1L4ZA

X-ray crystal structure of the complex of microplasminogen with alpha domain of streptokinase in the presence cadmium ions
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
248
structure length
248
Chain Sequence
PSFDCGKPQVEPKKCPGRVVGGCVAHPHSWPWQVSLRTRFGMHFCGGTLISPEWVLTAAHCLEKSPRPSSYKVILGAHQEVNLEPHVQEIEVSRLFLEPTRKDIALLKLSSPAVITDKVIPACLPSPNYVVADRTECFITGWGETQGTFGAGLLKEAQLPVIENKVCNRYEFLNGRVQSTELCAGHLAGGTDSCQGDAGGPLVCFEKDKYILQGVTSWGLGCARPNKPGVYVRVSRFVTWIEGVMRNN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Plasminogen
publication title Effects of deletion of streptokinase residues 48-59 on plasminogen activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/blood clotting
total genus 53
structure length 248
sequence length 248
ec nomenclature ec 3.4.21.7: Plasmin.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1l4zA02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1l4zA01
2O8LA 3PM3A 1KTSB 1TRMA 1SR5C 4K1SA 4J1YA 4F4OC 2HNTC 1J16A 4SGBE 3ZZ9A 1HXEH 2R2WU 4ZKNU 3U98H 3RXQA 3UOPA 1FNIA 2YOLA 4INKA 1MQ6A 2STBE 2R3UA 1YLDA 4YM9A 1MKXH 3ATLA 3MU0A 2P93A 5DP3A 1H8IH 3RXFA 4KTSA 4LZ1H 5ABWA 1SGNE 4ZXXH 1GJ8B 1CHOG 1AI8H 2AFQB 1IQIA 2PHBA 1TNLA 3RXDA 3GDUA 4TY7A 4Y0YE 2DUCA 3S9CA 1AE5A 3SNDA 4NG9H 1QL8A 1MH0A 1PJPA 1W11U 2VNTA 5GDSH 4I32A 2BY7X 4AGKA 1OYTH 5CMXH 1E34B 2ZCLP 1MUEB 1WTHD 3H7OA 3MFJA 3NXPA 2H5DA 3RDZA 4I8LA 4ZHLU 2IOTA 2D2DA 1CT2E 1EZQA 1IQLA 3HKJB 4IMQA 1FUJA 1O2OA 1GI8B 1W14U 1DWDH 5C5OA 1MU8B 5C5NA 1QBOA 1TBZH 4CR5A 5B6OA 2GT7A 3E0PB 3BF6H 1W3CA 3BEIB 1ELCA 4DG4A 3ZV9A 1TOCB 1HLTH 1BA8B 4TPYA 2HNTE 2PKAB 1C2GA 1SFIA 3A7YA 3F9GA 3RUOA 7KMEH 2OC7A 1TQ7B 6LPRA 4YOJA 1ZJDA 1T8OA 1LHGH 1Z8JB 6CHAC 1TONA 1O3IA 5CHAB 1CBWB 2VVUA 1NRNH 3RXHA 1EQ9A 1FLEE 3ATWA 1J17T 1S81A 1ZPCA 1A7SA 2G00A 1BTPA 1VCPA 2J95A 2BDAA 1YPEH 1H9HE 3HATH 1NFXA 1EATA 1L2EA 4YT6H 1F0UA 1MZAA 2P59A 4WMDA 3GOVB 4X1PU 3FAOA 3KF2A 1ZSKA 1G2MA 1FPHH 3SU2A 1ELDE 4B76A 4GCHF 1GMCG 1NY22 4NZLA 2QYIA 1UK3A 4XBCA 3GCTF 1S83A 4A92A 1O0DH 1ELTA 2XBXA 4GVUA 2WPIS 1EZXC 1CO7E 1NRSH 1DT2A 1YPHC 1O2LA 2BY9X 2FZZA 3M35A 2GV6A 4WWYA 1V2VT 2JH0D 5F8TA 1ELEE 2PKAA 4Y8XA 1YCPM 3E1XB 4MPVA 1O2KA 1MZDA 3M7QA 2ZGBH 1SC8U 1QJ1B 3LH1A 4AG2A 3UOUA 9LPRA 1C1UH 4E05H 1GI5A 2UUJB 1NS3A 1HDTH 1OSSA 2ZDAH 1CSOE 1P3CA 3SNCA 2FTLE 3CP7A 1TNKA 3QZRA 1ELAA 4Q7YA 3DHKH 1O2JA 4JZ1A 1UTJA 5FX6A 2M5TA 1S85A 2TGPZ 2OINA 4B2CA 4H6SB 1J15A 1O3OA 3K9XB 2SGDE 2ZFPH 2FXRA 1MTNC 4GLYA 4X2XA 1H9IE 3TJNA 1ZPZA 4KP0A 4K1EA 1D3DB 2Q6FA 2WYJA 1FY4A 5DP7A 1DSUA 1QB9A 4ABBA 5IDKA 1WV7H 4ZKOU 1RTLA 1MBQA 1KLJH 2PWXA 1PQ8A 1S0RA 2EI8A 4NIVA 4UFEH 2PUQH 3L33A 3SU5A 1HJ9A 4O3UA 5TCAA 1OKXA 1HAVB 5C1UA 1YPHE 3ZZDA 1ANEA 1LVOA 1DVAH 1WOFA 3SNBA 3VB5A 1Q2WA 5AHGH 1TYNA 2G4UA 1GPZA 1GBLA 2PSXA 3A83A 4YZUA 1H1BA 2ZDVH 4MTBA 1TMUH 3GY7A 2ZDNA 1O5BB 2FWWA 3M37A 1GJ9B 3H5CB 3HK3B 1GI2A 4X0WU 5DP4A 4D9RA 3PLKA 1WQSA 1UVSH 1PPBH 4NGAH 1GI3A 2ZECA 1A0JA 1UTOA 4X6OA 5GXPA 4B2BA 2KAIB 4CR9A 1O3BA 1CT4E 3U8RH 1AD8H 3NWUA 1GCTB 3FFGA 1HAIH 1EJNA 2NU0E 4GHQA 1TAWA 1BZXE 1GBFA 1W0YH 2B7DH 1V2UT 4CRDA 1L1NA 1N6XA 3G01A 2Z9GA 1XM1A 2BDIA 2OQUA 2VWNA 1C5TA 2F9VA 3SV8A 2SGPE 1DPOA 4X1SU 2GD4B 1EAUA 1FY3A 2Y5HA 1T32A 1ZGIA 1YYY1 4R8TB 2BMGB 3T27A 1HAVA 5C1YA 1YCPH 2ANWA 4WMEA 1YCPK 5DP6A 5E2PA 1O2SA 1CGIE 1PFXC 1TRNA 2OTVA 3BEUA 2BQ7B 3HK6B 1PPZA 2OBQA 1L0ZA 1AFQC 3HKIB 1MTWA 1GMHG 3A86A 1C1TA 2W7SA 1SPJA 3Q76A 4ZHAA 3NCLA 5LH8A 3VXFH 3A7ZA 3M3SA 3UNRA 1RIWB 5AFZH 1BTYA 1XUHA 1W13U 4INHA 3SNEA 2KAIA 2QIQA 2A7JA 4Y8YA 3TK6A 1YM0A 5JB9S 2CMYA 5PTPA 4FUGA 2NU1E 3S7KB 2TIOA 1G2LA 3UQOA 1O35A 3AAVA 1SMFE 5BRRE 2FS8A 1A3EH 1EUFA 1MKWH 3UUZA 4O03A 1F5RA 3RXOA 3SU0A 5ESTE 1UHBB 1IAUA 2XWBI 3PYHA 1P06A 1B7XB 1TBRH 3C1KA 1UVUH 1V2QT 4YTAA 2Z9LA 1GCDA 5A8ZA 1O3PB 4PROA 3VB6A 4X6PA 5HYOA 1P9UA 1A5GH 1ZGVA 4TWYA 2R0KA 1LPZB 2FOGA 4JZDH 3BTGE 1LDTT 5A0BA 4YT7H 4DGJA 3VFEA 4BAOB 2BQ6B 1XKBC 1BTWA 1O2MA 2PFEA 3RXEA 1LVMA 3OY5U 2STAE 3SJOA 3ZZBA 2F9NA 1A46H 2PUXB 1UTQA 3DT0H 1F7ZA 4CHAB 4YLQH 3TPIZ 2ZU5A 1C2FA 5F8XA 2C8XB 3TK5A 1QL7A 1VZQH 1C2DA 1EOLA 1YF4A 1O3HA 1K1OA 1O5CB 2VIQA 2P8OB 1EX3A 1SGIB 3NK8A 5TJXA 4A1XA 2ZTYA 5HXFA 3ZZ8A 1ZOMA 2OC1A 1BOQA 3KQDA 4SGAE 2BLVA 2HGTH 1GVZA 1SGFG 3SJIA 1SQOA 4K5ZA 1NC6A 1BTUA 4UONA 1ZSLA 3LJJA 1OOKB 1V3XA 2GCTC 2PLXA 1UVOA 3EE0B 2A32A 1GJ6A 4Q7ZA 1EAWA 1FIWA 2A45B 1KDQA 1VGCC 4ZROA 2BD8A 2ZI2H 4I33A 2LPRA 2ZA5A 2SGAA 1N1LA 3BG4C 2QA9E 2FOCA 4LOYH 1Y3VA 2XW9A 2C93B 5L2YH 2J2UA 1E0FD 1GHZA 1PQ5A 3S7HB 2J38A 2FO9A 2ZU1A 1N8OB 2GZ8A 3QDZB 1JMOH 1ZTLA 3HPTB 1O3GA 4D9QA 4ABIA 1ZMNA 1JXPA 2BDGA 2WPLS 4FU7A 4ZKRU 3UPEA 1A0LA 2NU3E 2ZFTA 1O2ZA 3P8GA 3TGJE 4IBLH 4NWKA 1GJBB 1Q3XA 2PSYA 5JYIA 1QR3E 5A8XA 2R3YA 1OP0A 2ZPRA 3BTKE 5FPTA 3R3GB 5FCKA 1MCVA 2ZHEH 1Z6EA 1WYKA 1O5GH 1FV9A 2DE9A 4MG3A 4I8HA 4GHTA 1GHYH 8LPRA 2BVSH 1C2JA 1C2KA 5LPRA 1GBCA 1FI8A 1NFUA 3O8DA 2AMPA 3BIVH 2HNTF 1PYTD 3IG6B 2CN0H 1C2EA 5AFYH 4CRAA 3MH5A 4ABFA 3RXPA 4XOJA 4ABHA 1HB0B 1DWCH 1QBNA 2QAAA 5EPYA 3U9AH 2J94A 5DP5A 3SU6A 2XBYA 1ABJH 1A5HA 1WQVH 4H42U 4UDWH 3EAJA 2P3UB 1S82A 