1V2OT

Trypsin inhibitor in complex with bovine trypsin variant x(ssyi)bt.b4
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
223
structure length
223
Chain Sequence
IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSASSYIITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Understanding protein-ligand interactions: the price of protein flexibility
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
molecule keywords Trypsin
total genus 54
structure length 223
sequence length 223
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2003-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2oT01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 1v2oT02
1CT2E 2ZHQH 3ZV9A 3QZQA 1GBFA 3S9AA 2UWPA 1FMGA 5BPEA 2OTVA 2QV1A 3AW0A 2XC4A 4ZMAH 2BD9A 1C2DA 1QL7A 1CBWB 3SUGA 1QA0A 3BN9A 1CGIE 3O8CA 5C1UA 4O97A 3U8TH 1P2OA 4IW4E 1NRSH 1W7XH 2AMDA 3LKWA 4TY6A 1ANBA 1YF4A 1NROH 2G5VA 4LZ1H 1ACBE 1WTHD 1C9PA 1C5RA 3MH4A 1ZHPA 3ZZAA 1DT2A 3SV9A 3GCHC 4CRAA 1YPGH 1O5DH 3V13A 3B9FH 1O3GA 4GSOA 1KDQB 4YT6H 2FDAA 1UTJA 2WUBA 2BY8X 2EEKA 1TMUH 5F8XA 1EZSC 3LDXH 5EG4A 4ZKSU 1THSH 3VB7A 4A1TA 1QL8A 4X6NA 1IAUA 4BXWA 3TK5A 1S0RA 2A7HA 5EXMA 3STIA 2PTNA 4ISLA 1W10U 1OSSA 4ABBA 3W95A 2FESH 2RA3A 3BTQE 1Z8RA 1WCZA 2PGQB 1HAXB 1GJCB 2GV6A 3MMGA 1TPOA 4CRBA 4U2WA 1MU8B 1BTZA 3RXOA 1RTFB 1PYTC 1S85A 1V2JT 4AB9A 1RRKA 1Y3WA 3MNXA 5JB9S 1TONA 1K22H 2F3CE 1UCYK 1O3DA 1GHXH 4X6MA 5FBIA 2XNIA 1TRNA 2SFAA 2HGTH 4AFQA 4AGKA 1K1OA 3RU4E 3UNRA 2J9NA 1MTNC 1QRXA 3P8NA 3VPKA 1IQGA 1HJAC 3SW2B 2TIOA 4MQAA 2FI3E 2BD2A 4Y8ZA 1YP9A 3A7WA 4INLA 3SQHE 1ABJH 1BHXB 1AD8H 2O8UA 3UQOA 1C5PA 3VB4A 1UHBB 1TOMH 1O3KA 2BY5X 1LHEH 1HDTH 3CP7A 3V12A 2ZP0H 5DP3A 2ZDMA 1O3JA 3MNCA 4Z6AH 1RFNA 2FZZA 1VCWA 2AGEX 4WXVA 3MH5A 4FUJA 2ZKSA 1KXAA 3RC5A 4I31A 1HXEH 2ZECA 2DUCA 2STAE 2VGCC 3P17H 1AMHA 1NO9H 2A31A 1MQ6A 4ISNA 1K1NA 2FTMA 4D8NA 2FMJA 4I8GA 3SHAH 2ZG0H 1W0ZU 2GZ9A 1EPTB 1ZTKA 1HYLA 1W14U 1TA2A 2NU3E 1SGNE 1LVYA 2GCTB 1MCTA 1DOJA 2C8YB 4VGCC 1EPTC 2TGTA 3BV9B 2J4IA 4AFUA 2XW9A 2VIDA 4FUFA 3ZZ4A 3QDZB 2A0QB 2BDYA 2FYQA 3FP8E 4VGCB 2HVXA 1IHSH 3P8OA 3SOSA 1O2KA 1NM6A 3L3TA 1CO7E 3ZZBA 5CMXH 3E90B 1X7AC 2Z3DA 3PMBB 1C5SA 1K1LA 4Q2KA 4A92A 4K69A 7GCHF 3E3TA 1C1PA 1P10A 1LDTT 4AYYB 3CS0A 1OX1A 1AVWA 1O3OA 1YYY1 5FPYA 3A7XA 3AVZA 3Q3XA 2PUQH 1D3DB 1GHYH 1YC0A 4DJZB 3GICB 2IOTA 1P02A 2DE9A 1GJ4H 2V35A 1WYKA 2QXGA 3C1KA 4B2AA 4KELA 2A32A 1FY3A 1SQOA 4Y11E 1O35A 3KF2A 1HCGA 4UFEH 2F9OA 8ESTE 2ZFPH 4U01A 1O34A 1ANEA 3UOPA 3A89A 2BDAA 2XC5A 2HLCA 1P3EA 5BRRE 5JB8S 3MU1A 3ZVGA 1C1WH 3TU7H 2WPKS 1BMMH 1HAVB 1TAWA 3UR9A 4YOJA 1FQ3A 1C4Y2 2AIPA 1T8NA 3UIRA 1MKWH 4NA9H 1SHHB 2Q1JA 3TH3H 4X8TH 2VNTA 5GCHG 2GKVE 1NRRH 5L2ZH 2SNWA 1A1RA 4FUDA 4WMDA 1GJBB 1THPB 1QBNA 4K8BA 1CHOG 1ZLRA 2H9HA 1GG6C 1AI8H 4F4OC 1ANCA 1QTFA 5FHTA 3TGIE 3M36A 4FVDA 4THNH 2A1DB 2Z9LA 3K6YA 5A09A 3F9FA 7GCHG 3OSYA 1ZMJA 4CBNA 3D62A 1IQEA 1NN6A 3Q3KA 2VH6A 3MNBA 1KTSB 1XVOA 2G5NA 4IC5A 1TBQH 2ZFSA 2A7JA 1AB9B 1P2QA 2AIQA 2JH0D 3ZVBA 1ELDE 2QCYA 3LGWA 1TGBA 1S0QA 3N7OA 2QXHA 3QLPH 1IQLA 3WY8A 4B76A 1V2MT 3D49H 1MTSA 2F9VA 1FDPA 4YESB 1CHGA 1YM0A 2ZDAH 1NU9A 3P92A 1C5XB 2XC0A 4UFGH 4LXBH 5DP7A 1G37A 5A2MH 3GCTG 1W11U 1C9TA 5IDKA 3KNXA 4ABAA 1CA0C 2Z9KA 2CMYA 4BAMB 5LGOA 2ALPA 1BITA 1NC6A 2BDCA 1YKTA 3QTVH 1GVZA 1A7SA 1QFKH 1S81A 3UOUA 1IQNA 1SPJA 2OBOA 3KEEA 3U1IB 3SU4A 1A0LA 1C2HA 3M7TA 1QL9A 1TQ7B 3RXFA 2QA9E 3NCLA 4JZIA 4JZEH 2VH0A 2OC1A 1A0HB 1FAXA 2ZCLP 2UUYA 3HKJB 1Y5AT 4K8YA 2GMTC 4OS1A 2A2XH 4AFSA 2Q6DA 1AE8H 5LPEA 2V6NA 1ORFA 1WV7H 2M5TA 1BDAA 3FVFB 4O9VA 1GBTA 1O36A 1OWJA 2ULLA 1C2LA 1O30A 3RM2H 2RG3A 1Y5BT 1BQYA 4H4FA 3PLPA 5SGAE 1AVGH 5PTPA 2FX6A 1TGCA 3FZZA 4SGBE 2O8LA 3VGCC 1HB0B 2FM2A 1IHTH 1F0UA 3LPRA 8LPRA 3A8CA 3AAUA 2BDBA 3PTNA 1DSUA 1K28D 1PJPA 2P8OB 3A88A 3SNDA 1XUFA 3B8JA 3ODDA 4XDEA 1J15A 3TLOA 3GY4A 3LJJA 4A7IB 2VIWA 4YT7H 1LHCH 1ZYOA 4ASHA 3EAJA 1JIRA 2BY6X 2VB0A 1BTHH 1Z1JA 1O33A 1GGDB 1TWXB 1W0YH 5C5NA 1GWAA 1K1JA 1P09A 1F2SE 1RJXB 1BTUA 1SFIA 3EDXB 1DWEH 3RMNH 3GCOA 1L1NA 4X0WU 4IMZA 1D3PB 1AQ7A 3PLBA 3V0XA 3R3GB 3A83A 2W7SA 3TJOA 5EQQA 1HBTH 2CHAB 1QJ1B 4K1TA 5JBCS 1SQAA 2BDGA 1SGPE 1E35B 5E8EH 3TIUA 1O2NA 2ZIQH 3Q00A 4Y71A 1C1SA 1A46H 5T6DA 3MO6A 2ZTYA 1JOUB 5C3NA 1IQIA 1CQQA 1W13U 2UUFB 2HPPH 1Z6JH 3LT3A 2WPHS 1P03A 2UUKB 5EQSA 2H1UA 3RC4A 4NCYA 1P2NA 3HGPA 1HUTH 4ZHAA 4YZUA 1C4U2 1BHXF 1V2OT 4X8VH 2G81E 4MNVA 1P2KA 3LGYA 1BRBE 2KAIA 1KXBA 2GZ7A 1UTMA 1A5GH 1UTPA 2R2WU 3BEFB 2BQWB 1YPKH 1MBQA 1UVSH 4Y76A 5EW1H 5HXFA 3SZNA 2OC7A 1JRSA 2GCHF 3MTYA 2WPLS 2XWAA 3RXUA 5L30H 2BZ6H 3KCGH 5A8YA 1TX8A 2B8OH 2VVVA 3S7KB 4AX9H 3QX5H 3HK3B 4LK4A 4DVAU 1WUNH 2JETB 3S7HB 1A5HA 2ZPQA 4O3TA 3SN8A 2QAAA 1AGJA 4JZFH 4JYVH 4K5ZA 2OC8A 1ZPCA 3QUMP 4IGDA 4HZHA 3SI3H 1O3LA 4NZQA 4X1PU 1FZZA 2CGAA 4J2YB 1GBEA 4Z0KA 