1V2OT

Trypsin inhibitor in complex with bovine trypsin variant x(ssyi)bt.b4
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSYIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Trypsin
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2oT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2oT02
1GCTB 5K0HA 1ORFA 1T8OA 4WWYA 1O2NA 1UMAH 2VH0A 5ESTE 1GHXH 2FLRH 4OGXA 1MZDA 1KXAA 3RXSA 1SGTA 3T26A 5C20A 1Y3VA 2ZFQH 1XUJA 2OLGA 1MZAA 1C2FA 2CV3A 1TE0A 5EG4A 1DXPA 1FDPA 1SHYA 1C5ZB 1XUHA 4FUHA 3RXTA 3MH4A 1ABIH 3SNCA 3PTBA 4Q2KA 3TNSA 2FI3E 1B7XB 1EPTC 1Z8IB 3QWCH 1JBUH 2PLXA 4TWYA 2Z3DA 4IC6A 2WINI 4NSYA 1X7AC 3QX5H 1EJMA 1GJ9B 4WH8A 3BTME 3CS0A 6GCHG 3ODFA 3ODDA 5DPAA 3SJIA 1J15A 1ELDE 4JZDH 1SSXA 5DP8A 1K1NA 4CRCA 3UNRA 1LQEA 6GCHF 2B5TB 1CQQA 4B2AA 3RM0H 4Q7XA 3MH6A 5FXLA 1SGNE 1AFEH 1SGPE 2CXVA 2HGTH 2Y82A 1O33A 2GVFA 1Z6JH 1OWEA 3VPKA 5T6GA 1BBRE 1O32A 1O2MA 3KQBA 4CRBA 1S5SA 2XW9A 3NPSA 1V2RT 1QA0A 2GCTC 3TK5A 1H4WA 4YM9A 2OXSA 1GHYH 1SGCA 2HOBA 3QGNB 1HPGA 1BTHH 1DANH 2Q1JA 1Y3XA 1LQDB 1NU7B 2CGAA 3BSQA 4X2VA 1YPMH 4K1SA 1F7ZA 1P3EA 4X6NA 5EGMA 1A5IA 1IQGA 1TB6H 1BMAA 1HDTH 3TH3H 2BVRH 2OINA 4WMDA 2P3TB 1EB2A 1A61H 1C1UH 1GJ6A 3QK1A 1GGDB 4RKJB 3MU1A 2C8WB 1AB9B 4WXIA 3ESTA 1IQFA 2DE8A 3VB5A 2ZPSA 4DW2U 2ZFRH 2H5CA 1T7CA 4ABFA 1UTNA 4FUDA 1GMDG 4K3JA 1Q31A 1LTOA 4H42U 1O2GH 4D9RA 3E3TA 1GMDF 1ZMNA 2I6QA 4NGAH 3LJJA 2PFEA 5EQSA 3SHCH 3KIDU 3RXPA 2ODPA 4FU8A 4JZ1A 1D3TB 5I46H 1A2CH 2HNTC 2ODYB 2PHBA 5JBTA 2RA0A 1W14U 1L1GA 1OXGA 3EE0B 3F9FA 1Y5BT 3H7TA 1O3KA 1J17T 1BTZA 1A3BH 1S6HA 2OQ5A 1E34B 1G30B 5FPSA 3SUEA 1NRQH 5FHTA 5ETXA 2H1UA 2XCNA 3ZZ4A 1BMMH 3QLPH 2Q6DA 1YP9A 2A7CA 3A7VA 2BM2A 3GY4A 2CF9H 3UOUA 1A3EH 1ZHRA 5DGJA 1PQAA 5C1YA 5LH8A 1ANCA 5LPEA 3Q00A 2BD3A 3SU1A 4ABJA 2ZIQH 1O2PA 3O8RA 1O2YA 2QA9E 4ABIA 2J34A 3G01A 4RKOB 3ZZCA 2Y81A 4FUEA 2FOGA 1IQLA 3ZVGA 4YLUA 2FDAA 1AI8H 1UTJA 4O9VA 2P3UB 2Q6GA 1TNJA 1XX9A 1UTOA 4Y8ZA 3A7YA 3A85A 2R2MB 4ISLA 2PWXA 2M5TA 2SGDE 4KGAA 1WSSH 1CA8B 1CU1A 3LONA 2JH0D 1FXYA 1MTUA 3E8LA 2ULLA 1ANBA 4YTAA 2SGPE 3SNDA 1B0EA 2XCFA 1MTWA 1ZGIA 4INLA 1ZZZA 3SZNA 4AX9H 1LHFH 1OKXA 5AVDA 2G5NA 2Z9JA 2QXJA 1QBVH 1V2WT 1O3IA 1LVMA 1O35A 2FS8A 1EB1H 1DM4B 4AB9A 2D26C 1OP0A 4QT8C 5C67A 1LVBA 1UVOA 4UE7H 3UREA 5FX6A 4CH2B 2J2UA 3NWUA 2FTMA 1ANDA 3ZZDA 4K5ZA 1P01A 3A8CA 1GMHG 3BTHE 4Y79A 4MPUA 4NA7A 1P12E 1O3PB 1GMHF 1ID5H 1DDJA 4XE4A 3ITIA 2NU4E 1MD8A 2BDYA 4CREA 3DFLA 1NY22 1C5RA 3AW1A 1QJ6B 1HNEE 4KTSA 5EW2H 1DVAH 1OSSA 1AVGH 2G00A 3SQHE 2G4UA 1XXFA 1TGSZ 1GI2A 2Q6FA 4ZHMU 1ELVA 3BIVH 2B7DH 2VWMA 3FANA 1C1MA 7LPRA 4OS4A 3A81A 2BLWA 2QIQA 1LPGB 3SORA 3TJUA 3RMMH 2H9TH 1T4VH 1BTPA 3BTWE 1BBRK 3CS7A 3JZ1B 4X1SU 4OS7A 1O3CA 2NU0E 1V2TT 1IQMA 1C1PA 1E37B 3P8FA 3GY8A 2WPHS 2F83A 1DSUA 3ZVEA 3V12A 1FAKH 2FZZA 4A1TA 1O3AA 3QZQA 1UK2A 3MTYA 1OWJA 2PTCE 3TGIE 2TPIZ 3HKIB 5GPIB 1C5QA 2GP9B 4NA9H 1ZMJA 2UWLA 3S7HB 4J1YA 3FFGA 3SO3A 2BVSH 1YC0A 2XYAA 3T25A 2QXGA 4B76A 1FPCH 5F03A 3RDZA 3RXQA 4ZKRU 4E7RG 2F9NA 1AZ8A 1W0ZU 1NRPH 1BTUA 2A0QB 3OSYA 1HXFH 2AERH 1AHTH 1O3FA 4THNH 3URCA 1TMTH 4IN2A 3ZZ9A 5CHAB 1LHGH 2SGQE 2VWLA 4O03A 5HM2A 1IQNA 1QTFA 1VJ9U 3A87A 2BY6X 1TPOA 4F49A 4D76A 1HUTH 1IAUA 5EW1H 2P95A 1ZSJA 2AFQB 9ESTA 3HK3B 1QIXB 3RC4A 4FUJA 4NA8A 1C2LA 1FN8A 2A5KA 3P8OA 1A1RA 4ZXXH 2WV4A 4INHA 3BTFE 1N6XA 1MKWK 5T6FA 2ZDAH 3H5CB 2FPZA 2ZCHP 3LH3A 5GCHG 4Z6AH 3MYWA 3TH2H 4WMEA 4Y8XA 2ZTZA 4E7NA 1MQ6A 2TGPZ 1RS0A 3ZVBA 1D3PB 3EA7A 2ZDLA 1CVWH 3D23A 1HAPH 6CHAC 4WVPE 2XBXA 3GYMA 2BLQA 2NU1E 4B74A 2A4RA 2SGFE 1A0JA 1UHBA 1RTFB 4JYUH 1GCTC 4ISHH 2CMYA 3URDA 1RJXB 4DCDA 4MDSA 3MNXA 2VIOA 1FIZA 3NKKA 1O3JA 3MNSA 1EP5A 1ABJH 1QBNA 3S0NA 1GI3A 1BIOA 5SGAE 2A7JA 5TCAA 4X8TH 3NCLA 4Y76A 1K2I1 1AVWA 1YPKH 3VGCC 2OCVB 1INCA 1Y59T 3SU4A 3ZVDA 1O36A 1WTHD 5C5NA 2ILNA 1YPLH 3D49H 3SI3H 1MAXA 1KDQA 3UIRA 1GDNA 1PPGE 1O3HA 1XVMA 5GJ4B 3ENSB 4ZHLU 1K1IA 4BXSA 1O3OA 1TGNA 2ZKSA 1C1VH 3SOSA 3LDXH 1PJPA 1FV9A 3NZIA 2JH6D 1O2HA 4WJG2 1PPCE 4I8HA 4I8JA 2GMTB 1AD8H 3DD2H 2G8TA 2G52A 1V2QT 2ALVA 1OWHA 2A4OA 3GY7A 4CRFA 3U8RH 1BRCE 1NZQH 1QRWA 1KIGH 1LVOA 2Y80A 4UFGH 1AE5A 5C1UA 4TPIZ 4A92A 3SJKA 2BX3A 4UFEH 1WAYB 1S83A 2W5EA 3IITA 4CR5A 2UUYA 4TY6A 2XRCA 4JZFH 1MMJN 1OS8A 1S6FA 3AAUA 4UFDH 1NRNH 2OC1A 1WQVH 1F2SE 2XC4A 2PUXB 3RP2A 2ZFPH 2PGBB 9LPRA 3BTEE 1P04A 3F6UH 1QQ4A 2ZGBH 1RFNA 1KDQB 1EZSC 3U9AH 2AGEX 2D8WA 1SVPA 3NXPA 1YLCA 1GGDC 2ZZUH 1O2WA 4NIXA 1AB9C 2ANMH 3TGJE 1KLIH 2HNTF 3TJOA 4ZKNU 3UPEA 3VB4A 5EXNA 3M35A 1PYTD 3UWIA 1A0HB 3PLBA 1MH0A 5HMAA 3UY9A 1AU8A 1Z7KA 4H6TA 1F0UA 1TLDA 2O8WA 4K1TA 1UVUH 1ARCA 3A7XA 2JETB 1C5SA 3CENA 2ZHWH 2FYRA 2D2DA 2NWNA 1UTQA 1V3XA 1YCPK 2FYQA 4Y0ZE 2Z94A 1P2MA 1GBMA 1O3GA 3UUZA 2AS9A 3D65E 4GLYA 1XXDA 1ZOMA 3LKWA 2FX6A 2V35A 1MBMA 1MKXK 2F9PA 1V2OT 2HALA 2XNIA 1EASA 4Z0KA 1HB0B 3RXHA 3UOPA 2RA3A 2H5DA 5H4IB 4MLFB 4DJZB 3TLOA 1CE5A 3A8DA 4OS1A 4UD9H 2F9BH 3V0XA 4A6LA 1T31A 3VXFH 1GL0E 3MU4A 3KQDA 3VB7A 1QJ1B 4ABDA 1C1NA 1L1JA 1YCPM 1GJAB 4AG2A 3QZRA 4AYVB 