 3S7HB 2WPMS 1AVWA 1MKXK 3ODFA 3T2NA 3TH2H 4XE4A 2Y5GA 4GPGA 5JBTA 3SUDA 3UOUA 5E2OA 2BY5X 1HAVA 1O2NA 3E16B 1GHAF 3MFJA 3L33A 1UK4A 4Q7ZA 4D9RA 1O5GH 1IOEA 3OY6U 5EQQA 3RMLH 1OWEA 1ZMLA 4NIWA 4MDSA 4Z0KA 3JZ2B 1A2CH 1N8OC 4E7RG 1O34A 1QRWA 2B9LA 1UTJA 4GHTA 3NZIA 1S83A 5LH8A 4Y8XA 3RXPA 2RA3A 1LVBA 3SUGA 1C2FA 1O30A 3UWIA 3UREA 1TONA 1YPKH 1L4ZA 1FAKH 1C2DA 3T26A 2I6QA 2DE9A 2O9QA 4MNVA 1PYTD 4RSPA 2FXRA 2ZDNA 3MOCA 1K1OA 3P70B 1V2MT 1ZHPA 2XCFA 3GY4A 1MQ5A 2BOHB 2XTTB 1C5RA 4BTUB 1A61H 1DLKB 2QY0B 1GJ9B 3SQHE 2A1DB 1F2SE 2AIQA 1ZGVA 3QWCH 1KLTA 2FYQA 3KQDA 2ZDKA 3UQVA 1O3AA 4FUCA 2FDAA 1ANEA 3SNBA 5DG6A 1MKWK 4AGKA 2XC5A 4JZIA 1V6DA 1CQQA 1BMNH 1Z8GA 3HGPA 1W3CA 1GCDA 1FIWA 1V2OT 3I78A 2ZFSA 1J9CH 2B8OH 1RTFB 1V2PT 2XW9A 1C2JA 1QL9A 1ELCA 1V2JT 2Z9JA 4LK4A 5FXLA 6GCHF 4O3TA 1C2EA 5EXMA 5EW2H 1GJBB 1F5KU 1C1MA 5BPEA 1KIGH 1ZPZA 1ZHRA 4ZHMU 1O2RA 1BB0B 1NRRH 1AO5A 2ZKSA 1YYY1 1BIOA 3TJOA 4OS2A 1K21H 4HTCH 4NIVA 2FS9A 4UD9H 3OY5U 1KXDA 1EXFA 3UOPA 3GDVA 1SR5C 1QJ7B 1QNJA 2F9VA 2BZ6H 2RDLA 3BV9B 1C5WB 2XBVA 4H6SB 1XXDA 1MAXA 2O8LA 3KCGH 4O03A 5DP8A 1EASA 1W11U 4UFEH 1O31A 5ABWA 2GZ8A 2ZDAH 2WV5A 3V3MA 5L2YH 4DY7B 1TE0A 2V3HH 1SSXA 3KQCA 5F6MA 2FEQH 1QRXA 3F9EA 3V7TA 3SHCH 1VITF 1LVOA 4DT7B 1V2UT 3SI3H 3SU2A 2P59A 1TNLA 2FZZA 1BBRE 1PQ7A 4YESB 5FBIA 5FBEA 4WXIA 3GYLB 2BVXH 1T4VH 4BANB 3MHWU 1GMDF 1XUFA 1ACBE 4B71A 1TBRH 4FUHA 4YOIA 3BSQA 4MG3A 5EQRA 1DOJA 2JETB 2ZTZA 1EOLA 1C4V2 1O2PA 1LHFH 3TK9A 3ENSB 4X2VA 2ANWA 2OINA 4DCDA 5J4SA 1UK2A 1O2TA 2XNIA 3A7WA 2G81E 4B75A 1S6FA 2ANKH 1LHGH 3GOVB 4X1SU 2DUCA 1OYQA 3ATKA 1OWKA 3O8DA 1JXPA 3TH4H 1PPCE 3BTTE 2FOEA 1QRZA 1A5HA 1QB1A 5B6OA 2CJIA 1GI9B 1GI8B 1P2JA 3ATWA 3SNEA 1SGNE 2BD9A 1O2JA 3SQEE 1OXGA 1RD3B 2W26A 1XUGA 1FIZA 2NU2E 4Y0YE 2FX6A 5C1UA 1CBWB 2Z6BD 4I8LA 4K5ZA 5T3HA 3GCTF 1TRYA 1UCYK 1ZRBA 1UVSH 1ZGIA 3ZZCA 5PTPA 1WV7H 2VWOA 1GJAB 3NKKA 1D4PB 1DS2E 3KQBA 1JBUH 1O2VA 2B5TB 4LZ1H 1AKSB 3D49H 3PROA 2BTCE 1YPHE 4GCHG 3NPSA 1O3GA 2SGDE 2P8OB 1Z6EA 1O2UA 1PQ5A 1CT2E 2ZU5A 4WH6A 4D8NA 4WMFA 1AIXH 1ELVA 2J9NA 2ZFPH 1SGRE 1ELTA 1G3CA 1QCPA 4CRDA 1C1PA 3L3TA 4A5TS 1YP9A 3Q76A 1O2IA 4MQAA 1TNHA 4BAQB 2O8WA 4A92A 2ZGXH 4X2XA 3K9XB 4U2WA 1F92A 1Y5AT 1T8OA 3MNBA 5IDKA 1JIMA 1THPB 1Z6JH 2HRVA 4YZUA 4IS5A 1DX5M 2ZHFH 1GBAA 3RXCA 2GP9B 1V2LT 4SGBE 1MH0A 2F9OA 2D8WA 1GDQA 1DFPA 4X6PA 5DP3A 3BIUH 3M37A 2XBWA 2GVFA 5DP6A 3VGCB 5C5OA 1WUNH 4YOJA 4I32A 2BX4A 5AF9H 2AGIX 1NTPA 1TWXB 3TGJE 2FLRH 5DO4H 5T6FA 2UWPA 2R0KA 1CT0E 1DY8A 4ZROA 2J2UA 1GJCB 2R3YA 5DK1A 1MKXH 1HXFH 1XKBC 1GBBA 1TGSZ 2WPJS 3FZDA 4YM9A 4CRFA 1QJ1B 2TGAA 2LNCA 2W3KA 3BTKE 4K1TA 1IAUA 1RXPA 4YOGA 1G32B 3MH6A 1V3XA 1E34B 1CA0C 5H4IB 4GHQA 1SMFE 2VIWA 2HLCA 1J15A 2BD5A 1NC6A 2FOBA 1SOZA 2UWOA 1KTSB 1IQMA 1EKBB 1YCPH 1RIWC 3ZZ8A 1KDQB 1SHHB 2P3FH 1BOQA 1SGFG 3LPRA 3PLKA 3UIRA 2PW8H 1KXBA 1FQ3A 2A2XH 4K1EA 5L2ZH 1G9IE 2HPQH 1SB1H 2IJOB 2VWMA 4OS4A 1YPHC 2J38A 2ZU4A 1ZSJA 3QN7A 4A1VA 2TRMA 4WXVA 2ZDVH 3EA7A 1S6HA 2QXHA 4ABJA 1K28D 3LGTA 1ZSKA 9ESTA 1L4DA 4DJZB 2OLGA 2PTCE 3M5NA 3A8DA 1MAYA 1OWDA 2LPRA 3BTEE 1Z8JB 1LTOA 3TNSA 3MH7A 1BITA 4YLUA 2ZHQH 3P6ZB 2WUCA 1TMBH 1Z1IA 2HGTH 4INKA 4OGXA 4XBDA 2XBYA 1AFQB 4Y8YA 1BTYA 1HGTH 2XBXA 4OGYA 2A5AA 1GMHG 2ZO3H 3H7OA 1GI7B 4ZXYH 1PPZA 3I77A 1MKWH 1H4WA 3STJA 3S7KB 3U8OH 1SG8B 4NG9H 1QBOA 4GAWA 1FAXA 4NIXA 1W14U 2JH6D 3QGNB 1IQGA 1DXWA 3KL6A 3RM2H 4AFSA 1QY6A 1T31A 1NFWA 1QURH 4B1TA 1GBDA 1EJAA 2CF8H 1HAHH 1L0ZA 3SNCA 3TLOA 1LPZB 2THFB 1T32A 1HAGE 3ATMA 3K6ZA 3GY5A 1B0EA 4KTUA 1BRCE 4B74A 1CGJE 3M7TA 3ZVBA 3EYDA 1ZPBA 1O5CB 2BDBA 3DFLA 1P05A 2UUJB 5HM9A 1NFXA 3ELAH 1AUTC 1KXFA 8KME2 2R0LA 2BOKA 3F9HA 1MUEB 1QTFA 2J34A 1SI5H 1GBLA 1BJUA 1W12U 1UTKA 1FPHH 4FXGH 1V2KT 1AD8H 1DWEH 1T7CA 3RXMA 1NU9A 2FIRH 3TGKE 3SGAE 3SV2H 1IQNA 2PUXB 1EP6A 1RTLA 1ZRKA 5DP5A 3UWJH 1P01A 3E0PB 2AGEX 5A0BA 1Y8TA 1L1GA 3NK8A 4CH8B 2AERH 3FP8E 2Z9KA 4AB8A 1MTSA 1B5GH 1WCZA 5EW1H 1E35B 5JBAS 4BTIB 1GL1A 2WPLS 3OX7U 3BTME 3IG6B 2Z94A 1KXAA 1ZTKA 1MZDA 5E0HA 4TWYA 3C27B 1ZZZA 2AH4X 2QXIA 1VJAU 3ZZDA 1A0JA 2ILNA 2C90B 4JZDH 3RU4T 4ZKOU 1QA0A 1W7XH 4IN2A 4HFPB 4B2CA 1JWTA 