2NU4E

Accommodation of positively-charged residues in a hydrophobic specificity pocket: crystal structures of sgpb in complex with omtky3 variants lys18i and arg18i
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Accommodation of positively-charged residues in a hydrophobic specificity pocket: Crystal structures of SGPB in complex with OMTKY3 variants Lys18I and Arg18I
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase
molecule keywords Streptogrisin B, Proteinase B
total genus 50
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nu4E02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nu4E01
1DICA 2ALPA 2O9QA 1MQ6A 3MHWU 4AOQA 1L1NA 1O2RA 4LZ4B 1O2IA 1W7GH 2VIVA 1MZAA 2Y5GA 3V12A 5A2MH 1HB0B 1DX5M 3NK8A 5E8EH 3RMMH 4I7YH 1FMGA 2J9NA 4IN1A 4BAKB 1MKWH 3A84A 1Y59T 3ODFA 1LHDH 1W13U 2G5NA 4UFGH 4BANB 2AFQB 2ZC9H 1DFPA 2BQ6B 4I32A 3BTME 5DP9A 3FZZA 1MTNB 4K5ZA 3KNXA 3P70B 1NRNH 1BHXF 2GDDA 1FY3A 1TMBH 2ZHFH 1LVBA 1BJUA 1GBJA 2HPQH 3U8OH 3ZZBA 1QB1A 5K7RA 1K1MA 4CHAC 2OC0A 2HLCA 3PYHA 2VNTA 4JZ1A 4FXGH 2C4FH 4HGCA 1KLIH 3RXTA 1HJ9A 2ZKSA 1BA8B 3RXRA 3SI4H 3SNBA 3T2NA 4E06H 2J92A 3H7OA 1V2PT 2PSXA 3RU4D 3ZYEA 3M3VA 3Q3KA 5DJ7A 1C2LA 7GCHG 5JYIA 3SJKA 1UTNA 3BTHE 4NZLA 1BBRK 3O8CA 1SR5C 1XUJA 3UREA 1BRAA 2BY5X 1EJMA 4IC6A 3URCA 4Q7ZA 5GWZA 1HYLA 2ZU2A 2XC4A 1L4ZA 1PPFE 1P02A 4ISOA 2A45B 1TX8A 2QF0A 2CF9H 3BEIB 2Y7XA 1C1NA 1CQQA 1D3DB 1VJ9U 3BIUH 4GHTA 1D3QB 1XKBC 2A2QH 3PWCA 1C4Y2 1Z1IA 4AFQA 5FBIA 1B5GH 2O8TA 4B74A 3GICB 5EXLA 1EZSC 1AHTH 3KQEA 4NSYA 2QXGA 4O9VA 1SG8B 1YP9A 5JBCS 1LKBA 1E34B 4Y7AA 1LKAA 2ZEBA 4HTCH 5F8XA 2K1QA 1ZRKA 1B0FA 4MPWA 5GCHF 1SFIA 1TFXA 2H5DA 4ABIA 1PQ8A 2DE8A 3BTWE 1MUEB 3U1IB 3Q76A 1NFWA 2FI4E 5DP7A 1DUEA 1FY5A 2FTLE 1QCPA 4TWYA 1MMJN 2QV1A 1GI5A 2SGQE 3SN8A 1O5EH 1N6YA 1SBWA 4WF8A 4X8UH 3ELAH 3QLPH 1M9UA 4BOHA 1O39A 4ZUHA 5DKMA 3RU4T 1TIOA 3KL6A 5AVDA 1AI8H 1AE5A 5EW1H 3PMHB 1PPBH 4DJZB 2QXIA 4CR5A 1TMUH 3LIWA 2PTCE 3RXLA 1BHXB 1H9HE 1LDTT 1G2LA 1JOUB 1E35B 3ATIA 2UWPA 3VEQB 2OD3B 4X1QU 4B2AA 1RTKA 4IMQA 2WPKS 4Y79A 1GI7B 1QQUA 1XXDA 1ZMJA 3SGAE 2OCVB 5FXLA 1WUNH 1WBGB 4TWWA 2PKAB 1FQ3A 4Y76A 1TNIA 1C5PA 1C4V2 1OPHB 2BDHA 4ZHAA 2GCHG 1GL1A 1DSTA 4CRCA 3EAJA 2R0LA 3A7WA 3F9FA 1S6HA 2BD3A 4U2WA 2TGTA 5LPEA 2OINA 4KELA 7ESTE 1Q31A 2A5IA 1GBEA 3LPRA 2XC0A 2BDYA 3P92A 1SL3A 1W8BH 1D9IA 3MO3A 5E0HA 3ZVAA 5J4SA 1UTMA 2B0FA 2WV5A 3M7TA 3GYLB 1XMNB 1FJSA 1AQ7A 2FIRH 2Z9JA 1AB9B 4U32A 5FX6A 4YOIA 4NIYA 2W3IA 1FY8E 4JZFH 1IQEA 1GBHA 3SUGA 1GHBG 1NTPA 1O3GA 1ZJDA 2R2MB 5EXNA 3P8GA 1E0FD 4ABJA 2ZU4A 1DLKB 3NCLA 2BHGA 1FLEE 1FPHH 1W10U 2WPMS 1O2QA 1TABE 4GAWA 3HK3B 1A2CH 3A8CA 1Z8GA 1C2HA 4YOJA 1SQOA 4NCYA 4I8KA 2H9EH 2ALVA 1SGDE 3SNEA 1AFQC 2FI3E 5AFYH 1GCDA 4X6NA 5A0CA 1CBWC 4YLUA 3TNSA 2H2ZA 7LPRA 1V2OT 1BTZA 2G52A 2A7HA 5ESTE 1PPEE 3GCOA 4FUHA 2HALA 5PTPA 2OXSA 1QJ7B 1O3OA 1ELGA 1NROH 3VB3A 1TNHA 4FUEA 1TOCB 1C5VA 3MH6A 3TJOA 1OSSA 1LPZB 1KLJH 2AEIH 4TPIZ 1MCTA 1BTXA 3GY8A 1GVKB 2A32A 1DM4B 1J14A 3IITA 2G81E 1L2EA 3KGPA 1V3XA 3S7KB 2BXTH 4DURA 3RDZA 3RXAA 3SU0A 3GCNA 1GBMA 2ZIQH 1ZSKA 3GY7A 2VVUA 1ZJKA 3WY8A 1FZZA 1UK2A 1TGNA 1ELVA 2JH5D 2BOKA 3UTUH 1S81A 2F9OA 1ELBA 1YLDA 3EGKH 1SQTA 1DVAH 4JCNA 4SGAE 1ZGVA 1GGDB 4KGAA 1VZQH 2BLOA 2FXRA 4AYYB 3O8RA 2GD4B 3ZZ6A 5E0GA 3T25A 5EPYA 3SGBE 4ZKOU 3RMNH 4K60A 1DLEA 2YNBA 3A89A 3A86A 1RFNA 1K9OE 1EATA 2TIOA 2Z3CA 1GHWH 1MCVA 3B8JA 1BTUA 3HK6B 1G3BA 3A82A 3PROA 2SGPE 4YOGA 1QTFA 1HV7A 4ZXXH 1AGJA 1BITA 1GHZA 1PJPA 5E0JA 2LNCA 1K2I1 3D62A 1NRPH 1QQ4A 2QF3A 5C1YA 3OSYA 4OS4A 1C2MA 1YPJH 3MNXA 2BTCE 1GBBA 1AUTC 1ZRBA 1DS2E 4K8YA 1UTPA 4FVDA 1Z8IB 1IQMA 4KP0A 1C5LH 1QJ1B 5JBBS 3E90B 4UFDH 2VVVA 5EQSA 3NPSA 3V0XA 1B0EA 1GDNA 7GCHF 1NESE 3NKKA 5L2ZH 5A8ZA 3AASA 1EB1H 1HIAA 4GHQA 1A46H 2GZ9A 2ZHDA 1ELTA 4K8BA 3OU0A 1MH0A 1G3DA 1O3JA 4YT7H 3E91A 2ODPA 2ZFQH 2G51A 2G4TA 2IPHA 6LPRA 1P8VC 4OS7A 1BIOA 3RXUA 1JBUH 4B76A 2ZPSA 1ANDA 5C2ZA 2ZWLH 5ESBA 1O2KA 8GCHF 3P6ZB 1OWJA 1WV7H 3L3TA 4ZXYH 1FIZA 3OYPA 2CHAB 2FX4A 4Y0YE 4MNWA 4I8JA 3NUMA 1V2TT 2GX4A 4X2YA 3LDXH 1LVOA 1C5UA 2AH4X 2OUAA 3FVFB 3G01A 3M35A 1GI2A 1OP2A 1ZR0A 3QGJA 4JZDH 2B8OH 1QRZA 1GI9B 1TNKA 1OKXA 1WTHD 1THSH 3AVZA 4WMFA 1C2KA 1DY9A 1RTFB 1TB6H 4NG9H 2CV3A 2A4QA 1GI0A 1UTLM 1Z1JA 1KXEA 1F5LA 2ZFFH 2ESTE 1YPGH 1QL7A 2W5EA 3TU7H 4QT8C 1VCPA 5JB8S 1GJ8B 1AFQB 2Q1JA 2F9NA 1WSSH 1C2GA 2FX6A 4CH2B 1EPTC 1OWKA 4R0IA 2BZAA 1FDPA 2ZGCA 4ZKNU 4OS2A 3F68H 2VWOA 1O3CA 1CHOF 4OS5A 1W7XH 1W11U 1NPMA 2VIOA 1DSUA 1NN6A 1ZTLA 2G55A 4H4FA 5FCRA 5LPRA 1AU8A 1C1RA 3LH1A 1C5YB 2O8LA 2FOMB 1Y8TA 2UUFB 2FOBA 1S83A 1G30B 2AGGX 2B9LA 4BTTB 1JMOH 5CMXH 1O3PB 2XWAA 4WMEA 3HGNA 3TLOA 1PQ7A 1BOQA 3L33A 1V2LT 1AZZA 1EJAA 4JK6A 1O36A 8GCHG 3CS7A 1SGIB 4WVPE 2HVXA 3PLKA 3PO1B 3SJ8A 1V2QT 5G4BA 3S69A 3SBKA 5A0BA 3A8BA 1YBWA 4GCHG 2JH6D 2GVFA 4RSPA 3MU4A 2A0QB 3BTKE 5DGJA 1BTHH 1LPGB 2IJOB 2VVCA 2W26A 3MH7A 4IGDA 1QURH 4VGCB 2BYAX 3QDZB 1B7XB 1AWHB 2ZCLP 1Y3WA 1JRSA 1P2MA 1NRQH 1ZPCA 4IW4E 1AZ8A 2GDEH 1UVTH 3UOPA 3QK1A 5DP6A 1VGCC 1V2JT 1HAHH 1O32A 5DP5A 