3EA9A 1GDUA 3TPIZ 1C5VA 2WPKS 2A31A 1Z71A 2BOKA 1YM0A 3A7ZA 2SNVA 4WXVA 1C1TA 1A46H 2ESTE 1MU6B 1TX6A 4ABGA 3E1XB 6ESTA 2AMPA 1CO7E 2XWBI 5GWZA 1SGFG 1GJBB 7KMEH 4MNWA 4MPVA 4OS2A 3WY8A 1PYTC 2TIOA 1O2UA 1UCYK 1K1JA 3T2NA 1EZUC 3LT3A 4O3TA 2JKHA 2O8LA 5AF9H 3RXEA 1OWDA 3A83A 4DIHH 2ZEBA 1XKAC 4FUGA 1KY9A 2OQUA 1GBKA 2G4TA 4I33A 1JXPA 1SGIB 1N6YA 2FESH 1BTWA 3I77A 3E90B 3BTKE 2ZGXH 3LC5A 1AFQC 1O5CB 1PPFE 1Z8GA 1DICA 2V3OH 1C2JA 5ABWA 3LU9B 3TH4H 1AY6H 4TWWA 1XMNB 3RXFA 1XVOA 1D3QB 5A8XA 5EODA 4GSOA 4XBBA 1PPHE 4GHQA 2HNTE 1HV7A 2IPHA 1V2UT 1SGEE 1TABE 2QGRA 3VGCB 1SFIA 2P3FH 2FWWA 1KXBA 2V6NA 2CN0H 1ZJDA 2GD4B 3SW2B 2V0BA 4ABEA 5C5OA 1ZYOA 2VWOA 1VITG 2OUAA 4BAMB 3T5FH 1ANEA 1VITF 3SGAE 1FONA 4I8GA 3SV9A 1TX8A 3GISB 3BEFB 1V6DA 1SI5H 1SLUB 1UVTH 1LPZB 2FS9A 3E0PB 1P9UA 2HWLB 2BB4A 1C4Y2 2G55A 2P16A 1NT1A 2ZCLP 4KKDA 1YBWA 5F6MA 1ESTA 1GL1A 1GBDA 2XBVA 2WV5A 1ACBE 2H9EH 4GPGA 2BVXH 3A8BA 2WPLS 1OP8A 1D9IA 1T32A 1LVYA 4Y7AA 1O2JA 3ZZBA 3OY6U 3PLKA 4BNRA 2ZO3H 2ZCKP 1HJ8A 3ZV9A 2ZPRA 1VJAU 5G4BA 4FU7A 1F5RA 1IHSH 1QL8A 1TBZH 1K1MA 3RC5A 2ZC9H 1GI9B 3KEEA 3M3TA 2A5AA 4IMQA 4X2WA 1E38B 1W13U 4ZUHA 3O8CA 4XOJA 1E36B 1G3CA 1THPB 3SUDA 1O2KA 4ABBA 4M7GA 4X0WU 2BZ6H 3T27A 2ZU4A 1EQ9A 3HKJB 1DUAA 4MNYA 5LGOA 1NPMA 1J14A 1OX1A 1OYQA 5CHAC 3JZ2B 3V3MA 2B9LA 2UUFB 2NU3E 2ZECA 4BAHB 3MO9A 1W11U 1CT4E 5F8XA 4ZH8A 3RXKA 1GI7B 2PV9B 1YPHC 1GJ4H 1UJ1A 2D1JA 3A89A 4R8TB 1S81A 1C5WB 1C1OA 4X6MA 2HLCA 4R0IA 3LGYA 4HI3A 1SPJA 2VH6A 1LMWB 3SV8A 2FI5E 3ATWA 5JBBS 4NZQA 1KYNA 3FP8E 1C9TA 5CE1A 1QHRB 1JOUB 1GHVH 1EAUA 2J94A 2PKSB 3SV2H 4FXGH 1ZPZA 1V2MT 1M9UA 1K21H 3BG4B 2ZU5A 1KXFA 1C5LH 2W26A 1QL7A 1BITA 2PGQB 3SNAA 4X6PA 1YF4A 1THRH 2ZGHA 2Y5FA 2BDGA 4I8KA 4NSVA 1RTLA 3MO6A 5A0CA 2SFAA 3MNBA 3LGIA 2BD8A 2BY5X 4IC5A 1IQHA 4BXWA 5JYIA 8ESTE 1TBRH 4U01A 5FAHA 4B73A 2YNBA 1K9OE 1AWHB 1HYLA 3SUFA 2VGCC 4ASHA 5EXLA 2BQ7B 3TVJB 5F8TA 4IBLH 1BHXF 3M5OA 1BZXE 1O5FH 1P9SA 1QJ7B 3RUOA 2RDLA 4IGDA 4LK4A 2ZA5A 3RXMA 3UNSA 4SGAE 3VEQB 1MTSA 3PWCA 3EA8A 1GBIA 1GBFA 3ATLA 1Q2WA 4D9QA 1TGBA 4X1PU 2BLOA 2R0KA 3PMJA 1EATA 2BD7A 3SUGA 1XM1A 1HAZB 3K6ZA 1L2EA 2GMTC 1ESAA 1TGCA 2PTNA 1OWKA 1BJUA 1GHZA 2VIWA 3GY3A 4Y7BA 2CF8H 1ZTKA 2VIQA 1OPHB 2DE9A 1T4UH 2WUCA 1AFQB 3DUXH 1C1QA 1NTPA 1GHBG 4DT7B 1O2TA 4X8UH 2FOFA 1H9LB 3Q3KA 1MTVA 1BT7A 1GHBF 1LKBA 2BY7X 1CSOE 4TYDA 3SJ8A 1LPKB 1NS3A 1SR5C 1GHWH 1WUNH 1GVKB 4MPWA 5L2ZH 3BG8A 2R3UA 2BXTH 2OC8A 3K6YA 4ZROA 5K7RA 1TAWA 2TRMA 8GCHG 5EQRA 1SQAA 4MPXA 1ELBA 1GVLA 4XFQA 8GCHF 3L33A 2BMGB 4BOHA 1O3DA 1GMCG 1QFKH 2A2QH 2ZDVH 3M7UA 1EP6A 1Q3XA 3MU8A 1O38A 4HGCA 3SU6A 3BV9B 1GJ5H 1GMCF 1QB6A 1C5TA 4FUCA 1BMNH 4AFZA 1C4U2 1C2IA 3OX7U 1RIWB 3E91A 4OS6A 5DJ7A 1HBTH 1B0FA 2GGVB 2ZFFH 3H7OA 2ZQ1A 1ETRH 1UVSH 3ZYDA 1BDAA 3QUMP 3RMNH 1O5BB 2JETC 1C5YB 4MVNA 4TPYA 3TK6A 1FY8E 1P8VC 1SOZA 1Z1JA 2OC7A 1IOEA 1ZMLA 4LXBH 3U8TH 3ZVCA 4A1XA 3GY2A 3Q3XA 2UUKB 5JB9S 2Z7FE 4NIYA 2ZHEH 2W7UA 1ZGVA 3LIWA 3HGPA 3LOXA 3MHWU 2QXIA 4MG3A 2PSYA 5L6NH 1LHCH 1SHHB 3BF6H 4AZ2B 1HJAB 3A7WA 2PSXA 3MU5A 3PV4A 1JWTA 4D7GA 4GAWA 3UFAA 4CBOA 1V2KT 1QY6A 2B8OH 1GPZA 1IQJA 4JCNA 1H8DH 4YOJA 3I78A 2R0LA 2ZPQA 1MU8B 4KELA 3RLWH 1Y3UA 3KQEA 3L6PA 4CHAB 1LHDH 1W3CA 2ZNKH 3RXRA 1CT2E 1FJSA 3M5MA 3F9HA 4U30A 4BTIB 1C9PA 2ZP0H 1ZHPA 3B23B 3M5LA 1H9HE 1QBOA 1AKSA 1TONA 4E06H 1VR1H 2J4IA 2VIDA 3P17H 4B1TA 2FP7B 2OBQA 4FUIA 1GBCA 8KME2 2AMQA 4UONA 5FCKA 3RXUA 2THFB 3T29A 1ZLRA 2VVUA 4YT7H 1TBQH 1ZJKA 1BUIA 5A8ZA 5GCHF 4LZ1H 1LCYA 1KXCA 1UCYE 1WTGH 1C1SA 3M5NA 3GCHC 3TK9A 3GDUA 1G3BA 2BXUH 2SGAA 2WYJA 2ZDMA 1SLVB 2TBSA 1EX3A 3P92A 5I25A 5AHGH 1L4DA 3MO3A 4YESB 3RXBA 3DFJA 3ZZ5A 4X2XA 2CJIA 1AZZA 3MI4A 1FI8A 3B9FH 1SGFA 1S0QA 1TIOA 3SNEA 2VGCB 2QYIA 4ABAA 3K65B 5EQQA 1BRAA 2Z9GA 1GBLA 2P94A 1ESBA 1C5MD 4Y10E 1LHEH 1TPSA 2ZGCA 4CRGA 1UTLM 1KSNA 1CGHA 1AKSB 1RGQA 2ZFSA 1P03A 3A8AA 4X6OA 2OC0A 3D62A 4NZLA 4HZHA 1MCTA 2GZ8A 5AFZH 1TALA 4K8YA 2C3SA 4I7YH 5CMXH 1MAYA 3FZDA 2FOMB 4X1QU 2HRVA 2Y7XA 1GBBA 2FXRA 3AW0A 2IJOB 4AYYB 1O2QA 1SC8U 3SV6A 1SGDE 3R3GB 3PMBB 1QL9A 3S9CA 3R0FA 4AOQA 4Y71A 4DGJA 4ISOA 3P8NA 1BQYA 1G3DA 3SGBE 3MOCA 4MTBA 3BN9A 1UTKA 4NCYA 3MMGA 1O2OA 1ZPCA 1UVPA 4ESTE 1T8NA 1QCPA 5FCRA 1WBGB 2PUQH 3PO1B 3PWBA 1CT0E 3A84A 5AFYH 1O30A 2CHAB 1PPEE 1V2VT 1AMHA 3GICB 2AMDA 4BANB 1Y8TA 3GCOA 1DY8A 4XSKU 3ZYEA 1D6RA 1K1LA 4KTCA 5PTPA 4TY7A 1VGCB 2O8MA 4J2YB 2XC0A 3U1JB 1Y5AT 1C2GA 4I8LA 1K22H 3MNCA 2H2ZA 1N8OB 1SL3A 1UK4A 4JZIA 3FP6E 2VB0A 4BTTB 1PPZA 3QN7A 3E6PH 1F0RA 4DURA 1TYNA 2Y5GA 4K60A 1EOLA 2G81E 3RMLH 3ZV8A 1P05A 1P11E 1Z8RA 2R3YA 4K2YA 3P70B 4UFFH 4OGYA 4OS5A 2GKVE 3ZZ3A 1BTXA 1TQ0B 1TNLA 3S7KB 3U8OH 4NFFA 1TMBH 1C2KA 1BMLA 1PFXC 1D3DB 2ZG0H 1HAIH 2FX4A 1BA8B 5DKMA 3TIUA 4AFQA 3P6ZB 1SOTA 2FI4E 2WPIS 1O2LA 3RU4T 1P2NA 2BD4A 4K8BA 1P06A 1RTKA 3FZZA 1DITH 2BX4A 4D8NA 3LJOA 1TRMA 5B6OA 2PKSC 1SBWA 1GCDA 3B8JA 1GG6C 3BG4C 3Q3YA 5LPFA 2A7HA 1VCQA 2ZHDA 4FVDA 1F5LA 4BAOB 1TNKA 4B75A 3EYDA 1DWDH 3FVFB 3QGJA 2TGDA 3A80A 3T28A 3AASA 5GDSH 3U98H 2F9UA 