1O5DH 1ZHMA 4O9VA 2BMGB 3A7VA 2O8UA 4K8YA 1TGBA 4TWWA 2GTBA 2HWLB 3P92A 3ZZ3A 5EXNA 2TPIZ 3VB3A 3TGIE 1GHWH 4MPXA 4TY6A 2WV4A 5TJXA 3RUOA 2TGDA 5EG4A 1E36B 3ZZ7A 3MH5A 2BD4A 1D3DB 1EZUC 1O3CA 5DP4A 2PGQB 1UVOA 4O97A 3UQOA 3PYHA 3PLBA 1HLTH 1QB6A 2NU3E 1FY4A 1Z8IB 3PMHB 1BHXF 4ZKNU 2VVCA 3DT0H 2VWNA 2FODA 1QQUA 4XBCA 1DDJA 1SGDE 1ZYOA 4JK6A 3WY8A 1HCGA 2VIQA 5I46H 5JBCS 3GY8A 5CHAB 1CHOF 2FYRA 3Q3YA 2ZGCA 4UONA 4M7GA 3V0XA 2JETC 3LGVA 1HV7A 5GCHG 1VITH 3LDXH 2QYIA 2C8XB 1QHRB 4WY3A 3SU0A 3RXOA 1XVOA 1XUIA 3T62A 3F9GA 1NFYA 2PV9B 4IC5A 2GX4A 3PWCA 4Y7AA 1TGTA 3U98H 3M7UA 2BQ7B 1P2OA 5A09A 3URDA 1LKBA 4B2BA 3BF6H 1RGQA 2BDYA 1S81A 3RDZA 5AVDA 1DXPA 4FUIA 4H6TA 3MH4A 3ZV9A 4LZ4B 1SVPA 3OU0A 3RC5A 1V2NT 1HXEH 1O33A 3SJOA 1C1SA 2A32A 3A87A 3P8OA 4X1NU 4GVUA 4ABFA 2ZHEH 3TK5A 1O2WA 3M5OA 3QO6A 1H1BA 2O8MA 1HIAA 2FOAA 1N6YA 5FX5A 3Q3KA 2C8WB 4YTAA 4ZUHA 4BAKB 1YCPK 2BY6X 1TNIA 2P3UB 3M7QA 1SPJA 2CHAB 3SU4A 2FWWA 3BTWE 3ZZAA 5A8ZA 1SGIB 2P8OC 5DPAA 1SQAA 1HPGA 1MBQA 3E3TA 3RP2A 1C2IA 1GDUA 4U32A 5E8EH 3A80A 3UTUH 2GCHG 5FCKA 3RXSA 1TB6H 2P16A 2ZDLA 3KIDU 2H9EH 1XM1A 3ZVAA 2V6NA 1RTKA 1TIOA 2YOLA 1O3BA 2RCEA 3T27A 3SOSA 3S9CA 3SJ9A 2Q6FA 3K6YA 5LPEA 1EUFA 4UDWH 1DLEA 3VFEA 3RXBA 4KP0A 3RXTA 3HATH 2HALA 3MNCA 2FI5E 4WWYA 1UVPA 2ANYA 2FO9A 2XYAA 3TH3H 3W95A 2B7DH 3A8BA 5GIBA 1F7ZA 2IN2A 4NWKA 4OS6A 3HK6B 3VGCC 4K2YA 1AZZA 4MNYA 3FP7E 4ABDA 1C5QA 3E90B 3HKJB 3BTFE 3GCOA 1JRSA 1C5UA 2F3CE 2QAAA 1JOUB 2RA0A 1C1TA 1SGEE 4Y11E 1FDPA 1Y59T 1ELAA 1WQVH 2A4RA 1C1NA 2FPZA 3LH3A 2A45B 1YF4A 3PWBA 1G3DA 1PFXC 1UCYE 3GCNA 4AYVB 1H9HE 1UMAH 5A0AE 1AB9B 2PTNA 5FCRA 4BXSA 1XUJA 2ZHWH 1AQ7A 3D62A 2A7HA 4OS1A 3RC6A 1ZPCA 2ZGJA 1O2LA 2FTLE 2ASUB 4FU8A 3TK6A 3E6PH 3ZVEA 3MMGA 2Y5FA 1HB0B 1KDQA 1AWHB 2NU1E 1SGPE 4WH8A 1BRUP 2ZTYA 1GBMA 3M61U 3QTOH 1ESAA 1V2QT 3E8LA 3QZQA 3S9AA 3SV6A 1DITH 5F8ZA 1S84A 1ZSLA 5DP9A 4SGAE 4FUGA 3RXRA 2JH5D 1HJ8A 1H8IH 3V12A 1OP8A 2BLVA 3F6UH 4R0IA 1MCTA 3SJKA 1H9IE 4IC6A 2SNWA 3M3SA 1A4WH 1AFQC 1S82A 1YCPM 3O8BA 1KLIH 3SN8A 3SU5A 4J1YA 1GG6B 1DICA 1O3DA 1WOFA 4UEHH 2Z3EA 1SGTA 1ESTA 1G2LA 2G4UA 5C5NA 1W0YH 2OC7A 2FI3E 2ZU3A 4D9QA 1TLDA 2QCYA 3TJUA 3RXHA 4DIHH 2P95A 3TJVA 3F1SB 4QT8C 2UUFB 1NFUA 1O3HA 3HGNA 2FLBH 3LIWA 1UTLM 2QC2A 3BTHE 1SQOA 2VNTA 5JYIA 4DW2U 4UFFH 1QR3E 2ZECA 3K65B 4CRCA 1BTZA 1TYNA 3FZZA 1CA8B 1FV9A 2BY7X 2GMTB 1DY9A 4ISOA 1SLWB 2ZGHA 1Z1JA 2YNAA 1H8DH 1WQSA 4KELA 3ZZ9A 3VB7A 3BTDE 2D26C 3SGBE 6LPRA 1TOCB 2GZ7A 1TRNA 1W7GH 1O5AB 2XCNA 1GBJA 4I7YH 1BT7A 4TPYA 6CHAB 2GV6A 3BEFB 1HAVB 2IOTA 3MU1A 1L1JA 1W2KH 1FY1A 1O2QA 1ZR0A 3SUFA 5FAHA 2H2ZA 1QQ4A 1EQ9A 2HPPH 3PO1B 3RXUA 1GI2A 1O3IA 1GHBG 2BDGA 2OTVA 2VIOA 2Y82A 1NY22 2R3UA 1AE8H 1DT2A 1XKAC 3GY3A 4MNWA 3EA9A 1BRBE 1T4UH 3RMMH 1HRTH 1BZXE 1YM0A 1NESE 4BOHA 1C5TA 1K22H 2BYAX 4IW4E 2V3OH 3NCLA 1OSSA 4HZHA 1P03A 5EGMA 1GBIA 5A8XA 5C2ZA 5A0CA 5L30H 3CS7A 3MTYA 2W5EA 1INCA 3SU1A 1TA2A 3RXEA 1F5LA 3P8NA 1QBNA 1GHXH 2SGAA 1T8LA 1TNKA 3FANA 1MTNB 4KKDA 4YT6H 2A5KA 4I8HA 1BBRK 1AY6H 3LH1A 8LPRA 2M5TA 4RKJB 1D9IA 1S5SA 4X8SH 3GICB 4CBNA 1O32A 1Q2WA 2VGCB 1EJNA 2WUBA 2ODYB 1AMHA 4H4FA 1E38B 1BMAA 1P12E 2EA3A 1BJVA 4NGAH 4ZHAA 3ITIA 1DM4B 3K2UA 3VPKA 1O3NA 1C5PA 2WPIS 4D7GA 4B76A 1LDTT 5F8XA 1GGDB 1TQ0B 3SV7A 2PKSB 1YGCH 2G52A 3GISB 1BCUH 3DA9B 4A1TA 2ZCLP 5HYOA 1GHVH 1ETRH 1K1MA 4GCHF 3BG8A 1V2WT 2ZCHP 1KY9A 1AN1E 2BDAA 1J14A 4FUFA 1TMTH 1TPOA 1D3PB 2XRCA 3MYWA 4GUXA 1PPHE 1C4Y2 2BD7A 2H5CA 2P3TB 1GJ6A 5CHAC 2GCTB 5CMXH 1TQ7B 3OSYA 1ELBA 4FVBA 1TGCA 1HBTH 3LOXA 4E05H 3M5MA 1NU7B 1E37B 4BXWA 1AE5A 1QJ6B 4MLFB 3E91A 1W10U 1K1PA 2ZU1A 1J16A 4MVNA 1GWAA 1LHDH 2ESTE 1C5SA 3T29A 2ZI2H 1Y3YA 3UNSA 3O8RA 4HI3A 5TCAA 2SFAA 1CGHA 3SU3A 3FFGA 1WSSH 2GZ9A 2F9UA 4I8JA 1BMLA 2GD4B 3ZZ5A 3RMNH 2GDDA 1J8AA 2A31A 3D23A 3ZV8A 1UTPA 2C8YB 1PPBH 2AGGX 1VCWA 1G37A 2HNTE 3W94A 1M9UA 2H5DA 2AMPA 4B2AA 4WMEA 1O2XA 2PKAB 4AZ2B 4MPWA 5C67A 5GJ4B 1UTNA 3PTNA 4NA7A 1F0UA 3A81A 3A8AA 5HMAA 1SGYE 3MO6A 2SGPE 4E7NA 2OQUA 2VIPA 3R0FA 1O0DH 5F8TA 1DSUA 3GCHB 3GYMA 3VXEH 3RMOH 1K1IA 4X6OA 1TA6A 1UVTH 5TCCA 1LMWB 5T6GA 4AOQA 5JBBS 1XVMA 2VH0A 4K3JA 2W3IA 1C5NH 3RXJA 3AW1A 4X0WU 3A88A 3EQ0H 1L1NA 1UK3A 3LKWA 3MO3A 1HAXB 3UNRA 2QGRA 2V35A 3FP6E 4Y8ZA 1V2VT 2OP9A 5AFYH 4DVAU 1O3PB 4BTTB 3SORA 4AG1A 1WTGH 1ZMNA 3SBKA 4ASHA 2PHBA 1WAYB 2AMDA 1VR1H 2I6SA 4NCYA 2NU0E 2RG3A 3KF2A 3ZVGA 1K2I1 5FHTA 1P11E 3H7TA
