1V2OT

Trypsin inhibitor in complex with bovine trypsin variant x(ssyi)bt.b4
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSYIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trypsin
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2oT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2oT02
2BD2A 1QBNA 2SNVA 1MAYA 1XMNB 3GY7A 2ZFRH 1ELTA 2YNBA 1SR5C 1HAOH 2IJOB 1O2SA 2ZZUH 3A85A 3ATMA 4DOQA 1XUJA 1UVPA 4B74A 1HXEH 1L1JA 4U2WA 1A3BH 1QY6A 3MU1A 1EXFA 3C27B 1HFDA 2C3SA 5HMAA 1ZYOA 2RG3A 2BD7A 1TQ7B 3BTEE 3HK6B 1QL8A 1ZZZA 1QL9A 1FUJA 2F9OA 2KAIA 4XBDA 3NKKA 1DWDH 3IG6B 1ZJDA 2TGTA 1DITH 3BG8A 4AYVB 1SHYA 3CENA 4WXVA 2BY7X 1GBKA 1C2DA 4FUCA 1K1LA 4X6PA 2XXLA 1N6YA 1KXFA 1P2OA 3K9XB 1OWIA 1SGRE 3E1XB 1Y5BT 2ZU1A 2EI7A 3GY3A 1HV7A 1XUGA 4ZH8A 2OQ5A 4B73A 6LPRA 4X8UH 5FBIA 2WPLS 2FX6A 2AGGX 1GBIA 3T26A 4DCDA 3VXEH 1C2EA 1W0ZU 3FZDA 1BRUP 1KSNA 2BDCA 3F6UH 1HIAA 3LU9B 1AU8A 1ELBA 4SGAE 1O3OA 2H5CA 1PQ8A 3D65E 3PB1E 1KDQB 1O2WA 2FODA 1GI3A 1BJUA 3MU5A 2UWOA 4CH8B 5C2ZA 2ESTE 2FXRA 5DGJA 3H7TA 5CE1A 1P0SH 1Y3VA 1V2RT 5C5NA 1ETRH 1OYQA 2F9NA 2GX4A 1EX3A 6ESTA 8GCHF 2VGCC 2IN2A 1LTOA 1YC0A 2P93A 2FDAA 1QL7A 4E7RG 4ABDA 2AH4X 3AAUA 1JWTA 4ZROA 2GCHF 5FAHA 1NN6A 1C5XB 1BCUH 3PYHA 3URDA 1TLDA 2ZC9H 4A1XA 3ZZ9A 2ZDKA 1AIXH 2PSYA 1DDJA 1MTUA 2J4IA 3JZ2B 1HCGA 8ESTE 3SU6A 1XVOA 3ZZ4A 1UHBA 1O2ZA 1KIGH 3VEQB 1C9PA 5FHTA 2GZ7A 2QV1A 4XBCA 1N8OC 4RN6A 2Z3CA 5I46H 4HGCA 1BITA 4A5TS 4Z0KA 1ZTJA 2A0QB 2VIDA 1O2NA 5TCAA 4MQAA 1DM4B 1EAXA 2D2DA 1NM6A 2ODPA 1GHYH 1O5CB 1BDAA 3RMMH 1BUIA 1FI8A 4UD9H 1WTGH 2FI4E 1E35B 3ZZ8A 2V3HH 1C1MA 1DS2E 4XE4A 4NIVA 1O38A 4LK4A 1ARCA 2XYAA 1O3AA 1C4V2 1XUIA 2I6QA 2ANKH 1DY9A 2VWMA 1A5IA 1THPB 1V2ST 2AGEX 2OCVB 2QF0A 3TVJB 1W3CA 1C9TA 3ZZ5A 4Q80A 3SN8A 1TPAE 3ITIA 2BMGB 5EXMA 3LJOA 2FPZA 2ZHDA 1BTPA 2AFQB 4FU7A 1W0YH 3M7UA 3MNXA 1AB9B 2A7JA 2PLXA 5F8ZA 1KTSB 1MTVA 1GJ4H 1NU9A 1DWEH 1GL0E 4KTCA 3FFGA 3RUOA 2LPRA 4AB9A 2HLCA 2TRMA 1ANCA 3T25A 1LHGH 2PGBB 3GICB 1RTLA 3TU7H 1A0HB 1NZQH 4R8TB 1HYLA 1TBRH 4K5ZA 5DG6A 2WV4A 1TE0A 3BG4C 2ZHFH 1O30A 1E0FD 2Z94A 3PLBA 4ISOA 3QGNB 2SGQE 3K6ZA 1O2HA 3EQ0H 4WMDA 6CHAB 4WMEA 3TK5A 1GCDA 3TK9A 4E06H 2ZU2A 1P12E 1C2FA 1MUEB 2Y81A 3Q3XA 2FLBH 2ODQA 1LCYA 3SJOA 1A2CH 1AKSA 1UMAH 2XWBI 1H9LB 4FUJA 2ZU5A 3U8OH 4IN2A 4JK5A 1TNHA 1VCWA 2Z9GA 1B0FA 1GI2A 1RRKA 1VZQH 3RXCA 5EQSA 5AFYH 1O31A 3TITA 2QF3A 3A87A 4O3TA 2FS8A 4M7GA 5L2YH 3S0NA 1YPGH 1VITH 1OSSA 5AHGH 4AOQA 1P02A 4MNYA 2F9VA 4FU9A 1TNKA 5A0CA 1K28D 4MNXA 5DO4H 1Z6JH 1NY22 4X1RU 7GCHF 4D76A 1GJ5H 1AVGH 1UTNA 2R2WU 1RTKA 2OD3B 3SW2B 4TY6A 4JZFH 1SOZA 3M3VA 1TRNA 1GMCG 2C8WB 3F1SB 4XOJA 2P8OB 1OP0A 5EG4A 1A61H 1NESE 3BIVH 4DGJA 4NA7A 1AY6H 1B5GH 3QO6A 4I8KA 1NT1A 3M3TA 4Y6DA 5EPYA 4INKA 2D8WA 1Q3XA 1A4WH 2A2XH 1SGNE 1JRTA 3DFLA 3MNSA 2D26C 1GJBB 1OP2A 1V3XA 1AN1E 1EAUA 2FOBA 1GMHF 3AAVA 4X2YA 2Z3EA 3PLPA 3PO1C 2BDIA 1VGCC 2PKSB 1K1MA 3QTOH 2R9PA 2A1DB 1O2QA 1OKXA 3D23A 2FEQH 4INLA 5HXFA 4GLYA 1ZSJA 1LVBA 1NFWA 2ZP0H 4WXIA 3R3GB 4BAMB 5A8XA 1V2KT 1YCPH 4CHAB 2WPIS 3SV9A 1MKWH 2HGTH 3E91A 1QRZA 5IDKA 4CREA 1MKXH 4DIHH 2BLWA 1C2JA 1DT2A 2O8MA 2VIQA 2GKVE 3GY8A 1PJPA 1YPHE 1S6HA 1O3HA 1YBWA 1C5SA 3QWCH 1W13U 1LHCH 4HTCH 1HAGE 3ZZ3A 2BLQA 1BOQA 1O5EH 4OGYA 3SJ8A 4FUBA 1RIWB 1ANDA 4A7IB 3K65B 2ZQ2A 1O2LA 1HUTH 3BEUA 1KLJH 4DIIH 3SHCH 4NG9H 2ZGXH 5J4QA 4MPWA 1Z8JB 1GHAF 3RXUA 2CHAB 2BY5X 4AFUA 1QBOA 1KLIH 1OWHA 4KP0A 3LIWA 5LPRA 1V2PT 3ZVDA 6GCHF 1P06A 3KQDA 2BVSH 2XBWA 2B9LA 3UR6A 2FS9A 1FY1A 2TGAA 4MPVA 2FOAA 1EPTA 2LNCA 3RXQA 1O2VA 1ESAA 2Z9IA 1IQHA 3AW1A 4X2WA 2M5TA 4X2XA 2CN0H 1FXYA 3I78A 1UO6A 4YM9A 1N1LA 2GGVB 4AX9H 2QN5T 3O8BA 2FWWA 4AFZA 1LVOA 1AE8H 1AUJA 1S82A 4ISIH 4X1NU 4TPIZ 2XTTB 4GHTA 5C67A 4NIWA 4X8SH 1BZXE 1G3CA 2C8ZB 1J14A 1KTTB 5GCHG 1SVPA 1AI8H 1G9IE 7KMEH 1TMTH 2PWXA 2GV6A 1C1OA 2VIPA 1MTNB 1C5QA 1EP5A 3VB7A 2ZG0H 2WUCA 1ZGVA 3ATKA 2ZDMA 3PTNA 5GDSH 3OU0A 3RXIA 3WY8A 5JDUB 1VITG 4JYUH 4BOHA 1AVXA 1S85A 3ELAH 1GBDA 1ZPCA 2SGDE 1QURH 4JZ1A 3LGVA 4O97A 1TGBA 1A0JA 1BB0B 5EOKA 1J17T 3F9GA 4ZKRU 3Q3YA 3O8CA 1GI5A 2THFB 1TAWA 2CV3A 2NU3E 4B2AA 4U32A 5DP4A 3A83A 1EUFA 4H42U 3EDXB 2RA0A 2F91A 1SLWB 1MH0A 2ZEBA 1HPGA 3MU4A 1NS3A 2FM2A 4ABJA 2ZDVH 1GHZA 4YO9A 3MFJA 1SGFA 2WV5A 2A45B 1CA0B 1EP6A 5HGGA 3V3MA 3CP7A 1AO5A 1C2LA 2G00A 1DY8A 1A3EH 1SFIA 1F5LA 3BTTE 3MH7A 1P2NA 4X1PU 4CBOA 3BF6H 4FUHA 1T4UH 1F0UA 1GJ7B 1C5VA 1AWFH 4TY7A 1SLUB 2SGAA 2BDHA 1FIZA 2ZFTA 3GCTG 2Q6FA 2NU0E 1FV9A 2Y7ZA 5CHAC 2GCTB 2C8XB 4FUDA 3QUMP 1SMFE 3SI4H 3SGAE 1XXDA 2G55A 2BLOA 1TBZH 3M5OA 1DUEA 2FTMA 2QXHA 4WH6A 1C1QA 4WVPE 4YTAA 3ZZAA 1GBFA 1YM0A 2ANMH 1TB6H 5AFZH 3S7KB 3Q76A 2ZQ1A 1HB0B 4NCYA 1D3QB 1AFQC 3NXPA 1SQTA 3U1JB 2R3UA 4BAQB 1AD8H 4YOJA 2P59A 1PFXC 2BX4A 3QK1A 3TNSA 1NO9H 3GY2A 3UQOA 3RXBA 3VB4A 3Q3KA 4OS7A 2OTVA 4H4FA 4D7FA 4KTUA 4LZ1H 1E37B 3RU4D 1GI1A 2EI6A 1INCA 4YT6H 1LVYA 3ZYEA 1ZLRA 3P8FA 3ZYDA 1FZZA 1UTKA 3FZZA 1WUNH 1EOJA 5E2OA 1G3DA 3E90B 1GJ8B 1BMAA 1WQSA 1W7GH 2BDGA 3UNQA 1ZOMA 1TNGA 4GCHF 