2NU4E

Accommodation of positively-charged residues in a hydrophobic specificity pocket: crystal structures of sgpb in complex with omtky3 variants lys18i and arg18i
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Streptogrisin B, Proteinase B
publication title Accommodation of positively-charged residues in a hydrophobic specificity pocket: Crystal structures of SGPB in complex with OMTKY3 variants Lys18I and Arg18I
rcsb
source organism Meleagris gallopavo
total genus 50
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nu4E02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nu4E01
1BUIA 3RMMH 2A0QB 3F9HA 2A4GA 6CHAC 2ALVA 2VINA 2VIQA 1SLWB 1NZQH 1TNGA 2J94A 1MTNB 1ARCA 2OC8A 2ZGBH 8ESTE 5FX5A 5B6OA 1EAXA 2PW8H 5BPEA 2P8OC 3PWBA 1HCGA 3JZ1B 1ESBA 3Q00A 4WMDA 1YLDA 1PPEE 3CS0A 3PM3A 3RXOA 2ZTYA 1IHTH 2AIPA 1TAWA 3STJA 2H1UA 3AVZA 4X1RU 4A92A 4FUGA 1DDJA 3DFJA 2EC9H 3A89A 1C4U2 4K8YA 4RSPA 3BEFB 1EKBB 1GJ9B 2G8TA 2B0FA 3BF6H 1DY9A 2WPJS 4KTCA 4B71A 1K1NA 3SORA 1OWEA 1KXBA 4YT7H 5LGOA 4ZKSU 1MH0A 1P01A 3PLBA 5A2MH 3KF2A 1W7XH 2Z6BD 1QA7A 5HXFA 1HIAA 1TBZH 1UTOA 2ZU2A 5JBCS 1CT0E 4ASHA 1ANEA 1LPZB 3Q3XA 5ESTE 3VB7A 4AZ2B 4NSYA 2H9TH 1P9UA 1ZPCA 3NCLA 3ZZ6A 2Y82A 1KXDA 3A86A 1K1MA 1LKBA 4IW4E 1A61H 1A46H 5AFYH 5L6NH 3QLPH 1QHRB 2W3IA 1S5SA 1O2QA 1E0FD 1KLTA 3MU1A 1MU8B 1A5IA 3SNEA 3GCHC 1K1PA 1O3GA 1GJ6A 2G00A 4I32A 1YCPM 4CBNA 2PTCE 2KAIB 1ESAA 8GCHG 4X2YA 5FHTA 5CHAC 3BTWE 2CF9H 1TX6A 1C5SA 1CT4E 2Y7XA 1HNEE 1EQ9A 1LO6A 1D6RA 1GBMA 2J2UA 2C93B 2GDEH 2JKHA 4K1EA 2BD3A 1MTSA 2UUFB 1ID5H 2GDDA 1G3DA 1PFXC 4LZ1H 1T8LA 4ABGA 1TNHA 4CR5A 1YPGH 4YESB 1LHDH 1O5CB 2BLWA 2WINI 5DPAA 4YO9A 1W10U 4E7RG 1G3CA 1SQAA 4MDSA 3M5OA 3TK6A 1NY22 2TGTA 1SLXB 1O5EH 1RD3B 3VB6A 1EXFA 2BZAA 3MMGA 1AUJA 3BTQE 5C1XA 4XFQA 1SLUB 3GY7A 4Y0ZE 4Y8YA 3GCHB 1HLTH 2K1QA 4GCHF 2PTNA 4Y10E 3ZYDA 2EA3A 1UTQA 2XWBI 1MTUA 5CHAB 1NESE 5EW2H 1AU8A 1O39A 2UWOA 5IYTA 1NFUA 2AFQB 2RCEA 2FI4E 2ZHDA 1HXFH 1N6XA 2J4IA 3P6ZB 3VFEA 2BD2A 1RIWC 1YF4A 4IMQA 3WY8A 1TPSA 3A85A 4FUJA 1EUFA 3UR9A 1O2IA 1O32A 4XBBA 2FO9A 4Y6DA 2FX6A 4CR9A 2B7DH 3M7TA 4X1NU 2Z9KA 4O3TA 2QA9E 1XUJA 1GHWH 2GZ8A 1QL9A 1L1GA 4YLUA 3LU9B 2QN5T 1Z8IB 1ZPZA 2ZQ1A 6LPRA 1Y8TA 1SVPA 2DUCA 1D9IA 4D8NA 5A8YA 1F5LA 4IMZA 5A8ZA 1C2HA 2H5CA 1C4Y2 1ABIH 4AFUA 2FI5E 2AMDA 2BDAA 3S9AA 5ETXA 3TLOA 3SV6A 1HJ9A 2ZGJA 3ZZCA 5DP6A 1S82A 4GVUA 1TPAE 1G36A 1AGJA 4ABBA 3LGTA 4Q7XA 1O30A 1RIWB 4MPWA 1DY8A 1FN6A 1HXEH 3A88A 1QFKH 1FZZA 3T26A 4IGDA 4WXVA 1P06A 2GT7A 1NU9A 1XUGA 2F9NA 2R0KA 2OBQA 1KDQA 1EB2A 3KN2A 2ZDAH 4WF8A 3S7KB 1DITH 4FUDA 4OS4A 1TGTA 5C1UA 4AYVB 1FI8A 3ENSB 1P10A 4ZHLU 1AHTH 2W7SA 1XUHA 1TMUH 4OS7A 4ISLA 2HVXA 4ABFA 1F0TA 1OS8A 2BLVA 1AFEH 1TE0A 2C8XB 3TJUA 5EW1H 1A7SA 4R0IA 1J8AA 1P2JA 4YOJA 1HAOH 3LJOA 1C2IA 5GDSH 5HYOA 5GJ4B 2WYGA 1O3EA 2Z9GA 1AFQB 1ELGA 2AEIH 1X7AC 5C3NA 1KTSB 2ZU4A 2P94A 2A32A 2VH6A 1L2EA 1BIOA 2FOFA 3RXRA 4Y76A 1GJ8B 2V6NA 3VB5A 3F9GA 4ZKNU 1GJ5H 3QZQA 1GI9B 5DP3A 5AHGH 5DP5A 2BB4A 2FOBA 4DURA 1LKAA 3E1XB 3STIA 5C20A 1Y5BT 1QB6A 3ZZ8A 4H4FA 4MTBA 3LONA 4YZUA 3AASA 5FCRA 1WAYB 1YPKH 1C5RA 1TPPA 1LMWB 3E0PB 5TCAA 1W0YH 1YPLH 2Y7ZA 2ANKH 2QCYA 1SGIB 1TGNA 2PKAB 2ZQ2A 4K60A 1VCWA 3KEEA 1TNIA 4ABIA 4YTAA 1GBHA 3LIWA 1NROH 1QB1A 1YCPK 3CP7A 4FU8A 4LZ4B 5EPNA 5T6FA 3BN9A 4J1YA 3SU1A 4TPIZ 1V6DA 1O5FH 1C1VH 1GJ7B 2FS8A 4B73A 2HALA 1KXEA 1PJPA 4K1SA 3D23A 1TGSZ 2P95A 3SU5A 5JBBS 1HB0B 1CHOF 1WCZA 5PTPA 4X8VH 3UY9A 1TIOA 1ORFA 2C3SA 4CRGA 3MWIU 2ZPRA 3SNCA 4CH8B 4H6TA 3TH2H 1OP8A 1SMFE 1T4VH 1KDQB 1O2WA 4O97A 4U2WA 1FN8A 1XM1A 7GCHG 2CHAB 4MNVA 1ABJH 1O2UA 1ZMJA 4U32A 3TITA 1LHFH 1DX5M 1SQOA 5DK1A 1H9IE 2ZA5A 3HK3B 1TRYA 3M35A 3E16B 3GCTG 2ZFTA 1ETRH 3LC3A 1HV7A 4X1SU 3H7TA 2A5KA 2CJIA 1MBMA 1G3EA 1EASA 3PV4A 1XUIA 2WYJA 4ISNA 2ZZUH 3SJKA 4WMEA 3T29A 4IS5A 3SO3A 3UOUA 1GBJA 1NM6A 2ALPA 3TJOA 3V0XA 4DJZB 1C5UA 3SQEE 1EOLA 2UUJB 1VITG 2WV4A 2PGBB 1A5GH 5T6GA 4TPYA 1YCPH 4JK5A 1JIMA 1K1IA 3RU4T 7LPRA 1CVWH 3H5CB 1C2EA 4UE7H 1G37A 1V2JT 1SGFA 1GJBB 3OY5U 1O2NA 1SOZA 1UCYK 2I6SA 1ANCA 1O37A 1EZXC 2HLCA 1ESTA 1QTFA 1GGDB 1EX3A 1PQ8A 2VNTA 1A0LA 1RTLA 1EZQA 1EATA 3LH1A 5DP4A 2A31A 1SG8B 3SJ9A 4ABEA 3NKKA 1TX7A 2PLXA 3A7YA 2O9QA 5GIBA 4ISIH 4AG1A 1O38A 3A8DA 4UFGH 1O3NA 4INLA 1NPMA 1OKXA 1MKWK 5FX6A 1BRCE 2BQWB 2C8YB 4LXBH 3MU0A 3RXMA 1AO5A 1YP9A 1KLJH 2Q6GA 2FMJA 3SU0A 3U9AH 1GJCB 2BDIA 1S0QA 3RU4D 1DLEA 1YBWA 3AW1A 2IN2A 4AB8A 1GHBG 1UHBB 3QZRA 1HUTH 4ISOA 1FIWA 1JOUB 2ZU5A 1FLEE 4BANB 1KSNA 2SNVA 1AE5A 1NN6A 2BX3A 3D65E 2PKSC 3LDXH 2ZHEH 3RXQA 5C5OA 3T28A 3ZZAA 1E35B 4KP0A 4AORA 4H6SB 2FOGA 5EXMA 2RA0A 1DWEH 1MAXA 2BDYA 1HAHH 3IG6B 4INHA 1Q2WA 3C1KA 1O5GH 3RC5A 1NFXA 1TOCB 3T25A 4FUHA 3RXSA 1PPZA 2BLQA 4RN6A 1U6QA 3GISB 1MCTA 1UVTH 3I77A 3ATLA 1A1RA 4K69A 3RXDA 4TWWA 3U8RH 3P8OA 2XCNA 3VB4A 2FOCA 1GI6A 1TYNA 3A8CA 4I7YH 4BNRA 9ESTA 1SQTA 1KLIH 1NRPH 3ZVBA 1T4UH 1EPTA 2OLGA 1THSH 3BSQA 4UEHH 1DM4B 3URCA 4ZKRU 1FONA 1G9IE 1GMDF 4BAHB 2AS9A 3P95A 5JPMH 2PUQH 4B74A 1D3TB 3UIRA 3R3GB 1V2LT 2XBYA 5GCHG 3E0NB 