1HJ9A

Atomic resolution structures of trypsin provide insight into structural radiation damage
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQITSNMFCAYGLEGKGDSCQGDSGGPVVCSGKLQGIVSWGSGCQAKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords BETA-TRYPSIN
publication title Atomic Resolution Structure of Trypsin Provide Insight Into Structural Radiation Damage
pubmed doi rcsb
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2001-01-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hj9A01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1hj9A02
2VVUA 1UVSH 1AO5A 1S5SA 2PW8H 2ZQ2A 4OS7A 2EEKA 1O3NA 1SPJA 3Q3XA 4A7IB 3HPTB 3ZZ7A 1D9IA 4CR5A 1JBUH 1BMNH 3RC4A 2ZHDA 3BG4B 1O2WA 2CJIA 1TBRH 5DPAA 3LOXA 4YM9A 3DD2H 1UK3A 1TPOA 2Z7FE 4K1EA 2ZTXA 1GCTC 2SGQE 3VXEH 1AB9C 4FUDA 4WY3A 1QBOA 1O3IA 1GHXH 3FP7E 4NIXA 2G00A 2BDIA 2RG3A 2W3IA 1RTLA 4CRBA 3AW1A 1BJUA 1LO6A 1VGCB 3TGJE 1YBWA 3S9CA 4DIIH 2WPMS 4BNRA 1W13U 2ZDNA 1HAXB 1AN1E 2ZDVH 4BAOB 1O3LA 2VGCC 2LNCA 2Z9LA 4I33A 3R0FA 1N8OC 3SOSA 3MI4A 1EZSC 1O35A 1RFNA 1QURH 2GGVB 3M7QA 2QXHA 2F3CE 1ZSLA 3E1XB 1MKWK 3RXSA 4X1SU 1F7ZA 1A5IA 2BQ7B 3LPRA 3KHVA 4X1QU 4E06H 1DICA 1GHVH 1TNKA 4B1TA 4JZDH 1NPMA 1S0QA 2PWXA 1C5TA 2ZP0H 2UWPA 1G3DA 2DE9A 3SNCA 5A09A 3ATIA 1MTUA 1EJNA 4SGBE 5T6DA 3TGKE 3ZYDA 5TJXA 4ABIA 1TGBA 3SUFA 5T6GA 3B23B 1D4PB 1FY5A 1EPTA 2I6SA 1K1MA 1TMTH 4B73A 1HCGA 5HM2A 1C1OA 1C5QA 1GJAB 3GCTG 1TPAE 4AG2A 5C1UA 3QDZB 4O3UA 2YNBA 1DWCH 2AMQA 5GXPA 1QY6A 1OOKB 1UJ1A 3A86A 1A3EH 5GDSH 3E0NB 3PWBA 3UNQA 1GVKB 1AGJA 1CGJE 5AFZH 5EQSA 1P06A 3RXIA 4AFQA 4YO9A 5IYTA 4YESB 1T8MA 1C2DA 2ZHQH 1TNHA 2WYGA 1AUTC 1VCQA 4ZMAH 1NFWA 1QTFA 1G36A 3IITA 3A83A 1LHCH 2PUXB 3ZZCA 1KXFA 1QRWA 3ZZAA 3BTDE 2F9BH 1ZZZA 2W7SA 1W0YH 7ESTE 3SJKA 3P8FA 2C8XB 1KY9A 1QIXB 2ILNA 2XRCA 1RRKA 2AGIX 2BDGA 6CHAC 1TONA 1L2EA 3A85A 1ZGVA 5EXLA 1F5KU 2FO9A 1ELEE 1FNIA 2P59A 2ALPA 2Y5GA 1FN8A 1TMUH 1KLIH 3FP6E 1S6FA 3FFGA 4JK6A 2ZA5A 1Y3WA 4ZHMU 2ZGJA 2BDHA 4JZIA 1SQOA 1GVZA 4Y79A 1TALA 4TPIZ 3QO6A 2GZ7A 1GBMA 1RTFB 1YPMH 2B5TB 2B7DH 2CV3A 3T62A 5LPRA 5JBCS 3BF6H 4R0IA 3ZVEA 1KXEA 3TK6A 3S9AA 3ODFA 3KQBA 1ZJDA 2F9PA 1UVTH 5FCKA 2Q6FA 1EAWA 4KTSA 1ARBA 2IN2A 1A5GH 4RSPA 2GP9B 1TX6A 1V6DA 4WMFA 1GMCG 1SQAA 2FPZA 4GAWA 1YGCH 1O5GH 1UO6A 4BAQB 1XKAC 3T28A 3QN7A 1UK2A 1KLJH 1C5PA 2ANKH 2V35A 3GICB 5C67A 3H5CB 1QL8A 1MBQA 3PMJA 1TA2A 2V3HH 1AWFH 1LVYA 1OS8A 3PTNA 3SJ8A 1KXAA 2PKSC 4K3JA 3SUGA 1W3CA 2NU0E 3KL6A 1SB1H 2ZO3H 5A8XA 3A89A 1OWIA 4JZEH 1BIOA 4YLQH 1O3PB 4H6TA 1HJ9A 3FP8E 3MNXA 2VIWA 2ZPQA 1U6QA 1B5GH 2O8WA 1IQJA 3PMAB 1YLCA 3TNSA 1KIGH 6ESTA 2UWOA 3S7KB 1F92A 3EA9A 1D6WA 1TGTA 4IBLH 4KGAA 1LHEH 3TK9A 1SGRE 2ZI2H 3B9FH 2PV9B 2OC0A 1EB2A 1GCDA 4ZHAA 1XXFA 3BTTE 4O03A 4HZHA 1SOTA 1ZTJA 3TGIE 1FJSA 3M5LA 4A5TS 1GHBG 1TPSA 3L3TA 1P05A 2HVXA 3NCLA 1C5ZB 2KAIA 3QZRA 4AORA 4WH6A 2ZDLA 1EP6A 1HFDA 1P2MA 1O5FH 4JYVH 1GHZA 1J14A 1O2UA 1RJXB 4JZFH 1LHFH 4X2VA 2WPJS 2XBVA 3OY6U 1NESE 1Z8IB 4TPYA 3A84A 4INHA 3UNSA 1G9IE 2AMPA 2GZ9A 4CRFA 1S6HA 4ISNA 3L6PA 5JB8S 1SGDE 4Y10E 5DP5A 1AMHA 2ZNKH 3VGCC 1TNLA 2ZGXH 3ZYEA 3ZVCA 1YPKH 5AHGH 2WV4A 1C2MA 1IQLA 1GGDB 1DLKB 5DGJA 2EA3A 2AFQB 1BHXF 2ZFPH 5GCHG 3M3VA 2FYQA 3BSQA 3RXDA 3RXQA 2ODYB 4I31A 1EOJA 4YLUA 3P70B 5C1YA 5DO4H 3UR6A 1G30B 1GI8B 3AAVA 4VGCC 1F2SE 3UFAA 3V3MA 4AN7A 2ALVA 3MH7A 1UCYH 4BANB 1Y5AT 1SLXB 1LQEA 2W5EA 2FXRA 3UR9A 3QTOH 4IN1A 1GHWH 1ZPZA 1F5LA 3BG8A 4K2YA 3RM2H 1AKSA 4CRCA 2GV7A 3RUOA 3EDXB 2G52A 2FI3E 2WINI 2B9LA 8GCHG 1DXWA 3RMLH 1O3KA 1DSUA 4A6LA 1AVXA 3LONA 2O9QA 1P8VC 1NZQH 1TOCB 1QL9A 3A8CA 2HPPH 2R0KA 2A5IA 1DVAH 1ELVA 3GY3A 1O3CA 2FOAA 2Z9GA 5DP7A 1GHAG 4JCNA 4WXIA 1C9TA 3LH3A 1JMOH 1W14U 4F49A 1EQ9A 3SHAH 2QC2A 4X6PA 1HLTH 1EZQA 3HKJB 5DG6A 1O37A 2GV6A 3E16B 3A81A 1NRRH 4H4FA 1Z8GA 1F5RA 5FCRA 4Y7BA 2GDDA 3LKWA 3ZZ9A 2GX4A 2ZU3A 5FPSA 1WQSA 4D9RA 5FBIA 1ABJH 1NTPA 5DK1A 1C2HA 3RXTA 1UTKA 3U1IB 1AQ7A 1VJ9U 2GCTB 3NK8A 1JOUB 3RP2A 1UHBA 1ZJKA 3BIVH 1ELBA 5A0CA 2VH0A 5ETXA 1KTSB 2GT7A 4DURA 1CHOF 4RKOB 2BZ6H 2FWWA 2HWLB 1H9IE 3ENSB 2VIOA 4K1TA 1GI4A 4X1RU 4HI3A 1O3HA 1BTWA 3RU4E 4MG3A 2FS8A 2Z94A 5T6FA 1KXDA 4I8JA 1CHGA 2VB0A 4Q7XA 2ANWA 1QFKH 2PHBA 1S85A 3SU1A 3CS7A 1DXPA 4B75A 1LPGB 1QB9A 2Q1JA 1C2IA 2TGTA 1W7GH 1K1OA 1P9SA 3KNXA 4AZ2B 1VCWA 3EGKH 1HAYB 4Y6DA 1V2TT 1J16A 1LPKB 4OS6A 4GHTA 2ZFFH 1TNGA 1VITF 2ODPA 1IQEA 3GCOA 3GY2A 2C8ZB 2BXUH 2XWAA 2XBWA 2RA3A 1O2NA 1QB6A 4FU9A 1A1RA 5E0GA 3K65B 3LGYA 3M5OA 2FM2A 4NZLA 1A61H 3M7UA 1V2WT 2PFEA 2BQWB 1V2VT 3DFJA 2EI7A 2CXVA 4NZQA 1D3QB 1FUJA 4YT6H 2A4QA 2A0QB 1YPEH 5GPIB 1XXDA 3B8JA 3GOVB 2K1QA 2Z9JA 2ZKSA 1O33A 4QT8C 1P2OA 1GJ9B 1IQNA 3RXOA 1YP9A 2PGQB 2QY0B 3E3TA 2A2XH 1SFIA 1PPEE 2CF8H 3V12A 3LGWA 1A0JA 4INLA 1OYTH 3PMBB 1ELTA 2ZU5A 1FPHH 2OUAA 3QX5H 3GYMA 1AVWA 1BTHH 2AH4X 3PLKA 2YOLA 2TGAA 5ABWA 2ZFTA 3UOPA 2O8MA 3TH2H 1J8AA 1MKXH 3LC5A 1SLVB 2GDEH 1EZUC 1BTZA 2VINA 1FV9A 2BD8A 2NU3E 1Y8TA 2SNVA 5DP6A 1HAZB 5F8ZA 4GHQA 1OP8A 3SU4A 2AIPA 4I8GA 1AB9B 2HNTE 1XUGA 1PFXC 2C3SA 2ZWLH 4KTCA 2BDYA 1MTNB 