3GY4A 2BD4A 2Y7XA 3SQHE 3ZZ3A 5BPEA 1BBRK 1AWFH 1AQ7A 1TNGA 5GCHF 3M7TA 3A8BA 2BB4A 1BTZA 3E16B 2FOAA 4B75A 1ZRKA 2ZTZA 1OXGA 2EI6A 1YPKH 4OS5A 1D6WA 5LPFA 1ORFA 4Y76A 3MMGA 1AVXA 1AIXH 1UO6A 5A0CA 1HIAB 1K22H 3STIA 9ESTA 1F0RA 2D1JA 2OP9A 3GYMA 2HOBA 3VGCB 1P11E 2I6QA 3RXCA 1KXDA 2F9UA 1LKBA 1QURH 4ZH8A 1NROH 4BTTB 5EOKA 1P3EA 1GG6C 1K21H 1XXDA 2ZP0H 1C5VA 2A0QB 2ALVA 4TYDA 4MPXA 1YKTA 4AFSA 1BIOA 2FP7B 2Z3DA 2JETC 4CH2B 1Y3XA 3KL6A 1TFXA 2BD2A 2Y7ZA 3Q3XA 4GSOA 1KYNA 2QV1A 1FXYA 2V35A 1PPFE 1UTMA 1RTFB 1F0SA 1HJ8A 1ZLRA 1IHTH 3SU4A 4A7IB 1K1IA 3E8LA 1DM4B 4MNXA 2ANYA 1VR1H 1EP5A 2QF0A 1DSTA 1H8DH 4VGCB 3ZZ7A 2BOHB 4WF8A 1ESAA 1SGDE 4FUCA 5E0HA 3EA8A 4NFEA 1P2QA 4MQAA 1V2KT 4UEHH 3LC3A 5FPYA 1KXCA 2FIRH 1YGCH 3BV9B 1NPMA 1BHXB 8ESTE 2VGCC 2GZ7A 4ABJA 3SU3A 1BQYA 1NFYA 2UUFB 1DUAA 2QGRA 3TVJB 2Y81A 1HIAA 1S0QA 1XVMA 3ITIA 2SFAA 4ABAA 4FUFA 1HJAB 1C4Y2 1P2JA 4M7GA 3RXRA 3QZQA 5F6MA 4X1RU 1TABE 2C8ZB 4IN2A 2XC5A 3KN2A 4X1QU 3VB3A 3TNTA 5C67A 4FU9A 1GHVH 1RJXB 6GCHG 1QRWA 5T6GA 1WUNH 1O3MA 1F5LA 1K28D 1UTLM 3E6PH 1SQTA 8GCHG 4XBDA 1GVKB 4OS6A 4XE4A 1DWEH 4YOIA 5EQSA 1YP9A 4MNVA 3M3TA 1MKXK 4O3TA 5A8YA 1BRUP 1AB9B 3UIRA 2WINI 4B71A 5EGMA 5EQQA 3U1IB 2BDBA 1ABIH 1MAXA 3GCHB 1NN6A 3K6YA 3PO1C 1MU6B 2GMTC 3BTHE 4NSVA 4RKJB 2CXVA 3RXUA 1LHEH 4OGXA 3RXMA 3MO6A 3UR9A 1OP8A 3A8AA 1W7XH 4ZXYH 3DD2H 5IYTA 1SQAA 2Y6TA 2Q6DA 3V7TA 4AB9A 1B5GH 2P95A 1QBVH 1O2NA 1AMHA 1TGBA 4YOGA 2QXHA 2W3IA 1YPJH 1TGCA 2XNIA 2XYAA 3A89A 5JB8S 3BG8A 1VITF 4A1VA 1K9OE 1O2IA 3LKWA 2BZAA 2HPQH 4ASHA 1L1JA 1MD8A 1GHWH 5FXLA 1P9SA 3ZZ6A 4ZUHA 3PV4A 1OWEA 1TPPA 4Z0KA 2J92A 2A5AA 4UD9H 3T2NA 1O2XA 3PMJA 1B0EA 1UMAH 4Y71A 1PPHE 5EXMA 2VIWA 1UK4A 2B0FA 2YNBA 1E37B 3M5LA 3FVFB 1DWBH 1RD3B 2Z6BD 1GDNA 5JBBS 4X8SH 1VCQA 4IMZA 2V0BA 1CQQA 4Y8ZA 3M61U 1SOTA 5EODA 4Y11E 1O3NA 4BOHA 2F9PA 1XUKA 3VEQB 3Q3KA 3F68H 5DG6A 1C5LH 1SGYE 4DCDA 3RU4D 4XDEA 1UCYE 1SLWB 1V2TT 5DKMA 4ZMAH 2AMDA 3A7TA 1K1LA 1TPOA 4HGCA 1AGJA 1PPEE 1O3LA 1RRKA 1GWAA 3FP6E 2A5IA 3SO3A 2Y5GA 2QXJA 1XMNB 5JBCS 2GCHG 5GIBA 2Z94A 2ZQ2A 3M5NA 2FLRH 3SZNA 1C4V2 4YESB 2W5EA 1YC0A 3EDXB 5LPEA 1KXBA 1FN6A 3MWIU 1TLDA 3BN9A 5K0HA 2BXUH 1T8NA 2ESTE 4THNH 1LPGB 1AN1E 2C3SA 1Q31A 1Y3WA 4I8GA 1O33A 1O39A 3RMOH 2GKVE 5CHAC 1CBWC 1G3BA 3MU1A 3ZVDA 3M3VA 1TRYA 4BAKB 1Y3UA 4Y7BA 2Q6GA 1T4UH 1AFEH 1EZUC 1CA0B 1SSXA 2NU2E 2RDLA 3I77A 1C5QA 5DP9A 1MBMA 2PTCE 3ZVCA 1ELFA 3A84A 1NRRH 2FM2A 1IQEA 2CV3A 3TNSA 4ISLA 3VXEH 1O3FA 1C1WH 1AUJA 3MYWA 1ETTH 1GBEA 1Z1JA 1DXPA 1UCYH 1U6QA 2PGQB 3P92A 1Z1IA 1BMLA 1ARBA 1TMBH 1G3DA 1FY1A 2VINA 4GPGA 3QGNB 3RC4A 2VIDA 2HPPH 3QUMP 4JCNA 4UFGH 1KXEA 1QTFA 1AE8H 2C4FH 4K2YA 4I8JA 4BAHB 2QCYA 2A4OA 2HRVA 1CA8B 3C27B 1C5XB 1K1JA 3KQEA 4BXWA 3RXJA 3AAUA 7GCHF 3A8DA 3OSYA 3SUFA 1Y3YA 4LXBH 3SHCH 1ACBE 4YO9A 1TNHA 1RGQA 1AHTH 4HTCH 4BTUB 2Y80A 2V3HH 1FY8E 1E36B 1K2I1 1P01A 2THFB 4ISIH 3DFJA 1F92A 3U8OH 3RC6A 5I46H 1GJDB 1J8AA 4FUEA 3SV9A 3TGIE 1VJ9U 1DANH 4OGYA 1GVLA 1DLEA 3WY8A 2C8WB 1OP2A 3PMHB 1GHXH 2SGQE 2WPKS 4NCYA 2ZKSA 2PKSB 2CF8H 1C1OA 4CRGA 1XVOA 1C1QA 1GMDG 4DY7B 3JZ2B 1DY9A 3EYDA 1NTPA 4IC6A 4H4FA 3VPKA 1NO9H 2Y82A 2XC4A 5HMAA 3D62A 4HZHA 4RSPA 1ZZZA 1GDUA 2AIPA 3E91A 4D7FA 1S5SA 1DOJA 1AY6H 1E35B 1Y5UT 3UNQA 4AORA 7ESTE 1MQ5A 2O8MA 3ZVEA 3T62A 1GGDB 1GHBF 1UVPA 4AX9H 2PW8H 2F83A 2Z3CA 4B73A 3ODFA 2AGGX 2Z7FE 2Y5FA 2W3KA 3S9AA 1QCPA 3O8CA 3EA7A 3T26A 2ZCHP 1FMGA 1K1PA 1O3DA 3SUGA 1ESTA 2ANKH 3BTFE 1OS8A 2W26A 1DE7H 4X8VH 4BXSA 2CHAB 1MTSA 2TPIZ 3QK1A 1GJ4H 2FOEA 4U2WA 4AN7A 1IQNA 1SL3A 4DIHH 1C1NA 3SBKA 1CGJE 1Z6JH 3ZYDA 1X7AC 4B2AA 4DW2U 2BY5X 1GCTC 2C8YB 3SHAH 1CGHA 2SGFE 4ABDA 3RXGA 1SHHB 4B1TA 5JPMH 2LNCA 4FUJA 1INCA 5K7RA 1MKWK 3PTNA 1LQDB 2NU4E 3P70B 1S6FA 1KXFA 2BYAX 1PQAA 5E0JA 1NZQH 4O97A 1JIRA 4ISHH 1EXFA 1CVWH 1YPLH 1TIOA 3D49H 1FAXA 1IHSH 2GVFA 1EASA 3T5FH 3UR6A 3AW1A 3SJKA 1Y8TA 2G81E 1PPGE 5JBAS 4U01A 1C1PA 1A0HB 2SGEE 1D3QB 1O2VA 1W12U 2A7CA 1ZMLA 1DUEA 2WYGA 2G5NA 2CGAA 5EU8A 2XBWA 1RIWC 3FP8E 2GV7A 1C5PA 4FUHA 2BD3A 2ZIQH 1A61H 3RXVA 2A31A 4AFQA 1JWTA 3MH6A 3PWCA 3LGYA 3PMBB 1EB2A 4WMFA 5ETXA 1O2WA 4E7NA 2OLGA 2VJ1A 1Z8GA 3T25A 2DE8A 4Y0ZE 1CHOF 3ZYEA 1PYTC 1GBJA 3OY6U 3URDA 2ANMH 2G5VA 3MHWU 1AZ8A 3A80A 3LU9B 3PWBA 4GCHG 2JKHA 3K65B 1UHBA 3RXKA 2UWOA 3OTJE 3GCTG 1P2KA 2A2QH 2GGVB 4YLUA 1P03A 2EC9H 1SGCA 2G51A 1N6YA 5ESBA 3P17H 3A82A 3LDXH 4LK4A 3SN8A 3PTBA 1Z8IB 2F3CE 1RS0A 2WV5A 1UTNA 2FPZA 1J14A 3ZZ5A 2G55A 1HYLA 1LHDH 4IW4E 4ABEA 2UUKB 4XBBA 1GBAA 2B5TB 4CHAC 3MH4A 1LTOA 1NRPH 2OQ5A 3HGPA 1P2OA 1BB0B 3RMMH 3RU4T 4JMYA 3FZDA 2FS9A 1T7CA 1H4WA 1W0ZU 3MH7A 4FXGH 3TLOA 8KME2 2H1UA 2P8OC 1BJVA 1K1MA 3STJA 3ZVAA 5EW1H 3GY6A 1BBRE 2V6NA 2ODQA 4X2WA 1GJAB 4X8TH 1XXFA 2ZFRH 3OX7U 3UWJH 2WPHS 3P6ZB 3UNSA 2A1DB 1NFWA 4LZ4B 4JZIA 5HM2A 5G4BA 1ZHPA 2GT8A 4INLA 1EZSC 5EXNA 3TK9A 2XCFA 2B9LA 1FZZA 2Q1JA 1T8MA 3MNXA 1AWHB 3AW0A 3SUEA 5L6NH 2Z9KA 3MU5A 2YNAA 3M5MA 2ZFSA 1BRBE 1C5MD 2AGIX 1C2LA 2G52A 3RXLA 2TBSA 2VIPA 1FPCH 4Q80A 3ENSB 2PTNA 1N8OC 2FOBA 2K1QA 1BJUA 1BHXF 3MOCA 3SJ8A 1WBGB 4AYYB 1G32B 3RMLH 3SI3H 2BDCA 4GAWA 1GI6A 1SB1H 1O2YA 4UFFH 