chains in the Genus database with same CATH superfamily
3U1JB 3OYPA 2KCYA 2OBOA 3QGJA 3IITA 1O38A 1OS8A 2Q6GA 2L74A 4ABEA 3GY2A 3B9FH 3HK3B 2PFEA 1PJPA 3BEIB 1IQHA 1K1NA 1P06A 1O3KA 1TX8A 4Y71A 2XWAA 1AZ8A 1COWD 3DD2H 5EPYA 2A2QH 1AWFH 7GCHG 2ZQ1A 3PM3A 4INLA 2NWNA 1F5RA 1EZQA 4FU9A 1BTUA 5C94A 2TGTA 2Q1JA 5K7RA 1GMHF 2QN5T 3Q3XA 1OYTH 1PQAA 1FI8A 1GMCG 2OBQA 2QV1A 1C5XB 1G36A 3TNTA 3RXQA 5EJLA 3A82A 3ODDA 1GVKB 1UVUH 2QF4A 3GY7A 3A7YA 1C1UH 2W6JD 1TRMA 3L6PA 2BQWB 2HNTC 3PRDA 1AB9C 2HOBA 1HUTH 1YPJH 1QIXB 2FMJA 4Y76A 2FESH 1SGFA 2G5NA 4X8UH 2CGAA 4I8GA 1LVYA 2SGFE 2ZFTA 4X8VH 4CHAB 4ZHLU 1OWJA 1F0RA 3AK5A 1IQLA 2QA9E 3KGPA 6ESTA 1O37A 4ESTE 2KFWA 3RU4E 3VEQB 1NPMA 2C4FH 5C3NA 8GCHG 2SGQE 1A7SA 1PQ8A 1GI4A 2DE8A 1THSH 1EPTB 1QBVH 3MU5A 2WSSD 2R2WU 5FPTA 1O2GH 3UNQA 1GBEA 1AVXA 4I31A 3RXIA 4AFUA 4A1XA 1O35A 5HM2A 4Y10E 5T1VA 1E1QD 1IQFA 2Z9GA 1O2SA 1OX1A 1GHAG 4CREA 1HAPH 1K1JA 4JYUH 4KTCA 4X1RU 1O5EH 2ZPSA 3PV4A 4VGCB 5DGJA 1O2MA 3VG8A 1LVMA 2BVSH 3EE0B 4ZH8A 1HFDA 2BM2A 1LPKB 1A0HB 2UUYA 3NWUA 1NROH 5FPSA 1Z8RA 2WPDD 1IHTH 5L6NH 2ZNKH 2OXSA 2H6MA 1TNJA 2G5VA 1MTVA 3TIUA 1FY3A 4DT4A 1FONA 1GJDB 2CK3D 2D2DA 3ATIA 4MTBA 2H9TH 4O3UA 1ARBA 1MTWA 1BQYA 1SBWA 1T8MA 5E0GA 4CH2B 3SJ8A 3QTVH 2V3MA 1SLUB 1TPAE 1GJ4H 2A4QA 3V13A 3SHAH 5JB8S 1DSTA 3T5FH 2VBCA 3F9FA 1SOTA 1C5VA 3MO9A 1MZAA 1Y3VA 2VVUA 2BXUH 1FX0B 4ISHH 4RT0A 1BTPA 5EU8A 1O3EA 3KN2A 2EY4C 1P04A 1YPLH 2AFQB 2TGPZ 1THRH 1CBWC 3RM0H 2BD8A 3PMAB 2Y80A 3DHKH 2GMTC 2WPHS 1LQDB 3M3VA 1BBRH 3LU9B 3NXPA 1D6WA 4E06H 3H5CB 5FL7D 5I25A 1ELFA 3LC3A 3HKIB 2QF0A 2F9NA 1AKSA 2G51A 4ABIA 4WVPE 1H8ED 1YKTA 6CHAC 3Q77A 1EAIA 2ZU2A 1GDNA 3S9BA 5JDUB 1P3EA 2OQ5A 5EOKA 6GCHG 2FP7B 2GGVB 1P0SH 1TNGA 2A0QB 4IN1A 1DWCH 1TBZH 2ZQ2A 1D6RA 4IGDA 3A89A 2BDIA 1C2LA 3PO1C 3KNXA 1C1QA 2ZFQH 4TYDA 3KQ5A 4NFFA 1ELGA 1ELDE 1WBGB 2PLXA 3AAUA 1YC0A 1O3OA 5GCHF 3MNXA 1P2NA 4AGJA 3DFJA 4WMDA 5ETXA 2XOKD 1GCTB 2A4OA 3SGQE 3QLPH 3BTGE 2LELA 4HGCA 3U69H 4BAHB 3P95A 2YMSB 1YWUA 1FUJA 1GL0E 2FOMB 3RXAA 5EODA 5EXLA 1MQ6A 1E1RD 3MI4A 1CGIE 2BLOA 1MTNC 4THNH 2BQ6B 4FUBA 3M5LA 3VB4A 2CXVA 1XX9A 1LHEH 1TALA 1XMNB 2ZP0H 4RN6A 2KAIB 1VITG 5ESBA 2GV7A 2VGCC 1UO6A 4Y79A 4U01A 1C9PA 2XC4A 3F68H 8ESTE 1Y3XA 2OD3B 4I8KA 9LPRA 1JIRA 1KTTB 2D1JA 1MU6B 4DOQA 4FETA 4BAMB 4FVDA 4GSOA 3W1EA 5AFZH 3UR9A 1GMDG 2Z3DA 3GY6A 1P2MA 1GGDC 3PV2A 5IYTA 5C1YA 3EGKH 4I33A 2PKSC 1UHBB 2FS8A 1ANDA 1SL3A 2OK5A 2CF9H 1MD8A 2BVRH 1Y5UT 1ELEE 4Q63A 3ATLA 4FUJA 3FVFB 2BXTH 2ODPA 5A2MH 1OOKB 2SNVA 1X7AC 3ZYEA 2ZPRA 3OE7D 1ABIH 2QF3A 4XRNA 2GCHF 2GCTC 3BN9A 3SU6A 4HG6A 3OEHD 4NA9H 3FAOA 1C1WH 3UUZA 2VINA 4NIYA 2IPQX 5HGGA 3MWIU 1A1RA 2FX4A 4IBLH 3T25A 3JZ1B 3LGWA 4AYYB 1EP5A 1EB1H 2BDHA 1V2TT 1WTHD 3KHVA 1P10A 1UTQA 2B0FA 1ESBA 4AORA 4ASUD 4GLYA 5LPRA 1MU8B 5EQSA 1P2KA 5LGOA 1UJ1A 1Q3XA 2ZF0H 3GCTG 3QK1A 1F0SA 1HAOH 2UUKB 1A5IA 1GVZA 2ZFFH 3D65E 1PPGE 1QB9A 1TMUH 2OC0A 4F48B 3RXDA 1P9UA 4X1PU 1K0HA 3LT3A 1VGCB 2VH6A 1G3EA 1SQRA 1EB2A 1NRNH 2VIVA 2XXLA 2ZHDA 3MNSA 3U8TH 2F9PA 3CS0A 5E0JA 1DE7H 1LQEA 1GI5A 1TABE 2PKAA 2K8IA 1NZQH 1Q31A 1YLDA 1P9SA 2BLQA 1TPPA 3LGUA 1O3MA 1PYTC 1C2HA 1VZQH 1C1OA 5KGOA 3AASA 3AAVA 5C20A 1P2QA 1TGNA 2PR3A 1KXCA 2QE7D 7ESTE 5AHGH 1NRQH 3GDUA 4UE7H 4ABGA 2AYWA 4X2WA 3PB1E 3GCHC 4DG4A 2ZEBA 1NT1A 1FY8E 4ZAEA 3RLYH 3BG4B 1TBQH 3RXVA 2PSXA 3TPIZ 1Z71A 2JH0D 4FU7A 2IPHA 5CE1A 1MBMA 4LXBH 1V2RT 7LPRA 1ABJH 4H42U 2ODQA 4YLQH 2ZZUH 1AHTH 1NRSH 1VCQA 4JYVH 4AN7A 1JRTA 3A84A 1U6QA 1HJAB 4INHA 1Y3WA 3R3GB 4K8BA 2CMYA 3U8RH 7KMEH 2VB0A 3RLWH 1BUIA 1JMOH 1W13U 4NZLA 3RXKA 1CO7E 4K69A 1FY5A 3F0OA 2F83A 5LPFA 1MMJN 1LO6A 3U9AH 1T8NA 2XWBI 3A8CA 1DVAH 1Z7KA 1RFNA 2AIPA 2JJ1D 5K0HA 4OS7A 5G4BA 1FN8A 2G4TA 1C5MD 1FJSA 3M36A 1IQKA 2ZG0H 1GHZA 2AS9A 1TX7A 1CVWH 1ORFA 3SV9A 2ALPA 3LC5A 2VIDA 4UFDH 3U1IB 2BZAA 3SW2B 3CP7A 1GI3A 1O3JA 3P8FA 3ZVCA 1W8BH 