1TGTA 2TGAA 1FY1A 3ZZ7A 4JK5A 3SU3A 4Y11E 2PKAA 1A4WH 1DT2A 3SGQE 3RM2H 1DE7H 2VINA 2ZTYA 4AORA 2WYGA 1SLXB 4UEHH 2O9QA 1P3CA 1GI6A 5BPEA 1SB1H 2W3KA 3ATIA 2ALPA 2BY8X 1GJ7B 2A4QA 2BTCE 2Z9KA 1DWCH 4O97A 2ZTXA 3OU0A 3VFEA 1YKTA 2QV1A 2WPMS 1EJNA 1QNJA 2R2WU 3DT0H 3V7TA 1C5UA 3GYLB 3E0NB 1AQ7A 1MQ5A 1V2NT 3GCHB 1O2SA 1L4ZA 1S85A 2FIRH 4AFSA 3RXOA 1MCVA 1P10A 3SU2A 3RMOH 2Y7ZA 3TU7H 3SBKA 2FOCA 4HFPB 4ABHA 1XUIA 4ZXYH 1J9CH 2FOEA 3PTNA 4DVAU 1YPHE 4BTUB 1AUTC 2AGGX 3PLPA 1BRUP 4D7FA 3RLYH 1HLTH 2PKAB 2PR3A 4F4OC 3VXEH 5DO4H 1C2HA 2VWNA 1WQSA 1A0LA 1SFQB 6LPRA 1HGTH 4DIIH 5FBIA 3O8DA 1O3MA 1OOKB 2FEQH 1AIXH 3ATKA 1A5GH 1DY9A 2ZQ2A 1TA2A 1G37A 3NK8A 2QN5T 3EQ0H 1QB1A 3F68H 2XC5A 2BLVA 1FAXA 1JRTA 4DOQA 3ZZAA 1O34A 1THSH 2GZ7A 1BCUH 1W2KH 1ELAA 1T8MA 4B71A 3GCTG 1CGJE 4MQAA 1C2DA 2BD2A 1FNIA 4GCHG 1RIWC 1EZQA 1NRRH 3HGNA 3GCTF 4FUBA 1C2MA 2ZFTA 4YOIA 4A1VA 3MU0A 1DSTA 4GCHF 2GDEH 3LGUA 4Y8YA 5E8EH 1BB0B 1AO5A 2O8UA 4YO9A 1WYKA 4B2BA 2V3HH 3VB6A 1JMOH 5DP9A 4U2WA 1H8IH 1NFWA 3M36A 1E35B 1BHXB 4JZEH 2ZU1A 4AB8A 4X8SH 3F9GA 3UWJH 1IQKA 2BQWB 4I31A 2ZHQH 4IN1A 4CBNA 1O5EH 2ANYA 4DG4A 2EEKA 2VIPA 2A32A 2Z6BD 1MBQA 1NFXA 1O5DH 5J4QA 1DWBH 2ZU2A 1C5OH 4UDWH 4JYTA 3A7TA 3PMAB 3IG6B 4ZAEA 2A4GA 1L1NA 1P02A 1C5NH 1PQ7A 1FLEE 1DPOA 1O2ZA 8LPRA 1HJAC 1FPHH 2RCEA 1U6QA 2YOLA 4U32A 3K9XB 1FIWA 3UQOA 4WH6A 2QF3A 2STBE 1KTSB 3BTGE 1G3EA 1SG8B 1Z6EA 4AGJA 3UTUH 1VCWA 2VU8E 4CHAC 1DXWA 5EOKA 4FVBA 1V2ST 3SV7A 2FTLE 5TJXA 1OP2A 4MNXA 2AGIX 3L3TA 3U69H 5A2MH 3ZVAA 1ELGA 5FBEA 3E16B 2GT8A 3AVZA 3KN2A 2BY9X 3BTDE 2Y5HA 2KAIA 4CRDA 1A7SA 3O8BA 1J16A 1GHAG 3NUMA 2ZWLH 4CRAA 5C1XA 4JYVH 1YPEH 3Q76A 2DUCA 1FY5A 1GHAF 1GG6B 1GI1A 1HAGE 1W8BH 1QURH 1Y3YA 1MTNB 1OYTH 2BYAX 4X2YA 3M61U 3QTVH 3KCGH 2P8OB 3SI4H 1TMUH 3RXAA 1DS2E 1TWXB 1VCPA 4RN6A 2A2XH 5EPYA 1GI8B 1PQ8A 5HXFA 2ANWA 4XDEA 2BHGA 5FPYA 3SHAH 2G5VA 1EKBB 1NROH 3ZZ6A 4BAKB 4Y0YE 1BBRH 3K2UA 3TNTA 1TPAE 4JMYA 2VJ1A 2SGEE 1C1WH 1C2EA 2WPJS 1FQ3A 1AE8H 1DFPA 3PM3A 3SU5A 5J4SA 2EC9H 2Z9LA 4WY3A 1TA6A 1NC6A 2F9OA 2P59A 4LOYH 3GOVB 4YOGA 3SJOA 2HPQH 1GVZA 3MH7A 4NFEA 1MD7A 1CBWB 1K28D 5DP7A 2QC2A 4K1EA 2R9PA 3UR6A 2C93B 2KAIB 3F9EA 3IWMA 3S69A 4VGCB 2AIPA 1ZRKA 2BDBA 3KL6A 4YLQH 2ANKH 3F1SB 1GDQA 2I6SA 1H1BA 1W7XH 1O3NA 3TGKE 3AAVA 1O2VA 1D6WA 1EPTA 5E0HA 3Q77A 2OBOA 4XBCA 5HGGA 1ELEE 1GI5A 2J9NA 1QRZA 2C8XB 5L30H 3SQEE 5C2ZA 1V2LT 1BTYA 1P2IA 1H9IE 4WMFA 1ZHMA 4X1RU 3A88A 1HAHH 1HAOH 1KXDA 1TOCB 5A0AE 2BDHA 3BTQE 3EAJA 5DG6A 3LGVA 1UTMA 4AN7A 1FUJA 5E2PA 5A09A 4I32A 1P09A 1KLJH 2PW8H 1W0YH 1G32B 3PO1C 2STAE 4INKA 1GBHA 3GDVA 4WF8A 2CHAC 2LPRA 2XWAA 1FN6A 1NFUA 4MNVA 4O3UA 1KLTA 1FY4A 4NWKA 2RG3A 3KHVA 1VGCC 3LGWA 2ASUB 4X8VH 3STIA 3ATMA 4HTCH 3KF2A 1C1RA 1N8OC 1MKWH 2Z3EA 2BDCA 1Z1IA 1HJ9A 4IMZA 2A45B 1CGIE 1VITH 1K1PA 1QB9A 1TNGA 1FMGA 1YPJH 5A0BA 4GUXA 1TFXA 5JBAS 1LDTT 1J8AA 1EPTB 5E2OA 1GBEA 1O2IA 2ZDKA 2GCHG 2C8ZB 1P2KA 3RXVA 3C1KA 1LKAA 1SGRE 4H6SB 5DP4A 5EU8A 1EAIA 3RU4E 1QGFA 2VNTA 2GCHF 3EGKH 3EDXB 1YGCH 2LNCA 4KTUA 2W3IA 1E0FD 3C27B 1ZTLA 1NFYA 3KGPA 3MFJA 2BZAA 2Y6TA 1ELFA 1SMFE 1YLDA 1P2JA 4YT6H 5JBCS 1IQIA 1W12U 1P0SH 1TQ7B 4JK6A 5GIBA 2BDAA 1UO6A 3HPTB 5FX5A 1HAYB 1SGQE 3HATH 3UNQA 1QQUA 2GCTB 4ZMAH 3BEUA 3PYHA 3HK6B 3SJ9A 1EAWA 3ZVFA 1EAXA 1NRSH 4Q80A 1BJVA 1GJCB 3KQCA 3RU4D 2GV7A 1O2RA 1D4PB 3SU0A 2FOBA 4YZUA 1P2OA 1HFDA 2BDIA 1ETSH 4ISIH 3N7OA 2SNWA 1B5GH 1AWFH 3P95A 1O3EA 1YYY1 5BRRE 1FZZA 5L2YH 2C90B 1XKBC 1O31A 1JRSA 2FO9A 2H6MA 3CP7A 1IQEA 1EZXC 2GX4A 1QA7A 1P2QA 3KNXA 2EA3A 3BEIB 2ZI2H 2O8TA 3GDSA 3GY6A 1O0DH 2HVXA 1RRKA 1O3BA 4X1NU 2EI7A 4SGBE 1AUJA 4K69A 1KXEA 1SLWB 2G51A 3PROA 4GVUA 1UK3A 2BQ6B 1AN1E 5F8ZA 1W10U 4B2CA 1N1LA 2FLBH 2VVVA 3MH5A 5LPRA 3SNBA 1CA0C 1S82A 3ELAH 2VIVA 4XBDA 1NU9A 5E0JA 3STJA 1CHGA 2Z3CA 3W94A 4GHTA 3OYPA 1XUFA 2EI8A 1HAXB 1ELCA 1ZTJA 3P8GA 3BTTE 2QY0B 1NM6A 4AG1A 2GV6A 1ZRBA 1TX7A 3RXJA 5DP5A 5EPNA 1C5PA 2ODQA 3M7QA 1HXEH 3OY5U 5JDUB 3RXLA 3I29A 4PROA 2OD3B 2TGTA 1TOMH 1RD3B 4A7IB 1C5XB 1YCPH 2A5IA 3S9AA 1G9IE 1VZQH 4KP0A 2BD9A 5JPMH 2F9VA 3A86A 2VVCA 1A5HA 1GBTA 1BRBE 2ZF0H 1MKXH 2F91A 1LO6A 1KTTB 3TJNA 1XUKA 2AH4X 1DUEA 3DHKH 2UWPA 4NG9H 5HYOA 1HRTH 1SQOA 2AEIH 1XUGA 1C4V2 1UTPA 2GT7A 1EUFA 2QAAA 2QCYA 3LC3A 3GCNA 5JB8S 3BIUH 1GBAA 1HIAA 5IYTA 2UWOA 2H9HA 3M37A 4ISNA 3UR9A 2FMJA 1DLEA 2JH5D 3PMHB 4ZKSU 4A5TS 1YPGH 1TPPA 3M3SA 3MWIU 3W95A 5C3NA 1ZR0A 4AGKA 2GTBA 1WCZA 1UHBB 5DK1A 3U1IB 1ARBA 1BOQA 3FAOA 3LH1A 1F0TA 5GXPA 3S9BA 1WV7H 4FUFA 1HAVA 1UCYH 1TNHA 1T8LA 5IDKA 3RXGA 2HPPH 2FOAA 1JIRA 5T6DA 5DP3A 4CH8B 2IOTA 1DLKB 2F3CE 2FOHA 5EXMA 7ESTE 2XTTB 2OTVA 4AFUA 2ZDNA 7GCHG 3QO6A 4CR9A 2NU2E 1PPBH 1ETTH 1AVXA 1NESE 1DWEH 2XXLA 7GCHF 1FY3A 2A1DB 3OTJE 3RXDA 2YNAA 1WU1A 5A8YA 4DY7B 3QDZB 5E0GA 4NIVA 1GBJA 1HCGA 1W7GH 1G2LA 1O37A 3T62A 4H4FA 1CHOG 4NIWA 1P57B 1Z8JB 1HIAB 3RXCA 1CHOF 1O39A 1NO9H 1F5KU 3ZZ8A 2BOHB 1EJAA 1NN6A 3TITA 1IHTH 1MTNC 3SN8A 1DX5M 1O5GH 2AYWA 2P8OC 2Z9IA 3M7TA 4RSPA 3RC6A 2J95A 4Q7YA 4NWLA 1ZSKA 1ZSLA 1O3LA 1ELTA 1G2MA 2XBWA 1HAVB 2ZHFH 2QXHA 4Q7ZA 1F92A 5ESBA 1WOFA 1PQ5A 1K1OA 4E05H 2ZU3A 2ZGJA 2FM2A 3UQVA 2W7SA 2EI6A 1O5AB 1S0RA 1ZPBA 1SQTA 2C8YB 5HM9A 4LZ4B 3LPRA 4IW4E 3LGTA 1G36A 4IS5A 1S84A 1EOJA 3QTOH 1QRXA 1TRNA 1V2PT 1GJ8B 1CBWC 3FP7E 2J92A 3DA9B 1Y3WA 2GDDA 1JIMA 1GJDB 3V13A 1RXPA 2BD5A 1MUEB 3VB3A 1GI4A 2XBYA 3M3VA 1Y5UT 1L0ZA 4VGCC 2QF0A 4Y6DA 2K1QA 4ZKOU 2UUJB 2B0FA 1QR3E 2GZ9A 5FPTA 1TNIA 3PB1E 1OWIA 1TRYA 3TJVA 2OP9A 5DP6A 5T3HA 1F0SA 2WUBA 3A82A 1CA0B 2AIQA 2FODA 4FU9A 1O2XA 2P93A 1DOJA 3RXIA 1EXFA 1SGYE 2IN2A 1AGJA 5TCCA 1V2JT 6CHAB 1GWAA 4ZHAA 2C4FH 4BAQB 1GI0A 2J38A 3GY5A