4BAQB 1ETSH 4IN1A 4U32A 3ZZ4A 1C1MA 5E0GA 4MDSA 2R2MB 2ZO3H 4HI3A 2P3TB 3KEEA 1NESE 4FVDA 2BTCE 3SOSA 1O30A 1GI7B 4X8UH 1EPTB 1Y59T 1GDQA 1HAYB 3RLYH 1C5OH 2P16A 3PLBA 1SHYA 1TX8A 1GJCB 4WXVA 1C4U2 4WXIA 4RKOB 3JZ1B 2BLQA 1XUIA 2GP9B 3SI4H 1O3EA 1SOZA 4H6TA 2AYWA 1QHRB 5GPIB 2AGEX 4JYVH 1ZJKA 2ZFQH 1HXFH 3EA9A 3L6PA 1AU8A 4AFUA 5AVDA 3I78A 4ESTE 1H9LB 1G30B 3UY9A 1THRH 4Y7AA 1QGFA 1LQEA 2XRCA 3GY8A 1MD7A 2FLBH 4Q7XA 5EPNA 3SGAE 3W95A 4NZQA 2A2XH 3QO6A 1P0SH 2WUBA 4XSKU 2OC8A 4HFPB 1IQMA 1DY8A 1QA7A 1CU1A 3MI4A 2ZGHA 1XUGA 3A88A 1A5IA 1TX7A 4O9VA 2ZCKP 2W7UA 2HVXA 1HAOH 3ESTA 4CRBA 4GUXA 5F03A 2BDHA 2ODYB 3A81A 2G8TA 3S9BA 5T3HA 4KTCA 1G9IE 1EAIA 2ULLA 1O31A 4CREA 1NM6A 1TX6A 1V2OT 2CJIA 3FANA 1IQFA 2V3OH 1V2JT 1P10A 1EPTA 2IPHA 4I31A 3VGCC 1E38B 2G4TA 3ZVBA 4AOQA 3D65E 1BRCE 1EP6A 3TITA 1LVYA 2AERH 2RA0A 2H2ZA 2BD9A 2VWLA 1OWJA 1GJ7B 1QL9A 4ISNA 1C9PA 2ZU3A 3V12A 1ETRH 3OYPA 1ZYOA 1BITA 4TPIZ 5DK1A 1OX1A 3TIUA 7LPRA 2BOKA 1GHAF 1ZTJA 3PMAB 1L1GA 1ZTKA 2WPJS 5A09A 1GI0A 3SGBE 1QQ4A 2J4IA 3I29A 1JIMA 1P57B 2AH4X 4NFFA 4A6LA 3U8TH 4VGCC 4AG1A 5A2MH 1LMWB 5I25A 1WAYB 5T6FA 4BAMB 2VWMA 3ATIA 3EGKH 1KIGH 1O3KA 1QB6A 1QNJA 1MAYA 1P2NA 4OS4A 2XWAA 1W8BH 1O5AB 2QC2A 1WCZA 1G36A 1TQ0B 1TGSZ 2BD7A 2WV4A 1V6DA 1S84A 2ZHQH 5FAHA 1FAKH 3PB1E 3QLPH 1HJAC 4WY3A 2ZNKH 1KLIH 1O2GH 1G37A 4WVPE 1Z7KA 1V2LT 1BCUH 1V2RT 2I6SA 1TPSA 3LGIA 4DURA 3ZVFA 1THSH 1FONA 1GMHF 1RXPA 1UTKA 1YPMH 1HGTH 3TJUA 1MCTA 2JH6D 1WSSH 1P8VC 4KELA 1D3TB 2VU8E 3F9HA 3A85A 3R0FA 6CHAB 1SLVB 1GL0E 3F9FA 1O36A 5LGOA 2WPMS 1LHCH 4FUIA 3QGJA 3BTDE 1L4DA 3UREA 1BMMH 2O8UA 1O2PA 3V13A 1FIZA 1T8LA 2TRMA 3P8OA 5FX5A 2VIOA 1D6RA 2XBVA 2AIQA 2FODA 1TWXB 5DO4H 2VWOA 1AB9C 4NIWA 1ZSJA 1QJ6B 2J34A 3M5OA 1EOJA 3MO3A 3GCHC 3KHVA 2UUYA 1BUIA 5FPSA 3KQBA 1G3CA 3M7UA 4MNYA 3Q77A 1O32A 1YBWA 4AYVB 3GY2A 5DP8A 4AFZA 1MTVA 2BY8X 4Y6DA 3DFLA 1A3BH 2BX3A 2XC0A 4MPUA 5DJ7A 3SJ9A 4BANB 3IWMA 3RU4E 4NIXA 1NRQH 1YLCA 2C90B 1SI5H 2EA3A 3UQVA 4CBOA 4X2YA 5DGJA 1MMJN 4KGAA 1TALA 4FVBA 3TH3H 4DJZB 1DX5M 1P12E 4J2YB 3RXSA 2PGBB 3LH3A 1TGTA 4K60A 1ZHRA 4K8YA 1ESBA 2FDAA 4CH8B 4F49A 2FEQH 2UWLA 2GX4A 2NWNA 1IQJA 3B8JA 2BM2A 1V2NT 2FESH 1O38A 1AO5A 1HUTH 1F5KU 1OWDA 1GI9B 2VIVA 3F1SB 2J9NA 1SG8B 4DT7B 3P8NA 1O5DH 2SNVA 2H9EH 3LPRA 4QT8C 3UTUH 3GCNA 2SNWA 5HGGA 1Z71A 2TGAA 4BTIB 2ODPA 3EQ0H 3GY3A 4AGJA 1O5FH 1MTNB 3L3TA 3UWIA 2BX4A 3QWCH 2EI7A 3U1JB 3NKKA 1G3EA 1ZHMA 4JZFH 2QXIA 5JDUB 5GCHG 3LONA 1C2HA 3TH2H 4DOQA 3O8RA 4TY6A 4R0IA 5EQRA 2OUAA 3DUXH 3GYLB 3D23A 3Q3YA 3SGQE 1EJMA 1J9CH 4D76A 3BTTE 2BXTH 4KTUA 1XUFA 5TCCA 3NZIA 3SV2H 3LC5A 5JBTA 1LPKB 3TH4H 5T6DA 1UCYK 5C2ZA 4MVNA 1UVTH 2D8WA 4JK5A 4KKDA 2BDYA 2QXGA 5AF9H 4A5TS 1EKBB 1P05A 2ZFFH 3KCGH 1SVPA 1GBDA 2ZWLH 4AZ2B 1BTXA 2ZEBA 1ANDA 3E90B 4IS5A 1OPHB 1ZRBA 1V2MT 1FN8A 1VCWA 1TBQH 2OC0A 1SGTA 1KLTA 3MNBA 3SV7A 4ZHMU 1XX9A 1TMTH 2GDEH 3U69H 1HV7A 1P02A 1CA0C 3P8FA 1XKAC 3RM0H 3RXTA 1EB1H 3SQEE 3ZZCA 1C1RA 3LGWA 1KY9A 2OD3B 3ATMA 1Z8RA 2BVXH 4WJG2 5E8EH 4FUDA 3VB4A 1BTHH 1C2MA 1DS2E 4OS2A 2ZDLA 1B0FA 1HAHH 2XXLA 2ZGXH 1QB1A 3FP7E 2HWLB 4JK6A 1QIXB 3ZVGA 2O8WA 2CF9H 2B8OH 1BMNH 1CHGA 2ZHFH 2BLWA 1AFQB 3A7XA 2FX4A 3E3TA 4NA8A 1QA0A 3FZZA 5EW2H 5DPAA 1ELBA 3PLPA 1TB6H 4TWWA 1GHAG 3P95A 1KXAA 2Z3EA 3OU0A 1TNJA 1O2UA 3MU8A 2BLOA 1P04A 1SGEE 2FTMA 3MNSA 3S0NA 1C5RA 3BTQE 4DIIH 1GJ5H 1XUJA 2RCEA 3T29A 1FY5A 2FI4E 1HAGE 1C1SA 1C9TA 1HPGA 1IQHA 2VH0A 1V2ST 1O3CA 4ISOA 2RA3A 2A7HA 1SGFA 1DDJA 1O2RA 2FMJA 3MNCA 1W2KH 2BD5A 1K1NA 2PKSC 2IN2A 3LGVA 4A1TA 5GJ4B 4CRFA 1P09A 2JH5D 4NA9H 1JOUB 1O2QA 3KNXA 1TOMH 1HBTH 2UWPA 3LT3A 1D3PB 1AVWA 2VVCA 5C3NA 1HNEE 1IQKA 5E2OA 2D26C 3SW2B 3AVZA 4D7GA 1ANBA 3BTME 1Y5AT 1QJ7B 4U30A 4NWLA 3KIDU 3A7WA 2F9OA 1GGDC 1TE0A 1VITG 1UTPA 2AEIH 2FOHA 3N7OA 1ELGA 3TGKE 3M36A 1TPAE 4RN6A 2ZPQA 1HAZB 1TGNA 1O34A 2PR3A 3A7VA 1D4PB 1T4VH 1AZZA 1ZR0A 3RP2A 6GCHF 2Z9IA 1VITH 1SFQB 3UFAA 2CHAC 1FJSA 1GBTA 1DICA 2BY6X 1DXWA 2GCTB 2H9TH 1KDQB 1V2WT 3GCOA 3DA9B 8GCHF 1S6HA 3V0XA 1RFNA 1EAXA 2R9PA 1QRZA 1VGCB 1O3AA 2P94A 1TNIA 1FQ3A 4E7RG 3TJOA 2Z9JA 3BG4B 2TGDA 2VVVA 2AMQA 4ZAEA 3ODDA 2TGTA 3MTYA 1BMAA 2A4QA 1WU1A 3RC5A 1QY6A 2GTBA 1KTTB 1LO6A 2ZZUH 1OWHA 3KGPA 2ZDKA 1IOEA 2H9HA 4ZKSU 1O37A 3VB7A 1ID5H 5EG4A 3ATKA 2GDDA 2ILNA 2ZU4A 1LVBA 1LHFH 4NA7A 5FCRA 1VJAU 1A4WH 2ASUB 4CRCA 3RXIA 3A8CA 1F2SE 3Q00A 2BVRH 1GBMA 4Y10E 1C5SA 3QX5H 4ABGA 4OS7A 1ZMJA 2ZTXA 2WUCA 1RTKA 2BZ6H 4E06H 5SGAE 5GWZA 3V3MA 2F91A 3QN7A 4X2VA 1JBUH 1UJ1A 1ARCA 1OYQA 2VH6A 4D8NA 2ZGCA 1LCYA 2BHGA 2QF3A 3CS0A 1QRXA 3GDSA 4BNRA 1YPGH 4MPWA 5F8ZA 4FU8A 4MLFB 5FHTA 2HALA 2ZQ1A 1GL1A 2HLCA 2ZDMA 2ZHWH 1GI4A 2FI3E 1THPB 4MNWA 1SLXB 3AASA 3LIWA 3LGTA 2FYQA 3H7TA 1NU9A 1C5YB 2FOFA 1FDPA 5C20A 5EXLA 4DVAU 4Y79A 4FUBA 3MU4A 3SUDA 1V2PT 5FBIA 3BTWE 4K1TA 1AUTC 3T28A 3SORA 1BRAA 1C2IA 2O8TA 2QY0B 1QQUA 4OS1A 2OBOA 1C5NH 3GICB 1GI1A 1DLKB 1C1VH 5L2ZH 2ZPSA 4K3JA 4IC5A 3O8BA 3LJOA 5C1XA 3PROA 1M9UA 1SBWA 1DITH 4I7YH 1GMCF 1HAXB 2H5CA 2EEKA 1T31A 2FI5E 2FOMB 2ZF0H 3MO9A 7GCHG 3W94A 3IITA 1NU7B 3BEFB 2XTTB 2GCHF 1WTGH 3RM2H 1AKSB 1KSNA 1GG6B 3F9EA 3CENA 