2KR7A 1HIAB 4A7IB 4FUEA 1RRKA 2HVXA 4JZFH 1BHXB 1NS3A 1O2OA 1HYLA 1BTXA 3AVZA 4Y6DA 3G01A 3UPEA 1O5FH 3KEEA 3AW0A 2PSYA 2WYJA 3A7XA 1N8OB 3STIA 1BRAA 1QFKH 4XOJA 1GHYH 1SLXB 4ABAA 2GT7A 4MNXA 4NZQA 2OC8A 1IHSH 2Z3CA 2STBE 1GBFA 2W6ID 2PWXA 4DIIH 3S0NA 1K9OE 3BEUA 2EEKA 1EZSC 2OUAA 3ESTA 4TPIZ 4CR9A 4X1QU 1QL8A 1C1RA 4WF8A 4TT3D 1OHHD 1SKYE 4JYTA 4Q2KA 1G3BA 4XFQA 1DUEA 1EX3A 2H9HA 1HJ9A 3NRLA 2BHGA 3N99A 1GJ7B 4X6NA 1TAWA 1EAXA 1C2MA 1NO9H 2J94A 2PP6A 1DPOA 4FUDA 4Q7YA 2VU8E 2VVVA 2J92A 3BIVH 2W7UA 1K1LA 1OWIA 4BAOB 4CHAC 2FTMA 1OWHA 3P8GA 2F9BH 3URCA 1HAIH 3SO3A 3SNAA 3A85A 5DP7A 2EI6A 4AG2A 1EPTC 1EPTA 4YT7H 1ZJDA 4K1SA 3TITA 2V0BA 2TBSA 1IQIA 2BB4A 2ZTXA 3P17H 1ETTH 3MU0A 4B6FA 2A5IA 1O5BB 4R8TB 4JMYA 2R9PA 1ANBA 1C4U2 1O3FA 2GJGA 3VXFH 4CBOA 1C5YB 4X8TH 4NSYA 1FNIA 2KCOA 4VGCC 4ZXXH 1GHBF 2VJ1A 1AVGH 4ZMAH 3RXFA 4AFZA 2TIOA 1DANH 1SFIA 1KXEA 4F4OC 1G2MA 4ABHA 1C5ZB 1OP2A 1EZXC 3F2FA 1KLJH 2EC9H 1C9TA 3EAJA 2C3SA 1AFEH 1AU8A 4NA8A 1AUJA 1B7XB 3SNDA 1P8VC 5FPYA 1O2HA 2FM2A 1ZLRA 3E0NB 3QDZB 4A6LA 3KQEA 3LONA 1A3BH 2QXGA 2A7CA 2JKHA 4NSVA 1O39A 3LGYA 5GXPA 2QIQA 1MTUA 4Z6AH 1H9LB 1BMMH 3S69A 1J17T 2AEIH 1O2YA 1A3EH 5DN6D 1TFXA 1IQJA 5JB9S 4UFGH 3UR6A 1KYNA 1Y3UA 5A8YA 2UWLA 2F91A 4J2YB 3DUXH 4NWLA 1FLEE 1XXFA 1TOMH 1A5GH 1O36A 1TPSA 2ANMH 2J97A 3ZZ6A 4B73A 1C2GA 1HAYB 1A0LA 1GI0A 1NBME 1S0QA 4F49A 2OCVB 3GDSA 1CHGA 3SJIA 3A83A 1ID5H 1FN6A 1KSNA 3TU7H 4DGJA 3CENA 4ZKSU 2FI4E 2GKVE 1XUKA 1EOJA 2CHAC 3PV5A 1NN6A 2AMQA 1N6XA 2FOHA 2L6OA 4KTSA 3NUMA 1S85A 3A7ZA 2Y5HA 1YBWA 2HNTF 2ZCKP 1CT4E 4AX9H 2C8ZB 4RKOB 4MPVA 1S0RA 4U30A 1ETSH 1IQEA 4RI0A 1MD7A 3GS9A 1YPMH 1PPFE 1SGQE 1LHCH 3RXLA 2PGBB 1WYKA 3HPTB 2BY9X 1V2ST 4X2YA 4Q4LA 3B8JA 4ABBA 1HNEE 1PPEE 1A46H 2WYGA 4K60A 1GBKA 4IMZA 3EDXB 3RC4A 1GCTC 3T28A 3QUMP 2Y7ZA 4ISIH 1EAWA 1SFQB 1Y5BT 2YMSC 1P3CA 1P02A 1ZOMA 3Q00A 2VWLA 1P2IA 4ISLA 5J4QA 3IWMA 1YLCA 2FOGA 3E1XB 5BRRE 4JZ1A 4PROA 2STAE 1SQTA 1FZZA 4ZKRU 1WU1A 1N1LA 3PLPA 2QXJA 2A7JA 1C1VH 3LGIA 2BDCA 3M35A 3QX5H 2ZPQA 3EA8A 1GJ5H 3C1KA 3M3TA 4OS5A 2KAIA 5FX6A 1W0ZU 1XUHA 1FXYA 2ZGBH 2P93A 3I29A 4AB9A 2J98B 3MQKC 3DSOA 2ZIQH 1C5LH 3PMJA 5ESTE 4Y0ZE 1WXRA 4AFQA 2P94A 4NFEA 1CHOG 1BA8B 2ZFRH 4D7FA 1UHBA 2GT8A 3PMBB 1ZMJA 1BTWA 2Q6DA 1D3QB 5C1XA 1GBCA 4XBBA 5HKKD 4X6MA 2FOCA 2O8TA 4BNRA 1QL7A 3OAAD 2EI8A 2ALVA 1E79D 5EJ1A 2Z9IA 1ANCA 5E2PA 4JZEH 3PRBA 5GDSH 5JPMH 2G8TA 1YPEH 3PTBA 3N7OA 3VB6A 1E0FD 1MCVA 1DWDH 2BLWA 1OPHB 3FKSD 2G55A 4Y7BA 5EPNA 1P57B 1AGJA 2J95A 2SGEE 3A7TA 3ZVFA 1BDAA 2GDEH 3DSGA 1VJ9U 1GVLA 1F0TA 2H1UA 4TY7A 3ZVDA 2EI7A 3ZZBA 1RS0A 4CRGA 1P09A 1B0FA 2W7SA 1FMGA 1YPGH 1FPCH 1NRPH 4JK5A 1O3LA 2Y81A 1O2KA 3SI4H 1ZTJA 2CN0H 4JCNA 1GI6A 1GI1A 1C2KA 1LCYA 2ZA5A 3RU4D 5HXFA 5F03A 1O2ZA 1C5OH 1AI8H 2ULLA 2J4IA 1D3TB 5GPIB 1VGCC 4AC9A 4YO9A 2CV3A 4DURA 2Y6TA 2BD3A 1NM6A 1HAZB 2BY8X 2BX3A 1GBTA 2Z9LA 2C93B 3RXGA 7GCHF 2WINI 3LJOA 1GG6C 4CR5A 3BTQE 5SGAE 1VCPA 2Z7FE 4LOYH 1GPZA 2OC1A 1ZTLA 1UTOA 2BD2A 3SZNA 1UCYH 1CSOE 4KGAA 4Q7XA 3UAIC 3QZRA 4XSKU 1GMCF 1DUAA 3ZYDA 3ZZ4A 1CA0B 2NU4E 4CRBA 5GWZA 1EJMA 3MU4A 3LJJA 2A4GA 5T6DA 1OP0A 3O8CA 1ARCA 1SLVB 5DJ7A 1EAUA 1L2EA 2PUQH 1LKAA 3BG4C 1EATA 1RIWB 1ZJKA 2ZWLH 3A86A 3UFAA 3UY9A 4Q80A 1G30B 1GJ8B 5DKMA 1CU1A 1HDTH 3B23B 1QA7A 1DWBH 1UTMA 2YNBA 4D76A 1SGCA 1RJXB 3MU8A 1BTHH 2FOFA 1HJAC 2ZDMA 2G00A 3OTJE 1OKXA 4XDEA 3SUEA 4CRAA 1LPGB 1GBHA 4WJG2 3TJNA 2ZC9H 2R2MB 4MPUA 2K1QA 3SV8A 1SC8U 3TVJB 1SHYA 1CE5A 1TX6A 4IMQA 2WPKS 2Y7XA 1QGFA 3VB5A 2V7QD 2XC0A 4ISNA 8GCHF 3S7HB 2WPMS 1AVWA 1MKXK 3ODFA 3T2NA 4M9FA 3TH2H 4XE4A 2Y5GA 1BMFD 4GPGA 5JBTA 3SUDA 3UOUA 5E2OA 2BY5X 5EIYA 1HAVA 1O2NA 3E16B 3KYGA 3WW7A 1GHAF 3MFJA 3L33A 1UK4A 2F4LA 4Q7ZA 4D9RA 1O5GH 1IOEA 3OY6U 5EQQA 3RMLH 1OWEA 1ZMLA 4NIWA 4MDSA 4Z0KA 3JZ2B 1A2CH 1N8OC 4E7RG 1O34A 1QRWA 2B9LA 1UTJA 4GHTA 3NZIA 1EFRD 1S83A 5LH8A 4Y8XA 3RXPA 2RA3A 1LVBA 3SUGA 1C2FA 1O30A 3UWIA 3UREA 1TONA 1YPKH 1L4ZA 1FAKH 1C2DA 3T26A 2I6QA 2DE9A 2O9QA 4MNVA 1PYTD 4RSPA 2FXRA 2ZDNA 3MOCA 1K1OA 3P70B 1V2MT 1ZHPA 2XCFA 2KCPA 3GY4A 1MQ5A 2BOHB 2XTTB 1C5RA 4BTUB 1A61H 1DLKB 2QY0B 1GJ9B 3SQHE 2A1DB 1F2SE 2AIQA 