1HJ9A

Atomic resolution structures of trypsin provide insight into structural radiation damage
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAYGLEGKGDSCQGDSGGPVVCSGKLQGIVSWGSGCQAKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Atomic Resolution Structure of Trypsin Provide Insight Into Structural Radiation Damage
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hj9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hj9A02
3AASA 1IQLA 1DICA 3T62A 1C9PA 2B0FA 1P9SA 4AZ2B 4BTUB 2A5KA 2FS9A 2CJIA 3LKWA 2FX6A 1ZTJA 3E6PH 1P06A 5ETXA 4K3JA 5ESBA 2BDHA 1GJ6A 4R0IA 2J94A 1OSSA 1AQ7A 4IC6A 1K1IA 1DXPA 1ESAA 4MNXA 1O3OA 4FU7A 1WQVH 1O3FA 1AVWA 1TMTH 5LPFA 4YLQH 1P0SH 5GWZA 1P3EA 2WPKS 2FMJA 1DOJA 1IQKA 1F5LA 2H9EH 3VB7A 1C5NH 1C5OH 3Q76A 1NU7B 3KCGH 1SHYA 1C5ZB 4B76A 2VWOA 4WF8A 3SU2A 4DOQA 1GJDB 5AF9H 4I8LA 2WPMS 4Y7BA 5DP4A 2B5TB 3GDUA 4AYYB 3C1KA 1EJMA 1SVPA 2C8YB 1BBRK 1D9IA 4ISLA 2ZU3A 1C1PA 2SFAA 1GBDA 3SU4A 1F0UA 3U98H 2G8TA 4PROA 3DT0H 5F8TA 1DY9A 3MNCA 1HB0B 2D26C 5H4IB 1O30A 3KQBA 4CR5A 1DY8A 1GMCG 4YO9A 3SOSA 1C5PA 3GY3A 1TMBH 1ZHRA 3BN9A 1JBUH 3RM2H 2FOEA 2QF3A 3UR9A 1QBNA 1WTGH 3R0FA 1SLUB 4R8TB 4X6OA 1GMCF 2J38A 3BG4C 4YM9A 1W13U 2XWAA 1T8OA 1GCTB 2FXRA 1VGCB 1XXFA 4E7RG 1O2IA 1O2XA 1P09A 2GT8A 1TX8A 2P59A 1TBQH 3T28A 2Y81A 3A80A 3EE0B 2Z3EA 2Y82A 4Y11E 1KXDA 1ZLRA 1ELTA 1MTUA 1Z8JB 3F9EA 1KSNA 5JDUB 2GDEH 1AMHA 2FLBH 1A0JA 2EEKA 2W26A 3E16B 2H6MA 4A1VA 3CS7A 3P6ZB 3VB4A 1Z1JA 1GDNA 5EOKA 2FLRH 4IMZA 3TK9A 1QRZA 6ESTA 3E0PB 2F9BH 4B74A 1SL3A 2P16A 1OOKB 1ARCA 4K1SA 1NRRH 2GD4B 4TY6A 3R3GB 5EQRA 1O2VA 3CENA 1DM4B 2SGAA 1WTHD 4OS2A 2STAE 2ANMH 2Q6DA 3I29A 1NFWA 4CBNA 1EP6A 4ABDA 1EOJA 4AN7A 3P8GA 5CHAC 3GY8A 3K9XB 2ZFSA 1EUFA 5DKMA 1V2WT 1ZMJA 1SGQE 2V6NA 4NGAH 3A8AA 1OPHB 1SGTA 4ABHA 3RC5A 3S9CA 3FANA 4TY7A 1Z8RA 3KQCA 1NM6A 2BY6X 1QJ6B 1KXBA 2F9OA 3RMLH 1TPAE 4IGDA 1O2LA 1THPB 9LPRA 1MAYA 1GG6C 2Y80A 3DHKH 4NIYA 3M7QA 3SU0A 2FI4E 1PPCE 1MQ6A 1AFQB 2VVVA 1SB1H 1VITG 4FVBA 1RS0A 3TJOA 3SU1A 4ISNA 3FZZA 1VCPA 1SFIA 1E38B 2UWPA 1TALA 2Q1JA 5A8YA 4FU8A 1DLKB 2OBQA 3GY7A 5GPIB 2ZA5A 3MTYA 3ITIA 1YM0A 4NFFA 1NFXA 3MHWU 3PMBB 3TVJB 1K22H 4H4FA 1JMOH 4AGKA 4NWKA 1TGNA 4DT7B 7GCHG 3ZVCA 3VB5A 3RLWH 2JKHA 3NKKA 4INLA 2BDCA 2A45B 1FJSA 2PW8H 6GCHF 3M5MA 1DX5M 3GISB 1QL7A 2ODYB 2FP7B 3LJJA 3TGIE 1DITH 2D8WA 4YOJA 2VVUA 7GCHF 1Q3XA 1GI4A 3HPTB 4B2BA 4FUBA 5A0CA 3FFGA 1VJ9U 5CE1A 3NK8A 1IAUA 2HOBA 3A86A 3SI4H 5GDSH 1TONA 1ELAA 2BD4A 1T7CA 2SGDE 1WYKA 2ILNA 2NU1E 3C27B 2G55A 1P2MA 2F91A 2SNVA 4DW2U 1W8BH 2ODQA 1HAOH 2ZQ1A 3Q3KA 4JYTA 4CRGA 1Q31A 1TNKA 1QBOA 3EDXB 3KHVA 3ZVBA 3NCLA 2QCYA 4I33A 1O3PB 2F9NA 3LT3A 1JRTA 2G4TA 5EW1H 2VGCB 2V35A 4NIWA 1GJAB 1IQNA 1SBWA 1GGDC 1IQEA 3P8OA 5DJ7A 1H9HE 3H7OA 1W14U 2IJOB 4D7GA 1GBEA 5IYTA 2G52A 1XUIA 1O5GH 2AMPA 4I8KA 3VXEH 3MH5A 2J2UA 3ATMA 3P92A 2GMTB 1C1RA 2G5NA 1C4Y2 1RFNA 2RA3A 4IS5A 3ESTA 2ZU5A 1G9IE 4HGCA 2FEQH 1TWXB 3SU3A 1LPZB 1FAKH 2PSXA 3L3TA 4TYDA 1G3BA 1HAVA 3ATLA 2FM2A 1XM1A 4CRAA 3A83A 2ODPA 2ANWA 2JETC 1T31A 4VGCC 3SV9A 1T32A 3TITA 1YYY1 1D3PB 4KELA 1AN1E 1TRNA 1O3CA 1EJNA 2GZ8A 5HM2A 5E2OA 1E36B 4INHA 5CHAB 3HATH 2PV9B 3D62A 1CT0E 1MKWH 2WPHS 4X1QU 1ELFA 5PTPA 1ZSJA 1OYQA 2J92A 4AOQA 4MPVA 1C9TA 2ZEBA 1QRXA 1ZGIA 1O2JA 3NWUA 5HXFA 1BTXA 2IOTA 3VB6A 1JXPA 4WMFA 5F8XA 1C5WB 1NRPH 2XC5A 3SU6A 1BTYA 1RRKA 4SGAE 1THRH 2J4IA 1C1QA 4TPYA 1C1VH 3LGVA 2XTTB 4DY7B 2P93A 1MMJN 1F0RA 3K2UA 1V2RT 1S0RA 2K1QA 1GPZA 1N8OB 1IQGA 3EAJA 4INKA 4TWYA 3ZZCA 5EXNA 2R0KA 3GCHC 1VR1H 3BIUH 1UVUH 1OKXA 4ZXYH 1SC8U 1GCDA 1ORFA 1IQIA 4CRCA 1KXCA 5EODA 2VIDA 6LPRA 1AVGH 1NESE 3RXRA 2XNIA 1UHBB 4ZKSU 4FUEA 1FAXA 3SGAE 4WH6A 4D76A 3F1SB 2TIOA 4WXVA 1LVMA 3RDZA 3K6YA 1W0ZU 1A3BH 3PYHA 5DG6A 2ZNKH 2VGCC 3LONA 1FI8A 1JOUB 1NS3A 3NZIA 4CH8B 2FOBA 2W7UA 4NG9H 1QRWA 1RJXB 2PKAB 1ARBA 4XBCA 1EPTA 4E05H 2GX4A 4K8YA 1C5MD 4MNWA 1FDPA 1UVTH 3PB1E 4IMQA 5HM9A 1O3MA 3UQVA 2ZI2H 1FY1A 3OX7U 1GJCB 5FBEA 4ZHMU 2VIVA 1PFXC 5E2PA 1CHOF 3TH2H 1FQ3A 1PPBH 1NFUA 1UTOA 3NXPA 2TPIZ 1V2LT 1L4DA 5DPAA 2ZDLA 1FLEE 1CHOG 2QYIA 1TX6A 3ZZ7A 1BA8B 1CSOE 4H6TA 3ZV8A 5L30H 2ALVA 3VPKA 1ZMLA 4A6LA 1AZZA 3B9FH 2FOFA 4AB8A 1GHAF 4JMYA 2ZFFH 5FPYA 1K1MA 1MD8A 4CHAB 1P12E 1P11E 2ANKH 4K69A 2ZU1A 5F6MA 1A5HA 2UWLA 1BOQA 5DP9A 3QGJA 1NN6A 1PQ5A 1BMNH 4JK5A 1TPSA 1DSTA 2BVSH 1PPHE 3MWIU 4A92A 2XYAA 3O8RA 3PWBA 3LC5A 1TLDA 2ESTE 3QZQA 1CBWB 3GCOA 2FOAA 4CR9A 2Z9LA 4DGJA 1CA0C 1ETTH 3A89A 2XW9A 4JYVH 2IPHA 3SNEA 4CRFA 2GCHF 1EKBB 3FP7E 1XUKA 5TCCA 2W7SA 1UTLM 1F5KU 1QBVH 3FZDA 1KTTB 3Q77A 4LZ1H 5BRRE 2CN0H 3MFJA 1ZPBA 1CGIE 2Y5FA 3TK5A 4GHQA 3P70B 4LOYH 1GI0A 4NZQA 4YLUA 1O5AB 3DUXH 5T6FA 1JIMA 1K1LA 4BAKB 2HLCA 1K9OE 1K1OA 4OGXA 1TFXA 1O39A 3BTKE 1A4WH 4JZ1A 3GY6A 2BB4A 4I8HA 2PGBB 1V2QT 3UNRA 1A0LA 1NT1A 2VIWA 2BLVA 1OWEA 1HAZB 2H1UA 2A32A 3LJOA 1O5CB 1FN6A 1RTKA 2BOKA 1E0FD 2HWLB 4NA8A 1C5XB 1TABE 3ZZ8A 5DP3A 1GBTA 2A5AA 2SGPE 3HKIB 1NRQH 3M61U 1NU9A 4UFFH 2BZ6H 3MU0A 5JB8S 2CF8H 2OXSA 2YOLA 5C2ZA 1NO9H 2VINA 4I32A 5DO4H 2KAIA 