2NU4E

Accommodation of positively-charged residues in a hydrophobic specificity pocket: crystal structures of sgpb in complex with omtky3 variants lys18i and arg18i
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B, Proteinase B
publication title Accommodation of positively-charged residues in a hydrophobic specificity pocket: Crystal structures of SGPB in complex with OMTKY3 variants Lys18I and Arg18I
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase
total genus 50
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nu4E02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nu4E01
1AFQC 1XKBC 1UJ1A 1ZJKA 3A8CA 1EAWA 3F6UH 4H6SB 4J2YB 1O3GA 3JZ1B 1P0SH 1RTKA 1TIOA 6GCHF 2ZU5A 1UVUH 1OP0A 4AG1A 1IAUA 1SFQB 1O32A 2KAIA 5DP3A 3V12A 1TE0A 1P04A 1YPJH 3MO3A 3R0FA 1VITG 1D4PB 1QY6A 3B8JA 2RA3A 1MMJN 1F0UA 3LPRA 2QGRA 2Q6GA 1OP8A 5C5OA 1ESAA 1FDPA 3NWUA 5FXLA 3GYLB 1QGFA 3VB7A 2SGFE 1T32A 1O5BB 3TK5A 4TWYA 3SGAE 1EPTC 1JWTA 4AGJA 2HRVA 2G5NA 1YM0A 2XC0A 3SU4A 5EXMA 1AUJA 3A82A 5ABWA 1SSXA 3TITA 1TRMA 2LPRA 4ZHMU 4U01A 2CV3A 1B5GH 2EI6A 4I33A 3QX5H 1AUTC 1C1NA 5FX6A 1LPGB 2ZFSA 1FONA 1GI9B 1S85A 3ZZ9A 1ELBA 3RXDA 4B74A 3PMAB 1DPOA 1UMAH 2BD2A 1ANCA 1CSOE 2FOBA 3S9AA 3HKJB 3P8FA 1FY3A 1AB9B 1SGRE 4JYUH 3A89A 1UVOA 1CHOG 3T29A 1RIWB 1ZMJA 2ZPQA 4OS7A 1HCGA 3V7TA 4ABJA 4X6OA 3L6PA 3VGCC 5JBTA 3A7XA 1GJDB 4NZLA 3MH6A 1EP6A 5FCKA 2O8MA 1YPMH 2ZA5A 4MQAA 2GDEH 1SGQE 3OSYA 5AFZH 1ETSH 1EZXC 4Q2KA 2O8UA 1QB1A 2I6QA 1K1OA 1RXPA 2OCVB 5T6DA 4OS6A 1HJAC 2BD4A 1BMMH 1QBNA 1AN1E 1KXCA 3BIUH 5ESBA 2F9UA 3DHKH 2QYIA 2VU8E 4RSPA 4UDWH 1C9TA 1T8OA 2STAE 3RU4D 3RXHA 2ZDAH 2WV5A 3F1SB 1ZSLA 4GSOA 3ITIA 1FPCH 1YP9A 1MU8B 1C5UA 1N6YA 4CR9A 2J38A 3ZVEA 5A0AE 1UK3A 4H4FA 2JETB 2NU0E 3U9AH 5L30H 3VEQB 1VGCB 1SQOA 4B73A 1O3KA 2BY9X 4IBLH 4YO9A 3ZZ7A 2A7JA 2Y7XA 5DK1A 1QL8A 2HOBA 2P16A 3K2UA 1V2JT 1LMWB 1GI5A 3ELAH 1HXFH 1MKXK 2SGDE 4ZXYH 1SGTA 1Z8JB 4O3TA 1C5XB 1E34B 1P05A 4ZH8A 1O5GH 2BLWA 3PWCA 1PPHE 5EGMA 1YYY1 4J1YA 5K7RA 2C93B 1OS8A 2H5DA 1EZUC 1GJ5H 1QRZA 1WQSA 5GCHG 1W12U 1CGJE 1SQAA 3HGNA 2Q6FA 1PQ5A 3EYDA 3QK1A 1TRYA 5L2ZH 2ODQA 2A7CA 2XWBI 3LGIA 1O2MA 2R3UA 3NPSA 1AZ8A 2W26A 5LH8A 1QB9A 1SHHB 3BEFB 3RU4T 1GJBB 1MTWA 2OTVA 1LKBA 4JK6A 3DD2H 4NIVA 1C5SA 2WUBA 1ZTLA 1FNIA 5PTPA 2PGBB 3M61U 2SGEE 3ZV9A 1VITF 1P9UA 2BDIA 5JDUB 1O3MA 3QZRA 3SN8A 1Y3VA 2EI8A 1QTFA 3E16B 1TQ0B 1PYTD 3OY5U 1P9SA 3SO3A 2F9OA 3T62A 2V0BA 1D9IA 1S81A 4IC6A 6CHAC 2ZGHA 4UFGH 1SGCA 3GYMA 1JMOH 3SV8A 3SU2A 4FUJA 5DP4A 1HPGA 2B9LA 1TNLA 4AB9A 3RXSA 2UUFB 5GPIB 1YPHE 2A5KA 1Y3YA 5SGAE 2FLBH 3BEUA 3GCTG 3U1JB 2FS9A 3GOVB 3ENSB 3D49H 2AFQB 1EB2A 1XVOA 1GBEA 1UCYH 4NSYA 2BY7X 3MU0A 3TH2H 3U8RH 1C2GA 2VIDA 3UWIA 4B1TA 1GGDB 1CHOF 1RS0A 1V2LT 3M5OA 1F0TA 4OGXA 1INCA 1QRWA 1C5RA 2ULLA 8ESTE 2ZI2H 2FDAA 3GDSA 1NFWA 1HJ8A 3D62A 2GDDA 1QBOA 3F9HA 3S0NA 4X6NA 3EAJA 1UCYK 1DT2A 2FESH 1LHFH 4IW4E 1BCUH 4JZEH 3RUOA 3EDXB 3STJA 4XDEA 3BIVH 1MCTA 4UONA 3E6PH 4FUIA 1J16A 3H7TA 2Z9LA 1P8VC 3A83A 1C1QA 1MTVA 3SUDA 4JMYA 1GI7B 1GCDA 3EE0B 4WXIA 2CN0H 1W2KH 1F92A 2TGPZ 5GWZA 4FVBA 3RM0H 3BEIB 1T4UH 1MTSA 1TNHA 1AVGH 1SPJA 2BMGB 3FVFB 1P01A 2FOMB 4BTTB 1EAUA 4AGKA 1GHVH 1O38A 2BDYA 1NS3A 3UR6A 2FS8A 4XOJA 3ODDA 2R3YA 2G4UA 5E0GA 2ZFFH 1TB6H 1ZHMA 4AYVB 1AGJA 4DOQA 2VIOA 1HBTH 1J14A 1VITH 1PQAA 4YZUA 2QC2A 1JBUH 1GL0E 1WV7H 2ZHDA 1FLEE 1K21H 2ZDVH 5FHTA 1GDQA 2NU3E 2ZFTA 2PGQB 1C5NH 2OXSA 1JIMA 1FAKH 2ZO3H 1DWEH 2D26C 2O8TA 3P95A 2BZAA 5A0CA 1IQNA 1UTKA 2THFB 2OUAA 3K6YA 4FU9A 3UR9A 2GP9B 4NA9H 1EAXA 5JBBS 1IOEA 2A4OA 1QL9A 1EASA 2ODYB 3RDZA 5HGGA 1GI3A 4JZIA 1ZSJA 2BD9A 4BAOB 4X1QU 2VNTA 3ZVDA 1UHBB 1AKSB 1V2TT 3BTFE 4ZROA 2C90B 2F9BH 4CRAA 3SNBA 4WMEA 2G4TA 1GBLA 4BXWA 4FU7A 5E0HA 1A3BH 1O3PB 1DX5M 3P8GA 1N1LA 5ETXA 1ZRKA 1HIAB 1TOCB 2V35A 2HGTH 1F7ZA 2BX4A 1GG6C 1ZRBA 1O2RA 1CU1A 1GMDG 5J4SA 1QR3E 3RXLA 4GLYA 4E06H 1JIRA 1C5TA 2UWPA 1BTYA 1W7GH 4MNXA 2CMYA 3GY2A 1YPEH 1GMHG 4YOGA 1ZJDA 2XCFA 1DUAA 3SQHE 3PM3A 3PV4A 2V3HH 2UUJB 1J8AA 2B0FA 4ABEA 1T8LA 2H6MA 1TWXB 1ANDA 5IDKA 5EW1H 3N7OA 1MBMA 1C1VH 1BITA 2OBOA 3F68H 4I8KA 4ISNA 2PW8H 3ZYEA 4LZ4B 3SW2B 4YLUA 1ABJH 3E0NB 3GCTF 4XFQA 2ZPRA 1KY9A 2PKSC 5EPYA 3VXEH 2TGAA 1FAXA 1TPSA 1CHGA 2BB4A 2VH6A 3GCNA 1C5MD 6GCHG 4CRBA 4YTAA 4LK4A 2J4IA 4WJG2 1A1RA 1C2MA 4TPIZ 2FOAA 1ELAA 2XYAA 2A5AA 4NFFA 5EQQA 5JPMH 2AH4X 1J9CH 3SJIA 1C1RA 1O5DH 1BA8B 3ZZ3A 3UNQA 5F8XA 4DJZB 3SV2H 3HATH 2BXUH 1L1JA 2BDHA 1O2YA 4X8VH 1GBHA 1H4WA 1O39A 1TQ7B 4K1SA 2ZU4A 7KMEH 1A7SA 2OINA 2TGDA 2VH0A 3ZV8A 1P2IA 4INKA 1A0JA 4ZKOU 3SGQE 2AMDA 4QT8C 3GCOA 2A45B 2ZU2A 3RXGA 1KTSB 2FP7B 3SI3H 1E0FD 3GY5A 3UWJH 3JZ2B 4NA7A 3MNBA 1MAYA 1ZR0A 3BTDE 1ZTJA 1G3DA 1BRCE 3LU9B 2PSXA 4AZ2B 1VZQH 4ABBA 1G3CA 3M5MA 2BD5A 1AB9C 3AASA 2ILNA 1C1SA 1RIWC 1AHTH 1SOTA 2VINA 2VWMA 3CS7A 3KQCA 3RMOH 4MVNA 3RXFA 1Z7KA 3ZZAA 1MKWH 1O0DH 1OWIA 1ACBE 4XE4A 1S6HA 2G5VA 2ZDMA 2W5EA 1E38B 3F9EA 4MNWA 4TYDA 4JYTA 5C67A 3Q76A 2C8WB 2BQWB 1DXWA 2OC0A 4DIIH 5H4IB 1EZSC 1V2KT 3LH1A 4FUBA 2HVXA 3BSQA 4KTSA 3L33A 3RXUA 4B2AA 