1ZGVA 3QWCH 1KLTA 2FYQA 3KQDA 2ZDKA 3UQVA 1O3AA 4FUCA 2FDAA 1ANEA 3SNBA 5DG6A 1MKWK 4AGKA 2XC5A 4JZIA 1V6DA 1CQQA 4F55A 1BMNH 1Z8GA 3HGPA 1W3CA 1GCDA 1FIWA 1V2OT 3I78A 2ZFSA 1J9CH 2B8OH 1RTFB 1V2PT 2XW9A 1C2JA 1QL9A 1ELCA 1V2JT 2Z9JA 4LK4A 5FXLA 6GCHF 4O3TA 1C2EA 5EXMA 5EW2H 1GJBB 1F5KU 2K0QA 5C0UA 1C1MA 5BPEA 1KIGH 1ZPZA 1ZHRA 4ZHMU 1O2RA 2LP6A 1BB0B 1NRRH 1AO5A 2ZKSA 1YYY1 1BIOA 3TJOA 2WHXA 4OS2A 1K21H 4HTCH 4NIVA 2FS9A 4UD9H 3OY5U 1KXDA 1EXFA 3UOPA 3GDVA 1SR5C 1QJ7B 1QNJA 2F9VA 2BZ6H 2JDID 2RDLA 3BV9B 1C5WB 2XBVA 4H6SB 1XXDA 1MAXA 3F3BA 2O8LA 2IJD1 3KCGH 4O03A 5DP8A 1EASA 1W11U 2J5UA 1O31A 4UFEH 5ABWA 2GZ8A 4ZCNA 2ZDAH 2WV5A 3V3MA 5L2YH 4DY7B 1TE0A 2V3HH 1SSXA 3KQCA 5F6MA 2FEQH 1QRXA 3F9EA 3V7TA 3CNRA 3SHCH 1VITF 1LVOA 4DT7B 1V2UT 3SI3H 3SU2A 2P59A 1TNLA 2FZZA 4ACBA 1BBRE 1PQ7A 4YESB 5FBIA 5FBEA 4WXIA 3GYLB 4TSFD 2BVXH 1T4VH 4BANB 3MHWU 1GMDF 1XUFA 1ACBE 3UB0A 4B71A 5GNDA 1TBRH 4FUHA 5KEDA 4YOIA 3BSQA 4MG3A 5EQRA 1DOJA 2JETB 2ZTZA 1EOLA 1C4V2 1O2PA 1LHFH 3TK9A 1MABB 3ENSB 4X2VA 2ANWA 2OINA 4DCDA 5J4SA 1UK2A 1O2TA 2XNIA 3A7WA 2G81E 4B75A 1S6FA 2ANKH 1LHGH 3GOVB 3N7EA 4X1SU 2DUCA 1OYQA 3ATKA 3KYFA 1OWKA 3O8DA 1JXPA 3TH4H 1PPCE 3BTTE 2FOEA 5KECA 1QRZA 1A5HA 1QB1A 5B6OA 2CJIA 1GI9B 1GI8B 1P2JA 3ATWA 3SNEA 1SGNE 2BD9A 2WV9A 1O2JA 5CHBA 3SQEE 1OXGA 1RD3B 2W26A 1XUGA 1FIZA 2NU2E 4Y0YE 2FX6A 5C1UA 1CBWB 2Z6BD 4I8LA 4K5ZA 5T3HA 3GCTF 1TRYA 1UCYK 1ZRBA 1UVSH 1ZGIA 3ZZCA 5PTPA 1WV7H 2VWOA 1W0JD 1GJAB 3NKKA 2EQNA 1D4PB 1DS2E 3KQBA 1JBUH 1O2VA 2B5TB 4LZ1H 1AKSB 3D49H 3ZIAD 3PROA 2BTCE 1YPHE 4GCHG 3NPSA 2J98A 1O3GA 2SGDE 2P8OB 1Z6EA 1O2UA 1PQ5A 1CT2E 2ZU5A 1VKYA 4WH6A 4D8NA 4WMFA 1AIXH 1ELVA 2J9NA 2ZFPH 1SGRE 1ELTA 1G3CA 1QCPA 4CRDA 1C1PA 3L3TA 4A5TS 1YP9A 3Q76A 1O2IA 4MQAA 1TNHA 4BAQB 2O8WA 4A92A 2ZGXH 4X2XA 3K9XB 4U2WA 1F92A 1Y5AT 1T8OA 3MNBA 3FO8D 5IDKA 1JIMA 1THPB 1Z6JH 2HRVA 4YZUA 4IS5A 1DX5M 2ZHFH 1GBAA 3RXCA 2GP9B 1V2LT 4SGBE 1MH0A 2F9OA 2D8WA 1GDQA 1DFPA 1H8HD 4X6PA 5EJZA 5DP3A 3BIUH 3M37A 2XBWA 2GVFA 5DP6A 3VGCB 5C5OA 1WUNH 4YOJA 4I32A 2BX4A 5AF9H 2AGIX 5CDFE 1NTPA 1TWXB 3TGJE 2FLRH 5DO4H 5T6FA 2UWPA 5C0TA 2R0KA 1CT0E 1DY8A 4ZROA 2J2UA 1GJCB 2R3YA 5DK1A 1MKXH 1HXFH 1XKBC 1YY3A 1GBBA 1TGSZ 2WPJS 3FZDA 4YM9A 4CRFA 1QJ1B 2TGAA 2LNCA 2W3KA 3BTKE 2YMSD 4K1TA 1IAUA 1RXPA 4YOGA 1G32B 3MH6A 1V3XA 1E34B 1CA0C 5H4IB 4GHQA 1SMFE 2VIWA 2HLCA 1J15A 2BD5A 1NC6A 2FOBA 1SOZA 2UWOA 1KTSB 1IQMA 1EKBB 1YCPH 1RIWC 3ZZ8A 1KDQB 1SHHB 2P3FH 1BOQA 1SGFG 3LPRA 3PLKA 3UIRA 2PW8H 1KXBA 1FQ3A 2A2XH 4K1EA 5L2ZH 1G9IE 2HPQH 1SB1H 2IJOB 2VWMA 4OS4A 1YPHC 2J38A 2ZU4A 1ZSJA 3QN7A 4A1VA 2TRMA 4WXVA 2JJ2D 2ZDVH 3EA7A 1S6HA 2QXHA 4ABJA 1K28D 3LGTA 1ZSKA 9ESTA 1L4DA 5HIYA 4DJZB 2OLGA 2PTCE 3M5NA 3A8DA 1MAYA 1OWDA 2LPRA 3BTEE 1Z8JB 1LTOA 3TNSA 3MH7A 1BITA 4YLUA 2ZHQH 3P6ZB 2WUCA 1TMBH 1Z1IA 2HGTH 4INKA 4OGXA 4XBDA 2XBYA 1AFQB 4Y8YA 4ACAA 1BTYA 1HGTH 2XBXA 2HVYB 4OGYA 2A5AA 1GMHG 2ZO3H 2M2AA 1GI7B 3H7OA 4ZXYH 1PPZA 3I77A 1MKWH 4RT1A 1H4WA 3STJA 3S7KB 3U8OH 1SG8B 4NG9H 1QBOA 4GAWA 1FAXA 4NIXA 1W14U 2JH6D 4P02A 3QGNB 1IQGA 1DXWA 3KL6A 3RM2H 4AFSA 1YLNA 1QY6A 1T31A 1NFWA 1QURH 3WWFA 4B1TA 1GBDA 1UW7A 1EJAA 4FOUC 3WWBA 2CF8H 1HAHH 1L0ZA 3SNCA 3TLOA 1LPZB 2THFB 1T32A 1HAGE 3ATMA 3K6ZA 3GY5A 1B0EA 4KTUA 1BRCE 4B74A 1CGJE 3M7TA 3ZVBA 3EYDA 1ZPBA 1O5CB 2BDBA 3DFLA 1P05A 2UUJB 5HM9A 5HIZA 1NFXA 3ELAH 1AUTC 1KXFA 8KME2 2R0LA 2BOKA 3F9HA 1MUEB 1QTFA 2J34A 1SI5H 1GBLA 1BJUA 1W12U 1UTKA 1FPHH 4FXGH 1V2KT 1AD8H 1DWEH 1T7CA 3RXMA 1NU9A 2FIRH 3TGKE 3SGAE 3SV2H 1IQNA 2PUXB 1EP6A 1RTLA 1ZRKA 5DP5A 3UWJH 1P01A 3E0PB 2AGEX 5A0BA 1Y8TA 1L1GA 3NK8A 4CH8B 2AERH 3FP8E 2Z9KA 4AB8A 1MTSA 1B5GH 1WCZA 5EW1H 1E35B 5JBAS 4BTIB 1GL1A 2WPLS 3OX7U 3BTME 3IG6B 2Z94A 1KXAA 1ZTKA 1MZDA 5E0HA 4TWYA 3C27B 1ZZZA 2AH4X 2QXIA 1VJAU 3ZZDA 1A0JA 2ILNA 2C90B 4JZDH 3RU4T 4ZKOU 1QA0A 1W7XH 2AHME 2XNDD 4IN2A 4HFPB 4B2CA 1JWTA 1O5DH 1ZHMA 4O9VA 2BMGB 3A7VA 2O8UA 4K8YA 1TGBA 4TWWA 2GTBA 2HWLB 3P92A 3ZZ3A 5EXNA 2TPIZ 3VB3A 5F53A 3TGIE 1GHWH 4MPXA 4TY6A 2WV4A 5TJXA 3RUOA 2TGDA 5EG4A 1E36B 3ZZ7A 3MH5A 2BD4A 1D3DB 1EZUC 1O3CA 5DP4A 2PGQB 1UVOA 4O97A 3UQOA 3PYHA 3PLBA 