5GCHF 1P2IA 4HGCA 1O2UA 2C8ZB 3R0FA 2OUAA 1BBRE 2PWXA 1QQ4A 7ESTE 1RXPA 1NESE 1QCPA 4FUHA 1O38A 4MPUA 1GHVH 1QBVH 4WXIA 4CRDA 3RDZA 1MAXA 1GJDB 1LMWB 1O0DH 4GHQA 5GDSH 1EZXC 4Q80A 4X2YA 5LH8A 3E0NB 4OGXA 3BTHE 2ZWLH 1V2LT 2O9QA 3EGKH 1DY8A 1C2EA 2ZU1A 1F5RA 2QC2A 3RXCA 3RMMH 1KLJH 4AG2A 1N6XA 4XOJA 2I6QA 4A5TS 4KTSA 3A87A 1ELVA 1L2EA 3HK6B 2Z7FE 3P6ZB 2ZZUH 1GI5A 1O5AB 2ZTZA 1G2MA 2TBSA 1XUKA 2Y7ZA 1LCYA 3TJVA 1RGQA 4OS7A 4RKOB 1ELTA 2OQUA 4KKDA 1K21H 4AN7A 1IQKA 1O5EH 2EI6A 4RSPA 1KSNA 2JETC 1H9IE 3LC5A 1ZHMA 3H7OA 4X6OA 2AMPA 5EW2H 2A5KA 1B0FA 2VVCA 1T8LA 1QA7A 1C1MA 1NRQH 4D9RA 1RD3B 1S6HA 3TITA 3E6PH 3RC6A 1A61H 2W5EA 2FEQH 3EA7A 5GIBA 3ZZ8A 4GUXA 4ZH8A 1BRUP 4DIIH 4CBOA 2NU2E 2VIQA 4IBLH 3GCNA 4UFDH 3PMHB 1O3EA 2WPIS 1GBLA 4FUGA 1YPLH 1UVPA 3MYWA 4WH8A 1OKXA 1F0RA 1YCPM 1Y3XA 3T5FH 1OP0A 4WF8A 3EE0B 1LVMA 3BG8A 1HXFH 2BD3A 4UDWH 3CS7A 4Y0ZE 3RMLH 1GBCA 3NUMA 1FPHH 1FPCH 1B7XB 1HV7A 2J34A 1AIXH 3LC3A 2W26A 1TA6A 2ZPRA 1MMJN 4HI3A 3ZZDA 2BX4A 1GJ9B 4ZUHA 4PROA 1GBIA 1V2WT 4FXGH 1K1PA 4ABFA 3E16B 3MU8A 4KTCA 4Y10E 1VITH 1G3BA 4MVNA 2Z9JA 3PB1E 1EAIA 2G52A 1V3XA 2PKSC 4AFZA 3HGNA 4SGAE 1QJ7B 1OOKB 1DSTA 2PUXB 1DY9A 3LH3A 3OY5U 3ZZ6A 2FOMB 1WBGB 1P8VC 1EQ9A 1PPEE 2ZFFH 1SC8U 3A80A 3RXPA 3TJUA 1LPKB 2CF9H 3MO3A 1EKBB 5GPIB 3RXVA 4K3JA 1SLWB 1GJ6A 4ISOA 4ZHMU 1VITG 1DXPA 2CXVA 3LGIA 3TH4H 1OS8A 1F92A 1Y3YA 1HJ9A 1G2LA 1XUGA 2ZHFH 5C5OA 3UUZA 3ZVCA 1C1QA 1V2NT 4FU7A 4DY7B 1A3BH 1MTWA 1YLDA 1LTOA 3PYHA 1NRNH 3SU2A 4ZHLU 5A8ZA 1C5ZB 4TWWA 3SU6A 2XBWA 5JDUB 1YPMH 1LHGH 1GI6A 3E0PB 1C2MA 1C5LH 1GGDC 4JZDH 1OWKA 3A8AA 1RS0A 3V7TA 1QQUA 3SGQE 2ESTE 1P2MA 4UFFH 1CHOF 1O2JA 1TIOA 3LIWA 2ALVA 1C1NA 1HAVA 1NS3A 5AF9H 2FYRA 3FP6E 1O2XA 3RXGA 1BJVA 3A82A 4XBCA 2FX4A 5DG6A 1KTTB 1EB2A 4OGYA 1TE0A 5ETXA 1MAYA 1BB0B 5EXNA 4ISIH 3K9XB 3OU0A 2A4RA 4MPXA 5EU8A 2FOHA 2R0KA 5L6NH 1EXFA 2GCTC 1EZUC 4B2CA 5FCKA 2CJIA 3VB6A 4DW2U 1T31A 2WPJS 2EA3A 1Z8JB 2Y82A 3UTUH 2F9NA 1C1UH 2XBVA 4IN1A 2C93B 3BTWE 1W12U 2VU8E 4XSKU 4X8SH 1BIOA 2Q6GA 3RXAA 1ETTH 4ABDA 3O8RA 4DCDA 1E34B 1NY22 3M5OA 3TH2H 1W7GH 3TJNA 2OC0A 2ZPSA 4CRGA 3QGNB 1KY9A 3RU4D 3T26A 4ZKNU 3SUFA 3GY2A 1YLCA 1V2TT 1BZXE 4I7YH 4D7GA 4MNWA 3S0NA 5G4BA 1GHBF 3Q3YA 3PWCA 1HAIH 1RTKA 4XBDA 1JXPA 3T28A 4JCNA 3URCA 2ZEBA 1ZRKA 1F5KU 3KQCA 3LJOA 3NZIA 1C4V2 3BG4C 2WPMS 4MLFB 1NFYA 3H7TA 1HAOH 1ZSLA 1P9SA 5CHAB 3GYMA 1IQJA 1OYTH 4ZAEA 3HATH 3DFJA 1DS2E 4K1SA 5T3HA 1DUAA 1GI1A 1C2FA 3GY5A 4CH8B 5FX6A 3VEQB 3A81A 1JIMA 2V3OH 2XRCA 2FP7B 2BD5A 2HRVA 4GCHG 3VB3A 2FOBA 3EQ0H 2VWLA 1ZPBA 3MH6A 1NPMA 1GMHG 1OXGA 1F0TA 1SGDE 2C4FH 1NFXA 5K7RA 1DE7H 3M3TA 1O2IA 5FAHA 3QN7A 1GHAG 3S9BA 1EP6A 3SV8A 3A84A 1XKBC 2C8XB 2IPHA 3GY3A 1AVXA 3A7TA 2W3KA 1C5VA 1CGHA 1M9UA 1L4ZA 4MNYA 1IOEA 1A0JA 1DM4B 1LVBA 1YPEH 3KQBA 3U8RH 1PPFE 5DP9A 2ZF0H 2D1JA 1GBMA 1C5TA 5HMAA 2G4TA 1VCPA 1SHYA 2H5CA 4X6PA 1ELBA 4OS6A 1U6QA 1PQAA 4Q7YA 2A4GA 1DITH 3A8DA 1O5GH 1LQDB 3ATWA 1LKAA 2BDHA 2G55A 2ZU2A 3TNSA 4ABJA 5DJ7A 2QYIA 2FOFA 2UUJB 2YNBA 3M35A 3F9EA 3MWIU 2CV3A 5FPTA 3SV6A 1HIAA 1V6DA 5I46H 1GI7B 2ZC9H 4TWYA 1FIWA 4D76A 3SNEA 4ZXYH 1W3CA 1C5YB 3P95A 4Q7ZA 1H1BA 4K1EA 2PV9B 3NKKA 1G3CA 2AERH 3ATMA 3IG6B 4ABGA 1XVMA 5DPAA 3SV7A 5E2PA 1C2GA 3PMJA 1TABE 1INCA 3GISB 4FUIA 3RXIA 1GBBA 1EJNA 4Y0YE 1DFPA 4U32A 2UWLA 1WQSA 2HOBA 3T62A 1DXWA 3PO1C 5FX5A 2NU1E 5JPMH 1NZQH 5I25A 1SGQE 1SB1H 1Y5UT 2ANKH 1OPHB 3GDUA 1G3EA 2EI8A 2ZNKH 2B5TB 3SGBE 2GCHG 2KAIB 1PPZA 2P3FH 2XTTB 1PPBH 4Y6DA 1FUJA 1F7ZA 1ZSKA 4NG9H 2A2QH 2NU4E 1TNGA 1P05A 1SGFG 1LPZB 3T29A 1UVTH 1S84A 1TGNA 1ID5H 3F1SB 3M7QA 2BVSH 4X2VA 1TX7A 4WMEA 1ZRBA 3SI4H 5F8ZA 1L4DA 2QN5T 1GL0E 3GCTF 1SG8B 1TRMA 1FLEE 3RXJA 2HPQH 5E0JA 5E2OA 4E05H 3Q76A 1MU6B 1OYQA 1UCYH 3U98H 1MTNB 1N1LA 1SOZA 2BLOA 1TRYA 1GPZA 5IYTA 2P95A 3BTTE 1UTKA 1JWTA 3SJKA 1BTXA 1WSSH 2F91A 5F03A 1VJ9U 4BNRA 5C2ZA 1SMFE 3M3VA 2PLXA 1QB9A 4WH6A 3TVJB 1YPHC 1ELEE 4MPVA 4U30A 1AZZA 1LHDH 4ZXXH 4UEHH 3QK1A 4X1QU 1O37A 3A7VA 2A45B 1PFXC 1AFEH 3PO1B 2BX3A 3QO6A 1A3EH 1ELGA 5JBTA 1OWIA 1RIWC 1PPHE 2VJ1A 2QXJA 1HLTH 3MI4A 4WWYA 3RXQA 2R9PA 5C1XA 1C5QA 4HTCH 1YCPK 3A7ZA 3QTOH 1C1TA 3Q77A 3SJ8A 3P8FA 1HNEE 1O2HA 1GBKA 1QRWA 3KL6A 2BY9X 1S82A 1SR5C 1C1RA 2O8MA 1LQEA 1ELAA 1DVAH 1P0SH 2Y7XA 3CENA 1GHZA 4KGAA 5DKMA 1ESBA 1N8OB 1QY6A 2ANYA 1OP2A 2TGDA 1OWDA 1H9LB 1TQ0B 1ZJDA 1SVPA 5GXPA 2ZGXH 1P3CA 4X1NU 3EYDA 3H5CB 2OP9A 1NFUA 1H9HE 1GMDF 3MHWU 1FONA 4YTAA 1HPGA 3ENSB 1AKSA 3M5MA 2J94A 4WVPE 3I29A 4AORA 1T4UH 2R3UA 4B1TA 2Q6FA 3BF6H 1B5GH 4JYTA 1MD7A 4CRFA 1Z7KA 2AS9A 1ETSH 1SI5H 3RXSA 2NWNA 4B71A 7KMEH 5HYOA 1TBRH 1UTOA 3UWIA 4GVUA 3UREA 3KHVA 4AZ2B 1SBWA 2FXRA 2SNVA 4AOQA 1PPGE 4WMFA 3T25A 1FV9A 3RXMA 1AO5A 3FANA 3ZYEA 4JYUH 1O3PB 3BIUH 1NFWA 2O8TA 2HNTF 4GLYA 3PV4A 1C5WB 1K9OE 3PM3A 4ABHA 1C1VH 2FLRH 4CR9A 3A8BA 1KLIH 1ZTLA 3U1JB 2XBYA 1GMHF 2P93A 