3T5FH 2NU1E 3RXGA 1LTOA 1HJ8A 2FO9A 1VITF 1EZXC 1OS8A 3E0NB 1U6QA 1O3BA 3SU3A 5I25A 4Y11E 4Z0KA 2PSYA 1BMNH 3RXSA 5HXFA 1BJVA 1C5WB 1CO7E 1PQAA 1QNJA 4ASHA 3EA9A 4XSKU 4GVUA 1O2PA 4AFZA 1ZPZA 2PW8H 1W3CA 5BRRE 4WXIA 1EAXA 1MTSA 2A31A 1ANBA 2C90B 1O31A 2GV7A 1ZMLA 3MMGA 1LQDB 2PKSB 2WYJA 3PM3A 5TJXA 2SGFE 4J1YA 3SQEE 1FAKH 1F2SE 1KSNA 1O3DA 5A09A 1AKSA 3SV8A 1VCQA 2BDIA 2XW9A 3IWMA 1PPCE 4BAHB 2WV4A 5CHAB 5B6OA 4XE4A 2WINI 2IOTA 1K28D 2ODYB 2P93A 1VITH 1HAXB 1V2VT 1W2KH 2XBVA 2WUCA 3QN7A 4M7GA 2PLXA 4GCHF 4H6TA 1HLTH 4DW2U 3BTDE 4GLYA 1UCYK 3VB5A 3SUEA 1PPZA 3ZZCA 2AS9A 1K22H 2FDAA 4D8NA 3UQOA 3MH4A 5GXPA 3BEFB 1KXAA 1CGHA 2J94A 5JDUB 1NU9A 4PROA 1PYTC 5LPFA 3LU9B 1G37A 2QA9E 1MTNC 4GPGA 1TBRH 1XUKA 4Q7XA 1MKXK 2ZDLA 1IQLA 2PGBB 4UFEH 2BQWB 1EZUC 2CXVA 4I33A 2W7UA 1ELCA 1GG6B 3AAUA 2FZZA 1DITH 4AG2A 1KXCA 2GCTB 2QN5T 4RKOB 1FI8A 1EB2A 1AMHA 2QGRA 2STBE 1T8MA 1KXBA 4BXSA 1TX7A 2VWMA 1CT0E 1G9IE 1BTWA 3UY9A 1GPZA 1HIAB 1HNEE 1V6DA 3SI3H 5FCKA 4ZKSU 2NWNA 1IQKA 1RGQA 1GHBF 4NIXA 1C5RA 1C9PA 1CHGA 1GWAA 3ZVBA 2GZ8A 4KKDA 5LH8A 2C93B 1KY9A 1XUGA 1ELAA 3GY3A 4ZKRU 1DE7H 2HNTC 1YPLH 1MAYA 1TGSZ 4ABEA 3Q00A 2ZDKA 3SO3A 3PLBA 3LGYA 2ZPRA 1O33A 1AVWA 1HPGA 4F49A 1BT7A 3MYWA 4ABFA 1C5QA 2BY9X 3UNRA 3SU6A 4NA7A 2NU4E 3RXOA 4BTIB 4AGKA 1AE8H 3ZZ3A 4A7IB 2VGCC 2RDLA 2XTTB 1DWBH 1O37A 2ZZUH 3K6YA 1MKXH 1O3NA 5HGGA 3DUXH 3SV2H 1IQFA 2O8MA 4FUGA 1C1VH 1EQ9A 2VH0A 2XNIA 4MTBA 2GP9B 3T28A 4KTSA 1ANCA 1QA0A 1HXFH 3EYDA 2FS9A 1F0TA 3JZ2B 3TGJE 1ZHMA 2BX3A 1LQEA 1TQ0B 1WOFA 2A1DB 3BV9B 5EQQA 4YM9A 1BRBE 1GI8B 3TH4H 1OWHA 5F03A 3SORA 2A4RA 5C20A 1AFEH 1GI1A 2THFB 3QZRA 3PMAB 1ZHRA 5DG6A 1OX1A 3MO9A 3UNSA 1BRCE 2H1UA 2FM2A 4XBBA 1TPAE 1O5DH 3F9HA 4ZROA 2STAE 2P8OB 3BG8A 4JMYA 2Y7ZA 2CGAA 1P2JA 3KEEA 1A3EH 1AO5A 1TNJA 2FOAA 1QJ6B 3UR6A 3PTNA 1FY1A 3PMJA 3D65E 2ZHEH 1P2QA 1UK4A 1NFUA 1H4WA 1D4PB 1SLVB 2XRCA 5EG4A 5GCHG 1P2OA 3D23A 4D76A 1TPPA 1O2YA 1AWFH 3LOXA 3UUZA 2PHBA 3LGVA 3QZQA 3KCGH 1O2XA 1GJDB 2ZHWH 3TIUA 3A7ZA 4ISNA 1AN1E 1MKWK 2H5CA 2P3FH 1C5SA 1A0HB 1O2MA 1O5CB 2TPIZ 1DOJA 1SGCA 1UMAH 2GGVB 5C67A 2OBQA 1HAVA 1LHEH 2TGPZ 4GUXA 3TJUA 2ZQ2A 3KN2A 4B2BA 1VITG 1QL8A 1ESTA 1P12E 5GIBA 2ZF0H 1OYTH 4DCDA 1YCPK 3BTGE 4AFSA 4MPUA 2GCHF 4WH6A 1DXPA 1O5FH 1Y3VA 4FU9A 2Y81A 2I6SA 2Y6TA 1UTJA 1EX3A 1GBLA 3PMBB 2FI5E 1S0RA 1A4WH 5FHTA 1O3HA 1P3EA 1PYTD 3F6UH 1OXGA 1D3PB 4FUFA 2J34A 1AKSB 1SB1H 1AB9C 2A7CA 1C2JA 3SUFA 4WWYA 3ZZ9A 2SFAA 1A5GH 1GVLA 1WYKA 1EAWA 2RA3A 2GMTC 3M36A 1O5AB 5TCCA 1GJ4H 1NRRH 2XCNA 2WPHS 1CGJE 3ZZ4A 3TJVA 1F0UA 1TQ7B 2Z9KA 1O35A 1QFKH 1GJ9B 1ZYOA 1TONA 4Y10E 3QGNB 3RXBA 2M5TA 4INLA 1O3IA 4E05H 1L1GA 3VXEH 1C2FA 2Z6BD 1CVWH 1ZZZA 3NWUA 1QRXA 4YT6H 2D2DA 3LJJA 1QHRB 3RP2A 4BNRA 2DE9A 1A5IA 2QXHA 5EGMA 3PB1E 1HJAC 2VIPA 3PWBA 4AB9A 1VCWA 4X0WU 2PR3A 5H4IB 2G00A 2OBOA 1GJBB 2J2UA 1UTKA 2WPLS 3W94A 3SGQE 1GMDF 4ABBA 3SHCH 5F8TA 2O8WA 2HNTF 2FLBH 2F9PA 1FXYA 1LVYA 4LOYH 4JYUH 4WJG2 2KAIA 1SGEE 4Y0ZE 3Q3XA 3R3GB 3OX7U 3E16B 3LT3A 2BDAA 1PFXC 2PTNA 3B9FH 4FUCA 1CBWB 2TBSA 3RMLH 3BN9A 1J8AA 2Z94A 3DFLA 2QXJA 4ZAEA 2ZA5A 1TPOA 1PPHE 3DT0H 1XUFA 2FODA 2VWLA 1C1TA 3GCTF 2B7DH 1V2RT 3TVJB 1TX6A 1O30A 2P94A 2LPRA 1XUHA 1EOLA 3ZZ5A 2GV6A 3LGUA 4OGYA 3GOVB 1KTSB 9LPRA 4CH8B 3FFGA 3GY4A 1W14U 5K0HA 3A83A 3URDA 2A2XH 1GBAA 3RLWH 1KTTB 1GGDC 2EI8A 4BTUB 3FP6E 1YPMH 2UUYA 1GMCF 6GCHG 4MLFB 1DWCH 2W7SA 1LHFH 1V2ST 2D1JA 1G3EA 3FP7E 1Y3YA 4JZEH 3LC3A 2OC8A 4K1SA 3F9EA 6ESTA 3QTVH 3MH5A 2ZECA 3S9BA 3SW2B 1N6XA 2QCYA 1YCPM 4I8GA 4ESTE 1SVPA 3A7TA 5J4QA 3A80A 3ZYDA 1OWDA 4X8VH 2VIDA 4YLQH 1RIWB 5A8YA 3SNAA 2VIQA 1O2JA 3BG4C 1Z7KA 2ZQ1A 4IMZA 1GDUA 2ZTZA 1H8DH 1S84A 3GDUA 1DXWA 1KIGH 4CBOA 4X1SU 4NZQA 3ATKA 1TA2A 1NS3A 1W0ZU 3A7YA 2RG3A 2Q6GA 4CR9A 1O5GH 1LO6A 1NFXA 2Y5HA 3OY6U 1VR1H 4HFPB 1O5BB 2I6QA 5F8ZA 3EE0B 3RXMA 3KQCA 1N8OB 1UCYE 2IN2A 3BTEE 3DA9B 3LC5A 1IQHA 1T31A 1V2KT 1F7ZA 2BDBA 2UUJB 1S85A 5FBEA 1A61H 3M5OA 1J17T 1RTLA 3RC6A 5CE1A 2VB0A 1IHSH 1MTUA 2EC9H 4AN7A 4TYDA 3SNDA 4LXBH 2R3YA 5SGAE 5EQRA 3RXQA 4K3JA 1GBTA 1E36B 1GHVH 2BX4A 1WAYB 1ARBA 1CSOE 1GHYH 1Y3XA 2ANMH 1DPOA 4XBDA 3UR9A 2SGDE 2ZTXA 1CT2E 1TALA 3U98H 4WY3A 1GDQA 1DDJA 2NU0E 2WUBA 3HGPA 4Y6DA 4IBLH 3STJA 3TNTA 3RXKA 1RJXB 5L6NH 2Z3EA 3EQ0H 4CBNA 3ZVCA 3VGCB 4H6SB 1Y5UT 2BVXH 2FWWA 4NGAH 5AFZH 1WTGH 1RIWC 3A7VA 3VB7A 1ESAA 4UD9H 2QIQA 1JXPA 1KDQB 4K1EA 1ORFA 2AGEX 2J38A 1T7CA 4BAMB 2ZFRH 1IQNA 1NU7B 2BD8A 1A0JA 4A6LA 3TK6A 2FEQH 1K1NA 1ETRH 3ZZ7A 3D49H 4NWKA 2VH6A 2R0KA 5A8XA 1C5MD 1PPGE 1VJAU 1MU6B 1G32B 2Z3DA 4FVBA 2HOBA 1GHAF 4UFFH 3VPKA 4FU8A 4U01A 4ZHMU 1AIXH 1SHHB 4B75A 3MI4A 1C1WH 2P59A 2Y5FA 1J16A 2ZU3A 4X2VA 1HDTH 1EOJA 4D9QA 2BD5A 2XBXA 2ZDNA 3UQVA 1EZQA 4DOQA 1LMWB 1EAUA 1NFYA 1XM1A 2Y80A 1SLUB 4YTAA 1GHXH 1WQVH 1O38A 2BVSH 3ODDA 1THPB 2VWNA 1DT2A 2GT8A 2Q6FA 3I77A 1EP6A 3RXDA 2PV9B 2C3SA 4DGJA 4X6OA 1CE5A 2YOLA 3MFJA 1ZTKA 1UVSH 1ETSH 3EA8A 1ELFA 4MNXA 4X2WA 3UIRA 1HFDA 4TY7A 3P8OA 2ZHQH 1BMMH 1ZSJA 3CP7A 6CHAB 3F1SB 3FZDA 3SJ9A 4X8TH 3ATMA 3TJNA 4UDWH 1SSXA 1EJNA 1T8OA 4GSOA 4XOJA 1UTQA 