7KMEH 4MPWA 3ZVFA 2PUQH 4H6SB 1A46H 2WYJA 1G37A 4HI3A 1H9LB 2BD7A 4DVAU 3QZRA 1HLTH 3EA9A 3A85A 3EGKH 3A87A 3UFAA 3URDA 2A1DB 1A5IA 3QWCH 4AFSA 4Y71A 1INCA 1LHCH 3UREA 3A82A 4IW4E 2TGPZ 3SUGA 1DUAA 1GHXH 2A0QB 1HJAC 4Y8ZA 3GY4A 2FZZA 3BG8A 2OC1A 4X8SH 1TA2A 1UTMA 4YOIA 1E35B 3DFLA 2PTNA 5J4SA 2BTCE 3UWJH 1NZQH 1PQ8A 3L33A 2XC0A 1VJAU 4AGJA 5B6OA 1WUNH 2JETB 1EZXC 2ZFQH 1HAVB 1MU6B 5AFYH 1CA8B 4ZKNU 1GVZA 1ELBA 2PWXA 3D49H 3ZZ3A 3ZZ4A 3RMMH 2Z3DA 2H5DA 4O3TA 1TPOA 1D6RA 2FIRH 3ZVDA 1XVMA 1GHBF 1LVOA 4GVUA 4ABIA 3RXBA 3ZVGA 5AFZH 4B1TA 2ALPA 1TGBA 1GBJA 6GCHG 1TBRH 3JZ1B 4UE7H 3PM3A 4ZUHA 1BITA 1GBLA 1C1NA 1O32A 1EASA 3LGWA 3SORA 1C2EA 3QO6A 4X8VH 3SJKA 3V13A 1YPGH 3UY9A 3A7ZA 5L6NH 4JZEH 4RSPA 5LPEA 1TA6A 4KGAA 4LXBH 2UUFB 2HVXA 4A5TS 1G3DA 5C5OA 3SV6A 2BD8A 3G01A 4B75A 1OX1A 1PYTC 2A7CA 3T29A 4JK6A 4U01A 2EI8A 1YC0A 4ABFA 3EA7A 1TBZH 1GHWH 2F3CE 3LPRA 3IWMA 1EPTB 3MU8A 1OP0A 1YPHC 3SV7A 4RKJB 1XVOA 3SNAA 5GXPA 8LPRA 1THSH 5C5NA 1MTSA 5DGJA 3SU5A 3SHAH 1AGJA 1UTJA 1HDTH 1MZAA 1QJ1B 4ISHH 2BX3A 1SQOA 1ELGA 1F2SE 1BTZA 1F7ZA 4ABGA 4ABAA 1KLIH 1CQQA 1H8DH 1EZSC 3RM0H 1HPGA 3STJA 2VWMA 2P8OC 1IHTH 3QLPH 1XKBC 1C5TA 1TQ0B 2ZFTA 3RXFA 5C20A 3MNXA 1GL0E 5A8ZA 4NWLA 1DSUA 4XSKU 2AIPA 1L4ZA 2Y6TA 2HNTC 4ISOA 5JB9S 2CF9H 1Z1IA 1D3DB 2HGTH 2C8XB 4X1RU 3K65B 1O2YA 1BIOA 3MU1A 4CH2B 1ETRH 3PMHB 3QN7A 3QDZB 1J15A 3F68H 2B8OH 1ZJDA 3DD2H 1EAWA 4K60A 1T8MA 1A3EH 1Y5UT 3MU4A 3M37A 4ZMAH 3UUZA 3MNBA 3MH7A 1RGQA 1ZPZA 2GMTC 4FU9A 1BZXE 1RTLA 3BTGE 3OU0A 4ZHLU 3LGIA 2C3SA 1OYTH 3M7UA 1T8LA 3M7TA 2GKVE 5HYOA 2FX4A 4GUXA 5FXLA 4X1SU 3TPIZ 1B0FA 4AB9A 4UEHH 2BDGA 4NA7A 2P8OB 1Y8TA 4AG2A 4CRDA 1GGDB 1BRBE 5GIBA 1AIXH 1MTWA 1QA7A 1LHGH 2DE8A 5DP8A 1DWEH 1TGSZ 3UNQA 2ZDAH 4I8JA 1XX9A 2ZPSA 2PUXB 2R2WU 4IC5A 1SI5H 2ZTZA 1YBWA 1TGTA 1MUEB 1OWDA 4FVDA 1O2OA 3SBKA 3RU4T 1W12U 3HGPA 2JH5D 1W11U 3TJVA 1C5VA 3Q00A 4DJZB 8ESTE 3RXUA 3M3TA 3CP7A 4X0WU 1P03A 1AO5A 1FY8E 2FDAA 1GI8B 1BQYA 3S7HB 1SGRE 1B7XB 1C5QA 1SGFA 1SPJA 5I46H 2GCHG 3BEFB 1AE8H 2PKSB 2ZHFH 1D3TB 1SGDE 3PTNA 1UK2A 3E8LA 1G3EA 1GBFA 2BQWB 3GY5A 2HRVA 1P2KA 1TMUH 2QXIA 5AHGH 2ZDMA 1XXDA 1C2JA 1JWTA 1Y3WA 4K5ZA 1EAUA 1FY5A 3ZZBA 3LGYA 1OWHA 2G51A 2RA0A 1ETSH 1N1LA 4GPGA 3T27A 3TNTA 2PSYA 1CVWH 1QR3E 2ZDVH 2BD3A 5A0BA 1YP9A 2FI5E 2V3OH 1S5SA 1IQFA 1D4PB 1LHFH 2A7HA 3M36A 3P8NA 5TJXA 4A7IB 4YT7H 4KKDA 1BRAA 1KXAA 2Z9JA 1FUJA 3RXLA 3NPSA 3RC4A 2VVCA 1MH0A 1LPGB 5DP5A 2BDBA 1AY6H 2ZPRA 1OS8A 5C1XA 2WINI 3BSQA 4GAWA 1G2LA 2G00A 1J8AA 3K6ZA 2V0BA 3M35A 4CREA 2KAIB 5EXMA 1ELCA 3PLPA 1BCUH 4ZAEA 1GI9B 3P17H 1C1TA 4GLYA 3OTJE 3RXQA 2ZGXH 1S6HA 1FMGA 1O2NA 2Y5HA 2A2XH 1SGNE 2ZHWH 5FX6A 1ZTLA 1Z7KA 2ZFRH 3UTUH 4OS1A 1MKWK 5E0HA 3GDVA 1C1WH 3PMAB 3ZZ5A 1EB2A 5BPEA 4YT6H 1EPTC 2PKSC 3OY5U 3RU4D 1TOMH 3PV4A 3GYLB 3BTTE 1KLJH 4THNH 1AI8H 3BTQE 1QQ4A 3ZZ6A 4BNRA 1T4VH 2I6SA 2OCVB 2VJ1A 1K1NA 1ELDE 3A7VA 3BIVH 1O3NA 1TOCB 2UUKB 4FUFA 1F92A 1O2QA 3S9AA 3KQEA 2Q6GA 2ZCLP 1OWIA 1O2HA 1Z71A 1PPGE 3FAOA 2Q6FA 1TNGA 1SFQB 1IQHA 3PO1B 3TH4H 1BHXB 1J17T 2OC7A 3GCTG 3GYMA 3E0NB 3OY6U 1O3AA 1V2PT 3RXEA 1TNJA 1AUJA 1ID5H 3P8FA 5ESTE 1CT2E 2YNBA 2EI6A 1O3IA 1K21H 1L1JA 1MZDA 4IBLH 3D65E 1PPZA 2BD9A 3LU9B 3RXHA 2ZHQH 4YTAA 3SJIA 2O8TA 1WOFA 2WV5A 1O35A 3VGCB 1SOTA 1SLWB 4TWWA 1CGJE 1VITF 3H5CB 1BMMH 4AG1A 4OS5A 1SGEE 1GI2A 5FCKA 3WY8A 3BV9B 5DP6A 3RXVA 4Q80A 2AMQA 1WV7H 1LMWB 3BF6H 1PJPA 1UCYK 4DCDA 3ZYEA 1GHBG 4KTCA 2QV1A 4Y7AA 1MCVA 2AEIH 1LPKB 1P2OA 1YGCH 4D7FA 2B7DH 5EW2H 1TYNA 1EXFA 1H1BA 2TGDA 1GBIA 4BTIB 5L2YH 2P3UB 2VIQA 1IQJA 1Y3UA 2A5IA 3UIRA 4F4OC 3KN2A 1QL9A 1T8NA 1ZJKA 5JPMH 1GHVH 1AWFH 1DLEA 2FOCA 4BAHB 2EC9H 1O3LA 1QFKH 4D9QA 2ANYA 1LHEH 4Y8YA 3L6PA 1YPMH 1AU8A 2QGRA 1KIGH 1GJ8B 4K8BA 1QCPA 4B71A 1DXWA 1HJ9A 1O3KA 2CMYA 4E7NA 2HPPH 2VB0A 2ZDKA 1QURH 2AFQB 3SGBE 1FN8A 4ZKOU 3PWCA 3QK1A 5JYIA 5FBIA 1C2GA 4Q2KA 3TGKE 4X2WA 3GY2A 4UDWH 4UONA 3IG6B 4FUJA 2QXGA 1O3GA 1LHDH 1NY22 1OWKA 3LGUA 2F9UA 2Z7FE 1C2KA 1YPJH 4UFGH 4XBDA 1ELEE 1V3XA 2BVRH 3QUMP 3UR6A 1QNJA 2QAAA 1KDQA 1A7SA 2O8WA 2H9TH 3S7KB 1L2EA 3VB3A 2GZ7A 4A1TA 2YNAA 1LVYA 2FWWA 1P9UA 3TJNA 1V2UT 3O8DA 4JCNA 4FUGA 2NU4E 1TRMA 3GCHB 3BTWE 2XXLA 4I31A 1Y5BT 2OQUA 1N8OC 2BLOA 3RXDA 1O2ZA 1CA0B 5C67A 4BAQB 4IN1A 2IN2A 1EAXA 2ZKSA 3RP2A 2BM2A 1C1SA 1GBMA 3UPEA 1Z8GA 1SGYE 3OSYA 2ZO3H 1BRUP 3P95A 1FZZA 1UVPA 4X8TH 1MTNB 1D6WA 2ZFPH 1C1OA 3BEUA 1Y3XA 5T6GA 1YCPH 3H7TA 1GBKA 2W3KA 4WMEA 5A09A 1KYNA 1HJAB 5LPRA 1MTVA 2BD5A 1AFEH 2VH6A 1N6XA 2BZAA 3SNBA 2R9PA 3LIWA 4NZLA 1DANH 2ZZUH 3STIA 1DWDH 1BT7A 2D2DA 2GDDA 1XUGA 2TRMA 5EPYA 5EPNA 3UOPA 2F9VA 1GMHF 1O2MA 4K2YA 3U9AH 2WPIS 4M7GA 4OS4A 2ZGHA 2CV3A 1N6YA 1BBRH 1QTFA 3ATKA 1O31A 4NCYA 1V2JT 1GI5A 5DK1A 1PQAA 2A31A 3AAVA 3SQHE 1C2HA 4ABBA 5E0GA 1A2CH 2WYGA 4D9RA 1S81A 3Q3XA 3ZVEA 2OC8A 1GI1A 2GV6A 4J1YA 4YESB 1RTFB 5F03A 3N7OA 1AB9C 1KDQB 1GMDF 1H9IE 1K1PA 1OWJA 1VZQH 5JBAS 4WVPE 2GVFA 2ULLA 2OTVA 3ENSB 1NTPA 3SI3H 2VWNA 1YLDA 4WH8A 3SN8A 2D1JA 1RD3B 2QN5T 4X8UH 1HAYB 3HK6B 2TGTA 1S0QA 3MNSA 1X7AC 3MI4A 2AYWA 1YLCA 