4I33A 1WBGB 2JH5D 1J16A 1D6RA 1LKBA 1LHDH 3QLPH 2BD8A 2HPQH 1CA8B 1YPHC 4F49A 5BRRE 3STIA 1CT0E 3BTWE 2PUQH 3TJNA 4VGCB 2I6SA 1TA2A 1ZSLA 4FXGH 2Y5HA 1IQIA 1C1UH 1TIOA 4FUFA 3SUFA 3T5FH 1EB1H 5GWZA 1TOCB 1TGSZ 1Z8RA 2FX4A 3RMOH 3UWIA 1WAYB 1H8DH 2Z9KA 1C1RA 3LKWA 3GYLB 2XC0A 1V2JT 5BPEA 1HAPH 1OYTH 1NTPA 4ZAEA 5JBBS 1HAVA 2GMTB 1ZJKA 1G32B 1ABJH 4X6NA 1EB2A 2ZTYA 3SGBE 1J15A 5T6GA 1UCYH 1V2VT 1VJAU 2NU2E 3HGPA 1C1NA 3E6PH 1O2OA 5DJ7A 1CBWC 3UPEA 2J34A 2A7HA 1GWAA 2OBOA 1MD8A 1FPHH 1GJAB 4NGAH 3BN9A 3S9CA 1EJNA 1PPHE 4ZHMU 1T31A 5DP3A 4NIYA 2ZIQH 5EQRA 2IOTA 1S83A 4Y8ZA 3NUMA 1H1BA 1VCQA 1CQQA 4XSKU 1QIXB 2BM2A 1LPKB 1GI7B 1KDQA 1GBEA 3VGCC 4K60A 1BBRH 1OP8A 5K0HA 1FJSA 8GCHG 1W8BH 1ELCA 4ISLA 2OLGA 4FUEA 2IPHA 3BEFB 1GMDG 1Z8GA 7ESTE 1PYTC 2F83A 4K8BA 3PLKA 1A7SA 3FP6E 4DG4A 4GAWA 4O9VA 5F8TA 5CMXH 3OYPA 4BTUB 1F0SA 1KLTA 3F9FA 4IS5A 2PKAB 3AW0A 3RXVA 1SGCA 1MQ5A 1K1IA 4BXSA 1CSOE 1FAXA 3M5LA 2ZHQH 2SNWA 2F9BH 2V3OH 1SBWA 3GCOA 2B5TB 2FOHA 4X8VH 2AGIX 1BIOA 2NU4E 3ZVGA 3BTQE 3IWMA 1ANEA 1JOUB 2WPJS 3A7WA 3RC5A 5FCRA 4OS2A 2OC7A 1MBMA 1T8MA 4JCNA 1XKAC 3LGIA 3LPRA 4MPUA 4X1SU 5EQQA 1CU1A 5FPYA 1GCTB 1EKBB 1F0RA 2KAIB 2BB4A 1AZZA 4I31A 2P8OC 2QY0B 1C5OH 1FY5A 1UTOA 3FP7E 1OWJA 4AFQA 2OC0A 4PROA 1BJVA 4A92A 4JYVH 1E34B 2O8LA 2ZCHP 4XDEA 4YESB 3DA9B 5F6MA 4ZKSU 1ZHPA 3ZZBA 2HNTC 2H1UA 1G2MA 1EZSC 2DE9A 5DP7A 2H5DA 2P3FH 4MDSA 2V0BA 1RTFB 1FY8E 3S69A 3EYDA 1G3BA 4IMQA 1PQ5A 4YZUA 4O03A 4FUIA 3SU1A 3ZZ6A 1LHEH 4SGBE 1QBVH 4Y0YE 2UWPA 3RXEA 1O2YA 1AVWA 2G8TA 1CO7E 1HIAB 1S84A 1HGTH 3ATWA 5GXPA 5DK1A 1C5UA 3BV9B 1P05A 2ZDNA 3CS7A 2R0LA 4CRAA 3LOXA 4Y76A 3GOVB 2AMPA 2BTCE 1ELAA 1QGFA 1KXDA 4Y8YA 3K2UA 2CJIA 2W26A 2OP9A 2ZU3A 4KELA 4I8JA 5C1YA 2F9UA 1ZHRA 2BLVA 3VPKA 1GBLA 2SGEE 1FAKH 4BTIB 4IN1A 2BDBA 1KY9A 3FVFB 4X0WU 4NWKA 1AFEH 1DSUA 1ACBE 1MZDA 2G52A 1CGIE 1HAXB 1IAUA 3W94A 5HM2A 4HZHA 2YOLA 3GDVA 1BQYA 3G01A 1EJAA 2Z9LA 1LMWB 2A4GA 4GSOA 1GDQA 5EPNA 1UHBB 1N6XA 2GDEH 2ULLA 3V0XA 3P95A 4UFEH 2Z3DA 1GJDB 1WOFA 1C1WH 1MBQA 1W10U 4WH8A 1DWCH 3DT0H 7GCHG 3MO9A 3P70B 3VB3A 3A8CA 3OY5U 2RA3A 1YCPK 4UEHH 3M37A 3A7ZA 1MKWK 3SO3A 4Y11E 1LO6A 1TRMA 4WY3A 3EA8A 2GT8A 2OXSA 4ZUHA 3ZV8A 2Z6BD 2BHGA 1MKXK 2BQ6B 4Q7XA 1XX9A 1L1GA 1O3DA 1PPEE 1O2IA 2A4QA 2J92A 2WPMS 4CRCA 5K7RA 3UFAA 1FIWA 5EXLA 1SB1H 1FY3A 2BDAA 3MYWA 1C1SA 1O5FH 4K1TA 5A09A 3U8RH 1TPSA 3HKIB 4ZMAH 1DPOA 1GMHG 3UR9A 3LGWA 1VCPA 2VIWA 1GBBA 3A8AA 5A8YA 3MMGA 2Z9JA 1EPTC 3SBKA 4ZXXH 1QJ1B 2R3YA 3ZZDA 2P16A 1P2IA 1G36A 4Y79A 4NA8A 1O3GA 1SGQE 3A8DA 3L33A 2EC9H 3B9FH 3MO6A 5TCCA 3RLYH 3SJKA 3PMAB 5EXNA 2WPHS 2PGQB 3OSYA 1H9HE 2Q1JA 2ZGBH 2FOCA 1P9SA 2PW8H 4O3UA 5B6OA 3A86A 3HPTB 1F5RA 3SU2A 1FPCH 4DURA 1CHOG 5JB8S 4HFPB 2FOMB 4UFFH 2Z7FE 5ESTE 4B76A 1CA0C 3ZVCA 5LH8A 1XXFA 3DUXH 1K22H 1V2UT 2XBYA 1JXPA 2AS9A 3S9AA 1IQEA 3P8OA 1W14U 1YLCA 1JIRA 1K1JA 1IQLA 1L1NA 2XBVA 3RXJA 5A2MH 1AKSB 3UNSA 2TBSA 1HJ9A 1A5HA 1K1NA 1DANH 3LT3A 2ZFFH 1XM1A 1TFXA 4XBBA 4JZEH 1TNLA 1DVAH 3RXFA 2GCTC 1GHAG 3D62A 2GT7A 2FO9A 4MTBA 1JMOH 3M36A 4IBLH 1SLVB 1Z71A 6GCHG 2G81E 1Z1JA 3LH3A 4ZKNU 4ABAA 1HJAC 2C4FH 3FANA 3U1IB 3MH5A 3A82A 3RC4A 1UTMA 4DJZB 1P10A 1RD3B 5E2PA 4ABIA 2W3IA 2STBE 2EI8A 7LPRA 2NU1E 1UCYE 5PTPA 1GG6C 1O32A 1O5BB 4ISHH 3LH1A 5ABWA 3STJA 5C3NA 1T32A 3RXRA 4DVAU 4ZHAA 4B2BA 4THNH 3OY6U 1C2MA 1CE5A 1P3EA 3MHWU 1THSH 3QZQA 4JMYA 3MI4A 3SU5A 4JZDH 2WYGA 4AGJA 1ELVA 1GGDB 1VR1H 2ZCKP 2UUFB 1M9UA 1TGTA 1GMCF 5FX5A 3SUEA 8KME2 4OS6A 3ZVAA 2SGPE 1Z6EA 1UK3A 2J2UA 5T6DA 2J95A 3SNCA 3RU4T 1PPFE 1BBRE 2R0KA 4AB8A 1YP9A 1QFKH 4F4OC 3VB6A 5E8EH 4GUXA 1QCPA 2PTNA 2HWLB 1PPBH 4I8GA 1AQ7A 1QTFA 3RP2A 1MU6B 1GHWH 1GVKB 3KQEA 1YPLH 1OXGA 4GHQA 4R0IA 1ZR0A 1JIMA 2ILNA 1NRRH 2ALPA 1ARBA 3UY9A 2OC1A 4B2CA 1C5ZB 4J1YA 1MQ6A 1QQUA 3HK3B 1E36B 3MOCA 3SOSA 3R0FA 1C1VH 4OS1A 3SV7A 1GI6A 4K3JA 4IGDA 1KYNA 2GMTC 2O8UA 5FX6A 1LDTT 2Y82A 3EE0B 1GBCA 1QJ7B 1IQFA 1IHTH 2TGDA 2HNTF 3KNXA 1TX6A 4LXBH 2BD5A 1UK4A 2BQ7B 3LGYA 3BG4B 4YLQH 1FY4A 1P09A 4X1QU 3UWJH 4GPGA 4K8YA 4BNRA 3DFJA 2J94A 3M61U 1WU1A 3M5NA 2PV9B 4MPXA 3VFEA 1NROH 1LPGB 3U69H 3AVZA 2QIQA 1TABE 2G5NA 2VJ1A 4MNVA 3LC5A 1IQKA 1A0LA 5EU8A 4Y7BA 1FLEE 1GJCB 5DP8A 3ZZCA 2W7UA 2A2QH 3TIUA 3EA9A 1V2MT 2FOFA 1GI8B 1Y8TA 1NC6A 9ESTA 1RFNA 1WV7H 1D6WA 1GHBG 2BYAX 1C2IA 4YOIA 3UREA 4BXWA 2A4OA 3PMJA 2AEIH 4ABEA 1KXEA 4YT7H 4NSYA 1ELFA 2SFAA 2O8WA 1C1PA 1O2RA 2Y5GA 1BA8B 1YKTA 1C5LH 2BD9A 3BTGE 1GBHA 1UCYK 3GDUA 3RM2H 2AMQA 1O3NA 2GVFA 1DX5M 4D9RA 2STAE 2BZAA 2ZKSA 3ATLA 4OS5A 1F7ZA 1B0EA 1ZPZA 3RLWH 1O33A 1TMUH 1LKAA 4KKDA 1NFUA 2ZHEH 1GCTC 2FYQA 2CMYA 4JZIA 3MTYA 5JBCS 4YLUA 2ZGHA 3GCHB 1DUAA 5IYTA 2XC5A 4X6MA 1GI4A 3RU4E 2RCEA 2R2MB 1BBRK 1Z8IB 1DOJA 4WMFA 2O9QA 1MAXA 4AN7A 3MNBA 2XRCA 2ODYB 1P57B 5EW1H 2P95A 3GISB 1ORFA 1UVOA 1BMLA 3SZNA 9LPRA 4ESTE 3A7YA 4XFQA 1VITF 1S81A 1ELDE 2YNAA 3V13A 3RXOA 1PQ7A 1O2UA 1P03A 4MLFB 2JETB 3M7QA 2OQUA 5J4SA 1K9OE 1TMBH 3H7OA 1GBAA 1J8AA 1SQAA 1WCZA 2ANYA 1UK2A 1O5DH 3HATH 1PPCE 4FVDA 3SJ9A 4UFDH 1ZMNA 1HDTH 