1NTPA 1FXYA 2FYQA 1TPOA 7ESTE 1ELCA 1MD8A 2V3HH 3O8BA 2C90B 1GBLA 2O8LA 2GCTC 1INCA 2FLBH 2ASUB 3KQCA 1TFXA 4YT6H 1FUJA 1YYY1 3PWCA 2PHBA 3OTJE 3BIUH 1YPHC 2OINA 1YPMH 3UFAA 1MTNC 4I8KA 1SGRE 2B8OH 1FY8E 3KQDA 1D4PB 1QRXA 1FIZA 2IPHA 4XE4A 1EP5A 1UK3A 3MO9A 3A82A 4D7FA 2I6QA 1O2OA 1JIRA 3KGPA 1GI8B 2RA3A 1MZDA 5DGJA 5FPTA 1EB1H 2SNWA 4LK4A 4OS6A 3SZNA 3ODDA 1AB9C 3S7HB 3KIDU 2FOEA 8LPRA 1VCQA 3NK8A 3TGJE 1GBEA 3SI3H 1IHSH 5FBIA 4I8GA 1A4WH 1V2UT 3K6YA 2PWXA 1ZMLA 1BITA 2PGQB 2Z94A 1BRAA 2TPIZ 3ZZ9A 1QJ6B 1TBQH 5G4BA 3K65B 3SGAE 1AN1E 2FOMB 3OY6U 3ZVGA 1IQFA 3SQHE 3SV7A 4IC5A 1GL0E 4A1VA 1W14U 5C1YA 1JWTA 3LPRA 1TGCA 2A7HA 4DVAU 1ZOMA 2FZZA 1XX9A 1AB9B 4NZLA 1GI2A 2SGQE 2A2QH 1TB6H 2LNCA 2ZCHP 2EEKA 1H4WA 4Y8XA 1CBWB 2BVXH 1O31A 2A1DB 1BJVA 4TYDA 2PR3A 4I33A 2ZC9H 2ODPA 1T31A 1Y59T 3M61U 4KKDA 1KY9A 2ULLA 3R0FA 4YM9A 2FXRA 4X6NA 1SHHB 3EGKH 1ELAA 2GZ7A 2W5EA 4KTSA 3O8CA 3BIVH 3F9EA 2BQ6B 3LH3A 4Y11E 2ZWLH 1DFPA 1QRZA 2BTCE 2WPHS 3K9XB 1SHYA 1PPBH 1HPGA 1C5NH 1VGCC 4RKJB 1DUEA 2BMGB 2F9UA 3GY4A 4D7GA 2F3CE 4JYVH 4WWYA 2ANMH 3IWMA 2OQ5A 3MTYA 1GPZA 4GCHG 3MOCA 1MZAA 1AVXA 1UVSH 3OYPA 3ZVAA 3RXHA 1A2CH 2Q6FA 4DW2U 5EU8A 1HAVB 1EJNA 2HWLB 2Q6DA 1BTYA 2CMYA 4ZAEA 5A09A 1MMJN 1H8DH 3MNXA 3SUGA 2GVFA 4NIXA 1ETTH 2THFB 2OP9A 1O3PB 3P8NA 3UNSA 5FBEA 2ZFPH 1HBTH 1UTJA 2BD4A 3S9BA 4AX9H 2AGEX 2ZCLP 5E2PA 1UK2A 1UTLM 1VGCB 5IDKA 3SGQE 1SFQB 3PB1E 1UVOA 1F0UA 2UUYA 3RC6A 4X6OA 1Y3YA 4A7IB 2XBWA 3G01A 2HOBA 2VVVA 3U8TH 1E38B 3RMLH 2QF3A 3P17H 4MPVA 4IBLH 1BMMH 1B7XB 1OYQA 4GHTA 1BBRE 2GV6A 2R2WU 3HGPA 1WBGB 4ZH8A 1O36A 3ZZBA 1YLCA 1Y5UT 3BTFE 3TJVA 1CE5A 1UTKA 3MH7A 3KHVA 5E0HA 3EYDA 4INKA 4PROA 4ZHMU 1SB1H 2R0LA 1W13U 4GHQA 1C2MA 1ZLRA 3QX5H 1L4DA 2G5NA 2EI6A 2HPQH 2IOTA 4I8HA 2FWWA 4K8BA 1TLDA 1YGCH 3MNCA 2F9BH 3PROA 3ODFA 2O8WA 1SSXA 1UMAH 2FLRH 3C27B 3TIUA 4X2VA 3RXEA 4O3UA 5L30H 1Z6EA 4A6LA 1ZRBA 4DOQA 1P02A 1K1LA 1HIAB 1NS3A 3EQ0H 3QO6A 1L0ZA 4E7NA 1VITH 1WOFA 2A5IA 3B8JA 1XKAC 1SBWA 1V2VT 3B23B 1IQGA 2GD4B 4Q7YA 4CHAB 2HNTC 3MNBA 1A3EH 1LDTT 1O35A 5FPYA 1LHGH 1O2JA 1V2QT 2QXHA 2IJOB 3E8LA 1V2PT 1GBAA 5L2YH 1V2KT 1AKSA 1AFQC 1S84A 3LT3A 4NG9H 1GBKA 3SGBE 2A7CA 7KMEH 2F91A 1WTGH 5C2ZA 4F4OC 1G3BA 1SC8U 1G2LA 1IQMA 2Z3CA 1MAYA 3A7ZA 3TGKE 1D3PB 1GBCA 1TBRH 1RS0A 1BA8B 3A7TA 3HKIB 2OXSA 4X2XA 1V2MT 2XNIA 4UFFH 1AQ7A 1KXFA 3FP6E 4U30A 3A80A 2ZG0H 1ELDE 1L1JA 1D6WA 1FV9A 4Y7BA 1O2XA 1OP2A 2G4UA 3TJNA 1O3BA 1B5GH 3PTNA 4GAWA 3SNAA 1H9HE 2WPMS 4ABJA 4ESTE 3RXFA 2J92A 6GCHF 3MFJA 1CGHA 3UPEA 4IN1A 1SGYE 3RLYH 5T3HA 1T7CA 3GY5A 3BEIB 2ILNA 2VGCC 4Q7ZA 2QXGA 1GBIA 1AUTC 1C1QA 3PLPA 3QGJA 2AYWA 2PV9B 2R3YA 3RXCA 4J2YB 2RDLA 5FCKA 1DSTA 1RXPA 1P2KA 1T32A 1CHOG 4O03A 1L4ZA 1IQLA 1TA6A 1GBTA 3EDXB 2EI8A 4X1PU 4A5TS 2SGDE 5L2ZH 3NZIA 1XUKA 3FAOA 1O2GH 1Z8GA 5J4SA 1GI1A 2VIPA 3V12A 1EOJA 2O8MA 2CHAC 2Z3DA 4ABDA 1IQHA 1NFWA 2ZPSA 1C5XB 1EP6A 1GCTC 1C5TA 1BTUA 1AVGH 2TBSA 1E36B 4JMYA 1W11U 2PSXA 2ZHWH 3RXUA 3NPSA 1JRTA 2OTVA 3LKWA 2Z9IA 2VGCB 1P9SA 4WJG2 5JB9S 1C2JA 2BD5A 2ZO3H 1F5KU 2A4QA 2ZF0H 3P8FA 5TJXA 3TNTA 3S9CA 4ZUHA 1LQDB 2FS9A 2G5VA 5K7RA 2WV5A 2XYAA 5LH8A 1BBRH 1ETSH 1O2MA 1S0RA 1S83A 1CU1A 1W0ZU 2VU8E 4B75A 4DT7B 3Q3YA 3Q76A 4WVPE 2Z7FE 2XRCA 2XC4A 4DCDA 1GI5A 3RXBA 3VXEH 1C2GA 3BG8A 1ELVA 1C5PA 3SNBA 2H9HA 3KQBA 3ZVDA 4ZXYH 1W2KH 5F8ZA 2NU2E 1GCTB 4CRDA 4X8TH 1BHXF 1UTNA 2A5AA 2ZIQH 1DS2E 1EJAA 1GGDC 2XC5A 1ANDA 3T27A 1J15A 4NZQA 1SGPE 1HJAC 2TGDA 1IOEA 2OD3B 2ZI2H 3GY8A 2WUCA 1C1TA 1GCDA 3URDA 1ZRKA 5DP9A 1V2ST 4RKOB 3JZ2B 4XBCA 3QN7A 1ELBA 1ZGIA 1ELFA 2SGFE 5AFZH 2ZDKA 1NRRH 3IITA 2ZDVH 5FAHA 5DKMA 2V0BA 4FUEA 1FMGA 2J9NA 3UOPA 3TVJB 3EE0B 1Z71A 1LQEA 3FANA 2NU3E 4H42U 4IC6A 3BTEE 4BXWA 1N8OB 5C5NA 5F6MA 4AB9A 1P0SH 1UVUH 2BVRH 1GHYH 2V3OH 1DANH 1IAUA 3UWJH 1M9UA 2A7JA 2GT8A 3GY6A 4ABHA 4X0WU 2ZDMA 4MLFB 1HJAB 2HRVA 1YPEH 3FP8E 2ZGHA 1QQ4A 4B1TA 2BM2A 1VZQH 3HATH 4ZROA 3DFLA 4AN7A 5EQSA 4BAMB 4WMFA 1O3OA 1P8VC 3U69H 2OBOA 1S81A 3GDVA 4MNYA 1GI4A 1O2YA 1E37B 1MTVA 3NUMA 3RLWH 3MH5A 1J16A 4GSOA 1SPJA 1AMHA 4I8LA 1GBFA 1SGTA 1GHXH 1P04A 2DE8A 1JBUH 1O3DA 2AMPA 4CRCA 3A8BA 2Y81A 2ANYA 1G2MA 1GHAF 2B5TB 4K2YA 1GG6C 2A2XH 2O8TA 5EG4A 1FQ3A 3CS7A 4LOYH 1SGCA 2ANWA 1OX1A 5DP8A 2CN0H 2FYRA 4MG3A 3OSYA 3O8RA 2FX4A 3GCOA 1SI5H 1SOTA 3E91A 1WU1A 3F9FA 1DE7H 1GJAB 1ZTKA 2BXTH 4Z6AH 2GV7A 3A7WA 5ABWA 3V13A 1GMDG 2BZ6H 2FPZA 1T8OA 5EPYA 1Z8RA 1PPFE 3ZZ3A 1UO6A 3PO1B 3SJ8A 1IQKA 3DD2H 1DWDH 1XVMA 3LC5A 1AWHB 2SGEE 1BB0B 1GG6B 2ZFFH 2NU4E 3QK1A 2H5DA 1OWKA 2WPLS 1QCPA 1BMAA 1DT2A 1ZJKA 1UTPA 2AIQA 2BDCA 4FVDA 2G4TA 1BDAA 3N7OA 1ZHRA 1C1PA 1ZZZA 4Q80A 1WSSH 4HTCH 2GCHF 3GY3A 1TOMH 4ZKOU 1CGIE 1XXFA 5E0GA 3TGIE 4DIIH 3SUDA 1C2DA 1AWFH 2PUXB 2SGAA 1T8NA 1ARBA 1TNLA 3GDUA 3M7UA 4XSKU 1TONA 2W7UA 5EGMA 2BYAX 1FY5A 4VGCC 4D9QA 1C2FA 3F6UH 3L3TA 4ZHAA 1F2SE 1LCYA 3MU4A 2F83A 3EA9A 4HGCA 4JCNA 2CV3A 3RC4A 2C8ZB 1TALA 3KNXA 1SGFG 3RU4E 1RTFB 2ZFRH 1P2IA 1FPCH 1K21H 1P2NA 1DICA 3UQOA 1QBNA 1C4V2 2XCFA 2PFEA 3ESTA 3LGYA 2Q1JA 1C2KA 1H1BA 3MNSA 1T8MA 1RRKA 1TWXB 1O0DH 5ESBA 1TMBH 