3A87A 2GTBA 2FOFA 1N1LA 3LONA 2XC5A 1F0SA 1K1IA 1FPCH 2OQUA 2AMPA 3MU0A 2NU2E 3M5NA 1QBOA 3SU2A 3GCHC 1C2EA 3E1XB 3TH3H 2FOCA 3V13A 1GBKA 2ZU1A 4K69A 1C1OA 4E7NA 3RXJA 2J4IA 1NM6A 3C1KA 4MNYA 1P10A 3E6PH 3CENA 3KQBA 4ABGA 2VJ1A 4O3UA 1LCYA 3VB4A 1C2DA 4AX9H 2ULLA 2R9PA 1KLTA 2DUCA 1T8NA 4NSVA 2P8OC 3GISB 4YO9A 2UUKB 1IAUA 4H42U 2ZDVH 3R0FA 3GY5A 3TGKE 1C1QA 3BTQE 1P2IA 3VGCC 3S0NA 3M7UA 2AYWA 5JB9S 1P09A 4MPXA 3GYMA 1KXDA 1BRUP 1QBNA 3OTJE 3U9AH 1O2TA 2QY0B 2RCEA 4YESB 2ZCHP 2C8ZB 3A85A 4I31A 2CJIA 2HRVA 3KIDU 1XXFA 1O2WA 1TRYA 2C8WB 2ZGJA 1EXFA 1K1PA 4KTCA 1HGTH 1O3FA 5EPNA 4FU7A 3ZZ8A 3KHVA 1SGYE 1OOKB 2PGQB 1QB6A 3C27B 1NC6A 4NIWA 3T26A 3SUDA 3O8DA 1FNIA 3GDVA 1AD8H 1V2MT 3JZ1B 5GJ4B 4FUIA 3RXPA 4O3TA 3S9CA 3SV6A 2P3TB 2XXLA 1BTYA 3E8LA 1O2UA 3PO1C 1OYQA 1ELEE 1YKTA 1H1BA 3SHAH 4AGJA 1BUIA 3MOCA 2P16A 4XFQA 1P57B 5C1UA 1H9IE 2ZPQA 1ACBE 3Q77A 1FY4A 3DFJA 3M5LA 4NA8A 4MPVA 3RXIA 1QY6A 5ABWA 3DD2H 1DWEH 1P05A 2BVRH 1ANEA 1S5SA 1UHBA 4MNVA 4O97A 1HRTH 4X8SH 2V0BA 2BD9A 2PKAA 2AMDA 4B2CA 1ETTH 1A0LA 1UO6A 1A7SA 1IQJA 1TGCA 4NFFA 5FPYA 1BBRH 1CT4E 4B73A 1AVXA 3LKWA 2ANYA 5AHGH 2ILNA 5F6MA 3UWIA 4F4OC 3HKJB 3PLPA 2P95A 2C8XB 3PV4A 2BMGB 2FMJA 3RXEA 2ZTYA 1O2SA 4LZ1H 3MO6A 1QL9A 1GCTB 3QUMP 3U8RH 3LH3A 5LGOA 3MU1A 2O8UA 4KTUA 3A81A 4DIHH 3P17H 1K21H 2BXUH 1SPJA 2ZG0H 1TE0A 4OGXA 2P3UB 1HCGA 1MAXA 3LGWA 1ZOMA 1YCPH 2VINA 2FOHA 5EW2H 1XKAC 3DHKH 3ATLA 4X6MA 1T4UH 2EI7A 1J9CH 3ATWA 4A1VA 5GPIB 5EU8A 2ZO3H 4B71A 2VGCB 1QIXB 2RA0A 4AB8A 1IOEA 5T6FA 4DVAU 1A5HA 1G36A 4VGCC 1FN8A 1GI6A 1GMDG 2YNAA 1ZHPA 4NFEA 4AZ2B 1P3CA 2H9TH 1HAPH 1O3MA 4AG1A 4B1TA 1P2NA 3GY6A 4U30A 2WYGA 5FPSA 5C5NA 1GBFA 1LPKB 8ESTE 1AY6H 1Z8RA 3HATH 1OWIA 3QO6A 2F3CE 2SGEE 1NRSH 4ISLA 4OS6A 3U8TH 1KDQA 1MZDA 3H5CB 1SGQE 4XBCA 3ESTA 1O2LA 2TGDA 1O3LA 3RMOH 2H6MA 1TGBA 3A8AA 1SLWB 1HAIH 5DP4A 3MU8A 1AVGH 2CMYA 4Y7BA 5T6DA 1OP8A 1SLXB 1TOMH 2W3KA 1P11E 4D7FA 2BY7X 1OWEA 2R3UA 3SV9A 3UNQA 3ZV9A 1RXPA 4UONA 1P04A 1UTOA 3T62A 5GDSH 1J15A 2JETB 1K1OA 1F92A 2FLRH 2BB4A 3RC5A 3S9AA 1YF4A 1BBRE 2ZGHA 4HZHA 1Z8JB 1EUFA 3I78A 1ABJH 1T4VH 4CRDA 1MU8B 1HXEH 4E7RG 1GJ7B 3ZVFA 4BXWA 3VFEA 3ZZAA 4Y8XA 2FTMA 3A88A 6GCHF 2ANKH 3N7OA 2AIPA 1ARCA 1IQGA 4DT7B 1LHGH 4FUDA 1K1LA 3EDXB 1P0SH 3AAVA 3K65B 2BDGA 1KYNA 1UJ1A 1WU1A 1JIRA 1Y3UA 3VXFH 1P03A 6CHAC 1ABIH 3M37A 3BIVH 1MBMA 3ZZDA 4AYVB 1ZMNA 1TRNA 5EXMA 3CS0A 1GMCG 2A7JA 1TRMA 2G5VA 1D3TB 1TWXB 1Q3XA 2XBWA 2FPZA 5BPEA 3S7HB 4WXVA 1FAXA 4SGBE 2CHAC 2XBYA 3MNBA 4JK5A 1X7AC 1GJCB 2UWOA 5L30H 1TYNA 1GJAB 1P2KA 2BY6X 2Y82A 2UWLA 3RXFA 4Q7YA 4IN2A 1SOTA 4LK4A 3RXCA 2Z9GA 1GMHF 3V3MA 1O3AA 1SOZA 3VB6A 3A7XA 4UEHH 4HI3A 1GG6C 4ZHLU 4MQAA 4IS5A 1TGTA 1BB0B 2QAAA 2V3HH 2ZDMA 5CHAC 4A1TA 4X1PU 1ZLRA 1MD8A 4IC5A 4CHAB 2G4UA 1V2WT 3B23B 1C5ZB 3K6ZA 1C5TA 2A5AA 1TBZH 2OQ5A 1O2NA 2OC7A 3KQDA 5DPAA 5AF9H 1SGNE 3FAOA 4JYTA 1YM0A 1WQSA 4RKJB 2BLWA 2GZ7A 4THNH 2FOGA 2Z9IA 3SNCA 1Z6EA 4I8HA 5FX5A 2BD2A 1L4DA 3RLYH 3TK9A 3E0PB 1WCZA 3NXPA 1DANH 4D7GA 5T3HA 1HAOH 4Y71A 4ZMAH 1XX9A 3RM2H 3V7TA 1D6RA 2GKVE 3UPEA 2VIWA 4DG4A 4DY7B 3QX5H 1S0QA 1YPHE 4RN6A 5JBTA 1O34A 4R8TB 3RM0H 1BZXE 1YYY1 5C1XA 3TITA 2GMTB 5DP8A 1K1JA 4BAQB 1L1JA 1GBIA 3ZVGA 1RS0A 1P9SA 1PQ5A 4ABAA 4Y8YA 5JPMH 4NIVA 5I46H 1C5NH 4OS1A 1GVZA 2A4OA 1C4U2 1T32A 1G2MA 3TK5A 1QR3E 2BQ7B 4MG3A 2GT7A 1ZSLA 3AW1A 4Q80A 1DWDH 2ZFSA 3U69H 4K1TA 2Z9LA 9ESTA 3SU1A 3ZVEA 1CA8B 1TLDA 2ZGXH 3MWIU 2TRMA 1GCTC 1SGRE 1O2HA 2V35A 2ASUB 1RD3B 1TNGA 1NO9H 5DO4H 1YLCA 2EI6A 3I29A 1JRTA 3RC4A 1Y5AT 1MTVA 1H9LB 1THRH 2J95A 5A0AE 3OY5U 3UFAA 2GCTC 2ZU5A 1DY8A 2PKSC 1HAZB 1EPTA 1CA0C 2JH0D 2A5KA 3FANA 1MQ5A 3SOSA 2BY8X 3K2UA 2XCFA 3GDSA 3RU4E 2EEKA 3SV7A 3GCHB 3STIA 3IG6B 3QWCH 3QTOH 4Y8ZA 3ZV8A 2OC1A 1SI5H 1V2NT 2VU8E 5C5OA 3M5MA 1G3CA 3ZVDA 1C1UH 4A5TS 5L2YH 3BTTE 3M7QA 1YGCH 1AUJA 3SU5A 2F91A 5HMAA 1NT1A 3GY2A 4INHA 1Z71A 1H8IH 3KF2A 1IQIA 4Q2KA 5FAHA 5E2PA 1MTWA 1LHCH 1O2GH 4J2YB 1HJAB 1W0YH 4WMDA 1UVPA 1FONA 1P06A 3MNSA 1FN6A 1GJ6A 1Q2WA 2BM2A 2BD4A 4ABHA 4ISHH 4X1RU 4K2YA 1BDAA 1O0DH 2ZNKH 1O3EA 4CRAA 2H9HA 1F0RA 3A8DA 1UHBB 3P95A 3BG4B 1C1PA 3MTYA 1EASA 3P8NA 1EP5A 5IYTA 1P9UA 4CREA 2KAIB 1INCA 2D26C 2ZP0H 4FUBA 3HKIB 1BMAA 1HUTH 1DUAA 2C8YB 1TPSA 1TBQH 1LVMA 1O2ZA 4TPYA 4CRGA 1UK3A 1SQAA 4JZIA 2AGIX 2OP9A 3MU5A 4MDSA 4CRFA 1QB9A 5IDKA 1HAGE 1BTPA 3HPTB 1Y5BT 1YPKH 3E3TA 2ZI2H 2ZFPH 2EA3A 5TCAA 3UOUA 1S82A 2PUQH 1QGFA 1P01A 1EAIA 2ODQA 8KME2 1CHOG 2FYQA 4FUJA 2OLGA 5T6GA 2F9BH 2BLVA 2Z7FE 4TY6A 2V3OH 2B5TB 5DK1A 2JKHA 1OP0A 4ISIH 8LPRA 2JETC 1BMLA 1UCYH 2BLQA 1C1SA 1SHYA 1TAWA 3BF6H 5HM9A 1UVOA 2R2WU 3TGIE 1QA7A 3K9XB 1E37B 2HGTH 1BCUH 2HWLB 1YC0A 3BTFE 3SQHE 4MVNA 1ZPBA 5FPTA 3U1JB 1IHTH 2NU3E 1FUJA 1SFQB 1E38B 4XDEA 2XYAA 1L0ZA 5HM2A 1CGIE 3ENSB 1TMTH 1RRKA 1C9TA 2A4GA 3EA7A 2G8TA 3M3SA 3NZIA 1HAYB 1NY22 1O3KA 2OTVA 3LGTA 1GHAG 2ZFTA 2D8WA 1Z6JH 1A1RA 3F9GA 1VGCB 1GBCA 2XWBI 2AMQA 3M3TA 1SGFA 4INKA 1TNLA 1GMHG 3Q3YA 1QBVH 1GBDA 1XUIA 4O03A 1O2OA 1YPHC 4BAOB 1A3BH 1BQYA 2F9UA 1JIMA 2ZGBH 2TGAA 3SJIA 1C5OH 2FYRA 4UE7H 4DIIH 1HAVB 