5DP4A 3SJIA 5FAHA 3SV6A 5GIBA 5EGMA 2F83A 3FZZA 4X6NA 4XE4A 1YPGH 2BLVA 2QYIA 1HXEH 3A7VA 4ISHH 3GY4A 1ORFA 2ZFSA 3KQDA 2CHAC 4OS5A 1N8OB 1EB1H 5ESBA 2OBQA 1NRQH 3Q00A 1O3BA 1V2ST 5HM9A 1T8NA 1OSSA 3KIDU 4ZXYH 3GY5A 4LK4A 4XBBA 3BEIB 3BTEE 1GJ7B 1QQ4A 1K9OE 4FUCA 3QGJA 2QA9E 1C1TA 2WPHS 3MTYA 1EP5A 2M5TA 1P02A 1FPCH 3HK6B 4FUBA 3MH4A 4ABBA 4OGXA 3EA8A 2HRVA 1C2GA 1EATA 1GMDG 3ZZ5A 2R9PA 3SGQE 1FQ3A 1WOFA 2R2WU 4IMQA 1SC8U 3GCTF 4UFGH 3F9GA 4NGAH 3MNCA 1CVWH 5DJ7A 4MTBA 2A32A 5FX5A 1AE8H 2ZTYA 4GUXA 1W10U 4ZROA 2P3UB 4CHAB 3S0NA 1SHYA 4X8UH 2R3YA 3NWUA 4AFUA 4IW4E 1P12E 2J2UA 4AG1A 2ZHFH 2HPQH 2BVSH 1MD8A 3Q3KA 4XDEA 3RMNH 5FBEA 1GJ6A 4D8NA 1MBMA 1V2UT 4I8KA 5DP9A 2B0FA 2DUCA 1NRPH 4NIYA 1NN6A 1Z6JH 2J95A 2FMJA 1HAIH 1Y5UT 1LDTT 4FXGH 4NSVA 2P94A 2ZFQH 1MTNC 1UVOA 4KP0A 1TX8A 1P0SH 3SJOA 2BY9X 5CHAC 1ELDE 2BTCE 5EW1H 1DS2E 2C4FH 5A8ZA 4A1XA 1LVMA 1C1NA 3O8RA 1CA0C 1Z71A 1GBCA 1ESTA 1YPJH 3AW0A 3F9FA 1SFQB 1QRXA 6CHAB 3RXPA 3SU3A 4X2XA 4AYYB 3RXAA 1HUTH 1MUEB 1CBWB 1EX3A 2G4TA 3K2UA 1BT7A 4Y71A 2TIOA 1P9UA 2HNTF 1NC6A 3ZV9A 1MCTA 2GMTC 2QXJA 1JRSA 5J4QA 4Q7YA 3PROA 4CH8B 1BRAA 5LH8A 1GMCF 4KTUA 4ZH8A 2WYJA 2P8OC 2FOFA 4NWKA 3RXGA 4BXWA 4AB9A 4K69A 2ANYA 4MPXA 1A3BH 1IQGA 2BLOA 2J9NA 4WMEA 3VXFH 5C5NA 3E90B 3AAUA 4NA7A 3W95A 1Q2WA 1ID5H 2BDAA 5BPEA 4Q2KA 2I6QA 1O5CB 1YM0A 2UWLA 2PTCE 1GBFA 2STAE 4GVUA 1W8BH 4ABGA 1MKWH 4CHAC 1RD3B 1W0ZU 1LVBA 5JBBS 3TK5A 3MNBA 3LH1A 1BMMH 2R3UA 5JB9S 3SNAA 4X1NU 1FDPA 3WY8A 5PTPA 7GCHG 2ZDKA 4CREA 2PKSB 2Z9KA 5F8XA 3RXEA 1MTWA 4WXVA 1THRH 1GI5A 2ZCKP 3AASA 2ANMH 3QWCH 4Y0ZE 1O34A 1T8OA 1TMBH 3MU0A 5L2YH 2CMYA 1J17T 3LIWA 1TGCA 2W26A 1GBIA 1ESBA 1V2JT 3MU5A 1C4U2 4MDSA 3RXLA 1TRMA 1GBKA 3E8LA 1C1PA 1J9CH 1GBLA 5EXNA 4NSYA 2OC1A 1GHBF 3BTHE 1SLUB 3UIRA 3A8DA 2SGAA 5EQQA 2Q6GA 3LC3A 4MPUA 2A45B 2WPKS 3PLBA 4B76A 2OD3B 1TFXA 2D8WA 3UREA 1CBWC 3URDA 2BOKA 4IN2A 1O0DH 1O3JA 2VWOA 5JBTA 1C5VA 1C5LH 2Z3EA 2ZGBH 5EU8A 3UNRA 2V0BA 4ABEA 2P3FH 2GD4B 3ZZ3A 1BCUH 1TLDA 3PB1E 4M7GA 4ZKRU 2UUYA 2H9TH 5EPNA 1EJMA 2Y6TA 2ZGHA 1DM4B 1F0SA 1LCYA 2ZU2A 2F9NA 2CN0H 5GCHF 2QF3A 1NRSH 5J4SA 3VGCB 5DP3A 1W2KH 3IG6B 3AVZA 4IC6A 1FAKH 1EKBB 2XW9A 1AFEH 1NO9H 1XUJA 3SQEE 4HTCH 2ZF0H 2OC7A 4RN6A 1DFPA 2BXTH 3OSYA 1ETTH 1RXPA 4ABAA 2A7HA 2R0LA 2HGTH 2ZDAH 1UMAH 1E36B 4Z0KA 4XOJA 2A4RA 3TH3H 4VGCB 3UQOA 1G2LA 1C1QA 1GJ4H 1O39A 1T32A 1SI5H 1V3XA 2WV5A 1EPTB 1ZLRA 1O5AB 1S82A 3U9AH 1IQHA 8GCHF 2DE8A 3T5FH 1AE5A 2AIQA 1G37A 1AZZA 2FEQH 3M3TA 4ZHLU 2VIDA 1BBRH 2Q6DA 3A80A 1O2VA 1LTOA 1HYLA 3OTJE 2RCEA 1DOJA 3M37A 4AOQA 1C2LA 3TH4H 3RLWH 1GHAF 3FAOA 3SQHE 5JPMH 5TCCA 3O8BA 5I25A 1D3TB 3MHWU 1AHTH 2JH5D 4BAMB 1XVOA 3NZIA 3ZZBA 3QZQA 3RXVA 3UY9A 1O2XA 4NCYA 3UTUH 1GJ8B 4X8SH 1GBEA 3LGVA 3ZVBA 2XTTB 3CP7A 4I8LA 5F6MA 4BXSA 1AI8H 3GCHC 1O31A 4YT7H 1T7CA 2VVVA 5HMAA 2THFB 3M35A 5K7RA 1DLEA 4GCHG 3L33A 3BEFB 4O3TA 3SBKA 4F4OC 5C2ZA 2AERH 4NWLA 2SGDE 4Y8ZA 3MU4A 4ASHA 1M9UA 1HAPH 3I29A 3ZZ4A 1O3GA 4X2YA 1IAUA 1GBJA 3DHKH 1UTJA 2GKVE 2BDCA 1MTSA 1BRCE 1GI7B 1QNJA 1CGIE 1PQ5A 2FTLE 2WUCA 2QV1A 5L2ZH 3SGAE 4CBNA 3E91A 4K60A 2IPHA 5E2PA 2A31A 3VB7A 1TE0A 1C1VH 1UCYK 3ODDA 2PSXA 1TYNA 1CA8B 1V2PT 1O2LA 4D7FA 3ESTA 4ZKNU 2BD4A 5B6OA 1ABIH 1SL3A 4K1SA 3F9HA 1YC0A 2PLXA 4NIWA 2J92A 1N1LA 3IWMA 4GSOA 2C8YB 1HPGA 3NKKA 1OWDA 1NROH 2Z9IA 1MZAA 2AGGX 4FUEA 1SBWA 3K9XB 1EPTC 2B8OH 1KSNA 2QCYA 3GY7A 1UTQA 1OYQA 3I77A 3ATLA 1ZRBA 1O2IA 1A2CH 1T4UH 1THSH 4YOIA 3ZZ6A 3OU0A 2VNTA 1ZGIA 3R3GB 1SG8B 1P3CA 2UUFB 1SGQE 1SLWB 1TA6A 1TNJA 1V2OT 2F9OA 3FVFB 1A4WH 3KEEA 3NXPA 4Y8XA 1GMHF 1WV7H 1MQ6A 4ZAEA 4A1VA 2HOBA 3RXKA 1P11E 3M61U 3A7WA 4AYVB 1QGFA 1O3DA 1TBQH 3KF2A 1PPCE 3GCNA 1QJ1B 1ETSH 2H5DA 3P92A 4JZ1A 2BD7A 2BY6X 1DY8A 4LZ1H 1TX7A 3N7OA 1N6YA 1QBVH 1BA8B 1H8DH 3Q76A 4DG4A 5L30H 1P2NA 1CT0E 1DANH 3JZ2B 1HJ8A 4OS2A 3M5NA 5DKMA 1C5NH 1RS0A 3A7XA 1G3EA 1P03A 1Y3VA 3G01A 2BOHB 3PM3A 1V2MT 2PSYA 3A8AA 3VFEA 1P2QA 4D76A 3TJOA 1MMJN 2C90B 1ZMNA 2FLRH 1GDUA 4MPWA 3RXMA 4Y7AA 1QCPA 3KCGH 5TCAA 3HK3B 4LOYH 3TJNA 1ELAA 1C5SA 5K0HA 1NFUA 3QK1A 4FU7A 1O2JA 2ULLA 4YZUA 1O2MA 1GG6C 4D9QA 1H9LB 2BY7X 4UFDH 2H5CA 3MU1A 3F1SB 2XWBI 2BZAA 2UUKB 1MTVA 5JBAS 5G4BA 2J34A 2VIQA 5A0BA 5DP8A 1TGNA 1D3DB 1SQTA 1DX5M 1K1JA 1HB0B 3SNDA 1BJVA 4Y0YE 4FUJA 2BD3A 1LQDB 3H7OA 1O5BB 3BTFE 2CHAB 4OS4A 2YNAA 1C2EA 1EUFA 1HAVA 2XBYA 1GI0A 3PLPA 2G5NA 1BQYA 3MO9A 5AVDA 2V3OH 3RC5A 1C1SA 1HIAB 1OWEA 3DA9B 4ABHA 1XUIA 2QN5T 4FVBA 1AUJA 4AFZA 1GJDB 3SV7A 1CO7E 2JH6D 3FZDA 4D7GA 4JYUH 3QLPH 1QQUA 1GJ5H 2P16A 1GMHG 1A7SA 1GMDF 4NFFA 5E0HA 3LU9B 4U30A 1D3PB 4IMZA 7KMEH 3SU0A 3BTQE 1O3AA 3K6YA 1KXBA 1PJPA 1AD8H 1KLTA 1TQ7B 5LPFA 1WBGB 1ZMLA 4X8TH 3VPKA 1GI3A 3SNEA 2LPRA 9LPRA 1BTXA 1SSXA 3O8DA 1IOEA 3EA7A 2GT8A 2BVXH 3CS0A 1ZHPA 4UDWH 2QF0A 4CBOA 1OPHB 3TJUA 3U69H 2FS9A 1IQKA 2Y7XA 3P6ZB 5I46H 1BTUA 3CENA 3STIA 3PMHB 3BIUH 3SW2B 3ZZ8A 2GCHG 3SUEA 1Z8JB 4DOQA 3MWIU 2IJOB 1TIOA 2FOBA 4AGKA 4B2AA 1YF4A 4DJZB 2OC8A 1H9HE 1AZ8A 1SGNE 2SFAA 2QAAA 1BRUP 3ZVAA 3DUXH 1PPBH 5F03A 1H8IH 4ESTE 1SGFA 1JWTA 1EXFA 2FP7B 