chains in the Genus database with same CATH superfamily
1GCTB 5K0HA 1ORFA 1T8OA 4WWYA 1O2NA 1UMAH 2VH0A 5ESTE 1GHXH 2FLRH 4OGXA 1MZDA 1KXAA 3RXSA 1SGTA 3T26A 4ZCNA 5C20A 1Y3VA 2ZFQH 1XUJA 2OLGA 1MZAA 1C2FA 2CV3A 1TE0A 5EG4A 1DXPA 1FDPA 1SHYA 1C5ZB 1XUHA 4FUHA 3RXTA 3MH4A 1ABIH 3SNCA 3PTBA 4Q2KA 3TNSA 2FI3E 1B7XB 1EPTC 1Z8IB 3QWCH 1JBUH 2PLXA 4TWYA 2Z3DA 4IC6A 2WINI 4NSYA 1X7AC 3QX5H 1EJMA 1GJ9B 4WH8A 3BTME 3CS0A 6GCHG 3ODFA 3ODDA 5DPAA 3SJIA 1J15A 1ELDE 4JZDH 1SSXA 5DP8A 1K1NA 4CRCA 3UNRA 1LQEA 6GCHF 3ZIAD 2B5TB 1CQQA 4B2AA 3RM0H 4Q7XA 3MH6A 5FXLA 4F55A 1W0KD 1SGNE 1AFEH 1SGPE 2CXVA 2HGTH 2WZQA 2Y82A 1O33A 2GVFA 1Z6JH 1OWEA 3VPKA 2JJ1D 5T6GA 1BBRE 3SYJA 1O32A 1O2MA 3KQBA 4CRBA 1S5SA 2XW9A 3NPSA 1V2RT 1QA0A 2GCTC 3TK5A 2KFWA 1H4WA 4YM9A 2OXSA 1GHYH 4Z1MD 1SGCA 1WDIA 2HOBA 3QGNB 1HPGA 1BTHH 1DANH 2Q1JA 1Y3XA 1LQDB 1NU7B 2CGAA 3BSQA 4X2VA 3MQKC 1YPMH 4K1SA 1F7ZA 1P3EA 4X6NA 5EGMA 1A5IA 1IQGA 1TB6H 1BMAA 1HDTH 3TH3H 2BVRH 2OINA 4WMDA 2P3TB 1EB2A 1A61H 1C1UH 1GJ6A 3QK1A 1GGDB 4RKJB 3MU1A 2C8WB 1AB9B 2V7QD 4WXIA 3ESTA 1IQFA 2DE8A 3VB5A 2ZPSA 4DW2U 2ZFRH 2H5CA 1T7CA 2W6JD 4ABFA 1UTNA 4FUDA 1GMDG 4K3JA 1Q31A 1LTOA 4H42U 1O2GH 2M2AA 4D9RA 3E3TA 1GMDF 1ZMNA 2I6QA 2JDID 4NGAH 3LJJA 2PFEA 5EQSA 3SHCH 3KIDU 3RXPA 2ODPA 4FU8A 4JZ1A 1D3TB 5I46H 1A2CH 2HNTC 2ODYB 2PHBA 5JBTA 3PV5A 2RA0A 2J5UA 1W14U 1L1GA 4XRNA 1OXGA 3EE0B 3F9FA 1Y5BT 3H7TA 5C17A 1O3KA 1J17T 1BTZA 1A3BH 1S6HA 2OQ5A 1E34B 1G30B 5FPSA 3SUEA 5C0UA 1NRQH 5FHTA 5ETXA 2H1UA 2XCNA 3ZZ4A 1BMMH 3QLPH 2Q6DA 1YP9A 2A7CA 3A7VA 3WWFA 2BM2A 3GY4A 1E1QD 2CF9H 4RT1A 3UOUA 1A3EH 1ZHRA 5DGJA 1PQAA 5C1YA 5LH8A 1K0HA 1ANCA 5LPEA 3Q00A 2BD3A 3SU1A 4ABJA 2ZIQH 1O2PA 3O8RA 1O2YA 2QA9E 4ABIA 2J34A 3G01A 4RKOB 3ZZCA 2Y81A 5EJ1A 4FUEA 2FOGA 1IQLA 3ZVGA 4YLUA 2FDAA 1AI8H 1UTJA 4O9VA 2P3UB 2Q6GA 1TNJA 1XX9A 2QE7D 1UTOA 4Y8ZA 3A7YA 3A85A 2R2MB 4ISLA 2PWXA 2M5TA 2SGDE 4KGAA 1WSSH 1CA8B 1CU1A 3LONA 2JH0D 1FXYA 1MTUA 3E8LA 2ULLA 1ANBA 4YTAA 2SGPE 3SNDA 1B0EA 2J98A 2XCFA 1MTWA 1ZGIA 2WV9A 4INLA 1ZZZA 3SZNA 4AX9H 1LHFH 1OKXA 5AVDA 2G5NA 2Z9JA 2QXJA 1QBVH 1V2WT 1O3IA 1LVMA 1O35A 2FS8A 1EB1H 1DM4B 4AB9A 3N7EA 2D26C 1OP0A 4QT8C 5C67A 1LVBA 1UVOA 4UE7H 3UREA 5FX6A 4CH2B 2J2UA 3NWUA 2FTMA 1ANDA 3ZZDA 4K5ZA 1P01A 2RDEA 3A8CA 1GMHG 3BTHE 4Y79A 4MPUA 4NA7A 1P12E 1O3PB 1GMHF 1ID5H 1DDJA 4XE4A 3ITIA 2NU4E 1MD8A 2BDYA 4CREA 3DFLA 1NY22 1C5RA 3AW1A 1QJ6B 1HNEE 4KTSA 5EW2H 1DVAH 1OSSA 1AVGH 2G00A 3SQHE 2G4UA 1XXFA 1TGSZ 5HIYA 1GI2A 2Q6FA 4ZHMU 1ELVA 3BIVH 2B7DH 2VWMA 3FANA 1C1MA 7LPRA 4OS4A 2J98B 3A81A 2BLWA 2QIQA 1LPGB 3SORA 3TJUA 3RMMH 2H9TH 1T4VH 1BTPA 3BTWE 1BBRK 3CS7A 3JZ1B 4X1SU 4OS7A 1O3CA 2NU0E 1NBMD 1V2TT 1IQMA 1C1PA 1E37B 5EIYA 3P8FA 3GY8A 2WPHS 2F83A 1DSUA 3ZVEA 3V12A 1FAKH 2FZZA 4A1TA 1O3AA 3QZQA 1UK2A 3MTYA 1OWJA 2PTCE 3W1EA 2TPIZ 3HKIB 5GPIB 3TGIE 1C5QA 2GP9B 4NA9H 1ZMJA 2UWLA 3S7HB 4J1YA 3FFGA 3SO3A 2BVSH 1YC0A 2XYAA 3T25A 2QXGA 4B76A 1FPCH 5F03A 5DSFA 3RDZA 3RXQA 4ZKRU 4E7RG 2F9NA 1AZ8A 1W0ZU 1NRPH 1BTUA 2A0QB 3OSYA 1HXFH 2AERH 1AHTH 3U28C 1O3FA 4THNH 2K8IA 3URCA 1TMTH 4IN2A 3ZZ9A 5CHAB 1LHGH 2SGQE 2VWLA 4O03A 5HM2A 1IQNA 1QTFA 1VJ9U 3A87A 2BY6X 1TPOA 4F49A 4D76A 1HUTH 1IAUA 5EW1H 2P95A 3OFND 1ZSJA 2AFQB 9ESTA 3HK3B 1QIXB 3RC4A 4FUJA 4NA8A 1C2LA 1FN8A 2A5KA 3P8OA 1A1RA 4ZXXH 2WV4A 4INHA 3BTFE 1N6XA 1MKWK 5T6FA 2ZDAH 3H5CB 2FPZA 2ZCHP 3LH3A 2L6OA 5GCHG 4Z6AH 3MYWA 3TH2H 4WMEA 4Y8XA 3PV2A 2ZTZA 4E7NA 1MQ6A 2TGPZ 1RS0A 5GNDA 1D3PB 3EA7A 3ZVBA 2ZDLA 1CVWH 3D23A 1HAPH 6CHAC 4WVPE 2XBXA 3GYMA 2BLQA 2NU1E 4B74A 2A4RA 2SGFE 1A0JA 1UHBA 1RTFB 4JYUH 1GCTC 4ISHH 2CMYA 3URDA 1RJXB 4DCDA 4MDSA 3MNXA 2VIOA 1FIZA 3NKKA 1O3JA 3MNSA 1EP5A 1ABJH 1QBNA 3S0NA 1GI3A 1BIOA 5SGAE 2A7JA 5TCAA 2YMSB 4X8TH 3NCLA 4Y76A 1K2I1 1AVWA 1YPKH 3VGCC 2OCVB 1INCA 1Y59T 3SU4A 3ZVDA 1O36A 1WTHD 5C5NA 2ILNA 1YPLH 3D49H 3SI3H 1MAXA 1KDQA 3UIRA 1GDNA 1PPGE 1O3HA 1XVMA 5GJ4B 3ENSB 4ZHLU 1K1IA 4BXSA 1O3OA 4TSFD 1TGNA 2ZKSA 1C1VH 3SOSA 3LDXH 1PJPA 1FV9A 3NZIA 2JH6D 1O2HA 2EY4C 2VBCA 4WJG2 1PPCE 4I8HA 4I8JA 2GMTB 4ACAA 1AD8H 3DD2H 2G8TA 2G52A 1V2QT 2ALVA 1OWHA 2A4OA 3GY7A 4CRFA 3U8RH 1BRCE 1NZQH 1QRWA 3N99A 1KIGH 1LVOA 2Y80A 4UFGH 1AE5A 1E79D 2K0QA 5C1UA 4TPIZ 4A92A 3SJKA 2BX3A 4UFEH 2LELA 1WAYB 1S83A 2W5EA 3IITA 4CR5A 2UUYA 3F0PA 4TY6A 2XRCA 4JZFH 1MMJN 1OS8A 1S6FA 3AAUA 4UFDH 1NRNH 2OC1A 1WQVH 1F2SE 2XC4A 2PUXB 3RP2A 2ZFPH 2PGBB 9LPRA 3BTEE 1P04A 