3SHAH 1MMJN 1O3CA 1NFXA 3TPIZ 1MTWA 4CH2B 1SC8U 4DW2U 2GV7A 2ANWA 1PPZA 5JYIA 3RXAA 2EEKA 1V2WT 4WJG2 1C2GA 1SGDE 2BXTH 3KCGH 1O2TA 4E7NA 1OOKB 3I77A 5ESBA 2BY9X 4ABHA 1QB6A 1T8NA 4ASHA 4DY7B 4NFFA 3SORA 1B7XB 1Y3UA 1FN8A 1WTHD 3GCTF 1EJMA 1IHSH 5F03A 4B75A 4UFGH 4WWYA 4WF8A 1V6DA 4Z6AH 1OWDA 1MCTA 3RMLH 1AWHB 2QXJA 1L0ZA 3A7XA 4BANB 3LJJA 1O3JA 3P17H 2BY8X 3T27A 4RSPA 4X8TH 1RJXB 2VH0A 1QJ6B 1O2XA 1AB9C 1YPEH 1WYKA 1QB9A 3E16B 1UVUH 1ZTKA 3TH2H 1NU7B 1MTSA 1VJ9U 1Y59T 3BEIB 3H5CB 4GVUA 1OWKA 1QR3E 2ZGCA 1QA0A 1GDUA 4IC6A 1EASA 1OS8A 4IMZA 1L2EA 1W7XH 1S0RA 2XW9A 2HRVA 4KTSA 3UNRA 3PV4A 1W2KH 1P2KA 1SPJA 1XUKA 3UOUA 5H4IB 1ID5H 2Q6DA 3URCA 1V2OT 1C4U2 1XKBC 6CHAC 1ETSH 1PQAA 1DSTA 3SQEE 3KGPA 3VB5A 1C5NH 3O8DA 2WYJA 2ZFSA 2ZTZA 1QRXA 2QYIA 3U98H 2GCHG 1QA7A 2VB0A 4I8LA 1IOEA 5GJ4B 4IW4E 1SFQB 2G51A 1G37A 2XBXA 1O3PB 2BVXH 2ZPRA 1C5PA 3SV6A 3A7VA 2ZECA 2WINI 5DP6A 4YOGA 1D3TB 2AIPA 1SLXB 1HAVB 1AMHA 3RXPA 3GCNA 3RXMA 1O2GH 4OS4A 1SI5H 3KIDU 5DP5A 2C90B 3PWCA 4CRFA 3UQVA 1MCVA 1Q31A 1YPJH 1FN6A 2ZPSA 1SGYE 3BIUH 2UWLA 5DP9A 1F2SE 3ZVBA 5A0BA 5E0JA 5LGOA 1FNIA 1P04A 3KQBA 3T62A 1T4VH 2ZDAH 2VVVA 4CRBA 5C5OA 1BHXF 2Y5FA 1O35A 1QNJA 2FI3E 1T7CA 3L3TA 1D9IA 5CHAB 5DKMA 1C4Y2 2ZHWH 1HXFH 5EODA 2P3TB 2VIVA 3M5MA 1AGJA 2PFEA 1Y5AT 3OTJE 1TGCA 1LQEA 1Q2WA 2PHBA 1CVWH 3K6YA 3A7TA 1LQDB 1NRNH 1NPMA 1W11U 1OX1A 2A7CA 3L6PA 2B8OH 2Q6GA 3I29A 2PKSC 4J2YB 3O8RA 1AFQB 2ZO3H 1P01A 3IITA 2AIQA 1UJ1A 2QXIA 1GMDF 5LPEA 1ELGA 1BTHH 1YYY1 1LPZB 3BTME 1P11E 3PTBA 3KF2A 3V12A 1IQNA 3U8TH 4CHAC 1P9UA 3TNTA 1CHGA 4K2YA 2W3KA 1EAIA 1TGNA 1O3BA 3F9HA 1HAYB 3RXHA 3MU8A 4QT8C 5EW2H 2PTCE 1A1RA 2VVCA 4H6SB 3SNBA 1AHTH 1A5GH 3EGKH 3ESTA 3KN2A 1DE7H 4K1EA 5C20A 4NFEA 3MWIU 1V2TT 2B7DH 2QGRA 1HBTH 4RKOB 3TJVA 3BTDE 2RDLA 4Y10E 3QTVH 2XCNA 1O3LA 3PROA 1ETTH 4NZLA 3GDSA 2A5KA 1GGDC 1G30B 1SQOA 3BTFE 1FDPA 1U6QA 3TGKE 4B1TA 1QRWA 1RIWC 3CS0A 2GZ8A 1KXBA 2BX3A 1O36A 2FTLE 1O3IA 2AERH 3LONA 1C5WB 3NWUA 2QAAA 1YF4A 1V2LT 2H9TH 1Z1IA 4ZKOU 2CHAC 1GPZA 1WQVH 3D49H 2TGPZ 4ZHLU 5FXLA 5JBTA 1O39A 2FESH 3SU0A 1F5KU 5JPMH 3V7TA 2A4RA 1SOTA 1TOMH 2G4TA 2XC4A 2XCFA 2H9HA 2D1JA 4NIXA 1A46H 5SGAE 2ASUB 1X7AC 1TA6A 1SGEE 1CBWB 1K1OA 1Z7KA 4AFSA 1QHRB 1O5AB 1HNEE 1CGHA 1ZTLA 4Q7ZA 1HLTH 1LHFH 3NK8A 2VINA 3MU0A 1C5YB 1KXAA 1SG8B 1S5SA 1Y3XA 1TYNA 3U9AH 3A88A 1ZHMA 5JB9S 1QB1A 1MTNC 1UVTH 2EA3A 2GZ9A 2OC8A 5ETXA 4CRDA 3VGCB 1EOLA 2ZWLH 3QN7A 3NCLA 1O2PA 1BTWA 4FVBA 1BMNH 3RXKA 2VWLA 3ZVFA 4ABBA 2FOGA 3M35A 2ZF0H 1GI0A 1JBUH 3DD2H 1GHXH 1SGTA 1TBQH 2VU8E 1G2LA 3EAJA 3LDXH 4BTTB 3SU3A 3A84A 2FIRH 2Y80A 4X2VA 3F9EA 3ENSB 3P8NA 2CF8H 1TNIA 2QCYA 2VVUA 4FU8A 1GVLA 3SJIA 1YPKH 5FPSA 4E05H 4UONA 2UUKB 3M7TA 3S9BA 1V2NT 2BOHB 2BZ6H 3N7OA 1BRCE 3C1KA 3RXLA 1UVSH 1RGQA 1TWXB 2FI5E 1XUFA 4NA9H 3SGQE 5AF9H 1SGPE 2ALVA 2DUCA 2JH6D 1EZUC 2Y6TA 2JH0D 3F68H 2VNTA 1EZQA 5F8XA 5A8ZA 2ZDLA 5FCKA 3MH4A 5G4BA 2J9NA 1P2MA 4RKJB 1TX8A 4X6OA 3TH3H 2CF9H 2BOKA 1C5RA 1GJ6A 1V2QT 2P94A 2C93B 2G5VA 5HM9A 1C5TA 1TRYA 1TX7A 2VGCB 2HVXA 5T3HA 4KGAA 1J9CH 4I8HA 1MU8B 3JZ1B 3B23B 3GCHC 1P2QA 3S7HB 1O2KA 1TPPA 2BD4A 2PR3A 1GVZA 4LZ4B 2GDDA 2FZZA 4Q7YA 1DWBH 1SHHB 3TH4H 2DE8A 1O3EA 1IQJA 4MVNA 1BTYA 1ZRKA 1ZMJA 1ZRBA 1BMMH 3RMNH 4D7GA 1NRQH 1S6FA 1D3PB 2BD3A 1TONA 1N8OB 4AGKA 1JRSA 3A8BA 1ZPBA 4CR5A 2JETC 3M3SA 3BTKE 5L2ZH 2ZU4A 2SGFE 1P3CA 1HJ8A 2AMDA 1D4PB 4ISNA 3E0NB 1HRTH 5L6NH 1OPHB 2V35A 1UTLM 2QXGA 2FLRH 5JBAS 3ZVEA 1ANBA 4Q2KA 1CHOF 4NSVA 1GBTA 2OINA 3T2NA 3GY4A 4UDWH 4DT7B 1H9IE 4TYDA 1MD7A 4TPYA 2CGAA 2H6MA 4U30A 2K1QA 3UIRA 4AORA 1SSXA 2OUAA 4I32A 4A1TA 4K69A 2BVRH 1O34A 1GHVH 3RC6A 5E0HA 3SV2H 3P6ZB 2Y7XA 5AVDA 3GY6A 2BXUH 2WPKS 2ZNKH 1K1PA 5LPFA 3SUGA 4VGCC 3MNCA 3BTHE 3RXGA 2BDYA 1GDNA 3BSQA 2HOBA 3SI3H 4CR9A 1GBJA 1HAZB 4JK6A 3OX7U 4CBNA 3ODFA 1IQMA 4BAKB 2ZPQA 1E38B 1HAHH 1ZMLA 3NPSA 3KQCA 5TJXA 3UOPA 3TJUA 1XVMA 1AZ8A 1ABIH 2VWNA 3PWBA 1FMGA 3RXDA 2P3UB 2ZTXA 2FMJA 4TWWA 2FOEA 1ZSKA 2F9PA 3LGUA 4AYYB 1XUHA 3SQHE 4A6LA 3KHVA 1F92A 3E8LA 4UE7H 2GD4B 1IQGA 4TWYA 1BTZA 3SU4A 4D9QA 4CRGA 4ZXYH 3GY5A 1BRAA 3LC3A 4HI3A 3TK6A 1QQ4A 2H2ZA 2B0FA 3KL6A 2ZGJA 2C8YB 4FUGA 4Y8XA 2F3CE 3HGNA 4NWLA 1EATA 3E0PB 2PSXA 4AG2A 1K2I1 2A5IA 1DXPA 3TJOA 1F0TA 1O3FA 2QA9E 3DHKH 3A81A 1O37A 1RXPA 1ELEE 1MZAA 2A5AA 5GIBA 3PM3A 2GTBA 1EPTB 1O0DH 1O2JA 4ABFA 3A80A 4LOYH 4IC5A 1GJ9B 1SGIB 5FBEA 1C2KA 4NZQA 1BTXA 1T8OA 1YCPM 1ZGIA 2XNIA 3RM0H 3VXFH 3TGJE 4H6TA 4Y71A 1T8LA 2VH6A 1DXWA 4Y7AA 1DFPA 2ZFQH 5E0GA 5A0AE 2ZCLP 1L4DA 1UTPA 3SUDA 1TALA 1PYTD 2TIOA 4OGXA 1AE5A 1Y3WA 1C1TA 3SV8A 3NZIA 2OBQA 3P8GA 1C5MD 2PUXB 1RS0A 4B71A 4U01A 3FP8E 3EA7A 1SL3A 4GCHG 1K21H 3TLOA 3HKJB 2A32A 3Q77A 1O2MA 1O3MA 1BTUA 5GCHF 3W95A 1TQ0B 2HNTE 4A1VA 1G3EA 5EGMA 2WUBA 1CGJE 1D3DB 3UTUH 1P8VC 3ZZ7A 3PO1B 2W5EA 5L30H 1VGCB 1TNJA 3MH6A 4D8NA 4I7YH 1GI9B 3T28A 2VWOA 1EQ9A 2ZA5A 8LPRA 1YPMH 3ODDA 2GP9B 3PMHB 2UUJB 3LGTA 5HYOA 2UUYA 2VIOA 2NWNA 2JKHA 1W12U 2V6NA 1HJAB 3Q00A 5DPAA 1CT4E 1Y5UT 1LVMA 2ZI2H 3SNDA 2FYRA 1DLKB 3RDZA 1BT7A 2XWAA 2J38A 5C1UA 1GHBF 5GPIB 3ATIA 2CXVA 3MO3A 2QC2A 3SNAA 3UUZA 1TPOA 4Y0ZE 1L4ZA 1YLDA 2HPPH 1GG6B 4INHA 3E3TA 1OWEA 1UTJA 3TGIE 1BRBE 1FONA 1GBMA 3QGJA 1DICA 4MG3A 2A31A 1S0QA 1Y3YA 1HAIH 2G4UA 3KEEA 5I25A 2ZFPH 3QX5H 3P92A 1C2HA 2W7SA 1PPGE 2BY6X 5T6FA 1EZXC 1SGFG 4K1SA 1EAWA 1H8IH 1GL1A 2AYWA 1DLEA 1NRPH 3QZRA 1NRSH 3FAOA 1O5GH 5FPTA 2O8TA 2FP7B 1FQ3A 1BHXB 1WSSH 1CT2E 1O3KA 3A89A 3SNEA 3GYMA 2H9EH 1UTQA 4MNWA 4JYTA 1ESBA 1P2JA 1ESTA 3AASA 3B8JA 2HALA 3RXSA 3QDZB 5C1XA 3RXTA 1NFYA 3T29A 1YGCH 2TPIZ 1THRH 2PKAA 3ZV9A 1KXCA 1H4WA 3PMBB 4AZ2B 4BAHB 4BAOB 4ABGA 2BQWB 4AG1A 1AUTC