2FESH 5DP3A 1SGPE 2PUXB 4A1XA 3LJOA 1MBQA 5ETXA 1FV9A 2ZCKP 3M61U 2CF8H 2WPIS 1O2VA 4I8LA 4WH8A 1EKBB 2FP7B 4D9RA 4YZUA 4X2XA 4JYVH 5HYOA 4Z6AH 3RXVA 1GJ5H 1JWTA 3RUOA 3GCTG 1SGTA 1W12U 2ZDAH 4CRBA 5JBAS 2SGAA 4X1NU 2SNVA 3RXHA 3SZNA 1XVOA 1D6WA 2BDCA 2F83A 5EOKA 2FS8A 3UWJH 2BD7A 1S6FA 3L6PA 1SGFG 1T8LA 3T29A 2BZ6H 3SJOA 1V2UT 2PFEA 2BOHB 1TA6A 3P8FA 1F5RA 1F5KU 3BEUA 1NZQH 3ITIA 3TPIZ 1SC8U 3SU4A 5C3NA 1CU1A 3O8BA 2CN0H 1HBTH 4A92A 4AFUA 1EPTB 2QC2A 1XVMA 4ZH8A 3PTBA 1GI3A 3LGIA 2V6NA 1GL0E 2QYIA 4ABDA 1QRWA 2SNWA 3AW0A 3BSQA 1GI4A 1ZGIA 4AORA 1FIWA 1C2IA 3W95A 1C1MA 7KMEH 2F9VA 2AIQA 3MNCA 4X6PA 2HPPH 1ID5H 1ELDE 2FOEA 3H7TA 1MD7A 4NA9H 1UVUH 1KXFA 1SMFE 1N8OC 5E2OA 1CA0B 2AERH 2PWXA 4NWLA 5EODA 2HNTE 3T27A 1ZTJA 1YPEH 3TH2H 2WPJS 2Q6DA 3FP8E 1ESBA 1C5XB 2ANWA
chains in the Genus database with same CATH superfamily
4M9FA 1DICA 2ALPA 2O9QA 1MQ6A 3MHWU 4AOQA 1L1NA 1O2RA 2QF5A 4LZ4B 3FOAA 1O2IA 1W7GH 2VIVA 1MZAA 2Y5GA 3V12A 5A2MH 1HB0B 1DX5M 3NK8A 5E8EH 1W0KD 3RMMH 5HKKD 4I7YH 1FMGA 2J9NA 4IN1A 4BAKB 1MKWH 3A84A 1Y59T 3ODFA 1LHDH 1W13U 2G5NA 4UFGH 4BANB 2AFQB 2ZC9H 1DFPA 2BQ6B 4I32A 3BTME 5DP9A 3FZZA 1MTNB 4K5ZA 3KNXA 3P70B 1NRNH 1BHXF 2GDDA 1FY3A 1TMBH 1E1RD 3KYGA 2ZHFH 1LVBA 1BJUA 1GBJA 2HPQH 3U8OH 3ZZBA 1QB1A 5K7RA 1K1MA 4CHAC 2OC0A 2HLCA 3PYHA 2VNTA 4JZ1A 4FXGH 2C4FH 3N99A 4HGCA 1KLIH 3RXTA 1HJ9A 2ZKSA 1BA8B 3RXRA 3SI4H 3SNBA 3T2NA 2KCAA 4E06H 2J92A 3H7OA 1V2PT 2PSXA 2WSSD 3RU4D 3ZYEA 3M3VA 3Q3KA 5DJ7A 1C2LA 7GCHG 5JYIA 3GS9A 3SJKA 1UTNA 3BTHE 4NZLA 1BBRK 3O8CA 2XNDD 1SR5C 1XUJA 3UREA 1BRAA 2BY5X 1EJMA 4IC6A 3URCA 4Q7ZA 5GWZA 1HYLA 2ZU2A 2XC4A 1L4ZA 1PPFE 1P02A 4ISOA 2A45B 1TX8A 2QF0A 2CF9H 2KX4A 3BEIB 2Y7XA 1C1NA 1CQQA 1D3DB 1VJ9U 3BIUH 4GHTA 1D3QB 1XKBC 2A2QH 3PWCA 4F48B 1C4Y2 3F0PA 1Z1IA 4AFQA 5FBIA 1B5GH 2O8TA 4B74A 3GICB 5EXLA 1EZSC 1AHTH 3KQEA 4NSYA 2QXGA 4O9VA 1SG8B 1YP9A 5JBCS 1LKBA 1E34B 4Y7AA 1LKAA 2ZEBA 4HTCH 5F8XA 2K1QA 1ZRKA 1B0FA 4MPWA 5GCHF 1SFIA 1TFXA 2H5DA 4ABIA 1PQ8A 2DE8A 3BTWE 1MUEB 3U1IB 3Q76A 1NFWA 2FI4E 5DP7A 3UB0A 1DUEA 1FY5A 2FTLE 1QCPA 4TWYA 1MMJN 2QV1A 1GI5A 2SGQE 3SN8A 1O5EH 1N6YA 1SBWA 4WF8A 4B6EA 4X8UH 3ELAH 3QLPH 1M9UA 4BOHA 1O39A 4ZUHA 5DKMA 3RU4T 1TIOA 3KL6A 5AVDA 1AI8H 1AE5A 5EW1H 3PMHB 1PPBH 4DJZB 2QXIA 4CR5A 1TMUH 3LIWA 2PTCE 3RXLA 1BHXB 1H9HE 1LDTT 1G2LA 1JOUB 1E35B 3ATIA 2UWPA 3VEQB 2OD3B 4X1QU 4B2AA 1RTKA 4IMQA 2WPKS 4Y79A 1GI7B 1QQUA 1XXDA 1ZMJA 3SGAE 2OCVB 5FXLA 1WUNH 1WBGB 4TWWA 2PKAB 1FQ3A 4Y76A 1TNIA 1C5PA 1C4V2 1OPHB 2BDHA 4ZHAA 2GCHG 1GL1A 1DSTA 3F2HA 3EAJA 4CRCA 2R0LA 3A7WA 3F9FA 1S6HA 2BD3A 4U2WA 2TGTA 5LPEA 2OINA 4KELA 7ESTE 1Q31A 2A5IA 1GBEA 3LPRA 2XC0A 2BDYA 3P92A 1SL3A 1W8BH 1D9IA 3MO3A 5E0HA 4XD7D 3ZVAA 5J4SA 1UTMA 2B0FA 2WV5A 3M7TA 3GYLB 1XMNB 1FJSA 1AQ7A 2FIRH 2Z9JA 1AB9B 4U32A 5FX6A 4YOIA 4NIYA 2W3IA 1FY8E 4JZFH 1IQEA 1GBHA 3SUGA 1GHBG 1NTPA 1O3GA 1ZJDA 2R2MB 5EXNA 3P8GA 1E0FD 4ABJA 2ZU4A 3CNRA 1DLKB 3NCLA 2BHGA 1FLEE 1FPHH 1W10U 2WPMS 1O2QA 1TABE 5HIYA 4GAWA 3HK3B 1A2CH 3A8CA 1Z8GA 1C2HA 4YOJA 1SQOA 4NCYA 4I8KA 5GNDA 2H9EH 2ALVA 1SGDE 3SNEA 1AFQC 2FI3E 5AFYH 1GCDA 4X6NA 5A0CA 1CBWC 4YLUA 3TNSA 2H2ZA 7LPRA 1V2OT 1BTZA 2G52A 2A7HA 5ESTE 1PPEE 3GCOA 4FUHA 2HALA 5PTPA 2OXSA 1QJ7B 1O3OA 1ELGA 1NROH 3VB3A 1TNHA 4FUEA 1TOCB 1C5VA 3MH6A 3TJOA 1OSSA 1LPZB 1SQRA 1KLJH 2AEIH 4TPIZ 1MCTA 1BTXA 3GY8A 1GVKB 2A32A 1DM4B 1J14A 3IITA 2G81E 1L2EA 3KGPA 1V3XA 2KZ4A 3S7KB 2BXTH 4DURA 3RDZA 3RXAA 3SU0A 3GCNA 1GBMA 2ZIQH 1ZSKA 3GY7A 2VVUA 1ZJKA 3WY8A 1FZZA 1UK2A 1TGNA 1ELVA 1QZ8A 2JH5D 2BOKA 3UTUH 1S81A 2F9OA 1ELBA 1YLDA 3EGKH 1SQTA 1DVAH 4JCNA 4SGAE 1ZGVA 1GGDB 4KGAA 1VZQH 2BLOA 1MABB 2FXRA 4AYYB 2PP6A 3O8RA 2GD4B 3ZZ6A 5E0GA 3T25A 5EPYA 3SGBE 2V7QD 4ZKOU 3RMNH 4AC9A 2KR7A 4K60A 2J98A 1DLEA 2YNBA 3A89A 2KM0A 3A86A 1RFNA 1K9OE 1EATA 2TIOA 2Z3CA 1GHWH 1MCVA 3B8JA 1BTUA 3HK6B 1G3BA 3A82A 3PROA 2SGPE 4YOGA 1QTFA 1HV7A 4ZXXH 1AGJA 1BITA 1GHZA 1PJPA 5E0JA 2LNCA 1K2I1 3D62A 1NRPH 1QQ4A 2QF3A 5C1YA 2J98B 3OSYA 1C2MA 4OS4A 1YPJH 3MNXA 2BTCE 1GBBA 1AUTC 1ZRBA 1DS2E 4K8YA 1UTPA 4FVDA 1Z8IB 1IQMA 4KP0A 1C5LH 1QJ1B 5JBBS 3E90B 4UFDH 2VVVA 5EQSA 3NPSA 3V0XA 1B0EA 1GDNA 7GCHF 1NESE 3NKKA 5L2ZH 5A8ZA 3AASA 1EB1H 1HIAA 4GHQA 2QE7D 1A46H 2GZ9A 2ZHDA 1ELTA 4K8BA 3OU0A 1MH0A 1G3DA 1O3JA 1E1QD 4YT7H 3E91A 2ODPA 2ZFQH 2G51A 2G4TA 4HG6A 2IPHA 6LPRA 1P8VC 4OS7A 1BIOA 3RXUA 1JBUH 4B76A 3NRLA 2ZPSA 1ANDA 5C2ZA 2ZWLH 5ESBA 3OE7D 1O2KA 8GCHF 3P6ZB 1OWJA 1WV7H 3L3TA 4ZXYH 1FIZA 3OYPA 2CHAB 2FX4A 4Y0YE 4MNWA 4I8JA 3NUMA 1V2TT 2GX4A 4X2YA 3LDXH 1LVOA 5CDFE 1C5UA 2AH4X 2OUAA 3FVFB 3G01A 3M35A 1GI2A 1OP2A 5HIZA 1ZR0A 3QGJA 4JZDH 2B8OH 1QRZA 1GI9B 1TNKA 1OKXA 1WTHD 1THSH 3AVZA 4WMFA 2JJ1D 1C2KA 1DY9A 1RTFB 1TB6H 4NG9H 2CV3A 2A4QA 1GI0A 2LP6A 1UTLM 1Z1JA 1KXEA 1F5LA 2ZFFH 3PV5A 2ESTE 1YPGH 1QL7A 2W5EA 3TU7H 4QT8C 1VCPA 5JB8S 1GJ8B 1AFQB 2Q1JA 2F9NA 1WSSH 1C2GA 2FX6A 4CH2B 1EPTC 1H8HD 1OWKA 4R0IA 2BZAA 1FDPA 2ZGCA 4ZKNU 4OS2A 1YY3A 3U28C 3F68H 2VWOA 1O3CA 1CHOF 4OS5A 1W7XH 1W11U 1NPMA 2VIOA 1DSUA 1NN6A 1ZTLA 2G55A 4H4FA 5FCRA 5LPRA 1AU8A 