2QXGA 4NA8A 4PROA 4BTTB 2ZGCA 3SHCH 1OWJA 5E2OA 5CHAB 2ZCLP 1NY22 2H6MA 1QR3E 3FANA 2ZDMA 3RDZA 1E37B 3A82A 2TPIZ 3D65E 3EAJA 1DWBH 4ZXXH 1EOLA 3M7TA 1O3EA 3D23A 1CA0B 4TY7A 1P3EA 1UCYE 1VZQH 3P17H 2UUJB 4O97A 3LGUA 1GBBA 2A4GA 4AX9H 3STJA 2ZU1A 2W7UA 2O8LA 5E0JA 2A1DB 2PTNA 5AF9H 3UOUA 1ZTKA 3A7TA 1NM6A 1JXPA 3SI3H 8LPRA 1BRBE 1O3FA 1TQ0B 1ELGA 4K8YA 1S0RA 4YOJA 1TOMH 1O2KA 3HKIB 1MQ5A 3SV2H 2GMTB 2VWMA 4E7NA 4Q7ZA 1PQAA 1IQMA 2WPIS 3SUDA 2P8OB 4XFQA 2FI5E 1GVLA 2ZECA 5FX6A 1E34B 1JIMA 4MNXA 3GDUA 1TPPA 1DUAA 1GPZA 1F0UA 4NG9H 1DE7H 2ZG0H 1FIWA 4IS5A 1JRTA 2BDBA 3T27A 3ZVGA 1SGFG 4ABFA 1YPHE 7GCHF 3MMGA 1ANDA 1AVGH 1ARCA 4ZUHA 4X1PU 4FU8A 1L1GA 3QTVH 3ZZDA 2C8WB 1L4ZA 2XC4A 1BDAA 3ATMA 3UQVA 1E38B 1C4V2 2AMDA 1WTHD 3UWJH 4JMYA 1UVUH 1YCPH 1AIXH 1QA7A 5HXFA 4WJG2 1PPFE 1UTPA 1DWEH 1GI2A 1FI8A 3SO3A 4YOGA 1O3MA 4AGJA 3SV8A 1MAXA 1DSTA 1P10A 1HNEE 3O8CA 2OBOA 1EAIA 1KDQB 1TNIA 1B0EA 3RU4T 5LGOA 1XMNB 1MAYA 1SOZA 2XXLA 2FTMA 3BTKE 1RTKA 1UTMA 1TABE 1VJAU 2G4UA 1CE5A 3P95A 2A5AA 4FUGA 1K2I1 4UEHH 1SGPE 2CF9H 4TWYA 2A5KA 2SGEE 1DPOA 1UTNA 2FOEA 3GDVA 3M3SA 4DW2U 3PTBA 3TVJB 5A2MH 4XBCA 1TBZH 1HAHH 1OWKA 3GY6A 1WUNH 4CRAA 1YPLH 1THPB 1ZMJA 2TBSA 4WMDA 1LKAA 1MU8B 1CU1A 2GTBA 1AFQC 1ZSJA 3S7HB 1O2TA 2OLGA 1GBDA 3GY8A 4X0WU 1S81A 1UTOA 1CT4E 2BY8X 2ZC9H 2Z3DA 1EAXA 1PPHE 2BQ6B 2C93B 1SVPA 2PUQH 6LPRA 1EZXC 1FONA 1BMLA 1S84A 2D2DA 1CQQA 1RIWC 1NS3A 3HGPA 4Z6AH 1FY8E 4R8TB 2OTVA 1O5EH 1KYNA 2OQUA 3I78A 2XCNA 3EQ0H 2JKHA 1EJAA 1VITH 4ISIH 2OINA 2PKAB 2XNIA 3GYLB 2G81E 2XBXA 3HATH 3TU7H 3QUMP 1P04A 2ASUB 1FN6A 4UONA 3UPEA 3EYDA 3T29A 2BX3A 6GCHG 2QGRA 3A88A 4RKJB 5BRRE 1FY3A 2RA0A 4DIHH 1CT2E 1KXCA 3Q77A 3NPSA 2Y5HA 1QHRB 3BG4C 1MU6B 5EQRA 1NT1A 2ZEBA 4MNWA 4U2WA 1H4WA 2SGPE 2ZPSA 3A7ZA 1NRNH 5AFYH 4WF8A 2BHGA 1Y3YA 1J15A 3RXUA 1ACBE 1A0HB 3U98H 3A7YA 4GLYA 3RXBA 3U8RH 2FOGA 4GCHF 3GISB 1BTYA 2JETB 2F91A 2PGBB 1X7AC 4JK5A 3GCHB 4U32A 1VGCC 1OKXA 1TWXB 2VIVA 1GBTA 3MFJA 1QB1A 1WQVH 3H7TA 1Z1JA 2OQ5A 4INKA 2D1JA 1FLEE 2BD2A 2P3TB 1ZRKA 2QXIA 1ESAA 2BVRH 1P2JA 2ZIQH 1LKBA 2H9HA 4X2WA 1JIRA 4DY7B 5LPEA 4J2YB 1Z6EA 5GJ4B 3BEUA 1DT2A 1NFXA 2BM2A 1HV7A 3SNBA 1Z7KA 2AS9A 4KKDA 2G8TA 1FZZA 3URCA 1LPZB 5F8TA 1N6XA 3P8OA 3UUZA 3T25A 1C4Y2 3JZ1B 1QJ6B 2ZFRH 3OX7U 1QJ7B 3SU6A 4BAHB 5CE1A 1C2FA 1ZHRA 1D6RA 2XYAA 1BBRK 2A7CA 1C5YB 1C5MD 3TPIZ 1HAGE 4B71A 1LMWB 1PYTC 4WWYA 3RMMH 1RGQA 1ZTLA 4B74A 1UTLM 2JH0D 2FZZA 4DCDA 5H4IB 3E0PB 4ABDA 4WH8A 3RXFA 1LHDH 3A87A 1S83A 1YLDA 2EI6A 3SZNA 2BMGB 1XUKA 2J4IA 2QIQA 2RDLA 4FUIA 2XCFA 4Y8YA 3RXJA 3TNTA 2VJ1A 5FPTA 1QL7A 1K22H 4THNH 2FX4A 1SHHB 3D49H 2BLQA 2FESH 3DT0H 1ZR0A 2ODQA 3M5MA 3MYWA 4ISOA 4NIVA 1V2NT 1NU7B 3U8TH 2ZHEH 2JETC 3PV4A 4FVDA 1K1IA 2FOMB 5T3HA 1FXYA 1TB6H 5EW2H 3RXCA 3BTME 2BD5A 4Y11E 1FMGA 1G3CA 5FXLA 4CRDA 1WSSH 1GWAA 3VEQB 1CGHA 1GL1A 1L0ZA 4X8VH 1HDTH 1C5WB 1IHSH 3VB6A 1MD7A 1WAYB 2XC0A 3RXHA 1G2MA 2BLWA 2O8UA 2FYRA 4BTUB 1SGCA 1V2QT 5C1XA 4K5ZA 2FDAA 3BV9B 3MU8A 5HYOA 5A8YA 3OY5U 2ZQ1A 2Z6BD 1O2ZA 1NFYA 4XBDA 2G51A 1HXFH 1FY4A 2BY5X 3BN9A 2H2ZA 3SU2A 4WVPE 2FLBH 4LZ4B 4ZKSU 1OWHA 1GG6B 2P95A 5EOKA 3MO6A 1K21H 2ZU4A 4J1YA 5JDUB 1L1NA 1YKTA 1ZYOA 2P93A 4X6OA 1OP2A 4K8BA 3P8NA 4MNYA 3T2NA 4TWWA 3RM0H 1AU8A 1C1UH 5FPYA 3SN8A 1Y59T 1XVMA 2HLCA 4JYTA 3F9EA 1GI6A 1ANCA 2HNTC 1Y3UA 2J94A 2OP9A 4TYDA 1L4DA 3F6UH 1HIAA 1Y5BT 1LHGH 1E0FD 1F0TA 3P8GA 2VWNA 1OP0A 1XUHA 1FAXA 1CSOE 3MOCA 3LGTA 2BB4A 1BUIA 3LJJA 2ZHWH 3GDSA 4KELA 4NFEA 1INCA 1EASA 1SR5C 3D62A 1O36A 1QA0A 2AEIH 3RLYH 4X6MA 3PWCA 2A4OA 1GHYH 1ZHMA 4E05H 1Z1IA 1YCPM 4FUFA 3C1KA 2NWNA 1F0RA 1WTGH 2BYAX 1P09A 1WYKA 1PQ7A 1FY1A 1P01A 2PR3A 1V2RT 1O2SA 1SMFE 2EC9H 3KQCA 1O2OA 1PPGE 2J38A 1PQ8A 1ZSKA 3V7TA 3TIUA 1V2LT 1H1BA 4O9VA 9ESTA 4UD9H 4Y76A 1NU9A 2GZ8A 2FX6A 1VCPA 1IQIA 2GCHF 2D26C 2FOCA 1WCZA 2Y82A 1IHTH 5C3NA 3T26A 2KAIB 3DFLA 2TRMA 1B0FA 1XKBC 2Z3CA 3W94A 1SGTA 4U01A 5GWZA 3C27B 5EG4A 3SV9A 3KQEA 1FIZA 1AY6H 4DGJA 2Y80A 8KME2 1A5HA 4MVNA 3PO1B 1C9PA 2OXSA 2H9EH 1B7XB 1O32A 1YPHC 3MNSA 3BTWE 4B2CA 5C20A 4AFSA 1GI9B 1GDNA 3SORA 1TRYA 2Y7ZA 2NU2E 2W3KA 1DUEA 1TRNA 4NA9H 3S69A 1Q31A 3ATKA 1GGDC 4H42U 2A7JA 5IDKA 2SGFE 5EXMA 1O2PA 4CRGA 1BITA 5L6NH 2FI4E 3ZV8A 1O2QA 1SGEE 2AGEX 3LGIA 5E8EH 2ZTZA 5SGAE 3V0XA 1O2YA 3TLOA 3ELAH 3LT3A 4CH2B 4DVAU 1GI1A 1QRZA 2V6NA 3SU5A 4E7RG 1BB0B 1O3OA 1QBNA 3LDXH 1BBRE 3TITA 1HAOH 4LXBH 3RMOH 1O2GH 1T4VH 2XC5A 1XUFA 4CR9A 1LVOA 2GVFA 2IOTA 1MCVA 2NU4E 1A46H 2ZCHP 2TGDA 4XSKU 1YYY1 3K6ZA 3VB5A 4BTIB 2ZPRA 1AKSB 1C5OH 3Q3YA 5C5OA 4OGYA 2G5VA 1VR1H 1IQFA 4I7YH 2FIRH 4ZKOU 1PYTD 1MKXK 2BD9A 2OCVB 3ZVDA 2FODA 3MH6A 4IGDA 1BHXB 3F68H 3KN2A 3A8BA 1O5DH 1G32B 1EAUA 1AWHB 1C1WH 3VB3A 1HJAB 3RU4D 2A2QH 1PPZA 1ELFA 1SGIB 3PYHA 5EPYA 1P57B 1W11U 1O30A 1C2KA 2VWLA 2Y81A 1C1MA 5EODA 4UFEH 3SGBE 1V2KT 1TAWA 4TY6A 1DWDH 3SJ9A 4BAKB 1T8LA 3KGPA 4UE7H 4AB8A 4H6SB 3QGNB 8ESTE 1G3BA 2STBE 5A0AE 1L1JA 2GCTC 1DY9A 1WU1A 3PO1C 2CGAA 4MLFB 4SGAE 3RC6A 7LPRA 3TJVA 1BMAA 2FOHA 1MZDA 1GJBB 2NU1E 1HBTH 1HRTH 1DDJA 1T31A 1XM1A 2VIPA 5ESTE 3M36A 1UHBB 