2NU4E

Accommodation of positively-charged residues in a hydrophobic specificity pocket: crystal structures of sgpb in complex with omtky3 variants lys18i and arg18i
Total Genus 50
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
185
structure length
185
Chain Sequence
ISGGDAIYSSTGRCSLGFNVRSGSTYYFLTAGHCTDGATTWWANSARTTVLGTTSGSSFPNNDYGIVRYTNTTIPKDGTVGGQDITSAANATVGMAVTRRGSTTGTHSGSVTALNATVNYGGGDVVYGMIRTNVCAEPGDSGGPLYSGTRAIGLTSGGSGNCSSGGTTFFQPVTEALSAYGVSVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Streptogrisin B, Proteinase B
publication title Accommodation of positively-charged residues in a hydrophobic specificity pocket: Crystal structures of SGPB in complex with OMTKY3 variants Lys18I and Arg18I
rcsb
source organism Meleagris gallopavo
molecule tags Hydrolase
total genus 50
structure length 185
sequence length 185
ec nomenclature ec 3.4.21.81: Streptogrisin B.
pdb deposition date 2006-11-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nu4E02
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 2nu4E01
4AYVB 1SLWB 3GY4A 3RXAA 5T6GA 1T32A 3E3TA 1BTPA 1VITF 1AWHB 1GMCG 1O2RA 3GY8A 2WV5A 1G2LA 5FBEA 1KXEA 4MLFB 2PTNA 3RXEA 2QY0B 3RXVA 1Z1IA 1PQ7A 4JZ1A 1Z1JA 3KGPA 4CR5A 1L1JA 4THNH 1BUIA 1AE8H 1D3PB 1Y3XA 2ZU3A 1YGCH 4BAOB 1XKBC 1UJ1A 3K2UA 4FUBA 5DP3A 3K65B 4YOIA 2QXJA 1SVPA 1C5WB 2J38A 1O33A 3M37A 2F9BH 3ZVGA 4OGXA 2FI5E 1UVOA 2HNTE 3DT0H 3ZYDA 7LPRA 2GCHF 4YLUA 2Q1JA 1GGDB 2OP9A 5AF9H 4GVUA 3KQBA 2ALVA 3PM3A 1FPHH 3MH4A 1O2PA 3BIVH 2VVUA 1NRQH 2AFQB 3TJOA 3GY7A 1GBJA 1B0EA 3A8DA 4ZKNU 2A4OA 2HVXA 3E0NB 2ZZUH 1SPJA 4K60A 4Y7AA 1RGQA 1JOUB 2YNAA 2FO9A 1IAUA 1HAPH 2FOFA 1C9TA 2XBYA 2TGPZ 2FOAA 2ZWLH 3RU4D 1AKSA 1GBTA 1ZMJA 1GBCA 2VVCA 3T2NA 3SU2A 1DANH 1ELGA 2A1DB 3RXQA 1THRH 4H4FA 3LU9B 3E91A 2ODQA 1ZPZA 1X7AC 4JYTA 1GMCF 1MZAA 1C1NA 3OSYA 5J4SA 5EQRA 1ZHPA 2XCNA 1W0ZU 3ATMA 3SU6A 1HAHH 1TPSA 3SU5A 2JH0D 3TK5A 1QB1A 3LC3A 4TY6A 5JDUB 4DGJA 1C2DA 2QC2A 1KXCA 4A6LA 1GBEA 3HKJB 1SGYE 4Y8XA 3U1IB 1WQVH 1S6FA 2BVSH 2OTVA 1HPGA 3W94A 2KAIA 3STIA 1DLKB 3RXDA 1TPAE 2A5KA 1TABE 4VGCC 1O5EH 4NCYA 2PHBA 1BITA 1O3BA 2GZ8A 2Z3DA 1S0RA 3M5LA 3MNXA 4O3UA 4B74A 1A5HA 4IMQA 2H6MA 4BXWA 1CGJE 3E6PH 2NU0E 4FUFA 3RU4E 2TIOA 1RTFB 2UUKB 2JETB 2W3KA 1BHXB 1WU1A 5DKMA 1THSH 1TX7A 3NWUA 2WUCA 2ZGBH 1P09A 1HCGA 3VPKA 2QF3A 5FXLA 1EAWA 2AMQA 1LCYA 1F92A 3QUMP 1TRMA 3BSQA 1O5AB 2ODPA 1SLUB 1OWEA 1IHSH 4X6MA 3SJIA 5GWZA 2W26A 1OPHB 1JBUH 1EJAA 3SV6A 1D3TB 3TJNA 1LKBA 1J9CH 8KME2 2BY9X 1GI4A 2GKVE 2Y5HA 1C1OA 2J92A 1GJBB 2BZAA 3A7YA 1UTOA 2TBSA 1ANCA 1HXFH 3SU1A 1O5CB 3RXPA 3P6ZB 3PO1B 3ATLA 4YZUA 1LKAA 3ODDA 3RXHA 5JBTA 2M5TA 2ODYB 3KQEA 2ZFQH 3LGUA 5C5OA 1ZSLA 2FESH 2V35A 1C5RA 2D26C 1DWCH 1OP8A 3A84A 4A5TS 4DW2U 1O5DH 2XC4A 1IQEA 2PSYA 2V3HH 3RXSA 1BMNH 3P8NA 5GPIB 2UWPA 2SFAA 1OYQA 1YPLH 1S0QA 3BEUA 3RC6A 4FU7A 4KP0A 4OS6A 1UO6A 3A86A 2ZGXH 3GYLB 1PYTC 1BDAA 2VIDA 3MH7A 1VZQH 1Z8GA 1A61H 2BD9A 3M7UA 3F6UH 6GCHG 1UHBA 2NWNA 5ESBA 5HXFA 4U30A 1N6XA 2QCYA 4BTUB 1ZHMA 2P59A 3KEEA 1L1NA 2VWNA 2O8UA 2ZA5A 3ZVCA 1E34B 3P70B 1AO5A 1DX5M 3RXRA 1MMJN 1KTSB 2P16A 2R0KA 1KIGH 4WF8A 1MTWA 2NU2E 3B8JA 2Z9JA 3TJVA 1OWDA 1IQLA 4BOHA 5F8TA 1AWFH 1AFEH 1PFXC 3PWBA 1ZTKA 3UIRA 2GP9B 1PYTD 3GCHC 3RC5A 2UWLA 2ZFTA 1UVPA 2WYGA 2WPJS 2BQ7B 3M7TA 1L0ZA 1P3EA 2VGCB 5A0AE 2BOKA 1YYY1 4NIWA 1K1PA 4D7GA 1LHCH 4GCHG 4AZ2B 3AAUA 1SB1H 3BIUH 2RG3A 1PPCE 1ELDE 3QDZB 1F5LA 4JK6A 1O30A 2BDCA 3BEFB 2XBXA 3RM0H 2CF8H 4XBDA 3HATH 1OSSA 1W11U 2OUAA 2IPHA 4R0IA 2ZDKA 1FAXA 2GZ9A 1BMAA 1CBWB 1EPTC 2ZPSA 2P3TB 5DP9A 6GCHF 5AFZH 1XUGA 3IWMA 4Q7XA 2FWWA 2FOHA 1C4V2 1XUKA 5JB8S 2A7HA 3BV9B 2ZECA 4Z6AH 3U98H 1AZZA 3FZDA 2B9LA 4GLYA 1UTNA 3ZZDA 1FLEE 3ZZ4A 3HK3B 4UFFH 4VGCB 4OS5A 1ELCA 1HXEH 1QCPA 1G36A 1V2VT 3Q3YA 1TAWA 1FZZA 2G8TA 4AB8A 1O35A 3I77A 1WCZA 4D9RA 4J2YB 1CVWH 5IYTA 2ZFFH 4ZUHA 4E7RG 3ELAH 2OXSA 3T28A 2FIRH 1PPFE 1GVLA 1ESTA 3OY6U 1DWBH 1A5GH 4GCHF 5DGJA 4B76A 3V3MA 1YCPM 4WXIA 2ZDLA 3M5MA 5EOKA 2IN2A 4I31A 2Z3EA 1C5VA 5FCRA 2H9EH 1VCWA 2O9QA 3RLWH 3VB7A 1GBLA 1DUAA 1UTQA 5EQSA 2PSXA 2O8LA 1TX6A 3PB1E 4AFUA 4MNWA 4PROA 5F03A 3NKKA 1AD8H 4I8JA 1ZRKA 1C5PA 1EJMA 1GI6A 1MKXK 2ANYA 4LK4A 1C2JA 1MUEB 4U2WA 3FFGA 3A80A 3SV2H 4DG4A 1S84A 4NIVA 3SU3A 3SUDA 1TX8A 2Q6FA 2UUFB 4NFFA 1KLIH 1O32A 3UTUH 1SQTA 4ZHMU 1O3DA 2AIQA 1C1WH 1DT2A 4XSKU 2Q6DA 1O3NA 1VJAU 1Z8RA 3EA9A 3DD2H 1S82A 2C3SA 4TWWA 5FHTA 4U32A 2BVXH 3LJOA 2R9PA 3PMAB 1WTGH 3TH3H 5EXNA 1C5TA 2D1JA 2GDEH 3CS0A 2PGQB 1CGIE 4BXSA 5EGMA 5FCKA 4O03A 4Y71A 5C1XA 1GI0A 3KF2A 1FNIA 1TGBA 2VWLA 1AY6H 4A92A 5DJ7A 1ETSH 3S69A 4WMDA 3DFLA 1T7CA 2G81E 7KMEH 1LPZB 1O37A 2FM2A 3QZRA 4X2VA 2BDGA 1HJAC 2FX4A 3GY3A 1EOLA 1T31A 1QQUA 4K5ZA 5DP8A 2FPZA 3SUFA 1V2MT 1KYNA 4BAQB 1O2NA 5EQQA 1O2UA 1HJ9A 1PPZA 3UNQA 4NIXA 4WMEA 2ZU1A 2G5NA 4MTBA 3ATKA 4XOJA 3RDZA 3EDXB 1NTPA 3EQ0H 1IOEA 1VJ9U 2ZHEH 1MU8B 1SGFG 2ZFSA 2TRMA 4AX9H 1HJ8A 4B73A 3BF6H 1GJ8B 1Y8TA 1NPMA 1HBTH 3UR9A 1ZRBA 2GX4A 2PKAA 4CHAC 1O3IA 4ISIH 1FIZA 1DFPA 4HI3A 3TIUA 4ZKOU 1ZYOA 2JH6D 1S83A 1MAYA 1H4WA 4OGYA 1UK4A 4INKA 2BLQA 5FX6A 3E1XB 