2Z9GA 1DFPA 1U6QA 2BLVA 3HK3B 1HAXB 1O2KA 4ZKRU 4UFEH 1MH0A 3ATIA 3SU0A 1Y8TA 3VB4A 3SJOA 4Z6AH 1MKWK 3Q77A 4ZUHA 1TX7A 1Q3XA 4Y8ZA 1C1OA 1O3BA 1UCYE 1E37B 1OWJA 2ZF0H 1X7AC 3V3MA 4DT7B 2CF9H 1SQTA 5DKMA 1S0QA 1Y3UA 3LGVA 1XUIA 4CBNA 1LHEH 1AVWA 2AERH 3RXIA 3LC3A 1UVTH 3U1IB 2JETC 1VGCC 1Z6JH 1GHYH 4INLA 4XBCA 5DJ7A 1PQ7A 4CRFA 3V13A 1Q2WA 4WY3A 1GMDF 2EC9H 2Y6TA 2ZGBH 1FIZA 1L4ZA 4CR5A 3GCHB 3SNEA 5JB9S 4YT7H 1H9IE 4JK5A 2ZCHP 2ZTYA 2QXHA 2ALVA 4I8LA 1NT1A 3A7ZA 1NRQH 3KN2A 1O3IA 2ZTZA 1TLDA 1LQEA 1M9UA 1K1LA 2R9PA 2VB0A 5IYTA 3A8AA 4JZFH 4ASHA 1S0RA 1D3QB 1NTPA 1XMNB 3LJJA 1KDQB 3GY3A 2A2QH 3GISB 1RRKA 1YLCA 2OBQA 1QQ4A 2FMJA 2CF8H 2Y81A 3Q00A 4IMQA 2BQ6B 5K0HA 4BXSA 3IITA 7ESTE 1T31A 1S84A 3UUZA 1C2DA 2Z3EA 1MU6B 4NWKA 3BTTE 4GVUA 5I25A 4OS1A 4IMZA 3LGTA 2Q6DA 1K1PA 1G2LA 3H7OA 2GCHG 7GCHF 1O2ZA 2A4GA 2PR3A 2TIOA 1DICA 3R3GB 1CBWB 4NIXA 1XX9A 4K60A 4X8UH 1P02A 1GI6A 1Y3WA 1O2JA 3QUMP 3UOUA 1YLDA 4D7GA 2ZNKH 3RMMH 2BHGA 4GHTA 3C1KA 2FOEA 3TVJB 4B2BA 1GI0A 2NU1E 1EX3A 2GGVB 4IGDA 3FP7E 2XTTB 3KGPA 5C1XA 3K6ZA 1P03A 2B5TB 3ZZDA 1YKTA 3OTJE 4GPGA 1GBJA 3M7QA 1O3OA 5DO4H 1WTHD 4K5ZA 1TOMH 5HYOA 1AO5A 1G3BA 3HPTB 1FN6A 1EPTA 2XRCA 1H9LB 1NPMA 1EOJA 3M3VA 4F49A 1ARCA 1DXPA 1O2LA 1GJAB 4NGAH 1JRSA 2W7SA 1O37A 1SVPA 1GMCF 2PTCE 4X2WA 4UD9H 2Z9JA 1KXAA 4D7FA 1EJNA 4UFDH 3UQOA 1GGDC 2ZQ2A 4KTUA 5L2YH 2FX6A 3ZVBA 3SZNA 4JZ1A 3RXVA 1QCPA 2VVUA 1DUEA 1TBRH 1BMLA 2BM2A 2CXVA 2P3TB 5GJ4B 1CE5A 5T3HA 1QJ1B 2WPMS 2SNWA 2UWOA 1THPB 4UFFH 1W11U 1PPZA 5BRRE 3RXRA 5CMXH 2OD3B 3A88A 1YF4A 3I77A 5E8EH 3PB1E 5F03A 4ZXXH 1ELTA 1O3FA 3MH5A 3RLWH 3SGBE 2GT8A 1KYNA 1Z6EA 4ZMAH 4NG9H 2ZFPH 2Y5GA 3ATMA 2BQ7B 2ZU1A 1GHZA 1EKBB 2BTCE 3K9XB 1BZXE 1P12E 3SNAA 1LCYA 4Y0ZE 3T26A 1SLWB 2GVFA 3URDA 1MTUA 2G00A 5L6NH 2W7UA 4A1XA 1UO6A 5FBIA 3L3TA 3PO1B 4I8GA 3RC5A 5LPRA 1L0ZA 1NRPH 1Y5UT 1BDAA 1EAIA 1W14U 1EXFA 3TJUA 1LPKB 4IN2A 4HGCA 2IJOB 5LPEA 1QIXB 3UQVA 1EOLA 2YOLA 2ZECA 1XUKA 5C2ZA 2A0QB 1QJ7B 3BV9B 3UY9A 3OX7U 1H1BA 4A92A 3F9FA 1GJ8B 1PQ8A 1T4VH 1V2WT 3P92A 2WPHS 4KGAA 4HZHA 2BD3A 1MAXA 1QQUA 1C4V2 2YNAA 4Y8YA 1C1UH 1NC6A 1W8BH 1ESBA 2CHAB 5FPTA 3M7TA 1MTNB 2ASUB 3SQEE 3BG4B 3SUEA 3SNCA 2SGPE 2G52A 2ZP0H 3B23B 3PMHB 3WY8A 1GI8B 1FI8A 2RG3A 1E35B 1J17T 2HWLB 4DCDA 3SHAH 1QRXA 5E2OA 2VIQA 2V6NA 4VGCB 2ZIQH 4FUDA 5FPSA 3O8BA 1GBFA 1TBQH 3RXKA 3MU4A 3T28A 3I78A 1YCPH 3RC4A 1AKSA 1P09A 2GCHF 2P59A 4CRDA 2KAIB 1SOZA 5DPAA 1O2XA 1AFQB 1PPFE 3W95A 3AAUA 1RTLA 3LONA 1O2IA 3SU6A 5T6GA 3RMLH 1HIAA 1V2PT 3A85A 1TMUH 2VWNA 1F5LA 1LVMA 4ABDA 5CHAB 1YCPK 3ATKA 1FN8A 2UWLA 2D2DA 2A4RA 5DP6A 4O97A 2FIRH 1AIXH 1IHSH 3NCLA 3DFJA 1K22H 1O5CB 4ZAEA 3MNSA 3MH7A 4KELA 1S83A 1BIOA 1MZAA 3MO6A 3AAVA 2P93A 1K2I1 1DS2E 4HI3A 3T25A 3SOSA 1A61H 4DGJA 4LOYH 1C5PA 4X8TH 3O8DA 1C1PA 1GHWH 1UK4A 4CHAB 1THRH 3PTBA 1IQIA 4ESTE 1SGIB 1O3DA 5HM2A 1MD8A 1KLTA 1HJ9A 1ZZZA 2Z94A 4AFQA 2IPHA 2ZEBA 1TALA 2BDBA 2J92A 1FUJA 1FY1A 2ALPA 5BPEA 4WVPE 4XSKU 3U98H 3RXBA 3A86A 1EJAA 3U8TH 1JOUB 3AW0A 2FI5E 3SU3A 5A2MH 2B8OH 1G9IE 1SLUB 1MBQA 1G37A 4Q80A 2P94A 2QXGA 1EZQA 1GI1A 1Y59T 2SFAA 3UOPA 1UTNA 5C5NA 3A7TA 1FY8E 4Y8XA 5AVDA 1EQ9A 4FUHA 4F4OC 4FUFA 3LH3A 3RU4E 5GDSH 1L1GA 5E2PA 5JYIA 2VWOA 2PV9B 1O2OA 1ANEA 2FOHA 1S82A 4AG2A 2OP9A 1AY6H 1Y3XA 3RP2A 3T2NA 2ZU3A 5AFYH 1PYTC 3I29A 1IQKA 1O2GH 2UUKB 1GVLA 5DG6A 4WXVA 1C5LH 1AZZA 3A8DA 1DLKB 1HAVA 4YESB 3LJOA 1GJCB 2STBE 4YOJA 2ZDNA 1DLEA 1RTFB 1P2KA 1SLXB 1PJPA 1F0SA 3RM2H 1AU8A 2C8XB 4U30A 2ZC9H 4TY7A 3SUFA 2WPKS 5F6MA 3PYHA 1WOFA 5TCCA 2R0KA 1SFIA 2ZCLP 4MLFB 4CREA 1D6WA 1QBVH 3MMGA 1O2PA 5B6OA 1JRTA 1O3JA 3TH4H 1SGFG 2BDGA 2QY0B 2BOHB 3M5LA 1TRNA 1BMNH 1D6RA 2J2UA 3MOCA 5A0BA 1HB0B 2G55A 2GMTB 2Z7FE 5A8YA 2W3IA 1HNEE 1HAHH 3TLOA 1A2CH 2QA9E 1IQGA 3SV6A 3ZZ4A 1F5RA 1A5HA 2AMQA 2HPPH 3T5FH 1O2SA 1A5IA 4A1VA 3RXCA 1SLVB 2W3KA 2XC5A 3TJNA 4DY7B 2WPLS 4MPUA 1FJSA 1TPOA 1FV9A 1SG8B 1IQJA 1V6DA 2ZGXH 2ZHFH 5EPNA 1K1MA 2J34A 1C2JA 1LHDH 3ZZBA 1XKAC 3G01A 4H6TA 1YPLH 3GCHC 3LGWA 1Q31A 1F0RA 4ZHAA 1WQVH 3A81A 3M5NA 4ISLA 5GIBA 2FOGA 2P8OB 1O3CA 1ETRH 5TCAA 1Z8RA 2FXRA 3CS0A 1D3TB 3PTNA 3SJ9A 1CO7E 2PSYA 1Y5AT 1BJVA 2FWWA 4DIHH 1DITH 1V2RT 1GJ9B 2H9TH 3GDUA 1HFDA 1NFXA 1QL7A 4XBDA 4THNH 2SNVA 1A5GH 5CE1A 1DY9A 1ZPCA 2RDLA 2Y7ZA 3TGKE 2R2WU 1TYNA 3MU8A 1BTUA 1C4U2 2BZ6H 2FM2A 3BTWE 4U32A 4BNRA 1TNGA 2H2ZA 1HDTH 1TNIA 2GX4A 1FPHH 4X1NU 3SJKA 3QGJA 1MD7A 2HNTF 1GBKA 3VB3A 7GCHG 3QGNB 3A7VA 2ZG0H 4MPXA 1OWKA 3MNXA 1YPKH 4BOHA 1CBWC 2J95A 2WINI 2XBVA 4FU8A 4IC5A 1A0HB 3TIUA 3ZZ5A 1YC0A 2A31A 3TJVA 2H1UA 5FBEA 4K2YA 3UTUH 2AEIH 1EP5A 1O2TA 3FZZA 3KF2A 2G81E 2HPQH 2JKHA 1BTZA 4BAQB 4ABHA 3ZZ6A 4CBOA 3FANA 3MHWU 3KIDU 4AFZA 4NSVA 2PTNA 2ANYA 3MU1A 3KL6A 4R0IA 1W7XH 4UE7H 2WPJS 1LTOA 1GMCG 4Y0YE 5DP5A 1XUFA 4E7NA 4PROA 3BTGE 1AQ7A 3MYWA 4K8BA 1OP2A 4TY6A 2F9VA 3O8RA 3M3TA 5LPFA 1BTXA 3EA8A 1O2QA 4B71A 4OS4A 4DVAU 3STIA 3KQDA 1OYTH 3ATWA 2BD7A 1G2MA 4X2YA 1SGDE 3M35A 3S69A 2VIWA 1ZHPA 3FZDA 1SBWA 2ZTXA 1VCQA 4HTCH 2BXTH 1FY4A 1AE5A 3TNTA 3IG6B 2SGQE 2XBYA 5E0JA 1EJMA 1ZTKA 3DT0H 1WUNH 