1KDQA 3NUMA 1KTTB 4MQAA 4I32A 1Y3XA 1K1LA 4MNVA 2R2MB 2HALA 4BOHA 2O8TA 1ZPBA 4DT7B 4YTAA 2BX4A 1HGTH 1UK4A 3MH5A 1GL0E 4ISLA 1CHOG 1O2HA 1GCTB 1E35B 1ANBA 2ESTE 4UFFH 1ZOMA 1O2RA 4OS1A 5JYIA 3E6PH 3MO3A 4I8HA 4GPGA 1MH0A 1K1NA 3HGNA 2AYWA 4A92A 3OYPA 1DITH 2WPLS 3EE0B 1K1PA 1GBAA 1C5RA 3LJOA 2VGCB 2H1UA 4B2BA 3ZVFA 1AFQB 5FHTA 1ELCA 1OXGA 1OX1A 1O38A 1W7XH 2G55A 1A0LA 1P2IA 4HFPB 3S9BA 1K28D 2VH6A 2Y5FA 1HAVB 4MPVA 3V13A 1ANEA 2F9UA 2VVCA 4IC5A 2SNWA 3VB4A 1BZXE 1UVPA 5HGGA 3UWIA 2WUBA 1VITG 2F9VA 1GDQA 4HGCA 2VU8E 3U1JB 1W12U 1XX9A 4ABJA 2TGPZ 1RIWB 2ZZUH 1ZPCA 1C2JA 3SI4H 1YCPK 1ETRH 1GJCB 1HJAC 3ATWA 1GBHA 1C5UA 2EI8A 2PKAA 1BOQA 3ITIA 4FUHA 1TGSZ 1SGYE 1Z8RA 4Q80A 1C5XB 1BTPA 3RXRA 6GCHF 3BTGE 4A1TA 1C1RA 3U8OH 5CMXH 1P2KA 1Q3XA
chains in the Genus database with same CATH superfamily
2VVUA 1SKYE 1UVSH 1AO5A 1S5SA 4Z1MD 2PW8H 2ZQ2A 4OS7A 2EEKA 1O3NA 1SPJA 3Q3XA 4A7IB 3HPTB 3ZZ7A 1D9IA 4CR5A 1JBUH 1BMNH 3RC4A 2ZHDA 3BG4B 1O2WA 2CJIA 1TBRH 3F2GA 5DPAA 3LOXA 4YM9A 3DD2H 1UK3A 1TPOA 2Z7FE 4K1EA 2ZTXA 1GCTC 2SGQE 3VXEH 1AB9C 4FUDA 4WY3A 1QBOA 1O3IA 3UB0A 1GHXH 3FP7E 4NIXA 2G00A 2BDIA 2RG3A 2W3IA 1RTLA 4CRBA 3AW1A 1BJUA 1LO6A 1VGCB 3TGJE 1YBWA 3S9CA 4DIIH 2WPMS 4BNRA 1W13U 2ZDNA 1HAXB 1AN1E 2ZDVH 4BAOB 1O3LA 2VGCC 2LNCA 2Z9LA 4I33A 3R0FA 1N8OC 3SOSA 3MI4A 3SZEA 1EZSC 1O35A 1RFNA 1QURH 2GGVB 3M7QA 2QXHA 2F3CE 1ZSLA 3E1XB 1MKWK 3RXSA 4X1SU 1F7ZA 1A5IA 2BQ7B 2KCAA 3LPRA 3KHVA 4X1QU 4E06H 4XD7D 1DICA 1GHVH 1TNKA 4B1TA 4JZDH 1NPMA 1S0QA 2PWXA 1C5TA 2ZP0H 2JIZD 2UWPA 1G3DA 2DE9A 3SNCA 5A09A 3ATIA 1MTUA 1EJNA 2K0QA 4SGBE 5T6DA 3TGKE 3ZYDA 5TJXA 4ABIA 1TGBA 2WPDD 3SUFA 5T6GA 3B23B 1D4PB 1FY5A 1EPTA 2I6SA 1K1MA 1TMTH 4B73A 1HCGA 5HM2A 1C1OA 1C5QA 1GJAB 2JJ1D 3GCTG 1TPAE 4AG2A 5C1UA 3QDZB 4O3UA 2YNBA 1DWCH 2AMQA 5GXPA 1QY6A 1OOKB 1UJ1A 3A86A 1A3EH 5GDSH 3E0NB 3PWBA 3UNQA 1GVKB 1AGJA 1CGJE 5AFZH 5EQSA 1P06A 3RXIA 4AFQA 4YO9A 5IYTA 4YESB 1T8MA 1C2DA 2ZHQH 1TNHA 2WYGA 2YMSB 1AUTC 1VCQA 4ZMAH 1NFWA 1QTFA 1G36A 3IITA 3A83A 1LHCH 2PUXB 3F3BA 3ZZCA 1KXFA 1QRWA 3ZZAA 3BTDE 2F9BH 1ZZZA 2W7SA 1W0YH 7ESTE 3SJKA 3P8FA 2C8XB 1KY9A 1QIXB 2ILNA 2XRCA 1RRKA 3OEHD 3N7EA 2AGIX 2BDGA 6CHAC 1TONA 1L2EA 5T1VA 3A85A 1ZGVA 5EXLA 1F5KU 2FO9A 1ELEE 1FNIA 2P59A 2ALPA 2Y5GA 1FN8A 1TMUH 1KLIH 3FP6E 1S6FA 3FFGA 4JK6A 2ZA5A 1Y3WA 4ZHMU 2ZGJA 2BDHA 3MQKC 4JZIA 1SQOA 1GVZA 4Y79A 1TALA 3AK5A 4TPIZ 3QO6A 2GZ7A 1GBMA 1RTFB 1YPMH 2B5TB 2B7DH 2CV3A 3T62A 5F53A 5LPRA 5JBCS 1MABB 3BF6H 4R0IA 3ZVEA 1KXEA 3TK6A 2KX4A 3S9AA 3ODFA 3KQBA 1ZJDA 2F9PA 1UVTH 5FCKA 2Q6FA 1EAWA 4KTSA 1ARBA 2IN2A 1A5GH 4RSPA 2GP9B 1TX6A 1V6DA 4WMFA 1GMCG 1SQAA 2FPZA 4GAWA 1YGCH 2GJGA 1O5GH 1UO6A 4BAQB 1XKAC 3T28A 3QN7A 1UK2A 1KLJH 1C5PA 2ANKH 2V35A 3GICB 5C67A 3H5CB 1QL8A 1MBQA 3PMJA 1TA2A 2KCPA 1AWFH 2V3HH 1LVYA 1OS8A 3PTNA 3SJ8A 1KXAA 2PKSC 4K3JA 3SUGA 1W3CA 2NU0E 2WV9A 3KL6A 1SB1H 2ZO3H 5A8XA 3A89A 1OWIA 4JZEH 1BIOA 4YLQH 1O3PB 4H6TA 1HJ9A 3FP8E 3MNXA 2VIWA 3DCLA 2ZPQA 1U6QA 1B5GH 2O8WA 1IQJA 3PMAB 1YLCA 3TNSA 1KIGH 6ESTA 2UWOA 3S7KB 1F92A 3EA9A 1D6WA 1TGTA 4IBLH 4KGAA 1LHEH 3TK9A 1SGRE 2ZI2H 3B9FH 2PV9B 2OC0A 1EB2A 1GCDA 4ZHAA 1XXFA 3BTTE 4O03A 4HZHA 1SOTA 1ZTJA 3TGIE 1FJSA 3M5LA 4A5TS 1GHBG 1TPSA 3L3TA 1P05A 2HVXA 3NCLA 1C5ZB 2KAIA 4F48B 2L74A 3QZRA 4AORA 4WH6A 2ZDLA 1EP6A 1HFDA 1P2MA 1O5FH 4JYVH 1GHZA 1J14A 1O2UA 1RJXB 4JZFH 1LHFH 4X2VA 5C17A 2WPJS 2XBVA 3OY6U 1NESE 1Z8IB 4TPYA 3A84A 4INHA 3UNSA 1G9IE 2AMPA 2GZ9A 4CRFA 1S6HA 4ISNA 3L6PA 5JB8S 1SGDE 1BMFD 4Y10E 5DP5A 1AMHA 2ZNKH 3VGCC 1TNLA 2ZGXH 3ZYEA 3ZVCA 1YPKH 5AHGH 2WV4A 1C2MA 5HKKD 1IQLA 1GGDB 1DLKB 5DGJA 2EA3A 2AFQB 1BHXF 2ZFPH 5GCHG 3M3VA 2FYQA 3BSQA 3RXDA 3RXQA 2ODYB 4I31A 1EOJA 2K8IA 4YLUA 3P70B 5C1YA 5DO4H 3KQ5A 3UR6A 1G30B 4DT4A 1GI8B 3AAVA 4VGCC 1F2SE 3UFAA 3V3MA 4AN7A 2ALVA 3MH7A 1UCYH 4BANB 1Y5AT 1SLXB 1LQEA 2W5EA 4ACAA 2FXRA 3UR9A 3QTOH 4IN1A 1GHWH 1ZPZA 1F5LA 3BG8A 4K2YA 3RM2H 1AKSA 4CRCA 2GV7A 3RUOA 3EDXB 2G52A 2FI3E 2WINI 5KEDA 2B9LA 8GCHG 1DXWA 2HLDD 1O3KA 1DSUA 2KCYA 3RMLH 4A6LA 1AVXA 2V7QD 5DSFA 3LONA 2O9QA 1P8VC 1NZQH 1TOCB 1QL9A 2QF5A 3A8CA 2HPPH 2R0KA 2A5IA 1DVAH 1ELVA 3GY3A 1O3CA 2FOAA 2Z9GA 5DP7A 4ACBA 1GHAG 4JCNA 4WXIA 1C9TA 3LH3A 1JMOH 1W14U 4F49A 1EQ9A 3SHAH 2QC2A 4X6PA 1HLTH 1EZQA 3HKJB 5DG6A 1O37A 2GV6A 3E16B 3A81A 1E1RD 1NRRH 4H4FA 1Z8GA 2OK5A 1F5RA 5FCRA 4Y7BA 2GDDA 3LKWA 2RFKC 3ZZ9A 2GX4A 2ZU3A 5FPSA 1WQSA 4D9RA 5FBIA 1ABJH 1NTPA 5DK1A 1C2HA 3RXTA 1UTKA 3U1IB 1AQ7A 1VJ9U 2GCTB 3NK8A 1JOUB 3RP2A 1UHBA 1ZJKA 3BIVH 1ELBA 5A0CA 2VH0A 5ETXA 1KTSB 2GT7A 1UW7A 4DURA 1CHOF 4RKOB 2BZ6H 2FWWA 2HWLB 1H9IE 3ENSB 2VIOA 2IJD1 4K1TA 1GI4A 4X1RU 4HI3A 1O3HA 1BTWA 3RU4E 4MG3A 2FS8A 2Z94A 5T6FA 1KXDA 4I8JA 1CHGA 2VB0A 4Q7XA 2ANWA 1QFKH 2PHBA 1S85A 3SU1A 3CS7A 1DXPA 3ZIAD 4B75A 1LPGB 1QB9A 2Q1JA 1C2IA 2TGTA 1W7GH 1K1OA 1P9SA 3KNXA 4AZ2B 1VCWA 3EGKH 1HAYB 4Y6DA 1V2TT 1J16A 1LPKB 4OS6A 4GHTA 2ZFFH 1TNGA 4TT3D 1VITF 2ODPA 1IQEA 3GCOA 3GY2A 1WXRA 2C8ZB 2BXUH 2XWAA 2XBWA 2RA3A 1O2NA 1QB6A 2V3MA 4FU9A 2J98B 1A1RA 5E0GA 3K65B 3LGYA 3F2FA 3M5OA 2FM2A 