5K0HA 1ABJH 3RC6A 3ZYDA 4KTUA 3I78A 4JZIA 1W2KH 4UFEH 2GV7A 3A7WA 4K1EA 1MKXH 1C2FA 1O33A 4O3UA 1GHYH 1P2QA 1MAXA 2A4QA 4BXWA 1AUTC 2AH4X 1ANCA 3PROA 2EI7A 2R3UA 1KXFA 1MTNC 1W7GH 2NU0E 1K28D 1K1JA 3A8CA 1BTPA 2P94A 5FHTA 1ZSKA 2HPQH 2XBVA 3SO3A 3RXOA 3LOXA 3S69A 2BXTH 1GJ4H 4DG4A 2Y7ZA 1Z6EA 1HUTH 1ZMNA 5FCRA 1EOLA 2B9LA 4MPXA 1P05A 1G2MA 1SGCA 4I7YH 1F0TA 1LTOA 3SJ9A 1QY6A 3V12A 3ELAH 5JBBS 1QGFA 2ZTYA 5C1YA 2A4GA 1BHXF 2R2MB 1TE0A 3U69H 1TPPA 1C2LA 4BAOB 1DT2A 1LKAA 2ZCHP 1BBRE 4X6NA 1DUEA 1NPMA 5EU8A 1DFPA 3AVZA 3M5LA 1B0EA 1HAGE 4B2CA 2O9QA 3BTDE 1J14A 4YOGA 1GHAG 1QB1A 1BB0B 2XBWA 2JH6D 2ZCKP 2XBXA 4CHAC 5JBTA 1DPOA 1MQ5A 2J34A 4BAMB 3SNDA 1QQUA 1NRSH 4XDEA 1TQ7B 2GZ9A 3QTOH 3V3MA 5L2ZH 5EGMA 1GBBA 3ZZDA 3PLKA 2FESH 3RXIA 2QA9E 1B5GH 3S9BA 1ANEA 2RG3A 1FY3A 4JZDH 3F6UH 2A2QH 1GCTC 3F9HA 3GCTF 3KF2A 2AS9A 4Q7XA 1ZTKA 1GBHA 2I6QA 2STBE 4J2YB 8KME2 1UTPA 3SUFA 1O2RA 1ANBA 1ACBE 8GCHF 3UNSA 1T4UH 4ZKRU 1S83A 3EYDA 1O36A 1O3HA 4Y0ZE 1QB6A 1ZOMA 1FPCH 1FIWA 1C1UH 3V0XA 3UOUA 2PLXA 8GCHG 3QX5H 4OS7A 3ODDA 5JBCS 1V2NT 2OQ5A 2SGFE 4VGCB 4OGYA 4CBOA 1C2MA 2PHBA 3U8TH 1G32B 4GHTA 1LCYA 9ESTA 1J16A 1P2IA 1PPEE 2BY7X 3SV8A 1BTHH 1P04A 4Y76A 2GT7A 2QY0B 1GDUA 2AGEX 5E0JA 1AD8H 2M5TA 4GSOA 1Y59T 4QT8C 1HYLA 1IQMA 1GI3A 3FP8E 5HGGA 3BTFE 4AYVB 5T6DA 1KLTA 3SGQE 4AFUA 1VITH 1UO6A 1SGPE 4K1TA 2FYQA 4ABJA 1SR5C 1YKTA 4H42U 4ZROA 4WY3A 3EQ0H 4Y6DA 3VFEA 1O5DH 1HV7A 1Y5AT 1U6QA 2ZGBH 1HIAB 1GJ9B 1IHSH 3IITA 1P2JA 1TAWA 4JZFH 3ZVAA 2JH0D 1XUFA 2VH0A 1FY4A 1F5RA 1HAHH 5A0AE 6CHAB 3VXFH 2NU3E 2OP9A 1MBQA 2BQ6B 4JYUH 1AWHB 1SOZA 2BOHB 2FTMA 1RIWC 2GP9B 1WU1A 1V6DA 1P10A 4FUDA 2ASUB 2BVXH 2FOMB 1XUHA 2AGIX 1EZQA 2SNWA 5ABWA 1IOEA 1O5FH 1TNLA 1BMAA 1CU1A 1SGFG 3UQOA 1Y3YA 3M3SA 1D3QB 2Z94A 2GCTC 1Z8IB 5GCHF 3F9FA 2FTLE 4AFZA 3FVFB 2AGGX 1DDJA 4UD9H 4Z6AH 1AKSB 3MH6A 3ATIA 1AZ8A 3O8BA 1H4WA 1TB6H 3GICB 4DIHH 3U8RH 1O34A 1V2OT 1TNHA 1BTUA 1BTWA 2A7JA 4WMDA 1HXEH 1P57B 2FO9A 2ZU4A 3VEQB 3SV2H 3CS0A 2WPJS 3ATWA 1AKSA 1ZGVA 2W3IA 2GGVB 2ZF0H 1ZSLA 3GDSA 3I77A 5G4BA 1GVKB 1A0HB 3LC3A 3SW2B 1AFQC 1YCPK 4MPUA 3RMOH 3SQEE 1JRSA 3S0NA 3MU5A 4X6PA 3PTBA 1LVBA 3TK6A 4AORA 2A4OA 4X6MA 3RXMA 2AERH 4MNVA 5FPTA 5EG4A 1XMNB 1GDQA 4WWYA 2PFEA 4Y8XA 3E3TA 1HXFH 1O2PA 4IN2A 1M9UA 7LPRA 2H5CA 2OUAA 2ZHDA 2BHGA 2UWOA 4Q7ZA 1FNIA 4MG3A 1HBTH 2OBOA 3U8OH 1S84A 3MYWA 1G36A 3A7YA 1ZHPA 1FPHH 1MCTA 4XOJA 1HIAA 1AHTH 3M5OA 1KTSB 2C90B 2GTBA 5DP7A 1P01A 2C93B 1GI6A 3D23A 1V2ST 3PLBA 5C1UA 3RXTA 3M5NA 5LGOA 1C4U2 2ZP0H 2H2ZA 4LZ4B 2CGAA 1G3CA 1E34B 5T3HA 2ZWLH 1W0YH 2Z3CA 1W10U 5E8EH 1GMHG 4BTTB 6CHAC 2P95A 2XCNA 4LK4A 2H9HA 2BYAX 1DS2E 2BDIA 3PMJA 1EQ9A 1YCPM 2THFB 1SLXB 2DUCA 2ZC9H 2BY8X 1UHBA 3A8BA 3KL6A 1ANDA 2QIQA 1H8IH 1A5GH 1HRTH 1OP2A 1ESTA 2FI3E 2QC2A 3M3VA 1O0DH 4ABEA 3BTHE 2PTCE 2WUCA 4WXIA 4KP0A 2OINA 2BY5X 4HFPB 1GMDG 1BMLA 1HJ8A 1QA0A 4X2YA 1O3JA 1QIXB 3TH3H 2RCEA 3KGPA 2WUBA 3A84A 2R3YA 3O8CA 1P02A 3E90B 2FYRA 3MMGA 1QB9A 1O2WA 1WAYB 2ZTXA 2BD2A 1O2UA 2Z9KA 4A1XA 1O3DA 1MU8B 4Y79A 4ASHA 4U32A 3QGNB 1O3EA 3E1XB 3A81A 3TNSA 1VCQA 1F0SA 1GBCA 1O3BA 2FS8A 5GJ4B 2PGQB 4O03A 2XBYA 1GL1A 1KY9A 2P3TB 4MDSA 2ZGCA 1GI7B 4GCHG 2O8MA 2AIQA 1DWBH 2G81E 1S82A 1NFYA 1TNIA 2FOGA 4O97A 2O8UA 4CRBA 5EQSA 1C5LH 2EA3A 2BLQA 1ELVA 2ZDNA 4GCHF 5EXLA 3BEIB 1BJVA 3DA9B 4RN6A 3RU4E 3V7TA 1JIRA 1ZYOA 2C4FH 2BXUH 4SGBE 4MQAA 1TIOA 1C5UA 4E06H 3NUMA 1BUIA 4FUHA 1LDTT 4D8NA 2J9NA 1GBAA 2TGAA 1UMAH 3HK3B 1UTNA 3VGCC 1GJ5H 3MH4A 3LDXH 1KXEA 1V2KT 1O5EH 3AW1A 4I8GA 4BOHA 2UUJB 1NC6A 1WQSA 5TCAA 2QF0A 4BXSA 2OC0A 2GCTB 3SJOA 1MBMA 2OLGA 3SUEA 2R0LA 4FUIA 2F83A 1CE5A 4ZXXH 1SQAA 1TGCA 1UCYE 1ZR0A 2Y5GA 1A61H 1MKXK 2W5EA 1UCYH 4NSYA 1AE5A 2CXVA 3AAUA 2G5VA 3BTEE 1RIWB 1K2I1 1CT4E 2BX4A 2UUYA 3RXGA 1FXYA 3LGTA 4MTBA 4AX9H 3LH1A 2BLWA 7ESTE 1EX3A 1LQDB 1HFDA 1HGTH 2G4UA 4NSVA 1BRCE 2VU8E 2Y7XA 1C5SA 1TRYA 4ZH8A 3OYPA 3SHCH 1S6FA 2HNTF 1YPHE 2C8WB 4DURA 1CBWC 1V2MT 1S85A 3URCA 1BDAA 1QL8A 2RDLA 4B73A 2XWBI 5K7RA 1WSSH 1YPKH 2V3HH 4ISIH 5A8XA 3TU7H 2ZIQH 5J4QA 3Q3YA 3RXKA 2XCFA 3SZNA 1XUJA 3RXCA 2LPRA 3PO1C 3LH3A 3SUDA 3T26A 2AMDA 3ODFA 1C2DA 3DFJA 3ZZ9A 1E37B 1QJ7B 3SNCA 1SSXA 1OXGA 3MOCA 5HMAA 1GJBB 1G30B 2VNTA 4U30A 4NIVA 4Y0YE 3TGJE 3RMNH 5IDKA 3KQDA 4AFQA 5I25A 1DE7H 1P2NA 4ZHAA 1EZUC 1W7XH 1SG8B 1GJ7B 1WCZA 2HNTE 2PR3A 1EJAA 1O2TA 2BY9X 1BJUA 1GHZA 1ZHMA 1O5BB 3U1IB 4HZHA 2ZU2A 2SGQE 1MD7A 4YZUA 1ABIH 4KTSA 2HALA 1LQEA 2WV4A 3SJ8A 2Z9IA 1ESBA 2P3FH 1HAIH 2BMGB 4X1PU 4HTCH 1SGIB 4FUCA 3MO3A 5AVDA 1W3CA 1TX7A 2FOHA 1EATA 1UTKA 1UVSH 1PQ7A 4X2XA 1O37A 5FAHA 1SLVB 4Q7YA 1SQTA 2XC4A 1L1GA 1UK4A 4NFEA 3A7TA 5GCHG 1YPEH 3RXSA 3TJUA 2NWNA 3MO9A 1ZZZA 2A4RA 3KIDU 1GVLA 2ZHEH 1RXPA 4NA9H 3RUOA 3U1JB 3GOVB 3W94A 1DWCH 2C8ZB 1DVAH 1PYTD 1ZPCA 2VWLA 2VIOA 3A7XA 2ZECA 3QTVH 3RXPA 4RKOB 1CO7E 3RXJA 4UFDH 1UTQA 1FIZA 1EAIA 1EP5A 4MNYA 1SHHB 3UWIA 1VGCC 1ZRKA 5FPSA 5CMXH 1GG6B 1C4V2 3BG4B 4BANB 4FXGH 2O8LA 2LNCA 2FPZA 2ZQ2A 1C5RA 1AB9B 5C3NA 1P8VC 1O2KA 1HAXB 4OS6A 1QHRB 1A1RA 1NRNH 4MLFB 1AVXA 3A88A 2DE9A 1FONA 2NU2E 3E91A 1HNEE 1OP8A 4XFQA 2CHAB 1PPFE 1SMFE 1WBGB 3HGNA 2CHAC 1Q2WA 3F9GA 3W95A 3MO6A 1CGHA 2J95A 1L1NA 1YPLH 2BDYA 3KNXA 2QXHA 4WJG2 3KEEA 3HKJB 1J9CH 2SGEE 3TIUA 2BQ7B 5LH8A 2F9PA 5EQQA 5F8ZA 4F49A 5FX5A 2FODA 1Z6JH 4XE4A 1LO6A 3B8JA 1C2IA 3A8DA 1V2VT 2XRCA 1Y3VA 4ESTE 1HAPH 2ZGJA 1CHGA 1UK3A 1FV9A 1L0ZA 2QXJA 3ZZAA 1EB1H 5A2MH 1XKAC 3RLYH 1GWAA 3T5FH 4O9VA 1O38A 1O2GH 2VIPA 1O2SA 4X1NU 3TLOA 4Y10E 4Z0KA 3T2NA 2ZPQA 1C5YB 3JZ2B 3GCNA 3ZV9A 1NROH 1UJ1A 2WPLS 2Z6BD 4DIIH 2PKAA 4X2VA 4TPIZ 2OD3B 1ZRBA 2ZG0H 3B23B 1YF4A 2TBSA 3RXAA 2Z9GA 2BDAA 4NIXA 3T25A 3EA8A 1LKBA 4XBBA 1UVOA 3FP6E 1HCGA 1VCWA 4B2AA 4U2WA 1P3CA 3AW0A 3BTME 1V2TT 1C1MA 4MVNA 5SGAE