3LGUA 5F8TA 3TK9A 4B76A 1O33A 2IOTA 1AMHA 1W3CA 3HK6B 4IS5A 1P2OA 2DE9A 1SGEE 5LGOA 1O3NA 1CT0E 2ZGJA 3A7WA 5DP8A 1OPHB 1O3HA 3NXPA 3SV7A 4WH8A 4X0WU 1BJUA 1MCVA 4KKDA 4ZKSU 3GY8A 1NRSH 3E8LA 1LO6A 5HMAA 1CT4E 1HV7A 1L1NA 4JZDH 1T7CA 3PLKA 4JCNA 1VJ9U 5EW2H 1TGTA 4JYVH 3PO1C 1FY5A 1OX1A 1O5FH 3QWCH 4D8NA 1O2WA 1O5EH 4K69A 1ARBA 1GCTB 4TWWA 5GXPA 2BDAA 2QN5T 2TRMA 1G32B 1T8NA 2WYGA 1G30B 6LPRA 4OS2A 1W0YH 1XUJA 1GL1A 2BLQA 5EOKA 2PKAB 5C1YA 2D8WA 2DE8A 2PLXA 1GDUA 2GT7A 5JBCS 2P3FH 1HLTH 2ZHQH 2Z3DA 2BDCA 4AB8A 2YNBA 1EB1H 3MO9A 5EXNA 3M3SA 3S9CA 1TPAE 1KLJH 3BTME 2FI3E 3MFJA 2FO9A 2DUCA 4NWLA 2K1QA 4BAMB 2V3OH 4MPWA 1MTNC 1DWDH 3BG4C 3KEEA 4A1TA 1C2HA 1ETTH 2RA0A 4BAHB 4RN6A 3BF6H 3RXMA 1RGQA 4BAKB 2XBXA 4I31A 2EI7A 2A5IA 4TPYA 4VGCC 3PROA 4B75A 1C2LA 2D1JA 1MUEB 1HGTH 1AWFH 3P6ZB 1ELVA 2AGEX 1YCPM 1VCPA 3SHCH 1NRNH 1O2VA 1QJ6B 4I32A 1ZPBA 2OLGA 2VGCB 1SI5H 4OGYA 4SGBE 2Y5HA 4I8HA 5F8ZA 4A5TS 1HAIH 2O8LA 1IQFA 5JB8S 2Z3CA 3U69H 3UREA 3ZVAA 2ZCKP 4WF8A 2B7DH 4B2CA 3VFEA 5CHAC 5C3NA 1TA2A 1C2IA 2AGGX 2H9EH 2VVCA 1FMGA 3RLYH 1Z1JA 4O03A 3LKWA 2OQUA 3FP6E 3RMNH 3PWBA 1BOQA 2O8WA 1VR1H 1HAGE 1BTHH 3GY7A 2FOCA 4IN1A 1O2UA 3M36A 3U8OH 4Y79A 1LVBA 1V2VT 3NKKA 3RXTA 2QAAA 1N8OB 3KHVA 1S5SA 1V2NT 1UTMA 1C1MA 4CHAC 1O3LA 2JH6D 3EQ0H 5DP7A 2Y82A 5FCRA 1FZZA 2IN2A 3D23A 3OU0A 5TJXA 1P2QA 3AW1A 2XNIA 3A84A 1MQ5A 5DP9A 3ESTA 1TX8A 2A7HA 1GWAA 9ESTA 4SGAE 1LVOA 3BTHE 1BRBE 2J9NA 3BG8A 2G8TA 2ZHEH 1VCWA 1V2OT 1P11E 5C20A 2XWAA 4YT6H 4NA8A 1S6FA 1WYKA 1UTJA 1A4WH 3GY6A 4FUEA 4Q7XA 3LC5A 4GUXA 1DE7H 4ABGA 2FPZA 5FPYA 2QV1A 1PPCE 4DG4A 3BTQE 1O3AA 1OYQA 2ZFQH 1PFXC 1ANBA 1N6XA 2UUYA 4MDSA 1OXGA 3P70B 2Z9KA 2BX3A 5A8ZA 1BMAA 1BRAA 2A4QA 3CENA 3RXEA 2H5CA 4AN7A 4D9RA 1BQYA 2GD4B 4WMDA 1GVZA 3C27B 2VIVA 3FP8E 1DSTA 4GCHF 2AMPA 5A09A 2GTBA 2BVXH 9LPRA 2CGAA 2O9QA 3E90B 4FVDA 1GPZA 3NZIA 2GCTB 4X6MA 1GVKB 1T8MA 2F9PA 2C8ZB 2GZ8A 2QCYA 1HAZB 1MKXH 5EQRA 3MI4A 4MNYA 1NESE 4BTUB 1HUTH 1QA7A 2F3CE 1EATA 4Y76A 3SBKA 1NM6A 3Q3YA 1GHXH 1CT2E 2HNTC 1ELEE 1KXBA 1TGNA 1WBGB 1WSSH 1YGCH 2LNCA 1MQ6A 1TNJA 1ZYOA 1O31A 3D65E 3OY6U 1XVMA 4FUGA 4YOIA 3BTKE 4D76A 1CA0B 4X2XA 1OWHA 2AIPA 4CRGA 5G4BA 2BVSH 3DUXH 2FX4A 4I8JA 3W94A 3MU5A 1K1JA 1L2EA 2ZQ1A 1YPHC 1B7XB 3A8BA 5EQSA 2ZGCA 3VB5A 8GCHF 2GMTC 1OOKB 4YM9A 4WMFA 1A46H 2NU2E 2ZWLH 2Y80A 3DA9B 2TPIZ 4NIWA 4HFPB 1RJXB 3QTOH 1K28D 4H42U 2GZ7A 4Q7YA 3QLPH 1TONA 4AFSA 3ZVCA 4X8SH 3LT3A 1O34A 2GV6A 2QF3A 1UHBA 1FIWA 3EA7A 4NZQA 1GDNA 1TGBA 3A7YA 1GHBG 1PPGE 1O2NA 3QDZB 1GJ7B 1ORFA 4UEHH 3SUGA 1KXDA 2NU4E 4E7RG 3QTVH 1V2ST 2C4FH 3E3TA 2RCEA 3IWMA 3VXFH 2I6SA 3RXAA 2EEKA 1CVWH 2ZKSA 1SMFE 4MG3A 1GBIA 2P8OC 3VB6A 1BTPA 4I7YH 4O3UA 1F5KU 3RC6A 1NU9A 2EA3A 3S9BA 4CRCA 4A7IB 1O36A 3SV9A 2M5TA 1H9HE 2ZHWH 1EPTB 4Y10E 4AOQA 1Z8GA 2HNTE 2PFEA 2R0LA 2ZPSA 3PLBA 3ATLA 1GBDA 1DOJA 4ISHH 2VVVA 1GBCA 1HXEH 2H9HA 1NO9H 1TA6A 5JBAS 1B0EA 1GBTA 1SGFA 1TMTH 1XXFA 3QN7A 4X6PA 2ZDKA 1OWEA 2Z6BD 5EG4A 1DY8A 3SORA 1WTGH 3LDXH 3GY4A 3NUMA 1GBAA 4DURA 4WH6A 1PPBH 3TPIZ 1WU1A 1O35A 3FFGA 1A3EH 1GJ4H 1LHGH 1K1NA 2XBWA 5I46H 2GZ9A 2FYRA 3VGCB 1TABE 1GHAG 4WWYA 2AGIX 3F9GA 4NIYA 3SJ8A 1C5OH 2FI4E 2ESTE 3ODFA 4U2WA 3BN9A 1UVSH 4KP0A 1LVYA 3MH4A 4AX9H 3TGIE 1HJAB 2HLCA 1OWDA 8KME2 4BANB 1DDJA 2A2XH 2C8YB 4KTCA 4X1PU 2ANKH 2WPIS 3M37A 1ZGVA 4E05H 5FX5A 1THSH 1BBRH 1Z71A 1NROH 1H8DH 1AI8H 1SR5C 2WYJA 3TNSA 1KSNA 4GHQA 3RXPA 1DVAH 1ID5H 1XUHA 1KXEA 1ELDE 1QHRB 5EODA 4Y11E 3PMBB 3MNCA 1ELGA 1NY22 4NFEA 2FZZA 1D3DB 2ANMH 1TPPA 3OYPA 4DW2U 1SGPE 1LKAA 1ZGIA 2XC4A 1BBRK 3LOXA 1UTQA 3HGPA 2BYAX 3ZZ8A 4X1RU 1IQEA 8LPRA 4ZHLU 1AFEH 3UFAA 2QIQA 5AF9H 1DANH 2Q1JA 3S7HB 2ODPA 4ABAA 2CJIA 1P3CA 3URCA 3KQEA 2BY6X 3GDVA 4ZKNU 3RXOA 2VJ1A 1C5WB 1E36B 4X2VA 5GCHF 1XM1A 2GKVE 2OQ5A 3P17H 3UNSA 1MZDA 2OC1A 1G36A 1GJ6A 1GCTC 2PUXB 1ZMNA 4LXBH 2FEQH 5HXFA 2BOKA 4RKJB 5HM9A 1TFXA 2WV4A 4Y7AA 1KIGH 1QFKH 1O2HA 1GHBF 1C5VA 2AYWA 2HALA 1F2SE 1NU7B 5C1UA 3K65B 1FXYA 2BLOA 1TNKA 2FOFA 1AVXA 1LDTT 2F9NA 3SU1A 5FAHA 2AIQA 1IQLA 4Q7ZA 1SL3A 4INHA 1AWHB 2A1DB 1P2NA 5AHGH 2F91A 4FXGH 1AE8H 4X1SU 1P2MA 1WCZA 2PKAA 1QA0A 2PHBA 1HAOH 4CH8B 3HKIB 3Q3XA 1C1WH 3NK8A 2OC7A 2QXIA 1GBMA 1J15A 1BRUP 1HAPH 1WAYB 2VWLA 4K8YA 1PPEE 1HRTH 3CP7A 3PMJA 1Z8IB 1C9PA 3P8OA 1K9OE 1C2FA 1UTLM 3E1XB 6CHAB 4M7GA 3TJOA 2ZDLA 1ZMLA 1LHCH 5EXLA 1KDQA 1K1IA 1HYLA 1TBZH 4GAWA 1GI4A 1C1TA 3M7UA 3VPKA 3QO6A 3TK6A 2XXLA 1LPZB 1KLIH 1UK2A 3ZVFA 1BHXB 3ZZCA 1Y5BT 2VGCC 4ISOA 1CQQA 3LIWA 4K1EA 3Q3KA 1BB0B 1P2JA 2VIPA 6ESTA 4A6LA 1NRRH 1P06A 1XUGA 4D9QA 1KTTB 1GHAF 1SGNE 2TGTA 2P95A 1TGCA 3E91A 3KQBA 3UPEA 3B9FH 3MTYA 1DWCH 4AFUA 3PLPA 1GI2A 2Y5FA 3LGYA 3S7KB 2QXJA 1DSUA 2P3UB 7LPRA 2FYQA 2OC8A 3UNRA 1ELFA 2AS9A 1N8OC 1Z1IA 4ABIA 1QB6A 3EGKH 2XW9A 1ZOMA 1IQMA 1OSSA 5T6FA 1CGHA 1V2UT 2FTLE 4AYYB 2JH5D 3TU7H 5DGJA 2FLRH 2FTMA 1SGYE 2C3SA 2GV7A 5EU8A 1HAVB 2BVRH 1AD8H 2PWXA 1ZPZA 1FQ3A 1W10U 1YPGH 1D3PB 1W0ZU 2Z9IA 4Y7BA 1LQDB 3ZYDA 1SHYA 1O5AB 2TBSA 1BTWA 3V0XA 4LZ1H 3H5CB 1SB1H 1QNJA 2PUQH 4BTIB 1V2QT 2J94A 4XBBA 2JH0D 2BY8X 3TGJE 