chains in the Genus database with same CATH superfamily
2BD2A 1QBNA 2SNVA 1MAYA 1XMNB 3GY7A 2ZFRH 1ELTA 2YNBA 1SR5C 1HAOH 2IJOB 1O2SA 2ZZUH 3A85A 3ATMA 4DOQA 1XUJA 1UVPA 4B74A 1HXEH 1L1JA 4U2WA 1A3BH 1QY6A 3MU1A 1EXFA 1BMFD 3C27B 1HFDA 2C3SA 5HMAA 1ZYOA 2RG3A 2BD7A 1TQ7B 3BTEE 3HK6B 1QL8A 1ZZZA 1QL9A 1FUJA 2F9OA 2KAIA 4XBDA 3NKKA 1DWDH 3IG6B 1ZJDA 3KYFA 2TGTA 1DITH 3BG8A 4AYVB 1SQRA 1SHYA 3CENA 4WXVA 2BY7X 1GBKA 5EJLA 1C2DA 1H8ED 4FUCA 1K1LA 4X6PA 2XXLA 1N6YA 1KXFA 1P2OA 3K9XB 1OWIA 1SGRE 3E1XB 1Y5BT 2ZU1A 5B6LA 2EI7A 3GY3A 1HV7A 2KZ4A 3DCLA 4ACBA 1XUGA 4ZH8A 2OQ5A 4B73A 6LPRA 4X8UH 5FBIA 2WPLS 2FX6A 2AGGX 1GBIA 3T26A 4DCDA 3VXEH 1C2EA 1W0ZU 3FZDA 1BRUP 1KSNA 2BDCA 3F6UH 1HIAA 3LU9B 1AU8A 3SYJA 1ELBA 4SGAE 1SKYE 1O3OA 2H5CA 1PQ8A 3D65E 3PB1E 1KDQB 1O2WA 2FODA 3DSPA 1GI3A 1BJUA 3MU5A 2UWOA 4CH8B 5C2ZA 2KCAA 2ESTE 2FXRA 5DGJA 3H7TA 5CE1A 1P0SH 1Y3VA 1V2RT 2KCYA 3F2FA 5C5NA 1ETRH 1OYQA 2F9NA 2GX4A 1EX3A 6ESTA 8GCHF 2VGCC 2IN2A 1LTOA 1YC0A 2P93A 2FDAA 1QL7A 4E7RG 4ABDA 2AH4X 3AAUA 1JWTA 4ZROA 2GCHF 5FAHA 1NN6A 1C5XB 1BCUH 3PYHA 3URDA 1TLDA 5KGOA 2ZC9H 4A1XA 3ZZ9A 2ZDKA 1AIXH 2PSYA 1DDJA 1MTUA 2J4IA 3JZ2B 1HCGA 8ESTE 3SU6A 1XVOA 3ZZ4A 1UHBA 1O2ZA 1KIGH 4TT3D 3VEQB 1C9PA 5FHTA 2GZ7A 2QV1A 4XBCA 1N8OC 4RN6A 5CHBA 2Z3CA 5I46H 4HGCA 1BITA 4A5TS 4Z0KA 1ZTJA 2A0QB 2VIDA 1O2NA 5TCAA 4MQAA 1DM4B 1EAXA 2D2DA 1NM6A 2ODPA 1GHYH 1O5CB 1BDAA 3RMMH 1BUIA 1FI8A 4UD9H 1WTGH 2FI4E 1E35B 3ZZ8A 2V3HH 1C1MA 1DS2E 4XE4A 1YY3A 4NIVA 4TSFD 1O38A 4LK4A 1ARCA 2XYAA 1O3AA 1C4V2 1XUIA 2I6QA 3ZIAD 2ANKH 1DY9A 2VWMA 1A5IA 1THPB 1V2ST 2AGEX 2OCVB 2QF0A 3TVJB 1W3CA 1C9TA 3ZZ5A 4Q80A 3SN8A 1TPAE 3ITIA 2BMGB 5EXMA 3LJOA 2FPZA 2ZHDA 1BTPA 2AFQB 4FU7A 1W0YH 3M7UA 3MNXA 1AB9B 2A7JA 2PLXA 5F8ZA 1KTSB 1MTVA 1GJ4H 4Z1MD 3WW7A 1NU9A 1DWEH 1GL0E 1K0HA 4KTCA 3FFGA 3RUOA 2LPRA 4AB9A 2HLCA 2TRMA 1ANCA 3T25A 1LHGH 2PGBB 3GICB 1RTLA 3TU7H 1A0HB 1NZQH 4R8TB 1HYLA 1TBRH 4K5ZA 5DG6A 2WV4A 1TE0A 3BG4C 2ZHFH 1O30A 3PRDA 1E0FD 2Z94A 3PLBA 4ISOA 4XD7D 3QGNB 2SGQE 3K6ZA 1O2HA 3EQ0H 4WMDA 6CHAB 4WMEA 3TK5A 1GCDA 3TK9A 4E06H 2ZU2A 1P12E 1C2FA 1MUEB 2Y81A 3Q3XA 2FLBH 2ODQA 1LCYA 3SJOA 1A2CH 1AKSA 1UMAH 2XWBI 1H9LB 4FUJA 2ZU5A 3U8OH 4IN2A 4JK5A 1TNHA 1VCWA 2Z9GA 1B0FA 2XNDD 1GI2A 1RRKA 1VZQH 2JIZD 3RXCA 5EQSA 5AFYH 1O31A 3TITA 2QF3A 3A87A 4O3TA 2FS8A 4M7GA 5L2YH 3S0NA 1YPGH 1VITH 1OSSA 5AHGH 4AOQA 1P02A 1WDIA 4MNYA 2F9VA 4FU9A 1TNKA 5A0CA 1K28D 4MNXA 5DO4H 1Z6JH 1NY22 4X1RU 7GCHF 4D76A 1GJ5H 1AVGH 1UTNA 2R2WU 1RTKA 2OD3B 3SW2B 4TY6A 3PV2A 4JZFH 1SOZA 3M3VA 1TRNA 1GMCG 2C8WB 3F1SB 4XOJA 2P8OB 1OP0A 5EG4A 1A61H 1NESE 3BIVH 4DGJA 4NA7A 1AY6H 1B5GH 3QO6A 4I8KA 1NT1A 3M3TA 4Y6DA 5EPYA 4INKA 2D8WA 1Q3XA 1A4WH 2A2XH 1SGNE 1JRTA 3DFLA 3MNSA 2D26C 1GJBB 1OP2A 1V3XA 1AN1E 1EAUA 2FOBA 1GMHF 3AAVA 4X2YA 2Z3EA 3PLPA 3PO1C 2BDIA 1VGCC 2PKSB 1K1MA 3QTOH 2R9PA 2A1DB 1O2QA 1OKXA 3D23A 2FEQH 4INLA 5HXFA 4GLYA 1ZSJA 2M2AA 1LVBA 1NFWA 2ZP0H 4WXIA 3R3GB 4BAMB 5A8XA 1V2KT 1YCPH 4CHAB 2WPIS 3SV9A 1MKWH 2HGTH 3E91A 3NRLA 1QRZA 4B6FA 5IDKA 4CREA 1MKXH 4DIHH 2BLWA 1C2JA 3OEED 1DT2A 2O8MA 2VIQA 2GKVE 3GY8A 1PJPA 1YPHE 1S6HA 1O3HA 1YBWA 1C5SA 3QWCH 1W13U 1LHCH 4HTCH 1HAGE 3ZZ3A 2BLQA 1BOQA 1O5EH 4OGYA 3SJ8A 4FUBA 1RIWB 3UAIC 1ANDA 4I86A 4A7IB 3K65B 2ZQ2A 1O2LA 1MABB 1HUTH 3BEUA 1KLJH 4DIIH 3SHCH 4NG9H 2ZGXH 5J4QA 4MPWA 1Z8JB 1GHAF 3RXUA 2CHAB 2BY5X 4AFUA 1QBOA 1KLIH 1OWHA 4KP0A 3LIWA 5LPRA 1V2PT 3ZVDA 6GCHF 1P06A 3KQDA 2BVSH 2XBWA 2B9LA 3UR6A 2FS9A 1FY1A 2TGAA 4MPVA 2FOAA 1EPTA 2LNCA 4YXWD 3RXQA 1O2VA 1ESAA 2Z9IA 1IQHA 1VKYA 3AW1A 4X2WA 2M5TA 1NBME 4X2XA 2CN0H 1FXYA 3I78A 1UO6A 4YM9A 1N1LA 2GGVB 4AX9H 2QN5T 2J98B 3O8BA 2FWWA 4AFZA 1LVOA 1AE8H 1AUJA 1S82A 4ISIH 4X1NU 4TPIZ 2XTTB 4GHTA 5C67A 4NIWA 4X8SH 1BZXE 1G3CA 2C8ZB 4FOUC 1J14A 1KTTB 5GCHG 1SVPA 1AI8H 1G9IE 7KMEH 1TMTH 2PWXA 2GV6A 1C1OA 2VIPA 1MTNB 1C5QA 1EP5A 3VB7A 2ZG0H 2WUCA 1ZGVA 3ATKA 2ZDMA 3PTNA 5GDSH 3OU0A 3RXIA 3WY8A 5JDUB 1VITG 4JYUH 4BOHA 1AVXA 1S85A 3ELAH 1GBDA 1NBMD 1ZPCA 2SGDE 1QURH 4JZ1A 3LGVA 2EQNA 4O97A 1TGBA 1A0JA 1BB0B 5EOKA 1J17T 3F9GA 4ZKRU 3Q3YA 3O8CA 1GI5A 2THFB 1TAWA 2CV3A 2NU3E 4B2AA 4U32A 3F0PA 3A83A 1EUFA 5DP4A 4H42U 3EDXB 5C0UA 2RA0A 2F91A 1SLWB 1MH0A 2ZEBA 5DSFA 1HPGA 3MU4A 1NS3A 2FM2A 4ABJA 2ZDVH 2RFKC 1GHZA 4YO9A 3MFJA 1SGFA 2WV5A 4RI0A 2A45B 1CA0B 1EP6A 5HGGA 3V3MA 3CP7A 1AO5A 1C2LA 2G00A 2AHME 1DY8A 1A3EH 1SFIA 1F5LA 3BTTE 3MH7A 