chains in the Genus database with same CATH superfamily
3AASA 1IQLA 1DICA 3T62A 1C9PA 2B0FA 1P9SA 4AZ2B 4BTUB 2A5KA 2FS9A 2CJIA 3LKWA 2FX6A 1ZTJA 3E6PH 1P06A 5ETXA 4K3JA 5ESBA 2BDHA 1GJ6A 4R0IA 2J94A 1OSSA 1AQ7A 4IC6A 1K1IA 1DXPA 1ESAA 4MNXA 2WSSD 1O3OA 4FU7A 1WQVH 1MABB 1AVWA 1O3FA 1TMTH 2J5UA 4YLQH 5LPFA 1P0SH 5GWZA 1P3EA 1VKYA 2WPKS 2FMJA 1DOJA 1IQKA 1F5LA 2H9EH 3VB7A 1C5NH 1C5OH 3Q76A 1NU7B 3KCGH 1SHYA 1C5ZB 4B76A 2VWOA 4WF8A 3SU2A 4DOQA 1GJDB 5AF9H 4I8LA 2WPMS 4Y7BA 5DP4A 2B5TB 2L6OA 1E1RD 3GDUA 4AYYB 3C1KA 1EJMA 1SVPA 2C8YB 1BBRK 1D9IA 4ISLA 2ZU3A 1C1PA 2SFAA 2CK3D 1GBDA 3SU4A 1F0UA 3U98H 4RT1A 2G8TA 4PROA 3DT0H 2IJD1 1DY9A 5F8TA 3MNCA 1HB0B 2D26C 5H4IB 1O30A 3KQBA 4CR5A 1DY8A 1GMCG 4YO9A 3SOSA 1C5PA 3GY3A 1TMBH 1ZHRA 3BN9A 1JBUH 3RM2H 2FOEA 2QF3A 3UR9A 1QBNA 1WTGH 3R0FA 1SLUB 4R8TB 4X6OA 5IK2D 1GMCF 2J38A 3BG4C 4YM9A 1W13U 2XWAA 1T8OA 1GCTB 2FXRA 1VGCB 1XXFA 4E7RG 5HIZA 1O2IA 1O2XA 1P09A 2GT8A 1TX8A 2P59A 1TBQH 3T28A 2Y81A 1E1QD 3A80A 3EE0B 2Z3EA 2Y82A 4Y11E 1KXDA 1ZLRA 1ELTA 1MTUA 1Z8JB 3F9EA 1KSNA 4RT0A 5JDUB 2GDEH 1AMHA 2FLBH 1A0JA 2F4LA 2EEKA 2W26A 3E16B 2H6MA 4A1VA 3CS7A 3P6ZB 3VB4A 1Z1JA 1GDNA 5EOKA 2FLRH 4IMZA 3TK9A 1QRZA 6ESTA 3E0PB 2F9BH 4B74A 1SL3A 2P16A 1OOKB 1ARCA 4K1SA 1NRRH 2GD4B 4TY6A 3R3GB 5EQRA 1H8ED 1O2VA 1E79D 3CENA 1DM4B 2SGAA 1WTHD 4OS2A 2STAE 2ANMH 2Q6DA 3I29A 1NFWA 4CBNA 1EP6A 5EIYA 4ABDA 1EOJA 4AN7A 3P8GA 5CHAC 3GY8A 3K9XB 2ZFSA 1EUFA 5DKMA 1V2WT 1ZMJA 1SGQE 2V6NA 4NGAH 3A8AA 1OPHB 1SGTA 4ABHA 3RC5A 3S9CA 2M2AA 3FANA 4TY7A 3WWBA 1Z8RA 3KQCA 1NM6A 2BY6X 1QJ6B 1KXBA 2F9OA 3RMLH 1TPAE 4IGDA 1O2LA 1THPB 9LPRA 1MAYA 1GG6C 2Y80A 3DHKH 4NIYA 4FETA 3M7QA 3SU0A 2FI4E 1PPCE 1MQ6A 2GJGA 1AFQB 2VVVA 1SB1H 1VITG 4FVBA 1RS0A 3TJOA 3SU1A 4ISNA 3FZZA 1VCPA 1SFIA 2L74A 4AC9A 1E38B 2UWPA 1TALA 2Q1JA 5A8YA 4FU8A 1DLKB 2OBQA 3GY7A 5GPIB 2ZA5A 3MTYA 3ITIA 1YM0A 4NFFA 1NFXA 3MHWU 4B6FA 3PMBB 3TVJB 1K22H 4H4FA 1JMOH 4AGKA 4NWKA 1TGNA 4DT7B 7GCHG 3ZVCA 3VB5A 3RLWH 2JKHA 3NKKA 4INLA 2BDCA 2A45B 1FJSA 2PW8H 6GCHF 3M5MA 1DX5M 3GISB 1QL7A 2ODYB 2FP7B 3LJJA 3VG8A 3TGIE 1DITH 2D8WA 4YOJA 2VVUA 7GCHF 1Q3XA 1GI4A 4TT3D 3HPTB 4B2BA 4FUBA 5A0CA 3FFGA 1VJ9U 5CE1A 3NK8A 1IAUA 2HOBA 3A86A 3SI4H 5GDSH 1TONA 1ELAA 2BD4A 1T7CA 2SGDE 1WYKA 2ILNA 2NU1E 3C27B 2G55A 1P2MA 2F91A 2SNVA 4DW2U 1W8BH 2ODQA 1HAOH 2ZQ1A 3Q3KA 3WWFA 4JYTA 4CRGA 2HVYB 1Q31A 1TNKA 1QBOA 3EDXB 3KHVA 3ZVBA 3NCLA 2QCYA 4I33A 1O3PB 2F9NA 3LT3A 1JRTA 2G4TA 5EW1H 2VGCB 2V35A 4NIWA 1GJAB 1IQNA 1SBWA 1GGDC 1IQEA 3P8OA 5DJ7A 1H9HE 3H7OA 1W14U 2IJOB 4D7GA 1GBEA 5IYTA 2G52A 1XUIA 1O5GH 2AMPA 4I8KA 3VXEH 3MH5A 2J2UA 3ATMA 3P92A 2GMTB 1C1RA 2G5NA 1C4Y2 1RFNA 2RA3A 4IS5A 3ESTA 2ZU5A 1G9IE 4HGCA 2FEQH 1TWXB 3SU3A 1LPZB 1FAKH 2PSXA 3L3TA 4TYDA 1G3BA 1HAVA 3ATLA 4YXWD 2FM2A 1XM1A 4CRAA 3A83A 2ODPA 2ANWA 2JETC 1T31A 4VGCC 4XRNA 3SV9A 5DN6D 1T32A 3TITA 1YYY1 1D3PB 4KELA 1AN1E 1TRNA 1O3CA 1EJNA 2GZ8A 5HM2A 5E2OA 1E36B 4INHA 5CHAB 3HATH 2PV9B 3D62A 1CT0E 1MKWH 2WPHS 4X1QU 1ELFA 5PTPA 1ZSJA 1OYQA 2J92A 1WXRA 4AOQA 4MPVA 1C9TA 2KCAA 2ZEBA 1QRXA 1ZGIA 1O2JA 3NWUA 5HXFA 1BTXA 2IOTA 3VB6A 1JXPA 4WMFA 5F8XA 1C5WB 1NRPH 2XC5A 3SU6A 1BTYA 1RRKA 4SGAE 1THRH 3U28C 2J4IA 1C1QA 4TPYA 1C1VH 3LGVA 2XTTB 4DY7B 2P93A 1MMJN 5EJZA 1F0RA 3K2UA 1V2RT 1S0RA 2K1QA 1GPZA 1N8OB 1IQGA 3EAJA 4INKA 4TWYA 3ZZCA 5EXNA 2R0KA 3GCHC 1VR1H 3BIUH 1UVUH 1OKXA 4ZXYH 1SC8U 1GCDA 1ORFA 1IQIA 4CRCA 1KXCA 5EODA 2VIDA 6LPRA 1AVGH 1NESE 3RXRA 2XNIA 2AHME 1UHBB 4ZKSU 4FUEA 1FAXA 3SGAE 4WH6A 4D76A 3F1SB 2TIOA 4WXVA 1LVMA 3RDZA 3K6YA 1W0ZU 1A3BH 3PYHA 5DG6A 2ZNKH 2VGCC 3LONA 2K8IA 1FI8A 1JOUB 1NS3A 2WV9A 3NZIA 5B6LA 4CH8B 2FOBA 2W7UA 4NG9H 1QRWA 1RJXB 2PKAB 1ARBA 4XBCA 1EPTA 4E05H 2GX4A 4K8YA 1C5MD 1BMFD 4MNWA 3DSGA 1FDPA 1UVTH 3PB1E 4DT4A 4IMQA 5HM9A 1O3MA 2KCYA 3UQVA 2ZI2H 1FY1A 3OX7U 1GJCB 5FBEA 4ZHMU 2VIVA 3F2GA 1PFXC 5E2PA 1CHOF 3TH2H 1FQ3A 1PPBH 1NFUA 1UTOA 3NXPA 2TPIZ 1V2LT 1L4DA 5DPAA 2ZDLA 1FLEE 1CHOG 2QYIA 1TX6A 3ZZ7A 1BA8B 1CSOE 4H6TA 3ZV8A 5L30H 2ALVA 3VPKA 1ZMLA 4A6LA 1AZZA 3F0OA 3B9FH 2FOFA 4AB8A 1GHAF 4JMYA 2ZFFH 5FPYA 4ACBA 1K1MA 1MD8A 3OAAD 1P12E 4CHAB 1P11E 2ANKH 3FN8A 4K69A 2ZU1A 5F6MA 1A5HA 2UWLA 1BOQA 5DP9A 3QGJA 1NN6A 1PQ5A 1BMNH 4JK5A 1TPSA 1DSTA 2BVSH 1PPHE 3MWIU 4A92A 2XYAA 3F0PA 3O8RA 3PWBA 3LC5A 1TLDA 2ESTE 3QZQA 1CBWB 3GCOA 2FOAA 4CR9A 2Z9LA 