2ZP0H 1OXGA 3TK6A 1DXWA 1UVSH 2C8WB 2F9VA 2ZGHA 1ELBA 1FY3A 1DICA 4BAKB 1IHTH 2EA3A 1SHHB 1LVBA 1V2PT 4D8NA 3Q77A 3IITA 4FVBA 1TMTH 1GJAB 1QRXA 1VGCB 3SJOA 2WV4A 1FV9A 1P2IA 1YPKH 1CE5A 3SQHE 1ANBA 1O2WA 2ANWA 1GBAA 5EXLA 2VB0A 3RXLA 1ANEA 3KHVA 1B7XB 1C1VH 3RLYH 1BRBE 5DP5A 1CHGA 1MH0A 4Y7BA 1DY9A 1TNJA 2AGIX 4I32A 2QF0A 3RC4A 1HAXB 2G55A 1FIWA 1J14A 3WY8A 8GCHG 1YLDA 4SGBE 4MPVA 1TPOA 2BD8A 1DWDH 3DUXH 4KKDA 3PLBA 3TH4H 1ABIH 3VGCC 2FI4E 4Y76A 1TNHA 2F9NA 3B9FH 2BD5A 1BBRK 1GHXH 1NRNH 2ZTXA 3AW1A 1KTTB 2FS9A 3M5NA 1XUJA 1Q3XA 1C2EA 4JZFH 4AYYB 1TBZH 1AB9C 1SSXA 1C5QA 3SNEA 2HLCA 2TGTA 3I29A 4UFGH 4A1XA 1O3LA 1EB2A 1VCQA 1AVWA 4NFEA 2V0BA 2C8ZB 4K8BA 5PTPA 1GBKA 1J15A 5T3HA 2TPIZ 4TPIZ 1XUFA 4RKJB 2PTCE 4AG1A 3R3GB 7ESTE 5F6MA 5LPEA 1E35B 1GHBG 2XBWA 1GDNA 1QA7A 2THFB 1P2OA 3GOVB 2Z9IA 1FI8A 1P02A 1FPCH 3RXKA 4YLQH 1ARBA 4UD9H 1HIAA 2BZ6H 2YOLA 3H7OA 2AMDA 4XBBA 2F3CE 2P8OB 4X0WU 5JYIA 2O8TA 2QAAA 4XBCA 1BJUA 1RIWC 1VR1H 3SW2B 5BPEA 4Q7YA 4K8YA 1P9SA 4JMYA 3MH6A 4NSYA 1LQEA 5FBIA 2A4GA 3ZZ6A 1A5IA 1W8BH 1S81A 3A87A 4ABIA 1LVMA 1TMBH 1MTNB 1VCPA 3L6PA 2BM2A 1TMUH 1XXFA 1ANDA 1F2SE 1GWAA 4B2CA 1JIRA 1MKXH 1T8NA 3RXCA 3OX7U 4CRFA 4MPUA 5LH8A 4DVAU 1O5BB 1D6RA 1EZSC 1MD8A 1NO9H 5EODA 1PPBH 1AGJA 4Q2KA 3BTTE 1C1TA 1GDQA 8LPRA 1MTVA 1O3KA 1GHBF 3ZZ3A 4ABGA 1VITH 4B75A 4DY7B 1QL7A 1IQIA 3CP7A 1QJ1B 5T6FA 3SUGA 3R0FA 2J9NA 3TU7H 1DITH 1V2QT 3V13A 2BDIA 5DP7A 3O8DA 1SGDE 1H8IH 2QN5T 1LHDH 4XE4A 4KTCA 1MD7A 1OOKB 5L30H 3QTOH 2R0LA 2EC9H 1GMHG 1D4PB 3P92A 2VWOA 1V2NT 3SBKA 1GJ6A 2LPRA 1BRCE 3GYMA 1E36B 4ABHA 1Y59T 2C8XB 1BTXA 1LMWB 5EW2H 1V3XA 2Y80A 4NWLA 4CHAB 1TQ7B 3QO6A 1QRZA 1W12U 1O34A 1HAVB 1TGCA 1GJ7B 2BLVA 1P2NA 3A7TA 1P11E 5JPMH 3B23B 1QBVH 3P8FA 4WVPE 4Q7ZA 2IOTA 1NFYA 1OWIA 2A7JA 5K0HA 4WMFA 1ZR0A 2GDDA 4DT7B 1N8OC 3RXJA 1GI9B 1YPHC 2FS8A 1CQQA 4U01A 2QIQA 2O8MA 3UNSA 2ZHFH 4AFQA 4AG2A 2ANKH 3U1JB 4RN6A 5C1UA 3PWCA 2DUCA 1KXDA 1QNJA 4ZHAA 2ESTE 1J8AA 2B7DH 5HYOA 4MNVA 3KQCA 3LIWA 4MNYA 3F68H 2FZZA 1W13U 1MKWK 2BDAA 1MZDA 4X8SH 1TNIA 3ZVAA 4YT6H 3A81A 4OS4A 1ZPCA 1LPGB 1A0LA 2VU8E 1GI7B 5LPFA 3BEIB 2W5EA 2BQ6B 1OKXA 3SHAH 1GMHF 1O2GH 1Y5UT 2F91A 4H42U 4K1EA 3KIDU 1V2RT 2G51A 2VIOA 5AFYH 4JCNA 2QYIA 1FDPA 3FZZA 1OWKA 2FTLE 1MQ6A 4FVDA 1O0DH 1UK3A 1O3AA 5GXPA 2ALPA 2Y5FA 3TGKE 1UTKA 5B6OA 3VGCB 1SFIA 2B8OH 4ZAEA 3RXMA 1GBMA 1TNLA 2D2DA 4E06H 1T8MA 2ZHQH 3MNCA 2GCTC 4FU8A 2A0QB 4JYUH 4FU9A 1EUFA 2ZDMA 1IQNA 5ETXA 3UQVA 3MYWA 1E38B 4DIHH 1NY22 2R3UA 2FOCA 2A5AA 2AEIH 2FODA 4B71A 1SOZA 1O2XA 1K21H 2STBE 1BBRE 2Y82A 4K1TA 3EE0B 2ZIQH 3RMMH 4XFQA 5E2OA 3M3TA 3BG4C 3PMBB 2ZEBA 3FP7E 1AMHA 3FANA 5E8EH 4ZHLU 2ZCLP 4JYVH 1V2LT 2IJOB 4D7FA 1KLJH 1H9LB 3MMGA 3U9AH 2Z9LA 1CT0E 1YPHE 2QXGA 3AAVA 1RIWB 1YPMH 3ZVBA 3G01A 1NRRH 1BBRH 3BTWE 1GCTC 3W95A 2SNVA 1TBRH 1L1GA 4CRAA 2PKSC 1NN6A 3KQDA 2FTMA 2VIPA 1GJ9B 2Z94A 1JRTA 1MAXA 1SGPE 2GMTC 3U69H 1F5KU 1CA8B 3S7KB 3VB6A 1HAIH 4ASHA 2HALA 4D76A 2BD2A 3BTDE 5A0BA 2F9UA 1F0UA 1RXPA 2J4IA 1GL1A 2ZF0H 2ZPQA 1SGTA 1UTPA 3Q00A 1GBBA 4Z0KA 1V6DA 3KL6A 3TLOA 2OD3B 1O3GA 1AIXH 5A8XA 2AYWA 1MTSA 3TH2H 4KTUA 1P2QA 1EASA 2R3YA 4I8HA 3GDVA 1ORFA 2WUBA 3HK6B 1BQYA 3QGNB 5A8ZA 4AB9A 3UUZA 3GY2A 1MBMA 4MPWA 4IBLH 1LVYA 1QB9A 2FDAA 5DG6A 3ZV8A 2EI6A 2HOBA 4ABDA 1Z6JH 3RXOA 2WPMS 2NU3E 2ZQ2A 3AASA 4Y0YE 4CRCA 1GVKB 2OQUA 1U6QA 5CHAC 1FAKH 1G3BA 3MU4A 1D3QB 2QA9E 5FAHA 1PPHE 4Q80A 4YO9A 2FLBH 3UWIA 1IQGA 4JZIA 1LHEH 2J94A 1TONA 1K1JA 4UFDH 2XYAA 1WTHD 4LXBH 1ESBA 4GHQA 1ZGIA 1QL9A 1C5LH 4OS2A 3RM2H 2HPQH 2XWBI 1C1UH 2TGAA 2Y81A 3S9BA 2Y7ZA 4BANB 1RFNA 2BDHA 1Z7KA 2Y5GA 1P2KA 2VVVA 2BXTH 4E05H 2RA3A 1ZHRA 4IN1A 2J2UA 1AU8A 1JMOH 4DJZB 3P17H 1FY4A 2ZHDA 4YOJA 4FUIA 1P0SH 2HRVA 1AFQC 1P57B 1C5YB 1WOFA 5E0HA 4KGAA 4I7YH 1TLDA 2FOMB 3SV8A 1XUHA 4NG9H 4R8TB 1HB0B 2Z6BD 1H1BA 1GHYH 4CRGA 2NU1E 1G3DA 2Y7XA 1GI1A 1QFKH 4NWKA 1C1SA 3TJUA 2ZQ1A 3MO3A 1QB6A 1JRSA 1J16A 1LO6A 4GPGA 2G00A 4TY7A 3NPSA 2OINA 1DM4B 1Y5BT 2BXUH 1BJVA 2ZO3H 1ZMNA 5T6DA 4MG3A 4TWYA 5I46H 1SLXB 3TGIE 3O8CA 5JBBS 1P05A 1YF4A 4AGJA 1CA0C 1ZSJA 4CBNA 1ZJDA 3MNBA 3CENA 2GZ7A 1F0TA 3VFEA 4AN7A 2C4FH 3T29A 3L3TA 2SGPE 4X6NA 4YESB 3UREA 1MKWH 5G4BA 5GDSH 1KDQA 1BTZA 5A0CA 1FJSA 4FUEA 1ZSKA 1KDQB 1ZTJA 2BQWB 3TK9A 5FPTA 2H1UA 1G32B 1TALA 4IS5A 1EAXA 4NGAH 1ELAA 2OC0A 1TRYA 4YTAA 3BG4B 1QURH 4NZLA 1QBOA 3E0PB 1CGHA 3LKWA 1QJ6B 1T4UH 2LNCA 4FXGH 3MOCA 2CN0H 1WAYB 4UE7H 1JWTA 1FY1A 4Y11E 2RDLA 4ZMAH 2C90B 4FUHA 3F9HA 3GDUA 3ZV9A 2I6SA 4CBOA 5HM9A 3RMOH 1C2HA 1GCTB 5CE1A 4WH6A 2PKSB 4Y10E 3T26A 1XXDA 2SGDE 3MNSA 1O2LA 5EXMA 4X6OA 3UWJH 1P9UA 1KSNA 1LVOA 3P95A 3SI4H 1F5RA 1GG6C 1O39A 4O9VA 5L6NH 5A2MH 1EQ9A 2Z3CA 4FUCA 5E2PA 3ZZ8A 3E16B 4X1PU 1O3EA 1NFUA 3OU0A 4A1VA 3ZZ5A 1BTUA 2ZU4A 1QIXB 1GHZA 1SQAA 3QX5H 2WPHS 3PROA 2XWAA 3UQOA 1UTJA 3LOXA 4I8KA 1G37A 2WPLS 4CRBA 1EXFA 2SGQE 2C93B 2OBQA 1O2ZA 3SO3A 3NZIA 3A83A 1NESE 2A2XH 1ZLRA 1FN6A 4ZKSU 3FAOA 3SU0A 1DPOA 1D3DB 5IDKA 7GCHG 1HAOH 4X1SU 3F9EA 3ITIA 4IW4E 1W2KH 2BX3A 2ZPRA 1SHYA 1CT4E 3MTYA 4K2YA 1YCPH 2BDYA 1AZ8A 2I6QA 3CS7A 2W3IA 3GCHB 3RXBA 1D6WA 1W0YH 1F0RA 1HRTH 1GGDC 5F8ZA 