2FODA 3RXQA 1C5ZB 2QF0A 3P8NA 4K1TA 1C4Y2 1P3EA 4R8TB 3RXJA 3AVZA 1O30A 4O9VA 3KCGH 5A8XA 4GCHG 1G3EA 1C5YB 1VJAU 3TH3H 1UTPA 3MWIU 1ESTA 3SI4H 1ZHRA 1BHXF 2GCTC 1W13U 3KNXA 1JXPA 1V2MT 4AORA 1IHTH 1RFNA 2G51A 1C5QA 1UVPA 1C2EA 1C2KA 4FUCA 1ELCA 1NZQH 3GICB 2XCNA 4ABFA 4RKOB 1NFYA 1TX6A 4Z0KA 1V3XA 1XXDA 4YLQH 1CGIE 2NWNA 1QURH 1TAWA 2BD8A 2R2MB 2ZZUH 1CA0C 1RD3B 1ZLRA 4MNVA 1GG6B 1A0LA 1BT7A 2ANWA 1UTOA 1TMBH 1DWBH 1DM4B 1IQHA 1TGSZ 3BTEE 3QZQA 2CHAC 3EA9A 5J4QA 2ZFRH 1GBBA 3FAOA 3ZVGA 8GCHG 3T27A 1HAYB 4MTBA 1ZSKA 3O8CA 3UIRA 4ISIH 1GMHF 4K3JA 4NCYA 4CH2B 1L4DA 1BBRE 1B0FA 1NN6A 2SGAA 3A87A 1H8IH 1SC8U 2A32A 2WUCA 4MPVA 1OKXA 3DFLA 1O3EA 2F83A 3A80A 3SU5A 4OS5A 1YBWA 4Y71A 1BUIA 1CA8B 1P57B 2BY5X 1EUFA 3SNDA 2PKSB 1NFUA 5ESTE 1KXFA 1P10A 1ABIH 4Y6DA 3E0PB
chains in the Genus database with same CATH superfamily
1AFQC 1E1QD 1UJ1A 1XKBC 1ZJKA 1EAWA 3A8CA 3F6UH 4H6SB 4J2YB 1O3GA 3JZ1B 1P0SH 1RTKA 1TIOA 6GCHF 2ZU5A 1UVUH 1OP0A 4AG1A 1IAUA 5EJZA 1SFQB 1O32A 2KAIA 5DP3A 3V12A 1TE0A 1P04A 1YPJH 3MO3A 3R0FA 1VITG 1D4PB 1QY6A 3B8JA 2RA3A 1MMJN 1F0UA 3LPRA 2QGRA 2Q6GA 1OP8A 5C5OA 1ESAA 1FDPA 2RDEA 3NWUA 5FXLA 3GYLB 1QGFA 3VB7A 2SGFE 1T32A 1O5BB 3TK5A 4TWYA 3SGAE 1EPTC 1JWTA 2YMSC 1COWD 4AGJA 2HRVA 2G5NA 1YM0A 2XC0A 3SU4A 5EXMA 1AUJA 3A82A 5ABWA 1SSXA 3TITA 1TRMA 2LPRA 4ZHMU 4U01A 2CV3A 1B5GH 2EI6A 4I33A 3QX5H 1AUTC 1C1NA 5FX6A 1LPGB 2ZFSA 1FONA 1GI9B 1S85A 3ZZ9A 1ELBA 3RXDA 5C94A 4B74A 3PMAB 1DPOA 1UMAH 2BD2A 1ANCA 1CSOE 2FOBA 3S9AA 2AHME 3HKJB 3P8FA 1FY3A 1AB9B 1SGRE 4JYUH 3A89A 1UVOA 1CHOG 3T29A 1RIWB 1ZMJA 2ZPQA 4OS7A 1HCGA 3V7TA 4ABJA 4X6OA 4AC9A 3L6PA 3VGCC 5JBTA 3A7XA 1GJDB 3PV5A 4NZLA 3MH6A 1EP6A 5FCKA 2EY4C 2O8MA 1YPMH 2ZA5A 2KFWA 5C0UA 4MQAA 2GDEH 1SGQE 3OSYA 2KR7A 5AFZH 1ETSH 2IJD1 1EZXC 4Q2KA 2O8UA 1QB1A 2I6QA 1K1OA 1RXPA 2OCVB 5T6DA 4OS6A 1HJAC 2WHXA 2BD4A 1BMMH 1QBNA 1AN1E 4RT1A 1KXCA 3BIUH 5ESBA 2F9UA 3F3BA 3DHKH 2QYIA 2VU8E 4RSPA 4UDWH 1C9TA 1T8OA 2STAE 3RU4D 3RXHA 2ZDAH 2WV5A 3F1SB 1ZSLA 4GSOA 3ITIA 1FPCH 1YP9A 1MU8B 1C5UA 1N6YA 4CR9A 2J38A 3ZVEA 5A0AE 1UK3A 2KZ4A 4RI0A 4H4FA 2JETB 2NU0E 3U9AH 5L30H 3VEQB 1VGCB 1SQOA 4B73A 1O3KA 2BY9X 4IBLH 4YO9A 3ZZ7A 2A7JA 2Y7XA 5DK1A 1QL8A 2HOBA 2P16A 3K2UA 1V2JT 1LMWB 1GI5A 3ELAH 1HXFH 1MKXK 2SGDE 4ZXYH 1SGTA 1Z8JB 4O3TA 5FL7D 1C5XB 1E34B 1P05A 3PRBA 5KEDA 4ZH8A 3N7DA 1O5GH 2BLWA 3PWCA 3SZEA 1PPHE 5EGMA 1YYY1 4J1YA 5K7RA 2C93B 1OS8A 2H5DA 1EZUC 1GJ5H 1QRZA 1WQSA 5GCHG 1W12U 1CGJE 1SQAA 3HGNA 2Q6FA 1PQ5A 3EYDA 3QK1A 1TRYA 5L2ZH 2ODQA 2A7CA 2XWBI 3LGIA 1O2MA 2R3UA 3NPSA 1AZ8A 2W26A 5LH8A 1QB9A 1SHHB 3BEFB 3RU4T 1GJBB 1MTWA 2OTVA 1LKBA 4JK6A 3DD2H 4NIVA 1C5SA 2WUBA 1ZTLA 1FNIA 5PTPA 2PGBB 3M61U 2SGEE 3ZV9A 1VITF 1P9UA 2BDIA 5JDUB 1VKYA 1O3MA 3QZRA 3SN8A 1Y3VA 2EI8A 1QTFA 3E16B 1TQ0B 1PYTD 1WXRA 3OY5U 1P9SA 3SO3A 2F9OA 3T62A 2V0BA 1D9IA 1S81A 4IC6A 6CHAC 2ZGHA 4UFGH 1SGCA 3GYMA 1JMOH 3SV8A 3SU2A 4FUJA 5DP4A 1HPGA 2B9LA 1TNLA 4AB9A 3RXSA 2UUFB 5GPIB 1YPHE 2A5KA 5CDFE 1Y3YA 5SGAE 2FLBH 3BEUA 3GCTG 3U1JB 2FS9A 3GOVB 3ENSB 3D49H 2AFQB 1EB2A 1XVOA 1GBEA 1UCYH 4NSYA 2BY7X 3MU0A 3TH2H 3U8RH 1C2GA 2VIDA 3UWIA 4B1TA 1GGDB 1CHOF 1RS0A 1V2LT 3M5OA 1F0TA 4OGXA 1NBMD 1INCA 1QRWA 1C5RA 2ULLA 8ESTE 2ZI2H 2FDAA 3GDSA 1NFWA 1HJ8A 1SQRA 3D62A 2GDDA 1QBOA 3OEHD 2J97A 3F9HA 3S0NA 4X6NA 3EAJA 2KX4A 1UCYK 1DT2A 2FESH 1LHFH 5T1VA 4IW4E 1BCUH 4JZEH 3RUOA 3EDXB 3STJA 4XDEA 3BIVH 1MCTA 3H09A 4UONA 3E6PH 4FUIA 1J16A 3H7TA 1K0HA 2Z9LA 3AK5A 1P8VC 3A83A 1C1QA 1MTVA 3SUDA 4JMYA 1GI7B 1GCDA 3EE0B 4WXIA 2CN0H 1W2KH 1F92A 2TGPZ 5GWZA 4FVBA 3RM0H 3BEIB 1T4UH 1MTSA 1TNHA 1AVGH 2L6OA 1SPJA 2BMGB 3FVFB 3NRLA 1P01A 2FOMB 4BTTB 1EAUA 4F48B 4AGKA 1GHVH 1O38A 2BDYA 1NS3A 3UR6A 2FS8A 4XOJA 3ODDA 2R3YA 2G4UA 5E0GA 2ZFFH 1TB6H 1ZHMA 4OM9A 4AYVB 1AGJA 4DOQA 2VIOA 1HBTH 1J14A 1VITH 1PQAA 4B6FA 4YZUA 2QC2A 1JBUH 1GL0E 1WV7H 2ZHDA 1FLEE 1K21H 2ZDVH 5FHTA 1GDQA 2NU3E 3F0PA 2ZFTA 2PGQB 1C5NH 2OXSA 5B6LA 1JIMA 1FAKH 2ZO3H 1DWEH 2D26C 2O8TA 3P95A 2BZAA 5A0CA 1IQNA 1UTKA 2THFB 2OUAA 3K6YA 4FU9A 3UR9A 2GP9B 4NA9H 1EAXA 5JBBS 1IOEA 2A4OA 1QL9A 1EASA 2ODYB 3RDZA 3F2HA 5HGGA 1GI3A 4JZIA 1ZSJA 2BD9A 4BAOB 4X1QU 2VNTA 3ZVDA 1UHBB 1AKSB 1V2TT 3BTFE 4ZROA 2C90B 2F9BH 4CRAA 3SNBA 4WMEA 2G4TA 1GBLA 4BXWA 1W0JD 5HKKD 4FU7A 3SYJA 5E0HA 1A3BH 1O3PB 1DX5M 3P8GA 1N1LA 5ETXA 1ZRKA 1HIAB 1TOCB 2V35A 2HGTH 1F7ZA 2BX4A 1GG6C 1ZRBA 1O2RA 1CU1A 1GMDG 3DSGA 2OK5A 1QR3E 5J4SA 3RXLA 4GLYA 4E06H 1JIRA 1C5TA 2UWPA 1BTYA 1W7GH 4MNXA 2CMYA 3GY2A 1YPEH 1GMHG 4YOGA 1ZJDA 2XCFA 3FKSD 1DUAA 3SQHE 3PM3A 3PV4A 2V3HH 2UUJB 1J8AA 2B0FA 4ABEA 1T8LA 2H6MA 1TWXB 1ANDA 5IDKA 5EW1H 3N7OA 1MBMA 1C1VH 1BITA 2OBOA 3F68H 4I8KA 4ISNA 2PW8H 3ZYEA 4LZ4B 2QF4A 3SW2B 4YLUA 1ABJH 3E0NB 3GCTF 4XFQA 2ZPRA 1KY9A 2PKSC 5EPYA 3VXEH 2TGAA 1FAXA 1TPSA 1CHGA 2BB4A 2VH6A 3GCNA 1C5MD 6GCHG 4CRBA 4YTAA 4LK4A 2J4IA 2W6ID 4WJG2 1A1RA 1C2MA 4TPIZ 2FOAA 1ELAA 2XYAA 2A5AA 4NFFA 5EQQA 5JPMH 2AH4X 1J9CH 1SKYE 3SJIA 1C1RA 1O5DH 1BA8B 3ZZ3A 3UNQA 5F8XA 2VBCA 4DJZB 3SV2H 3HATH 1OHHD 2BXUH 1L1JA 2BDHA 1O2YA 4X8VH 1GBHA 