4DGJA 1CA0C 1ETTH 3A89A 2XW9A 4JYVH 2IPHA 3SNEA 4CRFA 2GCHF 1EKBB 3FP7E 1XUKA 5TCCA 2W7SA 1UTLM 1F5KU 1QBVH 3FZDA 1KTTB 3NRLA 3Q77A 4LZ1H 5BRRE 2CN0H 4TSFD 3MFJA 1ZPBA 1CGIE 2Y5FA 3TK5A 4GHQA 3P70B 4LOYH 1GI0A 4NZQA 4YLUA 1O5AB 3DUXH 5T6FA 1JIMA 1K1LA 4BAKB 2HLCA 1K9OE 1K1OA 4OGXA 1TFXA 1O39A 3BTKE 1A4WH 4JZ1A 3GY6A 2BB4A 4I8HA 2PGBB 1V2QT 3UNRA 1A0LA 1NT1A 2VIWA 2BLVA 1OWEA 1HAZB 2H1UA 2A32A 3LJOA 3PRBA 1O5CB 1FN6A 1RTKA 2BOKA 1E0FD 2HWLB 4NA8A 1C5XB 2RFKC 1TABE 3ZZ8A 5DP3A 2QF5A 1GBTA 2A5AA 2SGPE 3HKIB 1NRQH 3M61U 1NU9A 4UFFH 2BZ6H 3MU0A 5JB8S 2CF8H 2OXSA 2YOLA 5C2ZA 1NO9H 2VINA 4I32A 5DO4H 2KAIA 2KCPA 7KMEH 4MPWA 3ZVFA 2PUQH 4H6SB 1A46H 2WYJA 1G37A 4HI3A 1H9LB 2BD7A 1K0HA 4DVAU 3QZRA 3OEED 1HLTH 3EA9A 3A85A 3EGKH 3A87A 3UFAA 3URDA 2A1DB 3F2FA 1A5IA 3QWCH 4AFSA 4Y71A 1INCA 1LHCH 3UREA 3A82A 4IW4E 2TGPZ 3SUGA 1DUAA 1GHXH 2A0QB 1HJAC 4Y8ZA 3GY4A 2FZZA 3BG8A 2OC1A 2WPDD 4X8SH 1TA2A 1UTMA 4YOIA 1E35B 3DFLA 2PTNA 5J4SA 2BTCE 3UWJH 1NZQH 1PQ8A 2K0QA 3L33A 2J98B 2XC0A 1VJAU 4AGJA 1SKYE 5B6OA 1WUNH 2JETB 1EZXC 2ZFQH 1HAVB 1MU6B 5AFYH 1CA8B 4ZKNU 1GVZA 1ELBA 2PWXA 3D49H 3ZZ3A 3ZZ4A 3RMMH 2Z3DA 2H5DA 4O3TA 1TPOA 1D6RA 2FIRH 3ZVDA 4B6EA 1XVMA 1GHBF 1LVOA 4GVUA 4ABIA 3RXBA 3ZVGA 5AFZH 4B1TA 2ALPA 1TGBA 1GBJA 6GCHG 1TBRH 3JZ1B 4UE7H 3PM3A 4ZUHA 1BITA 1GBLA 1C1NA 1O32A 1EASA 3LGWA 3SORA 1C2EA 3QO6A 4X8VH 3SJKA 3V13A 1YPGH 3UY9A 3A7ZA 5L6NH 4JZEH 4RSPA 5LPEA 2WHXA 1TA6A 4KGAA 4LXBH 2UUFB 2HVXA 4A5TS 1G3DA 5C5OA 3SV6A 2KX4A 2BD8A 3G01A 5DSFA 1OX1A 4B75A 1PYTC 2A7CA 3T29A 4JK6A 4U01A 2EI8A 1YC0A 4ABFA 3EA7A 1TBZH 1GHWH 2F3CE 3LPRA 3IWMA 1EPTB 3MU8A 4OM9A 1OP0A 1YPHC 3SV7A 4RKJB 1XVOA 3SNAA 5GXPA 8LPRA 1THSH 5C5NA 1MTSA 5DGJA 3SU5A 3SHAH 1AGJA 1UTJA 1HDTH 1MZAA 1QJ1B 3W1EA 4ISHH 2BX3A 1SQOA 1ELGA 1F2SE 1BTZA 1F7ZA 4ABGA 4ABAA 1KLIH 1CQQA 1H8DH 1EZSC 3RM0H 1HPGA 3STJA 2VWMA 2P8OC 1IHTH 3QLPH 1XKBC 2W6ID 1C5TA 1TQ0B 2ZFTA 3RXFA 5C20A 3MNXA 1GL0E 5A8ZA 4NWLA 1DSUA 4XSKU 1FX0B 1L4ZA 2AIPA 2Y6TA 2HNTC 4ISOA 5JB9S 2CF9H 1Z1IA 1D3DB 3OFND 2HGTH 2C8XB 4X1RU 3K65B 1O2YA 1BIOA 3SZEA 2KR7A 3MU1A 4CH2B 1ETRH 3PMHB 3QN7A 3QDZB 3H09A 1J15A 3F68H 2B8OH 2JIZD 1ZJDA 4Q4LA 3DD2H 1EAWA 4K60A 1T8MA 2QF4A 1A3EH 1Y5UT 3MU4A 5T1VA 3KQ5A 3M37A 4ZMAH 3UUZA 3MNBA 3MH7A 1RGQA 1ZPZA 2GMTC 4FU9A 1BZXE 1RTLA 3AK5A 3BTGE 3OU0A 4ZHLU 3LGIA 2C3SA 1OYTH 3M7UA 1T8LA 3M7TA 2GKVE 5HYOA 2FX4A 4GUXA 5FXLA 4X1SU 3TPIZ 1B0FA 4AB9A 4UEHH 2BDGA 4NA7A 2P8OB 1Y8TA 4AG2A 4CRDA 1GGDB 1BRBE 5GIBA 1AIXH 1MTWA 1QA7A 1LHGH 3N7DA 2DE8A 5DP8A 2OK5A 1DWEH 1TGSZ 3UNQA 2ZDAH 4I8JA 1XX9A 2ZPSA 2PUXB 2R2WU 4IC5A 1SI5H 2ZTZA 1YBWA 1TGTA 1MUEB 1OWDA 4FVDA 1O2OA 3SBKA 2JJ1D 1W12U 3HGPA 2JH5D 3RU4T 1W11U 3TJVA 1C5VA 3Q00A 4DJZB 8ESTE 3RXUA 3M3TA 3CP7A 4X0WU 1P03A 1AO5A 1FY8E 2FDAA 1GI8B 3F2HA 1H8HD 1BQYA 3S7HB 1SGRE 1B7XB 1C5QA 1SGFA 1SPJA 5I46H 2GCHG 3BEFB 1AE8H 2PKSB 2ZHFH 1D3TB 1SGDE 3PTNA 1UK2A 3E8LA 1G3EA 1GBFA 2BQWB 3GY5A 2HRVA 1P2KA 1TMUH 2QXIA 5AHGH 2ZDMA 1XXDA 1C2JA 1JWTA 1Y3WA 4K5ZA 1EAUA 1FY5A 3ZZBA 3LGYA 1OWHA 2G51A 2RA0A 1ETSH 1N1LA 4GPGA 3T27A 3TNTA 5C17A 2PSYA 1CVWH 1QR3E 2ZDVH 2BD3A 5A0BA 1YP9A 2FI5E 2V3OH 1S5SA 1IQFA 1D4PB 1LHFH 2A7HA 3M36A 3P8NA 5TJXA 4A7IB 4YT7H 4KKDA 1BRAA 1KXAA 2Z9JA 1FUJA 3RXLA 4FOUC 3NPSA 3RC4A 2VVCA 1MH0A 1LPGB 1COWD 5DP5A 2BDBA 1KMHB 1AY6H 2ZPRA 1OS8A 5C1XA 2WINI 3BSQA 4GAWA 1G2LA 2G00A 1J8AA 3K6ZA 2V0BA 3M35A 4CREA 2KAIB 5EXMA 1ELCA 3PLPA 1BCUH 4ZAEA 1GI9B 3P17H 1C1TA 4GLYA 3OTJE 3RXQA 2ZGXH 1S6HA 1FMGA 1O2NA 2Y5HA 2A2XH 1SGNE 2ZHWH 5FX6A 1ZTLA 1Z7KA 2ZFRH 3UTUH 4OS1A 1MKWK 5E0HA 3GDVA 1C1WH 3PMAB 3ZZ5A 1EB2A 2J97A 5BPEA 4YT6H 1EPTC 2PKSC 3OY5U 3RU4D 1TOMH 3PV4A 3GYLB 3BTTE 1KLJH 4THNH 1AI8H 3BTQE 1QQ4A 3ZZ6A 4BNRA 1T4VH 2I6SA 2OCVB 2VJ1A 1K1NA 1ELDE 3A7VA 3BIVH 1O3NA 1TOCB 2UUKB 4FUFA 1F92A 1O2QA 3S9AA 3KQEA 2Q6GA 2ZCLP 1OWIA 1O2HA 1Z71A 1PPGE 2XNDD 3FAOA 2Q6FA 1TNGA 1SFQB 1IQHA 3PO1B 3TH4H 1BHXB 1J17T 2OC7A 3GCTG 3GYMA 3E0NB 3OY6U 1O3AA 1V2PT 3PRDA 3RXEA 1TNJA 1AUJA 1ID5H 3P8FA 5ESTE 1CT2E 2YNBA 2EI6A 3N99A 1O3IA 1K21H 1L1JA 1MZDA 4IBLH 3D65E 1PPZA 2BD9A 3LU9B 3RXHA 2ZHQH 3KYGA 4YTAA 3SJIA 2O8TA 1WOFA 2WV5A 3MQKC 1O35A 3VGCB 1SOTA 1SLWB 4TWWA 1CGJE 1VITF 3H5CB 1BMMH 4AG1A 4OS5A 1SGEE 1GI2A 5FCKA 3WY8A 3BV9B 5DP6A 3RXVA 4Q80A 2AMQA 1WV7H 1LMWB 3BF6H 1PJPA 1UCYK 4DCDA 3ZYEA 1GHBG 4KTCA 2QV1A 4Y7AA 1MCVA 2AEIH 1LPKB 1P2OA 1YGCH 4D7FA 2B7DH 5EW2H 1TYNA 1EXFA 1H1BA 2TGDA 1GBIA 4BTIB 5L2YH 2P3UB 2VIQA 2YMSB 1IQJA 1Y3UA 2A5IA 3UIRA 4F4OC 3KN2A 1QL9A 1T8NA 1ZJKA 5JPMH 1GHVH 1AWFH 1DLEA 2FOCA 4BAHB 2EC9H 1O3LA 1QFKH 4F48B 4D9QA 2ANYA 1LHEH 4Y8YA 3L6PA 1YPMH 1AU8A 2QGRA 1KIGH 1GJ8B 4K8BA 1QCPA 4B71A 1DXWA 1HJ9A 1O3KA 2CMYA 4E7NA 2HPPH 2VB0A 2ZDKA 1QURH 2AFQB 3SGBE 1FN8A 4ZKOU 3PWCA 3QK1A 5JYIA 5FBIA 1C2GA 4Q2KA 3TGKE 4X2WA 3GY2A 4UDWH 4UONA 3IG6B 4FUJA 2QXGA 1O3GA 1LHDH 1NY22 1OWKA 3LGUA 2F9UA 2Z7FE 1C2KA 1YPJH 4UFGH 4XBDA 2V7QD 1ELEE 1V3XA 2BVRH 3QUMP 3UR6A 1QNJA 2QAAA 1KDQA 1A7SA 2O8WA 2H9TH 3S7KB 1L2EA 3VB3A 2GZ7A 4A1TA 2YNAA 1LVYA 2FWWA 1P9UA 3TJNA 1V2UT 3O8DA 