4NZLA 1A61H 3M7UA 1V2WT 2PFEA 2BQWB 1V2VT 1E79D 3DFJA 2EI7A 2CXVA 4NZQA 1D3QB 1FUJA 4YT6H 2A4QA 2A0QB 1YPEH 5GPIB 1XXDA 3B8JA 3GOVB 2K1QA 2Z9JA 2ZKSA 1O33A 4QT8C 1P2OA 1GJ9B 1IQNA 3RXOA 1YP9A 2PGQB 2QY0B 3E3TA 2A2XH 1SFIA 1PPEE 2CF8H 3V12A 3LGWA 1A0JA 4INLA 1OYTH 3PMBB 1ELTA 2ZU5A 2KFWA 1FPHH 2OUAA 3QX5H 3GYMA 1AVWA 1BTHH 2AH4X 3PLKA 2YOLA 2TGAA 5ABWA 2ZFTA 3UOPA 2O8MA 3TH2H 1J8AA 1MKXH 3LC5A 1SLVB 2GDEH 1EZUC 1BTZA 2VINA 1FV9A 2BD8A 2NU3E 1Y8TA 2SNVA 5DP6A 1NBMD 1HAZB 4XRNA 5F8ZA 4GHQA 1OP8A 3SU4A 4P02A 2AIPA 4I8GA 1AB9B 2HNTE 1XUGA 1PFXC 2C3SA 2ZWLH 4KTCA 2BDYA 1MTNB 5DP4A 3SJIA 5FAHA 3SV6A 5GIBA 3NRLA 5EGMA 2F83A 3FZZA 3UAIC 4X6NA 4XE4A 1YPGH 2BLVA 2QYIA 1HXEH 3A7VA 3DSPA 3GY4A 4ISHH 1ORFA 2ZFSA 3KQDA 2CHAC 1COWD 4OS5A 1N8OB 1EB1H 5ESBA 4B6EA 2OBQA 1NRQH 3Q00A 1O3BA 1V2ST 5HM9A 1T8NA 1OSSA 3KIDU 4ZXYH 3F0OA 3GY5A 4LK4A 4XBBA 5KGOA 3BEIB 3BTEE 1GJ7B 1QQ4A 1K9OE 4FUCA 3QGJA 2QA9E 1C1TA 2WPHS 3MTYA 1EP5A 2M5TA 1P02A 1FPCH 3HK6B 4FUBA 3MH4A 4ABBA 4OGXA 3EA8A 2HRVA 1C2GA 1EATA 3WWBA 1GMDG 3ZZ5A 2R9PA 3SGQE 1KMHB 1FQ3A 1WOFA 2R2WU 4IMQA 1SC8U 3GCTF 4UFGH 3F9GA 4NGAH 3MNCA 1CVWH 5DJ7A 4MTBA 2A32A 5FX5A 1AE8H 4AC9A 2ZTYA 4GUXA 1W10U 2M2AA 4ZROA 2P3UB 4CHAB 3S0NA 1SHYA 4X8UH 2R3YA 3NWUA 4AFUA 4IW4E 1P12E 2J2UA 4AG1A 2ZHFH 2HPQH 2BVSH 1MD8A 3Q3KA 4XDEA 3RMNH 1W0KD 5FBEA 3CNRA 4ZCNA 1GJ6A 4D8NA 1MBMA 1V2UT 4I8KA 5DP9A 2B0FA 2WSSD 2DUCA 2PP6A 1NRPH 4NIYA 1NN6A 1Z6JH 2J95A 2FMJA 1HAIH 1Y5UT 2L6OA 1LDTT 4FXGH 4NSVA 2P94A 2ZFQH 1MTNC 1UVOA 4KP0A 1TX8A 1P0SH 3SJOA 2BY9X 5CHAC 1ELDE 2BTCE 5EW1H 1DS2E 2C4FH 5A8ZA 4A1XA 1OHHD 3PRBA 3KYFA 1LVMA 1C1NA 3O8RA 1CA0C 1Z71A 1GBCA 1ESTA 1YPJH 3AW0A 3F9FA 1SFQB 1QRXA 6CHAB 3RXPA 3SU3A 4X2XA 4AYYB 3RXAA 5EJLA 1HUTH 1MUEB 1CBWB 1EX3A 2G4TA 3K2UA 1BT7A 4Y71A 2J97A 2TIOA 1P9UA 2HNTF 1NC6A 3ZV9A 1MCTA 2GMTC 2QXJA 1JRSA 5J4QA 4Q7YA 3PROA 4CH8B 1BRAA 5LH8A 1GMCF 4KTUA 4ZH8A 2WYJA 2P8OC 2FOFA 4NWKA 3RXGA 4BXWA 4AB9A 4K69A 2ANYA 4MPXA 1A3BH 1IQGA 2BLOA 2J9NA 4WMEA 5KECA 3VXFH 5C5NA 3E90B 5FL7D 3AAUA 4NA7A 3W95A 1Q2WA 1ID5H 2BDAA 5BPEA 4Q2KA 1YY3A 1O5CB 2I6QA 1YM0A 2UWLA 2PTCE 1GBFA 2STAE 4GVUA 1W8BH 4ABGA 1MKWH 4CHAC 1RD3B 1W0ZU 1LVBA 5JBBS 3TK5A 3MNBA 3LH1A 1BMMH 2R3UA 5JB9S 3SNAA 4X1NU 1FDPA 3WY8A 5PTPA 7GCHG 2ZDKA 4CREA 2PKSB 2Z9KA 5F8XA 3PV2A 4HG6A 1H8ED 3RXEA 1MTWA 1W0JD 4WXVA 1THRH 1GI5A 2ZCKP 3AASA 2ANMH 3QWCH 4Y0ZE 1O34A 1T8OA 1TMBH 3MU0A 5L2YH 2CMYA 1J17T 3LIWA 1TGCA 2W26A 1GBIA 1ESBA 1V2JT 3MU5A 1C4U2 4MDSA 3RXLA 1TRMA 1GBKA 3E8LA 1C1PA 1J9CH 1GBLA 5EXNA 4NSYA 2OC1A 1GHBF 3BTHE 1SLUB 3UIRA 3A8DA 2SGAA 5EQQA 2EY4C 2Q6GA 3LC3A 4MPUA 2A45B 2WPKS 3PLBA 4B76A 2OD3B 1TFXA 2D8WA 3UREA 1CBWC 3URDA 2BOKA 4IN2A 1O0DH 1O3JA 3PRDA 2VWOA 5JBTA 1C5VA 1C5LH 2Z3EA 2ZGBH 5EU8A 3UNRA 2V0BA 4ABEA 2P3FH 2GD4B 3ZZ3A 1BCUH 1TLDA 3PB1E 4M7GA 4ZKRU 2UUYA 2H9TH 5EPNA 1EJMA 2Y6TA 2ZGHA 1DM4B 1F0SA 1LCYA 2EQNA 2ZU2A 2F9NA 2CN0H 5GCHF 2QF3A 1NRSH 5J4SA 3VGCB 5DP3A 1W2KH 3IG6B 3AVZA 4IC6A 1FAKH 1EKBB 2XW9A 1AFEH 1NO9H 1XUJA 3SQEE 1YWUA 4HTCH 2ZF0H 2OC7A 4RN6A 1DFPA 2BXTH 3OSYA 1ETTH 1RXPA 4ABAA 2A7HA 2R0LA 2HGTH 2ZDAH 1UMAH 1E36B 4Z0KA 4XOJA 2A4RA 3TH3H 4VGCB 3UQOA 1G2LA 1C1QA 1GJ4H 1O39A 5IK2D 1T32A 1SI5H 1V3XA 2WV5A 1EPTB 1ZLRA 1O5AB 1S82A 3U9AH 1IQHA 8GCHF 2DE8A 3T5FH 1AE5A 2AIQA 1G37A 1AZZA 2FEQH 3M3TA 4ZHLU 2VIDA 1BBRH 2Q6DA 3A80A 1O2VA 1LTOA 1HYLA 3OTJE 2RCEA 1DOJA 3M37A 4AOQA 1C2LA 3TH4H 3RLWH 1GHAF 3FAOA 3SQHE 5JPMH 5TCCA 3O8BA 5I25A 1D3TB 3MHWU 1AHTH 2JH5D 4BAMB 1XVOA 3NZIA 3ZZBA 3QZQA 3RXVA 3FN8A 3UY9A 2HVYB 1O2XA 3N7DA 4NCYA 3UTUH 1GJ8B 4X8SH 1GBEA 3LGVA 3ZVBA 2XTTB 3CP7A 4I8LA 5F6MA 4Q4LA 4BXSA 1AI8H 3GCHC 1O31A 4YT7H 1T7CA 2VVVA 5HMAA 2THFB 3M35A 5K7RA 1DLEA 4GCHG 3L33A 3BEFB 4O3TA 3SBKA 4F4OC 5C2ZA 2AERH 4NWLA 2SGDE 4Y8ZA 3MU4A 4ASHA 1M9UA 1HAPH 3I29A 3ZZ4A 1O3GA 4X2YA 5EJ1A 1IAUA 1GBJA 3DHKH 1UTJA 3F0PA 2GKVE 2BDCA 1MTSA 1BRCE 1GI7B 1QNJA 1CGIE 1PQ5A 2FTLE 2WUCA 2QV1A 5L2ZH 3SGAE 4CBNA 3E91A 4K60A 2IPHA 5E2PA 2A31A 3VB7A 1TE0A 1C1VH 5GNDA 1UCYK 3FO8D 3ODDA 2PSXA 1TYNA 1CA8B 1V2PT 1O2LA 4D7FA 3ESTA 4ZKNU 2BD4A 5B6OA 1ABIH 1SL3A 4K1SA 3F9HA 1YC0A 2PLXA 4NIWA 2J92A 1N1LA 3IWMA 4GSOA 2C8YB 1HPGA 3NKKA 1OWDA 1NROH 2Z9IA 1MZAA 2AGGX 4FUEA 1SBWA 3K9XB 1EPTC 2B8OH 4B6FA 1KSNA 2QCYA 3GY7A 1UTQA 1OYQA 3I77A 3ATLA 1ZRBA 1O2IA 1A2CH 1T4UH 1THSH 4YOIA 5HIZA 3OU0A 3ZZ6A 2VNTA 1ZGIA 3R3GB 1SG8B 1P3CA 2UUFB 1SGQE 1SLWB 1TA6A 1TNJA 1V2OT 2F9OA 2J98A 3FVFB 1A4WH 3KEEA 3NXPA 4Y8XA 1GMHF 1WV7H 1MQ6A 4ZAEA 4A1VA 2HOBA 3RXKA 1P11E 3M61U 2AHME 3A7WA 4AYVB 1QGFA 1O3DA 1TBQH 3KF2A 1PPCE 3GCNA 4RT1A 1QJ1B 1ETSH 2H5DA 3P92A 2XOKD 4JZ1A 2BD7A 2BY6X 1DY8A 4LZ1H 1TX7A 4M9FA 3N7OA 1N6YA 1QBVH 1BA8B 1H8DH 3OFND 3Q76A 4DG4A 5L30H 1P2NA 1CT0E 1DANH 3JZ2B 1HJ8A 4OS2A 3M5NA 5DKMA 1C5NH 1RS0A 2KR7A 3A7XA 1G3EA 1P03A 2JDID 1Y3VA 3G01A 2BOHB 3PM3A 1V2MT 2PSYA 3A8AA 3VFEA 1P2QA 4D76A 3TJOA 1MMJN 2C90B 1ZMNA 2FLRH 1GDUA 4MPWA 3RXMA 4Y7AA 1QCPA 3KCGH 5TCAA 3HK3B 4LOYH 3TJNA 1ELAA 5C94A 1C5SA 5K0HA 1NFUA 3QK1A 4FU7A 1O2JA 2ULLA 2KM0A 4YZUA 1O2MA 1GG6C 4D9QA 1H9LB 