1H4WA 1O39A 1TQ7B 4K1SA 2ZU4A 7KMEH 1A7SA 2OINA 2TGDA 2VH0A 3ZV8A 1P2IA 4INKA 1A0JA 4ZKOU 3SGQE 2AMDA 4QT8C 3GCOA 2A45B 2ZU2A 3RXGA 1KTSB 2FP7B 3SI3H 1E0FD 3GY5A 3UWJH 3JZ2B 4NA7A 3MNBA 1MAYA 1ZR0A 3BTDE 1ZTJA 1G3DA 1BRCE 3LU9B 2PSXA 4AZ2B 1VZQH 1H8HD 4ABBA 1G3CA 3M5MA 2BD5A 1AB9C 3AASA 2ILNA 3EE7A 1C1SA 1RIWC 1AHTH 1SOTA 2VINA 2VWMA 3CS7A 3KQCA 3RMOH 4MVNA 3RXFA 1Z7KA 3ZZAA 1MKWH 1O0DH 1OWIA 1ACBE 4XE4A 1S6HA 2G5VA 2ZDMA 2W5EA 1E38B 3F9EA 4MNWA 4TYDA 4JYTA 5C67A 3Q76A 2C8WB 2BQWB 1DXWA 2OC0A 4DIIH 5H4IB 1EZSC 2JIZD 1V2KT 3LH1A 4FUBA 2HVXA 3BSQA 4KTSA 3L33A 3RXUA 4B2AA 2Z9GA 1DFPA 1U6QA 2BLVA 3HK3B 1HAXB 2KCAA 1O2KA 4ZKRU 4UFEH 1MH0A 3ATIA 3SU0A 1Y8TA 3VB4A 3SJOA 4Z6AH 1MKWK 3Q77A 4ZUHA 1TX7A 1Q3XA 4Y8ZA 1C1OA 1O3BA 3PV2A 1UCYE 1E37B 1OWJA 2ZF0H 5GNDA 1X7AC 4F55A 3V3MA 4DT7B 2CF9H 1SQTA 5DKMA 1S0QA 4TSFD 1Y3UA 3LGVA 1XUIA 4I86A 4CBNA 1LHEH 1AVWA 2AERH 3RXIA 3LC3A 1UVTH 3U1IB 2JETC 1VGCC 1Z6JH 3FOAA 3N7EA 1GHYH 3UB0A 2JDID 4INLA 4XBCA 5DJ7A 1PQ7A 4CRFA 3V13A 1Q2WA 4WY3A 1GMDF 2EC9H 2Y6TA 2ZGBH 1FIZA 1L4ZA 4CR5A 3GCHB 3SNEA 5JB9S 4YT7H 1H9IE 4JK5A 2HLDD 2ZCHP 2ZTYA 2QXHA 2ALVA 4I8LA 1NT1A 3A7ZA 1NRQH 3KN2A 1O3IA 2ZTZA 1TLDA 1LQEA 1M9UA 1K1LA 2R9PA 2VB0A 3ZIAD 5IYTA 3A8AA 4JZFH 4ASHA 1S0RA 1D3QB 1NTPA 1XMNB 3LJJA 1KDQB 3GY3A 2A2QH 3GISB 1RRKA 1YLCA 2OBQA 1QQ4A 2FMJA 2CF8H 2Y81A 3Q00A 4IMQA 2BQ6B 4Q63A 5K0HA 4BXSA 3IITA 1MABB 7ESTE 1T31A 1S84A 3UUZA 1C2DA 2Z3EA 1MU6B 4NWKA 3BTTE 4GVUA 5I25A 4OS1A 4IMZA 3LGTA 2Q6DA 1K1PA 1G2LA 3H7OA 2GCHG 7GCHF 1O2ZA 2A4GA 2PR3A 2TIOA 1DICA 3R3GB 1CBWB 4NIXA 3F2FA 1XX9A 4K60A 4X8UH 1P02A 1GI6A 1Y3WA 1O2JA 3QUMP 3UOUA 1YLDA 4D7GA 2ZNKH 3RMMH 5EJ1A 2BHGA 4GHTA 3C1KA 2FOEA 3TVJB 4B2BA 1GI0A 2NU1E 1EX3A 2GGVB 4IGDA 3FP7E 2XTTB 3KGPA 5C1XA 3K6ZA 1P03A 2B5TB 3ZZDA 1YKTA 3OTJE 4GPGA 1GBJA 3M7QA 1O3OA 5DO4H 1WTHD 4Q4LA 4K5ZA 5EIYA 1TOMH 5HYOA 1AO5A 1G3BA 3HPTB 1FN6A 1EPTA 2XRCA 1H9LB 1NPMA 1EOJA 3M3VA 4F49A 1ARCA 1DXPA 1O2LA 1GJAB 4NGAH 2JJ1D 1JRSA 4ACBA 2W7SA 1O37A 1SVPA 1GMCF 2PTCE 4X2WA 4UD9H 2Z9JA 1KXAA 4D7FA 1EJNA 4UFDH 3UQOA 1GGDC 2ZQ2A 4KTUA 1QZ8A 5L2YH 2FX6A 3ZVBA 3SZNA 4JZ1A 3RXVA 1QCPA 2VVUA 1DUEA 1TBRH 1BMLA 2BM2A 2CXVA 2P3TB 5GJ4B 1CE5A 5T3HA 1QJ1B 2WPMS 2SNWA 2UWOA 1THPB 4UFFH 1W11U 1PPZA 5BRRE 3RXRA 5CMXH 2OD3B 3A88A 1YF4A 3I77A 5E8EH 3PB1E 5F03A 4ZXXH 1ELTA 1O3FA 3MH5A 3RLWH 5C0TA 5C17A 3SGBE 2GT8A 1KYNA 1Z6EA 4ZMAH 4NG9H 2ZFPH 2Y5GA 3ATMA 2BQ7B 2ZU1A 1GHZA 1EKBB 2BTCE 3K9XB 1BZXE 1P12E 3SNAA 1LCYA 4Y0ZE 3T26A 1SLWB 2GVFA 3URDA 1MTUA 2G00A 5L6NH 2W7UA 4A1XA 1UO6A 5FBIA 3L3TA 3PO1B 4I8GA 3RC5A 5LPRA 1L0ZA 1NRPH 1Y5UT 1BDAA 1EAIA 1W14U 1EXFA 3TJUA 1LPKB 4IN2A 4HGCA 2IJOB 5LPEA 1QIXB 3UQVA 1EOLA 2YOLA 2ZECA 1XUKA 3DCLA 5C2ZA 2A0QB 1QJ7B 3BV9B 3UY9A 3OX7U 1H1BA 4A92A 3F9FA 1GJ8B 1PQ8A 1T4VH 1V2WT 3P92A 2WPHS 4KGAA 4HZHA 2J98A 2BD3A 1MAXA 1QQUA 1C4V2 2YNAA 4Y8YA 1C1UH 1NC6A 1W8BH 1ESBA 1EFRD 2CHAB 5FPTA 3M7TA 1MTNB 2ASUB 3SQEE 3BG4B 3SUEA 3SNCA 2SGPE 2G52A 2ZP0H 3U28C 3B23B 3KQ5A 3PMHB 3WY8A 1GI8B 1FI8A 2RG3A 1E35B 1J17T 2HWLB 4DCDA 3F2GA 1QRXA 3SHAH 5E2OA 2VIQA 2V6NA 4VGCB 2ZIQH 4FUDA 5FPSA 3O8BA 1GBFA 1TBQH 3RXKA 3MU4A 3T28A 3I78A 1YCPH 3RC4A 2KCPA 1AKSA 1P09A 2GCHF 2P59A 4CRDA 2KAIB 1SOZA 5DPAA 1O2XA 1AFQB 1PPFE 3W95A 3AAUA 1RTLA 3LONA 5KECA 1O2IA 3SU6A 5T6GA 3RMLH 1HIAA 1V2PT 2V7QD 3A85A 1TMUH 2VWNA 1F5LA 1LVMA 4ABDA 5CHAB 1YCPK 3ATKA 1FN8A 2UWLA 2D2DA 2A4RA 5DP6A 4O97A 2FIRH 1AIXH 1IHSH 3NCLA 3DFJA 3WW7A 1K22H 1O5CB 4ZAEA 3MNSA 3MH7A 2YMSB 4KELA 1S83A 1BIOA 1MZAA 3MO6A 3AAVA 2P93A 1K2I1 1DS2E 4HI3A 3T25A 3SOSA 1A61H 2WZQA 4DGJA 4LOYH 1C5PA 4X8TH 4XRNA 3W1EA 3O8DA 1C1PA 1GHWH 1UK4A 4CHAB 1THRH 3PTBA 1IQIA 4ESTE 1SGIB 1O3DA 5HM2A 1MD8A 1KLTA 1HJ9A 1ZZZA 2Z94A 4AFQA 2IPHA 2ZEBA 1TALA 2BDBA 2J92A 1FUJA 1FY1A 2ALPA 5BPEA 4WVPE 4XSKU 3U98H 3RXBA 3A86A 1EJAA 3U8TH 1JOUB 3AW0A 2FI5E 3SU3A 5A2MH 2B8OH 1G9IE 1SLUB 1MBQA 1G37A 4Q80A 2P94A 2QXGA 1EZQA 1GI1A 1Y59T 2SFAA 3UOPA 1UTNA 5C5NA 3A7TA 1FY8E 4Y8XA 5AVDA 1EQ9A 4FUHA 4F4OC 4FUFA 3LH3A 3RU4E 5GDSH 1L1GA 5E2PA 5JYIA 2VWOA 2PV9B 1O2OA 1ANEA 2FOHA 1S82A 4AG2A 2OP9A 1AY6H 1Y3XA 3RP2A 3T2NA 2ZU3A 5AFYH 1PYTC 3I29A 1IQKA 1O2GH 2UUKB 1GVLA 5DG6A 4WXVA 1C5LH 1AZZA 3A8DA 1DLKB 1HAVA 4YESB 3LJOA 1GJCB 5KGOA 2STBE 4YOJA 2ZDNA 1DLEA 1RTFB 1P2KA 1SLXB 1PJPA 1F0SA 3RM2H 1AU8A 2C8XB 4U30A 2ZC9H 4TY7A 3SUFA 2WPKS 5F6MA 3PYHA 1WOFA 5TCCA 2R0KA 1SFIA 2ZCLP 4MLFB 4CREA 1D6WA 4B6EA 1QBVH 3MMGA 1O2PA 5B6OA 1JRTA 1O3JA 3TH4H 1SGFG 2BDGA 2QY0B 2BOHB 3M5LA 1TRNA 1BMNH 1D6RA 2J2UA 3MOCA 5A0BA 1HB0B 2G55A 2GMTB 2Z7FE 5A8YA 2W3IA 1HNEE 1HAHH 3TLOA 1A2CH 2QA9E 1IQGA 3SV6A 3ZZ4A 1F5RA 1A5HA 2AMQA 2HPPH 3T5FH 1O2SA 1A5IA 4A1VA 3RXCA 1SLVB 2W3KA 2XC5A 3TJNA 4DY7B 2WPLS 4MPUA 1FJSA 1TPOA 1FV9A 1SG8B 1IQJA 1V6DA 2ZGXH 2ZHFH 5EPNA 1K1MA 2J34A 1C2JA 1LHDH 3ZZBA 1XKAC 3G01A 4H6TA 1YPLH 3GCHC 3LGWA 1Q31A 1F0RA 4ZHAA 2HVYB 3DSPA 1WQVH 3A81A 3M5NA 4ISLA 5GIBA 2FOGA 2P8OB 4HG6A 1O3CA 1ETRH 5TCAA 1BMFD 1Z8RA 2FXRA 3CS0A 1D3TB 3PTNA 3SJ9A 1CO7E 2PSYA 1Y5AT 1BJVA 2FWWA 4DIHH 1DITH 4FETA 1V2RT 1GJ9B 2H9TH 