1HLTH 1QB6A 2NU3E 1FY4A 1Z8IB 3PMHB 1BHXF 4ZKNU 2VVCA 4P00A 3DT0H 2VWNA 2FODA 1QQUA 3DCLA 4XBCA 1DDJA 1SGDE 1ZYOA 4JK6A 3WY8A 1HCGA 2VIQA 5I46H 5JBCS 3GY8A 5CHAB 1CHOF 2FYRA 3Q3YA 3FN8A 2ZGCA 4UONA 4M7GA 3V0XA 2JETC 3LGVA 1HV7A 5GCHG 1VITH 3LDXH 2QYIA 2C8XB 1QHRB 4WY3A 3SU0A 3RXOA 1XVOA 1XUIA 3T62A 3F9GA 1NFYA 2PV9B 4IC5A 2GX4A 3PWCA 4Y7AA 1TGTA 3U98H 3M7UA 2BQ7B 1P2OA 5A09A 3URDA 1LKBA 4B2BA 3BF6H 1RGQA 2BDYA 1S81A 3RDZA 5AVDA 1DXPA 4FUIA 3OEED 3MH4A 4H6TA 3ZV9A 4LZ4B 1SVPA 3OU0A 3RC5A 1V2NT 1HXEH 1O33A 3SJOA 1C1SA 2A32A 3A87A 3P8OA 4X1NU 4GVUA 4ABFA 2ZHEH 3TK5A 1O2WA 3M5OA 2KM0A 3QO6A 1H1BA 2O8MA 1HIAA 2KX4A 2FOAA 1N6YA 5FX5A 1S6LA 3Q3KA 2C8WB 4YTAA 4ZUHA 4BAKB 2QF5A 3EE7A 1YCPK 2BY6X 1TNIA 2P3UB 3M7QA 1SPJA 2CHAB 2F43B 3U28C 3SU4A 2FWWA 3BTWE 3ZZAA 5A8ZA 1SGIB 2P8OC 5DPAA 1SQAA 1HPGA 1MBQA 3E3TA 3RP2A 1C2IA 1GDUA 4U32A 5E8EH 3A80A 3UTUH 2GCHG 3DSPA 5FCKA 3RXSA 1TB6H 2P16A 2ZDLA 3KIDU 2H9EH 1XM1A 3ZVAA 2V6NA 1RTKA 1TIOA 2YOLA 1O3BA 2RCEA 3T27A 3SOSA 3S9CA 3SJ9A 2Q6FA 3K6YA 5LPEA 1EUFA 4UDWH 1DLEA 3VFEA 3RXBA 3H09A 4KP0A 3RXTA 3HATH 2HALA 3FOAA 3MNCA 2FI5E 4WWYA 1UVPA 2ANYA 2FO9A 2XYAA 3TH3H 3W95A 2B7DH 3A8BA 5GIBA 1F7ZA 2IN2A 4NWKA 4OS6A 3HK6B 3VGCC 4K2YA 1AZZA 4MNYA 3FP7E 4ABDA 1C5QA 3E90B 3HKJB 3BTFE 3GCOA 1JRSA 1C5UA 2F3CE 2QAAA 1JOUB 2RA0A 2JIZD 1C1TA 1SGEE 4Y11E 1FDPA 1Y59T 1ELAA 1WQVH 2A4RA 1C1NA 2FPZA 3LH3A 2A45B 1YF4A 3PWBA 1G3DA 1PFXC 1UCYE 3GCNA 2RDEA 4AYVB 1H9HE 1UMAH 5A0AE 1AB9B 2PTNA 5FCRA 2KZ4A 4BXSA 1XUJA 2ZHWH 1AQ7A 3D62A 2A7HA 4OS1A 3RC6A 1ZPCA 2ZGJA 2RFKC 1O2LA 2FTLE 2ASUB 4FU8A 3TK6A 3E6PH 3ZVEA 3MMGA 2Y5FA 1HB0B 1KDQA 1AWHB 4B6EA 2NU1E 1SGPE 4WH8A 1BRUP 2ZTYA 1GBMA 3M61U 3QTOH 1ESAA 1V2QT 2KCAA 3E8LA 3QZQA 3S9AA 3SV6A 1DITH 5F8ZA 1S84A 1ZSLA 5DP9A 2WZQA 4SGAE 4FUGA 3RXRA 2JH5D 1HJ8A 1H8IH 3V12A 1OP8A 2BLVA 3F6UH 4R0IA 1MCTA 3SJKA 1H9IE 4IC6A 4I86A 2SNWA 1WDIA 3M3SA 1KMHB 1A4WH 1AFQC 1S82A 1YCPM 3O8BA 1KLIH 3SN8A 3SU5A 4J1YA 1GG6B 1DICA 1O3DA 1WOFA 4UEHH 2Z3EA 1SGTA 1ESTA 1G2LA 2G4UA 5C5NA 1W0YH 1W0KD 2OC7A 2FI3E 2ZU3A 4D9QA 1TLDA 2QCYA 3TJUA 3RXHA 4DIHH 2P95A 3TJVA 3F1SB 4QT8C 2UUFB 1NFUA 1O3HA 3HGNA 2FLBH 3LIWA 1UTLM 2QC2A 3BTHE 1SQOA 2VNTA 5JYIA 4DW2U 3F2HA 1QR3E 2ZECA 3K65B 4UFFH 1QZ8A 4CRCA 1BTZA 1TYNA 3FZZA 1CA8B 1FV9A 2BY7X 2GMTB 1DY9A 4ISOA 1SLWB 4Z1MD 3SYJA 2ZGHA 1Z1JA 2YNAA 1H8DH 1WQSA 4KELA 3ZZ9A 3SZEA 3VB7A 3BTDE 2D26C 3SGBE 6LPRA 1TOCB 2GZ7A 1TRNA 1W7GH 3F0PA 1O5AB 2XCNA 1GBJA 4I7YH 1BT7A 4TPYA 6CHAB 2GV6A 3BEFB 3F2GA 1HAVB 2IOTA 3MU1A 1L1JA 1W2KH 1FY1A 5B6LA 1O2QA 1ZR0A 3SUFA 5FAHA 2H2ZA 1QQ4A 1EQ9A 2HPPH 3PO1B 2HLDD 3RXUA 1GI2A 1O3IA 1GHBG 2BDGA 2OTVA 2VIOA 2Y82A 1NY22 2R3UA 1AE8H 1DT2A 1XKAC 3GY3A 4MNWA 3EA9A 1BRBE 1T4UH 3RMMH 1HRTH 1BZXE 1YM0A 1NESE 4BOHA 1C5TA 1K22H 2BYAX 4IW4E 2V3OH 3OTPA 3NCLA 1OSSA 4HZHA 1P03A 5EGMA 1GBIA 5A8XA 5C2ZA 5A0CA 5L30H 3CS7A 3MTYA 2W5EA 1INCA 3SU1A 1TA2A 3RXEA 1F5LA 3P8NA 1QBNA 1GHXH 2SGAA 1T8LA 1TNKA 3FANA 1MTNB 4KKDA 4YT6H 2A5KA 4I8HA 1BBRK 1AY6H 3LH1A 8LPRA 2M5TA 4RKJB 1D9IA 1S5SA 4X8SH 4OM9A 3GICB 4CBNA 1O32A 1Q2WA 2VGCB 1EJNA 2WUBA 2ODYB 1AMHA 4H4FA 1E38B 1BMAA 1P12E 2EA3A 1BJVA 4NGAH 4ZHAA 3ITIA 1DM4B 3K2UA 3VPKA 1O3NA 1C5PA 2WPIS 4D7GA 4B76A 1LDTT 5F8XA 1GGDB 1TQ0B 3SV7A 2PKSB 1YGCH 2G52A 3GISB 1BCUH 3DA9B 4A1TA 2ZCLP 5HYOA 1GHVH 1ETRH 1K1MA 4GCHF 3BG8A 1V2WT 2ZCHP 1KY9A 1AN1E 2BDAA 1J14A 4FUFA 1TMTH 1TPOA 1D3PB 2XRCA 3MYWA 4GUXA 1PPHE 1C4Y2 2BD7A 2H5CA 2P3TB 1GJ6A 5CHAC 2GCTB 5CMXH 1TQ7B 3OSYA 1ELBA 4FVBA 1TGCA 1HBTH 3LOXA 4E05H 3M5MA 3OFND 1NU7B 1E37B 4BXWA 1AE5A 1QJ6B 4MLFB 3E91A 1W10U 1K1PA 2ZU1A 1J16A 4MVNA 1GWAA 1LHDH 2ESTE 1C5SA 3T29A 2ZI2H 1Y3YA 3UNSA 3O8RA 4HI3A 5TCAA 2SFAA 1CGHA 3SU3A 3FFGA 1WSSH 2GZ9A 2F9UA 4I8JA 1BMLA 2GD4B 3ZZ5A 3RMNH 2GDDA 1J8AA 2A31A 3D23A 3ZV8A 5C17A 1UTPA 2C8YB 1PPBH 2AGGX 1VCWA 1G37A 2HNTE 3W94A 1M9UA 2H5DA 2AMPA 4B2AA 4WMEA 1O2XA 2PKAB 4AZ2B 4MPWA 5C67A 5GJ4B 1UTNA 1NBMD 3PTNA 4NA7A 1F0UA 3A81A 3A8AA 5HMAA 1SGYE 3MO6A 2SGPE 4YXWD 4E7NA 2OQUA 2VIPA 3R0FA 1O0DH 5F8TA 1DSUA 3GCHB 3GYMA 3VXEH 3RMOH 1K1IA 4X6OA 1TA6A 1UVTH 3N7DA 5IK2D 5TCCA 1LMWB 5T6GA 4AOQA 5JBBS 1XVMA 2VH0A 4K3JA 2W3IA 1C5NH 3RXJA 3AW1A 4XD7D 4X0WU 3A88A 3EQ0H 1L1NA 1UK3A 3LKWA 3MO3A 1HAXB 3UNRA 2QGRA 2V35A 3FP6E 4Y8ZA 1V2VT 2OP9A 5AFYH 4DVAU 1O3PB 4BTTB 3SORA 4AG1A 1WTGH 1ZMNA 3SBKA 4ASHA 2PHBA 5DSFA 1WAYB 2AMDA 1VR1H 2I6SA 4NCYA 2NU0E 2RG3A 3KF2A 3ZVGA 1K2I1 5FHTA 1P11E 3H7TA