1P2NA 4X1PU 4CBOA 3BF6H 4FUHA 1T4UH 1F0UA 1GJ7B 1C5VA 1AWFH 4TY7A 1SLUB 2SGAA 2BDHA 1FIZA 2ZFTA 3GCTG 2Q6FA 2NU0E 1FV9A 2Y7ZA 5CHAC 2GCTB 2C8XB 4FUDA 4P00A 3QUMP 1SMFE 3SI4H 3SGAE 1XXDA 2G55A 2BLOA 1TBZH 3M5OA 1DUEA 2FTMA 2QXHA 4WH6A 1C1QA 4WVPE 4YTAA 3ZZAA 1GBFA 1YM0A 1EFRD 2ANMH 1TB6H 5AFZH 3S7KB 3Q76A 2ZQ1A 1HB0B 4NCYA 1D3QB 5C94A 1AFQC 3NXPA 1SQTA 5FL7D 3U1JB 2R3UA 4BAQB 1AD8H 4YOJA 2P59A 1PFXC 2BX4A 3QK1A 3TNSA 2J97A 1NO9H 3GY2A 3UQOA 3RXBA 3VB4A 3Q3KA 4OS7A 2OTVA 4H4FA 4D7FA 4KTUA 4LZ1H 1E37B 3RU4D 1GI1A 2EI6A 3U28C 1INCA 4YT6H 1LVYA 3ZYEA 1ZLRA 3P8FA 3ZYDA 1FZZA 1UTKA 3FZZA 1WUNH 1EOJA 5E2OA 1G3DA 3E90B 2K0QA 1GJ8B 1BMAA 1WQSA 1W7GH 2BDGA 3UNQA 1ZOMA 3OFND 1TNGA 4GCHF 4I33A 1WBGB 2JH5D 1J16A 1D6RA 1LKBA 1LHDH 3QLPH 2BD8A 2HPQH 1CA8B 1YPHC 4F49A 5BRRE 3STIA 3WWBA 1CT0E 3BTWE 2PUQH 2WHXA 3TJNA 4VGCB 2I6SA 1UW7A 3OEHD 1W0KD 1TA2A 1ZSLA 4FXGH 2LP6A 2Y5HA 1IQIA 1C1UH 1TIOA 4FUFA 3SUFA 3T5FH 1EB1H 5GWZA 1TOCB 1TGSZ 1Z8RA 2FX4A 3RMOH 3UWIA 1WAYB 1H8DH 2Z9KA 1C1RA 3LKWA 3GYLB 2GJGA 2WV9A 2XC0A 1V2JT 5BPEA 1HAPH 1OYTH 1NTPA 4ZAEA 5JBBS 1HAVA 2GMTB 1ZJKA 1G32B 1ABJH 4X6NA 1EB2A 2ZTYA 3SGBE 1J15A 5T6GA 1UCYH 1V2VT 1VJAU 2NU2E 3HGPA 1C1NA 3E6PH 1O2OA 5DJ7A 1CBWC 3UPEA 4ZCNA 2J34A 2A7HA 1GWAA 2OBOA 1MD8A 1FPHH 1GJAB 4NGAH 3BN9A 3S9CA 1EJNA 1PPHE 4ZHMU 1T31A 5DP3A 4NIYA 5C17A 2ZIQH 5EQRA 2IOTA 1S83A 4Y8ZA 3NUMA 1H1BA 1VCQA 1CQQA 4XSKU 1QIXB 2BM2A 1LPKB 1GI7B 1KDQA 1GBEA 3VGCC 4K60A 1BBRH 1OP8A 5K0HA 1FJSA 8GCHG 1W8BH 1ELCA 4ISLA 2OLGA 4FUEA 2IPHA 3BEFB 1GMDG 4AC9A 1Z8GA 7ESTE 1PYTC 2F83A 4K8BA 3PLKA 1A7SA 3FP6E 4DG4A 4GAWA 4O9VA 5F8TA 5CMXH 3OYPA 4BTUB 1F0SA 1KLTA 3F9FA 4IS5A 2PKAB 3AW0A 3RXVA 1SGCA 1MQ5A 1K1IA 4BXSA 1CSOE 1FAXA 3M5LA 2ZHQH 2SNWA 2F9BH 2V3OH 1SBWA 3GCOA 2B5TB 2FOHA 4X8VH 2AGIX 1BIOA 2NU4E 3ZVGA 3BTQE 3IWMA 1ANEA 1JOUB 2WPJS 3A7WA 3RC5A 5FCRA 4OS2A 2OC7A 1MBMA 1T8MA 4JCNA 1XKAC 3LGIA 3LPRA 4MPUA 4X1SU 5EQQA 1CU1A 5FPYA 1GCTB 1EKBB 1F0RA 2KFWA 2KAIB 2BB4A 4Q4LA 1AZZA 4I31A 2P8OC 2QY0B 1C5OH 1FY5A 1UTOA 3FP7E 1OWJA 2KCOA 2OC0A 4AFQA 4PROA 1BJVA 4A92A 4JYVH 1E34B 2O8LA 2ZCHP 4XDEA 4YESB 3OE7D 3DA9B 5F6MA 4ZKSU 1ZHPA 3ZZBA 2HNTC 2H1UA 1G2MA 1EZSC 2DE9A 5DP7A 2H5DA 2P3FH 4MDSA 2V0BA 1RTFB 1FY8E 3S69A 1YWUA 3EYDA 1G3BA 4IMQA 1PQ5A 4YZUA 4O03A 4FUIA 3SU1A 3ZZ6A 1LHEH 4SGBE 1QBVH 4Y0YE 2UWPA 3RXEA 1O2YA 1AVWA 2G8TA 1CO7E 1HIAB 1S84A 1HGTH 3ATWA 5GXPA 5DK1A 1C5UA 3BV9B 1P05A 2ZDNA 3CS7A 2R0LA 4CRAA 3LOXA 4Y76A 3GOVB 2AMPA 2BTCE 1ELAA 1QGFA 1KXDA 1YLNA 3K2UA 2CJIA 2W26A 2OP9A 2ZU3A 4KELA 4Y8YA 4I8JA 5C1YA 2F9UA 1ZHRA 2BLVA 3VPKA 1GBLA 2WZQA 2SGEE 1FAKH 3KQ5A 5C0TA 4BTIB 4IN1A 2BDBA 1KY9A 3FVFB 4X0WU 4NWKA 1AFEH 1DSUA 1ACBE 1MZDA 2G52A 1CGIE 1HAXB 1IAUA 3W94A 5HM2A 4HZHA 2YOLA 3GDVA 1BQYA 3G01A 1EJAA 2QE7D 2Z9LA 1LMWB 2A4GA 4GSOA 1GDQA 5EPNA 1UHBB 1N6XA 2GDEH 2ULLA 3V0XA 3P95A 4UFEH 2Z3DA 5T1VA 1GJDB 1WOFA 1C1WH 1MBQA 1W10U 4WH8A 1DWCH 3DT0H 7GCHG 3MO9A 3P70B 3VB3A 3A8CA 3OY5U 2RA3A 1YCPK 4UEHH 3M37A 3A7ZA 1MKWK 3SO3A 3OTPA 4Y11E 1LO6A 1TRMA 4WY3A 2EY4C 3EA8A 2GT8A 2OXSA 4ZUHA 3ZV8A 2Z6BD 2BHGA 1MKXK 2BQ6B 3EE7A 4Q7XA 1XX9A 1L1GA 1O3DA 1PPEE 2IPQX 1O2IA 2A4QA 2J92A 2WPMS 4CRCA 5K7RA 3UFAA 1FIWA 5EXLA 1SB1H 1FY3A 2BDAA 3MYWA 1C1SA 1O5FH 4K1TA 5A09A 3U8RH 1TPSA 3HKIB 4ZMAH 1DPOA 1GMHG 3UR9A 3LGWA 1VCPA 2VIWA 1GBBA 3A8AA 5A8YA 3MMGA 2Z9JA 1EPTC 3SBKA 2J5UA 4ZXXH 1QJ1B 2R3YA 3ZZDA 2P16A 1P2IA 1G36A 4Y79A 4NA8A 1O3GA 1SGQE 3A8DA 3L33A 2EC9H 3B9FH 3MO6A 5TCCA 3RLYH 3SJKA 3PMAB 5EXNA 2WPHS 2PGQB 3OSYA 1H9HE 2Q1JA 2ZGBH 2FOCA 1P9SA 2PW8H 4O3UA 5B6OA 3A86A 3HPTB 1F5RA 3SU2A 1FPCH 4DURA 1CHOG 2WSSD 5JB8S 2KX4A 4HFPB 2FOMB 1H8HD 4UFFH 2Z7FE 5ESTE 4B76A 1CA0C 3ZVCA 5LH8A 4FETA 1XXFA 3DUXH 1K22H 1V2UT 2XBYA 1JXPA 2AS9A 3S9AA 1IQEA 3P8OA 1W14U 1YLCA 1JIRA 1K1JA 1IQLA 1L1NA 2XBVA 3RXJA 5A2MH 1AKSB 3UNSA 2TBSA 1HJ9A 1A5HA 1K1NA 1DANH 3LT3A 2ZFFH 1XM1A 1TFXA 4XBBA 4JZEH 1TNLA 1DVAH 3RXFA 2GCTC 1GHAG 3D62A 2GT7A 2FO9A 4MTBA 1JMOH 3M36A 4IBLH 1SLVB 1Z71A 6GCHG 2G81E 1Z1JA 3LH3A 4RT0A 4ZKNU 4ABAA 1HJAC 2C4FH 3FANA 3U1IB 3MH5A 3A82A 3RC4A 1UTMA 4DJZB 1P10A 1RD3B 5E2PA 4ABIA 2QF5A 2W3IA 2STBE 2EI8A 7LPRA 2NU1E 1UCYE 5PTPA 1GG6C 1O32A 1O5BB 4ISHH 3LH1A 5ABWA 3STJA 5C3NA 5KECA 1T32A 3RXRA 4DVAU 4ZHAA 4B2BA 2KCPA 4THNH 3OY6U 1C2MA 1CE5A 1P3EA 3MHWU 1THSH 2L74A 3QZQA 2XOKD 3MI4A 4JMYA 4JZDH 2WYGA 3SU5A 4AGJA 1ELVA 1GGDB 1VR1H 2ZCKP 2UUFB 1M9UA 1TGTA 1GMCF 5FX5A 3SUEA 8KME2 4OS6A 3ZVAA 3F0OA 2SGPE 1Z6EA 1UK3A 2J2UA 5T6DA 2J95A 3SNCA 2J98A 5CDFE 3RU4T 1PPFE 1BBRE 2R0KA 4F55A 4AB8A 1YP9A 1QFKH 5IK2D 4F4OC 3VB6A 5E8EH 4GUXA 1QCPA 2PTNA 3F3BA 2HWLB 1PPBH 4I8GA 1AQ7A 1QTFA 3RP2A 1MU6B 1GHWH 1GVKB 3KQEA 1YPLH 1OXGA 4GHQA 4R0IA 1ZR0A 1JIMA 2ILNA 1NRRH 2ALPA 3AK5A 1ARBA 3UY9A 2OC1A 4B2CA 1C5ZB 4J1YA 1MQ6A 1QQUA 3HK3B 1E36B 3MOCA 3SOSA 1W0JD 3R0FA 1C1VH 4OS1A 3SV7A 1GI6A 4K3JA 4IGDA 1KYNA 2GMTC 2O8UA 5FX6A 1LDTT 2Y82A 3EE0B 1GBCA 1QJ7B 1IQFA 1IHTH 2TGDA 2HNTF 2YMSD 3KNXA 1TX6A 4LXBH 2BD5A 1UK4A 2BQ7B 5HKKD 3LGYA 3BG4B 4YLQH 1FY4A 1P09A 4X1QU 