1ZTLA 1NZQH 1CT2E 1GHAG 1PQ5A 1TGNA 3QN7A 3M3VA 3M7QA 3S9AA 3SOSA 1BT7A 1V2OT 3LGWA 3GY5A 2VWMA 4D9QA 1P03A 1TGTA 2FOGA 1SL3A 1C2GA 3LDXH 2XRCA 3LH1A 1QA0A 2ZCHP 4ZH8A 2QXIA 2OC8A 3M36A 1T8OA 3PMJA 4AFSA 1A0HB 1PJPA 1C2KA 1YPGH 2XNIA 1XKAC 2GGVB 2GT7A 4YT7H 1EPTB 1EZQA 1CO7E 2CV3A 1FONA 3LJJA 3OY5U 1DSTA 3A85A 1SGQE 2ZDAH 3ZZAA 3A82A 3ZYEA 1MU6B 1QJ7B 4YOGA 6CHAC 3LGTA 3QK1A 1TBQH 3N7OA 7GCHF 2QXHA 3GICB 9LPRA 1RTKA 1FY5A 1TGSZ 4ABJA 5C3NA 1O2YA 1O2IA 1HNEE 3NXPA 2OCVB 3MFJA 2PGBB 3SORA 3EA7A 4X1QU 2PUQH 1GHAF 1AN1E 2A32A 2CF9H 4MNXA 3UOPA 1P06A 1MBQA 1BRAA 1CA0B 1LTOA 1MCVA 1G3EA 2JETC 5LGOA 1ACBE 2XC5A 3HKIB 2VIQA 4BAHB 1NU9A 4DURA 4B1TA 4WWYA 3UPEA 4NA8A 1KXFA 3GCTG 4ISOA 1OP2A 1DOJA 4AORA 2VINA 3GDSA 1P01A 1GJ5H 3L33A 2SGAA 1H8DH 4Y6DA 1O2SA 4INLA 2OBOA 1DSUA 3SNDA 3PLKA 1WQSA 2PV9B 1A7SA 5H4IB 1O31A 1EZUC 2BX4A 6ESTA 1EX3A 3SNCA 3GCOA 1TNGA 1SG8B 5ESTE 1OP0A 2UUJB 1QGFA 4ISNA 1HLTH 3QTVH 1A3EH 1ETTH 1O3CA 3Q76A 2J95A 3T62A 3TITA 2PUXB 1MQ5A 2DE8A 1S5SA 1GCDA 1XVOA 1LHGH 1NU7B 1S6HA 1ELFA 1C5UA 1GJDB 3STJA 2A45B 4HTCH 3PO1C 1RRKA 4ISLA 1SGFA 4X2WA 3IG6B 4H6SB 1TB6H 3RMNH 1EB1H 1GG6B 2ZU5A 1DVAH 1C1MA 3SU4A 1A4WH 1O2TA 1TOCB 2VNTA 5A8YA 1HJAB 1L2EA 3PLPA 3SGBE 3PTNA 3FP8E 2ZHWH 5A09A 4IC6A 1O2HA 1GPZA 1TE0A 3D62A 2GVFA 3C27B 1AUTC 3GCTF 4IN2A 3RXUA 4GAWA 3U8OH 3V0XA 3QWCH 1YPEH 1HDTH 1O38A 4X1NU 3SGAE 2AS9A 2H5DA 1C5NH 4FUGA 5E0JA 1GBIA 4KTSA 1SBWA 4E7NA 1QTFA 2Z9GA 4BAMB 3MU0A 1HFDA 5ABWA 1N6YA 3UR6A 3MI4A 2FMJA 4B2BA 1K1OA 4RSPA 2ZCKP 8ESTE 2V6NA 1C2LA 2AERH 5FPYA 1M9UA 1BHXF 4MVNA 1DS2E 4X6PA 1UK2A 3U8RH 1HAVA 1E37B 2Z9KA 2HNTF 2ANMH 4ZXYH 1SGEE 1DE7H 2H5CA 1QL8A 2F83A 4FUDA 4CH2B 1WUNH 9ESTA 3MH5A 3TNSA 1ZGVA 3ENSB 3SZNA 2W7SA 2BLOA 1Y3VA 3PV4A 2UWOA 1UVTH 2Y6TA 2OLGA 5CMXH 2VGCC 1OYTH 2H9TH 3TPIZ 1LDTT 1O3OA 3SN8A 2PR3A 1RJXB 3LGIA 1NRSH 4TYDA 2H2ZA 1BOQA 2YNBA 1AKSB 3A7WA 3MHWU 1QBNA 1Z8JB 1XMNB 3T25A 2NU4E 3K6YA 3SNBA 1PQ8A 1V2ST 1BMLA 1YKTA 3GCNA 1C1QA 1YP9A 3I78A 4X2XA 3A88A 5JBAS 4AOQA 1AQ7A 1O2KA 6CHAB 4K69A 1CBWC 1JXPA 1INCA 1SGCA 4M7GA 2ILNA 2ZKSA 3BTHE 3VXEH 1E0FD 4GHTA 2Z7FE 1TOMH 1FQ3A 3QZQA 2GTBA 2A7CA 4ABFA 3S9CA 2PFEA 3URDA 1G3CA 3K6ZA 3M35A 2WYJA 2KAIB 4CH8B 5E0GA 1V2JT 1GVZA 1O36A 2ZFRH 2JKHA 4GSOA 1AB9B 1NM6A 1P2MA 3NUMA 3TNTA 1EP5A 1QQ4A 1NRPH 1ZJKA 3O8RA 1SFQB 2J34A 1QR3E 1PQAA 4INHA 1P10A 1GDUA 3A8AA 1SI5H 5HGGA 1SQOA 4MPXA 3SV7A 1C4Y2 3C1KA 3ZZCA 2BY6X 4X1RU 2P94A 1SLVB 2D8WA 5L2ZH 4O3TA 1K1LA 2ZTZA 5DO4H 1IQJA 2HPPH 2ZFPH 1TQ0B 3V7TA 5GJ4B 1FY8E 1P12E 1S85A 2XCFA 2AGGX 1DLEA 3BG8A 3PTBA 2HWLB 1GL0E 1HV7A 1UTLM 1UTMA 3A7XA 4WXVA 4OS7A 1ARCA 2TGDA 2O8WA 2CMYA 1BTWA 3EYDA 4JZDH 4DOQA 1YCPK 1KXAA 4Y0ZE 1ID5H 3HPTB 2WINI 3ZVEA 1EKBB 5TCCA 3F1SB 3M3SA 1BIOA 1F7ZA 2FI3E 3H7TA 2ZGJA 1EP6A 1FUJA 2FYRA 1SC8U 1K28D 1HUTH 1BB0B 3LGYA 1AHTH 3T27A 2UUYA 1Q31A 3JZ1B 3E90B 2ZTYA 4UDWH 4UFEH 1GBHA 2RCEA 3BTME 1UVUH 2F9OA 4ZROA 1J17T 1QRWA 4NZQA 3VXFH 1K9OE 4KELA 1THPB 2SGFE 2QGRA 1FXYA 1QHRB 2GV7A 2XTTB 5EPYA 1O2JA 1Z8IB 3P8OA 3FP6E 1TWXB 2BHGA 4A7IB 5K7RA 1ELTA 1B0FA 3SHCH 1AUJA 1UHBB 3RUOA 1ESAA 4O97A 1P2JA 2V3OH 3ATWA 3SUEA 1CHOG 1N8OB 1IQKA 3KN2A 1GI8B 3JZ2B 5C2ZA 1O3HA 2WPIS 3VB4A 2W7UA 3TVJB 1Z71A 3PMHB 2BD7A 5TCAA 1NFWA 3A7ZA 1XM1A 4WJG2 2FLRH 1SR5C 4HZHA 3NK8A 1XVMA 1W10U 5JBCS 2EI8A 5FX5A 3QGJA 1GBFA 4TPYA 2VH0A 3Q3KA 3AVZA 3RXIA 1CSOE 4BTIB 3ESTA 4K3JA 2PW8H 1FMGA 1C2MA 2BYAX 1Z6EA 4NA9H 2RA0A 3DHKH 5F8XA 1NC6A 3VB3A 1LQDB 1C5OH 3MU5A 1VGCC 4H6TA 1C5XB 2QV1A 1UCYK 5DP4A 3MU1A 2ASUB 2BB4A 2ZG0H 3ZZ9A 3LPRA 1BRUP 1Y5AT 3Q3XA 1D9IA 1K1MA 2AMPA 3DA9B 1A0JA 5EPNA 5EW1H 1GHVH 3UY9A 1H9IE 2DE9A 1HYLA 3AW0A 2ZDVH 1A2CH 4ABBA 2ZI2H 3ZZ7A 2FP7B 3ODFA 1O3FA 1T4VH 5DK1A 1YC0A 2OQ5A 1WSSH 4X8VH 3ATIA 1CHOF 1K1IA 2ZDNA 1O2VA 2GCTB 1IQFA 4NA7A 2P3FH 2CHAC 2G4TA 4JK5A 1IQMA 3A89A 4IC5A 2BMGB 1YPJH 1KXBA 1L4ZA 4HGCA 5L2YH 1YM0A 4XDEA 4DCDA 1SMFE 4QT8C 1TPPA 2VIWA 4Y79A 3LONA 1HAZB 2FOBA 1F0SA 1O5FH 3URCA 5DPAA 4ABEA 2A5IA 1XX9A 3BTKE 4UEHH 1C4U2 3D23A 2CXVA 2K1QA 2SNWA 1N1LA 2AGEX 2XW9A 5HMAA 1AE5A 1XUIA 3RXFA 4LOYH 3SJ8A 1O3PB 3O8BA 1C1RA 1QY6A 4F4OC 1ETRH 2ULLA 1DDJA 4WH8A 3SI3H 2XC0A 1B5GH 2H9HA 1C5ZB 1AVXA 3DFJA 1CU1A 2P8OC 2BY8X 4GUXA 2STAE 1IQHA 1GJCB 1HGTH 4X2YA 2FYQA 2GMTB 2P93A 3U8TH 1YBWA 3UOUA 1C1PA 1BCUH 3MU8A 1JIMA 1ZMLA 1BTHH 1TNKA 2A4QA 1O3JA 3OYPA 5C1YA 2AH4X 2BY7X 3LH3A 1L4DA 1GBDA 4ABAA 1P8VC 3KCGH 1AI8H 3E8LA 1MTNC 1NS3A 1BMMH 4JZEH 1OWHA 2HGTH 1BA8B 5GCHG 3RU4T 2GV6A 1GJ4H 1OWJA 3ZZBA 1Y3YA 1EJNA 3ZVFA 1G30B 3BTQE 2PWXA 4UONA 3BN9A 5C5NA 3RXGA 1GI2A 3ZVDA 4MQAA 2EEKA 1A46H 2GT8A 5JB9S 1WBGB 1C5SA 4Y8YA 1KY9A 1ABJH 1W3CA 3D49H 5CHAB 3TGJE 2ZGCA 1FN8A 1ELVA 2AIPA 1NT1A 3LC5A 5C67A 2BOHB 1GMDG 3VB5A 4Y8ZA 4BNRA 2ZU2A 1ZZZA 4IMZA 5DP6A 2SGEE 3V12A 1G9IE 3FVFB 4LZ4B 3UFAA 4HFPB 2PLXA 1K1NA 3MO6A 1ELEE 4FUJA 1EZXC 1EAUA 1P04A 2G5VA 3EGKH 4F49A 1C2FA 1NFXA 3M61U 1DUEA 2ZC9H 2BD3A 1SGIB 1SOTA 3BTFE 5J4QA 3LGVA 2PKAB 1EPTA 2BLWA 1TA6A 1RTLA 2XBVA 3SJ9A 6LPRA 1A3BH 4K1SA 1P3CA 1AFQB 1AVGH 2VIVA 5GCHF 1RS0A 4CREA 3SV9A 3UNRA 1WV7H 5SGAE 1DXPA 2R2MB 2C8YB 2BVRH 1Q2WA 2FX6A 4NIYA 