2VWOA 2VWLA 1L1NA 1LPGB 4SGBE 3SHAH 1Z7KA 3RM0H 1FY4A 1F0SA 1NRNH 3A7VA 1P3EA 1ZJDA 5I25A 2Y5HA 1O3CA 1SGEE 5HM9A 6ESTA 1BQYA 1QL8A 2C4FH 4NCYA 5C67A 3PLKA 2EI7A 4VGCB 4KELA 2D8WA 3RXPA 1AD8H 3ATWA 1MUEB 3V3MA 1GMHF 4Y79A 1CA8B 3SI4H 2OC1A 1SFIA 3FFGA 3U98H 2P3UB 5TCCA 1QIXB 5BRRE 2BDGA 3BTKE 2D26C 3PMAB 1C5ZB 2GP9B 3GCNA 3NWUA 3UWIA 1ZSLA 3V7TA 2XWAA 1CA0B 2J95A 4D76A 1TQ7B 2KAIA 3LGUA 5DO4H 4BOHA 3CENA 1CBWC 3E90B 2Y6TA 1C5QA 3ZV8A 2XW9A 1EPTC 5EODA 3W94A 5EQQA 1A5HA 1BMNH 2ZHQH 3BG4B 5FXLA 1N1LA 3UREA 8KME2 5I46H 1MTWA 1P2QA 3A8AA 1ZTLA 3H7OA 3D49H 3ZVFA 3E6PH 1MQ6A 1VR1H 1TQ0B 2SFAA 3T2NA 3RM2H 1BTPA 1K28D 5A8XA 2CGAA 1HAZB 3SV9A 2FP7B 1BMLA 2AH4X 3T62A 5JYIA 4OS2A 1YM0A 2ZTZA 1GBBA 2BXUH 3P8GA 1ELEE 2BDHA 1C1WH 1AZ8A 1K2I1 2GMTC 4ISHH 1TRMA 2VJ1A 3Q3KA 3RXGA 3SW2B 3VPKA 3P70B 1J14A 1AIXH 2LPRA 1LHCH 1UVPA 5E8EH 1GWAA 2QC2A 2ZDNA 1EPTB 5DP7A 4DY7B 1C1RA 1DVAH 1C5MD 2FI3E 3O8DA 2JETB 2A4OA 2D1JA 4UDWH 4AFSA 1GMCF 4KGAA 1TMTH 3TPIZ 3PMHB 2VH0A 1ZHMA 1WUNH 2NU0E 3UR6A 1PYTC 3SJOA 1O3LA 1FAKH 1OWIA 2XTTB 1Z1IA 2FDAA 1LTOA 2ESTE 6CHAB 1BTZA 2GMTB 2BY7X 5GXPA 1WYKA 2G55A 3RMOH 3S0NA 1GVLA 5LPRA 2BY8X 2UUKB 1A3BH 1YPJH 2P8OB 1FDPA 4CRFA 1KIGH 5A0CA 4OGXA 1OWHA 3OX7U 2H2ZA 2PSYA 5AVDA 3LGIA 5K0HA 2Z9JA 3QUMP 1UJ1A 1CO7E 1K22H 3SU6A 4JZ1A 4NWKA 1PPGE 1GHVH 3Q77A 2XC0A 3UQVA 1D3DB 3M37A 1Z8JB 4XBDA 4AGKA 3M3SA 1O3JA 1P05A 1V2RT 2ZHFH 3TU7H 1BTWA 1BRUP 3A81A 1ZR0A 4F49A 4HFPB 3UNQA 4FUCA 1J17T 2DE9A 1C1UH 4U01A 4XOJA 1O3HA 1BTXA 2QYIA 2TIOA 2VIWA 3L6PA 1TABE 3S69A 1BT7A 3GYMA 1DSUA 1BRBE 1NT1A 1H9LB 2WPIS 2ZCKP 3TH3H 1OP0A 1CQQA 1HGTH 4CBOA 1W8BH 4OS5A 3LGWA 4DGJA 5H4IB 1AVWA 1SR5C 4AG2A 1BTHH 2YOLA 3BTDE 1QR3E 2VIVA 3GYLB 3RUOA 4FUBA 2BOHB 1G30B 1WV7H 3ATKA 4CHAC 2P59A 3FZDA 4X6MA 1NRSH 3BTGE 3ZVEA 4FUFA 4E06H 1O3AA 2P16A 4GUXA 3KL6A 4ZXXH 1GI7B 1P09A 1V2NT 1N6YA 2GTBA 3QGNB 2GKVE 1PPHE 3SOSA 3VXFH 2C8WB 5E0JA 1EZUC 2SGPE 1O5BB 8GCHF 3HGNA 2FM2A 1NO9H 5SGAE 3RDZA 1QRWA 3ATIA 4O9VA 5CE1A 1BCUH 2VVUA 1AY6H 3DA9B 4CRAA 2ZNKH 4X1QU 1JXPA 5GPIB 4SGAE 3I78A 5LPFA 2ZPQA 4AFZA 4X2WA 1O5AB 4Y8ZA 1HYLA 3MO6A 3ZZ5A 5CMXH 4JZDH 1ANBA 1BOQA 2QV1A 1AZZA 4JYUH 2BY6X 2RG3A 1FNIA 1O2HA 3MHWU 2FOHA 4NA9H 4Q2KA 4DIHH 2W26A 3M7QA 4X6PA 1SL3A 1TRNA 1F7ZA 3ATMA 4FU7A 3RMNH 2HPPH 1TNJA 4YOIA 2AGIX 2XXLA 1WQVH 3MO3A 3QDZB 2PKAA 1IQJA 2ZGXH 1GHZA 4OGYA 4Y71A 5T6DA 2FODA 2GX4A 6GCHG 1DXPA 4D9RA 3DT0H 2V35A 1YKTA 1J9CH 4OS1A 1O34A 4BAKB 4I31A 3T5FH 2BX4A 4BAOB 1QJ7B 2B9LA 2NWNA 3AAUA 3U1IB 1NFYA 3NXPA 4WH6A 2JH0D 4NIYA 1Z1JA 2VWNA 1THRH 2QY0B 1O2PA 1C5WB 3OU0A 1P2MA 3UNRA 2F9OA 1SGQE 4A1TA 3A7XA 1PPCE 1K1OA 1D3QB 2BD9A 1SLVB 3ZZDA 3QTOH 1GDUA 4NIWA 3RP2A 2FEQH 2WUBA 3W95A 1UK4A 2G52A 2STBE 3RXJA 2P3FH 4NIVA 1YPHE 4KTUA 2VIOA 3GDSA 2ZKSA 3FVFB 4FXGH 4CH2B 4JZFH 1Y3WA 2BY5X 1Z6JH 1BBRK 4WY3A 4Z0KA 3ZYEA 2QIQA 1O5DH 1QBVH 5EXNA 3AW0A 1P57B 3AAVA 2UWLA 1C5LH 2VVCA 1GDNA 1PYTD 3RXIA 4NGAH 3KQEA 1NU7B 1O2RA 1QNJA 1GJDB 3PMJA 5F03A 2NU1E 2F9VA 1A0HB 1S6HA 1PQ7A 1EJMA 5EXLA 1OXGA 4JZIA 3TH4H 2TGAA 2VWMA 1HAXB 1DOJA 1ZPBA 1O3MA 2FTLE 3M3TA 1BHXB 3ELAH 1C1NA 3SNDA 3SUEA 4QT8C 1Q31A 2QGRA 3SJIA 5JB8S 1YC0A 3BV9B 2XBVA 1UCYE 3M3VA 1KYNA 2BHGA 3UTUH 3LJJA 1CGJE 1SGDE 3QWCH 5HM2A 3LOXA 2ZECA 3SU4A 1LVYA 1OWJA 4CRBA 1O2VA 4NA8A 1DWCH 1C1MA 3ZV9A 2A45B 4UFDH 4AGJA 5E2OA 1C5YB 2ZFSA 3SU2A 4NFEA 1FY1A 1LHEH 1MKXK 5F8XA 2ZU3A 1BJUA 1C5OH 2HNTF 1KTTB 3ZVCA 1LVBA 2WPKS 1AKSB 4BTTB 3DUXH 1HAYB 4JZEH 3VGCC 1GBDA 2Y80A 2XBXA 2A4RA 1DUAA 2Z3EA 3B9FH 3SV8A 2G51A 5JDUB 2GGVB 4R8TB 1RTKA 2BD8A 2R3UA 4UONA 1W7GH 3QTVH 1UHBA 1N8OC 1O3IA 3ITIA 1LPKB 1UTMA 2OC0A 1QY6A 4B2BA 1XXDA 1PQAA 4ABAA 3I29A 1C9PA 2ODYB 1TA2A 4MPXA 1ZYOA 1SGNE 3FZZA 4TY6A 1O2ZA 3M5MA 4GPGA 2P93A 1ZGVA 5DJ7A 2W3KA 1QGFA 1Y5AT 1Y3UA 1O2KA 3DHKH 5EOKA 2VIDA 2H6MA 2BDBA 2HGTH 1XMNB 1CT2E 1MCVA 4JYTA 1OOKB 4X8UH 3U1JB 3VGCB 2JH5D 3RXTA 2P3TB 1WQSA 4K5ZA 5AF9H 2GZ9A 1GHAG 1W3CA 1MKXH 2M5TA 2UWPA 2H9EH 1OWDA 4MPUA 2ODQA 2ZGCA 5J4QA 2J34A 1DLKB 1AE8H 1C5VA 4B2CA 4DG4A 1DWBH 1IQNA 5LPEA 1FPHH 1TNKA 4FVBA 4MNXA 1RFNA 3PMBB 2QAAA 1DPOA 4B2AA 1W12U 2YNBA 5FPSA 3TK9A 5A0AE 2CF8H 1E34B 2G81E 1HAIH 4BAQB 7GCHF 1ELTA 4JK6A 1DXWA 1VCPA 1RGQA 2ZFQH 4NSVA 4UFEH 1MU6B 1B0FA 4YOGA 3GCTF 1GI3A 2QXIA 1S85A 2TRMA 3SV2H 3LGVA 4K3JA 2FTMA 3PTBA 2R9PA 3PO1C 2BD7A 1HDTH 1QURH 1NRQH 1MQ5A 2FOAA 1EAWA 4E05H 1QA0A 1MD7A 1CSOE 1IQEA 2GCHG 2R2MB 1EZSC 2J38A 3KCGH 2TGPZ 4NA7A 1HJ8A 1VITF 1VJAU 2O8UA 4XDEA 3F1SB 2FIRH 3RXAA 1OYTH 4WH8A 1OPHB 2STAE 3RXVA 4Y0YE 1O2TA 4AOQA 2AERH 1G32B 2BLOA 1C2LA 1P2OA 1V2TT 1A0JA 1C1OA 1KXAA 3EAJA 4IN2A 1RJXB 3VEQB 2OQUA 3SUFA 2Y5GA 2HNTE 4NFFA 1GVKB 3BTTE 4AYYB 1O33A 2OCVB 1B0EA 4CREA 1QBOA 1UCYH 1CHGA 1P3CA 1IQIA 1XKBC 1C9TA 3MH6A 4BXSA 2ZTXA 4MQAA 2QF0A 1FY3A 3MH4A 1KXCA 2OC7A 3MYWA 4AFQA 2Z9LA 3HPTB 1Q3XA 4MVNA 2ZEBA 1P11E 1QB9A 3ZZ7A 1GDQA 4WXIA 1Y3XA 3UUZA 1K1JA 3A83A 3SHCH 4Y7AA 1QL7A 3VB3A 1VJ9U 1ZMNA 1XUFA 1ZSKA 1EAIA 1FJSA 1MKWH 1GMHG 4X8SH 3GY2A 1O2SA 1P03A 4M7GA 2YNAA 1Y3VA 2BOKA 2QXJA 1HAGE 3L33A 1V3XA 1GHBF 4A1XA 9LPRA 