3F6UH 1QQ4A 2ZGBH 1RFNA 1KDQB 1EZSC 3U9AH 2AGEX 2D8WA 1SVPA 3NXPA 1YLCA 4YXWD 1GGDC 2ZZUH 1O2WA 4NIXA 1AB9C 2ANMH 3TGJE 1KLIH 2HNTF 3TJOA 4ZKNU 3UPEA 3VB4A 5EXNA 3M35A 1PYTD 3UWIA 1A0HB 3PLBA 1MH0A 5HMAA 3UY9A 1AU8A 1Z7KA 4H6TA 1F0UA 1TLDA 2O8WA 4K1TA 1UVUH 1ARCA 3A7XA 2JETB 3F2GA 1C5SA 2PP6A 3CENA 2ZHWH 2FYRA 2D2DA 2NWNA 1UTQA 1V3XA 1YCPK 2FYQA 4Y0ZE 2Z94A 1P2MA 1GBMA 1O3GA 3UUZA 2AS9A 3D65E 4GLYA 1XXDA 1ZOMA 3LKWA 2FX6A 2V35A 2W6ID 1MBMA 1MKXK 2F9PA 1V2OT 2HALA 2XNIA 1EASA 4Z0KA 1HB0B 3RXHA 3UOPA 2RA3A 2H5DA 5H4IB 4MLFB 4DJZB 3TLOA 1CE5A 3A8DA 5C94A 4OS1A 4UD9H 2F9BH 3V0XA 4A6LA 1T31A 1BMFD 3VXFH 1GL0E 3MU4A 3KQDA 3VB7A 1QJ1B 4ABDA 1C1NA 1L1JA 1YCPM 1GJAB 4AG2A 3QZRA 4AYVB 3EA9A 1GDUA 3TPIZ 1C5VA 2LP6A 2WPKS 2A31A 1Z71A 2BOKA 1YM0A 3A7ZA 2SNVA 4WXVA 1C1TA 1A46H 2ESTE 1MU6B 1TX6A 4ABGA 3E1XB 6ESTA 2AMPA 1CO7E 2XWBI 5GWZA 2QF4A 1SGFG 1GJBB 7KMEH 4MNWA 4MPVA 4OS2A 3WY8A 1PYTC 2TIOA 1O2UA 1UCYK 1K1JA 3T2NA 1EZUC 3LT3A 4O3TA 2JKHA 2O8LA 5AF9H 3RXEA 1OWDA 3A83A 4DIHH 2ZEBA 1XKAC 4FUGA 1KY9A 2OQUA 1GBKA 2G4TA 4I33A 1JXPA 1SGIB 1N6YA 2FESH 1BTWA 3I77A 3DSPA 3E90B 3BTKE 2ZGXH 3LC5A 4P02A 1AFQC 1O5CB 1PPFE 5T1VA 1H8ED 1DICA 1Z8GA 2V3OH 1C2JA 5ABWA 3LU9B 3TH4H 1AY6H 4TWWA 1XMNB 3RXFA 1XVOA 1D3QB 5A8XA 5EODA 4GSOA 4XBBA 1PPHE 4GHQA 2HNTE 1HV7A 2IPHA 1V2UT 1SGEE 1TABE 2QGRA 3VGCB 1SFIA 2P3FH 2FWWA 1KXBA 2V6NA 2CN0H 1ZJDA 2GD4B 3SW2B 2V0BA 4ABEA 5C5OA 1ZYOA 2VWOA 1VITG 2OUAA 4BAMB 3T5FH 1ANEA 1VITF 3SGAE 2KCPA 1FONA 4I8GA 3SV9A 1TX8A 3GISB 3BEFB 1V6DA 1SI5H 1SLUB 1UVTH 1LPZB 2FS9A 3E0PB 1P9UA 2HWLB 2BB4A 1C4Y2 2G55A 2P16A 1NT1A 2ZCLP 4KKDA 1YBWA 5F6MA 1ESTA 1GL1A 1GBDA 2XBVA 2WV5A 1ACBE 2H9EH 4GPGA 2BVXH 3A8BA 2WPLS 1OP8A 1D9IA 1T32A 1LVYA 4Y7AA 1O2JA 3ZZBA 3OY6U 3PLKA 4BNRA 2ZO3H 2ZCKP 1HJ8A 3ZV9A 2ZPRA 1VJAU 5G4BA 4FU7A 1F5RA 1IHSH 1QL8A 1TBZH 1K1MA 3RC5A 2ZC9H 1GI9B 3KEEA 3M3TA 2A5AA 4IMQA 4X2WA 1E38B 1W13U 4ZUHA 3O8CA 4XOJA 1E36B 1G3CA 1THPB 3SUDA 1O2KA 4ABBA 4M7GA 4Q4LA 4X0WU 2BZ6H 3T27A 2YMSD 2ZU4A 1EQ9A 3HKJB 1DUAA 4MNYA 5LGOA 1NPMA 1J14A 1OX1A 1OYQA 5CHAC 3JZ2B 3V3MA 2B9LA 2UUFB 2NU3E 2ZECA 4BAHB 1VKYA 3MO9A 1W11U 1CT4E 5F8XA 2HLDD 4ZH8A 3RXKA 1GI7B 2PV9B 1YPHC 1GJ4H 1UJ1A 5HIZA 4AC9A 2D1JA 3A89A 4R8TB 1S81A 1C5WB 1C1OA 4X6MA 2HLCA 4R0IA 3LGYA 4HI3A 1SPJA 2VH6A 1LMWB 3SV8A 2FI5E 3ATWA 5JBBS 4NZQA 1KYNA 3FP8E 1C9TA 5CE1A 1QHRB 1JOUB 1GHVH 1EAUA 2J94A 2PKSB 3SV2H 4FXGH 1ZPZA 1V2MT 1M9UA 1K21H 3BG4B 2ZU5A 1KXFA 1C5LH 2W26A 1QL7A 1BITA 2PGQB 3SNAA 4X6PA 1YF4A 1THRH 2ZGHA 2Y5FA 2BDGA 3FN8A 4I8KA 4NSVA 1RTLA 3MO6A 5A0CA 2SFAA 3MNBA 4XD7D 3LGIA 2BD8A 2BY5X 4IC5A 1IQHA 4BXWA 5JYIA 8ESTE 1TBRH 4U01A 5FAHA 4B73A 2YNBA 4ACBA 1K9OE 1AWHB 1HYLA 3SUFA 2VGCC 4ASHA 2YMSC 5EXLA 2XNDD 2BQ7B 3TVJB 5F8TA 4IBLH 5EJLA 3WWBA 1BHXF 3M5OA 2HVYB 1BZXE 1O5FH 1P9SA 1QJ7B 3RUOA 2RDLA 4IGDA 4LK4A 2ZA5A 3RXMA 3UNSA 4SGAE 3VEQB 1MTSA 3PWCA 3EA8A 1GBIA 1GBFA 1H8HD 3ATLA 1Q2WA 4D9QA 1TGBA 2WHXA 4X1PU 2BLOA 2R0KA 3PMJA 5B6LA 1EATA 2BD7A 3SUGA 4TT3D 1XM1A 1HAZB 3F0OA 1L2EA 3K6ZA 2GMTC 1ESAA 1TGCA 2PTNA 1OWKA 1BJUA 1GHZA 4M9FA 2VIWA 3GY3A 4Y7BA 2CF8H 1ZTKA 2VIQA 1OPHB 2DE9A 1T4UH 2WUCA 1AFQB 3DUXH 1C1QA 1NTPA 1GHBG 4DT7B 1O2TA 4X8UH 2FOFA 1H9LB 3Q3KA 1MTVA 1BT7A 1GHBF 1LKBA 2BY7X 1CSOE 4TYDA 3SJ8A 1LPKB 1NS3A 1SR5C 1GHWH 1WUNH 1GVKB 4MPWA 5L2ZH 3BG8A 2R3UA 2BXTH 2OC8A 3K6YA 4ZROA 1NBME 5K7RA 1TAWA 2TRMA 8GCHG 5EQRA 1SQAA 4MPXA 1ELBA 1GVLA 4XFQA 8GCHF 3L33A 2BMGB 4BOHA 1O3DA 1GMCG 1QFKH 2A2QH 2ZDVH 3M7UA 1EP6A 1Q3XA 3MU8A 1O38A 4HGCA 3SU6A 3BV9B 1GJ5H 1GMCF 1QB6A 2EQNA 1C5TA 4FUCA 1BMNH 4AFZA 3DSOA 1C4U2 1C2IA 3OX7U 3OE7D 5KGOA 1WXRA 1RIWB 3E91A 4OS6A 5DJ7A 1HBTH 1B0FA 2GGVB 2ZFFH 3H7OA 2ZQ1A 1ETRH 1UVSH 2WSSD 3ZYDA 1BDAA 3DSGA 3QUMP 3RMNH 1O5BB 2JETC 1C5YB 4MVNA 4TPYA 3TK6A 1FY8E 1P8VC 1SOZA 1Z1JA 2OC7A 1IOEA 1ZMLA 4LXBH 3U8TH 3ZVCA 4A1XA 3GY2A 3Q3XA 2UUKB 5JB9S 2Z7FE 4NIYA 2ZHEH 2W7UA 1ZGVA 3LIWA 3HGPA 3LOXA 3MHWU 2QXIA 4MG3A 2PSYA 5L6NH 1LHCH 1SHHB 3BF6H 4AZ2B 1HJAB 3A7WA 2PSXA 3MU5A 3PV4A 1JWTA 4D7GA 4GAWA 3UFAA 4CBOA 1V2KT 1QY6A 2B8OH 1SKYE 1GPZA 2L74A 1IQJA 4JCNA 5EJZA 1H8DH 4YOJA 3I78A 2R0LA 2ZPQA 1MU8B 4KELA 3RLWH 1Y3UA 3KQEA 3L6PA 4CHAB 1LHDH 1W3CA 2ZNKH 3RXRA 1CT2E 1FJSA 3M5MA 3F9HA 2QF5A 4U30A 4BTIB 1C9PA 2ZP0H 1ZHPA 4OM9A 3B23B 3M5LA 1H9HE 1QBOA 1AKSA 1TONA 4E06H 1VR1H 2J4IA 2VIDA 3P17H 4B1TA 2FP7B 2OBQA 4FUIA 1GBCA 8KME2 2AMQA 4UONA 5FCKA 2KCAA 3RXUA 2THFB 1COWD 3T29A 1ZLRA 2VVUA 4YT7H 1TBQH 1ZJKA 1BUIA 5A8ZA 5GCHF 4LZ1H 2RFKC 1LCYA 1KXCA 1UCYE 1WTGH 1C1SA 3M5NA 3GCHC 3TK9A 3GDUA 1G3BA 2BXUH 2SGAA 2WYJA 2ZDMA 1SLVB 2TBSA 1EX3A 3P92A 5I25A 5AHGH 1L4DA 3MO3A 4YESB 3RXBA 3DFJA 3ZZ5A 4X2XA 1QZ8A 2CJIA 1YWUA 2KZ4A 1AZZA 3MI4A 1FI8A 3B9FH 1SGFA 1S0QA 1TIOA 3SNEA 2VGCB 2QYIA 4ABAA 3K65B 5EQQA 1BRAA 2Z9GA 1GBLA 2P94A 1ESBA 1C5MD 4Y10E 1LHEH 1TPSA 4Q63A 2ZGCA 4CRGA 1UTLM 1KSNA 1CGHA 1AKSB 1RGQA 2ZFSA 1P03A 3A8AA 4X6OA 2OC0A 3D62A 4NZLA 4HZHA 3OEHD 1MCTA 2GZ8A 5AFZH 1TALA 4K8YA 2C3SA 4I7YH 4HG6A 1MAYA 5CMXH 3FZDA 2FOMB 4X1QU 2HRVA 3SZEA 2Y7XA 