3BTEE 2A2QH 5GIBA 1Y3WA 2GD4B 3SGQE 5LPRA 1V2KT 1BTYA 1RD3B 4ESTE 2EI7A 1LHFH 1O2MA 3P8GA 3SQEE 1G2MA 1W14U 1HAGE 4X8TH 1MTUA 1LPKB 2BDBA 2WPKS 2Q6GA 4MDSA 3EAJA 4DIIH 1KLTA 3BTGE 2FEQH 3SNAA 1W7GH 4AFZA 1Y3UA 1GMDF 2FOEA 3M5OA 3HGNA 1K22H 1V2UT 3F9GA 1C2IA 1NROH 4AGKA 2JH5D 1BZXE 4J1YA 1W7XH 1TFXA 4ISHH 4OS1A 2B0FA 4RKOB 2G4UA 4IGDA 3MO9A 3LT3A 3GY6A 5AVDA 4YM9A 2VJ1A 1UCYE 3A7VA 1WYKA 1GHWH 2FXRA 4SGAE 3S0NA 1DY8A 3VEQB 1T8LA 2BD4A 2OC7A 2B5TB 4I33A 4CRDA 4I8LA 4A1TA 3A8CA 2CHAB 2HNTC 3NCLA 3D65E 5EU8A 4B2AA 1A1RA 4CR9A 1VITG 1OX1A 5C20A 1EATA 1TRNA 2P3UB 1O2QA 1C5MD 1GI3A 1OS8A 1UCYH 1UMAH 2CJIA 1YLCA 3PYHA 4LZ1H 3QLPH 3T5FH 5I25A 5TJXA 4ZXXH 3RP2A 3RXTA 2BTCE 1TYNA 3K9XB 4BTTB 2P95A 1ZOMA 3RMLH 4NSVA 2OC1A 5FPSA 4X8UH 1SGRE 1ZPBA 3A8BA 4I8GA 3GISB 3F9FA 5AHGH 2CGAA 1HAYB 1O2OA 1MCTA 2GCHG 4WY3A 3H5CB 4ZKRU 1GI5A 5BRRE 1HIAB 2R2WU 3EA8A 2XXLA 1C9PA 1O5GH 2G52A 1H9HE 1EAIA 2A4RA 1TA2A 2ZNKH 3HGPA 5HM2A 1V2WT 1PPEE 1SGNE 1TIOA 1V2TT 2VH6A 3KNXA 3S7HB 3OTJE 2BY5X 1DWEH 1O3MA 2A31A 8GCHF 5EG4A 2F9PA 1PPGE 3MWIU 3SJKA 1K2I1 1EOJA
chains in the Genus database with same CATH superfamily
4AYVB 1SLWB 2HLDD 2KR7A 3GY4A 3RXAA 5T6GA 1T32A 3E3TA 1BTPA 1VITF 1AWHB 1GMCG 1O2RA 3GY8A 2WV5A 1G2LA 5FBEA 1KXEA 4MLFB 2PTNA 3RXEA 2QY0B 3RXVA 1Z1IA 1PQ7A 4JZ1A 1Z1JA 3KGPA 4CR5A 1L1JA 4THNH 1BUIA 1AE8H 1D3PB 1Y3XA 2ZU3A 1YGCH 4BAOB 1XKBC 1UJ1A 3K2UA 4FUBA 5DP3A 3K65B 4YOIA 2QXJA 1SVPA 1C5WB 2J38A 1O33A 3M37A 2F9BH 3ZVGA 4OGXA 2FI5E 1UVOA 2HNTE 3DT0H 3ZYDA 7LPRA 2GCHF 4YLUA 2Q1JA 1GGDB 2OP9A 5AF9H 4GVUA 3KQBA 2ALVA 3PM3A 1FPHH 3MH4A 1O2PA 3BIVH 2VVUA 1NRQH 2AFQB 3TJOA 3GY7A 1GBJA 1B0EA 3A8DA 4ZKNU 2A4OA 2HVXA 3E0NB 2ZZUH 1SPJA 4K60A 4Y7AA 1RGQA 1WXRA 1JOUB 2YNAA 2FO9A 1IAUA 1HAPH 2FOFA 1K0HA 1C9TA 2XBYA 2TGPZ 2FOAA 2ZWLH 3RU4D 1AKSA 1GBTA 1ZMJA 1GBCA 2VVCA 3T2NA 3SU2A 1DANH 1ELGA 2A1DB 3RXQA 1THRH 4H4FA 3LU9B 3E91A 4M9FA 2ODQA 1ZPZA 1X7AC 4JYTA 4Z1MD 1GMCF 2KCYA 1MZAA 1C1NA 3OSYA 5J4SA 5EQRA 1ZHPA 2XCNA 1W0ZU 3ATMA 3SU6A 1HAHH 3WWBA 1TPSA 3SU5A 2JH0D 3TK5A 1QB1A 3LC3A 4TY6A 5JDUB 4DGJA 1C2DA 2QC2A 1KXCA 4A6LA 1GBEA 2JJ2D 3HKJB 1SGYE 4Y8XA 3U1IB 1WQVH 1S6FA 2BVSH 2OTVA 1HPGA 3W94A 2KAIA 3STIA 1DLKB 3RXDA 1TPAE 2A5KA 1TABE 4VGCC 2RFKC 1O5EH 4NCYA 2PHBA 2K0QA 1BITA 1O3BA 2GZ8A 2Z3DA 1S0RA 3M5LA 3MNXA 4O3UA 4B74A 1A5HA 4IMQA 2H6MA 4BXWA 2LELA 1CGJE 3E6PH 2NU0E 4FUFA 3RU4E 2TIOA 1RTFB 2UUKB 3OE7D 1MABB 2JETB 2W3KA 1BHXB 1WU1A 5DKMA 1THSH 1TX7A 3NWUA 2WUCA 2ZGBH 1P09A 1HCGA 3DSGA 3VPKA 2QF3A 5FXLA 1EAWA 2AMQA 1LCYA 1F92A 3QUMP 1TRMA 3BSQA 1O5AB 2ODPA 1SLUB 1OWEA 1IHSH 4X6MA 2LP6A 3SJIA 4XD7D 5GWZA 2W26A 1OPHB 3DSPA 1JBUH 1EJAA 3SV6A 1D3TB 3TJNA 1LKBA 1KMHB 1J9CH 8KME2 2BY9X 1GI4A 2GKVE 2Y5HA 1C1OA 2J92A 1GJBB 2BZAA 3A7YA 1UTOA 2TBSA 1ANCA 1HXFH 4Q63A 1O5CB 3SU1A 3RXPA 3P6ZB 3PO1B 2L74A 3ATLA 4YZUA 1LKAA 3ODDA 3RXHA 5JBTA 2M5TA 2ODYB 3KQEA 2ZFQH 3LGUA 5C5OA 1ZSLA 2FESH 2V35A 1C5RA 4RI0A 2D26C 1DWCH 1OP8A 3A84A 4A5TS 4DW2U 1O5DH 2XC4A 1IQEA 2PSYA 2V3HH 3RXSA 1BMNH 3P8NA 5GPIB 2UWPA 2SFAA 1OYQA 1YPLH 1S0QA 3BEUA 3RC6A 4FU7A 4KP0A 4OS6A 1UO6A 3A86A 2ZGXH 3GYLB 1PYTC 1BDAA 2VIDA 3MH7A 1VZQH 1Z8GA 1A61H 2BD9A 3M7UA 3F6UH 6GCHG 1UHBA 2NWNA 5ESBA 1COWD 5HXFA 4U30A 1N6XA 2QCYA 4BTUB 1ZHMA 2P59A 3KEEA 1L1NA 2VWNA 2O8UA 2ZA5A 3ZVCA 1E34B 3P70B 1AO5A 1DX5M 3RXRA 1MMJN 1KTSB 2P16A 2R0KA 1KIGH 4WF8A 1MTWA 2NU2E 3B8JA 2Z9JA 3TJVA 1OWDA 1IQLA 4BOHA 3KYGA 5F8TA 1AWFH 1AFEH 1PFXC 3PWBA 1ZTKA 3UIRA 2GP9B 1PYTD 3GCHC 3RC5A 2UWLA 2ZFTA 1UVPA 2WYGA 2WPJS 2BQ7B 3M7TA 1L0ZA 1P3EA 2VGCB 5A0AE 2BOKA 1YYY1 4NIWA 1K1PA 4D7GA 1LHCH 4GCHG 4AZ2B 3AAUA 1SB1H 3BIUH 2RG3A 1PPCE 1ELDE 3QDZB 1F5LA 4JK6A 1O30A 2BDCA 3BEFB 2XBXA 2F4LA 3RM0H 2CF8H 4XBDA 3HATH 1OSSA 1W11U 2OUAA 2IPHA 4R0IA 2ZDKA 1FAXA 2GZ9A 1BMAA 1CBWB 1EPTC 2ZPSA 2P3TB 5DP9A 6GCHF 5AFZH 1XUGA 3IWMA 4ZCNA 4Q7XA 2FWWA 2FOHA 1C4V2 1XUKA 5C0UA 5JB8S 2A7HA 3BV9B 2ZECA 4Z6AH 3U98H 1AZZA 3FZDA 2B9LA 4GLYA 1UTNA 3ZZDA 1FLEE 3ZZ4A 3HK3B 4UFFH 4VGCB 4OS5A 1ELCA 1HXEH 1QCPA 1G36A 1V2VT 3U28C 3Q3YA 1TAWA 1FZZA 2G8TA 4AB8A 1O35A 3I77A 1WCZA 4D9RA 4J2YB 1CVWH 3F0PA 5IYTA 2ZFFH 4ZUHA 4E7RG 3OFND 3ELAH 2OXSA 3T28A 2FIRH 1PPFE 1GVLA 1ESTA 2W6JD 1DWBH 1A5GH 3OY6U 4GCHF 5DGJA 4B76A 3V3MA 2QE7D 1YCPM 4WXIA 2ZDLA 3M5MA 5EOKA 2IN2A 4I31A 2Z3EA 1C5VA 5FCRA 2H9EH 1VCWA 2O9QA 3RLWH 3VB7A 1GBLA 1QZ8A 1DUAA 1UTQA 5EQSA 2PSXA 2O8LA 1TX6A 4B6EA 3PB1E 4AFUA 4MNWA 4PROA 5F03A 3NKKA 1AD8H 5C94A 4I8JA 1ZRKA 1C5PA 1EJMA 1GI6A 1MKXK 2ANYA 4LK4A 1C2JA 1MUEB 4U2WA 1NBMD 3FFGA 3A80A 3OTPA 3SV2H 4DG4A 1S84A 4NIVA 3SU3A 3SUDA 1TX8A 2Q6FA 2UUFB 4NFFA 1KLIH 1O32A 3UTUH 1SQTA 4ZHMU 1O3DA 2AIQA 1C1WH 1DT2A 4XSKU 2Q6DA 1O3NA 1VJAU 1Z8RA 3EA9A 3DD2H 1S82A 2C3SA 4TWWA 5FHTA 4U32A 2BVXH 3LJOA 2R9PA 3PMAB 1WTGH 3TH3H 5EXNA 1C5TA 2D1JA 2GDEH 3CS0A 1CGIE 2PGQB 4BXSA 5EGMA 5FCKA 4O03A 4Y71A 5C1XA 1GI0A 3KF2A 1FNIA 1TGBA 4F48B 2VWLA 1AY6H 4A92A 5DJ7A 1ETSH 3S69A 4WMDA 3DFLA 1T7CA 2G81E 7KMEH 1LPZB 1O37A 2FM2A 3QZRA 3W1EA 4X2VA 2BDGA 1HJAC 2FX4A 3GY3A 1EOLA 1T31A 1QQUA 4K5ZA 5DP8A 2FPZA 3SUFA 1V2MT 4HG6A 2KCPA 1KYNA 4BAQB 1O2NA 5EQQA 1O2UA 1HJ9A 