2BY7X 4UFDH 2H5CA 3MU1A 3F1SB 2XWBI 2BZAA 2UUKB 1MTVA 5JBAS 5G4BA 2J34A 2VIQA 5A0BA 5DP8A 1TGNA 1D3DB 1SQTA 1DX5M 1K1JA 2F43B 1HB0B 3SNDA 1BJVA 4Y0YE 4FUJA 3DSGA 2BD3A 1LQDB 3H7OA 1O5BB 3BTFE 2CHAB 4OS4A 2YNAA 1C2EA 1EUFA 1HAVA 2XBYA 1GI0A 3PLPA 2G5NA 1BQYA 3MO9A 5AVDA 2V3OH 3RC5A 1C1SA 1HIAB 1OWEA 3DA9B 1NBME 3W1EA 4ABHA 1XUIA 2QN5T 4FVBA 1AUJA 4AFZA 1GJDB 3SV7A 1CO7E 2JH6D 3FZDA 4D7GA 4YXWD 4JYUH 3QLPH 1QQUA 1GJ5H 2P16A 1GMHG 1A7SA 1GMDF 4NFFA 5E0HA 3LU9B 4U30A 2VBCA 1H8HD 1D3PB 4IMZA 7KMEH 3SU0A 1FX0B 3BTQE 1O3AA 2W6JD 3K6YA 1KXBA 5CHBA 1PJPA 1AD8H 1KLTA 1TQ7B 5LPFA 1WBGB 1ZMLA 4X8TH 3VPKA 1GI3A 3SNEA 4F55A 2LPRA 9LPRA 1BTXA 1SSXA 3O8DA 1IOEA 3EA7A 2GT8A 5DN6D 2BVXH 3CS0A 1ZHPA 4UDWH 2QF0A 4CBOA 1OPHB 3TJUA 3VG8A 3DSOA 3U69H 2FS9A 1IQKA 2Y7XA 3P6ZB 5I46H 1BTUA 3CENA 3STIA 3PMHB 3BIUH 3SW2B 3ZZ8A 2GCHG 3SUEA 1Z8JB 4DOQA 3MWIU 2IJOB 1TIOA 2FOBA 4AGKA 4B2AA 1YF4A 4DJZB 2OC8A 4TSFD 1H9HE 1AZ8A 1SGNE 2SFAA 2QAAA 1BRUP 3ZVAA 3DUXH 1PPBH 5F03A 1VKYA 1H8IH 4ESTE 1SGFA 1JWTA 1EXFA 2FP7B 2QXGA 4NA8A 4PROA 4BTTB 2ZGCA 3SHCH 1OWJA 5E2OA 5CHAB 2ZCLP 1NY22 2H6MA 1QR3E 3FANA 2ZDMA 3RDZA 1E37B 3A82A 2TPIZ 3D65E 3EAJA 1DWBH 4ZXXH 1EOLA 3M7TA 1O3EA 3D23A 1CA0B 4TY7A 1P3EA 1UCYE 1VZQH 2F4LA 3P17H 2UUJB 4O97A 3LGUA 1GBBA 2A4GA 4AX9H 2JJ2D 3STJA 2ZU1A 2W7UA 2O8LA 5E0JA 2A1DB 2PTNA 5AF9H 3UOUA 1ZTKA 3A7TA 1NM6A 1JXPA 3SI3H 8LPRA 4RT0A 1BRBE 1O3FA 1TQ0B 1ELGA 4K8YA 1S0RA 4YOJA 1TOMH 1O2KA 3HKIB 1MQ5A 3SV2H 2GMTB 2VWMA 4E7NA 4Q7ZA 1PQAA 1IQMA 3OEED 2WPIS 3SUDA 2P8OB 4XFQA 2FI5E 1GVLA 2ZECA 5FX6A 1E34B 1JIMA 4MNXA 3GDUA 1TPPA 1DUAA 1GPZA 1F0UA 4NG9H 1DE7H 2ZG0H 2CK3D 1FIWA 4IS5A 1JRTA 2BDBA 3T27A 3ZVGA 1SGFG 4ABFA 1YPHE 7GCHF 3MMGA 1ANDA 1AVGH 1ARCA 4ZUHA 4X1PU 4FU8A 1L1GA 3QTVH 3ZZDA 2C8WB 1L4ZA 2XC4A 2LP6A 1BDAA 3ATMA 3UQVA 1E38B 1C4V2 2QE7D 2AMDA 1WTHD 3UWJH 4JMYA 1UVUH 1YCPH 1AIXH 1QA7A 5HXFA 4WJG2 4I86A 1PPFE 3N99A 1UTPA 1DWEH 1GI2A 1FI8A 3SO3A 4YOGA 1O3MA 4AGJA 3SV8A 1MAXA 1DSTA 1P10A 1HNEE 3O8CA 2OBOA 1EAIA 1KDQB 1TNIA 1B0EA 3RU4T 5LGOA 1XMNB 1MAYA 1SOZA 2XXLA 3F2HA 2FTMA 3BTKE 1RTKA 1UTMA 1TABE 1VJAU 2G4UA 1CE5A 3P95A 2A5AA 4FUGA 1K2I1 1QZ8A 3OTPA 4UEHH 1SGPE 5CDFE 4FETA 2CF9H 4TWYA 2A5KA 2SGEE 1DPOA 1UTNA 2FOEA 3GDVA 3M3SA 4DW2U 3PTBA 3TVJB 5A2MH 4XBCA 1TBZH 1HAHH 1OWKA 3GY6A 1WUNH 4CRAA 1YPLH 1THPB 1ZMJA 2TBSA 4WMDA 1LKAA 1MU8B 1CU1A 2GTBA 1AFQC 1ZSJA 3S7HB 1O2TA 2OLGA 1GBDA 3GY8A 4X0WU 1S81A 1UTOA 1CT4E 2BY8X 2ZC9H 2RDEA 2Z3DA 1EAXA 1PPHE 2BQ6B 2C93B 1SVPA 2PUQH 6LPRA 1EZXC 1FONA 1BMLA 1S84A 2D2DA 1CQQA 1RIWC 1NS3A 3HGPA 4Z6AH 1FY8E 4R8TB 2OTVA 1O5EH 1KYNA 2OQUA 3I78A 2XCNA 3EQ0H 2JKHA 1EJAA 1VITH 4ISIH 2OINA 2PKAB 2XNIA 3GYLB 2G81E 2XBXA 3HATH 3TU7H 3QUMP 1P04A 2ASUB 1FN6A 4UONA 3UPEA 3EYDA 3T29A 2BX3A 6GCHG 2QGRA 3A88A 4RKJB 5BRRE 1FY3A 2RA0A 4DIHH 1CT2E 1KXCA 3Q77A 3NPSA 2Y5HA 1QHRB 3BG4C 1MU6B 5EQRA 1NT1A 2ZEBA 4MNWA 4U2WA 1H4WA 2SGPE 2ZPSA 3A7ZA 1NRNH 3FKSD 5AFYH 4WF8A 2BHGA 1Y3YA 1J15A 3RXUA 1ACBE 1A0HB 3U98H 3A7YA 4GLYA 3RXBA 3U8RH 2FOGA 4GCHF 3GISB 1BTYA 2JETB 2F91A 2PGBB 1X7AC 4JK5A 3GCHB 4U32A 1VGCC 1OKXA 1TWXB 2VIVA 1GBTA 3MFJA 1QB1A 1WQVH 3H7TA 1Z1JA 2OQ5A 4INKA 2D1JA 1FLEE 2BD2A 2P3TB 1ZRKA 2QXIA 1ESAA 2BVRH 1P2JA 2ZIQH 1LKBA 2H9HA 4X2WA 1JIRA 4DY7B 5LPEA 4J2YB 1Z6EA 5GJ4B 3BEUA 1DT2A 5C0UA 1NFXA 2BM2A 1HV7A 3SNBA 1Z7KA 2AS9A 4KKDA 2G8TA 1FZZA 3URCA 1LPZB 5F8TA 1N6XA 3P8OA 3UUZA 3T25A 1C4Y2 3JZ1B 1QJ6B 2ZFRH 3OX7U 1QJ7B 3SU6A 4BAHB 5CE1A 1C2FA 1ZHRA 1D6RA 2XYAA 1BBRK 2WZQA 2A7CA 1C5YB 1C5MD 3TPIZ 1HAGE 4B71A 1LMWB 1PYTC 4WWYA 3RMMH 1RGQA 1ZTLA 5HIYA 4B74A 1UTLM 2JH0D 4OM9A 2FZZA 4DCDA 5H4IB 3E0PB 4ABDA 4WH8A 3RXFA 5B6LA 3PV5A 1LHDH 3A87A 1S83A 1YLDA 2EI6A 3SZNA 2BMGB 1XUKA 2J4IA 2QIQA 2RDLA 4FUIA 2XCFA 4Y8YA 3RXJA 3TNTA 2VJ1A 5FPTA 1QL7A 1K22H 4THNH 2FX4A 1SHHB 3D49H 2BLQA 2FESH 3DT0H 1ZR0A 2ODQA 3M5MA 3MYWA 4ISOA 4NIVA 1V2NT 1NU7B 3U8TH 2YMSC 2ZHEH 2JETC 3PV4A 4FVDA 1K1IA 2FOMB 5T3HA 1FXYA 1TB6H 2IPQX 3OAAD 5EW2H 3RXCA 3BTME 2BD5A 4Y11E 1FMGA 1G3CA 5FXLA 4CRDA 1WSSH 1GWAA 3VEQB 1CGHA 1GL1A 1L0ZA 4X8VH 4P00A 1HDTH 1C5WB 1IHSH 3VB6A 1MD7A 1WAYB 2XC0A 3RXHA 1G2MA 2BLWA 2O8UA 2FYRA 4BTUB 1SGCA 1V2QT 5C1XA 4K5ZA 2FDAA 3BV9B 3MU8A 5HYOA 5A8YA 3OY5U 4FOUC 2ZQ1A 2Z6BD 2WHXA 1O2ZA 1NFYA 4XBDA 2G51A 1HXFH 1FY4A 1EFRD 2BY5X 3BN9A 2H2ZA 3SU2A 4WVPE 2FLBH 4LZ4B 4ZKSU 1OWHA 1GG6B 2P95A 5EOKA 3MO6A 1K21H 2ZU4A 4J1YA 5JDUB 1L1NA 1YKTA 1ZYOA 2P93A 4X6OA 1OP2A 4K8BA 3P8NA 4MNYA 3T2NA 4TWWA 3RM0H 1AU8A 1C1UH 5FPYA 3SN8A 5EJZA 3H09A 1Y59T 1XVMA 1E1QD 2HLCA 4JYTA 3F9EA 1GI6A 1ANCA 2HNTC 1Y3UA 2J94A 2OP9A 4TYDA 1L4DA 3WW7A 3F6UH 1HIAA 1Y5BT 1LHGH 1E0FD 1F0TA 1S6LA 3P8GA 2VWNA 1OP0A 1XUHA 1FAXA 1CSOE 3MOCA 4ASUD 3LGTA 2BB4A 1BUIA 3LJJA 2ZHWH 3GDSA 4KELA 4NFEA 1INCA 2XNDD 3KYGA 1EASA 1SR5C 3D62A 1O36A 1QA0A 2AEIH 3RLYH 4X6MA 3PWCA 2A4OA 1GHYH 1ZHMA 4E05H 5EIYA 1Z1IA 1YCPM 4FUFA 3C1KA 2NWNA 1F0RA 1WTGH 2BYAX 1P09A 1WYKA 1PQ7A 1FY1A 1P01A 4Q63A 2PR3A 1V2RT 1O2SA 1SMFE 2EC9H 3KQCA 1O2OA 1PPGE 2J38A 1PQ8A 1ZSKA 3V7TA 3TIUA 1V2LT 1H1BA 4O9VA 9ESTA 4UD9H 4Y76A 1NU9A 