1BT7A 2QN5T 2ZU2A 3B9FH 3NUMA 3RMNH 5H4IB 3S69A 1L4ZA 1GBKA 2JETB 2A5KA 1MTUA 4WH6A 3SNAA 5HM9A 3A87A 3URCA 3F6UH 1PQ7A 1SGQE 4CBNA 4JYTA 3LGUA 5FBEA 3K2UA 1BBRH 1OWIA 2O9QA 3HGNA 2OCVB 5A0AE 2XCNA 2IJOB 1HCGA 1JRSA 1F0TA 2AS9A 3GY5A 3K6ZA 4NIYA 1O2TA 1TA6A 2VB0A 2A4GA 1O5EH 3RXAA 1IQGA 3TJVA 1GBBA 4AB8A 2FX6A 4Z6AH 4UFDH 1TA2A 2VGCB 4X6NA 1P2IA 4WH8A 1CE5A 1PPCE 5J4SA 1LKAA 1GHBG 1QFKH 3BSQA 2OXSA 4K69A 5J4QA 2ZHDA 3RLWH 1HAPH 3CS7A 3QTVH 1ANCA 3BIUH 1AKSA 2ALPA 2ZGJA 1HFDA 1HRTH 1C5WB 1ZPBA 3RXBA 1SLUB 1AVGH 4XFQA 1ELVA 3BTEE 4Q2KA 1EPTC 1P2MA 1SGPE 3ELAH 4UE7H 4X1NU 1A1RA 3SV6A 4IGDA 2ZC9H 2H6MA 1DFPA 3B23B 1CT0E 4X6MA 3ZZAA 4K8BA 1SGRE 1UK2A 4JZEH 5L30H 2GZ9A 5CE1A 1C5ZB 1GBHA 3E0NB 1O2HA 1D9IA 4B74A 6ESTA 3NPSA 3LOXA 4JYUH 1OWKA 2P3FH 1GMDF 2R0LA 2GMTB 3PO1B 3KQCA 3SU1A 1Y5BT 3ZV8A 1GBIA 2PV9B 2F9BH 2FYRA 3GISB 4NSYA 1W7GH 2BQWB 2ZG0H 1EJAA 3GDVA 1NT1A 2A4RA 1A2CH 1JRTA 3QTOH 4I8KA 1O3JA 3TU7H 2RG3A 1BDAA 1W10U 1C5UA
chains in the Genus database with same CATH superfamily
2O8LA 3PM3A 1KTSB 1TRMA 1SR5C 4K1SA 1SKYE 4J1YA 4F4OC 2HNTC 1J16A 4SGBE 3ZZ9A 1HXEH 2R2WU 4ZKNU 3U98H 3RXQA 3UOPA 1FNIA 2YOLA 4INKA 4RT1A 1MQ6A 2STBE 2R3UA 1YLDA 4YM9A 1MKXH 3ATLA 3MU0A 2P93A 5DP3A 1H8IH 3RXFA 4KTSA 4LZ1H 5ABWA 1SGNE 4ZXXH 1GJ8B 1CHOG 1AI8H 2AFQB 1IQIA 2PHBA 1TNLA 3OAAD 3RXDA 3GDUA 4TY7A 4Y0YE 2DUCA 3S9CA 1AE5A 3SNDA 4NG9H 1QL8A 1MH0A 1PJPA 1W11U 2VNTA 5GDSH 4I32A 2BY7X 4AGKA 1OYTH 5CMXH 1E34B 2V7QD 2ZCLP 3OEHD 1MUEB 1WTHD 3H7OA 3MFJA 3NXPA 2H5DA 3RDZA 4I8LA 4ZHLU 2IOTA 2D2DA 1CT2E 1EZQA 1IQLA 3HKJB 4IMQA 1FUJA 1O2OA 1GI8B 1W14U 1DWDH 5C5OA 1MU8B 5C5NA 1QBOA 1TBZH 3UAIC 4CR5A 5B6OA 2GT7A 3E0PB 3BF6H 1W3CA 2EY4C 3BEIB 1ELCA 4DG4A 3ZV9A 1TOCB 1HLTH 1BA8B 4TPYA 2HNTE 2PKAB 1C2GA 1SFIA 3A7YA 3F9GA 3RUOA 7KMEH 2OC7A 1TQ7B 6LPRA 4YOJA 3F0PA 1ZJDA 1T8OA 5DSFA 1LHGH 1Z8JB 6CHAC 1TONA 1O3IA 2QE7D 5CHAB 1CBWB 2VVUA 1NRNH 3KYGA 3RXHA 1EQ9A 1FLEE 3ATWA 1J17T 1S81A 1ZPCA 1A7SA 2G00A 1BTPA 1VCPA 2J95A 2BDAA 1YPEH 1H9HE 3HATH 1NFXA 1EATA 1L2EA 4YT6H 1F0UA 1MZAA 2P59A 4WMDA 3GOVB 4X1PU 3FAOA 3KF2A 1ZSKA 4Q4LA 1G2MA 1FPHH 3N7EA 3SU2A 1ELDE 5CHBA 4B76A 4GCHF 1GMCG 1NY22 4NZLA 2QYIA 1UK3A 4XBCA 3GCTF 1S83A 4A92A 1O0DH 1ELTA 2XBXA 4GVUA 2WPIS 1EZXC 1CO7E 1NRSH 1DT2A 1YPHC 1O2LA 2BY9X 2FZZA 3M35A 2GV6A 4WWYA 1V2VT 2JH0D 5F8TA 1ELEE 2PKAA 4Y8XA 1YCPM 3E1XB 4B6EA 4MPVA 1O2KA 1MZDA 3M7QA 2ZGBH 1SC8U 1QJ1B 3LH1A 4AG2A 3UOUA 9LPRA 1C1UH 4E05H 1GI5A 2UUJB 1NS3A 1HDTH 1OSSA 2ZDAH 3FN8A 1CSOE 1P3CA 3SNCA 2FTLE 3CP7A 1YY3A 1TNKA 3QZRA 1ELAA 4Q7YA 3DHKH 1O2JA 4JZ1A 1UTJA 5FX6A 3OEED 2M5TA 1S85A 2TGPZ 3WWFA 2OINA 4B2CA 4H6SB 1J15A 1O3OA 3K9XB 2SGDE 2ZFPH 2FXRA 1MTNC 4GLYA 4X2XA 1H9IE 3TJNA 1ZPZA 4KP0A 3UB0A 4K1EA 1D3DB 2Q6FA 2WYJA 1FY4A 5DP7A 1DSUA 1QB9A 2KR7A 4ABBA 5IDKA 1WV7H 4ZKOU 1RTLA 1MBQA 1KLJH 2PWXA 1PQ8A 1S0RA 2EI8A 4NIVA 4UFEH 2PUQH 3L33A 3SU5A 3W1EA 1HJ9A 4O3UA 5TCAA 1OKXA 1HAVB 3DSOA 1YPHE 5C1UA 3ZZDA 1ANEA 1LVOA 1DVAH 1WOFA 3SNBA 3VB5A 1Q2WA 5AHGH 1TYNA 2G4UA 1GPZA 1GBLA 2PSXA 3A83A 4YZUA 1H1BA 4ZCNA 2ZDVH 4MTBA 1TMUH 3GY7A 2ZDNA 1O5BB 2FWWA 3M37A 1GJ9B 3H5CB 3HK3B 1GI2A 4X0WU 5DP4A 4D9RA 3PLKA 1WQSA 1UVSH 1PPBH 4NGAH 5C17A 1GI3A 2ZECA 1A0JA 1UTOA 4X6OA 5GXPA 4B2BA 2KAIB 4CR9A 1O3BA 1CT4E 3U8RH 1AD8H 3NWUA 1GCTB 3FFGA 1HAIH 1EJNA 2NU0E 2WSSD 2YMSC 4GHQA 1TAWA 1BZXE 2WPDD 1GBFA 1W0YH 2B7DH 1V2UT 4CRDA 1L1NA 1N6XA 3G01A 2Z9GA 1XM1A 2BDIA 2OQUA 2VWNA 1C5TA 2F9VA 3SV8A 2SGPE 1DPOA 4X1SU 2GD4B 1EAUA 1FY3A 2Y5HA 1T32A 1ZGIA 1YYY1 4R8TB 2BMGB 3T27A 1HAVA 5C1YA 1YCPH 2ANWA 4WMEA 1YCPK 5DP6A 3CNRA 5E2PA 1O2SA 1CGIE 1PFXC 1TRNA 2OTVA 3BEUA 2BQ7B 3HK6B 1PPZA 2OBQA 1L0ZA 5CDFE 1AFQC 3HKIB 1MTWA 1GMHG 3A86A 1C1TA 2W7SA 1COWD 1SPJA 3Q76A 4ZHAA 3NCLA 5LH8A 3VXFH 3A7ZA 3M3SA 3UNRA 1RIWB 5AFZH 4FETA 1BTYA 1XUHA 1W13U 4INHA 2LP6A 3SNEA 2KAIA 2QIQA 2A7JA 4Y8YA 3TK6A 1YM0A 5JB9S 2CMYA 5PTPA 4FUGA 2NU1E 3S7KB 2TIOA 1G2LA 3UQOA 1O35A 3AAVA 1SMFE 5BRRE 2FS8A 1A3EH 1EUFA 1MKWH 3UUZA 4O03A 1F5RA 3RXOA 3SU0A 5ESTE 1UHBB 1IAUA 2XWBI 3PYHA 1P06A 1B7XB 1TBRH 3C1KA 1UVUH 1V2QT 4YTAA 2Z9LA 1GCDA 5A8ZA 1O3PB 4PROA 3VB6A 4X6PA 5HYOA 1P9UA 1A5GH 1ZGVA 4TWYA 2R0KA 1LPZB 2FOGA 4JZDH 3BTGE 1LDTT 5A0BA 4YT7H 4DGJA 3VFEA 4BAOB 2BQ6B 1XKBC 1BTWA 1O2MA 2PFEA 3RXEA 1LVMA 3OY5U 2STAE 3SJOA 3ZZBA 2F9NA 1A46H 2PUXB 1UTQA 3DT0H 1F7ZA 4CHAB 5GNDA 4YLQH 3TPIZ 1W0KD 1E1QD 2ZU5A 1C2FA 5F8XA 2C8XB 3TK5A 1QL7A 1VZQH 1C2DA 1EOLA 1YF4A 1O3HA 1K1OA 1O5CB 2VIQA 2P8OB 1EX3A 1SGIB 3NK8A 4M9FA 5TJXA 4A1XA 2ZTYA 5HXFA 3ZZ8A 1ZOMA 2GJGA 2OC1A 1BOQA 3KQDA 4SGAE 2BLVA 2HGTH 1GVZA 1SGFG 3SJIA 1SQOA 4K5ZA 1NC6A 1BTUA 4UONA 1ZSLA 3LJJA 1OOKB 1V3XA 2GCTC 2PLXA 1UVOA 3EE0B 2A32A 1GJ6A 4Q7ZA 1EAWA 1FIWA 2A45B 1KDQA 1VGCC 4ZROA 2BD8A 2ZI2H 4I33A 2LPRA 2ZA5A 2SGAA 1N1LA 3BG4C 2QA9E 2FOCA 4LOYH 1Y3VA 2XW9A 3PV2A 2C93B 5L2YH 2CK3D 2J2UA 1E0FD 1GHZA 1PQ5A 3S7HB 2J38A 2FO9A 2ZU1A 1N8OB 2GZ8A 3QDZB 1JMOH 1ZTLA 3HPTB 1O3GA 4D9QA 4ABIA 1ZMNA 1JXPA 2BDGA 2WPLS 4FU7A 4ZKRU 3UPEA 1A0LA 2NU3E 2ZFTA 1O2ZA 3P8GA 4FOUC 4IBLH 3TGJE 4NWKA 1GJBB 1Q3XA 2PSYA 5JYIA 1QR3E 3OE7D 5A8XA 2R3YA 1OP0A 2ZPRA 3BTKE 