3UWJH 4GPGA 4K8YA 4BNRA 3DFJA 2J94A 2OK5A 3M61U 1WU1A 3M5NA 2PV9B 4MPXA 3VFEA 2F43B 4DT4A 1NROH 1LPGB 3U69H 3AVZA 2QIQA 1TABE 2G5NA 2VJ1A 4MNVA 3LC5A 1IQKA 1A0LA 5EU8A 4Y7BA 1FLEE 1GJCB 5DP8A 3ZZCA 2W7UA 2A2QH 3TIUA 3EA9A 1V2MT 2FOFA 1GI8B 1Y8TA 1NC6A 9ESTA 3FO8D 1RFNA 1WV7H 1D6WA 1GHBG 2BYAX 1C2IA 4YOIA 3UREA 4BXWA 2A4OA 3PMJA 2AEIH 1QZ8A 4ABEA 1KXEA 4YT7H 4NSYA 1ELFA 2SFAA 2O8WA 1C1PA 1O2RA 2Y5GA 1BA8B 1YKTA 2PP6A 1C5LH 2BD9A 3BTGE 1GBHA 1UCYK 3GDUA 3RM2H 2AMQA 1O3NA 2GVFA 1DX5M 4D9RA 2STAE 2BZAA 2ZKSA 3ATLA 4OS5A 1F7ZA 1B0EA 1ZPZA 3RLWH 1O33A 1TMUH 1LKAA 4KKDA 4B6EA 1NFUA 2ZHEH 1GCTC 2FYQA 2CMYA 4JZIA 3MTYA 5JBCS 4HG6A 2ZGHA 4YLUA 3GCHB 1DUAA 5IYTA 2XC5A 4X6MA 1GI4A 3RU4E 2RCEA 2R2MB 1BBRK 1Z8IB 1DOJA 4WMFA 2O9QA 1MAXA 4AN7A 3MNBA 2XRCA 2ODYB 1P57B 5EW1H 2P95A 3GISB 1ORFA 1UVOA 2F4LA 1BMLA 3SZNA 9LPRA 4ESTE 3A7YA 4XFQA 1VITF 1S81A 1ELDE 2YNAA 3V13A 3RXOA 1PQ7A 1O2UA 1P03A 4MLFB 2JETB 3M7QA 2OQUA 5J4SA 1K9OE 2IJD1 1TMBH 3H7OA 1GBAA 1J8AA 1SQAA 1WCZA 3MQKC 2ANYA 1UK2A 1O5DH 3HATH 3SZEA 1PPCE 4FVDA 3SJ9A 4UFDH 1ZMNA 1HDTH 3SHAH 1MMJN 1O3CA 1NFXA 3TPIZ 1MTWA 4CH2B 1SC8U 4DW2U 2GV7A 2ANWA 1PPZA 5JYIA 3RXAA 2EEKA 1V2WT 4WJG2 1C2GA 1SGDE 2BXTH 3KCGH 3N7DA 1O2TA 4E7NA 1OOKB 3I77A 5ESBA 2CK3D 2BY9X 4ABHA 1QB6A 1T8NA 4ASHA 4DY7B 4NFFA 3SORA 1B7XB 1Y3UA 3F2GA 1FN8A 1WTHD 3GCTF 1EJMA 1IHSH 5F03A 4B75A 4UFGH 4WWYA 4WF8A 1V6DA 4Z6AH 1OWDA 5HIYA 1MCTA 3RMLH 1AWHB 2QXJA 1L0ZA 3A7XA 4BANB 3LJJA 1O3JA 3P17H 2BY8X 3T27A 4RSPA 4X8TH 1RJXB 2VH0A 1QJ6B 1O2XA 5HIZA 1AB9C 1YPEH 1WYKA 1QB9A 3E16B 1UVUH 1ZTKA 3TH2H 1NU7B 1MTSA 1VJ9U 1Y59T 3BEIB 3H5CB 4GVUA 1OWKA 1QR3E 2ZGCA 1QA0A 1GDUA 5EJ1A 4IC6A 4P02A 1EASA 3N7EA 1OS8A 4IMZA 1L2EA 1W7XH 1S0RA 2XW9A 2HRVA 4KTSA 3WWFA 3PV4A 1W2KH 3UNRA 1P2KA 1SPJA 1XUKA 3UOUA 5H4IB 1ID5H 2Q6DA 3URCA 1V2OT 1C4U2 1XKBC 3FN8A 6CHAC 1ETSH 1PQAA 1DSTA 3SQEE 3KGPA 3VB5A 1C5NH 3O8DA 2WYJA 2ZFSA 2ZTZA 1QRXA 2QYIA 3U98H 2GCHG 1QA7A 4Q63A 2VB0A 4I8LA 1IOEA 5GJ4B 4IW4E 1SFQB 2G51A 1G37A 2XBXA 1O3PB 2BVXH 2ZPRA 1C5PA 3SV6A 3A7VA 2ZECA 2WINI 5DP6A 4YOGA 1D3TB 2AIPA 1SLXB 1HAVB 1AMHA 3RXPA 3GCNA 3RXMA 1O2GH 4OS4A 1SI5H 3KIDU 5DP5A 2C90B 3PWCA 4CRFA 3UQVA 1MCVA 1Q31A 1YPJH 1FN6A 1S6LA 2ZPSA 1SGYE 3BIUH 2UWLA 5DP9A 1F2SE 3ZVBA 5A0BA 5E0JA 5LGOA 1FNIA 1P04A 3KQBA 2VBCA 3T62A 3UB0A 1T4VH 2ZDAH 2VVVA 4CRBA 5C5OA 1BHXF 2Y5FA 1O35A 1QNJA 2FI3E 1T7CA 5GNDA 3L3TA 1D9IA 5CHAB 3N99A 5DKMA 1C4Y2 2ZHWH 1HXFH 5EODA 2P3TB 2QF4A 2VIVA 3M5MA 1AGJA 2PFEA 1Y5AT 3F2HA 3OTJE 1TGCA 1LQEA 1Q2WA 2PHBA 1CVWH 3K6YA 3A7TA 1LQDB 1NRNH 1NPMA 1W11U 1OX1A 2A7CA 3L6PA 2B8OH 2RDEA 2Q6GA 3I29A 2PKSC 4J2YB 3O8RA 1AFQB 2ZO3H 5F53A 1P01A 3IITA 2AIQA 1UJ1A 2QXIA 1GMDF 5LPEA 1ELGA 1BTHH 1YYY1 1LPZB 3BTME 1P11E 3PTBA 3KF2A 3V12A 1IQNA 3U8TH 4CHAC 1P9UA 3TNTA 1CHGA 5EJZA 4K2YA 2W3KA 1EAIA 1TGNA 1O3BA 3F9HA 1HAYB 3RXHA 2JJ2D 3MU8A 4QT8C 5EW2H 2PTCE 1A1RA 3GS9A 2VVCA 4H6SB 3SNBA 1AHTH 4XRNA 1A5GH 3EGKH 3ESTA 3KN2A 1DE7H 4K1EA 3KYGA 4NFEA 3MWIU 5C20A 1V2TT 2B7DH 2QGRA 1HBTH 4RKOB 3TJVA 3BTDE 2RDLA 4Y10E 5EIYA 3QTVH 2XCNA 1O3LA 3PROA 1ETTH 4NZLA 3GDSA 2A5KA 1GGDC 1G30B 1SQOA 3BTFE 1FDPA 1U6QA 3TGKE 4B1TA 1QRWA 1RIWC 3CS0A 2GZ8A 1KXBA 2BX3A 1O36A 2FTLE 1O3IA 2AERH 3LONA 1C5WB 3NWUA 2QAAA 1YF4A 1V2LT 2YMSB 2H9TH 1Z1IA 4ZKOU 2CHAC 1GPZA 1WQVH 3D49H 2TGPZ 4ZHLU 5FXLA 5JBTA 1O39A 2FESH 3SU0A 1F5KU 5JPMH 3V7TA 1E1RD 2V7QD 2A4RA 1SOTA 1TOMH 2G4TA 2XC4A 2XCFA 2H9HA 2D1JA 4NIXA 2W6ID 3H09A 1A46H 5SGAE 2ASUB 1X7AC 1TA6A 1SGEE 1CBWB 1K1OA 1Z7KA 4AFSA 3DSOA 1QHRB 1O5AB 1HNEE 1CGHA 1ZTLA 4Q7ZA 1HLTH 1LHFH 3NK8A 2VINA 3MU0A 1C5YB 1KXAA 1SG8B 1S5SA 1Y3XA 3PV5A 1TYNA 3U9AH 3A88A 1ZHMA 5JB9S 1QB1A 1MTNC 1UVTH 2EA3A 2GZ9A 2OC8A 5ETXA 4CRDA 3VGCB 1EOLA 2ZWLH 3QN7A 3NCLA 1O2PA 1BTWA 4FVBA 1BMNH 3RXKA 2VWLA 3ZVFA 4ABBA 2FOGA 3M35A 2ZF0H 1GI0A 1JBUH 3DD2H 1GHXH 1SGTA 1TBQH 2VU8E 1G2LA 3EAJA 3LDXH 4BTTB 3SU3A 3A84A 2FIRH 2Y80A 5KEDA 4X2VA 3F9EA 3ENSB 3P8NA 2CF8H 1TNIA 2QCYA 2VVUA 4FU8A 1GVLA 3SJIA 1YPKH 5FPSA 4E05H 4UONA 2UUKB 3M7TA 3S9BA 1V2NT 2BOHB 2BZ6H 3N7OA 1BRCE 3C1KA 3RXLA 3W1EA 1UVSH 1RGQA 1TWXB 2FI5E 1XUFA 4NA9H 3SGQE 5AF9H 1SGPE 2ALVA 4OM9A 2DUCA 2JH6D 1EZUC 2Y6TA 2JH0D 3F68H 2VNTA 3FKSD 1EZQA 5F8XA 5A8ZA 2ZDLA 5FCKA 3MH4A 5G4BA 2J9NA 2KM0A 3FOAA 1P2MA 4RKJB 1TX8A 4X6OA 3TH3H 2CF9H 2BOKA 1C5RA 1GJ6A 1V2QT 2P94A 2C93B 2G5VA 5HM9A 1C5TA 1TRYA 1TX7A 2VGCB 2HVXA 5T3HA 4KGAA 1J9CH 4I8HA 1MU8B 3JZ1B 3B23B 3GCHC 3PRBA 1P2QA 3S7HB 1O2KA 1TPPA 2BD4A 2PR3A 4F48B 1GVZA 4LZ4B 2GDDA 2FZZA 4Q7YA 1DWBH 1SHHB 3TH4H 2DE8A 1O3EA 1IQJA 4MVNA 1BTYA 1ZRKA 1ZMJA 1ZRBA 1BMMH 3RMNH 4D7GA 1NRQH 1S6FA 1D3PB 2BD3A 1TONA 1N8OB 4AGKA 1JRSA 3A8BA 1ZPBA 4CR5A 2JETC 3M3SA 3BTKE 5L2ZH 2ZU4A 2SGFE 1P3CA 1HJ8A 2AMDA 1D4PB 2W6JD 4ISNA 3E0NB 1HRTH 5L6NH 1OPHB 2V35A 1UTLM 2QXGA 2FLRH 5JBAS 3ZVEA 1ANBA 4Q2KA 1CHOF 4NSVA 1GBTA 2OINA 3T2NA 3GY4A 4UDWH 1E79D 4DT7B 1H9IE 4TYDA 1MD7A 4TPYA 2CGAA 2H6MA 2WPDD 2K1QA 4U30A 3UIRA 4AORA 3OAAD 1SSXA 2OUAA 4I32A 4A1TA 4K69A 2BVRH 5DN6D 1O34A 1GHVH 3RC6A 5E0HA 2V3MA 