4JCNA 4FUGA 2NU4E 1TRMA 3GCHB 3BTWE 2XXLA 4I31A 1Y5BT 2OQUA 1N8OC 5C94A 2BLOA 3RXDA 1O2ZA 1CA0B 5C67A 4BAQB 4IN1A 2IN2A 1EAXA 2ZKSA 3RP2A 4XD7D 4ACAA 2BM2A 1C1SA 1GBMA 3UPEA 1Z8GA 1SGYE 3OSYA 2ZO3H 1BRUP 5CDFE 3P95A 1FZZA 1UVPA 4X8TH 5C0UA 1MTNB 1D6WA 2ZFPH 1C1OA 3BEUA 1Y3XA 5T6GA 1YCPH 3H7TA 1GBKA 2JJ2D 4ZCNA 2W3KA 4WMEA 5A09A 1KYNA 1HJAB 5LPRA 1MTVA 2BD5A 1AFEH 2VH6A 1N6XA 2EQNA 2BZAA 3SNBA 2R9PA 3LIWA 4NZLA 1DANH 2ZZUH 3STIA 1DWDH 1BT7A 2D2DA 2GDDA 1XUGA 2TRMA 5EPYA 5EPNA 3UOPA 2F9VA 1GMHF 1O2MA 4K2YA 3U9AH 2WPIS 4M7GA 4OS4A 2ZGHA 2CV3A 1N6YA 1BBRH 1QTFA 3ATKA 1O31A 4NCYA 1V2JT 1GI5A 5DK1A 1PQAA 2A31A 3AAVA 3SQHE 1C2HA 4ABBA 5E0GA 1A2CH 2WYGA 4D9RA 1S81A 3Q3XA 3ZVEA 2OC8A 1GI1A 2GV6A 4J1YA 4YESB 1RTFB 5F03A 3N7OA 1AB9C 1KDQB 4M9FA 1GMDF 1H9IE 1K1PA 1OWJA 1VZQH 5JBAS 4WVPE 2GVFA 2ULLA 2OTVA 3ENSB 1NTPA 3SI3H 2VWNA 1YLDA 4I86A 4WH8A 3SN8A 5C0TA 2D1JA 1RD3B 2QN5T 4X8UH 1HAYB 3DCLA 4Z1MD 3HK6B 2TGTA 1S0QA 3MNSA 1X7AC 3MI4A 2AYWA 1YLCA 5K0HA 1ABJH 3RC6A 3ZYDA 4KTUA 3I78A 4JZIA 1W2KH 4UFEH 2GV7A 3A7WA 4K1EA 1MKXH 1C2FA 1O33A 4O3UA 1GHYH 1P2QA 1MAXA 2A4QA 4BXWA 1AUTC 2AH4X 1ANCA 3PROA 2EI7A 2R3UA 1KXFA 1MTNC 1W7GH 2NU0E 1K28D 1K1JA 1WDIA 1BTPA 2P94A 3A8CA 5FHTA 1ZSKA 2HPQH 2XBVA 3OE7D 3RXOA 3SO3A 3LOXA 3S69A 2BXTH 3N7EA 1GJ4H 4DG4A 2Y7ZA 1Z6EA 1HUTH 1ZMNA 5FCRA 1EOLA 2B9LA 4MPXA 1P05A 1G2MA 1SGCA 4I7YH 1F0TA 1LTOA 3SJ9A 1QY6A 3V12A 3ELAH 5JBBS 1QGFA 2ZTYA 3DSPA 2A4GA 5C1YA 1BHXF 2R2MB 1TE0A 3EE7A 3U69H 1TPPA 1C2LA 4BAOB 1DT2A 1LKAA 2ZCHP 1BBRE 4X6NA 1DUEA 1NPMA 5EU8A 1DFPA 3AVZA 3M5LA 1B0EA 1HAGE 4B2CA 2O9QA 3BTDE 1J14A 4YOGA 1GHAG 1QB1A 1BB0B 2XBWA 2JH6D 2ZCKP 2XBXA 3UB0A 4CHAC 5JBTA 1DPOA 1MQ5A 2J34A 4BAMB 3SNDA 1QQUA 1NRSH 4XDEA 1TQ7B 2GZ9A 3QTOH 3V3MA 5L2ZH 5EGMA 1GBBA 3ZZDA 3PLKA 2FESH 3RXIA 2PP6A 2QA9E 1B5GH 3S9BA 1ANEA 1W0KD 2RG3A 1OHHD 1FY3A 4JZDH 3F6UH 2A2QH 1GCTC 3F9HA 3GCTF 3KF2A 2AS9A 4Q7XA 1ZTKA 1GBHA 2I6QA 2STBE 4J2YB 8KME2 1UTPA 3SUFA 1O2RA 1ANBA 1ACBE 8GCHF 3UNSA 1T4UH 4ZKRU 1S83A 3EYDA 1O36A 1O3HA 4Y0ZE 4P02A 1QB6A 1ZOMA 1FPCH 3OTPA 1FIWA 1C1UH 3V0XA 3UOUA 2PLXA 5KEDA 8GCHG 3QX5H 4OS7A 3ODDA 1NBME 5JBCS 1V2NT 2OQ5A 2SGFE 4VGCB 4OGYA 4CBOA 5GNDA 1C2MA 2PHBA 3U8TH 1G32B 4GHTA 1LCYA 9ESTA 1J16A 1P2IA 1PPEE 2BY7X 3SV8A 1BTHH 1P04A 4Y76A 2GT7A 2QY0B 1GDUA 2AGEX 5E0JA 1AD8H 2M5TA 4GSOA 1Y59T 4QT8C 1HYLA 1IQMA 1GI3A 3FP8E 5HGGA 3BTFE 4AYVB 5T6DA 1KLTA 3SGQE 4AFUA 4F55A 1VITH 1UO6A 1SGPE 4K1TA 2FYQA 4ABJA 1SR5C 1YKTA 4H42U 4ZROA 4WY3A 3EQ0H 4Y6DA 3VFEA 1O5DH 1HV7A 1Y5AT 3DSOA 1U6QA 2ZGBH 1HIAB 1GJ9B 1IHSH 3IITA 1P2JA 1TAWA 4JZFH 3ZVAA 2JH0D 1XUFA 2VH0A 1FY4A 1F5RA 1HAHH 4Q63A 5A0AE 3VXFH 2NU3E 2OP9A 1MBQA 6CHAB 2BQ6B 4JYUH 1AWHB 1SOZA 2BOHB 2KCOA 2FTMA 1RIWC 2GP9B 1WU1A 1V6DA 1P10A 4FUDA 2ASUB 2BVXH 2FOMB 1XUHA 2AGIX 1EZQA 2SNWA 5ABWA 1IOEA 1O5FH 1TNLA 2JDID 1BMAA 1CU1A 1SGFG 3UQOA 1Y3YA 3M3SA 1D3QB 2Z94A 2GCTC 1Z8IB 5GCHF 3F9FA 2FTLE 4AFZA 3FVFB 2AGGX 1DDJA 1EFRD 4UD9H 4Z6AH 1AKSB 3MH6A 3ATIA 1AZ8A 3O8BA 1H4WA 1TB6H 3GICB 4DIHH 3U8RH 1O34A 2V3MA 1V2OT 1TNHA 1BTUA 2XOKD 1BTWA 2A7JA 4WMDA 1HXEH 1P57B 2FO9A 2ZU4A 3VEQB 3SV2H 3CS0A 2WPJS 3ATWA 1AKSA 1YLNA 1ZGVA 2W3IA 2GGVB 3PV2A 2ZF0H 1ZSLA 3GDSA 3I77A 5G4BA 1GVKB 1A0HB 2J98A 3LC3A 3SW2B 1AFQC 1YCPK 4MPUA 3RMOH 3SQEE 1JRSA 3S0NA 3MU5A 4X6PA 3PTBA 1LVBA 3TK6A 4AORA 3ZIAD 2A4OA 4X6MA 3RXMA 2AERH 3UAIC 4MNVA 5FPTA 5EG4A 1XMNB 1GDQA 4WWYA 2PFEA 4Y8XA 3E3TA 1HXFH 1O2PA 4IN2A 1M9UA 7LPRA 2H5CA 2OUAA 2ZHDA 2BHGA 2UWOA 4Q7ZA 3OEHD 1FNIA 4MG3A 1HBTH 2KZ4A 2OBOA 3U8OH 1S84A 3MYWA 1G36A 3A7YA 1ZHPA 1FPHH 4RI0A 1MCTA 4XOJA 1HIAA 3FO8D 1AHTH 3M5OA 1KTSB 2C90B 2GTBA 5DP7A 1P01A 2C93B 1GI6A 3D23A 1V2ST 3PLBA 5C1UA 3RXTA 3M5NA 5LGOA 1C4U2 2ZP0H 2H2ZA 4LZ4B 2CGAA 4P00A 1G3CA 1E34B 5T3HA 2ZWLH 1W0YH 2HLDD 2Z3CA 1W10U 5E8EH 1GMHG 4BTTB 6CHAC 2P95A 2XCNA 4LK4A 2H9HA 2BYAX 5CHBA 1DS2E 2BDIA 3PMJA 3CNRA 1EQ9A 1YCPM 2THFB 1SLXB 2DUCA 2ZC9H 2BY8X 1UHBA 3A8BA 3KL6A 1ANDA 2QIQA 1H8IH 1A5GH 1HRTH 1OP2A 1ESTA 2FI3E 2QC2A 3M3VA 1O0DH 4ABEA 3BTHE 2PTCE 2WUCA 4WXIA 4KP0A 2OINA 2BY5X 4HFPB 1GMDG 1BMLA 2EY4C 1HJ8A 1QA0A 4X2YA 1O3JA 1QIXB 3TH3H 2RCEA 3KGPA 2WUBA 3A84A 2R3YA 3O8CA 1P02A 2LP6A 3E90B 5EJ1A 2FYRA 3MMGA 1QB9A 1O2WA 1WAYB 2ZTXA 2BD2A 5FL7D 1O2UA 2Z9KA 4A1XA 1YY3A 1O3DA 1UW7A 1MU8B 4Y79A 4ASHA 4U32A 3QGNB 1O3EA 3E1XB 3A81A 3TNSA 1VCQA 1F0SA 1GBCA 1O3BA 2FS8A 5GJ4B 2PGQB 4O03A 2KFWA 2XBYA 1GL1A 1KY9A 2P3TB 4MDSA 2ZGCA 2YMSC 1GI7B 4GCHG 2O8MA 2AIQA 1DWBH 2G81E 1S82A 1NFYA 1TNIA 2FOGA 4O97A 2O8UA 4CRBA 5EQSA 1C5LH 2EA3A 2BLQA 1ELVA 2ZDNA 5HIYA 4GCHF 5EXLA 3BEIB 1BJVA 3DA9B 4RN6A 3RU4E 3V7TA 1JIRA 1ZYOA 2C4FH 3FKSD 2BXUH 3F3BA 4SGBE 1QZ8A 4MQAA 1TIOA 5EJLA 1C5UA 3GS9A 4E06H 3NUMA 1BUIA 4FUHA 1LDTT 5F53A 4D8NA 2J9NA 1GBAA 2TGAA 1UMAH 3HK3B 2IPQX 1UTNA 3VGCC 1GJ5H 3MH4A 3LDXH 1KXEA 1V2KT 1O5EH 3AW1A 4I8GA 4BOHA 2UUJB 1NC6A 1WQSA 5TCAA 2QF0A 4BXSA 2OC0A 2GCTB 3SJOA 1MBMA 2KM0A 2OLGA 3SUEA 2R0LA 4FUIA 3SYJA 2F83A 1CE5A 4ZXXH 1SQAA 1TGCA 1UCYE 1ZR0A 2Y5GA 5HKKD 1A61H 1MKXK 2W5EA 4ASUD 1UCYH 4NSYA 1AE5A 