3M37A 2Z9GA 4X8UH 4Y7BA 2ZO3H 1HJ8A 2ZCKP 1GHAF 3NXPA 1AUTC 4RN6A 2ZU3A 1TPSA 5C67A 1VZQH 3AW1A 1THRH 1XMNB 4NA7A 2J95A 2BDIA 3MNSA 4Y8XA 1SLUB 4H6SB 6GCHG 2YNAA 3GY6A 4A6LA 1F0SA 1TPAE 2BM2A 4QT8C 1GVLA 2D8WA 1D3QB 1TFXA 2XWBI 4ISHH 2R2MB 3OY6U 4BTUB 1MTVA 1BCUH 1Z71A 5GWZA 3DUXH 4IN2A 1J8AA 1UK2A 3M5LA 3K2UA 3RXBA 3BTKE 1UVUH 3ZZCA 2WUCA 1J17T 4K2YA 3KQDA 1O2TA 4YOIA 1LKBA 1AY6H 4A1XA 1WU1A 4XE4A 2VGCB 1BJUA 1PQ7A 1T7CA 3BG4B 1MKXH 3F6UH 1L0ZA 2V3HH 1BTPA 2Z9IA 3P8GA 4TYDA 2ILNA 2ZU5A 3RXTA 1MD8A 2ANMH 1BBRK 1ABIH 1MCVA 1KYNA 2TPIZ 2FOGA 2QF0A 2PKAA 4FUEA 1O31A 2VIOA 1CGJE 2VVUA 2BXTH 4FUBA 3MU5A 2PFEA 2EI7A 4IS5A 4OS2A 4O3UA 2RCEA 1D6RA 1Z8IB 4YLQH 4TPYA 4CH2B 1CSOE 2BQ7B 2FO9A 2B0FA 2WV5A 1V2VT 3MH7A 3O8BA 3RXKA 5H4IB 1LHFH 1CU1A 1N6YA 3TGKE 5E0GA 2ANWA 1O32A 1EP5A 2PSXA 2BD4A 3HPTB 1CVWH 2Z94A 4NWLA 3SJOA 5EPYA 1MTUA 3UR6A 2ZHEH 2PKAB 2TGAA 4KP0A 1HFDA 1UVOA 3SUDA 1L1JA 1WTGH 3I77A 2BD8A 1EPTA 2H5DA 2LNCA 1ZTJA 2H2ZA 2Y81A 3SU5A 1WAYB 5A8XA 2C8WB 4GPGA 1GHBG 2F9BH 3BEUA 5TJXA 1VGCB 1HIAB 1C5UA 1O2PA 2R0LA 1AFQB 1O2ZA 2C3SA 1VJAU 1EAXA 1LVOA 3RU4T 5DK1A 1A4WH 1C5OH 3GYLB 1CBWC 2BZAA 1VGCC 1GCTB 3IWMA 1QHRB 3W94A 2W3IA 2EC9H 1GCDA 1HAYB 3GDSA 4I8HA 1TB6H 2QGRA 3FFGA 1T32A 2RDLA 1EOLA 3KQEA 4LZ4B 3PTBA 2P3UB 1NTPA 1ETRH 2VINA 2J38A 1CA8B 2D26C 5DP5A 1EX3A 2RA0A 4CHAC 8GCHG 1KXDA 2GZ8A 1UJ1A 3UFAA 1IQMA 1GI3A 2AGGX 3BTEE 3SGAE 2W7UA 1GI8B 4NSYA 2SGEE 1BUIA 1GI9B 4INHA 1SLXB 5EOKA 1P04A 1UK4A 3OYPA 2OQ5A 2FTLE 1VITF 2GP9B 1RIWB 3RP2A 2PHBA 1SSXA 3SNAA 3SJ9A 4K60A 2FI5E 2ZDKA 1XUHA 1DWBH 1MUEB 1TNLA 4OS5A 3QZRA 1E36B 2ZA5A 3LONA 4NA8A 3PMAB 1V2KT 1G32B 1SGTA 1AN1E 4AG1A 2Z3EA 1GVKB 2ZU4A 1TX6A 3BTME 1AFQC 1CE5A 2CN0H 2ZCHP 2ODQA 2PW8H 1UMAH 1ZHRA 3U8OH 5J4SA 5FXLA 1TBZH 1AKSB 3BIVH 1ESAA 2GT8A 2BY7X 1GI0A 1A2CH 5HM9A 3HKIB 2ZGJA 4NSVA 4CREA 1QB6A 1QB1A 1V2ST 2CF8H 3O8DA 3KN2A 1Z6EA 2GMTB 3ZYDA 4F49A 1SLVB 3U69H 4FUCA 2BMGB 1SQTA 1YBWA 2XCNA 1XXFA 2F83A 4LOYH 2BVRH 3ELAH 2BTCE 3RXLA 1TALA 1YCPH 2XBXA 4NIWA 4MG3A 1S6FA 1C2IA 3VGCB 2BLWA 1ZGIA 4B74A 5HM2A 5K0HA 3M5NA 1P12E 1JRTA 5T6FA 1OWEA 3TK6A 2QF3A 4RKJB 1GL1A 1DWDH 2ZQ2A 3SNBA 2XXLA 5L2YH 1AHTH 3FP7E 1KDQA 1V2PT 3ZVEA 1NRPH 1LO6A 1TGTA 1J9CH 3M7UA 3L33A 4E7RG 4X1RU 1DWCH 1TNKA 1O2YA 5CHAC 1GBAA 1SFQB 3TNTA 6CHAC 3P70B 3VXFH 2P59A 6GCHF 2FPZA 4JK5A 5EPNA 1HAHH 1ZZZA 2ODPA 2FODA 2A5IA 2ZI2H 4DIHH 4WJG2 1UTNA 9LPRA 2QIQA 3D65E 4UE7H 4I8KA 1GBDA 4DURA 1N8OC 1P06A 4JK6A 1K2I1 1EATA 2WV4A 2ZDLA 1VR1H 8KME2 3ITIA 3NPSA 2ZGBH 4ZKOU 2P8OC 2BVXH 1XXDA 1KIGH 2J2UA 1ZMLA 2OD3B 2IN2A 1QNJA 1BRCE 2UWOA 1D6WA 1P11E 1HAZB 2GGVB 3UNSA 3LGUA 1FY1A 1QJ6B 1ZGVA 3OX7U 2AMQA 3RM0H 4I32A 1GBHA 1UCYE 3BSQA 4E06H 2B9LA 5B6OA 5LPRA 1Q3XA 4NFEA 5EGMA 1O2MA 1BA8B 1BMAA 2STBE 4GCHF 3ZVDA 1UHBA 2I6SA 1ZMNA 4JZ1A 3F9HA 2SGAA 2ASUB 7LPRA 1S5SA 2NU0E 1TNJA 3ODFA 1AUJA 3RMOH 2OLGA 3GOVB 5GJ4B 4O03A 1AWFH 1BBRH 3RXDA 1BRAA 3UY9A 3ZZ5A 3D23A 3BTDE 5AFYH 2VWNA 2F9PA 2HNTE 2SGPE 1F5LA 4H6TA 3E91A 5E0HA 1GJAB 2SGDE 1Y8TA 1ZSJA 2ZQ1A 3A7YA 2BXUH 4MNXA 1AWHB 2VWOA 2TRMA 2OINA 2O8WA 1HAGE 4E7NA 4NIXA 1V2UT 2GT7A 1H8DH 1QRZA 3SNCA 1O2SA 1ELCA 2IJOB 2BLQA 1TMTH 1GMDG 4BXSA 1SOTA 1YGCH 2G51A 2Y6TA 3UNQA 1G3DA 3SUEA 1FN8A 2ZFTA 3LGVA 4ZKRU 2PKSB 1MQ5A 1P9UA 1YPHE 1LPGB 1XKAC 1MZDA 1P01A 1MKWK 3UWJH 5AFZH 3S69A 1Q31A 3ATIA 1GHWH 1MBMA 1FY4A 4AB8A 5DO4H 4I8JA 1DUEA 8GCHF 3M61U 1TNIA 3S9CA 4B2BA 1YPJH 2HNTC 5AHGH 5FCRA 3SV2H 4WY3A 5F8TA 2GDEH 1FY8E 1A5IA 4CHAB 2SGQE 1K1IA 1MZAA 2G00A 1KLTA 1EB1H 2HALA 3M3SA 3SU3A 3LGTA 3SU0A 1EJAA 2YOLA 1C1OA 1T8MA 1PYTD 2ZDVH 4GAWA 3MOCA 3UQVA 3GCHB 2H9EH 4B75A 1ZR0A 3KGPA 4CR5A 1E38B 1XX9A 1EJMA 5FPSA 1DPOA 1TGSZ 3MU4A 1TPPA 3SQEE 1O2RA 1FIZA 5TCAA 5ABWA 5J4QA 3DD2H 1G36A 1DANH 3JZ2B 3E1XB 1CT4E 1GDNA 2H9TH 4BAKB 4H42U 1RTLA 2FIRH 4NZLA 5C1YA 2V0BA 2BOHB 1O3MA 3F68H 1GG6B 1FI8A 2Y5FA 1KXCA 4KTUA 4DT7B 1D4PB 1D9IA 4A1VA 1BMLA 1UTLM 2Y5GA 2BYAX 2K1QA 3A86A 4Y79A 4M7GA 1TYNA 1ZJKA 2P16A 1O3AA 2P3TB 3MO9A 1C5NH 2JH6D 1AZ8A 2ODYB 4UONA 1CT0E 4Y7AA 1C5MD 5EODA 2F9UA 4XFQA 4D7FA 2G8TA 4BAHB 1O2GH 2WYGA 5EXLA 4CRCA 3L6PA 1SGFA 2B7DH 2Y5HA 5DP6A 4ESTE 1GMCG 2ZFQH 4R0IA 3T2NA 1HJAB 1B0EA 3DFLA 2BD7A 2Y80A 3B23B 5JYIA 1BOQA 1KXEA 2BHGA 1IQHA 2WYJA 1OWHA 2Z6BD 1O3CA 2FOAA 3NWUA 1GI4A 3LH1A 5F6MA 2XCFA 3BTGE 1O5BB 4AGJA 1TOCB 4I8LA 4X2WA 3OTJE 1DX5M 2WINI 3AASA 1O2OA 2GVFA 1WQVH 2AGIX 3SORA 1V2QT 1SGEE 2FS9A 1FNIA 1P2JA 2JH5D 1ZOMA 1O5FH 3TGJE 1O2WA 1J14A 3QWCH 2Z3CA 2A7CA 1XM1A 1SGYE 4NFFA 1EUFA 3BEIB 5ESBA 1MH0A 3LOXA 1O3FA 3ESTA 1ZPZA 1Q2WA 1Y3UA 2R3YA 3PWBA 1IQFA 2J92A 1GJ5H 4BOHA 1FY5A 1BTYA 1EAWA 2FWWA 2D2DA 2GD4B 1DLKB 3ZVAA 4YLUA 3ZZ9A 1H8IH 1O2LA 1J16A 1PQ5A 2OBQA 1L1GA 2PSYA 1JMOH 2GX4A 3U9AH 2VIVA 4BAQB 3BTFE 1O39A 1GI2A 1OP8A 4ZROA 3ZV8A 2QY0B 1O3BA 4TPIZ 2FOCA 3RXEA 3GY8A 4UD9H 6ESTA 1GJ8B 1AE5A 1E37B 