2GZ8A 2FX6A 1VCPA 1IQIA 2GCHF 2D26C 2FOCA 1WCZA 2Y82A 1IHTH 5C3NA 3T26A 2KAIB 3DFLA 2TRMA 1B0FA 1XKBC 2Z3CA 3W94A 1SQRA 1SGTA 4U01A 5GWZA 3C27B 5EG4A 3SV9A 3FOAA 3KQEA 1FIZA 1AY6H 4DGJA 3U28C 2Y80A 8KME2 1A5HA 4MVNA 3PO1B 1C9PA 2OXSA 2H9EH 1B7XB 1O32A 1YPHC 3MNSA 3BTWE 4B2CA 5C20A 4AFSA 1GI9B 1GDNA 2KCOA 1TRYA 3SORA 2Y7ZA 2NU2E 2W3KA 1DUEA 1TRNA 4NA9H 3S69A 1Q31A 3ATKA 1GGDC 4H42U 2A7JA 5IDKA 2SGFE 5EXMA 1O2PA 4CRGA 1BITA 5L6NH 2FI4E 3ZV8A 1O2QA 1SGEE 2AGEX 3LGIA 5E8EH 2ZTZA 5SGAE 3V0XA 1O2YA 3TLOA 3ELAH 3LT3A 4CH2B 4DVAU 1GI1A 1QRZA 2V6NA 3SU5A 4E7RG 1BB0B 1O3OA 1QBNA 3LDXH 1BBRE 3TITA 1HAOH 4LXBH 3RMOH 1O2GH 1T4VH 2XC5A 1XUFA 4CR9A 1LVOA 2GVFA 2IOTA 1MCVA 2J5UA 2NU4E 1A46H 2ZCHP 2TGDA 4XSKU 1YYY1 3K6ZA 3VB5A 4BTIB 2ZPRA 1AKSB 1C5OH 3Q3YA 5C5OA 4OGYA 2G5VA 1VR1H 1IQFA 4I7YH 2FIRH 4ZKOU 1PYTD 1MKXK 2BD9A 2OCVB 3ZVDA 2FODA 3MH6A 4IGDA 1BHXB 3F68H 3KN2A 3A8BA 1O5DH 1G32B 1EAUA 1AWHB 1C1WH 3VB3A 1HJAB 3RU4D 2A2QH 1PPZA 1ELFA 1SGIB 3PYHA 5EPYA 1P57B 1W11U 1O30A 1C2KA 1WDIA 2VWLA 2Y81A 1C1MA 5EODA 4UFEH 3SGBE 1V2KT 1TAWA 4TY6A 1DWDH 3SJ9A 4BAKB 1T8LA 3KGPA 4UE7H 4AB8A 4H6SB 3QGNB 8ESTE 1G3BA 2STBE 5A0AE 1L1JA 2GCTC 1DY9A 1WU1A 3PO1C 2CGAA 4MLFB 4SGAE 3OE7D 3RC6A 3TJVA 7LPRA 1BMAA 2FOHA 1MZDA 2YMSD 1GJBB 1HBTH 1HRTH 1T31A 1DDJA 2NU1E 1XM1A 2VIPA 5ESTE 3M36A 1UHBB 1KDQA 3NUMA 1KTTB 4MQAA 4I32A 1Y3XA 1K1LA 4MNVA 2R2MB 3SYJA 2HALA 4BOHA 2O8TA 1ZPBA 4DT7B 4YTAA 2BX4A 1HGTH 1UK4A 3MH5A 1GL0E 4ISLA 1CHOG 1O2HA 2QF4A 3GS9A 1GCTB 1E35B 1ANBA 2ESTE 4UFFH 1ZOMA 1O2RA 4OS1A 5JYIA 3E6PH 3MO3A 2KZ4A 4I8HA 4GPGA 1MH0A 1K1NA 3HGNA 2AYWA 4A92A 3OYPA 4RI0A 1DITH 2WPLS 3EE0B 1K1PA 1GBAA 1C5RA 3LJOA 1K0HA 2VGCB 2H1UA 4B2BA 3ZVFA 1AFQB 2W6ID 5FHTA 1ELCA 1OXGA 1OX1A 1O38A 5C0TA 1W7XH 2G55A 1A0LA 1P2IA 4HFPB 3S9BA 1K28D 2VH6A 2LELA 2Y5FA 1HAVB 4MPVA 3V13A 1ANEA 2F9UA 2VVCA 1YLNA 4IC5A 2SNWA 3VB4A 1BZXE 1UVPA 5HGGA 3UWIA 2WUBA 1VITG 2F9VA 1GDQA 4HGCA 2VU8E 3U1JB 1W12U 1XX9A 4ABJA 2TGPZ 1RIWB 2ZZUH 3EE7A 1ZPCA 1C2JA 3SI4H 1YCPK 1ETRH 1GJCB 1HJAC 3ATWA 1GBHA 1C5UA 2EI8A 1BOQA 2PKAA 3ITIA 4FUHA 1TGSZ 1SGYE 1Z8RA 4Q80A 1C5XB 1BTPA 3RXRA 6GCHF 3BTGE 3WWFA 4A1TA 1C1RA 3U8OH 5CMXH 1P2KA 1Q3XA
chains in the Genus database with same CATH topology
2VVUA 1UVSH 1AO5A 1S5SA 2PW8H 2ZQ2A 4OS7A 2EEKA 1O3NA 1SPJA 3Q3XA 4A7IB 3HPTB 3ZZ7A 1D9IA 4CR5A 1JBUH 1BMNH 3RC4A 2ZHDA 3BG4B 1O2WA 2CJIA 1TBRH 5DPAA 3LOXA 4YM9A 3DD2H 1UK3A 1TPOA 2Z7FE 4K1EA 2ZTXA 1GCTC 2SGQE 3VXEH 1AB9C 4FUDA 4WY3A 1QBOA 1O3IA 1GHXH 3FP7E 4NIXA 2G00A 2BDIA 2RG3A 2W3IA 1RTLA 4CRBA 3AW1A 1BJUA 1LO6A 1VGCB 3TGJE 1YBWA 3S9CA 4DIIH 2WPMS 4BNRA 1W13U 2ZDNA 1HAXB 1AN1E 2ZDVH 4BAOB 1O3LA 2VGCC 2LNCA 2Z9LA 4I33A 3R0FA 1N8OC 3SOSA 3MI4A 1EZSC 1O35A 1RFNA 1QURH 2GGVB 3M7QA 2QXHA 2F3CE 1ZSLA 3E1XB 1MKWK 3RXSA 4X1SU 1F7ZA 1A5IA 2BQ7B 3LPRA 3KHVA 4X1QU 4E06H 1DICA 1GHVH 1TNKA 4B1TA 4JZDH 1NPMA 1S0QA 2PWXA 1C5TA 2ZP0H 2UWPA 1G3DA 2DE9A 3SNCA 5A09A 3ATIA 1MTUA 1EJNA 4SGBE 5T6DA 3TGKE 3ZYDA 5TJXA 4ABIA 1TGBA 3SUFA 5T6GA 3B23B 1D4PB 1FY5A 1EPTA 2I6SA 1K1MA 1TMTH 4B73A 1HCGA 5HM2A 1C1OA 1C5QA 1GJAB 3GCTG 1TPAE 4AG2A 5C1UA 3QDZB 4O3UA 2YNBA 1DWCH 2AMQA 5GXPA 1QY6A 1OOKB 1UJ1A 3A86A 1A3EH 5GDSH 3E0NB 3PWBA 3UNQA 1GVKB 1AGJA 1CGJE 5AFZH 5EQSA 1P06A 3RXIA 4AFQA 4YO9A 5IYTA 4YESB 1T8MA 1C2DA 2ZHQH 1TNHA 2WYGA 1AUTC 1VCQA 4ZMAH 1NFWA 1QTFA 1G36A 3IITA 3A83A 1LHCH 2PUXB 3ZZCA 1KXFA 1QRWA 3ZZAA 3BTDE 2F9BH 1ZZZA 2W7SA 1W0YH 7ESTE 3SJKA 3P8FA 2C8XB 1KY9A 1QIXB 2ILNA 2XRCA 1RRKA 2AGIX 2BDGA 6CHAC 1TONA 1L2EA 3A85A 1ZGVA 5EXLA 1F5KU 2FO9A 1ELEE 1FNIA 2P59A 2ALPA 2Y5GA 1FN8A 1TMUH 1KLIH 3FP6E 1S6FA 3FFGA 4JK6A 2ZA5A 1Y3WA 4ZHMU 2ZGJA 2BDHA 4JZIA 1SQOA 1GVZA 4Y79A 1TALA 4TPIZ 3QO6A 2GZ7A 1GBMA 1RTFB 1YPMH 2B5TB 2B7DH 2CV3A 3T62A 5LPRA 5JBCS 3BF6H 4R0IA 3ZVEA 1KXEA 3TK6A 3S9AA 3ODFA 3KQBA 1ZJDA 2F9PA 1UVTH 5FCKA 2Q6FA 1EAWA 4KTSA 1ARBA 2IN2A 1A5GH 4RSPA 2GP9B 1TX6A 1V6DA 4WMFA 1GMCG 1SQAA 2FPZA 4GAWA 1YGCH 1O5GH 1UO6A 4BAQB 1XKAC 3T28A 3QN7A 1UK2A 1KLJH 1C5PA 2ANKH 2V35A 3GICB 5C67A 3H5CB 1QL8A 1MBQA 3PMJA 1TA2A 2V3HH 1AWFH 1LVYA 1OS8A 3PTNA 3SJ8A 1KXAA 2PKSC 4K3JA 3SUGA 1W3CA 2NU0E 3KL6A 1SB1H 2ZO3H 5A8XA 3A89A 1OWIA 4JZEH 1BIOA 4YLQH 1O3PB 4H6TA 1HJ9A 3FP8E 3MNXA 2VIWA 2ZPQA 1U6QA 1B5GH 2O8WA 1IQJA 3PMAB 1YLCA 3TNSA 1KIGH 6ESTA 2UWOA 3S7KB 1F92A 3EA9A 1D6WA 1TGTA 4IBLH 4KGAA 1LHEH 3TK9A 1SGRE 2ZI2H 3B9FH 2PV9B 2OC0A 1EB2A 1GCDA 4ZHAA 1XXFA 3BTTE 4O03A 4HZHA 1SOTA 1ZTJA 3TGIE 1FJSA 3M5LA 4A5TS 1GHBG 1TPSA 3L3TA 1P05A 2HVXA 3NCLA 1C5ZB 2KAIA 3QZRA 4AORA 4WH6A 2ZDLA 1EP6A 1HFDA 1P2MA 1O5FH 4JYVH 1GHZA 1J14A 1O2UA 1RJXB 4JZFH 1LHFH 4X2VA 2WPJS 2XBVA 3OY6U 1NESE 1Z8IB 4TPYA 3A84A 4INHA 3UNSA 1G9IE 2AMPA 2GZ9A 4CRFA 1S6HA 4ISNA 3L6PA 5JB8S 1SGDE 4Y10E 5DP5A 1AMHA 2ZNKH 3VGCC 1TNLA 2ZGXH 3ZYEA 3ZVCA 1YPKH 5AHGH 2WV4A 1C2MA 1IQLA 1GGDB 1DLKB 5DGJA 2EA3A 2AFQB 1BHXF 2ZFPH 5GCHG 3M3VA 2FYQA 3BSQA 3RXDA 3RXQA 2ODYB 4I31A 1EOJA 4YLUA 3P70B 5C1YA 5DO4H 3UR6A 1G30B 1GI8B 3AAVA 4VGCC 1F2SE 3UFAA 3V3MA 4AN7A 2ALVA 3MH7A 1UCYH 4BANB 1Y5AT 1SLXB 1LQEA 2W5EA 