1PPZA 3UNQA 4NIXA 4WMEA 4ACAA 2ZU1A 2G5NA 4MTBA 3ATKA 4XOJA 3RDZA 3EDXB 1NTPA 3EQ0H 1IOEA 1VJ9U 2ZHEH 1MU8B 1SGFG 2ZFSA 2TRMA 4AX9H 1HJ8A 4B73A 3BF6H 1GJ8B 1Y8TA 2WPDD 5FL7D 1NPMA 1HBTH 3UR9A 1ZRBA 2GX4A 2PKAA 4CHAC 1O3IA 4ISIH 1FIZA 1DFPA 4HI3A 3TIUA 4ZKOU 1ZYOA 2JH6D 1S83A 1MAYA 1H4WA 4OGYA 1UK4A 4INKA 2BLQA 5FX6A 3E1XB 2ZP0H 1OXGA 3TK6A 1DXWA 1WDIA 1UVSH 2C8WB 2F9VA 2ZGHA 1ELBA 1FY3A 4FOUC 1DICA 4BAKB 1IHTH 2EA3A 1SHHB 1LVBA 1V2PT 4D8NA 3Q77A 2KCOA 3IITA 4FVBA 1TMTH 1GJAB 1QRXA 1VGCB 3SJOA 2WV4A 2J98B 1FV9A 1P2IA 1YPKH 1CE5A 3SQHE 1ANBA 5T1VA 1YY3A 1O2WA 5EJZA 2ANWA 1GBAA 5EXLA 2VB0A 3RXLA 1FX0B 1ANEA 3KHVA 1B7XB 1C1VH 3RLYH 1BRBE 5DP5A 1CHGA 1MH0A 4Y7BA 1DY9A 1TNJA 2AGIX 4I32A 2QF0A 3SZEA 3RC4A 1HAXB 2G55A 1FIWA 1E79D 1J14A 3WY8A 8GCHG 1YLDA 4SGBE 4MPVA 1TPOA 2BD8A 1DWDH 3DUXH 4KKDA 3PLBA 3TH4H 1ABIH 3VGCC 2FI4E 4Y76A 2JIZD 1TNHA 2F9NA 3B9FH 2BD5A 1BBRK 1GHXH 1NRNH 2ZTXA 3AW1A 1KTTB 2FS9A 3M5NA 1XUJA 1Q3XA 1C2EA 4JZFH 4AYYB 1TBZH 1AB9C 1SSXA 1C5QA 3SNEA 2HLCA 2TGTA 3I29A 4UFGH 4A1XA 1O3LA 1EB2A 1VCQA 1AVWA 4NFEA 2V0BA 2C8ZB 4K8BA 5PTPA 5B6LA 4F55A 1GBKA 1J15A 5T3HA 2TPIZ 4TPIZ 1XUFA 4RKJB 2PTCE 4AG1A 3R3GB 7ESTE 5F6MA 5LPEA 1E35B 1GHBG 2XBWA 1GDNA 1QA7A 2THFB 1P2OA 4P00A 3GOVB 2Z9IA 1FI8A 1P02A 1FPCH 3RXKA 4YLQH 1ARBA 4UD9H 1HIAA 2BZ6H 2YOLA 3H7OA 2AMDA 4XBBA 2F3CE 2P8OB 4X0WU 5JYIA 2O8TA 2QAAA 4XBCA 1BJUA 5KGOA 1RIWC 1VR1H 3SW2B 5BPEA 5KECA 4Q7YA 4K8YA 1P9SA 4JMYA 3MH6A 4NSYA 1LQEA 5FBIA 2A4GA 3ZZ6A 1A5IA 1W8BH 1S81A 2K8IA 3A87A 4ABIA 1LVMA 1TMBH 1MTNB 1VCPA 3L6PA 2BM2A 1TMUH 4FETA 1XXFA 1ANDA 1F2SE 1GWAA 4B2CA 1JIRA 1MKXH 1T8NA 3RXCA 3OX7U 4CRFA 2M2AA 4MPUA 5LH8A 4DVAU 1O5BB 1D6RA 1EZSC 1MD8A 1NO9H 5EODA 1PPBH 1AGJA 4Q2KA 5KEDA 3BTTE 1C1TA 2V7QD 1GDQA 8LPRA 1MTVA 1O3KA 3WWFA 1GHBF 3ZZ3A 4ABGA 1VITH 4B75A 4DY7B 1QL7A 1IQIA 3CP7A 1QJ1B 5T6FA 3SUGA 3R0FA 2J9NA 3TU7H 1DITH 1V2QT 3V13A 2BDIA 5DP7A 3O8DA 1SGDE 1H8IH 2QN5T 1LHDH 3F2HA 4XE4A 4KTCA 1MD7A 1OOKB 5L30H 3QTOH 2R0LA 2EC9H 1GMHG 1D4PB 2EY4C 3P92A 2VWOA 1V2NT 3SBKA 1GJ6A 2LPRA 1BRCE 3FO8D 3GYMA 1E36B 4ABHA 1Y59T 3KQ5A 2C8XB 1BTXA 1LMWB 5EW2H 1V3XA 2Y80A 4NWLA 4CHAB 1TQ7B 3QO6A 1QRZA 1W12U 1OHHD 1O34A 1HAVB 1TGCA 1GJ7B 2BLVA 3F2GA 1P2NA 3A7TA 1P11E 5JPMH 3B23B 1QBVH 3P8FA 4WVPE 4Q7ZA 2IOTA 1NFYA 1OWIA 2A7JA 5K0HA 4WMFA 1ZR0A 2GDDA 5HKKD 4DT7B 1N8OC 3RXJA 1BMFD 1GI9B 1YPHC 2FS8A 1CQQA 4U01A 2QIQA 2O8MA 3UNSA 2ZHFH 4AFQA 4AG2A 2ANKH 3U1JB 4RN6A 5C1UA 3PWCA 2DUCA 1KXDA 1QNJA 4ZHAA 2ESTE 1J8AA 2B7DH 5HYOA 4MNVA 3KQCA 3LIWA 4DT4A 4MNYA 3F68H 2FZZA 1W13U 1MKWK 2BDAA 2JDID 1MZDA 4X8SH 1TNIA 3ZVAA 4YT6H 3A81A 4OS4A 1ZPCA 1LPGB 1A0LA 2VU8E 1GI7B 5LPFA 3BEIB 2W5EA 2BQ6B 1OKXA 3SHAH 1GMHF 1O2GH 1Y5UT 2F91A 4H42U 4K1EA 3KIDU 1V2RT 2G51A 2VIOA 5AFYH 4RT1A 4JCNA 2QYIA 1FDPA 3FZZA 1OWKA 2FTLE 1MQ6A 4FVDA 1O0DH 1UK3A 1O3AA 5GXPA 2ALPA 2Y5FA 3TGKE 1UTKA 5B6OA 2WHXA 3VGCB 1SFIA 2B8OH 4ZAEA 3RXMA 1GBMA 1TNLA 2D2DA 4E06H 1T8MA 2ZHQH 3MNCA 2GCTC 5EJLA 4FU8A 2A0QB 4JYUH 4FU9A 1EUFA 2ZDMA 1IQNA 5ETXA 3UQVA 3MYWA 1E38B 4DIHH 3OEHD 3WW7A 1NY22 2R3UA 2FOCA 2A5AA 2AEIH 2FODA 4B71A 1SOZA 5HIYA 1O2XA 1K21H 2STBE 1BBRE 2Y82A 4K1TA 3EE0B 2ZIQH 3RMMH 4XFQA 5E2OA 3M3TA 3BG4C 3PMBB 2KX4A 2ZEBA 3FP7E 1AMHA 3FANA 5E8EH 4ZHLU 2ZCLP 4JYVH 1V2LT 2IJOB 4D7FA 1KLJH 1H9LB 3MMGA 3U9AH 2Z9LA 1CT0E 1YPHE 2QXGA 3AAVA 1RIWB 3N7DA 1YPMH 2KFWA 2KM0A 3ZVBA 3G01A 1NRRH 1BBRH 3BTWE 1GCTC 3W95A 2SNVA 1TBRH 1L1GA 1W0KD 4CRAA 2PKSC 1NN6A 3KQDA 2FTMA 2VIPA 1GJ9B 3MQKC 2Z94A 1JRTA 1MAXA 1SGPE 2GMTC 3N7EA 3U69H 1F5KU 4ACBA 1CA8B 3S7KB 3VB6A 1HAIH 4ASHA 2HALA 4D76A 2BD2A 3BTDE 5A0BA 2F9UA 1F0UA 1RXPA 2WSSD 2J4IA 1GL1A 2ZF0H 2ZPQA 1SGTA 1UTPA 3Q00A 1GBBA 4Z0KA 1V6DA 3KL6A 3TLOA 2OD3B 1O3GA 1AIXH 5A8XA 2AYWA 1MTSA 3TH2H 4KTUA 1P2QA 1EASA 2R3YA 4I8HA 3GDVA 1ORFA 2WUBA 3HK6B 1BQYA 3QGNB 5A8ZA 4AB9A 3UUZA 3GY2A 1MBMA 4MPWA 4IBLH 1LVYA 1QB9A 2FDAA 5DG6A 3ZV8A 2EI6A 2HOBA 4ABDA 1Z6JH 3RXOA 2WPMS 2NU3E 2ZQ2A 3AASA 4Y0YE 4CRCA 1GVKB 2OQUA 1U6QA 5CHAC 1FAKH 1G3BA 3MU4A 1D3QB 2QA9E 5FAHA 1PPHE 4Q80A 4YO9A 2FLBH 3UWIA 1IQGA 4JZIA 1LHEH 5DN6D 2J94A 1TONA 1K1JA 4UFDH 2XYAA 1WTHD 1EFRD 4LXBH 1ESBA 4GHQA 1ZGIA 1QL9A 1C5LH 3PV5A 4OS2A 3RM2H 2HPQH 2XWBI 1C1UH 2TGAA 2Y81A 3S9BA 2Y7ZA 5CHBA 4BANB 1RFNA 2BDHA 1Z7KA 2Y5GA 1P2KA 2VVVA 2BXTH 4E05H 2RA3A 1ZHRA 1E1RD 2J2UA 1AU8A 4IN1A 1JMOH 3UB0A 4DJZB 3P17H 1FY4A 2ZHDA 4YOJA 4FUIA 1P0SH 2HRVA 1AFQC 1P57B 1C5YB 1WOFA 5E0HA 4KGAA 4I7YH 1TLDA 2FOMB 2OK5A 3SV8A 1XUHA 4NG9H 4R8TB 1HB0B 2Z6BD 1H1BA 1GHYH 4CRGA 2NU1E 1G3DA 2Y7XA 1GI1A 4YXWD 1QFKH 4NWKA 1C1SA 2EQNA 4OM9A 3TJUA 2ZQ1A 3MO3A 1QB6A 1JRSA 1J16A 1LO6A 2J97A 4GPGA 2G00A 4TY7A 3NPSA 2OINA 2IJD1 1DM4B 1Y5BT 2BXUH 1BJVA 2ZO3H 1ZMNA 5T6DA 4MG3A 3F3BA 4TWYA 5I46H 1SLXB 3TGIE 3O8CA 5JBBS 2CK3D 1P05A 1YF4A 4AGJA 1CA0C 1ZSJA 4CBNA 1ZJDA 3MNBA 3CENA 2GZ7A 1F0TA 3VFEA 4AN7A 2C4FH 3T29A 3L3TA 2SGPE 2YMSC 4X6NA 4YESB 3UREA 1MKWH 2V3MA 5G4BA 5GDSH 1KDQA 1BTZA 5A0CA 1FJSA 4FUEA 1ZSKA 1KDQB 1ZTJA 2BQWB 3TK9A 5FPTA 2H1UA 1G32B 1TALA 3FKSD 1EAXA 4IS5A 4NGAH 1ELAA 2OC0A 1TRYA 4YTAA 3BG4B 1QURH 4NZLA 1QBOA 3E0PB 1CGHA 3LKWA 1QJ6B 1T4UH 