1GBBA 2FXRA 3AW0A 2IJOB 4AYYB 1O2QA 1SC8U 3SV6A 2F43B 5F53A 1SGDE 3R3GB 3PMBB 1QL9A 3F2FA 3S9CA 3R0FA 4AOQA 4Y71A 4DGJA 4ISOA 3P8NA 1BQYA 1G3DA 3SGBE 3MOCA 4MTBA 3BN9A 1UTKA 4NCYA 3MMGA 1O2OA 1ZPCA 1UVPA 4ESTE 1T8NA 1QCPA 5FCRA 1WBGB 2PUQH 3PO1B 3PWBA 1CT0E 3A84A 5AFYH 1O30A 2CHAB 1PPEE 1V2VT 1AMHA 3GICB 2AMDA 4BANB 1Y8TA 3GCOA 1DY8A 4XSKU 3ZYEA 1D6RA 1K1LA 4KTCA 5PTPA 4TY7A 1VGCB 2O8MA 4J2YB 2XC0A 3U1JB 1Y5AT 1C2GA 1UW7A 4I8LA 1K22H 3MNCA 2H2ZA 1N8OB 1SL3A 1UK4A 4JZIA 3FP6E 2VB0A 4BTTB 1PPZA 3QN7A 3E6PH 1F0RA 4DURA 1TYNA 2Y5GA 4K60A 1SQRA 1EOLA 2G81E 3RMLH 3ZV8A 1P05A 1P11E 1Z8RA 2R3YA 4K2YA 3P70B 4FOUC 4UFFH 4OGYA 4OS5A 2GKVE 3ZZ3A 1BTXA 1TQ0B 1TNLA 3S7KB 3U8OH 4NFFA 1TMBH 1C2KA 1BMLA 3FKSD 1PFXC 1D3DB 2ZG0H 1HAIH 2FX4A 1BA8B 5DKMA 3TIUA 4AFQA 3P6ZB 1SOTA 2FI4E 2WPIS 1O2LA 3RU4T 1P2NA 2BD4A 4K8BA 1P06A 1RTKA 3FZZA 1DITH 2BX4A 4D8NA 3LJOA 1TRMA 5B6OA 2PKSC 1SBWA 2IPQX 3GS9A 1GCDA 3B8JA 1GG6C 3BG4C 3Q3YA 5LPFA 2A7HA 1VCQA 2ZHDA 4FVDA 1F5LA 4BAOB 1TNKA 4B75A 3EYDA 1DWDH 3FVFB 3QGJA 2TGDA 3A80A 3T28A 3AASA 5GDSH 3U98H 2F9UA 1TGTA 2TGAA 1FY1A 5DN6D 3ZZ7A 4JK5A 3SU3A 4Y11E 2PKAA 1A4WH 1DT2A 3SGQE 3RM2H 3UAIC 1DE7H 2VINA 2ZTYA 3KYGA 4AORA 2WYGA 1SLXB 4UEHH 1P3CA 2O9QA 1GI6A 5BPEA 2IJD1 1SB1H 2W3KA 3ATIA 2ALPA 2BY8X 1GJ7B 2A4QA 2BTCE 2Z9KA 1DWCH 4O97A 2ZTXA 3OU0A 3AK5A 3VFEA 1YKTA 2QV1A 2WPMS 1EJNA 1QNJA 3DCLA 2R2WU 3DT0H 3V7TA 1C5UA 3GYLB 3E0NB 1AQ7A 1MQ5A 1V2NT 3UB0A 3GCHB 1O2SA 1L4ZA 1S85A 4B6EA 2FIRH 4AFSA 3RXOA 1MCVA 1P10A 3SU2A 3RMOH 2Y7ZA 3TU7H 3SBKA 2FOCA 4HFPB 4ABHA 1XUIA 4ZXYH 1W0JD 1J9CH 2FOEA 3PTNA 4DVAU 1YPHE 4BTUB 1AUTC 2AGGX 3PLPA 1BRUP 4D7FA 3RLYH 3OAAD 2KCOA 1HLTH 2PKAB 2PR3A 4F4OC 3VXEH 5DO4H 1C2HA 2VWNA 1WQSA 1A0LA 1SFQB 6LPRA 1HGTH 4DIIH 5FBIA 3O8DA 1O3MA 1OOKB 2FEQH 1E1RD 1AIXH 3ATKA 1A5GH 1DY9A 2ZQ2A 1TA2A 1G37A 3NK8A 2QN5T 3EQ0H 1QB1A 3F68H 2XC5A 2BLVA 1FAXA 1JRTA 4DOQA 3ZZAA 1O34A 1THSH 2GZ7A 1BCUH 1W2KH 1ELAA 5CDFE 1T8MA 3KQ5A 4B71A 3GCTG 1CGJE 4MQAA 1C2DA 2BD2A 1FNIA 4GCHG 1RIWC 1EZQA 1NRRH 3HGNA 3GCTF 4FUBA 3FOAA 1C2MA 2ZFTA 4YOIA 4A1VA 3MU0A 1DSTA 4GCHF 2GDEH 3LGUA 4Y8YA 5E8EH 1BB0B 1AO5A 2O8UA 4YO9A 1WYKA 4B2BA 2V3HH 3VB6A 1JMOH 5DP9A 4U2WA 1H8IH 1NFWA 2V3MA 3M36A 1E35B 1BHXB 4JZEH 2ZU1A 4AB8A 4X8SH 3F9GA 3UWJH 1IQKA 2BQWB 4I31A 5HKKD 1EFRD 2ZHQH 4IN1A 4CBNA 1O5EH 2ANYA 4DG4A 2EEKA 2VIPA 2A32A 2Z6BD 1MBQA 1NFXA 1O5DH 5J4QA 1DWBH 2ZU2A 1C5OH 4UDWH 4JYTA 3A7TA 3OTPA 3IG6B 3PMAB 4ZAEA 2A4GA 1L1NA 1P02A 1C5NH 1PQ7A 1FLEE 1DPOA 1KMHB 1O2ZA 8LPRA 1HJAC 1FPHH 4RI0A 2RCEA 2CK3D 1U6QA 2YOLA 4U32A 4B6FA 3K9XB 1FIWA 3UQOA 4WH6A 2QF3A 2STBE 3H09A 1KTSB 2KCYA 3BTGE 1G3EA 1SG8B 1Z6EA 4AGJA 3UTUH 1VCWA 2VU8E 4CHAC 1DXWA 5EOKA 4FVBA 1V2ST 3SV7A 2FTLE 5TJXA 1OP2A 4MNXA 2AGIX 3L3TA 3U69H 5A2MH 3ZVAA 1ELGA 5FBEA 4F48B 3E16B 2GT8A 3AVZA 3KN2A 2BY9X 3BTDE 2Y5HA 2KAIA 4CRDA 1A7SA 3O8BA 1J16A 1GHAG 3NUMA 2ZWLH 4CRAA 5C1XA 4JYVH 1YPEH 3Q76A 2DUCA 1FY5A 1GHAF 1GG6B 1GI1A 1HAGE 1W8BH 1QURH 1Y3YA 1MTNB 1OYTH 2BYAX 4X2YA 3M61U 3QTVH 3KCGH 2P8OB 3SI4H 1TMUH 3RXAA 1DS2E 1TWXB 1VCPA 4RN6A 2A2XH 5EPYA 1GI8B 1PQ8A 5HXFA 2ANWA 4XDEA 2BHGA 5FPYA 3SHAH 3F3BA 2G5VA 1EKBB 1NROH 3ZZ6A 4BAKB 4Y0YE 1BBRH 3K2UA 3TNTA 1TPAE 4JMYA 2VJ1A 2SGEE 1C1WH 1C2EA 2WPJS 1FQ3A 1AE8H 1DFPA 3PM3A 3SU5A 5J4SA 2EC9H 2Z9LA 4WY3A 1TA6A 1NC6A 2F9OA 2P59A 4LOYH 3GOVB 4YOGA 3SJOA 2HPQH 4FETA 1GVZA 3MH7A 4NFEA 1MD7A 2GJGA 1CBWB 1K28D 5DP7A 2QC2A 4RT0A 4K1EA 2R9PA 3FO8D 3UR6A 2C93B 2KAIB 3F9EA 3IWMA 3S69A 4VGCB 2AIPA 1ZRKA 2BDBA 3KL6A 4YLQH 2ANKH 4DT4A 3F1SB 1GDQA 2I6SA 1H1BA 1W7XH 1O3NA 4I86A 3TGKE 3AAVA 1O2VA 1D6WA 1EPTA 5E0HA 3Q77A 5FL7D 2OBOA 4XBCA 5HGGA 1ELEE 1GI5A 3VG8A 2J9NA 1QRZA 2C8XB 5L30H 3SQEE 5C2ZA 1V2LT 1BTYA 1P2IA 1H9IE 4WMFA 3CNRA 1ZHMA 4X1RU 3A88A 1HAHH 1HAOH 1KXDA 1TOCB 5A0AE 2BDHA 3BTQE 3EAJA 5DG6A 3LGVA 1UTMA 4AN7A 1FUJA 2KR7A 5E2PA 5A09A 4I32A 1P09A 1KLJH 2PW8H 1W0YH 1G32B 3PO1C 2STAE 4INKA 1GBHA 3GDVA 4WF8A 2CHAC 5CHBA 2LPRA 2XWAA 1FN6A 1NFUA 4MNVA 4O3UA 1KLTA 1FY4A 2JIZD 4NWKA 2RG3A 3KHVA 1VGCC 3LGWA 2ASUB 4X8VH 3STIA 3ATMA 4HTCH 3KF2A 1C1RA 1N8OC 1MKWH 2Z3EA 2BDCA 1Z1IA 1HJ9A 4IMZA 2A45B 1CGIE 1VITH 5KECA 1K1PA 1QB9A 1S6LA 3F2HA 1TNGA 1FMGA 1YPJH 5A0BA 4GUXA 1TFXA 5JBAS 1LDTT 1J8AA 1EPTB 5E2OA 1GBEA 1O2IA 2ZDKA 2GCHG 2C8ZB 1P2KA 3RXVA 3C1KA 1LKAA 1SGRE 4H6SB 5DP4A 5EU8A 1EAIA 3RU4E 1QGFA 2VNTA 2GCHF 3EGKH 3EDXB 1YGCH 2LNCA 4KTUA 2W3IA 1E0FD 3C27B 1ZTLA 1NFYA 3KGPA 3MFJA 2BZAA 2Y6TA 1ELFA 1SMFE 1YLDA 1P2JA 4YT6H 5JBCS 1IQIA 2AHME 1W12U 1P0SH 1TQ7B 4JK6A 5GIBA 2BDAA 1UO6A 3HPTB 5FX5A 1HAYB 2J97A 1SGQE 3HATH 3UNQA 1QQUA 2GCTB 4ZMAH 3BEUA 3PYHA 3HK6B 3SJ9A 1EAWA 3ZVFA 1EAXA 1NRSH 3WW7A 4Q80A 1BJVA 1GJCB 3KQCA 3RU4D 2GV7A 1O2RA 1D4PB 3SU0A 2FOBA 4YZUA 1P2OA 1HFDA 2BDIA 1ETSH 4ISIH 3N7OA 2SNWA 1B5GH 1AWFH 3OEED 2XOKD 3P95A 1O3EA 1YYY1 5BRRE 1FZZA 5L2YH 2C90B 1XKBC 1O31A 1JRSA 2FO9A 2H6MA 3CP7A 1IQEA 1EZXC 2GX4A 3N7DA 1QA7A 1P2QA 3KNXA 2EA3A 3BEIB 2ZI2H 2O8TA 3GDSA 3GY6A 1O0DH 2HVXA 1RRKA 1O3BA 4X1NU 2EI7A 4SGBE 1AUJA 4K69A 1KXEA 