5FPTA 3R3GB 5FCKA 1MCVA 2ZHEH 1Z6EA 1WYKA 1O5GH 1FV9A 2DE9A 4MG3A 4I8HA 4GHTA 1GHYH 8LPRA 2BVSH 1C2JA 1C2KA 5LPRA 1GBCA 1FI8A 1NFUA 3O8DA 2AMPA 3BIVH 2HNTF 1PYTD 3IG6B 2CN0H 1C2EA 5AFYH 4CRAA 2VBCA 3MH5A 4ABFA 3RXPA 4XOJA 4ABHA 2EQNA 1HB0B 1DWCH 1QBNA 2QAAA 5EPYA 3U9AH 2J94A 5DP5A 3SU6A 2XBYA 1ABJH 1A5HA 1WQVH 4H42U 4UDWH 3EAJA 2P3UB 1S82A 3GY4A 2BD4A 2Y7XA 3KQ5A 3SQHE 3ZZ3A 5BPEA 1BBRK 1AWFH 1AQ7A 1TNGA 5GCHF 3M7TA 3A8BA 2BB4A 1BTZA 3E16B 2FOAA 4B75A 1ZRKA 2ZTZA 1OXGA 2EI6A 1YPKH 4OS5A 1D6WA 5LPFA 1ORFA 4Y76A 2V3MA 2KZ4A 3MMGA 1AVXA 1AIXH 1UO6A 5A0CA 2KFWA 1HIAB 1K22H 3STIA 9ESTA 1F0RA 2D1JA 2OP9A 3GYMA 2HOBA 3VGCB 1P11E 2I6QA 3RXCA 1KXDA 2F9UA 1LKBA 1QURH 4ZH8A 1NROH 4BTTB 5EOKA 1P3EA 1GG6C 1K21H 1XXDA 2ZP0H 1C5VA 3F2GA 2A0QB 2ALVA 4TYDA 4MPXA 1YKTA 4AFSA 1BIOA 2FP7B 2Z3DA 2JETC 4CH2B 1Y3XA 3KL6A 1TFXA 2BD2A 2Y7ZA 3Q3XA 4GSOA 1KYNA 2QV1A 1FXYA 2V35A 1PPFE 1UTMA 1RTFB 1F0SA 1FX0B 1HJ8A 1ZLRA 1IHTH 3SU4A 4A7IB 1K1IA 3E8LA 1DM4B 4MNXA 2ANYA 1VR1H 2F43B 1EP5A 4AC9A 2QF0A 1DSTA 1H8DH 4VGCB 2LELA 3ZZ7A 2BOHB 2KM0A 4WF8A 1ESAA 1SGDE 4FUCA 5E0HA 3EA8A 4NFEA 1P2QA 4MQAA 1V2KT 4UEHH 3LC3A 5FPYA 1KXCA 2FIRH 1YGCH 3BV9B 1NPMA 1BHXB 2XOKD 8ESTE 2VGCC 2GZ7A 4ABJA 4ASUD 3SU3A 1BQYA 1NFYA 2UUFB 1DUAA 2QGRA 3TVJB 5HKKD 2Y81A 1HIAA 1S0QA 1XVMA 3ITIA 2SFAA 4ABAA 2F4LA 1HJAB 4FUFA 1C4Y2 1P2JA 4M7GA 3RXRA 3QZQA 5F6MA 4X1RU 1TABE 2C8ZB 4IN2A 2XC5A 3KN2A 4X1QU 3VB3A 2RFKC 3TNTA 5C67A 4FU9A 1GHVH 1RJXB 3KYFA 6GCHG 1QRWA 5T6GA 1WUNH 1O3MA 1F5LA 1K28D 2J98B 1UTLM 3E6PH 3F2HA 1SQTA 8GCHG 4XBDA 1GVKB 4OS6A 4XE4A 3SZEA 1DWEH 4YOIA 5EJZA 5EQSA 1YP9A 4MNVA 3M3TA 1MKXK 4O3TA 1NBMD 2KCOA 5A8YA 1BRUP 1AB9B 3UIRA 2WINI 4B71A 5EGMA 5EQQA 3U1IB 2BDBA 1ABIH 1MAXA 3GCHB 1NN6A 3K6YA 3PO1C 1MU6B 2GMTC 3BTHE 4NSVA 4RKJB 2CXVA 3RXUA 1LHEH 4OGXA 1W0JD 3RXMA 3MO6A 3UR9A 1OP8A 3A8AA 1W7XH 4ZXYH 3DD2H 5IYTA 1SQAA 2Y6TA 2Q6DA 3V7TA 4AB9A 1B5GH 2P95A 1QBVH 1O2NA 1AMHA 1TGBA 4YOGA 2QXHA 2W3IA 1YPJH 1TGCA 2XNIA 2XYAA 3A89A 5JB8S 3BG8A 1UW7A 1VITF 2K0QA 4A1VA 1BMFD 1K9OE 2J98A 1O2IA 3LKWA 2BZAA 2HPQH 4ASHA 1L1JA 1MD8A 4HG6A 1GHWH 5FXLA 1P9SA 3ZZ6A 4ZUHA 3PV4A 1OWEA 1TPPA 4Z0KA 2J92A 2A5AA 4UD9H 3T2NA 1O2XA 3PMJA 1B0EA 1UMAH 4Y71A 1PPHE 5EXMA 2VIWA 1UK4A 2B0FA 2YNBA 1E37B 3M5LA 3FVFB 1DWBH 1RD3B 2Z6BD 1GDNA 5JBBS 4X8SH 1VCQA 4IMZA 2V0BA 1CQQA 4Y8ZA 3M61U 1SOTA 5EODA 4Y11E 1O3NA 4BOHA 2F9PA 1XUKA 3VEQB 3Q3KA 3F68H 5DG6A 1C5LH 1SGYE 4DCDA 3RU4D 4XDEA 1UCYE 5KGOA 1SLWB 1V2TT 5DKMA 4ZMAH 2AMDA 3A7TA 1K1LA 1TPOA 4HGCA 1AGJA 1PPEE 3WW7A 1O3LA 1RRKA 1GWAA 3FP6E 2W6JD 2A5IA 3SO3A 2Y5GA 2QXJA 1XMNB 5JBCS 2GCHG 5GIBA 2Z94A 2WV9A 2ZQ2A 3M5NA 2FLRH 3SZNA 1C4V2 4YESB 2W5EA 1YC0A 3EDXB 5LPEA 1KXBA 2KCYA 1FN6A 3MWIU 2KCAA 1TLDA 2J5UA 3BN9A 5K0HA 2BXUH 1T8NA 2ESTE 4THNH 1LPGB 1AN1E 2C3SA 1Q31A 1Y3WA 4I8GA 1O33A 1O39A 3RMOH 2GKVE 5CHAC 1CBWC 1G3BA 3MU1A 3ZVDA 3M3VA 1TRYA 4XD7D 4BAKB 1Y3UA 4Y7BA 2Q6GA 1T4UH 1AFEH 1EZUC 1CA0B 1SSXA 2NU2E 2RDLA 3I77A 1C5QA 5DP9A 1MBMA 2PTCE 3ZVCA 1ELFA 3A84A 1NRRH 2FM2A 1IQEA 2CV3A 3FO8D 3TNSA 4ISLA 3VXEH 1O3FA 1C1WH 1AUJA 3MYWA 1ETTH 4RT0A 1GBEA 1Z1JA 1DXPA 1UCYH 1U6QA 2PGQB 3P92A 1Z1IA 1BMLA 1E1RD 1ARBA 1TMBH 1G3DA 1FY1A 2VINA 4GPGA 1K0HA 3QGNB 3RC4A 2VIDA 3N99A 2HPPH 3QUMP 4JCNA 4UFGH 1KXEA 1QTFA 1AE8H 2C4FH 4K2YA 4I8JA 4BAHB 2QCYA 2A4OA 2HRVA 1CA8B 5B6LA 3C27B 1C5XB 1K1JA 3KQEA 3WWBA 4BXWA 3RXJA 3AAUA 7GCHF 3A8DA 3OSYA 3SUFA 1Y3YA 4LXBH 3SHCH 1ACBE 4YO9A 1TNHA 1RGQA 1AHTH 4HTCH 4BTUB 2Y80A 2V3HH 1FY8E 1E36B 1K2I1 1P01A 2THFB 4ISIH 3DFJA 1F92A 3U8OH 3RC6A 5I46H 1GJDB 1J8AA 4FUEA 3SV9A 3TGIE 1VJ9U 1DANH 4OGYA 1GVLA 1DLEA 3WY8A 2C8WB 1OP2A 3PMHB 1GHXH 2SGQE 2WPKS 4NCYA 2ZKSA 4OM9A 2PKSB 2CF8H 1C1OA 4CRGA 1XVOA 1C1QA 5KECA 1GMDG 4DY7B 3JZ2B 1DY9A 3EYDA 1NTPA 4IC6A 4H4FA 3VPKA 1NO9H 2Y82A 2XC4A 5HMAA 3D62A 4HZHA 4RSPA 1ZZZA 1GDUA 2AIPA 1EFRD 3E91A 4D7FA 1S5SA 1DOJA 1AY6H 1E35B 1Y5UT 3UNQA 4AORA 7ESTE 1MQ5A 2O8MA 3ZVEA 3T62A 1GGDB 5IK2D 1GHBF 1UVPA 4AX9H 1KMHB 2PW8H 2F83A 2W6ID 2Z3CA 4B73A 3ODFA 2AGGX 2Z7FE 2Y5FA 2W3KA 3S9AA 1QCPA 3O8CA 3EA7A 3T26A 2ZCHP 1FMGA 1K1PA 1O3DA 3VG8A 4ACBA 3SUGA 1ESTA 2ANKH 3BTFE 1OS8A 2W26A 1DE7H 4X8VH 4BXSA 2CHAB 1MTSA 2TPIZ 3QK1A 1GJ4H 2FOEA 4U2WA 4AN7A 1IQNA 1SL3A 4DIHH 1C1NA 3SBKA 1CGJE 1Z6JH 3ZYDA 4ACAA 1X7AC 2QF4A 4B2AA 4DW2U 2BY5X 1GCTC 2C8YB 3SHAH 1CGHA 2SGFE 4ABDA 3RXGA 1SHHB 4B1TA 5JPMH 2LNCA 4FUJA 1INCA 5K7RA 1MKWK 3PTNA 1LQDB 2NU4E 3P70B 1S6FA 1KXFA 2BYAX 1PQAA 5E0JA 1NZQH 4O97A 1JIRA 4ISHH 1EXFA 1CVWH 1YPLH 1TIOA 3D49H 1FAXA 1IHSH 2GVFA 1EASA 3T5FH 3UR6A 3AW1A 3SJKA 1Y8TA 2G81E 1PPGE 5JBAS 4U01A 1C1PA 1A0HB 2SGEE 1D3QB 1O2VA 1W12U 5C0TA 2A7CA 1ZMLA 1DUEA 2WYGA 2G5NA 2CGAA 5EU8A 2XBWA 1RIWC 4DT4A 3FP8E 2GV7A 1C5PA 4FUHA 2BD3A 2ZIQH 1A61H 3RXVA 2A31A 4AFQA 1JWTA 3PRBA 3MH6A 3PWCA 3LGYA 3PMBB 4RI0A 1EB2A 4WMFA 5ETXA 1O2WA 4E7NA 2OLGA 2VJ1A 1Z8GA 3T25A 2DE8A 4Y0ZE 1CHOF 3ZYEA 1PYTC 1GBJA 3OY6U 3URDA 2ANMH 2G5VA 3MHWU 1AZ8A 3A80A 3LU9B 3PWBA 4GCHG 2JKHA 3K65B 1UHBA 3RXKA 2UWOA 1SQRA 3OTJE 3GCTG 1P2KA 2A2QH 2GGVB 4YLUA 1P03A 2EC9H 1SGCA 2G51A 1N6YA 5ESBA 3P17H 3A82A 3LDXH 4LK4A 3SN8A 3PTBA 