3SV2H 3CNRA 3P6ZB 2Y7XA 5AVDA 3GY6A 2BXUH 2WPKS 2ZNKH 1K1PA 5LPFA 3SUGA 4VGCC 1FX0B 3MNCA 3BTHE 3RXGA 2BDYA 1GDNA 1OHHD 3BSQA 2HOBA 4RT1A 3SI3H 4CR9A 1GBJA 1HAZB 4JK6A 3OX7U 4CBNA 3ODFA 1IQMA 4BAKB 2ZPQA 1E38B 1HAHH 1ZMLA 3NPSA 3KQCA 5TJXA 3UOPA 2HLDD 3TJUA 1XVMA 1AZ8A 1ABIH 2VWNA 3PWBA 1FMGA 3RXDA 2P3UB 2ZTXA 2FMJA 2JJ1D 2FOEA 4TWWA 1ZSKA 2F9PA 3LGUA 4AYYB 1XUHA 3SQHE 4A6LA 3KHVA 1F92A 3E8LA 4UE7H 2GD4B 1IQGA 4TWYA 1BTZA 4ACAA 3SU4A 4D9QA 4CRGA 4ZXYH 3GY5A 1BRAA 3LC3A 4HI3A 3TK6A 1QQ4A 1WXRA 2H2ZA 2B0FA 3KL6A 2ZGJA 2C8YB 4FUGA 4Y8XA 2F3CE 3HGNA 4NWLA 1EATA 3E0PB 2PSXA 4AG2A 1K2I1 2A5IA 1DXPA 3TJOA 1F0TA 1O3FA 2QA9E 3DHKH 3A81A 1O37A 1RXPA 1ELEE 1MZAA 2A5AA 5GIBA 3PM3A 2GTBA 1EPTB 1O0DH 1O2JA 4ABFA 3A80A 4LOYH 4IC5A 1GJ9B 2JDID 1SGIB 5FBEA 1C2KA 4NZQA 1BTXA 2L6OA 2K8IA 1T8OA 1YCPM 1ZGIA 2XNIA 3RM0H 3VXFH 3TGJE 4H6TA 4Y71A 1T8LA 2VH6A 1DXWA 4Y7AA 1DFPA 2ZFQH 5E0GA 5A0AE 2ZCLP 1L4DA 1UTPA 3SUDA 1TALA 1PYTD 2TIOA 4OGXA 1AE5A 1Y3WA 1C1TA 3SV8A 3NZIA 2OBQA 3P8GA 1C5MD 2PUXB 1RS0A 4B71A 4U01A 3FP8E 3EA7A 1SL3A 4GCHG 1K21H 3TLOA 3HKJB 2A32A 3Q77A 1O2MA 1O3MA 1BTUA 5GCHF 3DSGA 3W95A 1TQ0B 2HNTE 4A1VA 1G3EA 5EGMA 2WUBA 1CGJE 1D3DB 3UTUH 1P8VC 3ZZ7A 3PO1B 2W5EA 5L30H 1VGCB 1TNJA 3MH6A 4D8NA 4I7YH 1GI9B 3T28A 2VWOA 1EQ9A 2ZA5A 8LPRA 1YPMH 3ODDA 2GP9B 3PMHB 2UUJB 4M9FA 3LGTA 5HYOA 2UUYA 2VIOA 2NWNA 2JKHA 1W12U 2V6NA 1HJAB 3Q00A 5DPAA 1CT4E 1Y5UT 1LVMA 2ZI2H 3SNDA 2FYRA 1DLKB 3RDZA 1BT7A 2XWAA 2J38A 5C1UA 1GHBF 5GPIB 3ATIA 2CXVA 3MO3A 2HVYB 2QC2A 3SNAA 3UUZA 1TPOA 4Y0ZE 1L4ZA 3VG8A 1YLDA 2HPPH 1GG6B 4INHA 3E3TA 1OWEA 1UTJA 3TGIE 1BRBE 1FONA 1GBMA 3QGJA 4ASUD 1DICA 4MG3A 2A31A 2LELA 1S0QA 1Y3YA 1HAIH 2G4UA 3KEEA 5I25A 2ZFPH 3QX5H 3P92A 1C2HA 2W7SA 1PPGE 2BY6X 5T6FA 1EZXC 1SGFG 4K1SA 1EAWA 1H8IH 1GL1A 2AYWA 1KMHB 1DLEA 1NRPH 3QZRA 1E1QD 1NRSH 3FAOA 1O5GH 5FPTA 2O8TA 2FP7B 1FQ3A 1BHXB 1WSSH 1CT2E 1O3KA 3A89A 2KR7A 3SNEA 3GYMA 2H9EH 1UTQA 4MNWA 4JYTA 1ESBA 1P2JA 1ESTA 2YMSC 3AASA 3B8JA 2HALA 3RXSA 3QDZB 5C1XA 3RXTA 1NFYA 3T29A 1YGCH 2TPIZ 1THRH 2PKAA 3ZV9A 1KXCA 1H4WA 3PMBB 4AZ2B 4BAHB 4BAOB 4ABGA 1COWD 2BQWB 4AG1A 1AUTC
chains in the Genus database with same CATH topology
2BD2A 1QBNA 2SNVA 1MAYA 1XMNB 3GY7A 2ZFRH 1ELTA 2YNBA 1SR5C 1HAOH 2IJOB 1O2SA 2ZZUH 3A85A 3ATMA 4DOQA 1XUJA 1UVPA 4B74A 1HXEH 1L1JA 4U2WA 1A3BH 1QY6A 3MU1A 1EXFA 3C27B 1HFDA 2C3SA 5HMAA 1ZYOA 2RG3A 2BD7A 1TQ7B 3BTEE 3HK6B 1QL8A 1ZZZA 1QL9A 1FUJA 2F9OA 2KAIA 4XBDA 3NKKA 1DWDH 3IG6B 1ZJDA 2TGTA 1DITH 3BG8A 4AYVB 1SHYA 3CENA 4WXVA 2BY7X 1GBKA 1C2DA 4FUCA 1K1LA 4X6PA 2XXLA 1N6YA 1KXFA 1P2OA 3K9XB 1OWIA 1SGRE 3E1XB 1Y5BT 2ZU1A 2EI7A 3GY3A 1HV7A 1XUGA 4ZH8A 2OQ5A 4B73A 6LPRA 4X8UH 5FBIA 2WPLS 2FX6A 2AGGX 1GBIA 3T26A 4DCDA 3VXEH 1C2EA 1W0ZU 3FZDA 1BRUP 1KSNA 2BDCA 3F6UH 1HIAA 3LU9B 1AU8A 1ELBA 4SGAE 1O3OA 2H5CA 1PQ8A 3D65E 3PB1E 1KDQB 1O2WA 2FODA 1GI3A 1BJUA 3MU5A 2UWOA 4CH8B 5C2ZA 2ESTE 2FXRA 5DGJA 3H7TA 5CE1A 1P0SH 1Y3VA 1V2RT 5C5NA 1ETRH 1OYQA 2F9NA 2GX4A 1EX3A 6ESTA 8GCHF 2VGCC 2IN2A 1LTOA 1YC0A 2P93A 2FDAA 1QL7A 4E7RG 4ABDA 2AH4X 3AAUA 1JWTA 4ZROA 2GCHF 5FAHA 1NN6A 1C5XB 1BCUH 3PYHA 3URDA 1TLDA 2ZC9H 4A1XA 3ZZ9A 2ZDKA 1AIXH 2PSYA 1DDJA 1MTUA 2J4IA 3JZ2B 1HCGA 8ESTE 3SU6A 1XVOA 3ZZ4A 1UHBA 1O2ZA 1KIGH 3VEQB 1C9PA 5FHTA 2GZ7A 2QV1A 4XBCA 1N8OC 4RN6A 2Z3CA 5I46H 4HGCA 1BITA 4A5TS 4Z0KA 1ZTJA 2A0QB 2VIDA 1O2NA 5TCAA 4MQAA 1DM4B 1EAXA 2D2DA 1NM6A 2ODPA 1GHYH 1O5CB 1BDAA 3RMMH 1BUIA 1FI8A 4UD9H 1WTGH 2FI4E 1E35B 3ZZ8A 2V3HH 1C1MA 1DS2E 4XE4A 4NIVA 1O38A 4LK4A 1ARCA 2XYAA 1O3AA 1C4V2 1XUIA 2I6QA 2ANKH 1DY9A 2VWMA 1A5IA 1THPB 1V2ST 2AGEX 2OCVB 2QF0A 3TVJB 1W3CA 1C9TA 3ZZ5A 4Q80A 3SN8A 1TPAE 3ITIA 2BMGB 5EXMA 3LJOA 2FPZA 2ZHDA 1BTPA 2AFQB 4FU7A 1W0YH 3M7UA 3MNXA 1AB9B 2A7JA 2PLXA 5F8ZA 1KTSB 1MTVA 1GJ4H 1NU9A 1DWEH 1GL0E 4KTCA 3FFGA 3RUOA 2LPRA 4AB9A 2HLCA 2TRMA 1ANCA 3T25A 1LHGH 2PGBB 3GICB 1RTLA 3TU7H 1A0HB 1NZQH 4R8TB 1HYLA 1TBRH 4K5ZA 5DG6A 2WV4A 1TE0A 3BG4C 2ZHFH 1O30A 1E0FD 2Z94A 3PLBA 4ISOA 3QGNB 2SGQE 3K6ZA 1O2HA 3EQ0H 4WMDA 6CHAB 4WMEA 3TK5A 1GCDA 3TK9A 4E06H 2ZU2A 1P12E 1C2FA 1MUEB 2Y81A 3Q3XA 2FLBH 2ODQA 1LCYA 3SJOA 1A2CH 1AKSA 1UMAH 2XWBI 1H9LB 4FUJA 2ZU5A 3U8OH 4IN2A 4JK5A 1TNHA 1VCWA 2Z9GA 1B0FA 1GI2A 1RRKA 1VZQH 3RXCA 5EQSA 5AFYH 1O31A 3TITA 2QF3A 3A87A 4O3TA 2FS8A 4M7GA 5L2YH 3S0NA 1YPGH 1VITH 1OSSA 5AHGH 4AOQA 1P02A 4MNYA 2F9VA 4FU9A 1TNKA 5A0CA 1K28D 4MNXA 5DO4H 1Z6JH 1NY22 4X1RU 7GCHF 4D76A 1GJ5H 1AVGH 1UTNA 2R2WU 1RTKA 2OD3B 3SW2B 4TY6A 4JZFH 1SOZA 3M3VA 1TRNA 1GMCG 2C8WB 3F1SB 4XOJA 2P8OB 1OP0A 5EG4A 1A61H 1NESE 3BIVH 4DGJA 4NA7A 1AY6H 1B5GH 3QO6A 4I8KA 1NT1A 3M3TA 4Y6DA 5EPYA 4INKA 2D8WA 1Q3XA 1A4WH 2A2XH 1SGNE 1JRTA 3DFLA 3MNSA 2D26C 1GJBB 1OP2A 1V3XA 1AN1E 1EAUA 2FOBA 1GMHF 3AAVA 4X2YA 2Z3EA 3PLPA 3PO1C 2BDIA 1VGCC 2PKSB 1K1MA 3QTOH 2R9PA 2A1DB 1O2QA 1OKXA 3D23A 2FEQH 4INLA 5HXFA 4GLYA 1ZSJA 1LVBA 1NFWA 2ZP0H 4WXIA 3R3GB 4BAMB 5A8XA 1V2KT 1YCPH 4CHAB 2WPIS 3SV9A 1MKWH 2HGTH 3E91A 1QRZA 5IDKA 4CREA 1MKXH 4DIHH 2BLWA 1C2JA 1DT2A 2O8MA 2VIQA 