1SLWB 2G51A 3PROA 4GVUA 1UK3A 2BQ6B 1AN1E 5F8ZA 1W10U 4B2CA 1N1LA 2FLBH 2VVVA 3MH5A 5LPRA 3SNBA 4P00A 1CA0C 1S82A 3ELAH 2VIVA 4XBDA 1NU9A 5E0JA 3STJA 1CHGA 2Z3CA 3W94A 4GHTA 3OYPA 1XUFA 2EI8A 1HAXB 1ELCA 1ZTJA 3P8GA 3BTTE 2QY0B 1NM6A 4AG1A 2F4LA 2GV6A 1ZRBA 3KYFA 1TX7A 3RXJA 5DP5A 5EPNA 1C5PA 2ODQA 3M7QA 1HXEH 3OY5U 5JDUB 3RXLA 3I29A 4PROA 2OD3B 2TGTA 5IK2D 1TOMH 1RD3B 4A7IB 1C5XB 1YCPH 2A5IA 3S9AA 1G9IE 1VZQH 4KP0A 2BD9A 5JPMH 2F9VA 3A86A 2VVCA 1A5HA 1GBTA 1BRBE 2ZF0H 1MKXH 2F91A 3PRBA 1LO6A 1KTTB 3TJNA 1XUKA 2AH4X 1DUEA 3DHKH 2UWPA 4NG9H 5HYOA 1HRTH 1SQOA 2AEIH 1XUGA 1C4V2 1UTPA 2GT7A 1EUFA 2QAAA 2QCYA 3LC3A 3GCNA 5JB8S 3BIUH 1GBAA 1HIAA 5IYTA 2UWOA 2H9HA 3M37A 4ISNA 3UR9A 2FMJA 1DLEA 2JH5D 3PMHB 4ZKSU 4A5TS 1YPGH 1TPPA 3M3SA 3MWIU 3W95A 5C3NA 1ZR0A 4AGKA 2GTBA 1WCZA 1MABB 1UHBB 5DK1A 3U1IB 1ARBA 1BOQA 3FAOA 3LH1A 1F0TA 1YLNA 5GXPA 3S9BA 1WV7H 4FUFA 1HAVA 1UCYH 1TNHA 1T8LA 5IDKA 3RXGA 2HPPH 2FOAA 1JIRA 5T6DA 5DP3A 4CH8B 2IOTA 1DLKB 2F3CE 2FOHA 5EXMA 7ESTE 2XTTB 2OTVA 4AFUA 2ZDNA 3PRDA 7GCHG 3QO6A 4CR9A 2NU2E 1PPBH 1ETTH 1AVXA 1NESE 1DWEH 2XXLA 2OK5A 7GCHF 1FX0B 1FY3A 2A1DB 3OTJE 3RXDA 2YNAA 2JJ2D 1WU1A 5A8YA 5KEDA 4DY7B 3QDZB 5E0GA 4NIVA 1GBJA 1HCGA 1W7GH 1G2LA 1O37A 3T62A 4H4FA 1CHOG 4NIWA 1P57B 5C0TA 1Z8JB 1HIAB 3RXCA 1CHOF 1O39A 1NO9H 1F5KU 3ZZ8A 2BOHB 1EJAA 1NN6A 3TITA 1IHTH 1MTNC 3SN8A 1DX5M 1O5GH 2AYWA 2P8OC 2Z9IA 3M7TA 4RSPA 3RC6A 2J95A 4Q7YA 4NWLA 1ZSKA 1ZSLA 1O3LA 1ELTA 1G2MA 2XBWA 1HAVB 2ZHFH 2QXHA 4Q7ZA 1F92A 5ESBA 1WOFA 1PQ5A 1K1OA 4E05H 2ZU3A 2ZGJA 2FM2A 3UQVA 2W7SA 2EI6A 1O5AB 1S0RA 1ZPBA 1SQTA 2C8YB 5HM9A 4LZ4B 2KM0A 3LPRA 4IW4E 3LGTA 1G36A 4IS5A 1S84A 1EOJA 3QTOH 1QRXA 1OHHD 1TRNA 2KX4A 3NRLA 1V2PT 1GJ8B 1CBWC 3FP7E 2J92A 3DA9B 1Y3WA 2GDDA 1JIMA 1GJDB 3V13A 1RXPA 2BD5A 4ASUD 1MUEB 3VB3A 1GI4A 2XBYA 3M3VA 1Y5UT 1L0ZA 4VGCC 2QF0A 4Y6DA 2K1QA 4ZKOU 2UUJB 2B0FA 1QR3E 2GZ9A 5FPTA 1TNIA 3PB1E 1OWIA 1TRYA 3TJVA 2OP9A 5DP6A 5T3HA 1YY3A 1F0SA 2WUBA 3A82A 1CA0B 2AIQA 2FODA 4FU9A 1O2XA 2P93A 1DOJA 3RXIA 1EXFA 1SGYE 2IN2A 3EE7A 1AGJA 5TCCA 1V2JT 6CHAB 1GWAA 4ZHAA 2C4FH 2WPDD 4BAQB 1GI0A 2J38A 3GY5A
chains in the Genus database with same CATH topology
1GCTB 5K0HA 1ORFA 1T8OA 4WWYA 1O2NA 1UMAH 2VH0A 5ESTE 1GHXH 2FLRH 4OGXA 1MZDA 1KXAA 3RXSA 1SGTA 3T26A 5C20A 1Y3VA 2ZFQH 1XUJA 2OLGA 1MZAA 1C2FA 2CV3A 1TE0A 5EG4A 1DXPA 1FDPA 1SHYA 1C5ZB 1XUHA 4FUHA 3RXTA 3MH4A 1ABIH 3SNCA 3PTBA 4Q2KA 3TNSA 2FI3E 1B7XB 1EPTC 1Z8IB 3QWCH 1JBUH 2PLXA 4TWYA 2Z3DA 4IC6A 2WINI 4NSYA 1X7AC 3QX5H 1EJMA 1GJ9B 4WH8A 3BTME 3CS0A 6GCHG 3ODFA 3ODDA 5DPAA 3SJIA 1J15A 1ELDE 4JZDH 1SSXA 5DP8A 1K1NA 4CRCA 3UNRA 1LQEA 6GCHF 2B5TB 1CQQA 4B2AA 3RM0H 4Q7XA 3MH6A 5FXLA 1SGNE 1AFEH 1SGPE 2CXVA 2HGTH 2Y82A 1O33A 2GVFA 1Z6JH 1OWEA 3VPKA 5T6GA 1BBRE 1O32A 1O2MA 3KQBA 4CRBA 1S5SA 2XW9A 3NPSA 1V2RT 1QA0A 2GCTC 3TK5A 1H4WA 4YM9A 2OXSA 1GHYH 1SGCA 2HOBA 3QGNB 1HPGA 1BTHH 1DANH 2Q1JA 1Y3XA 1LQDB 1NU7B 2CGAA 3BSQA 4X2VA 1YPMH 4K1SA 1F7ZA 1P3EA 4X6NA 5EGMA 1A5IA 1IQGA 1TB6H 1BMAA 1HDTH 3TH3H 2BVRH 2OINA 4WMDA 2P3TB 1EB2A 1A61H 1C1UH 1GJ6A 3QK1A 1GGDB 4RKJB 3MU1A 2C8WB 1AB9B 4WXIA 3ESTA 1IQFA 2DE8A 3VB5A 2ZPSA 4DW2U 2ZFRH 2H5CA 1T7CA 4ABFA 1UTNA 4FUDA 1GMDG 4K3JA 1Q31A 1LTOA 4H42U 1O2GH 4D9RA 3E3TA 1GMDF 1ZMNA 2I6QA 4NGAH 3LJJA 2PFEA 5EQSA 3SHCH 3KIDU 3RXPA 2ODPA 4FU8A 4JZ1A 1D3TB 5I46H 1A2CH 2HNTC 2ODYB 2PHBA 5JBTA 2RA0A 1W14U 1L1GA 1OXGA 3EE0B 3F9FA 1Y5BT 3H7TA 1O3KA 1J17T 1BTZA 1A3BH 1S6HA 2OQ5A 1E34B 1G30B 5FPSA 3SUEA 1NRQH 5FHTA 5ETXA 2H1UA 2XCNA 3ZZ4A 1BMMH 3QLPH 2Q6DA 1YP9A 2A7CA 3A7VA 2BM2A 3GY4A 2CF9H 3UOUA 1A3EH 1ZHRA 5DGJA 1PQAA 5C1YA 5LH8A 1ANCA 5LPEA 3Q00A 2BD3A 3SU1A 4ABJA 2ZIQH 1O2PA 3O8RA 1O2YA 2QA9E 4ABIA 2J34A 3G01A 4RKOB 3ZZCA 2Y81A 4FUEA 2FOGA 1IQLA 3ZVGA 4YLUA 2FDAA 1AI8H 1UTJA 4O9VA 2P3UB 2Q6GA 1TNJA 1XX9A 1UTOA 4Y8ZA 3A7YA 3A85A 2R2MB 4ISLA 2PWXA 2M5TA 2SGDE 4KGAA 1WSSH 1CA8B 1CU1A 3LONA 2JH0D 1FXYA 1MTUA 3E8LA 2ULLA 1ANBA 4YTAA 2SGPE 3SNDA 1B0EA 2XCFA 1MTWA 1ZGIA 4INLA 1ZZZA 3SZNA 4AX9H 1LHFH 1OKXA 5AVDA 2G5NA 2Z9JA 2QXJA 1QBVH 1V2WT 1O3IA 1LVMA 1O35A 2FS8A 1EB1H 1DM4B 4AB9A 2D26C 1OP0A 4QT8C 5C67A 1LVBA 1UVOA 4UE7H 3UREA 5FX6A 4CH2B 2J2UA 3NWUA 2FTMA 1ANDA 3ZZDA 4K5ZA 1P01A 3A8CA 1GMHG 3BTHE 4Y79A 4MPUA 4NA7A 1P12E 1O3PB 1GMHF 1ID5H 1DDJA 4XE4A 3ITIA 2NU4E 1MD8A 2BDYA 4CREA 3DFLA 1NY22 1C5RA 3AW1A 1QJ6B 1HNEE 4KTSA 5EW2H 1DVAH 1OSSA 1AVGH 2G00A 3SQHE 2G4UA 1XXFA 1TGSZ 1GI2A 2Q6FA 4ZHMU 1ELVA 3BIVH 2B7DH 2VWMA 3FANA 1C1MA 7LPRA 4OS4A 3A81A 2BLWA 2QIQA 1LPGB 3SORA 3TJUA 3RMMH 2H9TH 1T4VH 1BTPA 3BTWE 1BBRK 3CS7A 3JZ1B 4X1SU 4OS7A 1O3CA 2NU0E 1V2TT 1IQMA 1C1PA 1E37B 3P8FA 3GY8A 2WPHS 2F83A 1DSUA 3ZVEA 3V12A 1FAKH 2FZZA 4A1TA 1O3AA 3QZQA 1UK2A 3MTYA 1OWJA 2PTCE 3TGIE 2TPIZ 3HKIB 5GPIB 1C5QA 2GP9B 4NA9H 1ZMJA 2UWLA 3S7HB 4J1YA 3FFGA 3SO3A 2BVSH 1YC0A 2XYAA 3T25A 2QXGA 4B76A 1FPCH 5F03A 3RDZA 3RXQA 4ZKRU 4E7RG 2F9NA 1AZ8A 1W0ZU 1NRPH 1BTUA 2A0QB 3OSYA 1HXFH 2AERH 1AHTH 1O3FA 4THNH 3URCA 1TMTH 4IN2A 3ZZ9A 5CHAB 1LHGH 2SGQE 2VWLA 4O03A 