3CNRA 3GDUA 1HFDA 1NFXA 1QL7A 4XBDA 4THNH 2SNVA 1A5GH 5CE1A 1DY9A 1ZPCA 2RDLA 2Y7ZA 3TGKE 2R2WU 1TYNA 3MU8A 1BTUA 1C4U2 2BZ6H 2FM2A 3BTWE 4U32A 4BNRA 1TNGA 2H2ZA 1HDTH 1TNIA 1NBME 2GX4A 1FPHH 4X1NU 3SJKA 3QGJA 1MD7A 2HNTF 1GBKA 3VB3A 7GCHG 3QGNB 3A7VA 2ZG0H 4MPXA 1OWKA 3MNXA 1YPKH 4BOHA 1CBWC 2J95A 2WINI 2XBVA 4FU8A 4IC5A 1A0HB 3TIUA 3ZZ5A 1YC0A 2A31A 3TJVA 2H1UA 5FBEA 4K2YA 3UTUH 2AEIH 1EP5A 4TT3D 1O2TA 3FZZA 3KF2A 3GS9A 2KCYA 2G81E 2HPQH 2JKHA 1BTZA 2LP6A 4BAQB 4ABHA 3ZZ6A 4CBOA 3FANA 3MHWU 3KIDU 4AFZA 4NSVA 2PTNA 2ANYA 3MQKC 3MU1A 3KL6A 4R0IA 1W7XH 5IK2D 4UE7H 2WPJS 1LTOA 1GMCG 4Y0YE 5DP5A 1XUFA 4E7NA 4PROA 3BTGE 1AQ7A 3MYWA 4K8BA 1OP2A 4TY6A 2F9VA 3O8RA 3M3TA 5LPFA 1BTXA 3EA8A 1O2QA 4B71A 4OS4A 4DVAU 3STIA 3KQDA 1OYTH 3ATWA 2BD7A 1G2MA 4X2YA 5F53A 1SGDE 3M35A 3S69A 3N99A 2VIWA 1ZHPA 3FZDA 1SBWA 2ZTXA 1VCQA 4HTCH 2BXTH 1FY4A 1AE5A 3TNTA 3IG6B 2SGQE 2XBYA 5E0JA 1EJMA 1ZTKA 3DT0H 1WUNH 3LGUA 5F8TA 3TK9A 4B76A 1O33A 2M2AA 2IOTA 1AMHA 5HIZA 1W3CA 3HK6B 4IS5A 1P2OA 2DE9A 1SGEE 5LGOA 1O3NA 3WWFA 1CT0E 2ZGJA 3A7WA 5DP8A 1OPHB 1O3HA 3NXPA 3SV7A 4WH8A 4X0WU 1BJUA 1MCVA 4KKDA 4ZKSU 3GY8A 1NRSH 3E8LA 1LO6A 5HMAA 1CT4E 1HV7A 1L1NA 4JZDH 1T7CA 3PLKA 4JCNA 1VJ9U 5EW2H 2F43B 1TGTA 3OTPA 3PO1C 1FY5A 1FX0B 1O5FH 1OX1A 4JYVH 3QWCH 4D8NA 1O2WA 1O5EH 2L74A 4K69A 1ARBA 1GCTB 4TWWA 5GXPA 2BDAA 2QN5T 2TRMA 4ASUD 1G32B 1T8NA 2WYGA 1G30B 6LPRA 4OS2A 1W0YH 1XUJA 5CHBA 2GJGA 1GL1A 2BLQA 5EOKA 2PKAB 5C1YA 2D8WA 2DE8A 2YMSD 2PLXA 1GDUA 2GT7A 5JBCS 2P3FH 2XOKD 1HLTH 2ZHQH 2Z3DA 2BDCA 5HIYA 4AB8A 2YNBA 1EB1H 3MO9A 5EXNA 3M3SA 3S9CA 1TPAE 1WDIA 1KLJH 3BTME 2FI3E 3MFJA 2FO9A 2DUCA 4NWLA 2K1QA 4BAMB 2V3OH 4MPWA 1MTNC 1DWDH 3BG4C 3KEEA 4A1TA 1C2HA 1ETTH 2RA0A 4BAHB 2W6JD 4Z1MD 4RN6A 3BF6H 3RXMA 1RGQA 4BAKB 2XBXA 4I31A 2EI7A 2A5IA 4TPYA 4VGCC 3PROA 4B75A 1C2LA 2D1JA 1MUEB 1HGTH 1E1RD 1AWFH 3P6ZB 1ELVA 2AGEX 1YCPM 1VCPA 3SHCH 1NRNH 1O2VA 1QJ6B 4I32A 1ZPBA 2EQNA 2OLGA 2VGCB 1SI5H 4OGYA 4SGBE 2Y5HA 4I8HA 5F8ZA 4A5TS 1HAIH 2O8LA 1IQFA 5JB8S 2Z3CA 3U69H 3UREA 3FN8A 3ZVAA 2ZCKP 4WF8A 2B7DH 4B2CA 2JJ2D 3VFEA 5CHAC 5C3NA 1TA2A 1C2IA 2AGGX 2H9EH 2VVCA 1FMGA 3RLYH 1Z1JA 4O03A 3LKWA 2OQUA 3FP6E 3RMNH 3PWBA 1BOQA 2O8WA 1VR1H 2LELA 1HAGE 1BTHH 3GY7A 2FOCA 4IN1A 1O2UA 3M36A 3U8OH 4Y79A 1LVBA 1V2VT 3NKKA 3RXTA 2K0QA 2QAAA 1N8OB 3KHVA 1S5SA 1V2NT 1UTMA 1C1MA 4CHAC 1O3LA 2JH6D 3EQ0H 5DP7A 2Y82A 2XNDD 5FCRA 1FZZA 2IN2A 2QF5A 3D23A 3OU0A 5TJXA 1P2QA 3AW1A 2XNIA 3A84A 2WPDD 1MQ5A 5DP9A 3ESTA 1TX8A 2A7HA 1GWAA 9ESTA 4SGAE 1LVOA 3BTHE 1BRBE 2J9NA 3BG8A 2G8TA 2ZHEH 1VCWA 1V2OT 1P11E 5C20A 2XWAA 4YT6H 4NA8A 1S6FA 1W0KD 2PP6A 1WYKA 1UTJA 1A4WH 3GY6A 4FUEA 3DSOA 3LC5A 4GUXA 4Q7XA 1DE7H 2CK3D 4ABGA 2FPZA 5FPYA 2QV1A 1PPCE 4DG4A 3BTQE 1O3AA 1OYQA 2ZFQH 1PFXC 1ANBA 1N6XA 2UUYA 4MDSA 1OXGA 3P70B 2Z9KA 2BX3A 5A8ZA 1BMAA 1BRAA 2A4QA 3CENA 3RXEA 2H5CA 4AN7A 4D9RA 1BQYA 2GD4B 4WMDA 1GVZA 3C27B 2VIVA 3FP8E 1DSTA 4GCHF 2AMPA 5A09A 2GTBA 2BVXH 9LPRA 2CGAA 2O9QA 3E90B 4FVDA 1GPZA 3NZIA 2GCTB 4X6MA 1GVKB 1T8MA 2F9PA 2C8ZB 2GZ8A 2QCYA 1HAZB 1MKXH 5EQRA 3MI4A 4MNYA 1NESE 4BTUB 1HUTH 1QA7A 2F3CE 1EATA 4Y76A 3SBKA 1NM6A 3Q3YA 1GHXH 3OE7D 1CT2E 2HNTC 1ELEE 1KXBA 1TGNA 1WBGB 1WSSH 1YGCH 2LNCA 1MQ6A 1TNJA 1ZYOA 1O31A 3D65E 3OY6U 1XVMA 4FUGA 4YOIA 3BTKE 4D76A 1CA0B 3F0OA 4X2XA 1OWHA 2AIPA 4CRGA 5G4BA 2BVSH 3DUXH 2FX4A 4I8JA 3W94A 3MU5A 1K1JA 1L2EA 2ZQ1A 1YPHC 1B7XB 3A8BA 5EQSA 2ZGCA 3VB5A 8GCHF 2GMTC 1OOKB 4YM9A 4WMFA 1A46H 2NU2E 2ZWLH 2Y80A 2KCOA 3DA9B 2TPIZ 4NIWA 4HFPB 1RJXB 3QTOH 1K28D 4H42U 2GZ7A 4Q7YA 3QLPH 1TONA 4AFSA 3ZVCA 4X8SH 3LT3A 1O34A 2GV6A 2QF3A 1UHBA 1FIWA 3EA7A 4NZQA 1GDNA 1TGBA 3A7YA 1GHBG 1PPGE 1O2NA 3WWBA 3QDZB 1GJ7B 1ORFA 4UEHH 3SUGA 1KXDA 2NU4E 4E7RG 3QTVH 1V2ST 2C4FH 3E3TA 2RCEA 3KYGA 3IWMA 4M9FA 3VXFH 2I6SA 3RXAA 2EEKA 4P02A 3OEED 1CVWH 2ZKSA 1SMFE 4MG3A 1GBIA 2P8OC 3VB6A 1BTPA 4I7YH 4O3UA 1F5KU 3RC6A 1NU9A 2EA3A 3S9BA 4CRCA 4A7IB 1O36A 3SV9A 4XD7D 2K8IA 2M5TA 2WSSD 4P00A 1H9HE 2ZHWH 1EPTB 4Y10E 4AOQA 1Z8GA 4FOUC 2HNTE 2PFEA 2R0LA 2ZPSA 3PLBA 3ATLA 1GBDA 1DOJA 4ISHH 2VVVA 2V3MA 1GBCA 1HXEH 2H9HA 1NO9H 1TA6A 5JBAS 1B0EA 1GBTA 1SGFA 1TMTH 1XXFA 3QN7A 4X6PA 2ZDKA 1OWEA 2Z6BD 5EG4A 1DY8A 3SORA 1WTGH 3LDXH 3GY4A 3NUMA 1GBAA 4DURA 4WH6A 1PPBH 3TPIZ 1WU1A 1O35A 3FFGA 1A3EH 3PRDA 1GJ4H 1LHGH 1K1NA 1UW7A 2XBWA 1S6LA 5I46H 2GZ9A 2FYRA 3VGCB 1TABE 1GHAG 4WWYA 2AGIX 3F9GA 4NIYA 3SJ8A 1C5OH 2FI4E 2ESTE 3ODFA 4U2WA 4YXWD 3BN9A 1UVSH 4KP0A 1LVYA 3MH4A 4AX9H 3TGIE 1HJAB 2HLCA 1OWDA 8KME2 4BANB 1DDJA 2A2XH 2C8YB 4KTCA 4X1PU 2ANKH 2WPIS 3M37A 1ZGVA 4E05H 5FX5A 1THSH 1BBRH 1Z71A 1NROH 1H8DH 1AI8H 1SR5C 2WYJA 3TNSA 1KSNA 4GHQA 3RXPA 1DVAH 1ID5H 1XUHA 1KXEA 1ELDE 1QHRB 5EODA 4Y11E 3PMBB 3MNCA 1ELGA 1NY22 5EJLA 4NFEA 2FZZA 1D3DB 2ANMH 1TPPA 3OYPA 4DW2U 1SGPE 1LKAA 1ZGIA 2XC4A 1BBRK 2J98B 3LOXA 1UTQA 3HGPA 2BYAX 3ZZ8A 2KM0A 4X1RU 4DT4A 1IQEA 8LPRA 4ZHLU 1AFEH 3UFAA 2QIQA 5AF9H 1DANH 2Q1JA 3S7HB 2ODPA 4ABAA 3KYFA 2CJIA 1P3CA 3URCA 3KQEA 2BY6X 3GDVA 4ZKNU 3RXOA 2VJ1A 1C5WB 1E36B 4X2VA 5GCHF 1XM1A 2GKVE 2OQ5A 3P17H 3UNSA 1MZDA 