1Z8IB 2F3CE 1RS0A 2WV5A 1UTNA 2FPZA 1J14A 1WXRA 2JJ1D 3ZZ5A 2G55A 1HYLA 1LHDH 4IW4E 4ABEA 2RDEA 5HIYA 2UUKB 4XBBA 1GBAA 2B5TB 4CHAC 3MH4A 1LTOA 1NRPH 2OQ5A 3HGPA 1P2OA 1BB0B 3RMMH 3RU4T 4JMYA 3FZDA 2FS9A 1T7CA 1H4WA 1W0ZU 3MH7A 4FXGH 3TLOA 8KME2 2H1UA 1E79D 2P8OC 1BJVA 1K1MA 3STJA 3ZVAA 5EW1H 3GY6A 1BBRE 2V6NA 2ODQA 3ZIAD 4X2WA 1GJAB 4X8TH 1XXFA 2ZFRH 3OX7U 3UWJH 2WPHS 3P6ZB 3UNSA 2A1DB 1NFWA 4LZ4B 4JZIA 5HM2A 5G4BA 1ZHPA 2GT8A 4INLA 1EZSC 5EXNA 3TK9A 2XCFA 2B9LA 1FZZA 2Q1JA 1T8MA 3MNXA 1AWHB 3AW0A 3MQKC 3SUEA 5L6NH 2Z9KA 3MU5A 2YNAA 3M5MA 2ZFSA 1BRBE 1C5MD 2AGIX 1C2LA 2G52A 3RXLA 2TBSA 2VIPA 1FPCH 4Q80A 3ENSB 2PTNA 1N8OC 2FOBA 2K1QA 1BJUA 1BHXF 3MOCA 3SJ8A 1WBGB 4AYYB 1G32B 3RMLH 3SI3H 2BDCA 4GAWA 1GI6A 1SB1H 1O2YA 4UFFH 4BAQB 1ETSH 4IN1A 4U32A 3ZZ4A 1C1MA 5E0GA 4MDSA 2R2MB 2ZO3H 4HI3A 2P3TB 3KEEA 1NESE 4FVDA 2BTCE 3SOSA 1O30A 1GI7B 4X8UH 1EPTB 1Y59T 1GDQA 1HAYB 3RLYH 1C5OH 2P16A 3PLBA 1SHYA 1TX8A 1GJCB 4WXVA 1C4U2 4WXIA 4RKOB 3JZ1B 2BLQA 1XUIA 2GP9B 3SI4H 1O3EA 1SOZA 4TSFD 4H6TA 2AYWA 1QHRB 2JDID 2AGEX 5GPIB 4JYVH 1ZJKA 2ZFQH 1HXFH 3EA9A 3L6PA 1AU8A 4AFUA 5AVDA 3I78A 4ESTE 1H9LB 1G30B 3UY9A 1THRH 4Y7AA 1QGFA 3FKSD 1LQEA 2XRCA 3GY8A 1MD7A 2FLBH 4Q7XA 5EPNA 4XRNA 3SGAE 3W95A 3F0OA 4NZQA 2A2XH 3QO6A 1P0SH 2WUBA 4XSKU 2OC8A 5EJLA 4HFPB 1IQMA 1DY8A 1QA7A 1CU1A 3MI4A 2ZGHA 1XUGA 3A88A 1A5IA 1TX7A 4O9VA 2ZCKP 2W7UA 1H8ED 2HVXA 1HAOH 3ESTA 4CRBA 4GUXA 5F03A 2BDHA 2ODYB 3A81A 4I86A 2G8TA 3S9BA 5T3HA 4KTCA 1G9IE 1EAIA 2ULLA 1O31A 4CREA 1NM6A 1TX6A 1V2OT 2CJIA 3FANA 1IQFA 5KEDA 2V3OH 1V2JT 1P10A 1EPTA 2IPHA 4I31A 3VGCC 1E38B 2G4TA 3ZVBA 4AOQA 3D65E 1BRCE 1EP6A 3TITA 1LVYA 2AERH 2RA0A 5EIYA 2H2ZA 2BD9A 2VWLA 1OWJA 1GJ7B 1QL9A 4ISNA 1C9PA 2ZU3A 3V12A 1ETRH 2KCPA 3OYPA 1ZYOA 1BITA 4TPIZ 5DK1A 1OX1A 3TIUA 7LPRA 2BOKA 4B6FA 1GHAF 2QF5A 1ZTJA 3N7DA 3PMAB 1L1GA 1ZTKA 2WPJS 5A09A 1GI0A 3SGBE 1QQ4A 2J4IA 3I29A 1JIMA 4TT3D 1YWUA 1P57B 2AH4X 4NFFA 4A6LA 3U8TH 4VGCC 4AG1A 5A2MH 1LMWB 5I25A 1WAYB 5T6FA 4BAMB 2VWMA 3ATIA 3EGKH 1KIGH 1O3KA 1QB6A 1QNJA 1MAYA 1NBME 1P2NA 4OS4A 2XWAA 1W8BH 1O5AB 2QC2A 1WCZA 1G36A 1TQ0B 1TGSZ 2BD7A 2WV4A 1V6DA 1S84A 2ZHQH 5FAHA 1FAKH 3OTPA 3PB1E 3QLPH 1HJAC 4WY3A 2ZNKH 1KLIH 1O2GH 1G37A 4WVPE 1Z7KA 1V2LT 1BCUH 1V2RT 2I6SA 1TPSA 3LGIA 4DURA 3ZVFA 1THSH 1FONA 1GMHF 1RXPA 1UTKA 1YPMH 1HGTH 3TJUA 1MCTA 2JH6D 1WSSH 5T1VA 1P8VC 4KELA 1D3TB 2VU8E 3F9HA 3A85A 3R0FA 6CHAB 1SLVB 1GL0E 3F9FA 1O36A 5LGOA 2WPMS 1LHCH 4FUIA 3QGJA 3BTDE 1L4DA 3UREA 1BMMH 2O8UA 1O2PA 3V13A 1FIZA 1T8LA 2TRMA 3P8OA 5FX5A 2VIOA 1D6RA 2XBVA 2AIQA 2FODA 3U28C 1TWXB 5DO4H 2VWOA 1AB9C 4NIWA 1ZSJA 1QJ6B 2J34A 1YLNA 1EOJA 3M5OA 3MO3A 2OK5A 3GCHC 3KHVA 2UUYA 1BUIA 5FPSA 3KQBA 1G3CA 3M7UA 4MNYA 3Q77A 1O32A 5F53A 1YBWA 4AYVB 3GY2A 5DP8A 4AFZA 1S6LA 2IPQX 1MTVA 2BY8X 4Y6DA 3DFLA 1A3BH 2BX3A 2XC0A 4MPUA 3EE7A 5DJ7A 3SJ9A 4BANB 5HIZA 3IWMA 3RU4E 4NIXA 1NRQH 4F48B 1YLCA 2C90B 1SI5H 2EA3A 3UQVA 4CBOA 4X2YA 4F55A 5DGJA 1MMJN 4KGAA 1TALA 4FVBA 3TH3H 4DJZB 1DX5M 1P12E 4J2YB 3RXSA 2PGBB 3LH3A 1TGTA 4K60A 1ZHRA 4K8YA 1ESBA 2FDAA 4CH8B 4F49A 2FEQH 2UWLA 2GX4A 2NWNA 1IQJA 3B8JA 2BM2A 1V2NT 2FESH 1O38A 1AO5A 1HUTH 1F5KU 1OWDA 1GI9B 2VIVA 3F1SB 2J9NA 1SG8B 4DT7B 3P8NA 1O5DH 2SNVA 2H9EH 3LPRA 4QT8C 3UTUH 3GCNA 2SNWA 5HGGA 1Z71A 2TGAA 4BTIB 2ODPA 3EQ0H 3GY3A 4AGJA 1O5FH 1MTNB 3L3TA 3UWIA 2BX4A 2KX4A 3QWCH 2EI7A 3U1JB 3NKKA 1G3EA 1ZHMA 4JZFH 2QXIA 5JDUB 5GCHG 3LONA 1C2HA 3TH2H 4DOQA 3O8RA 4TY6A 4R0IA 5EQRA 2OUAA 3DUXH 3GYLB 3D23A 3Q3YA 3SGQE 1EJMA 1J9CH 4D76A 3BTTE 2BXTH 2PP6A 4KTUA 1XUFA 5TCCA 3NZIA 3SV2H 3LC5A 5JBTA 1LPKB 5FL7D 5T6DA 3TH4H 1QZ8A 1UCYK 5C2ZA 4MVNA 1UVTH 2D8WA 4JK5A 4KKDA 2BDYA 2QXGA 5AF9H 4A5TS 1EKBB 1P05A 2ZFFH 3KCGH 1SVPA 1GBDA 2ZWLH 4AZ2B 1BTXA 2ZEBA 1ANDA 3E90B 4IS5A 1OPHB 1ZRBA 1V2MT 1FN8A 1VCWA 1TBQH 2OC0A 1SGTA 1KLTA 5DN6D 3MNBA 3SV7A 4ZHMU 1XX9A 1TMTH 2GDEH 2YMSB 3U69H 1HV7A 1P02A 1CA0C 3H09A 1XKAC 3P8FA 3RM0H 1EB1H 3F3BA 3RXTA 1C1RA 3SQEE 3ZZCA 3LGWA 1KY9A 2OD3B 3ATMA 1Z8RA 2BVXH 4WJG2 5E8EH 4FUDA 3VB4A 1BTHH 1C2MA 1WDIA 1DS2E 4OS2A 2ZDLA 1B0FA 1HAHH 2XXLA 2ZGXH 1QB1A 3FP7E 2HWLB 4JK6A 1QIXB 3ZVGA 2O8WA 2CF9H 2B8OH 1BMNH 1CHGA 2ZHFH 2BLWA 1AFQB 3A7XA 2FX4A 3E3TA 4NA8A 1QA0A 3FZZA 5EW2H 5DPAA 1ELBA 3PLPA 3PV5A 1TB6H 4TWWA 4P02A 1GHAG 3P95A 1OHHD 1KXAA 2AHME 2Z3EA 3OU0A 1TNJA 1O2UA 3MU8A 2BLOA 1P04A 1SGEE 2FTMA 3MNSA 3S0NA 1C5RA 3BTQE 4DIIH 1GJ5H 1XUJA 2RCEA 3T29A 1FY5A 2FI4E 1HAGE 1C1SA 1C9TA 1HPGA 2L6OA 1IQHA 2VH0A 1V2ST 1O3CA 4ISOA 2RA3A 2A7HA 1MABB 1SGFA 1DDJA 1O2RA 2FMJA 3MNCA 1W2KH 2BD5A 1K1NA 2PKSC 2IN2A 3LGVA 4A1TA 5GJ4B 4CRFA 1P09A 2JH5D 4NA9H 1JOUB 1O2QA 3KNXA 1TOMH 1HBTH 2UWPA 3FOAA 3LT3A 1D3PB 1AVWA 2VVCA 5C3NA 1HNEE 1IQKA 5E2OA 2D26C 3SW2B 3AVZA 4D7GA 1ANBA 3BTME 1Y5AT 1QJ7B 4U30A 4NWLA 3KIDU 3A7WA 2F9OA 1GGDC 1TE0A 1VITG 1UTPA 2AEIH 2FOHA 3DSPA 3N7OA 1ELGA 3TGKE 3M36A 1TPAE 4RN6A 2ZPQA 1HAZB 1TGNA 1O34A 2PR3A 3A7VA 1D4PB 1T4VH 1AZZA 1ZR0A 3RP2A 6GCHF 2Z9IA 1VITH 1SFQB 3UFAA 2CHAC 1FJSA 1GBTA 3F2FA 2YMSD 1DICA 2BY6X 1DXWA 2GCTB 2H9TH 2J97A 1KDQB 1V2WT 3GCOA 3DA9B 8GCHF 1S6HA 3PRDA 1RFNA 3V0XA 1EAXA 2R9PA 