1C1RA 3LH1A 1C5YB 2O8LA 2FOMB 1Y8TA 2UUFB 2FOBA 1S83A 1G30B 2AGGX 3PRDA 2B9LA 4BTTB 1JMOH 5CMXH 1O3PB 2XWAA 4WMEA 1K0HA 3HGNA 3TLOA 1PQ7A 1BOQA 3L33A 1V2LT 1AZZA 1EJAA 4JK6A 1O36A 8GCHG 3CS7A 1SGIB 4WVPE 2HVXA 3PLKA 3PO1B 3SJ8A 1V2QT 5G4BA 3S69A 3SBKA 5A0BA 3A8BA 1YBWA 2K0QA 4GCHG 2JH6D 2GVFA 4RSPA 1KMHB 3MU4A 2A0QB 3BTKE 5DGJA 1BTHH 1LPGB 2IJOB 2VVCA 2W26A 3MH7A 2WV9A 4IGDA 1QURH 4VGCB 2BYAX 3QDZB 1B7XB 1AWHB 2ZCLP 1Y3WA 1JRSA 1P2MA 1NRQH 1ZPCA 4IW4E 1AZ8A 2GDEH 1UVTH 2CK3D 3QK1A 5DP6A 3UOPA 1VGCC 1V2JT 1HAHH 1O32A 5DP5A 3T5FH 2NU1E 3RXGA 1LTOA 1HJ8A 5KEDA 2FO9A 1VITF 1EZXC 1OS8A 3E0NB 1U6QA 1O3BA 3SU3A 5I25A 4Y11E 4Z0KA 2PSYA 1BMNH 3RXSA 5HXFA 1BJVA 1C5WB 1CO7E 1PQAA 1QNJA 4ASHA 3EA9A 4XSKU 4GVUA 1O2PA 4AFZA 1ZPZA 2PW8H 1W3CA 5BRRE 4WXIA 1EAXA 1MTSA 2A31A 1ANBA 2C90B 1O31A 2GV7A 1ZMLA 3MMGA 1LQDB 2PKSB 2WYJA 3PM3A 5TJXA 2SGFE 4J1YA 3SQEE 1FAKH 1F2SE 1KSNA 1O3DA 5A09A 1AKSA 3SV8A 1VCQA 2BDIA 2XW9A 3IWMA 1PPCE 4BAHB 2WV4A 5CHAB 5B6OA 4XE4A 2IOTA 2ODYB 1K28D 2P93A 2WINI 1VITH 1HAXB 2F4LA 1V2VT 1W2KH 2XBVA 2WUCA 3QN7A 4M7GA 1UW7A 2PLXA 4GCHF 4H6TA 1HLTH 4DW2U 3BTDE 4GLYA 1UCYK 3VB5A 3SUEA 1PPZA 3ZZCA 2AS9A 1K22H 2FDAA 4D8NA 3UQOA 3MH4A 5GXPA 3BEFB 1KXAA 1CGHA 2J94A 5JDUB 1NU9A 4PROA 1PYTC 5LPFA 3LU9B 1G37A 2QA9E 1MTNC 4GPGA 1TBRH 1XUKA 4Q7XA 1MKXK 2ZDLA 1IQLA 2PGBB 4UFEH 2BQWB 2KCYA 1EZUC 2CXVA 4I33A 2W7UA 1ELCA 3H09A 1GG6B 3AAUA 2FZZA 1DITH 4AG2A 1KXCA 2GCTB 2QN5T 4RKOB 1FI8A 1EB2A 1AMHA 2QGRA 2RDEA 2STBE 1T8MA 1KXBA 4BXSA 1TX7A 3FN8A 2VWMA 1CT0E 1G9IE 1BTWA 3UY9A 3KQ5A 1GPZA 1HIAB 3DSOA 1HNEE 1V6DA 3SI3H 5FCKA 4ZKSU 2NWNA 1IQKA 1BMFD 1RGQA 1GHBF 4NIXA 1C5RA 1C9PA 1CHGA 1GWAA 3ZVBA 2GZ8A 4KKDA 5LH8A 2C93B 1KY9A 1XUGA 1ELAA 3GY3A 4ZKRU 2QF4A 1DE7H 2HNTC 1YPLH 1MAYA 1TGSZ 4ABEA 3Q00A 2ZDKA 3SO3A 3PLBA 3LGYA 2ZPRA 1O33A 1AVWA 1HPGA 4F49A 1BT7A 3MYWA 4ABFA 2F43B 1C5QA 2BY9X 3UNRA 3SU6A 4NA7A 2NU4E 3RXOA 4BTIB 4AGKA 1AE8H 3ZZ3A 4A7IB 2VGCC 2RDLA 2XTTB 1DWBH 1O37A 2ZZUH 3OAAD 3K6YA 1MKXH 1O3NA 5HGGA 3DUXH 3SV2H 1IQFA 2O8MA 4FUGA 1C1VH 1EQ9A 2VH0A 2WZQA 2XNIA 4MTBA 2GP9B 3T28A 4KTSA 1ANCA 1QA0A 1HXFH 3EYDA 2FS9A 1F0TA 3JZ2B 3TGJE 1ZHMA 2BX3A 1LQEA 4ZCNA 1TQ0B 1WOFA 3KYFA 2A1DB 2YMSC 3WW7A 3BV9B 5EQQA 4YM9A 1BRBE 1GI8B 3TH4H 1OWHA 5F03A 3SORA 2A4RA 5C20A 1AFEH 1GI1A 2THFB 3QZRA 3PMAB 1ZHRA 5DG6A 1OX1A 3MO9A 3UNSA 1BRCE 2H1UA 2FM2A 4XBBA 1TPAE 1O5DH 3F9HA 4ZROA 2STAE 2P8OB 3BG8A 4JMYA 2Y7ZA 5KGOA 2CGAA 1P2JA 5DN6D 3KEEA 1A3EH 1AO5A 1TNJA 2FOAA 1QJ6B 3UR6A 3PTNA 1FY1A 2HVYB 3PMJA 3D65E 2ZHEH 1P2QA 1UK4A 3WWBA 1NFUA 1H4WA 1D4PB 1SLVB 2XRCA 5EG4A 5GCHG 1P2OA 3D23A 4D76A 1TPPA 1O2YA 1AWFH 3LOXA 3UUZA 2PHBA 3LGVA 3QZQA 3KCGH 1O2XA 1GJDB 2ZHWH 3TIUA 3A7ZA 4ISNA 1AN1E 1MKWK 2H5CA 2P3FH 1C5SA 1A0HB 1O2MA 1O5CB 2TPIZ 1DOJA 1SGCA 1UMAH 2GGVB 5C67A 2OBQA 1HAVA 1LHEH 2TGPZ 4GUXA 3TJUA 2ZQ2A 3KN2A 4B2BA 2JIZD 1VITG 1QL8A 4P02A 1ESTA 1P12E 5EJZA 5GIBA 2ZF0H 1OYTH 4DCDA 1YCPK 3BTGE 4AFSA 4MPUA 2GCHF 4WH6A 1DXPA 1O5FH 1Y3VA 1VKYA 4FU9A 2Y81A 2I6SA 2Y6TA 1UTJA 1EX3A 1GBLA 3PMBB 2FI5E 1S0RA 1A4WH 5FHTA 1O3HA 1P3EA 1PYTD 3F6UH 1OXGA 1D3PB 2JJ2D 4FUFA 2J34A 1AKSB 1SB1H 1AB9C 2A7CA 1C2JA 3SUFA 4WWYA 3ZZ9A 2SFAA 1A5GH 1GVLA 1WYKA 4TSFD 1EAWA 2RA3A 2GMTC 3M36A 1O5AB 5TCCA 1GJ4H 1NRRH 2XCNA 2WPHS 1CGJE 3ZZ4A 3TJVA 1F0UA 1TQ7B 2Z9KA 1O35A 1QFKH 1GJ9B 1ZYOA 1TONA 4Y10E 3QGNB 3RXBA 2M5TA 3FO8D 4INLA 1O3IA 2IJD1 4E05H 1L1GA 3VXEH 1C2FA 2Z6BD 1CVWH 1ZZZA 3NWUA 3MQKC 1QRXA 4YT6H 2D2DA 3LJJA 1QHRB 3RP2A 4BNRA 1E79D 2K8IA 2DE9A 1A5IA 2QXHA 5EGMA 3PB1E 1HJAC 2VIPA 3PWBA 4AB9A 1VCWA 4X0WU 2PR3A 3WWFA 5H4IB 2G00A 2OBOA 1GJBB 3ZIAD 2J2UA 1UTKA 2WPLS 3W94A 3SGQE 1GMDF 4ABBA 3SHCH 5F8TA 2O8WA 2HNTF 2FLBH 2F9PA 1FXYA 1LVYA 1OHHD 4LOYH 4JYUH 4WJG2 2KAIA 1SGEE 4Y0ZE 3Q3XA 3R3GB 3OX7U 3E16B 3LT3A 2BDAA 1PFXC 2PTNA 3B9FH 4FUCA 1CBWB 2TBSA 3RMLH 3BN9A 1J8AA 2Z94A 3DFLA 2QXJA 4FOUC 4ZAEA 2ZA5A 1TPOA 1PPHE 1W0JD 3DT0H 1XUFA 2FODA 2VWLA 1C1TA 3GCTF 2B7DH 1V2RT 3TVJB 1TX6A 1O30A 2L74A 2P94A 2LPRA 1XUHA 1EOLA 3ZZ5A 4FETA 2GV6A 3LGUA 4OGYA 2EY4C 3GOVB 1KTSB 9LPRA 4CH8B 3FFGA 3GY4A 1W14U 5K0HA 3A83A 3URDA 2A2XH 1GBAA 3RLWH 1KTTB 1GGDC 2EI8A 4BTUB 3FP6E 1YPMH 2UUYA 1GMCF 6GCHG 2L6OA 1DWCH 4MLFB 2W7SA 1LHFH 1V2ST 2D1JA 1G3EA 3FP7E 1Y3YA 4JZEH 3LC3A 2OC8A 4K1SA 3F9EA 6ESTA 3QTVH 3MH5A 2ZECA 3S9BA 3SW2B 1N6XA 2LELA 2QCYA 1YCPM 4I8GA 4ESTE 1SVPA 3A7TA 5J4QA 3A80A 3ZYDA 1WDIA 1OWDA 4X8VH 2VIDA 4YLQH 1RIWB 5A8YA 3SNAA 2VIQA 1O2JA 3BG4C 1Z7KA 2ZQ1A 4IMZA 1GDUA 2ZTZA 2GJGA 1H8DH 1S84A 3GDUA 1DXWA 1KIGH 5CHBA 4CBOA 4X1SU 4NZQA 3ATKA 1TA2A 1NS3A 1W0ZU 3A7YA 2RG3A 2Q6GA 4CR9A 1O5GH 1LO6A 1NFXA 2Y5HA 3OY6U 1VR1H 4HFPB 1O5BB 2I6QA 5F8ZA 3EE0B 3RXMA 3KQCA 1N8OB 1UCYE 2IN2A 3BTEE 3DA9B 3LC5A 1IQHA 1T31A 1V2KT 1F7ZA 2BDBA 2UUJB 1S85A 5FBEA 1A61H 3M5OA 1J17T 1RTLA 3RC6A 5CE1A 2VB0A 1IHSH 1MTUA 2EC9H 4AN7A 4TYDA 3SNDA 4LXBH 2R3YA 5SGAE 5EQRA 3RXQA 4K3JA 1GBTA 1E36B 3OTPA 1GHVH 2BX4A 1WAYB 1ARBA 1CSOE 1GHYH 1Y3XA 2ANMH 1DPOA 4XBDA 3UR9A 2SGDE 2ZTXA 3SZEA 3F2FA 1CT2E 1TALA 3U98H 4WY3A 1GDQA 1DDJA 2NU0E 2WUBA 3HGPA 4Y6DA 