2FXRA 3UR9A 3QTOH 4IN1A 1GHWH 1ZPZA 1F5LA 3BG8A 4K2YA 3RM2H 1AKSA 4CRCA 2GV7A 3RUOA 3EDXB 2G52A 2FI3E 2WINI 2B9LA 8GCHG 1DXWA 3RMLH 1O3KA 1DSUA 4A6LA 1AVXA 3LONA 2O9QA 1P8VC 1NZQH 1TOCB 1QL9A 3A8CA 2HPPH 2R0KA 2A5IA 1DVAH 1ELVA 3GY3A 1O3CA 2FOAA 2Z9GA 5DP7A 1GHAG 4JCNA 4WXIA 1C9TA 3LH3A 1JMOH 1W14U 4F49A 1EQ9A 3SHAH 2QC2A 4X6PA 1HLTH 1EZQA 3HKJB 5DG6A 1O37A 2GV6A 3E16B 3A81A 1NRRH 4H4FA 1Z8GA 1F5RA 5FCRA 4Y7BA 2GDDA 3LKWA 3ZZ9A 2GX4A 2ZU3A 5FPSA 1WQSA 4D9RA 5FBIA 1ABJH 1NTPA 5DK1A 1C2HA 3RXTA 1UTKA 3U1IB 1AQ7A 1VJ9U 2GCTB 3NK8A 1JOUB 3RP2A 1UHBA 1ZJKA 3BIVH 1ELBA 5A0CA 2VH0A 5ETXA 1KTSB 2GT7A 4DURA 1CHOF 4RKOB 2BZ6H 2FWWA 2HWLB 1H9IE 3ENSB 2VIOA 4K1TA 1GI4A 4X1RU 4HI3A 1O3HA 1BTWA 3RU4E 4MG3A 2FS8A 2Z94A 5T6FA 1KXDA 4I8JA 1CHGA 2VB0A 4Q7XA 2ANWA 1QFKH 2PHBA 1S85A 3SU1A 3CS7A 1DXPA 4B75A 1LPGB 1QB9A 2Q1JA 1C2IA 2TGTA 1W7GH 1K1OA 1P9SA 3KNXA 4AZ2B 1VCWA 3EGKH 1HAYB 4Y6DA 1V2TT 1J16A 1LPKB 4OS6A 4GHTA 2ZFFH 1TNGA 1VITF 2ODPA 1IQEA 3GCOA 3GY2A 2C8ZB 2BXUH 2XWAA 2XBWA 2RA3A 1O2NA 1QB6A 4FU9A 1A1RA 5E0GA 3K65B 3LGYA 3M5OA 2FM2A 4NZLA 1A61H 3M7UA 1V2WT 2PFEA 2BQWB 1V2VT 3DFJA 2EI7A 2CXVA 4NZQA 1D3QB 1FUJA 4YT6H 2A4QA 2A0QB 1YPEH 5GPIB 1XXDA 3B8JA 3GOVB 2K1QA 2Z9JA 2ZKSA 1O33A 4QT8C 1P2OA 1GJ9B 1IQNA 3RXOA 1YP9A 2PGQB 2QY0B 3E3TA 2A2XH 1SFIA 1PPEE 2CF8H 3V12A 3LGWA 1A0JA 4INLA 1OYTH 3PMBB 1ELTA 2ZU5A 1FPHH 2OUAA 3QX5H 3GYMA 1AVWA 1BTHH 2AH4X 3PLKA 2YOLA 2TGAA 5ABWA 2ZFTA 3UOPA 2O8MA 3TH2H 1J8AA 1MKXH 3LC5A 1SLVB 2GDEH 1EZUC 1BTZA 2VINA 1FV9A 2BD8A 2NU3E 1Y8TA 2SNVA 5DP6A 1HAZB 5F8ZA 4GHQA 1OP8A 3SU4A 2AIPA 4I8GA 1AB9B 2HNTE 1XUGA 1PFXC 2C3SA 2ZWLH 4KTCA 2BDYA 1MTNB 5DP4A 3SJIA 5FAHA 3SV6A 5GIBA 5EGMA 2F83A 3FZZA 4X6NA 4XE4A 1YPGH 2BLVA 2QYIA 1HXEH 3A7VA 4ISHH 3GY4A 1ORFA 2ZFSA 3KQDA 2CHAC 4OS5A 1N8OB 1EB1H 5ESBA 2OBQA 1NRQH 3Q00A 1O3BA 1V2ST 5HM9A 1T8NA 1OSSA 3KIDU 4ZXYH 3GY5A 4LK4A 4XBBA 3BEIB 3BTEE 1GJ7B 1QQ4A 1K9OE 4FUCA 3QGJA 2QA9E 1C1TA 2WPHS 3MTYA 1EP5A 2M5TA 1P02A 1FPCH 3HK6B 4FUBA 3MH4A 4ABBA 4OGXA 3EA8A 2HRVA 1C2GA 1EATA 1GMDG 3ZZ5A 2R9PA 3SGQE 1FQ3A 1WOFA 2R2WU 4IMQA 1SC8U 3GCTF 4UFGH 3F9GA 4NGAH 3MNCA 1CVWH 5DJ7A 4MTBA 2A32A 5FX5A 1AE8H 2ZTYA 4GUXA 1W10U 4ZROA 2P3UB 4CHAB 3S0NA 1SHYA 4X8UH 2R3YA 3NWUA 4AFUA 4IW4E 1P12E 2J2UA 4AG1A 2ZHFH 2HPQH 2BVSH 1MD8A 3Q3KA 4XDEA 3RMNH 5FBEA 1GJ6A 4D8NA 1MBMA 1V2UT 4I8KA 5DP9A 2B0FA 2DUCA 1NRPH 4NIYA 1NN6A 1Z6JH 2J95A 2FMJA 1HAIH 1Y5UT 1LDTT 4FXGH 4NSVA 2P94A 2ZFQH 1MTNC 1UVOA 4KP0A 1TX8A 1P0SH 3SJOA 2BY9X 5CHAC 1ELDE 2BTCE 5EW1H 1DS2E 2C4FH 5A8ZA 4A1XA 1LVMA 1C1NA 3O8RA 1CA0C 1Z71A 1GBCA 1ESTA 1YPJH 3AW0A 3F9FA 1SFQB 1QRXA 6CHAB 3RXPA 3SU3A 4X2XA 4AYYB 3RXAA 1HUTH 1MUEB 1CBWB 1EX3A 2G4TA 3K2UA 1BT7A 4Y71A 2TIOA 1P9UA 2HNTF 1NC6A 3ZV9A 1MCTA 2GMTC 2QXJA 1JRSA 5J4QA 4Q7YA 3PROA 4CH8B 1BRAA 5LH8A 1GMCF 4KTUA 4ZH8A 2WYJA 2P8OC 2FOFA 4NWKA 3RXGA 4BXWA 4AB9A 4K69A 2ANYA 4MPXA 1A3BH 1IQGA 2BLOA 2J9NA 4WMEA 3VXFH 5C5NA 3E90B 3AAUA 4NA7A 3W95A 1Q2WA 1ID5H 2BDAA 5BPEA 4Q2KA 2I6QA 1O5CB 1YM0A 2UWLA 2PTCE 1GBFA 2STAE 4GVUA 1W8BH 4ABGA 1MKWH 4CHAC 1RD3B 1W0ZU 1LVBA 5JBBS 3TK5A 3MNBA 3LH1A 1BMMH 2R3UA 5JB9S 3SNAA 4X1NU 1FDPA 3WY8A 5PTPA 7GCHG 2ZDKA 4CREA 2PKSB 2Z9KA 5F8XA 3RXEA 1MTWA 4WXVA 1THRH 1GI5A 2ZCKP 3AASA 2ANMH 3QWCH 4Y0ZE 1O34A 1T8OA 1TMBH 3MU0A 5L2YH 2CMYA 1J17T 3LIWA 1TGCA 2W26A 1GBIA 1ESBA 1V2JT 3MU5A 1C4U2 4MDSA 3RXLA 1TRMA 1GBKA 3E8LA 1C1PA 1J9CH 1GBLA 5EXNA 4NSYA 2OC1A 1GHBF 3BTHE 1SLUB 3UIRA 3A8DA 2SGAA 5EQQA 2Q6GA 3LC3A 4MPUA 2A45B 2WPKS 3PLBA 4B76A 2OD3B 1TFXA 2D8WA 3UREA 1CBWC 3URDA 2BOKA 4IN2A 1O0DH 1O3JA 2VWOA 5JBTA 1C5VA 1C5LH 2Z3EA 2ZGBH 5EU8A 3UNRA 2V0BA 4ABEA 2P3FH 2GD4B 3ZZ3A 1BCUH 1TLDA 3PB1E 4M7GA 4ZKRU 2UUYA 2H9TH 5EPNA 1EJMA 2Y6TA 2ZGHA 1DM4B 1F0SA 1LCYA 2ZU2A 2F9NA 2CN0H 5GCHF 2QF3A 1NRSH 5J4SA 3VGCB 5DP3A 1W2KH 3IG6B 3AVZA 4IC6A 1FAKH 1EKBB 2XW9A 1AFEH 1NO9H 1XUJA 3SQEE 4HTCH 2ZF0H 2OC7A 4RN6A 1DFPA 2BXTH 3OSYA 1ETTH 1RXPA 4ABAA 2A7HA 2R0LA 2HGTH 2ZDAH 1UMAH 1E36B 4Z0KA 4XOJA 2A4RA 3TH3H 4VGCB 3UQOA 1G2LA 1C1QA 1GJ4H 1O39A 1T32A 1SI5H 1V3XA 2WV5A 1EPTB 1ZLRA 1O5AB 1S82A 3U9AH 1IQHA 8GCHF 2DE8A 3T5FH 1AE5A 2AIQA 1G37A 1AZZA 2FEQH 3M3TA 4ZHLU 2VIDA 1BBRH 2Q6DA 3A80A 1O2VA 1LTOA 1HYLA 3OTJE 2RCEA 1DOJA 3M37A 4AOQA 1C2LA 3TH4H 3RLWH 1GHAF 3FAOA 3SQHE 5JPMH 5TCCA 3O8BA 5I25A 1D3TB 3MHWU 1AHTH 2JH5D 4BAMB 1XVOA 3NZIA 3ZZBA 3QZQA 3RXVA 3UY9A 1O2XA 4NCYA 3UTUH 1GJ8B 4X8SH 1GBEA 3LGVA 3ZVBA 2XTTB 3CP7A 4I8LA 5F6MA 4BXSA 1AI8H 3GCHC 1O31A 4YT7H 1T7CA 2VVVA 5HMAA 2THFB 3M35A 5K7RA 1DLEA 4GCHG 3L33A 3BEFB 4O3TA 3SBKA 4F4OC 5C2ZA 2AERH 4NWLA 2SGDE 4Y8ZA 3MU4A 4ASHA 1M9UA 1HAPH 3I29A 3ZZ4A 1O3GA 4X2YA 1IAUA 1GBJA 3DHKH 1UTJA 2GKVE 2BDCA 1MTSA 1BRCE 1GI7B 1QNJA 1CGIE 1PQ5A 2FTLE 2WUCA 2QV1A 5L2ZH 3SGAE 4CBNA 3E91A 4K60A 2IPHA 5E2PA 2A31A 3VB7A 1TE0A 1C1VH 1UCYK 3ODDA 2PSXA 1TYNA 1CA8B 1V2PT 1O2LA 4D7FA 3ESTA 4ZKNU 2BD4A 5B6OA 1ABIH 1SL3A 4K1SA 3F9HA 1YC0A 2PLXA 4NIWA 2J92A 1N1LA 3IWMA 4GSOA 2C8YB 1HPGA 3NKKA 1OWDA 1NROH 2Z9IA 1MZAA 2AGGX 4FUEA 1SBWA 3K9XB 1EPTC 2B8OH 1KSNA 2QCYA 3GY7A 1UTQA 1OYQA