2LNCA 4FXGH 3MOCA 2CN0H 1WAYB 4UE7H 1JWTA 1FY1A 4Y11E 2RDLA 4ZMAH 2C90B 4FUHA 3F9HA 3GDUA 3ZV9A 2I6SA 2YMSD 4CBOA 5HM9A 3RMOH 1C2HA 1GCTB 2XOKD 5CE1A 4WH6A 2PKSB 4Y10E 3T26A 1XXDA 2SGDE 3MNSA 1O2LA 5EXMA 4X6OA 3UWJH 1P9UA 1KSNA 1LVOA 3P95A 3SI4H 1F5RA 1GG6C 1O39A 4O9VA 5L6NH 5A2MH 1H8HD 1EQ9A 2Z3CA 4FUCA 5E2PA 3ZZ8A 3E16B 4X1PU 1O3EA 1NFUA 3OU0A 4A1VA 3ZZ5A 4RT0A 1BTUA 2ZU4A 1QIXB 1GHZA 1SQAA 3QX5H 2WPHS 3PROA 2XWAA 3UQOA 1UTJA 3LOXA 4I8KA 1NBME 1G37A 2WPLS 4CRBA 1EXFA 2SGQE 2C93B 2OBQA 1O2ZA 3SO3A 3NZIA 3A83A 1NESE 2A2XH 1ZLRA 1FN6A 4ZKSU 3FAOA 3SU0A 1DPOA 1D3DB 5IDKA 7GCHG 1HAOH 4X1SU 3F9EA 3ITIA 4AC9A 4IW4E 1W2KH 2BX3A 2ZPRA 1SHYA 1CT4E 3MTYA 3PV2A 4K2YA 1YCPH 2BDYA 1AZ8A 2I6QA 3CS7A 2W3IA 3GCHB 3RXBA 1D6WA 1W0YH 1F0RA 1HRTH 1GGDC 5F8ZA 1ZTLA 1NZQH 1CT2E 1GHAG 1PQ5A 1TGNA 3QN7A 3M3VA 3M7QA 3S9AA 3SOSA 1BT7A 1V2OT 3LGWA 3GY5A 2VWMA 4D9QA 1P03A 1TGTA 3SYJA 2FOGA 1SL3A 1C2GA 3LDXH 4Q4LA 2XRCA 3LH1A 1QA0A 2ZCHP 4ZH8A 2QXIA 2OC8A 3M36A 2J98A 1T8OA 3PMJA 4AFSA 1A0HB 1PJPA 1C2KA 1YPGH 2XNIA 1XKAC 2GGVB 2GT7A 4YT7H 1EPTB 1EZQA 1CO7E 2CV3A 1FONA 3LJJA 3OY5U 1DSTA 3A85A 1SGQE 2ZDAH 3ZZAA 3A82A 3ZYEA 1MU6B 1QJ7B 4YOGA 6CHAC 3LGTA 3QK1A 1TBQH 3N7OA 7GCHF 2QXHA 3GICB 9LPRA 1RTKA 1FY5A 1TGSZ 4ABJA 5C3NA 1O2YA 1O2IA 1HNEE 3NXPA 2OCVB 3MFJA 2PGBB 3SORA 3EA7A 4X1QU 2PUQH 5EJ1A 1GHAF 1AN1E 2A32A 2CF9H 4MNXA 3UOPA 1P06A 1MBQA 1BRAA 1CA0B 1LTOA 1MCVA 1G3EA 2JETC 5LGOA 1ACBE 2XC5A 3HKIB 2VIQA 4BAHB 1NU9A 4DURA 4B1TA 2VBCA 4WWYA 3UPEA 4NA8A 1KXFA 3GCTG 4ISOA 1OP2A 1DOJA 4AORA 2VINA 3GDSA 1P01A 1GJ5H 2W6ID 3L33A 2SGAA 1H8DH 1H8ED 2J5UA 4Y6DA 1O2SA 4INLA 2OBOA 1DSUA 3SNDA 2L6OA 3PLKA 1WQSA 2PV9B 1A7SA 5H4IB 1O31A 1EZUC 2BX4A 6ESTA 1EX3A 3SNCA 3GCOA 1TNGA 1SG8B 5ESTE 1OP0A 2UUJB 1QGFA 4ISNA 1HLTH 3QTVH 1A3EH 1ETTH 3NRLA 1O3CA 3Q76A 2J95A 2RDEA 3T62A 2PUXB 3TITA 1MQ5A 3DCLA 2DE8A 2PP6A 1S5SA 1GCDA 1XVOA 1LHGH 1NU7B 1S6HA 1ELFA 1C5UA 1GJDB 3STJA 2A45B 4HTCH 3PO1C 1RRKA 4ISLA 1SGFA 4X2WA 3IG6B 4H6SB 1TB6H 3RMNH 1EB1H 1GG6B 2ZU5A 1DVAH 1C1MA 3SU4A 1A4WH 1O2TA 1TOCB 2JJ1D 2VNTA 5A8YA 1HJAB 1L2EA 3PLPA 3SGBE 3PTNA 3FP8E 2ZHWH 5A09A 4IC6A 1O2HA 2QF5A 1GPZA 1TE0A 3D62A 2GVFA 3C27B 1AUTC 3F0OA 3GCTF 4IN2A 4GAWA 3RXUA 3U8OH 3QWCH 3V0XA 1YPEH 1HDTH 1O38A 4X1NU 3SGAE 2AS9A 2H5DA 1C5NH 4FUGA 5DSFA 5E0JA 1GBIA 3PRDA 4KTSA 1SBWA 4E7NA 1QTFA 2Z9GA 4BAMB 3MU0A 1HFDA 5ABWA 1N6YA 3UR6A 3MI4A 2FMJA 4B2BA 1K1OA 4RSPA 2ZCKP 8ESTE 2V6NA 1C2LA 2AERH 2XNDD 5FPYA 1M9UA 1BHXF 4MVNA 1DS2E 4X6PA 1UK2A 3U8RH 1HAVA 1E37B 2Z9KA 2HNTF 2ANMH 4ZXYH 1SGEE 1DE7H 2H5CA 1QL8A 2F83A 4FUDA 4CH2B 1WUNH 9ESTA 3MH5A 3TNSA 1ZGVA 3ENSB 3SZNA 2W7SA 2BLOA 1Y3VA 3PV4A 2UWOA 1UVTH 3ZIAD 2Y6TA 2OLGA 5CMXH 2VGCC 1OYTH 2H9TH 3TPIZ 1LDTT 1O3OA 3SN8A 2PR3A 1RJXB 3LGIA 1NRSH 4TYDA 2H2ZA 1BOQA 2YNBA 1AKSB 3A7WA 3MHWU 1QBNA 1Z8JB 1XMNB 3T25A 2NU4E 5IK2D 3K6YA 3SNBA 1PQ8A 1V2ST 1BMLA 1YKTA 3GCNA 1C1QA 1YP9A 3I78A 4X2XA 3A88A 5JBAS 4AOQA 1AQ7A 1O2KA 4I86A 6CHAB 4K69A 1CBWC 1JXPA 1INCA 1SGCA 4M7GA 2ILNA 2ZKSA 3BTHE 3VXEH 1E0FD 2WV9A 4GHTA 2Z7FE 1TOMH 1FQ3A 3QZQA 2GTBA 2A7CA 4ABFA 3S9CA 2PFEA 3URDA 1G3CA 3K6ZA 3M35A 2WYJA 2KAIB 5GNDA 4CH8B 5E0GA 1V2JT 1GVZA 1O36A 2ZFRH 2JKHA 4GSOA 1AB9B 1NM6A 1P2MA 3NUMA 3TNTA 1EP5A 1QQ4A 1NRPH 1ZJKA 3O8RA 1SFQB 2J34A 1QR3E 1PQAA 4INHA 3CNRA 1P10A 1GDUA 3A8AA 1SI5H 5HGGA 2HVYB 1SQOA 4MPXA 3SV7A 1C4Y2 3C1KA 3ZZCA 2BY6X 4X1RU 2P94A 1SLVB 2D8WA 2KZ4A 5L2ZH 4O3TA 1K1LA 2ZTZA 5DO4H 1YWUA 1IQJA 2HPPH 2ZFPH 1TQ0B 3V7TA 5GJ4B 1FY8E 1P12E 1S85A 2XCFA 5EIYA 2AGGX 1DLEA 3BG8A 3PTBA 2HWLB 1GL0E 1W0JD 1HV7A 1UTLM 1UTMA 3A7XA 4WXVA 4OS7A 1ARCA 2TGDA 2O8WA 2CMYA 1BTWA 3EYDA 4JZDH 4DOQA 1YCPK 1KXAA 4Y0ZE 1ID5H 3HPTB 2WINI 3ZVEA 1EKBB 5TCCA 3F1SB 3M3SA 1BIOA 1F7ZA 2FI3E 3H7TA 2ZGJA 5C0TA 1EP6A 1FUJA 3F2FA 2FYRA 1SC8U 1K28D 1HUTH 1BB0B 1S6LA 3LGYA 3PRBA 1AHTH 3T27A 2UUYA 1Q31A 3JZ1B 3E90B 2ZTYA 4UDWH 4UFEH 3FOAA 1GBHA 2RCEA 3BTME 1UVUH 2F9OA 4ZROA 1J17T 1QRWA 4NZQA 3VXFH 1K9OE 4KELA 1THPB 2SGFE 2QGRA 1FXYA 1QHRB 2GV7A 2XTTB 5EPYA 4B6FA 1O2JA 1Z8IB 3P8OA 3FP6E 1TWXB 2BHGA 4A7IB 5K7RA 1ELTA 1B0FA 3SHCH 1AUJA 1UHBB 4XRNA 3RUOA 1ESAA 4O97A 1P2JA 2V3OH 3ATWA 5HIZA 3SUEA 1CHOG 1N8OB 1IQKA 3FN8A 3KN2A 1GI8B 3JZ2B 5C2ZA 1O3HA 2WPIS 3VB4A 2W7UA 3TVJB 1Z71A 3PMHB 2BD7A 5TCAA 1NFWA 3A7ZA 1XM1A 4WJG2 2FLRH 1UW7A 5C17A 1SR5C 4HZHA 3NK8A 1XVMA 1W10U 5JBCS 2EI8A 5FX5A 3GS9A 3QGJA 1GBFA 4TPYA 2VH0A 3Q3KA 4TT3D 3AVZA 3RXIA 1CSOE 4BTIB 3ESTA 4K3JA 2PW8H 1FMGA 1C2MA 2BYAX 1Z6EA 4NA9H 2RA0A 3DHKH 5F8XA 1NC6A 3VB3A 1LQDB 1C5OH 1SQRA 3MU5A 1VGCC 4H6TA 1C5XB 2QV1A 1UCYK 5DP4A 3MU1A 2ASUB 2BB4A 2ZG0H 3ZZ9A 3LPRA 1BRUP 1Y5AT 3Q3XA 1D9IA 1K1MA 2AMPA 3DA9B 1A0JA 5EPNA 5EW1H 1GHVH 3UY9A 1H9IE 2DE9A 1HYLA 3AW0A 2ZDVH 1A2CH 4ABBA 2ZI2H 3ZZ7A 3DSOA 2FP7B 3ODFA 1O3FA 1T4VH 5DK1A 1YC0A 5CDFE 2OQ5A 1WSSH 4X8VH 3ATIA 1CHOF 1E1QD 1K1IA 2ZDNA 1O2VA 4ASUD 2GCTB 1IQFA 4NA7A 2P3FH 2CHAC 2G4TA 4JK5A 1IQMA 3A89A 4IC5A 2BMGB 1YPJH 1KXBA 1L4ZA 4HGCA 5L2YH 1YM0A 2WZQA 4XDEA 4DCDA 1SMFE 4QT8C 1TPPA 2VIWA 4Y79A 3LONA 1HAZB 2FOBA 1F0SA 1O5FH 3URCA 5DPAA 4ABEA 1VKYA 2A5IA 1XX9A 3BTKE 4UEHH 1C4U2 3D23A 2CXVA 