4IBLH 3STJA 3TNTA 3RXKA 1RJXB 5L6NH 2Z3EA 3EQ0H 4CBNA 3ZVCA 3VGCB 4H6SB 1Y5UT 2BVXH 2FWWA 4NGAH 5AFZH 1WTGH 1RIWC 3A7VA 3VB7A 1ESAA 4UD9H 2QIQA 1JXPA 1KDQB 4K1EA 1ORFA 2AGEX 2J38A 1T7CA 4BAMB 4RI0A 2ZFRH 1IQNA 1NU7B 2BD8A 1A0JA 4A6LA 3TK6A 2FEQH 1K1NA 1ETRH 3ZZ7A 3D49H 4NWKA 2VH6A 2R0KA 5A8XA 1C5MD 1PPGE 5EJ1A 1VJAU 3OEHD 1MU6B 4I86A 1G32B 2Z3DA 4FVBA 2HOBA 1GHAF 4UFFH 3VPKA 4FU8A 5T1VA 4U01A 4ZHMU 1AIXH 1SHHB 4B75A 2HLDD 3MI4A 1C1WH 2P59A 2Y5FA 1J16A 2ZU3A 4X2VA 1HDTH 1EOJA 4D9QA 2BD5A 2XBXA 2ZDNA 3UQVA 3OEED 1EZQA 4DOQA 1LMWB 1EAUA 5IK2D 1NFYA 1XM1A 2Y80A 1SLUB 4YTAA 1GHXH 1WQVH 1O38A 2BVSH 3ODDA 1THPB 2VWNA 1DT2A 2GT8A 2Q6FA 3PV2A 3I77A 1EP6A 3RXDA 2PV9B 2C3SA 4DGJA 4X6OA 1CE5A 2YOLA 3MFJA 1ZTKA 1UVSH 1ETSH 3EA8A 1ELFA 4MNXA 4X2WA 3UIRA 1HFDA 4TY7A 3P8OA 2ZHQH 2YMSB 1BMMH 1ZSJA 3CP7A 6CHAB 3F1SB 3FZDA 3SJ9A 4X8TH 3ATMA 3TJNA 4UDWH 1SSXA 1EJNA 1T8OA 4GSOA 4TT3D 4XOJA 1UTQA 3A87A 2GTBA 2FOFA 1N1LA 2XOKD 3LONA 2XC5A 1F0SA 1K1IA 4B6FA 1FPCH 2OQUA 4Z1MD 2AMPA 3MU0A 2NU2E 3M5NA 1QBOA 3SU2A 3GCHC 1C2EA 3E1XB 3TH3H 2FOCA 3V13A 1GBKA 2ZU1A 4K69A 1C1OA 4E7NA 3RXJA 2J4IA 1NM6A 2W6ID 3C1KA 4MNYA 1P10A 3E6PH 3CENA 3KQBA 4ABGA 2VJ1A 4O3UA 1LCYA 3VB4A 1C2DA 4AX9H 4ASUD 2ULLA 2R9PA 1KLTA 2DUCA 1T8NA 4NSVA 2P8OC 3GISB 4YO9A 2UUKB 1IAUA 4H42U 2ZDVH 3R0FA 5DSFA 3GY5A 3TGKE 1C1QA 2KFWA 3BTQE 1P2IA 3VGCC 3S0NA 3M7UA 2AYWA 5JB9S 1P09A 4MPXA 3GYMA 1KXDA 1BRUP 1QBNA 3OTJE 3U9AH 1O2TA 3FKSD 2QY0B 2RCEA 4YESB 2ZCHP 2C8ZB 3A85A 4I31A 2CJIA 2HRVA 3KIDU 1XXFA 1O2WA 1TRYA 2C8WB 2ZGJA 1EXFA 1K1PA 4KTCA 1HGTH 1O3FA 5EPNA 4FU7A 3ZZ8A 3KHVA 1SGYE 1OOKB 2PGQB 1QB6A 3C27B 1NC6A 4NIWA 3F0OA 3N7DA 3T26A 3SUDA 1NBME 3O8DA 1FNIA 3GDVA 1AD8H 1V2MT 3JZ1B 5GJ4B 4FUIA 3RXPA 4O3TA 3S9CA 3SV6A 5C17A 2P3TB 2XXLA 1BTYA 3E8LA 1O2UA 3PO1C 1OYQA 1ELEE 1YKTA 1H1BA 3SHAH 4AGJA 1BUIA 3MOCA 2P16A 4XFQA 1P57B 5C1UA 1H9IE 2ZPQA 1ACBE 3Q77A 1FY4A 2J5UA 2YMSD 3DFJA 3M5LA 4NA8A 4MPVA 2V3MA 3RXIA 1QY6A 5ABWA 3DD2H 1DWEH 1P05A 2BVRH 1ANEA 1S5SA 1UHBA 4MNVA 4O97A 1HRTH 4X8SH 2V0BA 2BD9A 2PKAA 2AMDA 4B2CA 1ETTH 1A0LA 1UO6A 1A7SA 1IQJA 1TGCA 4NFFA 5FPYA 1BBRH 1CT4E 4B73A 1AVXA 3LKWA 2ANYA 5AHGH 2ILNA 5F6MA 3UWIA 4F4OC 3HKJB 3PLPA 2P95A 2C8XB 2AHME 3PV4A 2BMGB 2FMJA 3RXEA 2ZTYA 3F3BA 1O2SA 4LZ1H 3MO6A 1S6LA 1QL9A 1GCTB 3QUMP 3U8RH 3LH3A 5LGOA 3MU1A 2O8UA 4KTUA 3A81A 4DIHH 3P17H 1K21H 2BXUH 1SPJA 2ZG0H 1TE0A 4OGXA 2P3UB 1HCGA 1MAXA 3LGWA 1ZOMA 1YCPH 2VINA 2FOHA 5EW2H 1XKAC 3DHKH 3ATLA 4X6MA 1T4UH 2EI7A 1J9CH 3ATWA 2OK5A 4A1VA 1EFRD 5GPIB 5EU8A 4F55A 2ZO3H 3SYJA 4B71A 2VGCB 1QIXB 2RA0A 4AB8A 1IOEA 5T6FA 4DVAU 1A5HA 1G36A 4VGCC 1FN8A 1GI6A 1GMDG 2YNAA 1ZHPA 4NFEA 4AZ2B 1P3CA 2H9TH 1HAPH 1O3MA 3EE7A 4AG1A 4B1TA 1P2NA 3GY6A 4U30A 1WXRA 2WYGA 5FPSA 5C5NA 1GBFA 1LPKB 8ESTE 1AY6H 1Z8RA 3HATH 1OWIA 3QO6A 2F3CE 2SGEE 1NRSH 4ISLA 4OS6A 3U8TH 4OM9A 1KDQA 1MZDA 3H5CB 1SGQE 4XBCA 3ESTA 1O2LA 2TGDA 3VG8A 1O3LA 3RMOH 2H6MA 1TGBA 3A8AA 1SLWB 1HAIH 5DP4A 3MU8A 1AVGH 2CMYA 4Y7BA 5T6DA 1OP8A 1SLXB 1TOMH 2W3KA 1P11E 4D7FA 2BY7X 1OWEA 2R3UA 3SV9A 3UNQA 3ZV9A 1RXPA 4UONA 1P04A 1UTOA 3T62A 5GDSH 1J15A 2JETB 1K1OA 1F92A 2FLRH 2BB4A 3RC5A 3S9AA 1YF4A 1BBRE 2ZGHA 4HZHA 1Z8JB 1EUFA 3I78A 1ABJH 1T4VH 4CRDA 1MU8B 3PRBA 3F2GA 1HXEH 4E7RG 1GJ7B 3ZVFA 4BXWA 3VFEA 3ZZAA 4Y8XA 2FTMA 3A88A 6GCHF 2ANKH 3N7OA 2AIPA 1ARCA 1IQGA 4DT7B 1LHGH 4FUDA 1K1LA 3EDXB 1P0SH 3AAVA 3K65B 2BDGA 1KYNA 1SKYE 1UJ1A 1WU1A 1JIRA 1Y3UA 3VXFH 1P03A 6CHAC 1ABIH 3M37A 3BIVH 1MBMA 3ZZDA 4AYVB 1NBMD 1ZMNA 1TRNA 5EXMA 3CS0A 1GMCG 2A7JA 1TRMA 2G5VA 1D3TB 1TWXB 1Q3XA 5B6LA 2XBWA 2FPZA 5BPEA 3S7HB 4WXVA 1FAXA 4Q63A 4SGBE 2CHAC 2XBYA 3MNBA 4JK5A 1X7AC 1GJCB 2UWOA 5L30H 1YLNA 1TYNA 1GJAB 1P2KA 2BY6X 2Y82A 2UWLA 3RXFA 4Q7YA 4IN2A 1SOTA 4LK4A 3RXCA 2Z9GA 1GMHF 3V3MA 1O3AA 1SOZA 3VB6A 3A7XA 4UEHH 1FX0B 4HI3A 1GG6C 4ZHLU 4MQAA 4IS5A 1TGTA 1BB0B 2QAAA 2V3HH 2ZDMA 5CHAC 4A1TA 4X1PU 1ZLRA 3W1EA 1MD8A 4IC5A 4CHAB 2G4UA 1V2WT 3B23B 1C5ZB 3K6ZA 1C5TA 2A5AA 1TBZH 2OQ5A 1O2NA 2OC7A 3KQDA 5DPAA 5AF9H 1SGNE 3FAOA 4JYTA 1YM0A 1WQSA 4RKJB 2BLWA 4WMDA 2GZ7A 4THNH 2FOGA 2Z9IA 3SNCA 1Z6EA 2WPDD 4Q4LA 4I8HA 5FX5A 2BD2A 1L4DA 3RLYH 3TK9A 3E0PB 1WCZA 3NXPA 1DANH 4D7GA 5T3HA 1HAOH 4Y71A 4ZMAH 1XX9A 3RM2H 3V7TA 1D6RA 2GKVE 5KECA 3UPEA 2VIWA 4DG4A 4DY7B 3QX5H 1S0QA 1YPHE 4RN6A 5JBTA 1O34A 4R8TB 3RM0H 1BZXE 1YYY1 5C1XA 3TITA 2EQNA 2GMTB 1K1JA 5DP8A 4BAQB 1L1JA 1GBIA 3ZVGA 1RS0A 1P9SA 1PQ5A 4ABAA 4Y8YA 5JPMH 4NIVA 5I46H 1C5NH 4OS1A 1GVZA 2A4OA 1C4U2 1T32A 1G2MA 3TK5A 3OFND 1QR3E 2BQ7B 4MG3A 2GT7A 1ZSLA 3AW1A 4Q80A 1DWDH 2ZFSA 4P00A 3U69H 4K1TA 2Z9LA 9ESTA 3SU1A 3ZVEA 5C0TA 1CA8B 1TLDA 2ZGXH 3MWIU 2TRMA 1GCTC 1SGRE 1O2HA 2V35A 2ASUB 1RD3B 1TNGA 1NO9H 5DO4H 1YLCA 2EI6A 3I29A 1JRTA 3RC4A 1Y5AT 1MTVA 1H9LB 1THRH 3AK5A 2J95A 5A0AE 3OY5U 3UFAA 2GCTC 2ZU5A 1DY8A 2PKSC 1HAZB 1EPTA 1CA0C 2KCOA 2JH0D 2A5KA 3FANA 3DSGA 1MQ5A 3SOSA 2BY8X 3K2UA 2XCFA 3GDSA 4XRNA 3RU4E 2EEKA 3SV7A 2RFKC 3GCHB 3STIA 3IG6B 3QWCH 3QTOH 4Y8ZA 3ZV8A 2OC1A 1SI5H 1V2NT 2VU8E 5C5OA 3M5MA 1G3CA 3ZVDA 1C1UH 4A5TS 5L2YH 3BTTE 3M7QA 1YGCH 1AUJA 