1QRZA 1VGCB 1O3AA 2P94A 1TNIA 1FQ3A 4E7RG 3TJOA 2Z9JA 3BG4B 2TGDA 2VVVA 2AMQA 4ZAEA 3ODDA 2HLDD 2TGTA 3MTYA 1BMAA 2A4QA 3AK5A 1WU1A 3RC5A 1QY6A 2GTBA 1KTTB 1LO6A 1VKYA 2ZZUH 1OWHA 3KGPA 2ZDKA 1IOEA 2HVYB 2H9HA 4P00A 4ZKSU 1O37A 3VB7A 1ID5H 5EG4A 3ATKA 2GDDA 2ILNA 4Q63A 2ZU4A 1LVBA 1LHFH 4NA7A 5FCRA 1VJAU 1A4WH 2ASUB 4CRCA 3RXIA 3A8CA 1F2SE 2K8IA 2BVRH 3Q00A 1GBMA 4Y10E 1C5SA 3QX5H 4ABGA 4OS7A 1ZMJA 2ZTXA 2WUCA 1RTKA 2BZ6H 4E06H 5SGAE 5GWZA 3V3MA 2F91A 3QN7A 4X2VA 1JBUH 1UJ1A 1ARCA 1OYQA 2VH6A 4D8NA 2ZGCA 1LCYA 2BHGA 2QF3A 3CS0A 1QRXA 3GDSA 4BNRA 1YPGH 4MPWA 5F8ZA 4FU8A 4MLFB 3SYJA 5FHTA 2HALA 2ZQ1A 1GL1A 2HLCA 2ZDMA 2ZHWH 1GI4A 2FI3E 1THPB 4MNWA 1SLXB 3AASA 3LIWA 3LGTA 2FYQA 3H7TA 1NU9A 1C5YB 2FOFA 1FDPA 5C20A 5EXLA 4DVAU 4Y79A 4FUBA 3MU4A 3SUDA 1V2PT 5FBIA 3BTWE 4K1TA 1AUTC 1H8HD 3SORA 1BRAA 3T28A 1C2IA 2O8TA 2QY0B 1QQUA 4OS1A 2OBOA 1C5NH 3GICB 1GI1A 1DLKB 1C1VH 5L2ZH 2ZPSA 4K3JA 4Z1MD 4IC5A 3O8BA 3LJOA 5C1XA 3PROA 1M9UA 1SBWA 1DITH 4I7YH 1GMCF 1HAXB 2WZQA 2H5CA 2EEKA 1T31A 2FI5E 2FOMB 2ZF0H 3MO9A 7GCHG 3W94A 3IITA 1NU7B 3BEFB 2XTTB 2GCHF 1WTGH 3RM2H 1AKSB 1KSNA 1GG6B 3F9EA 3CENA 1BT7A 2QN5T 2ZU2A 3B9FH 3NUMA 3RMNH 5H4IB 3S69A 1L4ZA 1GBKA 2JETB 2A5KA 1MTUA 4WH6A 3SNAA 5HM9A 3DSGA 2XNDD 3A87A 3URCA 3F6UH 1PQ7A 1SGQE 4CBNA 4JYTA 2JIZD 3LGUA 5FBEA 3K2UA 1BBRH 1OWIA 5EJ1A 2O9QA 3HGNA 2OCVB 5A0AE 2XCNA 2IJOB 1HCGA 1JRSA 1F0TA 2AS9A 2JJ2D 3GY5A 3K6ZA 4NIYA 1O2TA 5C0UA 1TA6A 2L74A 2VB0A 2A4GA 1O5EH 3RXAA 1IQGA 3TJVA 1GBBA 4AB8A 5C94A 2FX6A 4Z6AH 4UFDH 1TA2A 2VGCB 4X6NA 1P2IA 4WH8A 1CE5A 1PPCE 3NRLA 5J4SA 1LKAA 1GHBG 1QFKH 3BSQA 3OFND 2OXSA 4K69A 5J4QA 2ZHDA 3RLWH 1HAPH 3CS7A 3QTVH 1ANCA 3BIUH 1AKSA 2ALPA 2ZGJA 1HFDA 2WHXA 4YXWD 1HRTH 1C5WB 1ZPBA 3RXBA 1SLUB 1AVGH 4XFQA 1ELVA 3BTEE 4Q2KA 1EPTC 1P2MA 1SGPE 3ELAH 4UE7H 4X1NU 1A1RA 3SV6A 4IGDA 2ZC9H 2H6MA 1DFPA 3B23B 1CT0E 4X6MA 3ZZAA 4K8BA 1SGRE 1UK2A 4JZEH 5L30H 2GZ9A 5CE1A 1C5ZB 1GBHA 3E0NB 1O2HA 1D9IA 4B74A 6ESTA 2IJD1 3NPSA 3LOXA 4JYUH 1OWKA 3DCLA 2P3FH 1GMDF 2R0LA 2GMTB 3PO1B 2M2AA 3KQCA 3SU1A 1Y5BT 3ZV8A 1GBIA 2PV9B 2F9BH 3GS9A 2FYRA 3GISB 4NSYA 1W7GH 2BQWB 2ZG0H 1EJAA 3GDVA 1NT1A 2A4RA 1A2CH 1JRTA 3QTOH 4I8KA 1O3JA 3TU7H 2RG3A 1BDAA 1W10U 1C5UA
chains in the Genus database with same CATH topology
2O8LA 3PM3A 1KTSB 1TRMA 1SR5C 4K1SA 4J1YA 4F4OC 2HNTC 1J16A 4SGBE 3ZZ9A 1HXEH 2R2WU 4ZKNU 3U98H 3RXQA 3UOPA 1FNIA 2YOLA 4INKA 1MQ6A 2STBE 2R3UA 1YLDA 4YM9A 1MKXH 3ATLA 3MU0A 2P93A 5DP3A 1H8IH 3RXFA 4KTSA 4LZ1H 5ABWA 1SGNE 4ZXXH 1GJ8B 1CHOG 1AI8H 2AFQB 1IQIA 2PHBA 1TNLA 3RXDA 3GDUA 4TY7A 4Y0YE 2DUCA 3S9CA 1AE5A 3SNDA 4NG9H 1QL8A 1MH0A 1PJPA 1W11U 2VNTA 5GDSH 4I32A 2BY7X 4AGKA 1OYTH 5CMXH 1E34B 2ZCLP 1MUEB 1WTHD 3H7OA 3MFJA 3NXPA 2H5DA 3RDZA 4I8LA 4ZHLU 2IOTA 2D2DA 1CT2E 1EZQA 1IQLA 3HKJB 4IMQA 1FUJA 1O2OA 1GI8B 1W14U 1DWDH 5C5OA 1MU8B 5C5NA 1QBOA 1TBZH 4CR5A 5B6OA 2GT7A 3E0PB 3BF6H 1W3CA 3BEIB 1ELCA 4DG4A 3ZV9A 1TOCB 1HLTH 1BA8B 4TPYA 2HNTE 2PKAB 1C2GA 1SFIA 3A7YA 3F9GA 3RUOA 7KMEH 2OC7A 1TQ7B 6LPRA 4YOJA 1ZJDA 1T8OA 1LHGH 1Z8JB 6CHAC 1TONA 1O3IA 5CHAB 1CBWB 2VVUA 1NRNH 3RXHA 1EQ9A 1FLEE 3ATWA 1J17T 1S81A 1ZPCA 1A7SA 2G00A 1BTPA 1VCPA 2J95A 2BDAA 1YPEH 1H9HE 3HATH 1NFXA 1EATA 1L2EA 4YT6H 1F0UA 1MZAA 2P59A 4WMDA 3GOVB 4X1PU 3FAOA 3KF2A 1ZSKA 1G2MA 1FPHH 3SU2A 1ELDE 4B76A 4GCHF 1GMCG 1NY22 4NZLA 2QYIA 1UK3A 4XBCA 3GCTF 1S83A 4A92A 1O0DH 1ELTA 2XBXA 4GVUA 2WPIS 1EZXC 1CO7E 1NRSH 1DT2A 1YPHC 1O2LA 2BY9X 2FZZA 3M35A 2GV6A 4WWYA 1V2VT 2JH0D 5F8TA 1ELEE 2PKAA 4Y8XA 1YCPM 3E1XB 4MPVA 1O2KA 1MZDA 3M7QA 2ZGBH 1SC8U 1QJ1B 3LH1A 4AG2A 3UOUA 9LPRA 1C1UH 4E05H 1GI5A 2UUJB 1NS3A 1HDTH 1OSSA 2ZDAH 1CSOE 1P3CA 3SNCA 2FTLE 3CP7A 1TNKA 3QZRA 1ELAA 4Q7YA 3DHKH 1O2JA 4JZ1A 1UTJA 5FX6A 2M5TA 1S85A 2TGPZ 2OINA 4B2CA 4H6SB 1J15A 1O3OA 3K9XB 2SGDE 2ZFPH 2FXRA 1MTNC 4GLYA 4X2XA 1H9IE 3TJNA 1ZPZA 4KP0A 4K1EA 1D3DB 2Q6FA 2WYJA 1FY4A 5DP7A 1DSUA 1QB9A 4ABBA 5IDKA 1WV7H 4ZKOU 1RTLA 1MBQA 1KLJH 2PWXA 1PQ8A 1S0RA 2EI8A 4NIVA 4UFEH 2PUQH 3L33A 3SU5A 1HJ9A 4O3UA 5TCAA 1OKXA 1HAVB 5C1UA 1YPHE 3ZZDA 1ANEA 1LVOA 1DVAH 1WOFA 3SNBA 3VB5A 1Q2WA 5AHGH 1TYNA 2G4UA 1GPZA 1GBLA 2PSXA 3A83A 4YZUA 1H1BA 2ZDVH 4MTBA 1TMUH 3GY7A 2ZDNA 1O5BB 2FWWA 3M37A 1GJ9B 3H5CB 3HK3B 1GI2A 4X0WU 5DP4A 4D9RA 3PLKA 1WQSA 1UVSH 1PPBH 4NGAH 1GI3A 2ZECA 1A0JA 1UTOA 4X6OA 5GXPA 4B2BA 2KAIB 4CR9A 1O3BA 1CT4E 3U8RH 1AD8H 3NWUA 1GCTB 3FFGA 1HAIH 1EJNA 2NU0E 4GHQA 1TAWA 1BZXE 1GBFA 1W0YH 2B7DH 1V2UT 4CRDA 1L1NA 1N6XA 3G01A 2Z9GA 1XM1A 2BDIA 2OQUA 2VWNA 1C5TA 2F9VA 3SV8A 2SGPE 1DPOA 4X1SU 2GD4B 1EAUA 1FY3A 2Y5HA 1T32A 1ZGIA 1YYY1 4R8TB 2BMGB 3T27A 1HAVA 5C1YA 1YCPH 2ANWA 4WMEA 1YCPK 5DP6A 5E2PA 1O2SA 1CGIE 1PFXC 1TRNA 2OTVA 3BEUA 2BQ7B 3HK6B 1PPZA 2OBQA 1L0ZA 1AFQC 3HKIB 1MTWA 1GMHG 3A86A 1C1TA 2W7SA 1SPJA 3Q76A 4ZHAA 3NCLA 5LH8A 3VXFH 3A7ZA 3M3SA 3UNRA 1RIWB 5AFZH 1BTYA 1XUHA 1W13U 4INHA 3SNEA 2KAIA 2QIQA 2A7JA 4Y8YA 3TK6A 1YM0A 5JB9S 2CMYA 5PTPA 4FUGA 2NU1E 3S7KB 2TIOA 1G2LA 3UQOA 1O35A 3AAVA 1SMFE 5BRRE 2FS8A 1A3EH 1EUFA 1MKWH 3UUZA 4O03A 1F5RA 3RXOA 3SU0A 5ESTE 1UHBB 1IAUA 2XWBI 3PYHA 1P06A 1B7XB 1TBRH 3C1KA 1UVUH 