1GI0A 1THPB 4I8JA 1F92A 1GVZA 5EQRA 3SU3A 1BZXE 1EAUA 3MU8A 1GL1A 3SN8A 2FESH 4THNH 3HK6B 1GJ4H 2PKSB 1CA0C 3A84A 3RXLA 1C1SA 2BVSH 3K6ZA 2CXVA 1ACBE 2ZU1A 1F5RA 4NWLA 1AI8H 1P12E 5F8TA 1QQUA 2AMQA 4K1TA 3SBKA 3BG4C 3TK5A 1TGBA 2Y5FA 1LVMA 1QJ1B 3BTHE 1O3FA 4BTIB 1ZTJA 1OSSA 4YLQH 1WTHD 4HZHA 4HI3A 1V2WT 3D62A 1PQ5A 1S6FA 2JH6D 3GICB 4BTUB 1JMOH 3ZZ4A 2AGGX 5HMAA 3K2UA 3BTME 4ZMAH 1HFDA 3A87A 5A0BA 1O2LA 5JBTA 1ZSJA 3U8OH 4GLYA 3HKJB 4TY7A 1HAVA 1V2OT 2VB0A 4MNWA 3PYHA 1XVOA 1F0RA 3TNSA 3M5LA 5GWZA 1O3KA 1NC6A 1HAPH 2BQ7B 1TX8A 2D2DA 2F9PA 3RXKA 1JRSA 3M36A 2ZP0H 3EA8A 1LVOA 3MU5A 5HGGA 3GOVB 1GMCG 1FAXA 1MBQA 2JETC 3EA7A 2BY9X 1K9OE 3MI4A 4FU9A 3E3TA 4FUIA 5DG6A 5GCHF 2ZDLA 3FP7E 3P92A 5JBAS 1H8IH 3BEUA 1HRTH 2GCTB 2OUAA 3M5NA 3F68H 4TWYA 4UD9H 1ZHPA 4B76A
chains in the Genus database with same CATH superfamily
1BUIA 3RMMH 2A0QB 3F9HA 2A4GA 6CHAC 2ALVA 2VINA 2VIQA 1SLWB 1NZQH 1TNGA 2J94A 1MTNB 1ARCA 2OC8A 2ZGBH 8ESTE 5FX5A 5B6OA 1EAXA 2PW8H 5BPEA 2P8OC 3PWBA 1HCGA 3JZ1B 1ESBA 3Q00A 4WMDA 3WWFA 1YLDA 1PPEE 3CS0A 3PM3A 3RXOA 2ZTYA 1IHTH 2AIPA 1TAWA 3STJA 2H1UA 3AVZA 4X1RU 4A92A 4FUGA 1DDJA 3DFJA 2EC9H 3A89A 1C4U2 4K8YA 5F53A 1QZ8A 4RSPA 3BEFB 1EKBB 1GJ9B 2G8TA 2B0FA 3BF6H 1DY9A 2WPJS 4KTCA 4B71A 1K1NA 3SORA 1OWEA 1KXBA 4YT7H 5LGOA 4ZKSU 1MH0A 1P01A 3PLBA 5A2MH 3KF2A 1W7XH 2Z6BD 1QA7A 5HXFA 1HIAA 1TBZH 1UTOA 2ZU2A 5JBCS 1CT0E 4ASHA 1ANEA 1LPZB 3Q3XA 5ESTE 3VB7A 4AZ2B 4NSYA 2H9TH 1P9UA 1ZPCA 3NCLA 3ZZ6A 2Y82A 1KXDA 3A86A 1K1MA 1LKBA 4IW4E 1A61H 1A46H 5AFYH 5L6NH 3QLPH 1QHRB 2W3IA 3MQKC 1S5SA 1O2QA 1E0FD 1KLTA 3MU1A 1MU8B 1A5IA 3SNEA 3GCHC 4XD7D 1K1PA 3WWBA 1O3GA 1GJ6A 2G00A 4I32A 1YCPM 4CBNA 2K8IA 2KAIB 2PTCE 1ESAA 8GCHG 2LP6A 4X2YA 5FHTA 5CHAC 3BTWE 2CF9H 1TX6A 1C5SA 1CT4E 2Y7XA 1HNEE 1EQ9A 5IK2D 1LO6A 2IJD1 1D6RA 1GBMA 2J2UA 2C93B 2GDEH 2JKHA 4K1EA 2BD3A 1MTSA 2UUFB 1ID5H 2GDDA 1G3DA 1W0JD 1PFXC 4LZ1H 1T8LA 4ABGA 1TNHA 4CR5A 1YPGH 4YESB 1LHDH 1O5CB 2BLWA 2WINI 5DPAA 4YO9A 1W10U 4E7RG 1G3CA 1SQAA 4MDSA 3M5OA 3TK6A 1NY22 2TGTA 1SLXB 1O5EH 1RD3B 3VB6A 1EXFA 2BZAA 3MMGA 1AUJA 3BTQE 4F55A 5C1XA 4XFQA 1SLUB 3GY7A 4Y0ZE 4Y8YA 3GCHB 1HLTH 2K1QA 4GCHF 2PTNA 4Y10E 3ZYDA 5C0TA 2EA3A 1UTQA 2XWBI 1MTUA 5CHAB 1NESE 5EW2H 1AU8A 1O39A 2UWOA 5IYTA 1NFUA 2AFQB 2RCEA 2FI4E 2ZHDA 1HXFH 1N6XA 2J4IA 3P6ZB 3VFEA 2BD2A 1RIWC 1YF4A 4IMQA 3WY8A 1TPSA 3A85A 4FUJA 1EUFA 3UR9A 1O2IA 1O32A 4XBBA 2FO9A 4Y6DA 2FX6A 4CR9A 4FETA 2B7DH 3M7TA 4X1NU 2Z9KA 4O3TA 2QA9E 1XUJA 1GHWH 2GZ8A 1QL9A 1L1GA 4YLUA 3LU9B 2QN5T 1Z8IB 1ZPZA 2ZQ1A 6LPRA 1Y8TA 1SVPA 2DUCA 1D9IA 4D8NA 5A8YA 1F5LA 4IMZA 5A8ZA 1C2HA 2H5CA 1C4Y2 1ABIH 4AFUA 2FI5E 2AMDA 2BDAA 3S9AA 5ETXA 3TLOA 3SV6A 1HJ9A 2ZGJA 3ZZCA 5DP6A 1S82A 4GVUA 1TPAE 1G36A 1AGJA 4ABBA 3LGTA 4Q7XA 1O30A 1RIWB 4MPWA 1DY8A 1FN6A 1HXEH 3A88A 1QFKH 1FZZA 3T26A 4IGDA 2WV9A 4WXVA 1P06A 2GT7A 1NU9A 1XUGA 2F9NA 2R0KA 2OBQA 3DCLA 1KDQA 1EB2A 3KN2A 2ZDAH 4WF8A 3S7KB 1DITH 4FUDA 4OS4A 1TGTA 5C1UA 4AYVB 1FI8A 3ENSB 1P10A 4ZHLU 1AHTH 2W7SA 1XUHA 4P00A 1TMUH 4OS7A 4ISLA 2QF5A 2HVXA 3DSPA 4ABFA 1F0TA 1OS8A 2BLVA 2GJGA 1AFEH 1TE0A 2C8XB 3TJUA 5EW1H 1A7SA 2QF4A 4R0IA 1J8AA 1P2JA 4YOJA 1HAOH 3LJOA 1C2IA 5GDSH 5HYOA 5KGOA 5GJ4B 1KMHB 1O3EA 2WYGA 2Z9GA 1AFQB 1ELGA 2AEIH 1X7AC 5C3NA 1KTSB 2ZU4A 2P94A 2A32A 2VH6A 1L2EA 1BIOA 2FOFA 3RXRA 4Y76A 1GJ8B 2V6NA 3VB5A 3F9GA 4ZKNU 1GJ5H 2KX4A 3QZQA 1GI9B 5DP3A 5AHGH 5DP5A 2BB4A 2FOBA 4DURA 1LKAA 3GS9A 3E1XB 3STIA 5C20A 1Y5BT 1QB6A 3ZZ8A 4H4FA 4MTBA 3LONA 4YZUA 3AASA 5FCRA 1WAYB 1YPKH 1C5RA 1TPPA 1LMWB 3E0PB 5TCAA 1W0YH 1YPLH 2Y7ZA 2ANKH 2QCYA 1SGIB 2LELA 1TGNA 2PKAB 2ZQ2A 4K60A 1VCWA 3KEEA 1TNIA 4ABIA 4YTAA 1GBHA 3PV2A 2QE7D 1NROH 1QB1A 1YCPK 3CP7A 3LIWA 4FU8A 4LZ4B 5EPNA 5T6FA 3BN9A 4J1YA 3SU1A 4TPIZ 1V6DA 1O5FH 1C1VH 1GJ7B 2FS8A 4B73A 2HALA 1KXEA 1PJPA 4K1SA 3D23A 1TGSZ 2P95A 3SU5A 5JBBS 1HB0B 1CHOF 1WCZA 5PTPA 4X8VH 3UY9A 1TIOA 1ORFA 2C3SA 4CRGA 3MWIU 2ZPRA 3SNCA 4CH8B 4H6TA 3TH2H 1OP8A 1SMFE 1T4VH 1KDQB 1O2WA 4O97A 4U2WA 3UAIC 1FN8A 1XM1A 7GCHG 2CHAB 4MNVA 1ABJH 1O2UA 1ZMJA 4U32A 3TITA 1LHFH 1DX5M 5EIYA 1SQOA 5DK1A 1H9IE 2ZA5A 3HK3B 1TRYA 3M35A 3E16B 3GCTG 2ZFTA 1ETRH 3LC3A 1HV7A 4X1SU 3H7TA 2A5KA 2CJIA 1MBMA 1G3EA 1EASA 3PV4A 1XUIA 2WYJA 3PRDA 2ZZUH 4ISNA 3SJKA 4WMEA 3T29A 4IS5A 3SO3A 3UOUA 1GBJA 1NM6A 2ALPA 3TJOA 3V0XA 4DJZB 1C5UA 3SQEE 1EOLA 2UUJB 1VITG 2WV4A 2PGBB 1A5GH 5T6GA 4TPYA 1YCPH 4JK5A 1JIMA 1K1IA 3RU4T 7LPRA 1CVWH 3H5CB 1C2EA 4UE7H 1G37A 1V2JT 3WW7A 1SGFA 1GJBB 2F4LA 3OY5U 1O2NA 1SOZA 1UCYK 2I6SA 1ANCA 1O37A 1EZXC 2OK5A 2HLCA 1ESTA 1QTFA 1GGDB 1EX3A 1PQ8A 2VNTA 1A0LA 1RTLA 4AC9A 1EZQA 1EATA 3LH1A 5DP4A 2A31A 1SG8B 3SJ9A 4ABEA 3NKKA 1TX7A 2PLXA 3A7YA 2O9QA 5GIBA 4ISIH 4AG1A 1O38A 3A8DA 5DN6D 4UFGH 2JDID 1O3NA 4INLA 1NPMA 1OKXA 1MKWK 5FX6A 1BRCE 2BQWB 2C8YB 4LXBH 3MU0A 3RXMA 1AO5A 1YP9A 1KLJH 2Q6GA 2FMJA 3SU0A 3U9AH 1GJCB 2BDIA 1S0QA 3RU4D 3DSOA 2YMSC 1DLEA 1YBWA 3AW1A 2IN2A 2WPDD 4AB8A 1GHBG 1UHBB 3QZRA 1HUTH 1NBMD 1MABB 4ISOA 1FIWA 1JOUB 2ZU5A 1FLEE 4BANB 1KSNA 2SNVA 1AE5A 1NN6A 2BX3A 3D65E 3F2HA 5CHBA 2PKSC 