3SU5A 2F91A 5HMAA 1NT1A 3GY2A 4INHA 1Z71A 1H8IH 3KF2A 1IQIA 4Q2KA 5FAHA 5E2PA 5EIYA 1MTWA 1LHCH 1O2GH 5FL7D 4ACAA 4J2YB 1HJAB 1H8ED 1W0YH 1UVPA 1FONA 1P06A 3MNSA 1FN6A 1GJ6A 1Q2WA 2BM2A 2BD4A 4ABHA 4ISHH 4X1RU 4K2YA 1BDAA 1COWD 1O0DH 2ZNKH 1O3EA 4CRAA 2H9HA 1F0RA 3A8DA 1UHBB 3P95A 3BG4B 1C1PA 3MTYA 1EASA 3P8NA 1EP5A 5IYTA 1P9UA 4CREA 2KAIB 1INCA 5EJLA 2D26C 2ZP0H 4FUBA 2WHXA 2JDID 3HKIB 3UAIC 1BMAA 1HUTH 1DUAA 2C8YB 1TPSA 1TBQH 1LVMA 1O2ZA 4TPYA 4CRGA 1UK3A 1SQAA 4JZIA 2AGIX 2OP9A 3MU5A 4MDSA 4CRFA 1QB9A 5IDKA 1HAGE 1BTPA 3HPTB 1Y5BT 1YPKH 3E3TA 2ZI2H 2ZFPH 2EA3A 5TCAA 3UOUA 1S82A 2PUQH 1QGFA 1P01A 1EAIA 2ODQA 8KME2 1CHOG 2FYQA 4FUJA 2OLGA 5T6GA 2F9BH 2BLVA 2J97A 2Z7FE 4TY6A 2V3OH 2B5TB 5DK1A 4RT1A 2JKHA 1OP0A 4ISIH 8LPRA 2JETC 1BMLA 1UCYH 2BLQA 3DSPA 1C1SA 1SHYA 4YXWD 1TAWA 3BF6H 5HM9A 1UVOA 2R2WU 3TGIE 1QA7A 3K9XB 1E37B 2HGTH 1BCUH 2HWLB 1YC0A 3BTFE 3SQHE 4MVNA 1ZPBA 5FPTA 3U1JB 1IHTH 2NU3E 1FUJA 1SFQB 1E38B 4XDEA 2XYAA 1L0ZA 5HM2A 3DCLA 1CGIE 3ENSB 1TMTH 1RRKA 1C9TA 2A4GA 3EA7A 2G8TA 3M3SA 3NZIA 1HAYB 1NY22 4ACBA 1O3KA 2OTVA 3LGTA 1GHAG 2ZFTA 2D8WA 1Z6JH 1A1RA 3F9GA 1VGCB 1GBCA 2XWBI 2AMQA 3M3TA 1SGFA 4INKA 1TNLA 1GMHG 3Q3YA 1QBVH 1GBDA 1XUIA 4O03A 1O2OA 1YPHC 4BAOB 1A3BH 1BQYA 2F9UA 1JIMA 2ZGBH 2TGAA 3SJIA 1C5OH 2FYRA 4UE7H 4DIIH 1HAVB 2FESH 5DP3A 1SGPE 2PUXB 4A1XA 3LJOA 1MBQA 5ETXA 1FV9A 2ZCKP 3M61U 2VBCA 2CF8H 2WPIS 2IPQX 1O2VA 4I8LA 4WH8A 1EKBB 2FP7B 4D9RA 2W6JD 4YZUA 4DT4A 4X2XA 4JYVH 5HYOA 4Z6AH 3RXVA 1GJ5H 1JWTA 3RUOA 3GCTG 1SGTA 1W12U 2ZDAH 4CRBA 5JBAS 3N7EA 2SGAA 4X1NU 2SNVA 3RXHA 3SZNA 1XVOA 1D6WA 2BDCA 2F83A 5EOKA 2FS8A 3UWJH 2BD7A 1S6FA 3L6PA 1SGFG 1T8LA 3T29A 2BZ6H 4RT0A 3SJOA 1V2UT 2PFEA 2BOHB 1TA6A 3P8FA 1F5RA 1F5KU 3BEUA 1NZQH 1YWUA 3ITIA 3TPIZ 1SC8U 3SU4A 5C3NA 1CU1A 3O8BA 2CN0H 1HBTH 4A92A 4AFUA 1EPTB 2QC2A 1XVMA 4ZH8A 3PTBA 1GI3A 3LGIA 2V6NA 1GL0E 2QYIA 5F53A 4ABDA 1QRWA 2SNWA 3AW0A 5C94A 3BSQA 1GI4A 1ZGIA 4AORA 1FIWA 1C2IA 3W95A 1C1MA 2KCPA 7KMEH 2F9VA 2AIQA 3MNCA 4X6PA 2HPPH 1ID5H 1ELDE 2FOEA 3H7TA 1MD7A 4NA9H 1UVUH 1KXFA 1SMFE 1N8OC 5E2OA 1CA0B 2AERH 2PWXA 4NWLA 5EODA 2HNTE 3T27A 1ZTJA 5C0UA 1YPEH 3TH2H 2WPJS 2Q6DA 3FP8E 1ESBA 2M2AA 1C5XB 2ANWA
chains in the Genus database with same CATH topology
1DICA 2ALPA 2O9QA 1MQ6A 3MHWU 4AOQA 1L1NA 1O2RA 4LZ4B 1O2IA 1W7GH 2VIVA 1MZAA 2Y5GA 3V12A 5A2MH 1HB0B 1DX5M 3NK8A 5E8EH 3RMMH 4I7YH 1FMGA 2J9NA 4IN1A 4BAKB 1MKWH 3A84A 1Y59T 3ODFA 1LHDH 1W13U 2G5NA 4UFGH 4BANB 2AFQB 2ZC9H 1DFPA 2BQ6B 4I32A 3BTME 5DP9A 3FZZA 1MTNB 4K5ZA 3KNXA 3P70B 1NRNH 1BHXF 2GDDA 1FY3A 1TMBH 2ZHFH 1LVBA 1BJUA 1GBJA 2HPQH 3U8OH 3ZZBA 1QB1A 5K7RA 1K1MA 4CHAC 2OC0A 2HLCA 3PYHA 2VNTA 4JZ1A 4FXGH 2C4FH 4HGCA 1KLIH 3RXTA 1HJ9A 2ZKSA 1BA8B 3RXRA 3SI4H 3SNBA 3T2NA 4E06H 2J92A 3H7OA 1V2PT 2PSXA 3RU4D 3ZYEA 3M3VA 3Q3KA 5DJ7A 1C2LA 7GCHG 5JYIA 3SJKA 1UTNA 3BTHE 4NZLA 1BBRK 3O8CA 1SR5C 1XUJA 3UREA 1BRAA 2BY5X 1EJMA 4IC6A 3URCA 4Q7ZA 5GWZA 1HYLA 2ZU2A 2XC4A 1L4ZA 1PPFE 1P02A 4ISOA 2A45B 1TX8A 2QF0A 2CF9H 3BEIB 2Y7XA 1C1NA 1CQQA 1D3DB 1VJ9U 3BIUH 4GHTA 1D3QB 1XKBC 2A2QH 3PWCA 1C4Y2 1Z1IA 4AFQA 5FBIA 1B5GH 2O8TA 4B74A 3GICB 5EXLA 1EZSC 1AHTH 3KQEA 4NSYA 2QXGA 4O9VA 1SG8B 1YP9A 5JBCS 1LKBA 1E34B 4Y7AA 1LKAA 2ZEBA 4HTCH 5F8XA 2K1QA 1ZRKA 1B0FA 4MPWA 5GCHF 1SFIA 1TFXA 2H5DA 4ABIA 1PQ8A 2DE8A 3BTWE 1MUEB 3U1IB 3Q76A 1NFWA 2FI4E 5DP7A 1DUEA 1FY5A 2FTLE 1QCPA 4TWYA 1MMJN 2QV1A 1GI5A 2SGQE 3SN8A 1O5EH 1N6YA 1SBWA 4WF8A 4X8UH 3ELAH 3QLPH 1M9UA 4BOHA 1O39A 4ZUHA 5DKMA 3RU4T 1TIOA 3KL6A 5AVDA 1AI8H 1AE5A 5EW1H 3PMHB 1PPBH 4DJZB 2QXIA 4CR5A 1TMUH 3LIWA 2PTCE 3RXLA 1BHXB 1H9HE 1LDTT 1G2LA 1JOUB 1E35B 3ATIA 2UWPA 3VEQB 2OD3B 4X1QU 4B2AA 1RTKA 4IMQA 2WPKS 4Y79A 1GI7B 1QQUA 1XXDA 1ZMJA 3SGAE 2OCVB 5FXLA 1WUNH 1WBGB 4TWWA 2PKAB 1FQ3A 4Y76A 1TNIA 1C5PA 1C4V2 1OPHB 2BDHA 4ZHAA 2GCHG 1GL1A 1DSTA 4CRCA 3EAJA 2R0LA 3A7WA 3F9FA 1S6HA 2BD3A 4U2WA 2TGTA 5LPEA 2OINA 4KELA 7ESTE 1Q31A 2A5IA 1GBEA 3LPRA 2XC0A 2BDYA 3P92A 1SL3A 1W8BH 1D9IA 3MO3A 5E0HA 3ZVAA 5J4SA 1UTMA 2B0FA 2WV5A 3M7TA 3GYLB 1XMNB 1FJSA 1AQ7A 2FIRH 2Z9JA 1AB9B 4U32A 5FX6A 4YOIA 4NIYA 2W3IA 1FY8E 4JZFH 1IQEA 1GBHA 3SUGA 1GHBG 1NTPA 1O3GA 1ZJDA 2R2MB 5EXNA 3P8GA 1E0FD 4ABJA 2ZU4A 1DLKB 3NCLA 2BHGA 1FLEE 1FPHH 1W10U 2WPMS 1O2QA 1TABE 4GAWA 3HK3B 1A2CH 3A8CA 1Z8GA 1C2HA 4YOJA 1SQOA 4NCYA 4I8KA 2H9EH 2ALVA 1SGDE 3SNEA 1AFQC 2FI3E 5AFYH 1GCDA 4X6NA 5A0CA 1CBWC 4YLUA 3TNSA 2H2ZA 7LPRA 1V2OT 1BTZA 2G52A 2A7HA 5ESTE 1PPEE 3GCOA 4FUHA 2HALA 5PTPA 2OXSA 1QJ7B 1O3OA 1ELGA 1NROH 3VB3A 1TNHA 4FUEA 1TOCB 1C5VA 3MH6A 3TJOA 1OSSA 1LPZB 1KLJH 2AEIH 4TPIZ 1MCTA 1BTXA 3GY8A 1GVKB 2A32A 1DM4B 1J14A 3IITA 2G81E 1L2EA 3KGPA 1V3XA 3S7KB 2BXTH 4DURA 3RDZA 3RXAA 3SU0A 3GCNA 1GBMA 2ZIQH 1ZSKA 3GY7A 2VVUA 1ZJKA 3WY8A 1FZZA 1UK2A 1TGNA 1ELVA 2JH5D 2BOKA 3UTUH 1S81A 2F9OA 1ELBA 1YLDA 3EGKH 1SQTA 1DVAH 4JCNA 4SGAE 1ZGVA 1GGDB 4KGAA 1VZQH 2BLOA 2FXRA 4AYYB 3O8RA 2GD4B 3ZZ6A 5E0GA 3T25A 5EPYA 3SGBE 4ZKOU 3RMNH 4K60A 1DLEA 2YNBA 3A89A 3A86A 1RFNA 1K9OE 1EATA 2TIOA 2Z3CA 1GHWH 1MCVA 3B8JA 1BTUA 3HK6B 1G3BA 3A82A 