5HM2A 1IQNA 1QTFA 1VJ9U 3A87A 2BY6X 1TPOA 4F49A 4D76A 1HUTH 1IAUA 5EW1H 2P95A 1ZSJA 2AFQB 9ESTA 3HK3B 1QIXB 3RC4A 4FUJA 4NA8A 1C2LA 1FN8A 2A5KA 3P8OA 1A1RA 4ZXXH 2WV4A 4INHA 3BTFE 1N6XA 1MKWK 5T6FA 2ZDAH 3H5CB 2FPZA 2ZCHP 3LH3A 5GCHG 4Z6AH 3MYWA 3TH2H 4WMEA 4Y8XA 2ZTZA 4E7NA 1MQ6A 2TGPZ 1RS0A 3ZVBA 1D3PB 3EA7A 2ZDLA 1CVWH 3D23A 1HAPH 6CHAC 4WVPE 2XBXA 3GYMA 2BLQA 2NU1E 4B74A 2A4RA 2SGFE 1A0JA 1UHBA 1RTFB 4JYUH 1GCTC 4ISHH 2CMYA 3URDA 1RJXB 4DCDA 4MDSA 3MNXA 2VIOA 1FIZA 3NKKA 1O3JA 3MNSA 1EP5A 1ABJH 1QBNA 3S0NA 1GI3A 1BIOA 5SGAE 2A7JA 5TCAA 4X8TH 3NCLA 4Y76A 1K2I1 1AVWA 1YPKH 3VGCC 2OCVB 1INCA 1Y59T 3SU4A 3ZVDA 1O36A 1WTHD 5C5NA 2ILNA 1YPLH 3D49H 3SI3H 1MAXA 1KDQA 3UIRA 1GDNA 1PPGE 1O3HA 1XVMA 5GJ4B 3ENSB 4ZHLU 1K1IA 4BXSA 1O3OA 1TGNA 2ZKSA 1C1VH 3SOSA 3LDXH 1PJPA 1FV9A 3NZIA 2JH6D 1O2HA 4WJG2 1PPCE 4I8HA 4I8JA 2GMTB 1AD8H 3DD2H 2G8TA 2G52A 1V2QT 2ALVA 1OWHA 2A4OA 3GY7A 4CRFA 3U8RH 1BRCE 1NZQH 1QRWA 1KIGH 1LVOA 2Y80A 4UFGH 1AE5A 5C1UA 4TPIZ 4A92A 3SJKA 2BX3A 4UFEH 1WAYB 1S83A 2W5EA 3IITA 4CR5A 2UUYA 4TY6A 2XRCA 4JZFH 1MMJN 1OS8A 1S6FA 3AAUA 4UFDH 1NRNH 2OC1A 1WQVH 1F2SE 2XC4A 2PUXB 3RP2A 2ZFPH 2PGBB 9LPRA 3BTEE 1P04A 3F6UH 1QQ4A 2ZGBH 1RFNA 1KDQB 1EZSC 3U9AH 2AGEX 2D8WA 1SVPA 3NXPA 1YLCA 1GGDC 2ZZUH 1O2WA 4NIXA 1AB9C 2ANMH 3TGJE 1KLIH 2HNTF 3TJOA 4ZKNU 3UPEA 3VB4A 5EXNA 3M35A 1PYTD 3UWIA 1A0HB 3PLBA 1MH0A 5HMAA 3UY9A 1AU8A 1Z7KA 4H6TA 1F0UA 1TLDA 2O8WA 4K1TA 1UVUH 1ARCA 3A7XA 2JETB 1C5SA 3CENA 2ZHWH 2FYRA 2D2DA 2NWNA 1UTQA 1V3XA 1YCPK 2FYQA 4Y0ZE 2Z94A 1P2MA 1GBMA 1O3GA 3UUZA 2AS9A 3D65E 4GLYA 1XXDA 1ZOMA 3LKWA 2FX6A 2V35A 1MBMA 1MKXK 2F9PA 1V2OT 2HALA 2XNIA 1EASA 4Z0KA 1HB0B 3RXHA 3UOPA 2RA3A 2H5DA 5H4IB 4MLFB 4DJZB 3TLOA 1CE5A 3A8DA 4OS1A 4UD9H 2F9BH 3V0XA 4A6LA 1T31A 3VXFH 1GL0E 3MU4A 3KQDA 3VB7A 1QJ1B 4ABDA 1C1NA 1L1JA 1YCPM 1GJAB 4AG2A 3QZRA 4AYVB 3EA9A 1GDUA 3TPIZ 1C5VA 2WPKS 2A31A 1Z71A 2BOKA 1YM0A 3A7ZA 2SNVA 4WXVA 1C1TA 1A46H 2ESTE 1MU6B 1TX6A 4ABGA 3E1XB 6ESTA 2AMPA 1CO7E 2XWBI 5GWZA 1SGFG 1GJBB 7KMEH 4MNWA 4MPVA 4OS2A 3WY8A 1PYTC 2TIOA 1O2UA 1UCYK 1K1JA 3T2NA 1EZUC 3LT3A 4O3TA 2JKHA 2O8LA 5AF9H 3RXEA 1OWDA 3A83A 4DIHH 2ZEBA 1XKAC 4FUGA 1KY9A 2OQUA 1GBKA 2G4TA 4I33A 1JXPA 1SGIB 1N6YA 2FESH 1BTWA 3I77A 3E90B 3BTKE 2ZGXH 3LC5A 1AFQC 1O5CB 1PPFE 1Z8GA 1DICA 2V3OH 1C2JA 5ABWA 3LU9B 3TH4H 1AY6H 4TWWA 1XMNB 3RXFA 1XVOA 1D3QB 5A8XA 5EODA 4GSOA 4XBBA 1PPHE 4GHQA 2HNTE 1HV7A 2IPHA 1V2UT 1SGEE 1TABE 2QGRA 3VGCB 1SFIA 2P3FH 2FWWA 1KXBA 2V6NA 2CN0H 1ZJDA 2GD4B 3SW2B 2V0BA 4ABEA 5C5OA 1ZYOA 2VWOA 1VITG 2OUAA 4BAMB 3T5FH 1ANEA 1VITF 3SGAE 1FONA 4I8GA 3SV9A 1TX8A 3GISB 3BEFB 1V6DA 1SI5H 1SLUB 1UVTH 1LPZB 2FS9A 3E0PB 1P9UA 2HWLB 2BB4A 1C4Y2 2G55A 2P16A 1NT1A 2ZCLP 4KKDA 1YBWA 5F6MA 1ESTA 1GL1A 1GBDA 2XBVA 2WV5A 1ACBE 2H9EH 4GPGA 2BVXH 3A8BA 2WPLS 1OP8A 1D9IA 1T32A 1LVYA 4Y7AA 1O2JA 3ZZBA 3OY6U 3PLKA 4BNRA 2ZO3H 2ZCKP 1HJ8A 3ZV9A 2ZPRA 1VJAU 5G4BA 4FU7A 1F5RA 1IHSH 1QL8A 1TBZH 1K1MA 3RC5A 2ZC9H 1GI9B 3KEEA 3M3TA 2A5AA 4IMQA 4X2WA 1E38B 1W13U 4ZUHA 3O8CA 4XOJA 1E36B 1G3CA 1THPB 3SUDA 1O2KA 4ABBA 4M7GA 4X0WU 2BZ6H 3T27A 2ZU4A 1EQ9A 3HKJB 1DUAA 4MNYA 5LGOA 1NPMA 1J14A 1OX1A 1OYQA 5CHAC 3JZ2B 3V3MA 2B9LA 2UUFB 2NU3E 2ZECA 4BAHB 3MO9A 1W11U 1CT4E 5F8XA 4ZH8A 3RXKA 1GI7B 2PV9B 1YPHC 1GJ4H 1UJ1A 2D1JA 3A89A 4R8TB 1S81A 1C5WB 1C1OA 4X6MA 2HLCA 4R0IA 3LGYA 4HI3A 1SPJA 2VH6A 1LMWB 3SV8A 2FI5E 3ATWA 5JBBS 4NZQA 1KYNA 3FP8E 1C9TA 5CE1A 1QHRB 1JOUB 1GHVH 1EAUA 2J94A 2PKSB 3SV2H 4FXGH 1ZPZA 1V2MT 1M9UA 1K21H 3BG4B 2ZU5A 1KXFA 1C5LH 2W26A 1QL7A 1BITA 2PGQB 3SNAA 4X6PA 1YF4A 1THRH 2ZGHA 2Y5FA 2BDGA 4I8KA 4NSVA 1RTLA 3MO6A 5A0CA 2SFAA 3MNBA 3LGIA 2BD8A 2BY5X 4IC5A 1IQHA 4BXWA 5JYIA 8ESTE 1TBRH 4U01A 5FAHA 4B73A 2YNBA 1K9OE 1AWHB 1HYLA 3SUFA 2VGCC 4ASHA 5EXLA 2BQ7B 3TVJB 5F8TA 4IBLH 1BHXF 3M5OA 1BZXE 1O5FH 1P9SA 1QJ7B 3RUOA 2RDLA 4IGDA 4LK4A 2ZA5A 3RXMA 3UNSA 4SGAE 3VEQB 1MTSA 3PWCA 3EA8A 1GBIA 1GBFA 3ATLA 1Q2WA 4D9QA 1TGBA 4X1PU 2BLOA 2R0KA 3PMJA 1EATA 2BD7A 3SUGA 1XM1A 1HAZB 3K6ZA 1L2EA 2GMTC 1ESAA 1TGCA 2PTNA 1OWKA 1BJUA 1GHZA 2VIWA 3GY3A 4Y7BA 2CF8H 1ZTKA 2VIQA 1OPHB 2DE9A 1T4UH 2WUCA 1AFQB 3DUXH 1C1QA 1NTPA 1GHBG 4DT7B 1O2TA 4X8UH 2FOFA 1H9LB 3Q3KA 1MTVA 1BT7A 1GHBF 1LKBA 2BY7X 1CSOE 4TYDA 3SJ8A 1LPKB 1NS3A 1SR5C 1GHWH 1WUNH 1GVKB 4MPWA 5L2ZH 3BG8A 2R3UA 2BXTH 2OC8A 3K6YA 4ZROA 5K7RA 1TAWA 2TRMA 8GCHG 5EQRA 1SQAA 4MPXA 1ELBA 1GVLA 4XFQA 8GCHF 3L33A 2BMGB 4BOHA 1O3DA 1GMCG 1QFKH 2A2QH 2ZDVH 3M7UA 1EP6A 1Q3XA 3MU8A 1O38A 4HGCA 3SU6A 3BV9B 1GJ5H 1GMCF 1QB6A 1C5TA 4FUCA 1BMNH 4AFZA 1C4U2 1C2IA 3OX7U 1RIWB 3E91A 4OS6A 5DJ7A 1HBTH 1B0FA 2GGVB 2ZFFH 3H7OA 2ZQ1A 1ETRH 1UVSH 3ZYDA 1BDAA 3QUMP 3RMNH 1O5BB 2JETC 1C5YB 4MVNA 4TPYA 3TK6A 1FY8E 1P8VC 1SOZA 1Z1JA 2OC7A 1IOEA 1ZMLA 4LXBH 3U8TH 3ZVCA 4A1XA 3GY2A 3Q3XA 2UUKB 5JB9S 2Z7FE 4NIYA 2ZHEH 2W7UA 1ZGVA 3LIWA 3HGPA 3LOXA 3MHWU 2QXIA 4MG3A 2PSYA 5L6NH 1LHCH 1SHHB 3BF6H 4AZ2B 1HJAB 3A7WA 2PSXA 3MU5A 3PV4A 1JWTA 4D7GA 4GAWA 3UFAA 4CBOA 1V2KT 1QY6A 2B8OH 1GPZA 1IQJA 4JCNA 1H8DH 4YOJA 3I78A