2K1QA 2SNWA 1N1LA 2AGEX 2XW9A 5HMAA 1AE5A 1XUIA 3RXFA 4LOYH 3SJ8A 1O3PB 3O8BA 1C1RA 1QY6A 4F4OC 1ETRH 2ULLA 1DDJA 4WH8A 3SI3H 2XC0A 1B5GH 2H9HA 1C5ZB 1AVXA 3DFJA 1CU1A 2P8OC 2BY8X 4GUXA 2STAE 1IQHA 1GJCB 1HGTH 4X2YA 2FYQA 2GMTB 2P93A 3U8TH 1YBWA 3UOUA 1C1PA 1BCUH 3MU8A 1JIMA 3N99A 1ZMLA 1BTHH 1TNKA 2A4QA 2GJGA 1O3JA 3KYFA 3OYPA 5C1YA 2AH4X 2BY7X 3LH3A 3AK5A 1L4DA 1GBDA 4ABAA 1P8VC 3KCGH 1AI8H 3E8LA 1MTNC 1NS3A 1BMMH 4JZEH 1OWHA 2HGTH 1BA8B 5GCHG 3RU4T 2GV6A 1GJ4H 1OWJA 3ZZBA 1Y3YA 1EJNA 3ZVFA 1G30B 3BTQE 2PWXA 2IPQX 3BN9A 4UONA 5C5NA 3RXGA 1GI2A 2F43B 3ZVDA 1YLNA 4MQAA 2EEKA 1A46H 2GT8A 5JB9S 1WBGB 1C5SA 4Y8YA 1KY9A 1ABJH 1W3CA 3D49H 5CHAB 3TGJE 2ZGCA 1FN8A 1ELVA 2AIPA 1NT1A 3LC5A 5C67A 2BOHB 1GMDG 3VB5A 4Y8ZA 4BNRA 2ZU2A 1ZZZA 3OAAD 4IMZA 5DP6A 2SGEE 3V12A 1G9IE 3FVFB 2KCAA 4LZ4B 3UFAA 4HFPB 2PLXA 1K1NA 3MO6A 1ELEE 4FUJA 1EZXC 1EAUA 1P04A 2G5VA 3EGKH 4F49A 2AHME 1C2FA 1NFXA 3M61U 1DUEA 2ZC9H 2BD3A 1SGIB 1SOTA 3BTFE 5J4QA 3LGVA 2PKAB 5F53A 1EPTA 2BLWA 1TA6A 1RTLA 2XBVA 3SJ9A 6LPRA 1A3BH 4K1SA 3OEED 1P3CA 1AFQB 1AVGH 2VIVA 5GCHF 1RS0A 4CREA 3SV9A 3UNRA 1WV7H 5SGAE 1DXPA 2R2MB 2C8YB 2BVRH 1Q2WA 2FX6A 4NIYA 3BTEE 2A2QH 5GIBA 1Y3WA 2GD4B 3SGQE 5LPRA 3VG8A 1V2KT 1BTYA 1RD3B 4ESTE 2EI7A 1LHFH 1O2MA 3P8GA 3SQEE 1G2MA 1W14U 1HAGE 4X8TH 1MTUA 1LPKB 2BDBA 2QF4A 2WPKS 2Q6GA 4MDSA 3EAJA 3H09A 4DIIH 1KLTA 3BTGE 2FEQH 3SNAA 1W7GH 4AFZA 1Y3UA 1GMDF 2FOEA 3M5OA 3HGNA 1K22H 1V2UT 3F9GA 1C2IA 1NROH 4AGKA 2JH5D 1BZXE 4J1YA 1W7XH 1TFXA 4ISHH 4OS1A 2B0FA 4RKOB 4P02A 2G4UA 4IGDA 3MO9A 3LT3A 3GY6A 5AVDA 4YM9A 2VJ1A 1UCYE 3A7VA 1WYKA 1GHWH 2FXRA 4SGAE 3S0NA 1DY8A 3VEQB 1T8LA 2BD4A 2OC7A 2B5TB 2YMSB 4I33A 4CRDA 4I8LA 4A1TA 3A8CA 2CHAB 2HNTC 3NCLA 3D65E 5EU8A 4B2AA 1A1RA 4CR9A 1VITG 1OX1A 5C20A 1EATA 1TRNA 2P3UB 1O2QA 1C5MD 1GI3A 1OS8A 1UCYH 1UMAH 2CJIA 1YLCA 3PYHA 4LZ1H 3QLPH 3T5FH 5I25A 5TJXA 4ZXXH 3RP2A 3RXTA 4TSFD 2BTCE 1TYNA 3K9XB 4BTTB 2P95A 1ZOMA 3RMLH 4NSVA 3EE7A 2OC1A 5FPSA 4X8UH 1SGRE 1ZPBA 3A8BA 4I8GA 3GISB 3F9FA 5AHGH 2CGAA 1HAYB 1O2OA 1MCTA 1SKYE 2GCHG 4WY3A 3H5CB 4ZKRU 1GI5A 5BRRE 1HIAB 2R2WU 3EA8A 2XXLA 1C9PA 1O5GH 2G52A 3UAIC 1H9HE 1EAIA 2A4RA 1TA2A 2ZNKH 3HGPA 5HM2A 1V2WT 1PPEE 1SGNE 1TIOA 1V2TT 2VH6A 3KNXA 3S7HB 3OTJE 2BY5X 1DWEH 1O3MA 2A31A 8GCHF 5EG4A 2F9PA 1PPGE 3MWIU 3SJKA 1K2I1 1EOJA
chains in the Genus database with same CATH topology
4AYVB 1SLWB 3GY4A 3RXAA 5T6GA 1T32A 3E3TA 1BTPA 1VITF 1AWHB 1GMCG 1O2RA 3GY8A 2WV5A 1G2LA 5FBEA 1KXEA 4MLFB 2PTNA 3RXEA 2QY0B 3RXVA 1Z1IA 1PQ7A 4JZ1A 1Z1JA 3KGPA 4CR5A 1L1JA 4THNH 1BUIA 1AE8H 1D3PB 1Y3XA 2ZU3A 1YGCH 4BAOB 1XKBC 1UJ1A 3K2UA 4FUBA 5DP3A 3K65B 4YOIA 2QXJA 1SVPA 1C5WB 2J38A 1O33A 3M37A 2F9BH 3ZVGA 4OGXA 2FI5E 1UVOA 2HNTE 3DT0H 3ZYDA 7LPRA 2GCHF 4YLUA 2Q1JA 1GGDB 2OP9A 5AF9H 4GVUA 3KQBA 2ALVA 3PM3A 1FPHH 3MH4A 1O2PA 3BIVH 2VVUA 1NRQH 2AFQB 3TJOA 3GY7A 1GBJA 1B0EA 3A8DA 4ZKNU 2A4OA 2HVXA 3E0NB 2ZZUH 1SPJA 4K60A 4Y7AA 1RGQA 1JOUB 2YNAA 2FO9A 1IAUA 1HAPH 2FOFA 1C9TA 2XBYA 2TGPZ 2FOAA 2ZWLH 3RU4D 1AKSA 1GBTA 1ZMJA 1GBCA 2VVCA 3T2NA 3SU2A 1DANH 1ELGA 2A1DB 3RXQA 1THRH 4H4FA 3LU9B 3E91A 2ODQA 1ZPZA 1X7AC 4JYTA 1GMCF 1MZAA 1C1NA 3OSYA 5J4SA 5EQRA 1ZHPA 2XCNA 1W0ZU 3ATMA 3SU6A 1HAHH 1TPSA 3SU5A 2JH0D 3TK5A 1QB1A 3LC3A 4TY6A 5JDUB 4DGJA 1C2DA 2QC2A 1KXCA 4A6LA 1GBEA 3HKJB 1SGYE 4Y8XA 3U1IB 1WQVH 1S6FA 2BVSH 2OTVA 1HPGA 3W94A 2KAIA 3STIA 1DLKB 3RXDA 1TPAE 2A5KA 1TABE 4VGCC 1O5EH 4NCYA 2PHBA 1BITA 1O3BA 2GZ8A 2Z3DA 1S0RA 3M5LA 3MNXA 4O3UA 4B74A 1A5HA 4IMQA 2H6MA 4BXWA 1CGJE 3E6PH 2NU0E 4FUFA 3RU4E 2TIOA 1RTFB 2UUKB 2JETB 2W3KA 1BHXB 1WU1A 5DKMA 1THSH 1TX7A 3NWUA 2WUCA 2ZGBH 1P09A 1HCGA 3VPKA 2QF3A 5FXLA 1EAWA 2AMQA 1LCYA 1F92A 3QUMP 1TRMA 3BSQA 1O5AB 2ODPA 1SLUB 1OWEA 1IHSH 4X6MA 3SJIA 5GWZA 2W26A 1OPHB 1JBUH 1EJAA 3SV6A 1D3TB 3TJNA 1LKBA 1J9CH 8KME2 2BY9X 1GI4A 2GKVE 2Y5HA 1C1OA 2J92A 1GJBB 2BZAA 3A7YA 1UTOA 2TBSA 1ANCA 1HXFH 3SU1A 1O5CB 3RXPA 3P6ZB 3PO1B 3ATLA 4YZUA 1LKAA 3ODDA 3RXHA 5JBTA 2M5TA 2ODYB 3KQEA 2ZFQH 3LGUA 5C5OA 1ZSLA 2FESH 2V35A 1C5RA 2D26C 1DWCH 1OP8A 3A84A 4A5TS 4DW2U 1O5DH 2XC4A 1IQEA 2PSYA 2V3HH 3RXSA 1BMNH 3P8NA 5GPIB 2UWPA 2SFAA 1OYQA 1YPLH 1S0QA 3BEUA 3RC6A 4FU7A 4KP0A 4OS6A 1UO6A 3A86A 2ZGXH 3GYLB 1PYTC 1BDAA 2VIDA 3MH7A 1VZQH 1Z8GA 1A61H 2BD9A 3M7UA 3F6UH 6GCHG 1UHBA 2NWNA 5ESBA 5HXFA 4U30A 1N6XA 2QCYA 4BTUB 1ZHMA 2P59A 3KEEA 1L1NA 2VWNA 2O8UA 2ZA5A 3ZVCA 1E34B 3P70B 1AO5A 1DX5M 3RXRA 1MMJN 1KTSB 2P16A 2R0KA 1KIGH 4WF8A 1MTWA 2NU2E 3B8JA 2Z9JA 3TJVA 1OWDA 1IQLA 4BOHA 5F8TA 1AWFH 1AFEH 1PFXC 3PWBA 1ZTKA 3UIRA 2GP9B 1PYTD 3GCHC 3RC5A 2UWLA 2ZFTA 1UVPA 2WYGA 2WPJS 2BQ7B 3M7TA 1L0ZA 1P3EA 2VGCB 5A0AE 2BOKA 1YYY1 4NIWA 1K1PA 4D7GA 1LHCH 4GCHG 4AZ2B 3AAUA 1SB1H 3BIUH 2RG3A 1PPCE 1ELDE 3QDZB 1F5LA 4JK6A 1O30A 2BDCA 3BEFB 2XBXA 3RM0H 2CF8H 4XBDA 3HATH 1OSSA 1W11U 2OUAA 2IPHA 4R0IA 2ZDKA 1FAXA 2GZ9A 1BMAA 1CBWB 1EPTC 2ZPSA 2P3TB 5DP9A 6GCHF 5AFZH 1XUGA 3IWMA 4Q7XA 2FWWA 2FOHA 1C4V2 1XUKA 5JB8S 2A7HA 3BV9B 2ZECA 4Z6AH 3U98H 1AZZA 3FZDA 2B9LA 4GLYA 1UTNA 3ZZDA 1FLEE 3ZZ4A 3HK3B 4UFFH 4VGCB 4OS5A 1ELCA 1HXEH 1QCPA 1G36A 1V2VT 3Q3YA 1TAWA 1FZZA 2G8TA 4AB8A 