3PROA 2SGPE 4YOGA 1QTFA 1HV7A 4ZXXH 1AGJA 1BITA 1GHZA 1PJPA 5E0JA 2LNCA 1K2I1 3D62A 1NRPH 1QQ4A 2QF3A 5C1YA 3OSYA 4OS4A 1C2MA 1YPJH 3MNXA 2BTCE 1GBBA 1AUTC 1ZRBA 1DS2E 4K8YA 1UTPA 4FVDA 1Z8IB 1IQMA 4KP0A 1C5LH 1QJ1B 5JBBS 3E90B 4UFDH 2VVVA 5EQSA 3NPSA 3V0XA 1B0EA 1GDNA 7GCHF 1NESE 3NKKA 5L2ZH 5A8ZA 3AASA 1EB1H 1HIAA 4GHQA 1A46H 2GZ9A 2ZHDA 1ELTA 4K8BA 3OU0A 1MH0A 1G3DA 1O3JA 4YT7H 3E91A 2ODPA 2ZFQH 2G51A 2G4TA 2IPHA 6LPRA 1P8VC 4OS7A 1BIOA 3RXUA 1JBUH 4B76A 2ZPSA 1ANDA 5C2ZA 2ZWLH 5ESBA 1O2KA 8GCHF 3P6ZB 1OWJA 1WV7H 3L3TA 4ZXYH 1FIZA 3OYPA 2CHAB 2FX4A 4Y0YE 4MNWA 4I8JA 3NUMA 1V2TT 2GX4A 4X2YA 3LDXH 1LVOA 1C5UA 2AH4X 2OUAA 3FVFB 3G01A 3M35A 1GI2A 1OP2A 1ZR0A 3QGJA 4JZDH 2B8OH 1QRZA 1GI9B 1TNKA 1OKXA 1WTHD 1THSH 3AVZA 4WMFA 1C2KA 1DY9A 1RTFB 1TB6H 4NG9H 2CV3A 2A4QA 1GI0A 1UTLM 1Z1JA 1KXEA 1F5LA 2ZFFH 2ESTE 1YPGH 1QL7A 2W5EA 3TU7H 4QT8C 1VCPA 5JB8S 1GJ8B 1AFQB 2Q1JA 2F9NA 1WSSH 1C2GA 2FX6A 4CH2B 1EPTC 1OWKA 4R0IA 2BZAA 1FDPA 2ZGCA 4ZKNU 4OS2A 3F68H 2VWOA 1O3CA 1CHOF 4OS5A 1W7XH 1W11U 1NPMA 2VIOA 1DSUA 1NN6A 1ZTLA 2G55A 4H4FA 5FCRA 5LPRA 1AU8A 1C1RA 3LH1A 1C5YB 2O8LA 2FOMB 1Y8TA 2UUFB 2FOBA 1S83A 1G30B 2AGGX 2B9LA 4BTTB 1JMOH 5CMXH 1O3PB 2XWAA 4WMEA 3HGNA 3TLOA 1PQ7A 1BOQA 3L33A 1V2LT 1AZZA 1EJAA 4JK6A 1O36A 8GCHG 3CS7A 1SGIB 4WVPE 2HVXA 3PLKA 3PO1B 3SJ8A 1V2QT 5G4BA 3S69A 3SBKA 5A0BA 3A8BA 1YBWA 4GCHG 2JH6D 2GVFA 4RSPA 3MU4A 2A0QB 3BTKE 5DGJA 1BTHH 1LPGB 2IJOB 2VVCA 2W26A 3MH7A 4IGDA 1QURH 4VGCB 2BYAX 3QDZB 1B7XB 1AWHB 2ZCLP 1Y3WA 1JRSA 1P2MA 1NRQH 1ZPCA 4IW4E 1AZ8A 2GDEH 1UVTH 3UOPA 3QK1A 5DP6A 1VGCC 1V2JT 1HAHH 1O32A 5DP5A 3T5FH 2NU1E 3RXGA 1LTOA 1HJ8A 2FO9A 1VITF 1EZXC 1OS8A 3E0NB 1U6QA 1O3BA 3SU3A 5I25A 4Y11E 4Z0KA 2PSYA 1BMNH 3RXSA 5HXFA 1BJVA 1C5WB 1CO7E 1PQAA 1QNJA 4ASHA 3EA9A 4XSKU 4GVUA 1O2PA 4AFZA 1ZPZA 2PW8H 1W3CA 5BRRE 4WXIA 1EAXA 1MTSA 2A31A 1ANBA 2C90B 1O31A 2GV7A 1ZMLA 3MMGA 1LQDB 2PKSB 2WYJA 3PM3A 5TJXA 2SGFE 4J1YA 3SQEE 1FAKH 1F2SE 1KSNA 1O3DA 5A09A 1AKSA 3SV8A 1VCQA 2BDIA 2XW9A 3IWMA 1PPCE 4BAHB 2WV4A 5CHAB 5B6OA 4XE4A 2WINI 2IOTA 1K28D 2ODYB 2P93A 1VITH 1HAXB 1V2VT 1W2KH 2XBVA 2WUCA 3QN7A 4M7GA 2PLXA 4GCHF 4H6TA 1HLTH 4DW2U 3BTDE 4GLYA 1UCYK 3VB5A 3SUEA 1PPZA 3ZZCA 2AS9A 1K22H 2FDAA 4D8NA 3UQOA 3MH4A 5GXPA 3BEFB 1KXAA 1CGHA 2J94A 5JDUB 1NU9A 4PROA 1PYTC 5LPFA 3LU9B 1G37A 2QA9E 1MTNC 4GPGA 1TBRH 1XUKA 4Q7XA 1MKXK 2ZDLA 1IQLA 2PGBB 4UFEH 2BQWB 1EZUC 2CXVA 4I33A 2W7UA 1ELCA 1GG6B 3AAUA 2FZZA 1DITH 4AG2A 1KXCA 2GCTB 2QN5T 4RKOB 1FI8A 1EB2A 1AMHA 2QGRA 2STBE 1T8MA 1KXBA 4BXSA 1TX7A 2VWMA 1CT0E 1G9IE 1BTWA 3UY9A 1GPZA 1HIAB 1HNEE 1V6DA 3SI3H 5FCKA 4ZKSU 2NWNA 1IQKA 1RGQA 1GHBF 4NIXA 1C5RA 1C9PA 1CHGA 1GWAA 3ZVBA 2GZ8A 4KKDA 5LH8A 2C93B 1KY9A 1XUGA 1ELAA 3GY3A 4ZKRU 1DE7H 2HNTC 1YPLH 1MAYA 1TGSZ 4ABEA 3Q00A 2ZDKA 3SO3A 3PLBA 3LGYA 2ZPRA 1O33A 1AVWA 1HPGA 4F49A 1BT7A 3MYWA 4ABFA 1C5QA 2BY9X 3UNRA 3SU6A 4NA7A 2NU4E 3RXOA 4BTIB 4AGKA 1AE8H 3ZZ3A 4A7IB 2VGCC 2RDLA 2XTTB 1DWBH 1O37A 2ZZUH 3K6YA 1MKXH 1O3NA 5HGGA 3DUXH 3SV2H 1IQFA 2O8MA 4FUGA 1C1VH 1EQ9A 2VH0A 2XNIA 4MTBA 2GP9B 3T28A 4KTSA 1ANCA 1QA0A 1HXFH 3EYDA 2FS9A 1F0TA 3JZ2B 3TGJE 1ZHMA 2BX3A 1LQEA 1TQ0B 1WOFA 2A1DB 3BV9B 5EQQA 4YM9A 1BRBE 1GI8B 3TH4H 1OWHA 5F03A 3SORA 2A4RA 5C20A 1AFEH 1GI1A 2THFB 3QZRA 3PMAB 1ZHRA 5DG6A 1OX1A 3MO9A 3UNSA 1BRCE 2H1UA 2FM2A 4XBBA 1TPAE 1O5DH 3F9HA 4ZROA 2STAE 2P8OB 3BG8A 4JMYA 2Y7ZA 2CGAA 1P2JA 3KEEA 1A3EH 1AO5A 1TNJA 2FOAA 1QJ6B 3UR6A 3PTNA 1FY1A 3PMJA 3D65E 2ZHEH 1P2QA 1UK4A 1NFUA 1H4WA 1D4PB 1SLVB 2XRCA 5EG4A 5GCHG 1P2OA 3D23A 4D76A 1TPPA 1O2YA 1AWFH 3LOXA 3UUZA 2PHBA 3LGVA 3QZQA 3KCGH 1O2XA 1GJDB 2ZHWH 3TIUA 3A7ZA 4ISNA 1AN1E 1MKWK 2H5CA 2P3FH 1C5SA 1A0HB 1O2MA 1O5CB 2TPIZ 1DOJA 1SGCA 1UMAH 2GGVB 5C67A 2OBQA 1HAVA 1LHEH 2TGPZ 4GUXA 3TJUA 2ZQ2A 3KN2A 4B2BA 1VITG 1QL8A 1ESTA 1P12E 5GIBA 2ZF0H 1OYTH 4DCDA 1YCPK 3BTGE 4AFSA 4MPUA 2GCHF 4WH6A 1DXPA 1O5FH 1Y3VA 4FU9A 2Y81A 2I6SA 2Y6TA 1UTJA 1EX3A 1GBLA 3PMBB 2FI5E 1S0RA 1A4WH 5FHTA 1O3HA 1P3EA 1PYTD 3F6UH 1OXGA 1D3PB 4FUFA 2J34A 1AKSB 1SB1H 1AB9C 2A7CA 1C2JA 3SUFA 4WWYA 3ZZ9A 2SFAA 1A5GH 1GVLA 1WYKA 1EAWA 2RA3A 2GMTC 3M36A 1O5AB 5TCCA 1GJ4H 1NRRH 2XCNA 2WPHS 1CGJE 3ZZ4A 3TJVA 1F0UA 1TQ7B 2Z9KA 1O35A 1QFKH 1GJ9B 1ZYOA 1TONA 4Y10E 3QGNB 3RXBA 2M5TA 4INLA 1O3IA 4E05H 1L1GA 3VXEH 1C2FA 2Z6BD 1CVWH 1ZZZA 3NWUA 1QRXA 4YT6H 2D2DA 3LJJA 1QHRB 3RP2A 4BNRA 2DE9A 1A5IA 2QXHA 5EGMA 3PB1E 1HJAC 2VIPA 3PWBA 4AB9A 1VCWA 4X0WU 2PR3A 5H4IB 2G00A 2OBOA 1GJBB 2J2UA 1UTKA 2WPLS 3W94A 3SGQE 1GMDF 4ABBA 3SHCH 5F8TA 2O8WA 2HNTF 2FLBH 2F9PA 1FXYA 1LVYA 4LOYH 4JYUH 4WJG2 2KAIA 1SGEE 4Y0ZE 3Q3XA 3R3GB 3OX7U 3E16B 3LT3A 2BDAA 1PFXC 2PTNA 3B9FH 4FUCA 1CBWB 2TBSA 3RMLH 3BN9A 1J8AA 2Z94A 3DFLA 2QXJA 4ZAEA 2ZA5A 1TPOA 1PPHE 3DT0H 1XUFA 2FODA 2VWLA 1C1TA 3GCTF 2B7DH 1V2RT 3TVJB 1TX6A 1O30A 2P94A 2LPRA 1XUHA 1EOLA 3ZZ5A 2GV6A 3LGUA 4OGYA 3GOVB 1KTSB 9LPRA 4CH8B 3FFGA 3GY4A 1W14U 5K0HA 3A83A 3URDA 2A2XH 1GBAA 3RLWH 1KTTB 1GGDC 2EI8A 4BTUB 3FP6E 1YPMH 2UUYA 1GMCF 6GCHG 4MLFB 1DWCH 2W7SA 1LHFH 1V2ST 2D1JA 1G3EA 3FP7E 1Y3YA 4JZEH 3LC3A 2OC8