1QR3E 1GMCF 3RXRA 3SU1A 1O5CB 2LPRA 2TGPZ 2QXIA 4IMQA 1EZQA 1TNHA 1Y59T 2ZHDA 3MFJA 1O3IA 1UTQA 4TY7A 2ZGCA 3K65B 1ARBA 3UPEA 3EA9A 2HWLB 1SGCA 4NWKA 1BT7A 1QGFA 1H4WA 1VCQA 3G01A 2AYWA 1JBUH 3DT0H 1ESTA 5TCCA 1GBJA 4GHTA 1FAKH 3RLYH 2ZHWH 2FI4E 3SO3A 5LPFA 4Q7XA 1QURH 3RXHA 3F9GA 1NT1A 5A0CA 5ESTE 1BTWA 2CHAC 4I33A 5HGGA 5CE1A 4X2XA 1FXYA 6CHAB 3MU0A 1QIXB 3E8LA 2OXSA 1EAUA 1O2VA 3T27A 2BQ6B 4INKA 1FN6A 5JBBS 4JMYA 2ZTXA 2AFQB 1E0FD 1GDUA 4XBBA 3ZZ7A 1NU7B 4R8TB 3KIDU 3LU9B 2PTCE 3TK9A 6LPRA 4AYVB 4NGAH 3K6ZA 1GDQA 2GDDA 1G9IE 2A4QA 2DE8A 9ESTA 4NIVA 2PGBB 3NK8A 4BTTB 1ARCA 1MKXK 2ZDNA 5AVDA 3ZZ3A 4ABIA 2FS8A 4MDSA 1W2KH 3PLKA 4IC6A 4DOQA 4BANB 2C90B 4HFPB 3FZDA 1SL3A 3I78A 5A0BA 2PR3A 4ABEA 4DGJA 4YO9A 3DA9B 3A85A 1O3HA 2GTBA 5DP8A 2JKHA 4FU9A 1KXFA 2BB4A 1SGIB 4BAOB 2VWMA 1T4VH 1GJ7B 4FVBA 2AEIH 1TLDA 5C20A 3FAOA 4YOGA 3GDVA 1AU8A 1GCTC 2ZGHA 3QGJA 3SBKA 1UO6A 3V3MA 2BLVA 4J1YA 1AB9C 1O3NA 1ELFA 2THFB 3C27B 3ATLA 3GY7A 2XYAA 1XUIA 1UK3A 1G30B 5DGJA 1EASA 3RUOA 3VXEH 2G4UA 3TPIZ 4D9QA 1K1MA 2BOKA 1C2KA 3VB5A 1DDJA 2ZFRH 3JZ1B 2A5AA 5EQRA 1T8OA 1PPCE 1Y3VA 1D3TB 1Z8GA 3EA8A 4DG4A 1TMBH 3ZVFA 4YM9A 5DP4A 2VIPA 1W8BH 2H6MA 5JBAS 3RLWH 1Z1IA 2AH4X 1P57B 4NIYA 3STJA 5A0AE 2FLBH 3IITA 1HRTH 1C2JA 1EOJA 3PROA 4Y8YA 1V2RT 2A4OA 4FU8A 3ATKA 4X1SU 5T6GA 4B73A 1CA0B 4MPWA 4MTBA 2SGFE 1S83A 1SGRE 1WOFA 3URDA 4BTIB 1BMNH 1QBOA 4OS4A 3SHCH 1HAPH 1FJSA 2P94A 3DHKH 1DLEA 3SJIA 1PQ8A 2FOEA 1HGTH 1O2QA 3AAVA 1XUJA 2OCVB 1ANDA 1DICA 3VFEA 2GV7A 5FBEA
chains in the Genus database with same CATH superfamily
1CT2E 2ZHQH 3ZV9A 3QZQA 1GBFA 3S9AA 2UWPA 1FMGA 5BPEA 2OTVA 2QV1A 3AW0A 2XC4A 1NBME 4ZMAH 2BD9A 1C2DA 1QL7A 1CBWB 3SUGA 1QA0A 3BN9A 1CGIE 3O8CA 5C1UA 4O97A 3U8TH 1P2OA 4IW4E 1NRSH 1W7XH 2AMDA 3LKWA 4TY6A 1ANBA 1YF4A 1NROH 2G5VA 4B6EA 4LZ1H 1ACBE 1WTHD 1C9PA 1C5RA 3MH4A 1ZHPA 3ZZAA 1DT2A 3SV9A 3GCHC 4CRAA 1YPGH 1O5DH 3V13A 3B9FH 1O3GA 4GSOA 1KDQB 4YT6H 2FDAA 4TT3D 1UTJA 2WUBA 2BY8X 2EEKA 1TMUH 5F8XA 1EZSC 3LDXH 2XOKD 5EG4A 2KR7A 2AHME 4ZKSU 1THSH 3VB7A 4A1TA 1QL8A 4X6NA 1IAUA 4BXWA 3TK5A 1S0RA 2A7HA 5EXMA 3STIA 2PTNA 4ISLA 1W10U 1OSSA 4ABBA 3W95A 2FESH 2RA3A 3BTQE 1Z8RA 1WCZA 2PGQB 1HAXB 1GJCB 2GV6A 2HLDD 3MMGA 1TPOA 4CRBA 4U2WA 1MU8B 1BTZA 3RXOA 1RTFB 1PYTC 1S85A 1V2JT 4AB9A 1RRKA 1Y3WA 3MNXA 5JB9S 1TONA 1K22H 2F3CE 1UCYK 1O3DA 1GHXH 4X6MA 5FBIA 2XNIA 1TRNA 2SFAA 2HGTH 4AFQA 4AGKA 1K1OA 2WSSD 3RU4E 3UNRA 2J9NA 1MTNC 1QRXA 3P8NA 3VPKA 1IQGA 1HJAC 3SW2B 2TIOA 4MQAA 2FI3E 2BD2A 4Y8ZA 1YP9A 3A7WA 4INLA 3SQHE 1ABJH 1BHXB 1AD8H 2O8UA 3UQOA 1C5PA 3VB4A 1UHBB 1TOMH 1O3KA 2BY5X 1LHEH 1HDTH 3CP7A 3V12A 2ZP0H 5DP3A 2ZDMA 1O3JA 3MNCA 4Z6AH 1RFNA 2FZZA 1VCWA 2AGEX 4WXVA 3MH5A 4FUJA 2ZKSA 1KXAA 3RC5A 4I31A 1HXEH 2ZECA 2DUCA 2STAE 2VGCC 3P17H 1AMHA 1NO9H 2A31A 1MQ6A 4ISNA 1K1NA 2FTMA 4D8NA 2FMJA 4I8GA 3SHAH 2ZG0H 1W0ZU 2GZ9A 1EPTB 1ZTKA 1HYLA 1W14U 1TA2A 2NU3E 1SGNE 3WWFA 1LVYA 2GCTB 1MCTA 1DOJA 2C8YB 4VGCC 1EPTC 2TGTA 3BV9B 2J4IA 4AFUA 2XW9A 2VIDA 4FUFA 3ZZ4A 3QDZB 2A0QB 2BDYA 2FYQA 3FP8E 4VGCB 2HVXA 1IHSH 3P8OA 3SOSA 1O2KA 1NM6A 3L3TA 1CO7E 3ZZBA 5CMXH 3E90B 1X7AC 2Z3DA 3PMBB 1C5SA 2F43B 1K1LA 4Q2KA 4A92A 4K69A 7GCHF 3E3TA 1C1PA 1P10A 1LDTT 4AYYB 3CS0A 1OX1A 1AVWA 1O3OA 1YYY1 5FPYA 3A7XA 3AVZA 3Q3XA 2PUQH 1D3DB 1GHYH 4YXWD 1YC0A 4DJZB 3GICB 2IOTA 1P02A 2DE9A 1GJ4H 2V35A 1WYKA 2QXGA 3C1KA 4B2AA 2KCYA 4KELA 2A32A 1FY3A 1SQOA 4Y11E 1O35A 3KF2A 1HCGA 4UFEH 2F9OA 8ESTE 2ZFPH 4U01A 1O34A 1ANEA 3UOPA 3A89A 2BDAA 2XC5A 2HLCA 1P3EA 5BRRE 5JB8S 3MU1A 2J97A 3ZVGA 1C1WH 3TU7H 2WPKS 1BMMH 1HAVB 1TAWA 3UR9A 4YOJA 1FQ3A 1C4Y2 2AIPA 1T8NA 3UIRA 1MKWH 1E79D 1SHHB 2Q1JA 4NA9H 4X8TH 3TH3H 2VNTA 5GCHG 2GKVE 1NRRH 5L2ZH 2SNWA 1A1RA 4FUDA 4WMDA 1GJBB 1THPB 1QBNA 5KGOA 4K8BA 1CHOG 1ZLRA 4RI0A 1MABB 2H9HA 1GG6C 1AI8H 4F4OC 1ANCA 1QTFA 2KZ4A 5FHTA 3TGIE 3M36A 4FVDA 4THNH 2A1DB 2Z9LA 3K6YA 1OHHD 5A09A 3F9FA 2EQNA 3OSYA 1ZMJA 7GCHG 4CBNA 3D62A 1IQEA 1NN6A 3Q3KA 2VH6A 3MNBA 1KTSB 1XVOA 2G5NA 4IC5A 1TBQH 2ZFSA 4FOUC 2A7JA 1AB9B 1P2QA 2AIQA 2JH0D 3ZVBA 1ELDE 2QCYA 3LGWA 3W1EA 5IK2D 4Q4LA 1TGBA 1S0QA 3N7OA 2QXHA 3QLPH 1IQLA 3WY8A 4B76A 1V2MT 4I86A 2K8IA 3D49H 3UAIC 1MTSA 2F9VA 1FDPA 4YESB 1CHGA 1YM0A 2ZDAH 1NU9A 3P92A 1C5XB 2XC0A 4UFGH 3F0OA 4LXBH 5DP7A 1G37A 5A2MH 3GCTG 1W11U 2K0QA 1C9TA 5IDKA 3KNXA 4ABAA 1CA0C 2KM0A 2CMYA 2Z9KA 4BAMB 5LGOA 2ALPA 1BITA 1NC6A 2BDCA 1YKTA 3QTVH 1GVZA 1A7SA 1QFKH 1S81A 3UOUA 2QE7D 1IQNA 1SPJA 2OBOA 3KEEA 3U1IB 3SU4A 1A0LA 1C2HA 3M7TA 1QL9A 1TQ7B 3RXFA 2QA9E 3NCLA 4JZIA 4JZEH 2VH0A 2OC1A 1A0HB 1FAXA 2ZCLP 2UUYA 3HKJB 1Y5AT 4K8YA 2GMTC 4OS1A 3PV2A 2A2XH 4AFSA 2Q6DA 1AE8H 5LPEA 2V6NA 1ORFA 1WV7H 2M5TA 1BDAA 3FVFB 4O9VA 1GBTA 1O36A 1OWJA 2ULLA 1C2LA 1O30A 3RM2H 2RG3A 1Y5BT 1BQYA 4H4FA 3PLPA 2JIZD 5B6LA 5KECA 5SGAE 1AVGH 5PTPA 2FX6A 1TGCA 3FZZA 4SGBE 3DSPA 2O8LA 3VGCC 