1O35A 3I77A 1WCZA 4D9RA 4J2YB 1CVWH 5IYTA 2ZFFH 4ZUHA 4E7RG 3ELAH 2OXSA 3T28A 2FIRH 1PPFE 1GVLA 1ESTA 3OY6U 1DWBH 1A5GH 4GCHF 5DGJA 4B76A 3V3MA 1YCPM 4WXIA 2ZDLA 3M5MA 5EOKA 2IN2A 4I31A 2Z3EA 1C5VA 5FCRA 2H9EH 1VCWA 2O9QA 3RLWH 3VB7A 1GBLA 1DUAA 1UTQA 5EQSA 2PSXA 2O8LA 1TX6A 3PB1E 4AFUA 4MNWA 4PROA 5F03A 3NKKA 1AD8H 4I8JA 1ZRKA 1C5PA 1EJMA 1GI6A 1MKXK 2ANYA 4LK4A 1C2JA 1MUEB 4U2WA 3FFGA 3A80A 3SV2H 4DG4A 1S84A 4NIVA 3SU3A 3SUDA 1TX8A 2Q6FA 2UUFB 4NFFA 1KLIH 1O32A 3UTUH 1SQTA 4ZHMU 1O3DA 2AIQA 1C1WH 1DT2A 4XSKU 2Q6DA 1O3NA 1VJAU 1Z8RA 3EA9A 3DD2H 1S82A 2C3SA 4TWWA 5FHTA 4U32A 2BVXH 3LJOA 2R9PA 3PMAB 1WTGH 3TH3H 5EXNA 1C5TA 2D1JA 2GDEH 3CS0A 2PGQB 1CGIE 4BXSA 5EGMA 5FCKA 4O03A 4Y71A 5C1XA 1GI0A 3KF2A 1FNIA 1TGBA 2VWLA 1AY6H 4A92A 5DJ7A 1ETSH 3S69A 4WMDA 3DFLA 1T7CA 2G81E 7KMEH 1LPZB 1O37A 2FM2A 3QZRA 4X2VA 2BDGA 1HJAC 2FX4A 3GY3A 1EOLA 1T31A 1QQUA 4K5ZA 5DP8A 2FPZA 3SUFA 1V2MT 1KYNA 4BAQB 1O2NA 5EQQA 1O2UA 1HJ9A 1PPZA 3UNQA 4NIXA 4WMEA 2ZU1A 2G5NA 4MTBA 3ATKA 4XOJA 3RDZA 3EDXB 1NTPA 3EQ0H 1IOEA 1VJ9U 2ZHEH 1MU8B 1SGFG 2ZFSA 2TRMA 4AX9H 1HJ8A 4B73A 3BF6H 1GJ8B 1Y8TA 1NPMA 1HBTH 3UR9A 1ZRBA 2GX4A 2PKAA 4CHAC 1O3IA 4ISIH 1FIZA 1DFPA 4HI3A 3TIUA 4ZKOU 1ZYOA 2JH6D 1S83A 1MAYA 1H4WA 4OGYA 1UK4A 4INKA 2BLQA 5FX6A 3E1XB 2ZP0H 1OXGA 3TK6A 1DXWA 1UVSH 2C8WB 2F9VA 2ZGHA 1ELBA 1FY3A 1DICA 4BAKB 1IHTH 2EA3A 1SHHB 1LVBA 1V2PT 4D8NA 3Q77A 3IITA 4FVBA 1TMTH 1GJAB 1QRXA 1VGCB 3SJOA 2WV4A 1FV9A 1P2IA 1YPKH 1CE5A 3SQHE 1ANBA 1O2WA 2ANWA 1GBAA 5EXLA 2VB0A 3RXLA 1ANEA 3KHVA 1B7XB 1C1VH 3RLYH 1BRBE 5DP5A 1CHGA 1MH0A 4Y7BA 1DY9A 1TNJA 2AGIX 4I32A 2QF0A 3RC4A 1HAXB 2G55A 1FIWA 1J14A 3WY8A 8GCHG 1YLDA 4SGBE 4MPVA 1TPOA 2BD8A 1DWDH 3DUXH 4KKDA 3PLBA 3TH4H 1ABIH 3VGCC 2FI4E 4Y76A 1TNHA 2F9NA 3B9FH 2BD5A 1BBRK 1GHXH 1NRNH 2ZTXA 3AW1A 1KTTB 2FS9A 3M5NA 1XUJA 1Q3XA 1C2EA 4JZFH 4AYYB 1TBZH 1AB9C 1SSXA 1C5QA 3SNEA 2HLCA 2TGTA 3I29A 4UFGH 4A1XA 1O3LA 1EB2A 1VCQA 1AVWA 4NFEA 2V0BA 2C8ZB 4K8BA 5PTPA 1GBKA 1J15A 5T3HA 2TPIZ 4TPIZ 1XUFA 4RKJB 2PTCE 4AG1A 3R3GB 7ESTE 5F6MA 5LPEA 1E35B 1GHBG 2XBWA 1GDNA 1QA7A 2THFB 1P2OA 3GOVB 2Z9IA 1FI8A 1P02A 1FPCH 3RXKA 4YLQH 1ARBA 4UD9H 1HIAA 2BZ6H 2YOLA 3H7OA 2AMDA 4XBBA 2F3CE 2P8OB 4X0WU 5JYIA 2O8TA 2QAAA 4XBCA 1BJUA 1RIWC 1VR1H 3SW2B 5BPEA 4Q7YA 4K8YA 1P9SA 4JMYA 3MH6A 4NSYA 1LQEA 5FBIA 2A4GA 3ZZ6A 1A5IA 1W8BH 1S81A 3A87A 4ABIA 1LVMA 1TMBH 1MTNB 1VCPA 3L6PA 2BM2A 1TMUH 1XXFA 1ANDA 1F2SE 1GWAA 4B2CA 1JIRA 1MKXH 1T8NA 3RXCA 3OX7U 4CRFA 4MPUA 5LH8A 4DVAU 1O5BB 1D6RA 1EZSC 1MD8A 1NO9H 5EODA 1PPBH 1AGJA 4Q2KA 3BTTE 1C1TA 1GDQA 8LPRA 1MTVA 1O3KA 1GHBF 3ZZ3A 4ABGA 1VITH 4B75A 4DY7B 1QL7A 1IQIA 3CP7A 1QJ1B 5T6FA 3SUGA 3R0FA 2J9NA 3TU7H 1DITH 1V2QT 3V13A 2BDIA 5DP7A 3O8DA 1SGDE 1H8IH 2QN5T 1LHDH 4XE4A 4KTCA 1MD7A 1OOKB 5L30H 3QTOH 2R0LA 2EC9H 1GMHG 1D4PB 3P92A 2VWOA 1V2NT 3SBKA 1GJ6A 2LPRA 1BRCE 3GYMA 1E36B 4ABHA 1Y59T 2C8XB 1BTXA 1LMWB 5EW2H 1V3XA 2Y80A 4NWLA 4CHAB 1TQ7B 3QO6A 1QRZA 1W12U 1O34A 1HAVB 1TGCA 1GJ7B 2BLVA 1P2NA 3A7TA 1P11E 5JPMH 3B23B 1QBVH 3P8FA 4WVPE 4Q7ZA 2IOTA 1NFYA 1OWIA 2A7JA 5K0HA 4WMFA 1ZR0A 2GDDA 4DT7B 1N8OC 3RXJA 1GI9B 1YPHC 2FS8A 1CQQA 4U01A 2QIQA 2O8MA 3UNSA 2ZHFH 4AFQA 4AG2A 2ANKH 3U1JB 4RN6A 5C1UA 3PWCA 2DUCA 1KXDA 1QNJA 4ZHAA 2ESTE 1J8AA 2B7DH 5HYOA 4MNVA 3KQCA 3LIWA 4MNYA 3F68H 2FZZA 1W13U 1MKWK 2BDAA 1MZDA 4X8SH 1TNIA 3ZVAA 4YT6H 3A81A 4OS4A 1ZPCA 1LPGB 1A0LA 2VU8E 1GI7B 5LPFA 3BEIB 2W5EA 2BQ6B 1OKXA 3SHAH 1GMHF 1O2GH 1Y5UT 2F91A 4H42U 4K1EA 3KIDU 1V2RT 2G51A 2VIOA 5AFYH 4JCNA 2QYIA 1FDPA 3FZZA 1OWKA 2FTLE 1MQ6A 4FVDA 1O0DH 1UK3A 1O3AA 5GXPA 2ALPA 2Y5FA 3TGKE 1UTKA 5B6OA 3VGCB 1SFIA 2B8OH 4ZAEA 3RXMA 1GBMA 1TNLA 2D2DA 4E06H 1T8MA 2ZHQH 3MNCA 2GCTC 4FU8A 2A0QB 4JYUH 4FU9A 1EUFA 2ZDMA 1IQNA 5ETXA 3UQVA 3MYWA 1E38B 4DIHH 1NY22 2R3UA 2FOCA 2A5AA 2AEIH 2FODA 4B71A 1SOZA 1O2XA 1K21H 2STBE 1BBRE 2Y82A 4K1TA 3EE0B 2ZIQH 3RMMH 4XFQA 5E2OA 3M3TA 3BG4C 3PMBB 2ZEBA 3FP7E 1AMHA 3FANA 5E8EH 4ZHLU 2ZCLP 4JYVH 1V2LT 2IJOB 4D7FA 1KLJH 1H9LB 3MMGA 3U9AH 2Z9LA 1CT0E 1YPHE 2QXGA 3AAVA 1RIWB 1YPMH 3ZVBA 3G01A 1NRRH 1BBRH 3BTWE 1GCTC 3W95A 2SNVA 1TBRH 1L1GA 4CRAA 2PKSC 1NN6A 3KQDA 2FTMA 2VIPA 1GJ9B 2Z94A 1JRTA 1MAXA 1SGPE 2GMTC 3U69H 1F5KU 1CA8B 3S7KB 3VB6A 1HAIH 4ASHA 2HALA 4D76A 2BD2A 3BTDE 5A0BA 2F9UA 1F0UA 1RXPA 2J4IA 1GL1A 2ZF0H 2ZPQA 1SGTA 1UTPA 3Q00A 1GBBA 4Z0KA 1V6DA 3KL6A 3TLOA 2OD3B 1O3GA 1AIXH 5A8XA 2AYWA 1MTSA 3TH2H 4KTUA 1P2QA 1EASA 2R3YA 4I8HA 3GDVA 1ORFA 2WUBA 3HK6B 1BQYA 3QGNB 5A8ZA 4AB9A 3UUZA 3GY2A 1MBMA 4MPWA 4IBLH 1LVYA 1QB9A 2FDAA 5DG6A 3ZV8A 2EI6A 2HOBA 4ABDA 1Z6JH 3RXOA 2WPMS 2NU3E 2ZQ2A 3AASA 4Y0YE 4CRCA 1GVKB 2OQUA 1U6QA 5CHAC 1FAKH 1G3BA 3MU4A 1D3QB 2QA9E 5FAHA 1PPHE 4Q80A 4YO9A 2FLBH 3UWIA 1IQGA 4JZIA 1LHEH 2J94A 1TONA 1K1JA 4UFDH 2XYAA 1WTHD 4LXBH 1ESBA 4GHQA 1ZGIA 1QL9A 1C5LH 4OS2A 3RM2H 2HPQH 2XWBI 1C1UH 2TGAA 2Y81A 3S9BA 2Y7ZA 4BANB 1RFNA 2BDHA 1Z7KA 2Y5GA 1P2KA 2VVVA 2BXTH 4E05H 2RA3A 1ZHRA 4IN1A 2J2UA 1AU8A 1JMOH 4DJZB 3P17H 1FY4A 2ZHDA 4YOJA 4FUIA 1P0SH 2HRVA 1AFQC 1P57B 1C5YB 1WOFA 5E0HA 4KGAA 4I7YH 1TLDA 2FOMB 3SV8A 1XUHA 4NG9H 4R8TB 1HB0B 2Z6BD 1H1BA 1GHYH