3LDXH 2ZHEH 3RXQA 5C5OA 3T28A 3ZZAA 1E35B 4KP0A 4AORA 4H6SB 2FOGA 5EXMA 2RA0A 1DWEH 1MAXA 2BDYA 1HAHH 3IG6B 4INHA 1Q2WA 3C1KA 4OM9A 1O5GH 3RC5A 1NFXA 1TOCB 3T25A 4FUHA 3RXSA 1PPZA 2BLQA 4RN6A 2YMSB 1U6QA 3GISB 1MCTA 1UVTH 3I77A 3ATLA 1A1RA 4K69A 3RXDA 4TWWA 3U8RH 4Q63A 3P8OA 2XCNA 3VB4A 2FOCA 1GI6A 1TYNA 3A8CA 4I7YH 4BNRA 9ESTA 1SQTA 1KLIH 1NRPH 3ZVBA 1T4UH 1EPTA 2OLGA 1THSH 3BSQA 4UEHH 1DM4B 3URCA 4ZKRU 1FONA 1G9IE 1GMDF 4FOUC 4BAHB 2AS9A 3P95A 5JPMH 2PUQH 4B74A 1D3TB 3UIRA 3R3GB 1V2LT 2XBYA 5GCHG 3E0NB 1NTPA 1FXYA 2FYQA 1TPOA 7ESTE 1ELCA 1MD8A 2V3HH 3CNRA 2C90B 3O8BA 1GBLA 2O8LA 3OE7D 2GCTC 1INCA 2FLBH 2ASUB 2J5UA 3KQCA 1TFXA 4YT6H 4ACBA 1FUJA 1YYY1 3PWCA 2PHBA 3OTJE 3BIUH 1YPHC 2OINA 1YPMH 3UFAA 1MTNC 4I8KA 1SGRE 2B8OH 1FY8E 3KQDA 1D4PB 1QRXA 1FIZA 2IPHA 4XE4A 3N7DA 1EP5A 1UK3A 3MO9A 3A82A 4D7FA 3FO8D 2I6QA 1O2OA 1JIRA 3KGPA 1GI8B 2RA3A 1MZDA 5DGJA 5FPTA 1EB1H 2SNWA 4LK4A 4OS6A 3SZNA 3ODDA 1AB9C 3S7HB 3KIDU 2FOEA 4ZCNA 3SYJA 8LPRA 1VCQA 3NK8A 3TGJE 3KYGA 1GBEA 3SI3H 1IHSH 5FBIA 4ACAA 4I8GA 1A4WH 1V2UT 3K6YA 2PWXA 1ZMLA 1BITA 2PGQB 2Z94A 1BRAA 2TPIZ 3ZZ9A 1QJ6B 1TBQH 5G4BA 3K65B 3SGAE 1AN1E 2FOMB 3OY6U 3ZVGA 1IQFA 1FX0B 3SQHE 3SV7A 4ASUD 4B6EA 4IC5A 1GL0E 4A1VA 1W14U 5C1YA 1JWTA 3LPRA 1TGCA 2A7HA 4DVAU 1ZOMA 2FZZA 1XX9A 1AB9B 4NZLA 5C94A 1GI2A 2SGQE 2A2QH 1TB6H 2LNCA 1BMFD 2ZCHP 2EEKA 1H4WA 4Y8XA 1CBWB 2BVXH 1O31A 2A1DB 1BJVA 4TYDA 2PR3A 4I33A 2ZC9H 2ODPA 1T31A 1Y59T 3M61U 4KKDA 1KY9A 2ULLA 3R0FA 4YM9A 2FXRA 4X6NA 1SHHB 3EGKH 1ELAA 2GZ7A 2W5EA 4KTSA 3SZEA 3O8CA 3BIVH 3F9EA 2BQ6B 3LH3A 4Y11E 2ZWLH 1DFPA 1QRZA 2BTCE 2WPHS 3K9XB 1SHYA 1PPBH 1HPGA 1C5NH 1VGCC 4RKJB 1DUEA 2BMGB 2F9UA 3GY4A 4D7GA 2F3CE 4JYVH 4WWYA 2ANMH 3IWMA 2OQ5A 3MTYA 1GPZA 4GCHG 3MOCA 1MZAA 1AVXA 1UVSH 3OYPA 3ZVAA 3RXHA 1A2CH 2Q6FA 4DW2U 5EU8A 1HAVB 1EJNA 2HWLB 2Q6DA 1BTYA 2CMYA 4ZAEA 5A09A 1MMJN 1H8DH 3MNXA 3SUGA 2GVFA 4NIXA 1ETTH 1K0HA 2THFB 2OP9A 1O3PB 3P8NA 3UNSA 5FBEA 2ZFPH 1HBTH 1UTJA 2BD4A 3S9BA 2JIZD 4RI0A 4AX9H 2AGEX 2ZCLP 5E2PA 1UK2A 1UTLM 1VGCB 5IDKA 3SGQE 1SFQB 3PB1E 1UVOA 1SKYE 1F0UA 2UUYA 2V3MA 3RC6A 4X6OA 1Y3YA 4A7IB 2XBWA 3G01A 2HOBA 2VVVA 3U8TH 1E38B 3RMLH 2QF3A 3P17H 4MPVA 4IBLH 1BMMH 1B7XB 2F43B 1OYQA 4GHTA 1BBRE 2GV6A 2R2WU 3HGPA 1WBGB 4ZH8A 1O36A 3ZZBA 1YLCA 5EJZA 1Y5UT 3BTFE 3TJVA 1CE5A 1UTKA 3MH7A 1UW7A 3KHVA 2KCOA 5E0HA 1E1QD 3EYDA 4INKA 4PROA 4ZHMU 1SB1H 2R0LA 1W13U 4GHQA 1C2MA 1ZLRA 3QX5H 1L4DA 2G5NA 2EI6A 2HPQH 2J98A 2IOTA 4I8HA 2FWWA 5B6LA 4K8BA 1TLDA 1YGCH 3MNCA 2F9BH 3PROA 3ODFA 3AK5A 2O8WA 1SSXA 4HG6A 1UMAH 2FLRH 3C27B 3TIUA 4X2VA 5C0UA 3RXEA 4O3UA 5L30H 1Z6EA 4A6LA 1ZRBA 4DOQA 1P02A 1K1LA 1HIAB 1NS3A 3EQ0H 3QO6A 1L0ZA 4E7NA 1VITH 1WOFA 2A5IA 3B8JA 1XKAC 1SBWA 1V2VT 3B23B 1IQGA 2GD4B 3KYFA 4Q7YA 4CHAB 2HNTC 3MNBA 3ZIAD 1A3EH 1LDTT 1O35A 5FPYA 1LHGH 1O2JA 1V2QT 2QXHA 2IJOB 3E8LA 1V2PT 1GBAA 5L2YH 1V2KT 1AKSA 1AFQC 5EJLA 1S84A 3LT3A 4NG9H 1GBKA 3SGBE 2A7CA 3N99A 7KMEH 2F91A 1WTGH 5C2ZA 5KECA 4F4OC 1G3BA 1SC8U 1G2LA 1IQMA 2Z3CA 1MAYA 3A7ZA 3TGKE 1D3PB 1GBCA 1TBRH 1RS0A 1BA8B 3A7TA 3HKIB 1W0KD 2OXSA 4X2XA 1V2MT 2XNIA 4UFFH 1AQ7A 1KXFA 3FP6E 4U30A 3A80A 2ZG0H 1ELDE 1L1JA 1D6WA 1FV9A 2L6OA 4Y7BA 1O2XA 1OP2A 2G4UA 3TJNA 1O3BA 1B5GH 3PTNA 4GAWA 3SNAA 1H9HE 2WPMS 3OFND 4ABJA 4ESTE 3RXFA 2J92A 6GCHF 3MFJA 1CGHA 3UPEA 4IN1A 1SGYE 3RLYH 5T3HA 1T7CA 3GY5A 3BEIB 2ILNA 2VGCC 4Q7ZA 2QXGA 4RT0A 1GBIA 1AUTC 1C1QA 3PLPA 3QGJA 2AYWA 2PV9B 2R3YA 3RXCA 4J2YB 2RDLA 5FCKA 1DSTA 1RXPA 1P2KA 1T32A 1CHOG 4O03A 4YXWD 1L4ZA 1IQLA 1TA6A 1GBTA 3EDXB 2IPQX 2EI8A 4X1PU 4A5TS 2SGDE 5L2ZH 3NZIA 1XUKA 3OEED 3FAOA 1O2GH 1Z8GA 5DSFA 5J4SA 1GI1A 2VIPA 3V12A 1EOJA 2O8MA 2CHAC 2Z3DA 5KEDA 4ABDA 1IQHA 1NFWA 2ZPSA 1C5XB 1EP6A 1GCTC 1C5TA 1BTUA 1AVGH 2TBSA 1E36B 4JMYA 1W11U 2PSXA 2ZHWH 3RXUA 3NPSA 1JRTA 2OTVA 3LKWA 2Z9IA 2VGCB 1P9SA 5FL7D 4WJG2 2KFWA 5JB9S 1C2JA 2BD5A 2ZO3H 1F5KU 2A4QA 2ZF0H 3P8FA 5TJXA 3TNTA 3S9CA 4ZUHA 1LQDB 2FS9A 2G5VA 5K7RA 2WV5A 2XYAA 5LH8A 1BBRH 1ETSH 1O2MA 1S0RA 1S83A 1CU1A 1W0ZU 2VU8E 4B75A 4DT7B 3Q3YA 3Q76A 4WVPE 2Z7FE 1OHHD 1YY3A 2XRCA 2XC4A 4DCDA 1GI5A 3RXBA 3VXEH 1C2GA 3BG8A 1ELVA 1C5PA 3SNBA 2H9HA 3KQBA 3ZVDA 4ZXYH 1W2KH 5F8ZA 2NU2E 1GCTB 4CRDA 2KM0A 4X8TH 1BHXF 1UTNA 2A5AA 4XRNA 2ZIQH 1DS2E 1YLNA 1EJAA 1GGDC 2XC5A 1ANDA 1WDIA 3T27A 1J15A 4NZQA 3W1EA 1SGPE 1HJAC 2TGDA 1IOEA 2OD3B 2ZI2H 3GY8A 2WUCA 5GNDA 1C1TA 1GCDA 3URDA 1ZRKA 5DP9A 1V2ST 4RKOB 3JZ2B 4XBCA 3QN7A 1ELBA 1ZGIA 1ELFA 2SGFE 5HKKD 5AFZH 2ZDKA 1NRRH 2J97A 3IITA 2JJ2D 2ZDVH 5FAHA 5DKMA 2V0BA 4FUEA 1FMGA 2J9NA 3UOPA 3TVJB 3EE0B 1Z71A 1LQEA 3FANA 2NU3E 4H42U 4IC6A 3BTEE 4BXWA 1N8OB 5C5NA 5F6MA 4AB9A 1P0SH 1UVUH 2BVRH 1GHYH 2V3OH 1DANH 1IAUA 3UWJH 1M9UA 2A7JA 2GT8A 3GY6A 4ABHA 4X0WU 2ZDMA 4MLFB 2K0QA 1HJAB 2HRVA 1YPEH 3FP8E 2ZGHA 1QQ4A 4B1TA 2BM2A 1VZQH 3HATH 4ZROA 3DFLA 4AN7A 5EQSA 4BAMB 4TT3D 4WMFA 1O3OA 1P8VC 3U69H 2OBOA 1S81A 3GDVA 4MNYA 1GI4A 1O2YA 1E37B 1MTVA 3NUMA 3PV5A 3RLWH 3MH5A 1J16A 4GSOA 1SPJA 1AMHA 4I8LA 1GBFA 1SGTA 1GHXH 1P04A 2DE8A 1JBUH 1O3DA 3N7EA 2AMPA 4CRCA 3A8BA 2Y81A 2ANYA 1G2MA 