2KX4A 1HB0B 1WDIA 2FM2A 1IHTH 1FX0B 1F0UA 3LPRA 8LPRA 3A8CA 3AAUA 2BDBA 3PTNA 1DSUA 1K28D 1PJPA 2P8OB 3A88A 3SNDA 1XUFA 3B8JA 3ODDA 4XDEA 1J15A 3TLOA 3GY4A 3LJJA 4A7IB 2JJ2D 3F0PA 2VIWA 4YT7H 1LHCH 1ZYOA 4ASHA 3EAJA 1JIRA 2BY6X 2VB0A 1BTHH 1Z1JA 1O33A 1GGDB 1TWXB 1W0YH 5C5NA 1GWAA 1K1JA 1P09A 1F2SE 1RJXB 1BTUA 1SFIA 3EDXB 1DWEH 3RMNH 3GCOA 4P00A 1L1NA 4X0WU 4IMZA 1D3PB 1AQ7A 3PLBA 3V0XA 3R3GB 3A83A 2W7SA 3TJOA 5EQQA 1HBTH 2CHAB 1QJ1B 4K1TA 5JBCS 1SQAA 2BDGA 1SGPE 1E35B 5E8EH 3TIUA 1O2NA 2ZIQH 2WV9A 3Q00A 4Y71A 1C1SA 1A46H 5T6DA 3H09A 3MO6A 2ZTYA 1JOUB 3N7DA 5C3NA 1IQIA 1CQQA 1W13U 2UUFB 2HPPH 1Z6JH 3LT3A 2WPHS 2KCAA 1P03A 2UUKB 5EQSA 2H1UA 3RC4A 4NCYA 1P2NA 3HGPA 1HUTH 4ZHAA 4YZUA 1C4U2 1SQRA 1BHXF 1V2OT 4X8VH 2G81E 4MNVA 1P2KA 2F4LA 3LGYA 1BRBE 2KAIA 1KXBA 2GZ7A 1UTMA 1A5GH 1UTPA 2R2WU 3BEFB 2BQWB 1YPKH 1MBQA 1UVSH 4Y76A 5EW1H 5HXFA 3SZNA 2OC7A 1JRSA 1E1QD 1COWD 2GCHF 3MTYA 2WPLS 2XWAA 3RXUA 5L30H 2BZ6H 3KCGH 5A8YA 1TX8A 2B8OH 2VVVA 3S7KB 4AX9H 3QX5H 1E1RD 3HK3B 4LK4A 4DVAU 1WUNH 2JETB 3S7HB 1A5HA 2ZPQA 4O3TA 3SN8A 2QAAA 1AGJA 4JZFH 4JYVH 4K5ZA 3OEED 2OC8A 1ZPCA 3QUMP 4IGDA 4HZHA 3SI3H 1O3LA 4NZQA 4X1PU 4F55A 1FZZA 2CGAA 4J2YB 1GBEA 4Z0KA 5GCHF 1P2IA 4HGCA 1O2UA 2C8ZB 3R0FA 2OUAA 1BBRE 2PWXA 1QQ4A 7ESTE 1RXPA 1NESE 1QCPA 4FUHA 1O38A 4Z1MD 4MPUA 1GHVH 1QBVH 4WXIA 5DN6D 4CRDA 3KQ5A 3RDZA 1MAXA 1GJDB 1LMWB 1O0DH 4GHQA 5GDSH 1EZXC 4Q80A 4X2YA 5LH8A 3E0NB 4OGXA 3BTHE 2ZWLH 1V2LT 5C0TA 2O9QA 3EGKH 1DY8A 2RFKC 1C2EA 2ZU1A 1F5RA 2QC2A 3RXCA 3RMMH 1KLJH 3F2GA 4AG2A 1N6XA 4XOJA 2I6QA 4A5TS 4KTSA 3A87A 1ELVA 1L2EA 3HK6B 3KYGA 3OE7D 2Z7FE 3P6ZB 2ZZUH 1GI5A 1O5AB 2ZTZA 1G2MA 2TBSA 1XUKA 2Y7ZA 1LCYA 3TJVA 1RGQA 4OS7A 4RKOB 1ELTA 2OQUA 4KKDA 1K21H 4AN7A 1IQKA 1O5EH 2EI6A 4RSPA 1KSNA 2JETC 1H9IE 3LC5A 1ZHMA 3H7OA 4X6OA 2QF4A 2AMPA 5EW2H 2A5KA 1B0FA 2VVCA 1T8LA 1QA7A 1C1MA 1NRQH 4D9RA 1RD3B 1S6HA 3TITA 3E6PH 3RC6A 1A61H 2W5EA 2FEQH 3EA7A 5EJZA 5GIBA 3ZZ8A 4GUXA 4ZH8A 1BRUP 4DIIH 1KMHB 4CBOA 2NU2E 2VIQA 4IBLH 3GCNA 4UFDH 3PMHB 1O3EA 2WPIS 1GBLA 4FUGA 1YPLH 1UVPA 3MYWA 4WH8A 1OKXA 1F0RA 1YCPM 1Y3XA 3T5FH 1OP0A 4WF8A 3EE0B 1LVMA 3BG8A 1HXFH 2BD3A 4UDWH 3CS7A 4Y0ZE 3RMLH 1GBCA 3NUMA 1FPHH 1FPCH 1B7XB 1HV7A 2J34A 1AIXH 3LC3A 2W26A 1TA6A 2ZPRA 1MMJN 4HI3A 3ZZDA 3SYJA 2BX4A 1GJ9B 4ZUHA 4PROA 1GBIA 1V2WT 4FXGH 1K1PA 4ABFA 3E16B 3MU8A 5HIZA 4KTCA 4Y10E 1VITH 1G3BA 4MVNA 2Z9JA 3PB1E 1EAIA 2G52A 1V3XA 2PKSC 4AFZA 3HGNA 4SGAE 1QJ7B 1OOKB 3EE7A 1DSTA 2PUXB 1DY9A 3LH3A 3OY5U 3ZZ6A 2FOMB 1WBGB 1P8VC 1EQ9A 1PPEE 2ZFFH 1SC8U 3A80A 3RXPA 3TJUA 1LPKB 2CF9H 3MO3A 1EKBB 5GPIB 3RXVA 4K3JA 1SLWB 1GJ6A 4ISOA 4ZHMU 1VITG 1DXPA 2CXVA 3LGIA 3TH4H 1OS8A 1F92A 1Y3YA 1HJ9A 1G2LA 1H8HD 1XUGA 2ZHFH 5C5OA 3UUZA 3ZVCA 3OEHD 1C1QA 1V2NT 4FU7A 4DY7B 1A3BH 1MTWA 2XNDD 1YLDA 1LTOA 3PYHA 1NRNH 3SU2A 4ZHLU 5CDFE 5A8ZA 1C5ZB 4TWWA 3SU6A 2XBWA 5JDUB 1YPMH 3WWBA 1LHGH 1GI6A 3E0PB 1C2MA 1C5LH 1GGDC 4JZDH 1OWKA 3A8AA 1RS0A 3V7TA 1QQUA 3SGQE 2ESTE 1P2MA 4UFFH 1CHOF 1K0HA 1O2JA 1TIOA 3LIWA 2ALVA 1C1NA 1HAVA 1NS3A 2PP6A 5AF9H 2FYRA 3FP6E 1O2XA 3RXGA 1BJVA 3A82A 4XBCA 2FX4A 5DG6A 1KTTB 1EB2A 1YY3A 4OGYA 1TE0A 5ETXA 1MAYA 2IJD1 1BB0B 5EXNA 4ISIH 3K9XB 3OU0A 2A4RA 4MPXA 5EU8A 2FOHA 3KYFA 2R0KA 5C0UA 1EXFA 5L6NH 2GCTC 1EZUC 4B2CA 5FCKA 2CJIA 3VB6A 4DW2U 1T31A 2WPJS 2EA3A 1Z8JB 2Y82A 3UTUH 1YWUA 1C1UH 2F9NA 2XBVA 4IN1A 2C93B 3BTWE 1W12U 2VU8E 4XSKU 4X8SH 1BIOA 2Q6GA 3RXAA 1ETTH 2QF5A 4ABDA 3O8RA 4DCDA 1E34B 1NY22 3M5OA 3TH2H 1W7GH 3TJNA 2OC0A 2ZPSA 4CRGA 3QGNB 1KY9A 3RU4D 3T26A 4ZKNU 3SUFA 3PRDA 3GY2A 1YLCA 1V2TT 1BZXE 4I7YH 4D7GA 4MNWA 3S0NA 2WZQA 3U28C 5G4BA 1GHBF 3Q3YA 3PWCA 1HAIH 3DCLA 1RTKA 4XBDA 3GS9A 1JXPA 3T28A 4JCNA 3URCA 2ZEBA 1SKYE 1F5KU 1ZRKA 3KQCA 3LJOA 3NZIA 1C4V2 3BG4C 2WPMS 4MLFB 1NFYA 3H7TA 1HAOH 1ZSLA 1P9SA 5CHAB 3GYMA 1IQJA 1OYTH 4ZAEA 3HATH 3DFJA 1DS2E 4K1SA 1YLNA 1DUAA 1GI1A 5T3HA 1C2FA 3GY5A 4CH8B 5FX6A 3VEQB 3A81A 1JIMA 2V3OH 2FP7B 2XRCA 2BD5A 2HRVA 4GCHG 3VB3A 2FOBA 3EQ0H 2VWLA 1ZPBA 3MH6A 1NPMA 1GMHG 1OXGA 1F0TA 1SGDE 2C4FH 1NFXA 5K7RA 1DE7H 3M3TA 1O2IA 4ASUD 5FAHA 3QN7A 1GHAG 3S9BA 1EP6A 3SV8A 3A84A 1XKBC 2C8XB 2IPHA 3GY3A 1AVXA 3A7TA 2W3KA 1C5VA 1CGHA 1M9UA 1L4ZA 4MNYA 1IOEA 1A0JA 1DM4B 1LVBA 1YPEH 3KQBA 3U8RH 1PPFE 5DP9A 2ZF0H 2D1JA 1GBMA 1C5TA 5HMAA 2G4TA 1VCPA 1SHYA 2H5CA 4X6PA 1ELBA 4OS6A 4FETA 1U6QA 1PQAA 4Q7YA 2A4GA 1DITH 3A8DA 1O5GH 1LQDB 3ATWA 1LKAA 2BDHA 2G55A 2ZU2A 3TNSA 4ABJA 5DJ7A 5C94A 2QYIA 2FOFA 2J98A 2UUJB 2YNBA 3M35A 3F9EA 3MWIU 2CV3A 5FPTA 3SV6A 1HIAA 1V6DA 5I46H 1GI7B 2ZC9H 4TWYA 1FIWA 4D76A 3SNEA 5HKKD 4ZXYH 1W3CA 1C5YB 3P95A 4Q7ZA 1H1BA 4K1EA 2PV9B 3NKKA 1G3CA 2AERH 3ATMA 3IG6B 4ABGA 1XVMA 5DPAA 3SV7A 5E2PA 1C2GA 3PMJA 1TABE 1INCA 3GISB 4FUIA 3RXIA 1GBBA 1EJNA 4Y0YE 1DFPA 4U32A 2UWLA 1WQSA 2HOBA 3T62A 1DXWA 3PO1C 5FX5A 2NU1E 5JPMH 1NZQH 5I25A 1SGQE 1SB1H 1Y5UT 