2CXVA 3AAUA 2G5VA 3BTEE 1RIWB 1K2I1 1CT4E 2QE7D 2BX4A 2UUYA 3RXGA 1FXYA 3LGTA 4MTBA 4AX9H 3LH1A 2BLWA 7ESTE 1EX3A 1LQDB 1HFDA 1HGTH 2G4UA 4NSVA 1BRCE 2VU8E 2Y7XA 1C5SA 1TRYA 4ZH8A 3OYPA 3SHCH 1S6FA 2HNTF 1YPHE 2C8WB 4DURA 1CBWC 1V2MT 1S85A 3URCA 1BDAA 1QL8A 2RDLA 4B73A 2XWBI 5K7RA 1WSSH 1YPKH 2V3HH 4ISIH 5A8XA 3TU7H 2ZIQH 5J4QA 3Q3YA 3RXKA 2XCFA 3SZNA 1XUJA 3RXCA 2LPRA 3PO1C 3LH3A 3SUDA 3T26A 2AMDA 3ODFA 1C2DA 3DFJA 3ZZ9A 1E37B 1QJ7B 3SNCA 1SSXA 4HG6A 1OXGA 2RDEA 1S6LA 3MOCA 5HMAA 1GJBB 1G30B 2VNTA 4U30A 5KECA 4NIVA 4Y0YE 3TGJE 3RMNH 3KYFA 5IDKA 3KQDA 4AFQA 5I25A 1DE7H 1P2NA 4ZHAA 1EZUC 1W7XH 1SG8B 1GJ7B 1WCZA 2HNTE 2PR3A 1EJAA 1O2TA 2BY9X 1BJUA 1GHZA 1ZHMA 1O5BB 3U1IB 4HZHA 2ZU2A 2SGQE 1MD7A 4YZUA 1ABIH 4KTSA 2HALA 1LQEA 2WV4A 3SJ8A 2Z9IA 1ESBA 2P3FH 1HAIH 2BMGB 4X1PU 4HTCH 1SGIB 4FUCA 3MO3A 5AVDA 1W3CA 1TX7A 2FOHA 1EATA 1UTKA 1UVSH 1PQ7A 4X2XA 1O37A 5FAHA 1SLVB 4Q7YA 1SQTA 1L1GA 2XC4A 1UK4A 4NFEA 3A7TA 5GCHG 1YPEH 5KGOA 3RXSA 3TJUA 2NWNA 3MO9A 1ZZZA 2A4RA 3KIDU 1GVLA 2ZHEH 1RXPA 4NA9H 2W6JD 3RUOA 3U1JB 3GOVB 3W94A 1DWCH 2C8ZB 1DVAH 1PYTD 1ZPCA 2VWLA 2VIOA 3A7XA 2ZECA 3QTVH 3RXPA 4RKOB 1CO7E 1NBMD 3RXJA 4UFDH 1UTQA 1FIZA 1YWUA 1EAIA 1EP5A 4MNYA 1SHHB 3UWIA 1VGCC 1ZRKA 5FPSA 5CMXH 1GG6B 1C4V2 3BG4B 4BANB 4FXGH 2O8LA 2LNCA 2FPZA 2ZQ2A 1C5RA 1AB9B 5C3NA 1P8VC 1O2KA 1HAXB 4OS6A 1QHRB 2YMSD 1A1RA 1NRNH 4MLFB 1AVXA 3A88A 2DE9A 1FONA 2NU2E 3E91A 1HNEE 1OP8A 4XFQA 2CHAB 1PPFE 1SMFE 1WBGB 3HGNA 3PV5A 2CHAC 1Q2WA 1SQRA 3F9GA 3W95A 3MO6A 1CGHA 2J95A 1L1NA 1YPLH 2BDYA 3KNXA 2QXHA 4WJG2 3KEEA 3HKJB 2LELA 1J9CH 2SGEE 3TIUA 2BQ7B 5LH8A 2F9PA 3FOAA 1W0JD 5EQQA 5F8ZA 4F49A 5FX5A 2FODA 1Z6JH 4XE4A 1LO6A 3B8JA 1C2IA 3A8DA 1V2VT 2XRCA 1Y3VA 4ESTE 1HAPH 2ZGJA 1CHGA 1UK3A 1FV9A 1L0ZA 2QXJA 2VBCA 3ZZAA 1EB1H 5A2MH 1XKAC 3RLYH 1GWAA 3T5FH 4O9VA 1O38A 1O2GH 2VIPA 1O2SA 4X1NU 3TLOA 4Y10E 4Z0KA 3T2NA 2ZPQA 1C5YB 3WW7A 3JZ2B 3GCNA 3ZV9A 1NROH 1UJ1A 2F43B 2WPLS 2Z6BD 2PKAA 4DIIH 4X2VA 4TPIZ 2OD3B 1ZRBA 2ZG0H 3B23B 1YF4A 2TBSA 3RXAA 2Z9GA 2BDAA 4NIXA 3T25A 3EA8A 1LKBA 4XBBA 1UVOA 3FP6E 1HCGA 2WZQA 1VCWA 4B2AA 4U2WA 1P3CA 3AW0A 3BTME 1V2TT 1C1MA 4MVNA 5SGAE
chains in the Genus database with same CATH topology
3AASA 1IQLA 1DICA 3T62A 1C9PA 2B0FA 1P9SA 4AZ2B 4BTUB 2A5KA 2FS9A 2CJIA 3LKWA 2FX6A 1ZTJA 3E6PH 1P06A 5ETXA 4K3JA 5ESBA 2BDHA 1GJ6A 4R0IA 2J94A 1OSSA 1AQ7A 4IC6A 1K1IA 1DXPA 1ESAA 4MNXA 1O3OA 4FU7A 1WQVH 1O3FA 1AVWA 1TMTH 5LPFA 4YLQH 1P0SH 5GWZA 1P3EA 2WPKS 2FMJA 1DOJA 1IQKA 1F5LA 2H9EH 3VB7A 1C5NH 1C5OH 3Q76A 1NU7B 3KCGH 1SHYA 1C5ZB 4B76A 2VWOA 4WF8A 3SU2A 4DOQA 1GJDB 5AF9H 4I8LA 2WPMS 4Y7BA 5DP4A 2B5TB 3GDUA 4AYYB 3C1KA 1EJMA 1SVPA 2C8YB 1BBRK 1D9IA 4ISLA 2ZU3A 1C1PA 2SFAA 1GBDA 3SU4A 1F0UA 3U98H 2G8TA 4PROA 3DT0H 5F8TA 1DY9A 3MNCA 1HB0B 2D26C 5H4IB 1O30A 3KQBA 4CR5A 1DY8A 1GMCG 4YO9A 3SOSA 1C5PA 3GY3A 1TMBH 1ZHRA 3BN9A 1JBUH 3RM2H 2FOEA 2QF3A 3UR9A 1QBNA 1WTGH 3R0FA 1SLUB 4R8TB 4X6OA 1GMCF 2J38A 3BG4C 4YM9A 1W13U 2XWAA 1T8OA 1GCTB 2FXRA 1VGCB 1XXFA 4E7RG 1O2IA 1O2XA 1P09A 2GT8A 1TX8A 2P59A 1TBQH 3T28A 2Y81A 3A80A 3EE0B 2Z3EA 2Y82A 4Y11E 1KXDA 1ZLRA 1ELTA 1MTUA 1Z8JB 3F9EA 1KSNA 5JDUB 2GDEH 1AMHA 2FLBH 1A0JA 2EEKA 2W26A 3E16B 2H6MA 4A1VA 3CS7A 3P6ZB 3VB4A 1Z1JA 1GDNA 5EOKA 2FLRH 4IMZA 3TK9A 1QRZA 6ESTA 3E0PB 2F9BH 4B74A 1SL3A 2P16A 1OOKB 1ARCA 4K1SA 1NRRH 2GD4B 4TY6A 3R3GB 5EQRA 1O2VA 3CENA 1DM4B 2SGAA 1WTHD 4OS2A 2STAE 2ANMH 2Q6DA 3I29A 1NFWA 4CBNA 1EP6A 4ABDA 1EOJA 4AN7A 3P8GA 5CHAC 3GY8A 3K9XB 2ZFSA 1EUFA 5DKMA 1V2WT 1ZMJA 1SGQE 2V6NA 4NGAH 3A8AA 1OPHB 1SGTA 4ABHA 3RC5A 3S9CA 3FANA 4TY7A 1Z8RA 3KQCA 1NM6A 2BY6X 1QJ6B 1KXBA 2F9OA 3RMLH 1TPAE 4IGDA 1O2LA 1THPB 9LPRA 1MAYA 1GG6C 2Y80A 3DHKH 4NIYA 3M7QA 3SU0A 2FI4E 1PPCE 1MQ6A 1AFQB 2VVVA 1SB1H 1VITG 4FVBA 1RS0A 3TJOA 3SU1A 4ISNA 3FZZA 1VCPA 1SFIA 1E38B 2UWPA 1TALA 2Q1JA 5A8YA 4FU8A 1DLKB 2OBQA 3GY7A 5GPIB 2ZA5A 3MTYA 3ITIA 1YM0A 4NFFA 1NFXA 3MHWU 3PMBB 3TVJB 1K22H 4H4FA 1JMOH 4AGKA 4NWKA 1TGNA 4DT7B 7GCHG 3ZVCA 3VB5A 3RLWH 2JKHA 3NKKA 4INLA 2BDCA 2A45B 1FJSA 2PW8H 6GCHF 3M5MA 1DX5M 3GISB 1QL7A 2ODYB 2FP7B 3LJJA 3TGIE 1DITH 2D8WA 4YOJA 2VVUA 7GCHF 1Q3XA 1GI4A 3HPTB 4B2BA 4FUBA 5A0CA 3FFGA 1VJ9U 5CE1A 3NK8A 1IAUA 2HOBA 3A86A 3SI4H 5GDSH 1TONA 1ELAA 2BD4A 1T7CA 2SGDE 1WYKA 2ILNA 2NU1E 3C27B 2G55A 1P2MA 2F91A 2SNVA 4DW2U 1W8BH 2ODQA 1HAOH 2ZQ1A 3Q3KA 4JYTA 4CRGA 1Q31A 1TNKA 1QBOA 3EDXB 3KHVA 3ZVBA 3NCLA 2QCYA 4I33A 1O3PB 2F9NA 3LT3A 1JRTA 2G4TA 5EW1H 2VGCB 2V35A 4NIWA 1GJAB 1IQNA 1SBWA 1GGDC 1IQEA 3P8OA 5DJ7A 1H9HE 3H7OA 1W14U 2IJOB 4D7GA 1GBEA 5IYTA 2G52A 1XUIA 1O5GH 2AMPA 4I8KA 3VXEH 3MH5A 2J2UA 3ATMA 3P92A 2GMTB 1C1RA 2G5NA 1C4Y2 1RFNA 2RA3A 4IS5A 3ESTA 2ZU5A 1G9IE 4HGCA 2FEQH 1TWXB 3SU3A 1LPZB 1FAKH 2PSXA 3L3TA 4TYDA 1G3BA 1HAVA 3ATLA 2FM2A 1XM1A 4CRAA 3A83A 2ODPA 2ANWA 2JETC 1T31A 4VGCC 3SV9A 1T32A 3TITA 1YYY1 1D3PB 4KELA 1AN1E 1TRNA 1O3CA 1EJNA 2GZ8A 5HM2A 5E2OA 1E36B 4INHA 5CHAB 3HATH 2PV9B 3D62A 1CT0E 1MKWH 2WPHS 4X1QU 1ELFA 5PTPA 1ZSJA 1OYQA 2J92A 4AOQA 4MPVA 1C9TA 2ZEBA 1QRXA 1ZGIA 1O2JA 