2OC1A 1G36A 1GJ6A 1GCTC 2PUXB 1ZMNA 4LXBH 2FEQH 5HXFA 2BOKA 4RKJB 5HM9A 1TFXA 2WV4A 4Y7AA 1KIGH 1QFKH 1O2HA 1GHBF 1C5VA 2AYWA 2HALA 1F2SE 1NU7B 5C1UA 3K65B 3VG8A 1FXYA 2BLOA 1TNKA 2FOFA 1AVXA 1LDTT 2F9NA 3SU1A 5FAHA 2AIQA 1IQLA 4Q7ZA 1SL3A 4INHA 1AWHB 2A1DB 2IPQX 1P2NA 5AHGH 1E79D 2F91A 2F4LA 4FXGH 1AE8H 4X1SU 1P2MA 1WCZA 2PKAA 4ACAA 1QA0A 2PHBA 1HAOH 4CH8B 3HKIB 3Q3XA 1C1WH 3NK8A 2OC7A 2QXIA 1GBMA 1J15A 1BRUP 1HAPH 1WAYB 2VWLA 4K8YA 1PPEE 1HRTH 3CP7A 3PMJA 1Z8IB 1C9PA 3P8OA 1K9OE 1C2FA 1UTLM 3E1XB 6CHAB 4M7GA 3TJOA 2ZDLA 1ZMLA 1LHCH 5EXLA 1KDQA 1K1IA 1HYLA 1TBZH 4GAWA 1GI4A 2WV9A 1C1TA 3M7UA 3VPKA 3QO6A 3TK6A 2XXLA 1LPZB 1KLIH 1UK2A 3ZVFA 1YWUA 1BHXB 3ZZCA 1Y5BT 2VGCC 4ISOA 1CQQA 3LIWA 4K1EA 3Q3KA 1BB0B 1P2JA 2VIPA 6ESTA 4A6LA 1NRRH 1P06A 1XUGA 4D9QA 5DSFA 1KTTB 1GHAF 1SGNE 2TGTA 2P95A 1TGCA 3E91A 3KQBA 3UPEA 3B9FH 3MTYA 1DWCH 4AFUA 3PLPA 1GI2A 2Y5FA 3LGYA 3S7KB 2QXJA 1DSUA 2P3UB 7LPRA 2FYQA 1YY3A 2OC8A 3UNRA 1ELFA 2AS9A 1N8OC 1Z1IA 4ABIA 1QB6A 3EGKH 2XW9A 1ZOMA 1IQMA 1OSSA 5T6FA 1CGHA 1V2UT 2FTLE 4AYYB 2JH5D 3TU7H 1YLNA 5DGJA 2FLRH 2FTMA 1SGYE 2C3SA 2GV7A 5EU8A 1HAVB 2BVRH 1AD8H 2PWXA 1ZPZA 1FQ3A 1W10U 1YPGH 1D3PB 1W0ZU 2Z9IA 4Y7BA 1LQDB 3ZYDA 1SHYA 2QE7D 1O5AB 1KMHB 2TBSA 1BTWA 3V0XA 4LZ1H 3H5CB 5DN6D 1SB1H 1QNJA 2PUQH 4BTIB 1V2QT 2J94A 4XBBA 2JH0D 2BY8X 3TGJE 2FODA 3RXQA 1C5ZB 2QF0A 3P8NA 4K1TA 1C4Y2 1P3EA 4R8TB 3RXJA 3AVZA 1O30A 4O9VA 3KCGH 5A8XA 4GCHG 4RT0A 1G3EA 3OAAD 1C5YB 1VJAU 3TH3H 1UTPA 3MWIU 1ESTA 3OFND 3SI4H 1ZHRA 1BHXF 2GCTC 1W13U 3KNXA 1JXPA 1V2MT 4AORA 1H8ED 1IHTH 1RFNA 2G51A 1C5QA 1UVPA 1C2EA 1C2KA 4FUCA 1ELCA 1NZQH 3UAIC 3GICB 2XCNA 4ABFA 4RKOB 1NFYA 1TX6A 4Z0KA 1V3XA 1XXDA 4YLQH 1CGIE 2NWNA 1QURH 1TAWA 2BD8A 2R2MB 2ZZUH 1CA0C 4ZCNA 1RD3B 1ZLRA 4MNVA 1GG6B 1A0LA 2RFKC 1BT7A 2ANWA 1UTOA 1TMBH 1DWBH 1DM4B 1IQHA 1TGSZ 3BTEE 3QZQA 2CHAC 3EA9A 5J4QA 2ZFRH 1GBBA 3FAOA 3ZVGA 8GCHG 3T27A 1HAYB 4MTBA 1ZSKA 3O8CA 3UIRA 4ISIH 1GMHF 4K3JA 4NCYA 4CH2B 1L4DA 1BBRE 1B0FA 1NN6A 2SGAA 3A87A 1H8IH 1SC8U 2A32A 2WUCA 4MPVA 1OKXA 3DFLA 1O3EA 2F83A 3A80A 3SU5A 4OS5A 1YBWA 3FO8D 4Y71A 1BUIA 1CA8B 1P57B 2BY5X 1EUFA 3SNDA 2J5UA 2PKSB 1NFUA 5ESTE 1KXFA 1P10A 1ABIH 4Y6DA 3E0PB
chains in the Genus database with same CATH topology
1AFQC 1XKBC 1UJ1A 1ZJKA 3A8CA 1EAWA 3F6UH 4H6SB 4J2YB 1O3GA 3JZ1B 1P0SH 1RTKA 1TIOA 6GCHF 2ZU5A 1UVUH 1OP0A 4AG1A 1IAUA 1SFQB 1O32A 2KAIA 5DP3A 3V12A 1TE0A 1P04A 1YPJH 3MO3A 3R0FA 1VITG 1D4PB 1QY6A 3B8JA 2RA3A 1MMJN 1F0UA 3LPRA 2QGRA 2Q6GA 1OP8A 5C5OA 1ESAA 1FDPA 3NWUA 5FXLA 3GYLB 1QGFA 3VB7A 2SGFE 1T32A 1O5BB 3TK5A 4TWYA 3SGAE 1EPTC 1JWTA 4AGJA 2HRVA 2G5NA 1YM0A 2XC0A 3SU4A 5EXMA 1AUJA 3A82A 5ABWA 1SSXA 3TITA 1TRMA 2LPRA 4ZHMU 4U01A 2CV3A 1B5GH 2EI6A 4I33A 3QX5H 1AUTC 1C1NA 5FX6A 1LPGB 2ZFSA 1FONA 1GI9B 1S85A 3ZZ9A 1ELBA 3RXDA 4B74A 3PMAB 1DPOA 1UMAH 2BD2A 1ANCA 1CSOE 2FOBA 3S9AA 3HKJB 3P8FA 1FY3A 1AB9B 1SGRE 4JYUH 3A89A 1UVOA 1CHOG 3T29A 1RIWB 1ZMJA 2ZPQA 4OS7A 1HCGA 3V7TA 4ABJA 4X6OA 3L6PA 3VGCC 5JBTA 3A7XA 1GJDB 4NZLA 3MH6A 1EP6A 5FCKA 2O8MA 1YPMH 2ZA5A 4MQAA 2GDEH 1SGQE 3OSYA 5AFZH 1ETSH 1EZXC 4Q2KA 2O8UA 1QB1A 2I6QA 1K1OA 1RXPA 2OCVB 5T6DA 4OS6A 1HJAC 2BD4A 1BMMH 1QBNA 1AN1E 1KXCA 3BIUH 5ESBA 2F9UA 3DHKH 2QYIA 2VU8E 4RSPA 4UDWH 1C9TA 1T8OA 2STAE 3RU4D 3RXHA 2ZDAH 2WV5A 3F1SB 1ZSLA 4GSOA 3ITIA 1FPCH 1YP9A 1MU8B 1C5UA 1N6YA 4CR9A 2J38A 3ZVEA 5A0AE 1UK3A 4H4FA 2JETB 2NU0E 3U9AH 5L30H 3VEQB 1VGCB 1SQOA 4B73A 1O3KA 2BY9X 4IBLH 4YO9A 3ZZ7A 2A7JA 2Y7XA 5DK1A 1QL8A 2HOBA 2P16A 3K2UA 1V2JT 1LMWB 1GI5A 3ELAH 1HXFH 1MKXK 2SGDE 4ZXYH 1SGTA 1Z8JB 4O3TA 1C5XB 1E34B 1P05A 4ZH8A 1O5GH 2BLWA 3PWCA 1PPHE 5EGMA 1YYY1 4J1YA 5K7RA 2C93B 1OS8A 2H5DA 1EZUC 1GJ5H 1QRZA 1WQSA 5GCHG 1W12U 1CGJE 1SQAA 3HGNA 2Q6FA 1PQ5A 3EYDA 3QK1A 1TRYA 5L2ZH 2ODQA 2A7CA 2XWBI 3LGIA 1O2MA 2R3UA 3NPSA 1AZ8A 2W26A 5LH8A 1QB9A 1SHHB 3BEFB 3RU4T 1GJBB 1MTWA 2OTVA 1LKBA 4JK6A 3DD2H 4NIVA 1C5SA 2WUBA 1ZTLA 1FNIA 5PTPA 2PGBB 3M61U 2SGEE 3ZV9A 1VITF 1P9UA 2BDIA 5JDUB 1O3MA 3QZRA 3SN8A 1Y3VA 2EI8A 1QTFA 3E16B 1TQ0B 1PYTD 3OY5U 1P9SA 3SO3A 2F9OA 3T62A 2V0BA 1D9IA 1S81A 4IC6A 6CHAC 2ZGHA 4UFGH 1SGCA 3GYMA 1JMOH 3SV8A 3SU2A 4FUJA 5DP4A 1HPGA 2B9LA 1TNLA 4AB9A 3RXSA 2UUFB 5GPIB 1YPHE 2A5KA 1Y3YA 5SGAE 2FLBH 3BEUA 3GCTG 3U1JB 2FS9A 3GOVB 3ENSB 3D49H 2AFQB 1EB2A 1XVOA 1GBEA 1UCYH 4NSYA 2BY7X 3MU0A 3TH2H 3U8RH 1C2GA 2VIDA 3UWIA 4B1TA 1GGDB 1CHOF 1RS0A 1V2LT 3M5OA 1F0TA 4OGXA 1INCA 1QRWA 1C5RA 2ULLA 8ESTE 2ZI2H 2FDAA 3GDSA 1NFWA 1HJ8A 3D62A 2GDDA 1QBOA 3F9HA 3S0NA 4X6NA 3EAJA 1UCYK 1DT2A 2FESH 1LHFH 4IW4E 1BCUH 4JZEH 3RUOA 3EDXB 3STJA 4XDEA 3BIVH 1MCTA 4UONA 3E6PH 4FUIA 1J16A 3H7TA 2Z9LA 1P8VC 3A83A 1C1QA 1MTVA 3SUDA 4JMYA 1GI7B 1GCDA 3EE0B 4WXIA 2CN0H 1W2KH 1F92A 2TGPZ 5GWZA 4FVBA 3RM0H 3BEIB 1T4UH 1MTSA 1TNHA 1AVGH 1SPJA 2BMGB 3FVFB 1P01A 2FOMB 4BTTB 1EAUA 4AGKA 1GHVH 1O38A 2BDYA 1NS3A 3UR6A 2FS8A 4XOJA 3ODDA 2R3YA 2G4UA 5E0GA 2ZFFH 1TB6H 1ZHMA 4AYVB 1AGJA 4DOQA 2VIOA 1HBTH 1J14A 1VITH 1PQAA 4YZUA 2QC2A 1JBUH 1GL0E 1WV7H 2ZHDA 1FLEE 1K21H 2ZDVH 5FHTA 1GDQA 2NU3E 2ZFTA 2PGQB 