2ANKH 1OPHB 3GDUA 1G3EA 2EI8A 2ZNKH 2B5TB 3SGBE 2GCHG 2KAIB 1PPZA 2P3FH 2XTTB 1PPBH 4Y6DA 1FUJA 1F7ZA 1ZSKA 5HIYA 4NG9H 2A2QH 2NU4E 1TNGA 1P05A 1SGFG 1LPZB 3T29A 1UVTH 3CNRA 1S84A 1TGNA 1ID5H 3FKSD 3F1SB 3M7QA 2BVSH 4X2VA 1TX7A 4WMEA 1ZRBA 3SI4H 5F8ZA 1L4DA 2QN5T 1GL0E 3GCTF 1S6LA 1SG8B 1TRMA 1FLEE 3RXJA 4TSFD 2HPQH 5E0JA 5E2OA 4E05H 3Q76A 1MU6B 1OYQA 1UCYH 3U98H 4XRNA 1MTNB 1N1LA 1SOZA 2BLOA 1TRYA 1UW7A 1GPZA 5IYTA 2P95A 3BTTE 1UTKA 1JWTA 3SJKA 1BTXA 4AC9A 1WSSH 2F91A 5F03A 1VJ9U 4BNRA 5C2ZA 1SMFE 3M3VA 2YMSD 2PLXA 1QB9A 4WH6A 3TVJB 1YPHC 1ELEE 2VBCA 4MPVA 4U30A 1AZZA 1LHDH 4ZXXH 4UEHH 3QK1A 4X1QU 1O37A 3A7VA 2A45B 1PFXC 1AFEH 3PO1B 2BX3A 3QO6A 1A3EH 1ELGA 5JBTA 1OWIA 1RIWC 1PPHE 2VJ1A 4RT0A 2QXJA 1HLTH 3MI4A 4WWYA 3RXQA 2R9PA 5C1XA 1C5QA 4HTCH 1YCPK 3A7ZA 3QTOH 1C1TA 3Q77A 3SJ8A 3P8FA 1HNEE 1O2HA 1GBKA 1QRWA 3KL6A 2BY9X 1S82A 1SR5C 1C1RA 2O8MA 1LQEA 1ELAA 1DVAH 1P0SH 2Y7XA 3CENA 1GHZA 4KGAA 5DKMA 1ESBA 1N8OB 1QY6A 2ANYA 1OP2A 2TGDA 1OWDA 1H9LB 1TQ0B 1ZJDA 1SVPA 5GXPA 2ZGXH 1P3CA 4X1NU 3EYDA 3H5CB 2OP9A 1NFUA 1H9HE 1GMDF 3MHWU 1FONA 4YTAA 1HPGA 3ENSB 1AKSA 3M5MA 2J94A 4WVPE 3I29A 4AORA 1T4UH 2R3UA 4B1TA 2Q6FA 3BF6H 1B5GH 4JYTA 1MD7A 4CRFA 1Z7KA 2AS9A 1ETSH 1SI5H 3RXSA 4RT1A 5EIYA 3SZEA 2NWNA 4B71A 7KMEH 5HYOA 1TBRH 1UTOA 5KEDA 3UWIA 4GVUA 3UREA 3KHVA 4AZ2B 3ZIAD 1SBWA 2FXRA 2SNVA 4AOQA 1PPGE 4WMFA 3T25A 1FV9A 3RXMA 1AO5A 3FANA 3ZYEA 2KCOA 4JYUH 2CK3D 1O3PB 3BIUH 1NFWA 2O8TA 2HNTF 5T1VA 4GLYA 3PV4A 1C5WB 1K9OE 3PM3A 4ABHA 1C1VH 2FLRH 4CR9A 3A8BA 1KLIH 1ZTLA 3U1JB 2XBYA 1GMHF 2P93A 3M37A 2Z9GA 4X8UH 4Y7BA 2ZO3H 5F53A 1HJ8A 2ZCKP 1GHAF 3NXPA 1AUTC 4RN6A 2ZU3A 1TPSA 2KFWA 5C67A 1VZQH 3AW1A 1THRH 1XMNB 4NA7A 2J95A 2BDIA 3MNSA 4Y8XA 1SLUB 4H6SB 6GCHG 2YNAA 3GY6A 5FL7D 4A6LA 4M9FA 1F0SA 2GJGA 1TPAE 2BM2A 2EY4C 4QT8C 1GVLA 2D8WA 1D3QB 1TFXA 2XWBI 4ISHH 2R2MB 3OY6U 4BTUB 1MTVA 1BCUH 4DT4A 1Z71A 5GWZA 3DUXH 4IN2A 1J8AA 1UK2A 3M5LA 3K2UA 3RXBA 3BTKE 1UVUH 3ZZCA 2WUCA 1J17T 4K2YA 3UB0A 3KQDA 1O2TA 4YOIA 1LKBA 1AY6H 5CHBA 4A1XA 1WU1A 4XE4A 2VGCB 1BJUA 1PQ7A 1T7CA 3BG4B 1MKXH 3F6UH 1L0ZA 2V3HH 1BTPA 2Z9IA 3P8GA 4TYDA 2ILNA 2ZU5A 3RXTA 2OK5A 1MD8A 2ANMH 1BBRK 1ABIH 1MCVA 1KYNA 2TPIZ 2FOGA 2QF0A 2PKAA 4FUEA 1O31A 2VIOA 1CGJE 3OTPA 2VVUA 2BXTH 4FUBA 3MU5A 2PFEA 2EI7A 4IS5A 4OS2A 4O3UA 2RCEA 1D6RA 1Z8IB 4YLQH 4TPYA 4CH2B 1CSOE 2BQ7B 2FO9A 5EJLA 2B0FA 2WV5A 1V2VT 3MH7A 3O8BA 3RXKA 5H4IB 1LHFH 1CU1A 1N6YA 3TGKE 5E0GA 2ANWA 1O32A 1EP5A 2PSXA 2BD4A 3HPTB 1CVWH 2Z94A 4NWLA 3SJOA 5EPYA 1MTUA 3UR6A 2ZHEH 2PKAB 5C17A 2TGAA 4KP0A 1HFDA 1UVOA 3SUDA 1L1JA 1WTGH 3I77A 2BD8A 1EPTA 2RDEA 2H5DA 2LNCA 1ZTJA 2H2ZA 2Y81A 3SU5A 1WAYB 5A8XA 2C8WB 4GPGA 1GHBG 2F9BH 3BEUA 5TJXA 1VGCB 1HIAB 1NBMD 1C5UA 1O2PA 2R0LA 1AFQB 1O2ZA 2C3SA 1VJAU 1EAXA 1LVOA 3RU4T 5DK1A 1A4WH 1C5OH 3GYLB 1CBWC 2BZAA 1VGCC 1GCTB 3FOAA 2M2AA 3IWMA 1QHRB 3W94A 2W3IA 2EC9H 1GCDA 1HAYB 3GDSA 4I8HA 1TB6H 2QGRA 3FFGA 4OM9A 1T32A 2RDLA 1EOLA 3KQEA 4LZ4B 3PTBA 2P3UB 1NTPA 1ETRH 2VINA 2J38A 1CA8B 2D26C 5DP5A 1EX3A 2RA0A 4CHAC 8GCHG 1KXDA 2GZ8A 1UJ1A 3OAAD 3UFAA 1IQMA 1GI3A 2AGGX 3BTEE 3SGAE 2W6ID 1GI8B 1H8ED 2W7UA 4NSYA 2SGEE 1BUIA 1GI9B 4INHA 1SLXB 5EOKA 1P04A 1UK4A 3WW7A 3OYPA 2OQ5A 2FTLE 1VITF 2GP9B 1RIWB 3RP2A 2PHBA 1SSXA 3SNAA 3FN8A 3SJ9A 4K60A 2FI5E 2ZDKA 1XUHA 1DWBH 3PV5A 1MUEB 1TNLA 4OS5A 3QZRA 1E36B 2ZA5A 3LONA 4NA8A 3PMAB 1V2KT 1G32B 1SGTA 1AN1E 4AG1A 2Z3EA 1GVKB 2ZU4A 1TX6A 3BTME 1AFQC 1CE5A 2CN0H 2ZCHP 2ODQA 2PW8H 1UMAH 1ZHRA 3U8OH 5J4SA 5FXLA 1TBZH 1AKSB 3BIVH 1ESAA 2GT8A 2BY7X 1GI0A 1A2CH 5HM9A 3HKIB 2ZGJA 4NSVA 2W6JD 4CREA 1QB6A 1QB1A 1V2ST 2CF8H 3O8DA 3KN2A 1Z6EA 1WXRA 3NRLA 2GMTB 3ZYDA 4P02A 4F49A 1SLVB 3U69H 4FUCA 2BMGB 1SQTA 1YBWA 2XCNA 1XXFA 2F83A 4LOYH 2BVRH 3ELAH 2BTCE 3RXLA 1TALA 1YCPH 2XBXA 4NIWA 2HVYB 4MG3A 1S6FA 1C2IA 5EJ1A 3VGCB 2BLWA 1ZGIA 4B74A 4B6FA 5HM2A 5K0HA 3M5NA 1P12E 1JRTA 5T6FA 1OWEA 3TK6A 3DSGA 2QF3A 4RKJB 1GL1A 1DWDH 2ZQ2A 3SNBA 2XXLA 5L2YH 1AHTH 3FP7E 1KDQA 1V2PT 3ZVEA 1NRPH 1LO6A 1TGTA 1J9CH 3M7UA 3L33A 4E7RG 4X1RU 4XD7D 1DWCH 1TNKA 1O2YA 5CHAC 1GBAA 1SFQB 3TNTA 6CHAC 3P70B 2V3MA 3VXFH 2P59A 6GCHF 2FPZA 4JK5A 5EPNA 1HAHH 1ZZZA 2ODPA 2FODA 2A5IA 2ZI2H 4DIHH 4WJG2 1UTNA 9LPRA 1W0JD 2QIQA 3D65E 4UE7H 4I8KA 1GBDA 2J5UA 4DURA 1N8OC 1P06A 2L6OA 4JK6A 1K2I1 1EATA 2WV4A 2ZDLA 1VR1H 8KME2 3ITIA 3F2HA 1EFRD 3NPSA 2ZGBH 4ZKOU 2P8OC 2BVXH 2IPQX 1XXDA 3DSOA 1KIGH 2J2UA 1ZMLA 2OD3B 2IN2A 1QNJA 1BRCE 2UWOA 1D6WA 1P11E 1HAZB 2GGVB 3UNSA 3LGUA 1FY1A 1QJ6B 1ZGVA 3OX7U 2AMQA 3RM0H 4I32A 1GBHA 1UCYE 3BSQA 4E06H 2B9LA 5B6OA 5LPRA 2V7QD 1Q3XA 4NFEA 5EGMA 1O2MA 1BA8B 1BMAA 2STBE 4GCHF 3ZVDA 1UHBA 2I6SA 1ZMNA 4JZ1A 3F9HA 2JDID 2SGAA 2ASUB 7LPRA 1S5SA 2NU0E 1TNJA 3ODFA 1AUJA 3RMOH 2OLGA 3GOVB 2KCPA 5GJ4B 4F48B 4O03A 1AWFH 1BBRH 3RXDA 1BRAA 3UY9A 3ZZ5A 3D23A 3BTDE 5AFYH 2VWNA 2F9PA 4ZCNA 2HNTE 