1V2QT 4YTAA 2Z9LA 1GCDA 5A8ZA 1O3PB 4PROA 3VB6A 4X6PA 5HYOA 1P9UA 1A5GH 1ZGVA 4TWYA 2R0KA 1LPZB 2FOGA 4JZDH 3BTGE 1LDTT 5A0BA 4YT7H 4DGJA 3VFEA 4BAOB 2BQ6B 1XKBC 1BTWA 1O2MA 2PFEA 3RXEA 1LVMA 3OY5U 2STAE 3SJOA 3ZZBA 2F9NA 1A46H 2PUXB 1UTQA 3DT0H 1F7ZA 4CHAB 4YLQH 3TPIZ 2ZU5A 1C2FA 5F8XA 2C8XB 3TK5A 1QL7A 1VZQH 1C2DA 1EOLA 1YF4A 1O3HA 1K1OA 1O5CB 2VIQA 2P8OB 1EX3A 1SGIB 3NK8A 5TJXA 4A1XA 2ZTYA 5HXFA 3ZZ8A 1ZOMA 2OC1A 1BOQA 3KQDA 4SGAE 2BLVA 2HGTH 1GVZA 1SGFG 3SJIA 1SQOA 4K5ZA 1NC6A 1BTUA 4UONA 1ZSLA 3LJJA 1OOKB 1V3XA 2GCTC 2PLXA 1UVOA 3EE0B 2A32A 1GJ6A 4Q7ZA 1EAWA 1FIWA 2A45B 1KDQA 1VGCC 4ZROA 2BD8A 2ZI2H 4I33A 2LPRA 2ZA5A 2SGAA 1N1LA 3BG4C 2QA9E 2FOCA 4LOYH 1Y3VA 2XW9A 2C93B 5L2YH 2J2UA 1E0FD 1GHZA 1PQ5A 3S7HB 2J38A 2FO9A 2ZU1A 1N8OB 2GZ8A 3QDZB 1JMOH 1ZTLA 3HPTB 1O3GA 4D9QA 4ABIA 1ZMNA 1JXPA 2BDGA 2WPLS 4FU7A 4ZKRU 3UPEA 1A0LA 2NU3E 2ZFTA 1O2ZA 3P8GA 3TGJE 4IBLH 4NWKA 1GJBB 1Q3XA 2PSYA 5JYIA 1QR3E 5A8XA 2R3YA 1OP0A 2ZPRA 3BTKE 5FPTA 3R3GB 5FCKA 1MCVA 2ZHEH 1Z6EA 1WYKA 1O5GH 1FV9A 2DE9A 4MG3A 4I8HA 4GHTA 1GHYH 8LPRA 2BVSH 1C2JA 1C2KA 5LPRA 1GBCA 1FI8A 1NFUA 3O8DA 2AMPA 3BIVH 2HNTF 1PYTD 3IG6B 2CN0H 1C2EA 5AFYH 4CRAA 3MH5A 4ABFA 3RXPA 4XOJA 4ABHA 1HB0B 1DWCH 1QBNA 2QAAA 5EPYA 3U9AH 2J94A 5DP5A 3SU6A 2XBYA 1ABJH 1A5HA 1WQVH 4H42U 4UDWH 3EAJA 2P3UB 1S82A 3GY4A 2BD4A 2Y7XA 3SQHE 3ZZ3A 5BPEA 1BBRK 1AWFH 1AQ7A 1TNGA 5GCHF 3M7TA 3A8BA 2BB4A 1BTZA 3E16B 2FOAA 4B75A 1ZRKA 2ZTZA 1OXGA 2EI6A 1YPKH 4OS5A 1D6WA 5LPFA 1ORFA 4Y76A 3MMGA 1AVXA 1AIXH 1UO6A 5A0CA 1HIAB 1K22H 3STIA 9ESTA 1F0RA 2D1JA 2OP9A 3GYMA 2HOBA 3VGCB 1P11E 2I6QA 3RXCA 1KXDA 2F9UA 1LKBA 1QURH 4ZH8A 1NROH 4BTTB 5EOKA 1P3EA 1GG6C 1K21H 1XXDA 2ZP0H 1C5VA 2A0QB 2ALVA 4TYDA 4MPXA 1YKTA 4AFSA 1BIOA 2FP7B 2Z3DA 2JETC 4CH2B 1Y3XA 3KL6A 1TFXA 2BD2A 2Y7ZA 3Q3XA 4GSOA 1KYNA 2QV1A 1FXYA 2V35A 1PPFE 1UTMA 1RTFB 1F0SA 1HJ8A 1ZLRA 1IHTH 3SU4A 4A7IB 1K1IA 3E8LA 1DM4B 4MNXA 2ANYA 1VR1H 1EP5A 2QF0A 1DSTA 1H8DH 4VGCB 3ZZ7A 2BOHB 4WF8A 1ESAA 1SGDE 4FUCA 5E0HA 3EA8A 4NFEA 1P2QA 4MQAA 1V2KT 4UEHH 3LC3A 5FPYA 1KXCA 2FIRH 1YGCH 3BV9B 1NPMA 1BHXB 8ESTE 2VGCC 2GZ7A 4ABJA 3SU3A 1BQYA 1NFYA 2UUFB 1DUAA 2QGRA 3TVJB 2Y81A 1HIAA 1S0QA 1XVMA 3ITIA 2SFAA 4ABAA 4FUFA 1HJAB 1C4Y2 1P2JA 4M7GA 3RXRA 3QZQA 5F6MA 4X1RU 1TABE 2C8ZB 4IN2A 2XC5A 3KN2A 4X1QU 3VB3A 3TNTA 5C67A 4FU9A 1GHVH 1RJXB 6GCHG 1QRWA 5T6GA 1WUNH 1O3MA 1F5LA 1K28D 1UTLM 3E6PH 1SQTA 8GCHG 4XBDA 1GVKB 4OS6A 4XE4A 1DWEH 4YOIA 5EQSA 1YP9A 4MNVA 3M3TA 1MKXK 4O3TA 5A8YA 1BRUP 1AB9B 3UIRA 2WINI 4B71A 5EGMA 5EQQA 3U1IB 2BDBA 1ABIH 1MAXA 3GCHB 1NN6A 3K6YA 3PO1C 1MU6B 2GMTC 3BTHE 4NSVA 4RKJB 2CXVA 3RXUA 1LHEH 4OGXA 3RXMA 3MO6A 3UR9A 1OP8A 3A8AA 1W7XH 4ZXYH 3DD2H 5IYTA 1SQAA 2Y6TA 2Q6DA 3V7TA 4AB9A 1B5GH 2P95A 1QBVH 1O2NA 1AMHA 1TGBA 4YOGA 2QXHA 2W3IA 1YPJH 1TGCA 2XNIA 2XYAA 3A89A 5JB8S 3BG8A 1VITF 4A1VA 1K9OE 1O2IA 3LKWA 2BZAA 2HPQH 4ASHA 1L1JA 1MD8A 1GHWH 5FXLA 1P9SA 3ZZ6A 4ZUHA 3PV4A 1OWEA 1TPPA 4Z0KA 2J92A 2A5AA 4UD9H 3T2NA 1O2XA 3PMJA 1B0EA 1UMAH 4Y71A 1PPHE 5EXMA 2VIWA 1UK4A 2B0FA 2YNBA 1E37B 3M5LA 3FVFB 1DWBH 1RD3B 2Z6BD 1GDNA 5JBBS 4X8SH 1VCQA 4IMZA 2V0BA 1CQQA 4Y8ZA 3M61U 1SOTA 5EODA 4Y11E 1O3NA 4BOHA 2F9PA 1XUKA 3VEQB 3Q3KA 3F68H 5DG6A 1C5LH 1SGYE 4DCDA 3RU4D 4XDEA 1UCYE 1SLWB 1V2TT 5DKMA 4ZMAH 2AMDA 3A7TA 1K1LA 1TPOA 4HGCA 1AGJA 1PPEE 1O3LA 1RRKA 1GWAA 3FP6E 2A5IA 3SO3A 2Y5GA 2QXJA 1XMNB 5JBCS 2GCHG 5GIBA 2Z94A 2ZQ2A 3M5NA 2FLRH 3SZNA 1C4V2 4YESB 2W5EA 1YC0A 3EDXB 5LPEA 1KXBA 1FN6A 3MWIU 1TLDA 3BN9A 5K0HA 2BXUH 1T8NA 2ESTE 4THNH 1LPGB 1AN1E 2C3SA 1Q31A 1Y3WA 4I8GA 1O33A 1O39A 3RMOH 2GKVE 5CHAC 1CBWC 1G3BA 3MU1A 3ZVDA 3M3VA 1TRYA 4BAKB 1Y3UA 4Y7BA 2Q6GA 1T4UH 1AFEH 1EZUC 1CA0B 1SSXA 2NU2E 2RDLA 3I77A 1C5QA 5DP9A 1MBMA 2PTCE 3ZVCA 1ELFA 3A84A 1NRRH 2FM2A 1IQEA 2CV3A 3TNSA 4ISLA 3VXEH 1O3FA 1C1WH 1AUJA 3MYWA 1ETTH 1GBEA 1Z1JA 1DXPA 1UCYH 1U6QA 2PGQB 3P92A 1Z1IA 1BMLA 1ARBA 1TMBH 1G3DA 1FY1A 2VINA 4GPGA 3QGNB 3RC4A 2VIDA 2HPPH 3QUMP 4JCNA 4UFGH 1KXEA 1QTFA 1AE8H 2C4FH 4K2YA 4I8JA 4BAHB 2QCYA 2A4OA 2HRVA 1CA8B 3C27B 1C5XB 1K1JA 3KQEA 4BXWA 3RXJA 3AAUA 7GCHF 3A8DA 3OSYA 3SUFA 1Y3YA 4LXBH 3SHCH 1ACBE 4YO9A 1TNHA 1RGQA 1AHTH 4HTCH 4BTUB 2Y80A 2V3HH 1FY8E 1E36B 1K2I1 1P01A 2THFB 4ISIH 3DFJA 1F92A 3U8OH 3RC6A 5I46H 1GJDB 1J8AA 4FUEA 3SV9A 3TGIE 1VJ9U 1DANH 4OGYA 1GVLA 1DLEA 3WY8A 2C8WB 1OP2A 3PMHB 1GHXH 2SGQE 2WPKS 4NCYA 2ZKSA 2PKSB 2CF8H 1C1OA 4CRGA 1XVOA 1C1QA 1GMDG 4DY7B 3JZ2B 1DY9A 3EYDA 1NTPA 4IC6A 4H4FA 3VPKA 1NO9H 2Y82A 2XC4A 5HMAA 3D62A 4HZHA 4RSPA 1ZZZA 1GDUA 2AIPA 3E91A 4D7FA 1S5SA 1DOJA 1AY6H 1E35B 1Y5UT 3UNQA 4AORA 7ESTE 1MQ5A 2O8MA 3ZVEA 3T62A 1GGDB 1GHBF 1UVPA 4AX9H 2PW8H 2F83A 2Z3CA 4B73A 3ODFA 2AGGX 2Z7FE 2Y5FA 2W3KA 3S9AA 1QCPA 3O8CA 3EA7A 3T26A 2ZCHP 1FMGA 1K1PA 1O3DA 3SUGA 1ESTA 2ANKH 3BTFE 1OS8A 2W26A 1DE7H 4X8VH 4BXSA 2CHAB 1MTSA 2TPIZ 3QK1A 1GJ4H 2FOEA 4U2WA 4AN7A 1IQNA 1SL3A 4DIHH 1C1NA 3SBKA 1CGJE 1Z6JH 3ZYDA 1X7AC 4B2AA 4DW2U 2BY5X 1GCTC 2C8YB 3SHAH 1CGHA 2SGFE 4ABDA 3RXGA 1SHHB 4B1TA 5JPMH 2LNCA 4FUJA 1INCA 5K7RA 1MKWK 3PTNA 1LQDB 2NU4E 3P70B 1S6FA 1KXFA 2BYAX 1PQAA 5E0JA 1NZQH 4O97A 1JIR