1GHAF 2B5TB 4K2YA 1GG6C 2A2XH 2O8TA 5EG4A 1FQ3A 3CS7A 4LOYH 1SGCA 2ANWA 1OX1A 5DP8A 2CN0H 2FYRA 4MG3A 3OSYA 3O8RA 2FX4A 3GCOA 1SI5H 1SOTA 3E91A 1WU1A 3F9FA 1DE7H 1GJAB 1ZTKA 2BXTH 4Z6AH 2GV7A 3A7WA 5ABWA 3V13A 1GMDG 2BZ6H 2CK3D 2FPZA 1T8OA 5EPYA 1Z8RA 1PPFE 3ZZ3A 1UO6A 3PO1B 3SJ8A 1IQKA 3DD2H 1DWDH 1XVMA 3LC5A 1AWHB 2SGEE 1BB0B 1GG6B 2ZFFH 2NU4E 3QK1A 2H5DA 1OWKA 2WPLS 1QCPA 1BMAA 1DT2A 1ZJKA 1UTPA 2AIQA 2BDCA 4FVDA 2G4TA 1BDAA 3N7OA 3FN8A 1ZHRA 1C1PA 1ZZZA 4Q80A 1WSSH 4HTCH 2GCHF 3GY3A 1TOMH 4F48B 4ZKOU 1CGIE 1XXFA 5E0GA 3TGIE 4DIIH 3SUDA 1C2DA 1AWFH 2PUXB 2SGAA 1T8NA 1ARBA 1TNLA 3GDUA 3M7UA 4XSKU 1TONA 2W7UA 5EGMA 2BYAX 1FY5A 4VGCC 4D9QA 1C2FA 3F6UH 3F0OA 3L3TA 4ZHAA 1F2SE 1LCYA 3MU4A 2F83A 3EA9A 4HGCA 4JCNA 2CV3A 3RC4A 2C8ZB 1TALA 3KNXA 1SGFG 2KZ4A 5T1VA 3RU4E 1RTFB 2ZFRH 1P2IA 1FPCH 1K21H 1P2NA 1DICA 3UQOA 1QBNA 1C4V2 2XCFA 2PFEA 3ESTA 3LGYA 1NBME 2Q1JA 1C2KA 1H1BA 2RDEA 3MNSA 4RT1A 1T8MA 1RRKA 1TWXB 1O0DH 5ESBA 3DSGA 1TMBH 2VWOA 2VWLA 1L1NA 1LPGB 4SGBE 3SHAH 1Z7KA 2L74A 3RM0H 1FY4A 1F0SA 1NRNH 3A7VA 1P3EA 3U28C 1ZJDA 5I25A 2Y5HA 1O3CA 1SGEE 5HM9A 6ESTA 1BQYA 1QL8A 2C4FH 4NCYA 5C67A 3PLKA 2EI7A 4VGCB 4KELA 2D8WA 3RXPA 1AD8H 3ATWA 1MUEB 3V3MA 1GMHF 4Y79A 1CA8B 3SI4H 2OC1A 1SFIA 3FFGA 3U98H 1VKYA 2P3UB 5TCCA 1QIXB 5BRRE 2BDGA 3BTKE 2D26C 3PMAB 1C5ZB 2GP9B 2KCAA 3GCNA 3NWUA 3UWIA 1ZSLA 3V7TA 2XWAA 2PP6A 1CA0B 2J95A 4D76A 2JJ1D 1TQ7B 2KAIA 3LGUA 5DO4H 4BOHA 3CENA 2M2AA 3F2GA 1CBWC 3E90B 2Y6TA 1C5QA 3ZV8A 2XW9A 1EPTC 5EODA 3W94A 5EQQA 1A5HA 2KCYA 1BMNH 2ZHQH 3BG4B 5FXLA 1N1LA 3UREA 8KME2 5I46H 1MTWA 1P2QA 3A8AA 1ZTLA 3H7OA 3D49H 1SQRA 3ZVFA 3E6PH 1MQ6A 1VR1H 1TQ0B 2SFAA 3T2NA 3H09A 1BTPA 3RM2H 1K28D 5A8XA 2CGAA 1WXRA 1HAZB 3SV9A 2FP7B 1BMLA 2AH4X 3T62A 5JYIA 4OS2A 2VBCA 1YM0A 2ZTZA 1GBBA 2BXUH 3P8GA 1ELEE 2BDHA 1C1WH 1AZ8A 1K2I1 1S6LA 2GMTC 4ISHH 1TRMA 2VJ1A 3Q3KA 3RXGA 3SW2B 3VPKA 3P70B 1J14A 1AIXH 2LPRA 1LHCH 1UVPA 5E8EH 1GWAA 2QC2A 2ZDNA 1EPTB 5DP7A 4DY7B 1C1RA 1DVAH 1C5MD 2YMSD 2FI3E 3O8DA 2EQNA 2JETB 2A4OA 2D1JA 4UDWH 2EY4C 4AFSA 1GMCF 4KGAA 1TMTH 3TPIZ 3PMHB 2VH0A 1ZHMA 2KCPA 1WUNH 2NU0E 3UR6A 1PYTC 2AHME 3SJOA 1O3LA 1FAKH 1OWIA 2XTTB 1Z1IA 2FDAA 1LTOA 2ESTE 6CHAB 1BTZA 2GMTB 2BY7X 3OAAD 5GXPA 1WYKA 2G55A 3RMOH 3S0NA 1GVLA 5LPRA 2BY8X 2UUKB 1A3BH 1YPJH 2P8OB 1FDPA 4CRFA 1KIGH 4B6FA 5A0CA 4OGXA 1OWHA 3OX7U 2H2ZA 2PSYA 5AVDA 3LGIA 5K0HA 2Z9JA 3QUMP 1UJ1A 1CO7E 1K22H 3SU6A 4JZ1A 4NWKA 1PPGE 1GHVH 2W6ID 3Q77A 2XC0A 3UQVA 3PRBA 1D3DB 3M37A 1Z8JB 4XBDA 4AGKA 3M3SA 1O3JA 1P05A 1YWUA 1V2RT 2ZHFH 3NRLA 1BTWA 3TU7H 1BRUP 3A81A 1ZR0A 4Q4LA 4F49A 4HFPB 3UNQA 2WSSD 4FUCA 1J17T 2DE9A 1C1UH 4U01A 4XOJA 1O3HA 1BTXA 2QYIA 2TIOA 2VIWA 3L6PA 1TABE 3S69A 1BT7A 3GYMA 1DSUA 1BRBE 1NT1A 1H9LB 2WPIS 2ZCKP 3TH3H 1OP0A 1CQQA 1HGTH 4CBOA 1W8BH 4OS5A 3LGWA 4DGJA 5H4IB 1AVWA 1SR5C 4AG2A 1BTHH 2YOLA 3BTDE 1QR3E 2VIVA 3GYLB 3RUOA 1EFRD 4FUBA 2BOHB 1G30B 1WV7H 3ATKA 4CHAC 2P59A 3FZDA 4X6MA 1NRSH 3BTGE 3ZVEA 4FUFA 4E06H 1O3AA 2P16A 1E1RD 4GUXA 3KL6A 4ZXXH 1GI7B 1P09A 1V2NT 1N6YA 2GTBA 3QGNB 2GKVE 1PPHE 3SOSA 2HLDD 3VXFH 2C8WB 5E0JA 1EZUC 2SGPE 1O5BB 8GCHF 3HGNA 2FM2A 1NO9H 5SGAE 3RDZA 1QRWA 3ATIA 4O9VA 5CE1A 1BCUH 2VVUA 1AY6H 3VG8A 3DA9B 4CRAA 2ZNKH 4X1QU 1JXPA 5GPIB 4SGAE 3I78A 5LPFA 2ZPQA 4AFZA 4X2WA 1O5AB 4Y8ZA 1HYLA 3MO6A 3ZZ5A 5CMXH 4JZDH 1ANBA 1BOQA 2QV1A 1AZZA 4JYUH 3KQ5A 2BY6X 2RG3A 1FNIA 1O2HA 3F2FA 2FOHA 3MHWU 4NA9H 4Q2KA 2W26A 4DIHH 3M7QA 4X6PA 1SL3A 1TRNA 1F7ZA 3ATMA 4FU7A 3RMNH 2HPPH 1TNJA 4YOIA 2AGIX 2XXLA 1WQVH 3MO3A 3QDZB 2PKAA 1IQJA 2ZGXH 1GHZA 4OGYA 4Y71A 5T6DA 2FODA 2GX4A 6GCHG 1DXPA 2V7QD 3DT0H 4D9RA 2V35A 1YKTA 1J9CH 4OS1A 1O34A 5CDFE 4BAKB 4I31A 3T5FH 2BX4A 4BAOB 1QJ7B 2B9LA 2NWNA 3AAUA 3U1IB 1NFYA 3NXPA 4WH6A 2JH0D 4NIYA 1Z1JA 2VWNA 1THRH 2QY0B 2HVYB 1O2PA 1C5WB 3FOAA 3OU0A 1P2MA 3UNRA 2F9OA 1SGQE 2KR7A 4A1TA 3A7XA 1PPCE 1K1OA 1D3QB 2BD9A 1SLVB 3ZZDA 3F0PA 3FKSD 3QTOH 1GDUA 4NIWA 3RP2A 2FEQH 3F3BA 2WUBA 3W95A 1UK4A 2G52A 2STBE 2XOKD 2P3FH 3RXJA 4NIVA 1YPHE 4KTUA 2VIOA 3GDSA 2ZKSA 3FVFB 4FXGH 4CH2B 4JZFH 1Y3WA 2BY5X 1Z6JH 1BBRK 4WY3A 4Z0KA 3ZYEA 2QIQA 1O5DH 1QBVH 1E79D 5EXNA 3AW0A 1P57B 3AAVA 2UWLA 1C5LH 2VVCA 1GDNA 1PYTD 3RXIA 4NGAH 3KQEA 1NU7B 1O2RA 1QNJA 1GJDB 3PMJA 5F03A 2NU1E 2F9VA 1A0HB 1S6HA 1PQ7A 1EJMA 5EXLA 1OXGA 4JZIA 3TH4H 2TGAA 2VWMA 2J98B 1HAXB 1DOJA 1ZPBA 1O3MA 2FTLE 3M3TA 1BHXB 3ELAH 1C1NA 3SNDA 3SUEA 5HIYA 4QT8C 3OTPA 1Q31A 2QGRA 3SJIA 5JB8S 1YC0A 3BV9B 2XBVA 1UCYE 3M3VA 1KYNA 2BHGA 3UTUH 3LJJA 1CGJE 1SGDE 3QWCH 5HM2A 3LOXA 2ZECA 3SU4A 1LVYA 1OWJA 4CRBA 1O2VA 4NA8A 1DWCH 1C1MA 3ZV9A 2A45B 4UFDH 4AGJA 5E2OA 1C5YB 2ZFSA 3SU2A 4NFEA 1FY1A 1LHEH 1MKXK 5F8XA 2ZU3A 1BJUA 1C5OH 2HNTF 1KTTB 3ZVCA 1LVBA 2WPKS 1AKSB 4BTTB 3DUXH 1HAYB 4JZEH 2XNDD 1GBDA 3VGCC 2Y80A 2XBXA 2A4RA 1DUAA 2Z3EA 3B9FH 3SV8A 2G51A 5JDUB 2GGVB 4R8TB 1RTKA 2BD8A 2R3UA 4UONA 1W7GH 3QTVH 1UHBA 1N8OC 1O3IA 3ITIA 1LPKB 1UTMA 2OC0A 1QY6A 4B2BA 1XXDA 1PQAA 4ABAA 3I29A 1C9PA 2ODYB 1TA2A 4MPXA 1ZYOA 1SGNE 3FZZA 4TY6A 1O2ZA 3M5MA 4GPGA 2P93A 1ZGVA 5DJ7A 2W3KA 1QGFA 1Y5AT 4DT4A 