2SGPE 1F5LA 4H6TA 3E91A 5E0HA 1GJAB 2SGDE 1Y8TA 1ZSJA 2ZQ1A 3A7YA 2BXUH 4MNXA 1AWHB 2VWOA 2TRMA 2OINA 2O8WA 1HAGE 2LP6A 5GNDA 4E7NA 4NIXA 2J98B 1V2UT 2GT7A 1H8DH 1QRZA 3SNCA 1O2SA 1VKYA 1ELCA 2IJOB 2BLQA 1TMTH 1GMDG 4BXSA 1SOTA 1YGCH 2G51A 2Y6TA 3UNQA 1G3DA 3SUEA 1FN8A 2ZFTA 3LGVA 4ZKRU 2PKSB 1MQ5A 1P9UA 1YPHE 1LPGB 1XKAC 1MZDA 1P01A 1MKWK 3UWJH 5AFZH 3S69A 1Q31A 3ATIA 1GHWH 1MBMA 1FY4A 4AB8A 5DO4H 4I8JA 1DUEA 8GCHF 3M61U 1TNIA 3S9CA 4B2BA 1YPJH 2HNTC 5AHGH 5FCRA 3SV2H 4WY3A 5F8TA 2GDEH 1FY8E 1A5IA 4CHAB 2SGQE 1K1IA 1MZAA 4ACBA 2G00A 1KLTA 1EB1H 2HALA 3M3SA 3SU3A 4HG6A 3LGTA 3SU0A 1EJAA 2YOLA 1C1OA 1T8MA 1PYTD 1QZ8A 3F3BA 2ZDVH 4GAWA 3MOCA 5DSFA 3UQVA 3GCHB 2H9EH 4B75A 1ZR0A 3KGPA 4CR5A 1E38B 1XX9A 1EJMA 5FPSA 1DPOA 1TGSZ 3MU4A 2WHXA 1TPPA 3SQEE 1O2RA 1FIZA 5TCAA 5ABWA 5J4QA 3DD2H 1G36A 1DANH 3JZ2B 3E1XB 1CT4E 1GDNA 2H9TH 4BAKB 4H42U 1RTLA 2FIRH 4NZLA 5C1YA 2V0BA 2BOHB 1O3MA 3F68H 1GG6B 1FI8A 2Y5FA 1KXCA 4KTUA 4DT7B 1D4PB 1D9IA 4A1VA 1BMLA 1UTLM 2Y5GA 3N7EA 2BYAX 2K1QA 3A86A 4Y79A 4M7GA 1TYNA 1ZJKA 2P16A 1O3AA 2P3TB 3MO9A 1C5NH 2JH6D 3OFND 1AZ8A 2ODYB 3VG8A 4UONA 1CT0E 4Y7AA 1C5MD 5EODA 2F9UA 4XFQA 4D7FA 2G8TA 4BAHB 1O2GH 2WYGA 5EXLA 4CRCA 3L6PA 1SGFA 2B7DH 2Y5HA 5DP6A 4ESTE 1GMCG 2ZFQH 4R0IA 3T2NA 1HJAB 1B0EA 3DFLA 2BD7A 2Y80A 3B23B 5JYIA 1BOQA 1KXEA 2BHGA 1IQHA 2WYJA 1OWHA 2Z6BD 1O3CA 2FOAA 3NWUA 1GI4A 3LH1A 5F6MA 2XCFA 3BTGE 1O5BB 4AGJA 1TOCB 4I8LA 4X2WA 3OTJE 1DX5M 2WINI 3AASA 1O2OA 2GVFA 1WQVH 2AGIX 3SORA 1V2QT 1SGEE 2FS9A 1BMFD 1FNIA 1P2JA 2JH5D 2WPDD 1ZOMA 1O5FH 3TGJE 1O2WA 1J14A 3QWCH 2Z3CA 2A7CA 1XM1A 1SGYE 4NFFA 1EUFA 3BEIB 5ESBA 1MH0A 3LOXA 1O3FA 3ESTA 1ZPZA 1Q2WA 1Y3UA 2R3YA 3PWBA 1IQFA 2J92A 1GJ5H 4BOHA 1FY5A 1BTYA 1EAWA 2FWWA 2D2DA 2GD4B 1DLKB 3MQKC 3ZVAA 4YLUA 3ZZ9A 1H8IH 1O2LA 1J16A 1PQ5A 2OBQA 1L1GA 2PSYA 1JMOH 2GX4A 3U9AH 2VIVA 4BAQB 3BTFE 1O39A 1GI2A 1OP8A 4ZROA 3ZV8A 2QY0B 1O3BA 4TPIZ 2FOCA 3RXEA 3GY8A 4UD9H 6ESTA 1GJ8B 1AE5A 1E37B 1QR3E 1GMCF 3RXRA 3SU1A 1O5CB 2LPRA 2TGPZ 2QXIA 4IMQA 2LELA 1EZQA 1TNHA 1Y59T 2ZHDA 3MFJA 1O3IA 1UTQA 4TY7A 2ZGCA 3K65B 1ARBA 3UPEA 3EA9A 2HWLB 1SGCA 4NWKA 3AK5A 1BT7A 1QGFA 1H4WA 2JJ1D 1VCQA 3G01A 2AYWA 1JBUH 3DT0H 1ESTA 5TCCA 1GBJA 4GHTA 1FAKH 3RLYH 2ZHWH 2FI4E 3SO3A 5LPFA 4Q7XA 1QURH 3RXHA 3F9GA 1NT1A 5A0CA 5ESTE 1BTWA 2CHAC 4I33A 5HGGA 5CE1A 4X2XA 1FXYA 1W0KD 6CHAB 3MU0A 1QIXB 3E8LA 2OXSA 1EAUA 1O2VA 3T27A 2BQ6B 4INKA 1FN6A 3FO8D 5JBBS 4JMYA 2ZTXA 2AFQB 1E0FD 1GDUA 4XBBA 4Q63A 3ZZ7A 1NU7B 4R8TB 3KIDU 3LU9B 2PTCE 3TK9A 6LPRA 4AYVB 4NGAH 3K6ZA 1GDQA 2GDDA 1G9IE 2A4QA 2DE8A 9ESTA 4NIVA 2PGBB 3NK8A 4BTTB 1ARCA 1MKXK 2ZDNA 5AVDA 3ZZ3A 4ABIA 2FS8A 4MDSA 1W2KH 3PLKA 4IC6A 4DOQA 4BANB 2C90B 4HFPB 3FZDA 1SL3A 3I78A 5A0BA 2PR3A 4ABEA 3F2FA 4YO9A 4DGJA 3DA9B 3A85A 1O3HA 2GTBA 5DP8A 2JKHA 4FU9A 1KXFA 2BB4A 1SGIB 4BAOB 3N99A 2VWMA 1T4VH 1GJ7B 2L74A 4FVBA 2AEIH 1TLDA 5C20A 3FAOA 4YOGA 3GDVA 1AU8A 1GCTC 2ZGHA 3QGJA 3SBKA 1UO6A 3V3MA 2BLVA 4J1YA 1AB9C 1O3NA 1ELFA 2THFB 3C27B 3ATLA 3GY7A 2XYAA 1XUIA 1UK3A 1G30B 5DGJA 1EASA 2YMSB 3RUOA 3VXEH 2G4UA 3TPIZ 4D9QA 1K1MA 2BOKA 1C2KA 3VB5A 1DDJA 2ZFRH 3JZ1B 2A5AA 5EQRA 1T8OA 1PPCE 1Y3VA 1D3TB 1Z8GA 3EA8A 4DG4A 1TMBH 3ZVFA 4YM9A 5DP4A 2VIPA 2YMSC 1W8BH 2H6MA 5JBAS 3RLWH 1Z1IA 2AH4X 1P57B 4NIYA 3STJA 5A0AE 2FLBH 3IITA 1HRTH 1C2JA 1EOJA 3PROA 4Y8YA 1V2RT 2A4OA 4FU8A 3ATKA 4X1SU 5T6GA 4ACAA 4B73A 1CA0B 4MPWA 4MTBA 2SGFE 1S83A 1SGRE 1WOFA 3URDA 4BTIB 1BMNH 1QBOA 4OS4A 3SHCH 1HAPH 1FJSA 2P94A 3DHKH 1DLEA 3SJIA 1PQ8A 2FOEA 1HGTH 1O2QA 3AAVA 1XUJA 2OCVB 3PRBA 1ANDA 1DICA 3VFEA 2GV7A 5FBEA
chains in the Genus database with same CATH topology
1CT2E 2ZHQH 3ZV9A 3QZQA 1GBFA 3S9AA 2UWPA 1FMGA 5BPEA 2OTVA 2QV1A 3AW0A 2XC4A 4ZMAH 2BD9A 1C2DA 1QL7A 1CBWB 3SUGA 1QA0A 3BN9A 1CGIE 3O8CA 5C1UA 4O97A 3U8TH 1P2OA 4IW4E 1NRSH 1W7XH 2AMDA 3LKWA 4TY6A 1ANBA 1YF4A 1NROH 2G5VA 4LZ1H 1ACBE 1WTHD 1C9PA 1C5RA 3MH4A 1ZHPA 3ZZAA 1DT2A 3SV9A 3GCHC 4CRAA 1YPGH 1O5DH 3V13A 3B9FH 1O3GA 4GSOA 1KDQB 4YT6H 2FDAA 1UTJA 2WUBA 2BY8X 2EEKA 1TMUH 5F8XA 1EZSC 3LDXH 5EG4A 4ZKSU 1THSH 3VB7A 4A1TA 1QL8A 4X6NA 1IAUA 4BXWA 3TK5A 1S0RA 2A7HA 5EXMA 3STIA 2PTNA 4ISLA 1W10U 1OSSA 4ABBA 3W95A 2FESH 2RA3A 3BTQE 1Z8RA 1WCZA 2PGQB 1HAXB 1GJCB 2GV6A 3MMGA 1TPOA 4CRBA 4U2WA 1MU8B 1BTZA 3RXOA 1RTFB 1PYTC 1S85A 1V2JT 4AB9A 1RRKA 1Y3WA 3MNXA 5JB9S 1TONA 1K22H 2F3CE 1UCYK 1O3DA 1GHXH 4X6MA 5FBIA 2XNIA 1TRNA 2SFAA 2HGTH 4AFQA 4AGKA 1K1OA 3RU4E 3UNRA 2J9NA 1MTNC 1QRXA 3P8NA 3VPKA 1IQGA 1HJAC 3SW2B 2TIOA 4MQAA 2FI3E 2BD2A 4Y8ZA 1YP9A 3A7WA 4INLA 3SQHE 1ABJH 1BHXB 1AD8H 2O8UA 3UQOA 1C5PA 3VB4A 1UHBB 1TOMH 1O3KA 2BY5X 1LHEH 1HDTH 3CP7A 3V12A 2ZP0H 5DP3A 2ZDMA 1O3JA 3MNCA 4Z6AH 1RFNA 2FZZA 1VCWA 2AGEX 4WXVA 3MH5A 4FUJA 2ZKSA 1KXAA 3RC5A 4I31A 1HXEH 2ZECA 2DUCA 2STAE 2VGCC 3P17H 1AMHA 1NO9H 2A31A 1MQ6A 4ISNA 1K1NA 2FTMA 4D8NA 2FMJA 