3NWUA 5HXFA 1BTXA 2IOTA 3VB6A 1JXPA 4WMFA 5F8XA 1C5WB 1NRPH 2XC5A 3SU6A 1BTYA 1RRKA 4SGAE 1THRH 2J4IA 1C1QA 4TPYA 1C1VH 3LGVA 2XTTB 4DY7B 2P93A 1MMJN 1F0RA 3K2UA 1V2RT 1S0RA 2K1QA 1GPZA 1N8OB 1IQGA 3EAJA 4INKA 4TWYA 3ZZCA 5EXNA 2R0KA 3GCHC 1VR1H 3BIUH 1UVUH 1OKXA 4ZXYH 1SC8U 1GCDA 1ORFA 1IQIA 4CRCA 1KXCA 5EODA 2VIDA 6LPRA 1AVGH 1NESE 3RXRA 2XNIA 1UHBB 4ZKSU 4FUEA 1FAXA 3SGAE 4WH6A 4D76A 3F1SB 2TIOA 4WXVA 1LVMA 3RDZA 3K6YA 1W0ZU 1A3BH 3PYHA 5DG6A 2ZNKH 2VGCC 3LONA 1FI8A 1JOUB 1NS3A 3NZIA 4CH8B 2FOBA 2W7UA 4NG9H 1QRWA 1RJXB 2PKAB 1ARBA 4XBCA 1EPTA 4E05H 2GX4A 4K8YA 1C5MD 4MNWA 1FDPA 1UVTH 3PB1E 4IMQA 5HM9A 1O3MA 3UQVA 2ZI2H 1FY1A 3OX7U 1GJCB 5FBEA 4ZHMU 2VIVA 1PFXC 5E2PA 1CHOF 3TH2H 1FQ3A 1PPBH 1NFUA 1UTOA 3NXPA 2TPIZ 1V2LT 1L4DA 5DPAA 2ZDLA 1FLEE 1CHOG 2QYIA 1TX6A 3ZZ7A 1BA8B 1CSOE 4H6TA 3ZV8A 5L30H 2ALVA 3VPKA 1ZMLA 4A6LA 1AZZA 3B9FH 2FOFA 4AB8A 1GHAF 4JMYA 2ZFFH 5FPYA 1K1MA 1MD8A 4CHAB 1P12E 1P11E 2ANKH 4K69A 2ZU1A 5F6MA 1A5HA 2UWLA 1BOQA 5DP9A 3QGJA 1NN6A 1PQ5A 1BMNH 4JK5A 1TPSA 1DSTA 2BVSH 1PPHE 3MWIU 4A92A 2XYAA 3O8RA 3PWBA 3LC5A 1TLDA 2ESTE 3QZQA 1CBWB 3GCOA 2FOAA 4CR9A 2Z9LA 4DGJA 1CA0C 1ETTH 3A89A 2XW9A 4JYVH 2IPHA 3SNEA 4CRFA 2GCHF 1EKBB 3FP7E 1XUKA 5TCCA 2W7SA 1UTLM 1F5KU 1QBVH 3FZDA 1KTTB 3Q77A 4LZ1H 5BRRE 2CN0H 3MFJA 1ZPBA 1CGIE 2Y5FA 3TK5A 4GHQA 3P70B 4LOYH 1GI0A 4NZQA 4YLUA 1O5AB 3DUXH 5T6FA 1JIMA 1K1LA 4BAKB 2HLCA 1K9OE 1K1OA 4OGXA 1TFXA 1O39A 3BTKE 1A4WH 4JZ1A 3GY6A 2BB4A 4I8HA 2PGBB 1V2QT 3UNRA 1A0LA 1NT1A 2VIWA 2BLVA 1OWEA 1HAZB 2H1UA 2A32A 3LJOA 1O5CB 1FN6A 1RTKA 2BOKA 1E0FD 2HWLB 4NA8A 1C5XB 1TABE 3ZZ8A 5DP3A 1GBTA 2A5AA 2SGPE 3HKIB 1NRQH 3M61U 1NU9A 4UFFH 2BZ6H 3MU0A 5JB8S 2CF8H 2OXSA 2YOLA 5C2ZA 1NO9H 2VINA 4I32A 5DO4H 2KAIA 7KMEH 4MPWA 3ZVFA 2PUQH 4H6SB 1A46H 2WYJA 1G37A 4HI3A 1H9LB 2BD7A 4DVAU 3QZRA 1HLTH 3EA9A 3A85A 3EGKH 3A87A 3UFAA 3URDA 2A1DB 1A5IA 3QWCH 4AFSA 4Y71A 1INCA 1LHCH 3UREA 3A82A 4IW4E 2TGPZ 3SUGA 1DUAA 1GHXH 2A0QB 1HJAC 4Y8ZA 3GY4A 2FZZA 3BG8A 2OC1A 4X8SH 1TA2A 1UTMA 4YOIA 1E35B 3DFLA 2PTNA 5J4SA 2BTCE 3UWJH 1NZQH 1PQ8A 3L33A 2XC0A 1VJAU 4AGJA 5B6OA 1WUNH 2JETB 1EZXC 2ZFQH 1HAVB 1MU6B 5AFYH 1CA8B 4ZKNU 1GVZA 1ELBA 2PWXA 3D49H 3ZZ3A 3ZZ4A 3RMMH 2Z3DA 2H5DA 4O3TA 1TPOA 1D6RA 2FIRH 3ZVDA 1XVMA 1GHBF 1LVOA 4GVUA 4ABIA 3RXBA 3ZVGA 5AFZH 4B1TA 2ALPA 1TGBA 1GBJA 6GCHG 1TBRH 3JZ1B 4UE7H 3PM3A 4ZUHA 1BITA 1GBLA 1C1NA 1O32A 1EASA 3LGWA 3SORA 1C2EA 3QO6A 4X8VH 3SJKA 3V13A 1YPGH 3UY9A 3A7ZA 5L6NH 4JZEH 4RSPA 5LPEA 1TA6A 4KGAA 4LXBH 2UUFB 2HVXA 4A5TS 1G3DA 5C5OA 3SV6A 2BD8A 3G01A 4B75A 1OX1A 1PYTC 2A7CA 3T29A 4JK6A 4U01A 2EI8A 1YC0A 4ABFA 3EA7A 1TBZH 1GHWH 2F3CE 3LPRA 3IWMA 1EPTB 3MU8A 1OP0A 1YPHC 3SV7A 4RKJB 1XVOA 3SNAA 5GXPA 8LPRA 1THSH 5C5NA 1MTSA 5DGJA 3SU5A 3SHAH 1AGJA 1UTJA 1HDTH 1MZAA 1QJ1B 4ISHH 2BX3A 1SQOA 1ELGA 1F2SE 1BTZA 1F7ZA 4ABGA 4ABAA 1KLIH 1CQQA 1H8DH 1EZSC 3RM0H 1HPGA 3STJA 2VWMA 2P8OC 1IHTH 3QLPH 1XKBC 1C5TA 1TQ0B 2ZFTA 3RXFA 5C20A 3MNXA 1GL0E 5A8ZA 4NWLA 1DSUA 4XSKU 2AIPA 1L4ZA 2Y6TA 2HNTC 4ISOA 5JB9S 2CF9H 1Z1IA 1D3DB 2HGTH 2C8XB 4X1RU 3K65B 1O2YA 1BIOA 3MU1A 4CH2B 1ETRH 3PMHB 3QN7A 3QDZB 1J15A 3F68H 2B8OH 1ZJDA 3DD2H 1EAWA 4K60A 1T8MA 1A3EH 1Y5UT 3MU4A 3M37A 4ZMAH 3UUZA 3MNBA 3MH7A 1RGQA 1ZPZA 2GMTC 4FU9A 1BZXE 1RTLA 3BTGE 3OU0A 4ZHLU 3LGIA 2C3SA 1OYTH 3M7UA 1T8LA 3M7TA 2GKVE 5HYOA 2FX4A 4GUXA 5FXLA 4X1SU 3TPIZ 1B0FA 4AB9A 4UEHH 2BDGA 4NA7A 2P8OB 1Y8TA 4AG2A 4CRDA 1GGDB 1BRBE 5GIBA 1AIXH 1MTWA 1QA7A 1LHGH 2DE8A 5DP8A 1DWEH 1TGSZ 3UNQA 2ZDAH 4I8JA 1XX9A 2ZPSA 2PUXB 2R2WU 4IC5A 1SI5H 2ZTZA 1YBWA 1TGTA 1MUEB 1OWDA 4FVDA 1O2OA 3SBKA 3RU4T 1W12U 3HGPA 2JH5D 1W11U 3TJVA 1C5VA 3Q00A 4DJZB 8ESTE 3RXUA 3M3TA 3CP7A 4X0WU 1P03A 1AO5A 1FY8E 2FDAA 1GI8B 1BQYA 3S7HB 1SGRE 1B7XB 1C5QA 1SGFA 1SPJA 5I46H 2GCHG 3BEFB 1AE8H 2PKSB 2ZHFH 1D3TB 1SGDE 3PTNA 1UK2A 3E8LA 1G3EA 1GBFA 2BQWB 3GY5A 2HRVA 1P2KA 1TMUH 2QXIA 5AHGH 2ZDMA 1XXDA 1C2JA 1JWTA 1Y3WA 4K5ZA 1EAUA 1FY5A 3ZZBA 3LGYA 1OWHA 2G51A 2RA0A 1ETSH 1N1LA 4GPGA 3T27A 3TNTA 2PSYA 1CVWH 1QR3E 2ZDVH 2BD3A 5A0BA 1YP9A 2FI5E 2V3OH 1S5SA 1IQFA 1D4PB 1LHFH 2A7HA 3M36A 3P8NA 5TJXA 4A7IB 4YT7H 4KKDA 1BRAA 1KXAA 2Z9JA 1FUJA 3RXLA 3NPSA 3RC4A 2VVCA 1MH0A 1LPGB 5DP5A 2BDBA 1AY6H 2ZPRA 1OS8A 5C1XA 2WINI 3BSQA 4GAWA 1G2LA 2G00A 1J8AA 3K6ZA 2V0BA 3M35A 4CREA 2KAIB 5EXMA 1ELCA 3PLPA 1BCUH 4ZAEA 1GI9B 3P17H 1C1TA 4GLYA 3OTJE 3RXQA 2ZGXH 1S6HA 1FMGA 1O2NA 2Y5HA 2A2XH 1SGNE 2ZHWH 5FX6A 1ZTLA 1Z7KA 2ZFRH 3UTUH 4OS1A 1MKWK 5E0HA 3GDVA 1C1WH 3PMAB 3ZZ5A 1EB2A 5BPEA 4YT6H 1EPTC 2PKSC 3OY5U 3RU4D 1TOMH 3PV4A 3GYLB 3BTTE 1KLJH 4THNH 1AI8H 3BTQE 1QQ4A 3ZZ6A 4BNRA 1T4VH 2I6SA 2OCVB 2VJ1A 1K1NA 1ELDE 3A7VA 3BIVH 1O3NA 1TOCB 2UUKB 4FUFA 1F92A 1O2QA 3S9AA 3KQEA 2Q6GA 2ZCLP 1OWIA 1O2HA 1Z71A 1PPGE 3FAOA 2Q6FA 1TNGA 1SFQB 1IQHA 3PO1B 3TH4H 1BHXB 1J17T 2OC7A 3GCTG 3GYMA 3E0NB 3OY6U 1O3AA 1V2PT 3RXEA 1TNJA 1AUJA 1ID5H 3P8FA 5ESTE 1CT2E 2YNBA 2EI6A 1O3IA 1K21H 1L1JA 1MZDA 4IBLH 3D65E 1PPZA 2BD9A 3LU9B 3RXHA 2ZHQH 4YTAA 3SJIA 2O8TA 1WOFA 2WV5A 1O35A 3VGCB 1SOTA 1SLWB 4TWWA 1CGJE