1C5NH 2OXSA 1JIMA 1FAKH 2ZO3H 1DWEH 2D26C 2O8TA 3P95A 2BZAA 5A0CA 1IQNA 1UTKA 2THFB 2OUAA 3K6YA 4FU9A 3UR9A 2GP9B 4NA9H 1EAXA 5JBBS 1IOEA 2A4OA 1QL9A 1EASA 2ODYB 3RDZA 5HGGA 1GI3A 4JZIA 1ZSJA 2BD9A 4BAOB 4X1QU 2VNTA 3ZVDA 1UHBB 1AKSB 1V2TT 3BTFE 4ZROA 2C90B 2F9BH 4CRAA 3SNBA 4WMEA 2G4TA 1GBLA 4BXWA 4FU7A 5E0HA 1A3BH 1O3PB 1DX5M 3P8GA 1N1LA 5ETXA 1ZRKA 1HIAB 1TOCB 2V35A 2HGTH 1F7ZA 2BX4A 1GG6C 1ZRBA 1O2RA 1CU1A 1GMDG 5J4SA 1QR3E 3RXLA 4GLYA 4E06H 1JIRA 1C5TA 2UWPA 1BTYA 1W7GH 4MNXA 2CMYA 3GY2A 1YPEH 1GMHG 4YOGA 1ZJDA 2XCFA 1DUAA 3SQHE 3PM3A 3PV4A 2V3HH 2UUJB 1J8AA 2B0FA 4ABEA 1T8LA 2H6MA 1TWXB 1ANDA 5IDKA 5EW1H 3N7OA 1MBMA 1C1VH 1BITA 2OBOA 3F68H 4I8KA 4ISNA 2PW8H 3ZYEA 4LZ4B 3SW2B 4YLUA 1ABJH 3E0NB 3GCTF 4XFQA 2ZPRA 1KY9A 2PKSC 5EPYA 3VXEH 2TGAA 1FAXA 1TPSA 1CHGA 2BB4A 2VH6A 3GCNA 1C5MD 6GCHG 4CRBA 4YTAA 4LK4A 2J4IA 4WJG2 1A1RA 1C2MA 4TPIZ 2FOAA 1ELAA 2XYAA 2A5AA 4NFFA 5EQQA 5JPMH 2AH4X 1J9CH 3SJIA 1C1RA 1O5DH 1BA8B 3ZZ3A 3UNQA 5F8XA 4DJZB 3SV2H 3HATH 2BXUH 1L1JA 2BDHA 1O2YA 4X8VH 1GBHA 1H4WA 1O39A 1TQ7B 4K1SA 2ZU4A 7KMEH 1A7SA 2OINA 2TGDA 2VH0A 3ZV8A 1P2IA 4INKA 1A0JA 4ZKOU 3SGQE 2AMDA 4QT8C 3GCOA 2A45B 2ZU2A 3RXGA 1KTSB 2FP7B 3SI3H 1E0FD 3GY5A 3UWJH 3JZ2B 4NA7A 3MNBA 1MAYA 1ZR0A 3BTDE 1ZTJA 1G3DA 1BRCE 3LU9B 2PSXA 4AZ2B 1VZQH 4ABBA 1G3CA 3M5MA 2BD5A 1AB9C 3AASA 2ILNA 1C1SA 1RIWC 1AHTH 1SOTA 2VINA 2VWMA 3CS7A 3KQCA 3RMOH 4MVNA 3RXFA 1Z7KA 3ZZAA 1MKWH 1O0DH 1OWIA 1ACBE 4XE4A 1S6HA 2G5VA 2ZDMA 2W5EA 1E38B 3F9EA 4MNWA 4TYDA 4JYTA 5C67A 3Q76A 2C8WB 2BQWB 1DXWA 2OC0A 4DIIH 5H4IB 1EZSC 1V2KT 3LH1A 4FUBA 2HVXA 3BSQA 4KTSA 3L33A 3RXUA 4B2AA 2Z9GA 1DFPA 1U6QA 2BLVA 3HK3B 1HAXB 1O2KA 4ZKRU 4UFEH 1MH0A 3ATIA 3SU0A 1Y8TA 3VB4A 3SJOA 4Z6AH 1MKWK 3Q77A 4ZUHA 1TX7A 1Q3XA 4Y8ZA 1C1OA 1O3BA 1UCYE 1E37B 1OWJA 2ZF0H 1X7AC 3V3MA 4DT7B 2CF9H 1SQTA 5DKMA 1S0QA 1Y3UA 3LGVA 1XUIA 4CBNA 1LHEH 1AVWA 2AERH 3RXIA 3LC3A 1UVTH 3U1IB 2JETC 1VGCC 1Z6JH 1GHYH 4INLA 4XBCA 5DJ7A 1PQ7A 4CRFA 3V13A 1Q2WA 4WY3A 1GMDF 2EC9H 2Y6TA 2ZGBH 1FIZA 1L4ZA 4CR5A 3GCHB 3SNEA 5JB9S 4YT7H 1H9IE 4JK5A 2ZCHP 2ZTYA 2QXHA 2ALVA 4I8LA 1NT1A 3A7ZA 1NRQH 3KN2A 1O3IA 2ZTZA 1TLDA 1LQEA 1M9UA 1K1LA 2R9PA 2VB0A 5IYTA 3A8AA 4JZFH 4ASHA 1S0RA 1D3QB 1NTPA 1XMNB 3LJJA 1KDQB 3GY3A 2A2QH 3GISB 1RRKA 1YLCA 2OBQA 1QQ4A 2FMJA 2CF8H 2Y81A 3Q00A 4IMQA 2BQ6B 5K0HA 4BXSA 3IITA 7ESTE 1T31A 1S84A 3UUZA 1C2DA 2Z3EA 1MU6B 4NWKA 3BTTE 4GVUA 5I25A 4OS1A 4IMZA 3LGTA 2Q6DA 1K1PA 1G2LA 3H7OA 2GCHG 7GCHF 1O2ZA 2A4GA 2PR3A 2TIOA 1DICA 3R3GB 1CBWB 4NIXA 1XX9A 4K60A 4X8UH 1P02A 1GI6A 1Y3WA 1O2JA 3QUMP 3UOUA 1YLDA 4D7GA 2ZNKH 3RMMH 2BHGA 4GHTA 3C1KA 2FOEA 3TVJB 4B2BA 1GI0A 2NU1E 1EX3A 2GGVB 4IGDA 3FP7E 2XTTB 3KGPA 5C1XA 3K6ZA 1P03A 2B5TB 3ZZDA 1YKTA 3OTJE 4GPGA 1GBJA 3M7QA 1O3OA 5DO4H 1WTHD 4K5ZA 1TOMH 5HYOA 1AO5A 1G3BA 3HPTB 1FN6A 1EPTA 2XRCA 1H9LB 1NPMA 1EOJA 3M3VA 4F49A 1ARCA 1DXPA 1O2LA 1GJAB 4NGAH 1JRSA 2W7SA 1O37A 1SVPA 1GMCF 2PTCE 4X2WA 4UD9H 2Z9JA 1KXAA 4D7FA 1EJNA 4UFDH 3UQOA 1GGDC 2ZQ2A 4KTUA 5L2YH 2FX6A 3ZVBA 3SZNA 4JZ1A 3RXVA 1QCPA 2VVUA 1DUEA 1TBRH 1BMLA 2BM2A 2CXVA 2P3TB 5GJ4B 1CE5A 5T3HA 1QJ1B 2WPMS 2SNWA 2UWOA 1THPB 4UFFH 1W11U 1PPZA 5BRRE 3RXRA 5CMXH 2OD3B 3A88A 1YF4A 3I77A 5E8EH 3PB1E 5F03A 4ZXXH 1ELTA 1O3FA 3MH5A 3RLWH 3SGBE 2GT8A 1KYNA 1Z6EA 4ZMAH 4NG9H 2ZFPH 2Y5GA 3ATMA 2BQ7B 2ZU1A 1GHZA 1EKBB 2BTCE 3K9XB 1BZXE 1P12E 3SNAA 1LCYA 4Y0ZE 3T26A 1SLWB 2GVFA 3URDA 1MTUA 2G00A 5L6NH 2W7UA 4A1XA 1UO6A 5FBIA 3L3TA 3PO1B 4I8GA 3RC5A 5LPRA 1L0ZA 1NRPH 1Y5UT 1BDAA 1EAIA 1W14U 1EXFA 3TJUA 1LPKB 4IN2A 4HGCA 2IJOB 5LPEA 1QIXB 3UQVA 1EOLA 2YOLA 2ZECA 1XUKA 5C2ZA 2A0QB 1QJ7B 3BV9B 3UY9A 3OX7U 1H1BA 4A92A 3F9FA 1GJ8B 1PQ8A 1T4VH 1V2WT 3P92A 2WPHS 4KGAA 4HZHA 2BD3A 1MAXA 1QQUA 1C4V2 2YNAA 4Y8YA 1C1UH 1NC6A 1W8BH 1ESBA 2CHAB 5FPTA 3M7TA 1MTNB 2ASUB 3SQEE 3BG4B 3SUEA 3SNCA 2SGPE 2G52A 2ZP0H 3B23B 3PMHB 3WY8A 1GI8B 1FI8A 2RG3A 1E35B 1J17T 2HWLB 4DCDA 3SHAH 1QRXA 5E2OA 2VIQA 2V6NA 4VGCB 2ZIQH 4FUDA 5FPSA 3O8BA 1GBFA 1TBQH 3RXKA 3MU4A 3T28A 3I78A 1YCPH 3RC4A 1AKSA 1P09A 2GCHF 2P59A 4CRDA 2KAIB 1SOZA 5DPAA 1O2XA 1AFQB 1PPFE 3W95A 3AAUA 1RTLA 3LONA 1O2IA 3SU6A 5T6GA 3RMLH 1HIAA 1V2PT 3A85A 1TMUH 2VWNA 1F5LA 1LVMA 4ABDA 5CHAB 1YCPK 3ATKA 1FN8A 2UWLA 2D2DA 2A4RA 5DP6A 4O97A 2FIRH 1AIXH 1IHSH 3NCLA 3DFJA 1K22H 1O5CB 4ZAEA 3MNSA 3MH7A 4KELA 1S83A 1BIOA 1MZAA 3MO6A 3AAVA 2P93A 1K2I1 1DS2E 4HI3A 3T25A 3SOSA 1A61H 4DGJA 4LOYH 1C5PA 4X8TH 3O8DA 1C1PA 1GHWH 1UK4A 4CHAB 1THRH 3PTBA 1IQIA 4ESTE 1SGIB 1O3DA 5HM2A 1MD8A 1KLTA 1HJ9A 1ZZZA 2Z94A 4AFQA 2IPHA 2ZEBA 1TALA 2BDBA 2J92A 1FUJA 1FY1A 2ALPA 5BPEA 4WVPE 4XSKU 3U98H 3RXBA 3A86A 1EJAA 3U8TH 1JOUB 3AW0A 2FI5E 3SU3A 5A2MH 2B8OH 1G9IE 1SLUB 1MBQA 1G37A 4Q80A 2P94A 2QXGA 1EZQA 1GI1A 1Y59T 2SFAA 3UOPA 1UTNA 5C5NA 3A7TA 1FY8E 4Y8XA 5AVDA 1EQ9A 4FUHA 4F4OC 4FUFA 3LH3A 3RU4E 5GDSH 1L1GA 5E2PA 5JYIA 2VWOA 2PV9B 1O2OA 1ANEA 2FOHA 1S82A 4AG2A 2OP9A 1AY6H 1Y3XA 3RP2A 3T2NA 2ZU3A 5AFYH 1PYTC 3I29A 1IQKA 1O2GH 2UUKB 1GVLA 5DG6A 4WXVA 1C5LH 1AZZA 3A8DA 1DLKB 1HAVA 4YESB 3LJOA 1GJCB 2STBE 4YOJA 2ZDNA 1DLEA