1Y3UA 1O2KA 3DHKH 5EOKA 2VIDA 2H6MA 2BDBA 2HGTH 1XMNB 1CT2E 1MCVA 4JYTA 1OOKB 4X8UH 3U1JB 3VGCB 2JH5D 3RXTA 2P3TB 1WQSA 4K5ZA 5AF9H 2GZ9A 1GHAG 1W3CA 1MKXH 2M5TA 2UWPA 2H9EH 1OWDA 4MPUA 2ODQA 2ZGCA 5J4QA 2J34A 1DLKB 1AE8H 1C5VA 4B2CA 4DG4A 1DWBH 1IQNA 5LPEA 1FPHH 1TNKA 4FVBA 4MNXA 1RFNA 3PMBB 2QAAA 1DPOA 4B2AA 1W12U 2YNBA 5C17A 5FPSA 3TK9A 5A0AE 2CF8H 1E34B 2G81E 1HAIH 4BAQB 7GCHF 3EE7A 1ELTA 4JK6A 1DXWA 1VCPA 1RGQA 4I86A 2ZFQH 4NSVA 5EJ1A 4UFEH 1MU6B 1B0FA 4YOGA 3GCTF 1GI3A 2QXIA 3UB0A 1S85A 2TRMA 3SV2H 3LGVA 4K3JA 2FTMA 3PTBA 2R9PA 3PO1C 2BD7A 1HDTH 1QURH 1NRQH 1MQ5A 2FOAA 1EAWA 4E05H 1QA0A 1MD7A 1CSOE 1IQEA 2GCHG 2R2MB 1EZSC 2J38A 3KCGH 2TGPZ 4NA7A 1HJ8A 1VITF 1VJAU 2O8UA 4XDEA 3F1SB 2FIRH 5HIZA 3RXAA 1OYTH 4WH8A 1OPHB 1H8ED 2STAE 3RXVA 4Y0YE 1O2TA 4AOQA 3OEHD 2AERH 1G32B 2WZQA 2BLOA 1C2LA 1P2OA 1V2TT 1A0JA 1C1OA 1KXAA 3EAJA 4IN2A 1RJXB 3VEQB 2OQUA 3SUFA 2Y5GA 2HNTE 1H8HD 4NFFA 1GVKB 3BTTE 4AYYB 1O33A 2OCVB 1B0EA 4CREA 1QBOA 1UCYH 1CHGA 1P3CA 1IQIA 1XKBC 1C9TA 3MH6A 4BXSA 2ZTXA 4MQAA 2QF0A 1FY3A 3MH4A 1KXCA 2OC7A 3MYWA 4AFQA 1COWD 2Z9LA 1Q3XA 3HPTB 4MVNA 2ZEBA 1P11E 1QB9A 3ZZ7A 1GDQA 4WXIA 1Y3XA 3UUZA 1K1JA 3A83A 3SHCH 4Y7AA 1QL7A 3VB3A 1VJ9U 1ZMNA 1XUFA 1ZSKA 1EAIA 1FJSA 1MKWH 1GMHG 4X8SH 3GY2A 1O2SA 1P03A 4M7GA 2YNAA 1Y3VA 2BOKA 2QXJA 2W6JD 1HAGE 3L33A 1V3XA 1GHBF 4A1XA 9LPRA 1GI0A 1THPB 4I8JA 1F92A 1GVZA 5EQRA 3SU3A 1BZXE 1EAUA 3MU8A 1GL1A 3SN8A 2FESH 4THNH 3HK6B 1GJ4H 2PKSB 1CA0C 3A84A 3RXLA 1C1SA 2BVSH 3K6ZA 2CXVA 1ACBE 2ZU1A 1F5RA 4NWLA 4TSFD 1AI8H 1P12E 5F8TA 1QQUA 2WHXA 2AMQA 4K1TA 3SBKA 3BG4C 3TK5A 1TGBA 2Y5FA 1LVMA 1QJ1B 3BTHE 1O3FA 4BTIB 1ZTJA 1OSSA 4YLQH 1WTHD 4HZHA 4HI3A 1V2WT 3D62A 1PQ5A 1S6FA 2JH6D 3GICB 4BTUB 1JMOH 3ZZ4A 2AGGX 5HMAA 3K2UA 3BTME 4ZMAH 1HFDA 3A87A 5A0BA 1O2LA 5JBTA 1ZSJA 3U8OH 4GLYA 3HKJB 4TY7A 1HAVA 1V2OT 2VB0A 4MNWA 3PYHA 1XVOA 1F0RA 3TNSA 3M5LA 5GWZA 1O3KA 1NC6A 1HAPH 2BQ7B 1TX8A 2D2DA 2F9PA 3RXKA 1JRSA 3M36A 2ZP0H 3EA8A 1LVOA 3MU5A 5HGGA 3GOVB 1GMCG 1FAXA 1MBQA 2JETC 3EA7A 2BY9X 1K9OE 3MI4A 4Z1MD 4P02A 4FU9A 3E3TA 4FUIA 5DG6A 5GCHF 2ZDLA 3FP7E 3P92A 2RFKC 5JBAS 1H8IH 3BEUA 4M9FA 1HRTH 2GCTB 2OUAA 3M5NA 3F68H 4TWYA 4UD9H 1ZHPA 4B76A
chains in the Genus database with same CATH topology
1BUIA 3RMMH 2A0QB 3F9HA 2A4GA 6CHAC 2ALVA 2VINA 2VIQA 1SLWB 1NZQH 1TNGA 2J94A 1MTNB 1ARCA 2OC8A 2ZGBH 8ESTE 5FX5A 5B6OA 1EAXA 2PW8H 5BPEA 2P8OC 3PWBA 1HCGA 3JZ1B 1ESBA 3Q00A 4WMDA 1YLDA 1PPEE 3CS0A 3PM3A 3RXOA 2ZTYA 1IHTH 2AIPA 1TAWA 3STJA 2H1UA 3AVZA 4X1RU 4A92A 4FUGA 1DDJA 3DFJA 2EC9H 3A89A 1C4U2 4K8YA 4RSPA 3BEFB 1EKBB 1GJ9B 2G8TA 2B0FA 3BF6H 1DY9A 2WPJS 4KTCA 4B71A 1K1NA 3SORA 1OWEA 1KXBA 4YT7H 5LGOA 4ZKSU 1MH0A 1P01A 3PLBA 5A2MH 3KF2A 1W7XH 2Z6BD 1QA7A 5HXFA 1HIAA 1TBZH 1UTOA 2ZU2A 5JBCS 1CT0E 4ASHA 1ANEA 1LPZB 3Q3XA 5ESTE 3VB7A 4AZ2B 4NSYA 2H9TH 1P9UA 1ZPCA 3NCLA 3ZZ6A 2Y82A 1KXDA 3A86A 1K1MA 1LKBA 4IW4E 1A61H 1A46H 5AFYH 5L6NH 3QLPH 1QHRB 2W3IA 1S5SA 1O2QA 1E0FD 1KLTA 3MU1A 1MU8B 1A5IA 3SNEA 3GCHC 1K1PA 1O3GA 1GJ6A 2G00A 4I32A 1YCPM 4CBNA 2PTCE 2KAIB 1ESAA 8GCHG 4X2YA 5FHTA 5CHAC 3BTWE 2CF9H 1TX6A 1C5SA 1CT4E 2Y7XA 1HNEE 1EQ9A 1LO6A 1D6RA 1GBMA 2J2UA 2C93B 2GDEH 2JKHA 4K1EA 2BD3A 1MTSA 2UUFB 1ID5H 2GDDA 1G3DA 1PFXC 4LZ1H 1T8LA 4ABGA 1TNHA 4CR5A 1YPGH 4YESB 1LHDH 1O5CB 2BLWA 2WINI 5DPAA 4YO9A 1W10U 4E7RG 1G3CA 1SQAA 4MDSA 3M5OA 3TK6A 1NY22 2TGTA 1SLXB 1O5EH 1RD3B 3VB6A 1EXFA 2BZAA 3MMGA 1AUJA 3BTQE 5C1XA 4XFQA 1SLUB 3GY7A 4Y0ZE 4Y8YA 3GCHB 1HLTH 2K1QA 4GCHF 2PTNA 4Y10E 3ZYDA 2EA3A 1UTQA 2XWBI 1MTUA 5CHAB 1NESE 5EW2H 1AU8A 1O39A 2UWOA 5IYTA 1NFUA 2AFQB 2RCEA 2FI4E 2ZHDA 1HXFH 1N6XA 2J4IA 3P6ZB 3VFEA 2BD2A 1RIWC 1YF4A 4IMQA 3WY8A 1TPSA 3A85A 4FUJA 1EUFA 3UR9A 1O2IA 1O32A 4XBBA 2FO9A 4Y6DA 2FX6A 4CR9A 2B7DH 3M7TA 4X1NU 2Z9KA 4O3TA 2QA9E 1XUJA 1GHWH 2GZ8A 1QL9A 1L1GA 4YLUA 3LU9B 2QN5T 1Z8IB 1ZPZA 2ZQ1A 6LPRA 1Y8TA 1SVPA 2DUCA 1D9IA 4D8NA 5A8YA 1F5LA 4IMZA 5A8ZA 1C2HA 2H5CA 1C4Y2 1ABIH 4AFUA 2FI5E 2AMDA 2BDAA 3S9AA 5ETXA 3TLOA 3SV6A 1HJ9A 2ZGJA 3ZZCA 5DP6A 1S82A 4GVUA 1TPAE 1G36A 1AGJA 4ABBA 3LGTA 4Q7XA 1O30A 1RIWB 4MPWA 1DY8A 1FN6A 1HXEH 3A88A 1QFKH 1FZZA 3T26A 4IGDA 4WXVA 1P06A 2GT7A 1NU9A 1XUGA 2F9NA 2R0KA 2OBQA 1KDQA 1EB2A 3KN2A 2ZDAH 4WF8A 3S7KB 1DITH 4FUDA 4OS4A 1TGTA 5C1UA 4AYVB 1FI8A 3ENSB 1P10A 4ZHLU 1AHTH 2W7SA 1XUHA 1TMUH 4OS7A 4ISLA 2HVXA 4ABFA 1F0TA 1OS8A 2BLVA 1AFEH 1TE0A 2C8XB 3TJUA 5EW1H 1A7SA 4R0IA 1J8AA 1P2JA 4YOJA 1HAOH 3LJOA 1C2IA 5GDSH 5HYOA 5GJ4B 2WYGA 1O3EA 2Z9GA 1AFQB 1ELGA 2AEIH 1X7AC 5C3NA 1KTSB 2ZU4A 2P94A 2A32A 2VH6A 1L2EA 1BIOA 2FOFA 3RXRA 4Y76A 1GJ8B 2V6NA 3VB5A 3F9GA 4ZKNU 1GJ5H 3QZQA 1GI9B 5DP3A 5AHGH 5DP5A 2BB4A 2FOBA 4DURA 1LKAA 3E1XB 3STIA 5C20A 1Y5BT 1QB6A 3ZZ8A 4H4FA 4MTBA 3LONA 4YZUA 3AASA 5FCRA 1WAYB 1YPKH 1C5RA 1TPPA 1LMWB 3E0PB 5TCAA 1W0YH 1YPLH 2Y7ZA 2ANKH 2QCYA 1SGIB 1TGNA 2PKAB 2ZQ2A 4K60A 1VCWA 3KEEA 1TNIA 4ABIA 4YTAA 1GBHA 3LIWA 1NROH 1QB1A 1YCPK 3CP7A 4FU8A 4LZ4B 5EPNA 5T6FA 3BN9A 4J1YA 3SU1A 4TPIZ 1V6DA 1O5FH 1C1VH 1GJ7B 2FS8A 4B73A 2HALA 1KXEA 1PJPA 4K1SA 3D23A 1TGSZ 2P95A 