chains in the Genus database with same CATH topology
3U1JB 3OYPA 2OBOA 3QGJA 3IITA 1O38A 1OS8A 2Q6GA 4ABEA 3GY2A 3B9FH 3HK3B 2PFEA 1PJPA 3BEIB 1IQHA 1K1NA 1P06A 1O3KA 1TX8A 4Y71A 2XWAA 1AZ8A 3DD2H 5EPYA 2A2QH 1AWFH 7GCHG 2ZQ1A 3PM3A 4INLA 2NWNA 1F5RA 1EZQA 4FU9A 1BTUA 2TGTA 2Q1JA 5K7RA 1GMHF 2QN5T 3Q3XA 1OYTH 1PQAA 1FI8A 1GMCG 2OBQA 2QV1A 1C5XB 1G36A 3TNTA 3RXQA 3A82A 3ODDA 1GVKB 1UVUH 3GY7A 3A7YA 1C1UH 1TRMA 3L6PA 2BQWB 2HNTC 1AB9C 2HOBA 1HUTH 1YPJH 1QIXB 2FMJA 4Y76A 2FESH 1SGFA 2G5NA 4X8UH 2CGAA 4I8GA 1LVYA 2SGFE 2ZFTA 4X8VH 4CHAB 4ZHLU 1OWJA 1F0RA 1IQLA 2QA9E 3KGPA 6ESTA 1O37A 4ESTE 3RU4E 3VEQB 1NPMA 2C4FH 5C3NA 8GCHG 2SGQE 1A7SA 1PQ8A 1GI4A 2DE8A 1THSH 1EPTB 1QBVH 3MU5A 2R2WU 5FPTA 1O2GH 3UNQA 1GBEA 1AVXA 4I31A 3RXIA 4AFUA 4A1XA 1O35A 5HM2A 4Y10E 1IQFA 2Z9GA 1O2SA 1OX1A 1GHAG 4CREA 1HAPH 1K1JA 4JYUH 4KTCA 4X1RU 1O5EH 2ZPSA 3PV4A 4VGCB 5DGJA 1O2MA 1LVMA 2BVSH 3EE0B 4ZH8A 1HFDA 2BM2A 1LPKB 1A0HB 2UUYA 3NWUA 1NROH 5FPSA 1Z8RA 1IHTH 5L6NH 2ZNKH 2OXSA 2H6MA 1TNJA 2G5VA 1MTVA 3TIUA 1FY3A 1FONA 1GJDB 2D2DA 3ATIA 4MTBA 2H9TH 4O3UA 1ARBA 1MTWA 1BQYA 1SBWA 1T8MA 5E0GA 4CH2B 3SJ8A 3QTVH 1SLUB 1TPAE 1GJ4H 2A4QA 3V13A 3SHAH 5JB8S 1DSTA 3T5FH 3F9FA 1SOTA 1C5VA 3MO9A 1MZAA 1Y3VA 2VVUA 2BXUH 4ISHH 5EU8A 1BTPA 1O3EA 3KN2A 1P04A 1YPLH 2AFQB 2TGPZ 1THRH 1CBWC 3RM0H 2BD8A 3PMAB 2Y80A 3DHKH 2GMTC 2WPHS 1LQDB 3M3VA 1BBRH 3LU9B 3NXPA 1D6WA 4E06H 3H5CB 5I25A 1ELFA 3LC3A 3HKIB 2QF0A 2F9NA 1AKSA 2G51A 4ABIA 4WVPE 1YKTA 6CHAC 3Q77A 1EAIA 2ZU2A 1GDNA 3S9BA 5JDUB 1P3EA 2OQ5A 5EOKA 6GCHG 2FP7B 2GGVB 1P0SH 1TNGA 2A0QB 4IN1A 1DWCH 1TBZH 2ZQ2A 1D6RA 4IGDA 3A89A 2BDIA 1C2LA 3PO1C 3KNXA 1C1QA 2ZFQH 4TYDA 4NFFA 1ELGA 1ELDE 1WBGB 2PLXA 3AAUA 1YC0A 1O3OA 5GCHF 3MNXA 1P2NA 4AGJA 3DFJA 4WMDA 5ETXA 1GCTB 2A4OA 3SGQE 3QLPH 3BTGE 4HGCA 3U69H 4BAHB 3P95A 1FUJA 1GL0E 2FOMB 3RXAA 5EODA 5EXLA 1MQ6A 3MI4A 1CGIE 2BLOA 1MTNC 4THNH 2BQ6B 4FUBA 3M5LA 3VB4A 2CXVA 1XX9A 1LHEH 1TALA 1XMNB 2ZP0H 4RN6A 2KAIB 1VITG 5ESBA 2GV7A 2VGCC 1UO6A 4Y79A 4U01A 1C9PA 2XC4A 3F68H 8ESTE 2OD3B 1Y3XA 4I8KA 9LPRA 1JIRA 1KTTB 2D1JA 1MU6B 4DOQA 4BAMB 4FVDA 4GSOA 5AFZH 3UR9A 1GMDG 2Z3DA 3GY6A 1P2MA 1GGDC 5IYTA 5C1YA 3EGKH 4I33A 2PKSC 1UHBB 2FS8A 1ANDA 1SL3A 2CF9H 1MD8A 2BVRH 1Y5UT 1ELEE 3ATLA 4FUJA 3FVFB 2BXTH 2ODPA 5A2MH 1OOKB 2SNVA 1X7AC 3ZYEA 2ZPRA 1ABIH 2QF3A 2GCHF 2GCTC 3BN9A 3SU6A 4NA9H 3FAOA 1C1WH 3UUZA 2VINA 4NIYA 5HGGA 3MWIU 1A1RA 2FX4A 4IBLH 3T25A 3JZ1B 3LGWA 4AYYB 1EP5A 1EB1H 2BDHA 1V2TT 1WTHD 3KHVA 1P10A 1UTQA 2B0FA 1ESBA 4AORA 4GLYA 5LPRA 1MU8B 5EQSA 1P2KA 5LGOA 1UJ1A 1Q3XA 2ZF0H 3GCTG 3QK1A 1F0SA 1HAOH 2UUKB 1A5IA 1GVZA 2ZFFH 3D65E 1PPGE 1QB9A 1TMUH 2OC0A 3RXDA 1P9UA 4X1PU 3LT3A 1VGCB 2VH6A 1G3EA 2VIVA 1EB2A 1NRNH 2XXLA 2ZHDA 3MNSA 3U8TH 2F9PA 3CS0A 5E0JA 1DE7H 1LQEA 2PKAA 1GI5A 1TABE 1NZQH 1Q31A 1YLDA 1P9SA 2BLQA 1TPPA 3LGUA 1O3MA 1PYTC 1C2HA 1VZQH 1C1OA 3AASA 3AAVA 5C20A 1P2QA 1TGNA 2PR3A 1KXCA 7ESTE 5AHGH 1NRQH 3GDUA 4UE7H 4ABGA 2AYWA 4X2WA 3PB1E 3GCHC 4DG4A 2ZEBA 1NT1A 1FY8E 4ZAEA 3RLYH 3BG4B 1TBQH 3RXVA 2PSXA 3TPIZ 1Z71A 2JH0D 4FU7A 2IPHA 5CE1A 1MBMA 4LXBH 1V2RT 7LPRA 1ABJH 4H42U 2ODQA 4YLQH 2ZZUH 1AHTH 1NRSH 1VCQA 4JYVH 4AN7A 1JRTA 3A84A 1U6QA 1HJAB 4INHA 1Y3WA 3R3GB 4K8BA 2CMYA 3U8RH 7KMEH 2VB0A 3RLWH 1BUIA 1JMOH 1W13U 4NZLA 3RXKA 1CO7E 4K69A 1FY5A 2F83A 5LPFA 1MMJN 1LO6A 3U9AH 1T8NA 2XWBI 3A8CA 1DVAH 1Z7KA 1RFNA 2AIPA 5K0HA 4OS7A 5G4BA 1FN8A 2G4TA 1C5MD 1FJSA 3M36A 1IQKA 2ZG0H 1GHZA 2AS9A 1TX7A 1CVWH 1ORFA 3SV9A 2ALPA 3LC5A 2VIDA 4UFDH 3U1IB 2BZAA 3SW2B 3CP7A 1GI3A 1O3JA 3P8FA 3ZVCA 1W8BH 1HIAB 4A7IB 4FUEA 1RRKA 2HVXA 4JZFH 1BHXB 1NS3A 1O2OA 1HYLA 1BTXA 3AVZA 4Y6DA 3G01A 3UPEA 1O5FH 3KEEA 3AW0A 2PSYA 2WYJA 3A7XA 1N8OB 3STIA 1BRAA 1QFKH 4XOJA 1GHYH 1SLXB 4ABAA 2GT7A 4MNXA 4NZQA 2OC8A 1IHSH 2Z3CA 2STBE 1GBFA 2PWXA 4DIIH 3S0NA 1K9OE 3BEUA 2EEKA 1EZSC 2OUAA 