2GKVE 3GY8A 1PJPA 1YPHE 1S6HA 1O3HA 1YBWA 1C5SA 3QWCH 1W13U 1LHCH 4HTCH 1HAGE 3ZZ3A 2BLQA 1BOQA 1O5EH 4OGYA 3SJ8A 4FUBA 1RIWB 1ANDA 4A7IB 3K65B 2ZQ2A 1O2LA 1HUTH 3BEUA 1KLJH 4DIIH 3SHCH 4NG9H 2ZGXH 5J4QA 4MPWA 1Z8JB 1GHAF 3RXUA 2CHAB 2BY5X 4AFUA 1QBOA 1KLIH 1OWHA 4KP0A 3LIWA 5LPRA 1V2PT 3ZVDA 6GCHF 1P06A 3KQDA 2BVSH 2XBWA 2B9LA 3UR6A 2FS9A 1FY1A 2TGAA 4MPVA 2FOAA 1EPTA 2LNCA 3RXQA 1O2VA 1ESAA 2Z9IA 1IQHA 3AW1A 4X2WA 2M5TA 4X2XA 2CN0H 1FXYA 3I78A 1UO6A 4YM9A 1N1LA 2GGVB 4AX9H 2QN5T 3O8BA 2FWWA 4AFZA 1LVOA 1AE8H 1AUJA 1S82A 4ISIH 4X1NU 4TPIZ 2XTTB 4GHTA 5C67A 4NIWA 4X8SH 1BZXE 1G3CA 2C8ZB 1J14A 1KTTB 5GCHG 1SVPA 1AI8H 1G9IE 7KMEH 1TMTH 2PWXA 2GV6A 1C1OA 2VIPA 1MTNB 1C5QA 1EP5A 3VB7A 2ZG0H 2WUCA 1ZGVA 3ATKA 2ZDMA 3PTNA 5GDSH 3OU0A 3RXIA 3WY8A 5JDUB 1VITG 4JYUH 4BOHA 1AVXA 1S85A 3ELAH 1GBDA 1ZPCA 2SGDE 1QURH 4JZ1A 3LGVA 4O97A 1TGBA 1A0JA 1BB0B 5EOKA 1J17T 3F9GA 4ZKRU 3Q3YA 3O8CA 1GI5A 2THFB 1TAWA 2CV3A 2NU3E 4B2AA 4U32A 5DP4A 3A83A 1EUFA 4H42U 3EDXB 2RA0A 2F91A 1SLWB 1MH0A 2ZEBA 1HPGA 3MU4A 1NS3A 2FM2A 4ABJA 2ZDVH 1GHZA 4YO9A 3MFJA 1SGFA 2WV5A 2A45B 1CA0B 1EP6A 5HGGA 3V3MA 3CP7A 1AO5A 1C2LA 2G00A 1DY8A 1A3EH 1SFIA 1F5LA 3BTTE 3MH7A 1P2NA 4X1PU 4CBOA 3BF6H 4FUHA 1T4UH 1F0UA 1GJ7B 1C5VA 1AWFH 4TY7A 1SLUB 2SGAA 2BDHA 1FIZA 2ZFTA 3GCTG 2Q6FA 2NU0E 1FV9A 2Y7ZA 5CHAC 2GCTB 2C8XB 4FUDA 3QUMP 1SMFE 3SI4H 3SGAE 1XXDA 2G55A 2BLOA 1TBZH 3M5OA 1DUEA 2FTMA 2QXHA 4WH6A 1C1QA 4WVPE 4YTAA 3ZZAA 1GBFA 1YM0A 2ANMH 1TB6H 5AFZH 3S7KB 3Q76A 2ZQ1A 1HB0B 4NCYA 1D3QB 1AFQC 3NXPA 1SQTA 3U1JB 2R3UA 4BAQB 1AD8H 4YOJA 2P59A 1PFXC 2BX4A 3QK1A 3TNSA 1NO9H 3GY2A 3UQOA 3RXBA 3VB4A 3Q3KA 4OS7A 2OTVA 4H4FA 4D7FA 4KTUA 4LZ1H 1E37B 3RU4D 1GI1A 2EI6A 1INCA 4YT6H 1LVYA 3ZYEA 1ZLRA 3P8FA 3ZYDA 1FZZA 1UTKA 3FZZA 1WUNH 1EOJA 5E2OA 1G3DA 3E90B 1GJ8B 1BMAA 1WQSA 1W7GH 2BDGA 3UNQA 1ZOMA 1TNGA 4GCHF 4I33A 1WBGB 2JH5D 1J16A 1D6RA 1LKBA 1LHDH 3QLPH 2BD8A 2HPQH 1CA8B 1YPHC 4F49A 5BRRE 3STIA 1CT0E 3BTWE 2PUQH 3TJNA 4VGCB 2I6SA 1TA2A 1ZSLA 4FXGH 2Y5HA 1IQIA 1C1UH 1TIOA 4FUFA 3SUFA 3T5FH 1EB1H 5GWZA 1TOCB 1TGSZ 1Z8RA 2FX4A 3RMOH 3UWIA 1WAYB 1H8DH 2Z9KA 1C1RA 3LKWA 3GYLB 2XC0A 1V2JT 5BPEA 1HAPH 1OYTH 1NTPA 4ZAEA 5JBBS 1HAVA 2GMTB 1ZJKA 1G32B 1ABJH 4X6NA 1EB2A 2ZTYA 3SGBE 1J15A 5T6GA 1UCYH 1V2VT 1VJAU 2NU2E 3HGPA 1C1NA 3E6PH 1O2OA 5DJ7A 1CBWC 3UPEA 2J34A 2A7HA 1GWAA 2OBOA 1MD8A 1FPHH 1GJAB 4NGAH 3BN9A 3S9CA 1EJNA 1PPHE 4ZHMU 1T31A 5DP3A 4NIYA 2ZIQH 5EQRA 2IOTA 1S83A 4Y8ZA 3NUMA 1H1BA 1VCQA 1CQQA 4XSKU 1QIXB 2BM2A 1LPKB 1GI7B 1KDQA 1GBEA 3VGCC 4K60A 1BBRH 1OP8A 5K0HA 1FJSA 8GCHG 1W8BH 1ELCA 4ISLA 2OLGA 4FUEA 2IPHA 3BEFB 1GMDG 1Z8GA 7ESTE 1PYTC 2F83A 4K8BA 3PLKA 1A7SA 3FP6E 4DG4A 4GAWA 4O9VA 5F8TA 5CMXH 3OYPA 4BTUB 1F0SA 1KLTA 3F9FA 4IS5A 2PKAB 3AW0A 3RXVA 1SGCA 1MQ5A 1K1IA 4BXSA 1CSOE 1FAXA 3M5LA 2ZHQH 2SNWA 2F9BH 2V3OH 1SBWA 3GCOA 2B5TB 2FOHA 4X8VH 2AGIX 1BIOA 2NU4E 3ZVGA 3BTQE 3IWMA 1ANEA 1JOUB 2WPJS 3A7WA 3RC5A 5FCRA 4OS2A 2OC7A 1MBMA 1T8MA 4JCNA 1XKAC 3LGIA 3LPRA 4MPUA 4X1SU 5EQQA 1CU1A 5FPYA 1GCTB 1EKBB 1F0RA 2KAIB 2BB4A 1AZZA 4I31A 2P8OC 2QY0B 1C5OH 1FY5A 1UTOA 3FP7E 1OWJA 4AFQA 2OC0A 4PROA 1BJVA 4A92A 4JYVH 1E34B 2O8LA 2ZCHP 4XDEA 4YESB 3DA9B 5F6MA 4ZKSU 1ZHPA 3ZZBA 2HNTC 2H1UA 1G2MA 1EZSC 2DE9A 5DP7A 2H5DA 2P3FH 4MDSA 2V0BA 1RTFB 1FY8E 3S69A 3EYDA 1G3BA 4IMQA 1PQ5A 4YZUA 4O03A 4FUIA 3SU1A 3ZZ6A 1LHEH 4SGBE 1QBVH 4Y0YE 2UWPA 3RXEA 1O2YA 1AVWA 2G8TA 1CO7E 1HIAB 1S84A 1HGTH 3ATWA 5GXPA 5DK1A 1C5UA 3BV9B 1P05A 2ZDNA 3CS7A 2R0LA 4CRAA 3LOXA 4Y76A 3GOVB 2AMPA 2BTCE 1ELAA 1QGFA 1KXDA 4Y8YA 3K2UA 2CJIA 2W26A 2OP9A 2ZU3A 4KELA 4I8JA 5C1YA 2F9UA 1ZHRA 2BLVA 3VPKA 1GBLA 2SGEE 1FAKH 4BTIB 4IN1A 2BDBA 1KY9A 3FVFB 4X0WU 4NWKA 1AFEH 1DSUA 1ACBE 1MZDA 2G52A 1CGIE 1HAXB 1IAUA 3W94A 5HM2A 4HZHA 2YOLA 3GDVA 1BQYA 3G01A 1EJAA 2Z9LA 1LMWB 2A4GA 4GSOA 1GDQA 5EPNA 1UHBB 1N6XA 2GDEH 2ULLA 3V0XA 3P95A 4UFEH 2Z3DA 1GJDB 1WOFA 1C1WH 1MBQA 1W10U 4WH8A 1DWCH 3DT0H 7GCHG 3MO9A 3P70B 3VB3A 3A8CA 3OY5U 2RA3A 1YCPK 4UEHH 3M37A 3A7ZA 1MKWK 3SO3A 4Y11E 1LO6A 1TRMA 4WY3A 3EA8A 2GT8A 2OXSA 4ZUHA 3ZV8A 2Z6BD 2BHGA 1MKXK 2BQ6B 4Q7XA 1XX9A 1L1GA 1O3DA 1PPEE 1O2IA 2A4QA 2J92A 2WPMS 4CRCA 5K7RA 3UFAA 1FIWA 5EXLA 1SB1H 1FY3A 2BDAA 3MYWA 1C1SA 1O5FH 4K1TA 5A09A 3U8RH 1TPSA 3HKIB 4ZMAH 1DPOA 1GMHG 3UR9A 3LGWA 1VCPA 2VIWA 1GBBA 3A8AA 5A8YA 3MMGA 2Z9JA 1EPTC 3SBKA 4ZXXH 1QJ1B 2R3YA 3ZZDA 2P16A 1P2IA 1G36A 4Y79A 4NA8A 1O3GA 1SGQE 3A8DA 3L33A 2EC9H 3B9FH 3MO6A 5TCCA 3RLYH 3SJKA 3PMAB 5EXNA 2WPHS 2PGQB 3OSYA 1H9HE 2Q1JA 2ZGBH 2FOCA 1P9SA 2PW8H 4O3UA 5B6OA 3A86A 3HPTB 1F5RA 3SU2A 1FPCH 4DURA 1CHOG 5JB8S 4HFPB 2FOMB 4UFFH 2Z7FE 5ESTE 4B76A 1CA0C 3ZVCA 5LH8A 1XXFA 3DUXH 1K22H 1V2UT 2XBYA 1JXPA 2AS9A 3S9AA 1IQEA 3P8OA 1W14U 1YLCA 1JIRA 1K1JA 1IQLA 1L1NA 2XBVA 3RXJA 5A2MH 1AKSB 3UNSA 2TBSA 1HJ9A 1A5HA 1K1NA 1DANH 3LT3A 2ZFFH 1XM1A 1TFXA 4XBBA 4JZEH 1TNLA 1DVAH 3RXFA 2GCTC 1GHAG 3D62A 2GT7A 2FO9A 4MTBA 1JMOH 3M36A 4IBLH 1SLVB 1Z71A 6GCHG 2G81E 1Z1JA 3LH3A 4ZKNU 4ABAA 1HJAC 2C4FH 3FANA 3U1IB 3MH5A 3A82A 3RC4A