3SU5A 5JBBS 1HB0B 1CHOF 1WCZA 5PTPA 4X8VH 3UY9A 1TIOA 1ORFA 2C3SA 4CRGA 3MWIU 2ZPRA 3SNCA 4CH8B 4H6TA 3TH2H 1OP8A 1SMFE 1T4VH 1KDQB 1O2WA 4O97A 4U2WA 1FN8A 1XM1A 7GCHG 2CHAB 4MNVA 1ABJH 1O2UA 1ZMJA 4U32A 3TITA 1LHFH 1DX5M 1SQOA 5DK1A 1H9IE 2ZA5A 3HK3B 1TRYA 3M35A 3E16B 3GCTG 2ZFTA 1ETRH 3LC3A 1HV7A 4X1SU 3H7TA 2A5KA 2CJIA 1MBMA 1G3EA 1EASA 3PV4A 1XUIA 2WYJA 4ISNA 2ZZUH 3SJKA 4WMEA 3T29A 4IS5A 3SO3A 3UOUA 1GBJA 1NM6A 2ALPA 3TJOA 3V0XA 4DJZB 1C5UA 3SQEE 1EOLA 2UUJB 1VITG 2WV4A 2PGBB 1A5GH 5T6GA 4TPYA 1YCPH 4JK5A 1JIMA 1K1IA 3RU4T 7LPRA 1CVWH 3H5CB 1C2EA 4UE7H 1G37A 1V2JT 1SGFA 1GJBB 3OY5U 1O2NA 1SOZA 1UCYK 2I6SA 1ANCA 1O37A 1EZXC 2HLCA 1ESTA 1QTFA 1GGDB 1EX3A 1PQ8A 2VNTA 1A0LA 1RTLA 1EZQA 1EATA 3LH1A 5DP4A 2A31A 1SG8B 3SJ9A 4ABEA 3NKKA 1TX7A 2PLXA 3A7YA 2O9QA 5GIBA 4ISIH 4AG1A 1O38A 3A8DA 4UFGH 1O3NA 4INLA 1NPMA 1OKXA 1MKWK 5FX6A 1BRCE 2BQWB 2C8YB 4LXBH 3MU0A 3RXMA 1AO5A 1YP9A 1KLJH 2Q6GA 2FMJA 3SU0A 3U9AH 1GJCB 2BDIA 1S0QA 3RU4D 1DLEA 1YBWA 3AW1A 2IN2A 4AB8A 1GHBG 1UHBB 3QZRA 1HUTH 4ISOA 1FIWA 1JOUB 2ZU5A 1FLEE 4BANB 1KSNA 2SNVA 1AE5A 1NN6A 2BX3A 3D65E 2PKSC 3LDXH 2ZHEH 3RXQA 5C5OA 3T28A 3ZZAA 1E35B 4KP0A 4AORA 4H6SB 2FOGA 5EXMA 2RA0A 1DWEH 1MAXA 2BDYA 1HAHH 3IG6B 4INHA 1Q2WA 3C1KA 1O5GH 3RC5A 1NFXA 1TOCB 3T25A 4FUHA 3RXSA 1PPZA 2BLQA 4RN6A 1U6QA 3GISB 1MCTA 1UVTH 3I77A 3ATLA 1A1RA 4K69A 3RXDA 4TWWA 3U8RH 3P8OA 2XCNA 3VB4A 2FOCA 1GI6A 1TYNA 3A8CA 4I7YH 4BNRA 9ESTA 1SQTA 1KLIH 1NRPH 3ZVBA 1T4UH 1EPTA 2OLGA 1THSH 3BSQA 4UEHH 1DM4B 3URCA 4ZKRU 1FONA 1G9IE 1GMDF 4BAHB 2AS9A 3P95A 5JPMH 2PUQH 4B74A 1D3TB 3UIRA 3R3GB 1V2LT 2XBYA 5GCHG 3E0NB 1NTPA 1FXYA 2FYQA 1TPOA 7ESTE 1ELCA 1MD8A 2V3HH 3O8BA 2C90B 1GBLA 2O8LA 2GCTC 1INCA 2FLBH 2ASUB 3KQCA 1TFXA 4YT6H 1FUJA 1YYY1 3PWCA 2PHBA 3OTJE 3BIUH 1YPHC 2OINA 1YPMH 3UFAA 1MTNC 4I8KA 1SGRE 2B8OH 1FY8E 3KQDA 1D4PB 1QRXA 1FIZA 2IPHA 4XE4A 1EP5A 1UK3A 3MO9A 3A82A 4D7FA 2I6QA 1O2OA 1JIRA 3KGPA 1GI8B 2RA3A 1MZDA 5DGJA 5FPTA 1EB1H 2SNWA 4LK4A 4OS6A 3SZNA 3ODDA 1AB9C 3S7HB 3KIDU 2FOEA 8LPRA 1VCQA 3NK8A 3TGJE 1GBEA 3SI3H 1IHSH 5FBIA 4I8GA 1A4WH 1V2UT 3K6YA 2PWXA 1ZMLA 1BITA 2PGQB 2Z94A 1BRAA 2TPIZ 3ZZ9A 1QJ6B 1TBQH 5G4BA 3K65B 3SGAE 1AN1E 2FOMB 3OY6U 3ZVGA 1IQFA 3SQHE 3SV7A 4IC5A 1GL0E 4A1VA 1W14U 5C1YA 1JWTA 3LPRA 1TGCA 2A7HA 4DVAU 1ZOMA 2FZZA 1XX9A 1AB9B 4NZLA 1GI2A 2SGQE 2A2QH 1TB6H 2LNCA 2ZCHP 2EEKA 1H4WA 4Y8XA 1CBWB 2BVXH 1O31A 2A1DB 1BJVA 4TYDA 2PR3A 4I33A 2ZC9H 2ODPA 1T31A 1Y59T 3M61U 4KKDA 1KY9A 2ULLA 3R0FA 4YM9A 2FXRA 4X6NA 1SHHB 3EGKH 1ELAA 2GZ7A 2W5EA 4KTSA 3O8CA 3BIVH 3F9EA 2BQ6B 3LH3A 4Y11E 2ZWLH 1DFPA 1QRZA 2BTCE 2WPHS 3K9XB 1SHYA 1PPBH 1HPGA 1C5NH 1VGCC 4RKJB 1DUEA 2BMGB 2F9UA 3GY4A 4D7GA 2F3CE 4JYVH 4WWYA 2ANMH 3IWMA 2OQ5A 3MTYA 1GPZA 4GCHG 3MOCA 1MZAA 1AVXA 1UVSH 3OYPA 3ZVAA 3RXHA 1A2CH 2Q6FA 4DW2U 5EU8A 1HAVB 1EJNA 2HWLB 2Q6DA 1BTYA 2CMYA 4ZAEA 5A09A 1MMJN 1H8DH 3MNXA 3SUGA 2GVFA 4NIXA 1ETTH 2THFB 2OP9A 1O3PB 3P8NA 3UNSA 5FBEA 2ZFPH 1HBTH 1UTJA 2BD4A 3S9BA 4AX9H 2AGEX 2ZCLP 5E2PA 1UK2A 1UTLM 1VGCB 5IDKA 3SGQE 1SFQB 3PB1E 1UVOA 1F0UA 2UUYA 3RC6A 4X6OA 1Y3YA 4A7IB 2XBWA 3G01A 2HOBA 2VVVA 3U8TH 1E38B 3RMLH 2QF3A 3P17H 4MPVA 4IBLH 1BMMH 1B7XB 1OYQA 4GHTA 1BBRE 2GV6A 2R2WU 3HGPA 1WBGB 4ZH8A 1O36A 3ZZBA 1YLCA 1Y5UT 3BTFE 3TJVA 1CE5A 1UTKA 3MH7A 3KHVA 5E0HA 3EYDA 4INKA 4PROA 4ZHMU 1SB1H 2R0LA 1W13U 4GHQA 1C2MA 1ZLRA 3QX5H 1L4DA 2G5NA 2EI6A 2HPQH 2IOTA 4I8HA 2FWWA 4K8BA 1TLDA 1YGCH 3MNCA 2F9BH 3PROA 3ODFA 2O8WA 1SSXA 1UMAH 2FLRH 3C27B 3TIUA 4X2VA 3RXEA 4O3UA 5L30H 1Z6EA 4A6LA 1ZRBA 4DOQA 1P02A 1K1LA 1HIAB 1NS3A 3EQ0H 3QO6A 1L0ZA 4E7NA 1VITH 1WOFA 2A5IA 3B8JA 1XKAC 1SBWA 1V2VT 3B23B 1IQGA 2GD4B 4Q7YA 4CHAB 2HNTC 3MNBA 1A3EH 1LDTT 1O35A 5FPYA 1LHGH 1O2JA 1V2QT 2QXHA 2IJOB 3E8LA 1V2PT 1GBAA 5L2YH 1V2KT 1AKSA 1AFQC 1S84A 3LT3A 4NG9H 1GBKA 3SGBE 2A7CA 7KMEH 2F91A 1WTGH 5C2ZA 4F4OC 1G3BA 1SC8U 1G2LA 1IQMA 2Z3CA 1MAYA 3A7ZA 3TGKE 1D3PB 1GBCA 1TBRH 1RS0A 1BA8B 3A7TA 3HKIB 2OXSA 4X2XA 1V2MT 2XNIA 4UFFH 1AQ7A 1KXFA 3FP6E 4U30A 3A80A 2ZG0H 1ELDE 1L1JA 1D6WA 1FV9A 4Y7BA 1O2XA 1OP2A 2G4UA 3TJNA 1O3BA 1B5GH 3PTNA 4GAWA 3SNAA 1H9HE 2WPMS 4ABJA 4ESTE 3RXFA 2J92A 6GCHF 3MFJA 1CGHA 3UPEA 4IN1A 1SGYE 3RLYH 5T3HA 1T7CA 3GY5A 3BEIB 2ILNA 2VGCC 4Q7ZA 2QXGA 1GBIA 1AUTC 1C1QA 3PLPA 3QGJA 2AYWA 2PV9B 2R3YA 3RXCA 4J2YB 2RDLA 5FCKA 1DSTA 1RXPA 1P2KA 1T32A 1CHOG 4O03A 1L4ZA 1IQLA 1TA6A 1GBTA 3EDXB 2EI8A 4X1PU 4A5TS 2SGDE 5L2ZH 3NZIA 1XUKA 3FAOA 1O2GH 1Z8GA 5J4SA 1GI1A 2VIPA 3V12A 1EOJA 2O8MA 2CHAC 2Z3DA 4ABDA 1IQHA 1NFWA 2ZPSA 1C5XB 1EP6A 1GCTC 1C5TA 1BTUA 1AVGH 2TBSA 1E36B 4JMYA 1W11U 2PSXA 2ZHWH 3RXUA 3NPSA 1JRTA 2OTVA 3LKWA 2Z9IA 2VGCB 1P9SA 4WJG2 5JB9S 1C2JA 2BD5A 2ZO3H 1F5KU 2A4QA 2ZF0H 3P8FA 5TJXA 3TNTA 3S9CA 4ZUHA 1LQDB 2FS9A 2G5VA 5K7RA 2WV5A 2XYAA 5LH8A 1BBRH 1ETSH 1O2MA 1S0RA 1S83A 1CU1A 1W0ZU 2VU8E 4B75A 4DT7B 3Q3YA 3Q76A 4WVPE 2Z7FE 2XRCA 2XC4A 4DCDA 1GI5A 3RXBA 3VXEH 1C2GA 3BG8A 1ELVA 1C5PA 3SNBA 2H9HA 3KQBA 3ZVDA 4ZXYH 1W2KH 5F8ZA 2NU2E 1GCTB 4CRDA 4X8TH 1BHXF 1UTNA 2A5AA 2ZIQH 1DS2E 1EJAA 1GGDC 2XC5A 1ANDA 3T27A 1J15A