3ESTA 4TPIZ 4CR9A 4X1QU 1QL8A 1C1RA 4WF8A 4JYTA 4Q2KA 1G3BA 4XFQA 1DUEA 1EX3A 2H9HA 1HJ9A 2BHGA 1GJ7B 4X6NA 1TAWA 1EAXA 1C2MA 1NO9H 2J94A 1DPOA 4FUDA 4Q7YA 2VU8E 2VVVA 2J92A 3BIVH 2W7UA 1K1LA 1OWIA 4BAOB 4CHAC 2FTMA 1OWHA 3P8GA 2F9BH 3URCA 1HAIH 3SO3A 3SNAA 3A85A 5DP7A 2EI6A 4AG2A 1EPTC 1EPTA 4YT7H 1ZJDA 4K1SA 3TITA 2V0BA 2TBSA 1IQIA 2BB4A 2ZTXA 3P17H 1ETTH 3MU0A 2A5IA 1O5BB 4R8TB 4JMYA 2R9PA 1ANBA 1C4U2 1O3FA 4CBOA 3VXFH 1C5YB 4X8TH 4NSYA 1FNIA 4VGCC 4ZXXH 1GHBF 2VJ1A 1AVGH 4ZMAH 3RXFA 4AFZA 2TIOA 1DANH 1SFIA 1KXEA 4F4OC 1G2MA 4ABHA 1C5ZB 1OP2A 1EZXC 1KLJH 2EC9H 1C9TA 3EAJA 2C3SA 1AFEH 1AU8A 4NA8A 1AUJA 1B7XB 3SNDA 1P8VC 5FPYA 1O2HA 2FM2A 1ZLRA 3E0NB 3QDZB 4A6LA 3KQEA 3LONA 1A3BH 2QXGA 2A7CA 2JKHA 4NSVA 1O39A 3LGYA 5GXPA 2QIQA 1MTUA 4Z6AH 1H9LB 1BMMH 3S69A 1J17T 2AEIH 1O2YA 1A3EH 1TFXA 1IQJA 5JB9S 4UFGH 3UR6A 1KYNA 1Y3UA 5A8YA 2UWLA 2F91A 4J2YB 3DUXH 4NWLA 1FLEE 1XXFA 1TOMH 1A5GH 1O36A 1TPSA 2ANMH 3ZZ6A 4B73A 1C2GA 1HAYB 1A0LA 1GI0A 1S0QA 4F49A 2OCVB 3GDSA 1CHGA 3SJIA 3A83A 1ID5H 1FN6A 1KSNA 3TU7H 4DGJA 3CENA 4ZKSU 2FI4E 2GKVE 1XUKA 1EOJA 2CHAC 1NN6A 2AMQA 1N6XA 2FOHA 4KTSA 3NUMA 1S85A 3A7ZA 2Y5HA 1YBWA 2HNTF 2ZCKP 1CT4E 4AX9H 2C8ZB 4RKOB 4MPVA 1S0RA 4U30A 1ETSH 1IQEA 1MD7A 1YPMH 1PPFE 1SGQE 1LHCH 3RXLA 2PGBB 1WYKA 3HPTB 2BY9X 1V2ST 4X2YA 3B8JA 4ABBA 1HNEE 1PPEE 1A46H 2WYGA 4K60A 1GBKA 4IMZA 3EDXB 3RC4A 1GCTC 3T28A 3QUMP 2Y7ZA 4ISIH 1EAWA 1SFQB 1Y5BT 3Q00A 1P3CA 1P02A 1ZOMA 2VWLA 1P2IA 4ISLA 5J4QA 3IWMA 1YLCA 2FOGA 3E1XB 5BRRE 4JZ1A 4PROA 2STAE 1SQTA 1FZZA 4ZKRU 1WU1A 1N1LA 3PLPA 2QXJA 2A7JA 1C1VH 3LGIA 2BDCA 3M35A 3QX5H 2ZPQA 3EA8A 1GJ5H 3C1KA 3M3TA 4OS5A 2KAIA 5FX6A 1W0ZU 1XUHA 1FXYA 2ZGBH 2P93A 3I29A 4AB9A 2ZIQH 1C5LH 3PMJA 5ESTE 4Y0ZE 4AFQA 2P94A 4NFEA 1CHOG 1BA8B 2ZFRH 4D7FA 1UHBA 2GT8A 3PMBB 1ZMJA 1BTWA 2Q6DA 1D3QB 5C1XA 1GBCA 4XBBA 4X6MA 2FOCA 2O8TA 4BNRA 1QL7A 2EI8A 2ALVA 2Z9IA 1ANCA 5E2PA 4JZEH 5JPMH 5GDSH 2G8TA 1YPEH 3PTBA 3N7OA 3VB6A 1E0FD 1MCVA 1DWDH 2BLWA 1OPHB 2G55A 4Y7BA 5EPNA 1P57B 1AGJA 2J95A 2SGEE 3A7TA 3ZVFA 1BDAA 2GDEH 1VJ9U 1GVLA 1F0TA 2H1UA 4TY7A 3ZVDA 2EI7A 3ZZBA 1RS0A 4CRGA 1P09A 1B0FA 2W7SA 1FMGA 1YPGH 1FPCH 1NRPH 4JK5A 1O3LA 2Y81A 1O2KA 3SI4H 1ZTJA 2CN0H 4JCNA 1GI6A 1GI1A 1C2KA 1LCYA 2ZA5A 3RU4D 5HXFA 5F03A 1O2ZA 1C5OH 1AI8H 2ULLA 2J4IA 1D3TB 5GPIB 1VGCC 4YO9A 2CV3A 4DURA 2Y6TA 2BD3A 1NM6A 1HAZB 2BY8X 2BX3A 1GBTA 2Z9LA 2C93B 3RXGA 7GCHF 2WINI 3LJOA 1GG6C 4CR5A 3BTQE 5SGAE 1VCPA 2Z7FE 4LOYH 1GPZA 2OC1A 1ZTLA 1UTOA 2BD2A 3SZNA 1UCYH 1CSOE 4KGAA 4Q7XA 3QZRA 4XSKU 1GMCF 1DUAA 3ZYDA 3ZZ4A 1CA0B 2NU4E 4CRBA 5GWZA 1EJMA 3MU4A 3LJJA 2A4GA 5T6DA 1OP0A 3O8CA 1ARCA 1SLVB 5DJ7A 1EAUA 1L2EA 2PUQH 1LKAA 3BG4C 1EATA 1RIWB 1ZJKA 2ZWLH 3A86A 3UFAA 3UY9A 4Q80A 1G30B 1GJ8B 5DKMA 1CU1A 1HDTH 3B23B 1QA7A 1DWBH 1UTMA 2YNBA 4D76A 1SGCA 1RJXB 3MU8A 1BTHH 2FOFA 1HJAC 2ZDMA 2G00A 3OTJE 1OKXA 4XDEA 3SUEA 4CRAA 1LPGB 1GBHA 4WJG2 3TJNA 2ZC9H 2R2MB 4MPUA 2K1QA 3SV8A 1SC8U 3TVJB 1SHYA 1CE5A 1TX6A 4IMQA 2WPKS 2Y7XA 1QGFA 3VB5A 2XC0A 4ISNA 8GCHF 3S7HB 2WPMS 1AVWA 1MKXK 3ODFA 3T2NA 3TH2H 4XE4A 2Y5GA 4GPGA 5JBTA 3SUDA 3UOUA 5E2OA 2BY5X 1HAVA 1O2NA 3E16B 1GHAF 3MFJA 3L33A 1UK4A 4Q7ZA 4D9RA 1O5GH 1IOEA 3OY6U 5EQQA 3RMLH 1OWEA 1ZMLA 4NIWA 4MDSA 4Z0KA 3JZ2B 1A2CH 1N8OC 4E7RG 1O34A 1QRWA 2B9LA 1UTJA 4GHTA 3NZIA 1S83A 5LH8A 4Y8XA 3RXPA 2RA3A 1LVBA 3SUGA 1C2FA 1O30A 3UWIA 3UREA 1TONA 1YPKH 1L4ZA 1FAKH 1C2DA 3T26A 2I6QA 2DE9A 2O9QA 4MNVA 1PYTD 4RSPA 2FXRA 2ZDNA 3MOCA 1K1OA 3P70B 1V2MT 1ZHPA 2XCFA 3GY4A 1MQ5A 2BOHB 2XTTB 1C5RA 4BTUB 1A61H 1DLKB 2QY0B 1GJ9B 3SQHE 2A1DB 1F2SE 2AIQA 1ZGVA 3QWCH 1KLTA 2FYQA 3KQDA 2ZDKA 3UQVA 1O3AA 4FUCA 2FDAA 1ANEA 3SNBA 5DG6A 1MKWK 4AGKA 2XC5A 4JZIA 1V6DA 1CQQA 1BMNH 1Z8GA 3HGPA 1W3CA 1GCDA 1FIWA 1V2OT 3I78A 2ZFSA 1J9CH 2B8OH 1RTFB 1V2PT 2XW9A 1C2JA 1QL9A 1ELCA 1V2JT 2Z9JA 4LK4A 5FXLA 6GCHF 4O3TA 1C2EA 5EXMA 5EW2H 1GJBB 1F5KU 1C1MA 5BPEA 1KIGH 1ZPZA 1ZHRA 4ZHMU 1O2RA 1BB0B 1NRRH 1AO5A 2ZKSA 1YYY1 1BIOA 3TJOA 4OS2A 1K21H 4HTCH 4NIVA 2FS9A 4UD9H 3OY5U 1KXDA 1EXFA 3UOPA 3GDVA 1SR5C 1QJ7B 1QNJA 2F9VA 2BZ6H 2RDLA 3BV9B 1C5WB 2XBVA 4H6SB 1XXDA 1MAXA 2O8LA 3KCGH 4O03A