4I8GA 3SHAH 2ZG0H 1W0ZU 2GZ9A 1EPTB 1ZTKA 1HYLA 1W14U 1TA2A 2NU3E 1SGNE 1LVYA 2GCTB 1MCTA 1DOJA 2C8YB 4VGCC 1EPTC 2TGTA 3BV9B 2J4IA 4AFUA 2XW9A 2VIDA 4FUFA 3ZZ4A 3QDZB 2A0QB 2BDYA 2FYQA 3FP8E 4VGCB 2HVXA 1IHSH 3P8OA 3SOSA 1O2KA 1NM6A 3L3TA 1CO7E 3ZZBA 5CMXH 3E90B 1X7AC 2Z3DA 3PMBB 1C5SA 1K1LA 4Q2KA 4A92A 4K69A 7GCHF 3E3TA 1C1PA 1P10A 1LDTT 4AYYB 3CS0A 1OX1A 1AVWA 1O3OA 1YYY1 5FPYA 3A7XA 3AVZA 3Q3XA 2PUQH 1D3DB 1GHYH 1YC0A 4DJZB 3GICB 2IOTA 1P02A 2DE9A 1GJ4H 2V35A 1WYKA 2QXGA 3C1KA 4B2AA 4KELA 2A32A 1FY3A 1SQOA 4Y11E 1O35A 3KF2A 1HCGA 4UFEH 2F9OA 8ESTE 2ZFPH 4U01A 1O34A 1ANEA 3UOPA 3A89A 2BDAA 2XC5A 2HLCA 1P3EA 5BRRE 5JB8S 3MU1A 3ZVGA 1C1WH 3TU7H 2WPKS 1BMMH 1HAVB 1TAWA 3UR9A 4YOJA 1FQ3A 1C4Y2 2AIPA 1T8NA 3UIRA 1MKWH 4NA9H 1SHHB 2Q1JA 3TH3H 4X8TH 2VNTA 5GCHG 2GKVE 1NRRH 5L2ZH 2SNWA 1A1RA 4FUDA 4WMDA 1GJBB 1THPB 1QBNA 4K8BA 1CHOG 1ZLRA 2H9HA 1GG6C 1AI8H 4F4OC 1ANCA 1QTFA 5FHTA 3TGIE 3M36A 4FVDA 4THNH 2A1DB 2Z9LA 3K6YA 5A09A 3F9FA 7GCHG 3OSYA 1ZMJA 4CBNA 3D62A 1IQEA 1NN6A 3Q3KA 2VH6A 3MNBA 1KTSB 1XVOA 2G5NA 4IC5A 1TBQH 2ZFSA 2A7JA 1AB9B 1P2QA 2AIQA 2JH0D 3ZVBA 1ELDE 2QCYA 3LGWA 1TGBA 1S0QA 3N7OA 2QXHA 3QLPH 1IQLA 3WY8A 4B76A 1V2MT 3D49H 1MTSA 2F9VA 1FDPA 4YESB 1CHGA 1YM0A 2ZDAH 1NU9A 3P92A 1C5XB 2XC0A 4UFGH 4LXBH 5DP7A 1G37A 5A2MH 3GCTG 1W11U 1C9TA 5IDKA 3KNXA 4ABAA 1CA0C 2Z9KA 2CMYA 4BAMB 5LGOA 2ALPA 1BITA 1NC6A 2BDCA 1YKTA 3QTVH 1GVZA 1A7SA 1QFKH 1S81A 3UOUA 1IQNA 1SPJA 2OBOA 3KEEA 3U1IB 3SU4A 1A0LA 1C2HA 3M7TA 1QL9A 1TQ7B 3RXFA 2QA9E 3NCLA 4JZIA 4JZEH 2VH0A 2OC1A 1A0HB 1FAXA 2ZCLP 2UUYA 3HKJB 1Y5AT 4K8YA 2GMTC 4OS1A 2A2XH 4AFSA 2Q6DA 1AE8H 5LPEA 2V6NA 1ORFA 1WV7H 2M5TA 1BDAA 3FVFB 4O9VA 1GBTA 1O36A 1OWJA 2ULLA 1C2LA 1O30A 3RM2H 2RG3A 1Y5BT 1BQYA 4H4FA 3PLPA 5SGAE 1AVGH 5PTPA 2FX6A 1TGCA 3FZZA 4SGBE 2O8LA 3VGCC 1HB0B 2FM2A 1IHTH 1F0UA 3LPRA 8LPRA 3A8CA 3AAUA 2BDBA 3PTNA 1DSUA 1K28D 1PJPA 2P8OB 3A88A 3SNDA 1XUFA 3B8JA 3ODDA 4XDEA 1J15A 3TLOA 3GY4A 3LJJA 4A7IB 2VIWA 4YT7H 1LHCH 1ZYOA 4ASHA 3EAJA 1JIRA 2BY6X 2VB0A 1BTHH 1Z1JA 1O33A 1GGDB 1TWXB 1W0YH 5C5NA 1GWAA 1K1JA 1P09A 1F2SE 1RJXB 1BTUA 1SFIA 3EDXB 1DWEH 3RMNH 3GCOA 1L1NA 4X0WU 4IMZA 1D3PB 1AQ7A 3PLBA 3V0XA 3R3GB 3A83A 2W7SA 3TJOA 5EQQA 1HBTH 2CHAB 1QJ1B 4K1TA 5JBCS 1SQAA 2BDGA 1SGPE 1E35B 5E8EH 3TIUA 1O2NA 2ZIQH 3Q00A 4Y71A 1C1SA 1A46H 5T6DA 3MO6A 2ZTYA 1JOUB 5C3NA 1IQIA 1CQQA 1W13U 2UUFB 2HPPH 1Z6JH 3LT3A 2WPHS 1P03A 2UUKB 5EQSA 2H1UA 3RC4A 4NCYA 1P2NA 3HGPA 1HUTH 4ZHAA 4YZUA 1C4U2 1BHXF 1V2OT 4X8VH 2G81E 4MNVA 1P2KA 3LGYA 1BRBE 2KAIA 1KXBA 2GZ7A 1UTMA 1A5GH 1UTPA 2R2WU 3BEFB 2BQWB 1YPKH 1MBQA 1UVSH 4Y76A 5EW1H 5HXFA 3SZNA 2OC7A 1JRSA 2GCHF 3MTYA 2WPLS 2XWAA 3RXUA 5L30H 2BZ6H 3KCGH 5A8YA 1TX8A 2B8OH 2VVVA 3S7KB 4AX9H 3QX5H 3HK3B 4LK4A 4DVAU 1WUNH 2JETB 3S7HB 1A5HA 2ZPQA 4O3TA 3SN8A 2QAAA 1AGJA 4JZFH 4JYVH 4K5ZA 2OC8A 1ZPCA 3QUMP 4IGDA 4HZHA 3SI3H 1O3LA 4NZQA 4X1PU 1FZZA 2CGAA 4J2YB 1GBEA 4Z0KA 5GCHF 1P2IA 4HGCA 1O2UA 2C8ZB 3R0FA 2OUAA 1BBRE 2PWXA 1QQ4A 7ESTE 1RXPA 1NESE 1QCPA 4FUHA 1O38A 4MPUA 1GHVH 1QBVH 4WXIA 4CRDA 3RDZA 1MAXA 1GJDB 1LMWB 1O0DH 4GHQA 5GDSH 1EZXC 4Q80A 4X2YA 5LH8A 3E0NB 4OGXA 3BTHE 2ZWLH 1V2LT 2O9QA 3EGKH 1DY8A 1C2EA 2ZU1A 1F5RA 2QC2A 3RXCA 3RMMH 1KLJH 4AG2A 1N6XA 4XOJA 2I6QA 4A5TS 4KTSA 3A87A 1ELVA 1L2EA 3HK6B 2Z7FE 3P6ZB 2ZZUH 1GI5A 1O5AB 2ZTZA 1G2MA 2TBSA 1XUKA 2Y7ZA 1LCYA 3TJVA 1RGQA 4OS7A 4RKOB 1ELTA 2OQUA 4KKDA 1K21H 4AN7A 1IQKA 1O5EH 2EI6A 4RSPA 1KSNA 2JETC 1H9IE 3LC5A 1ZHMA 3H7OA 4X6OA 2AMPA 5EW2H 2A5KA 1B0FA 2VVCA 1T8LA 1QA7A 1C1MA 1NRQH 4D9RA 1RD3B 1S6HA 3TITA 3E6PH 3RC6A 1A61H 2W5EA 2FEQH 3EA7A 5GIBA 3ZZ8A 4GUXA 4ZH8A 1BRUP 4DIIH 4CBOA 2NU2E 2VIQA 4IBLH 3GCNA 4UFDH 3PMHB 1O3EA 2WPIS 1GBLA 4FUGA 1YPLH 1UVPA 3MYWA 4WH8A 1OKXA 1F0RA 1YCPM 1Y3XA 3T5FH 1OP0A 4WF8A 3EE0B 1LVMA 3BG8A 1HXFH 2BD3A 4UDWH 3CS7A 4Y0ZE 3RMLH 1GBCA 3NUMA 1FPHH 1FPCH 1B7XB 1HV7A 2J34A 1AIXH 3LC3A 2W26A 1TA6A 2ZPRA 1MMJN 4HI3A 3ZZDA 2BX4A 1GJ9B 4ZUHA 4PROA 1GBIA 1V2WT 4FXGH 1K1PA 4ABFA 3E16B 3MU8A 4KTCA 4Y10E 1VITH 1G3BA 4MVNA 2Z9JA 3PB1E 1EAIA 2G52A 1V3XA 2PKSC 4AFZA 3HGNA 4SGAE 1QJ7B 1OOKB 1DSTA 2PUXB 1DY9A 3LH3A 3OY5U 3ZZ6A 2FOMB 1WBGB 1P8VC 1EQ9A 1PPEE 2ZFFH 1SC8U 3A80A 3RXPA 3TJUA 1LPKB 2CF9H 3MO3A 1EKBB 5GPIB 3RXVA 4K3JA 1SLWB 1GJ6A 4ISOA 4ZHMU 1VITG 1DXPA 2CXVA 3LGIA 3TH4H 1OS8A 1F92A 1Y3YA 1HJ9A 1G2LA 1XUGA 2ZHFH 5C5OA 3UUZA 3ZVCA 1C1QA 1V2NT 4FU7A 4DY7B 1A3BH 1MTWA 1YLDA 1LTOA 3PYHA 1NRNH 3SU2A 4ZHLU 5A8ZA 1C5ZB 4TWWA 3SU6A 2XBWA 5JDUB 1YPMH 1LHGH 1GI6A 3E0PB 1C2MA 1C5LH 1GGDC 4JZDH 1OWKA 3A8AA 1RS0A 3V7TA 1QQUA 3SGQE 2ESTE 1P2MA 4UFFH 1CHOF 1O2JA 1TIOA 3LIWA 2ALVA 1C1NA 1HAVA 1NS3A 5AF9H 2FYRA 3FP6E 1O2XA 3RXGA 1BJVA 3A82A 4XBCA 2FX4A 5DG6A 1KTTB 1EB2A 4OGYA 1TE0A 5ETXA 1MAYA 1BB0B 5EXNA 4ISIH 3K9XB 3OU0A 2A4RA 4MPXA 5EU8A 2FOHA 2R0KA 5L6NH 1EXFA 2GCTC 1EZUC 4B2CA 5FCKA 2CJIA 3VB6A 4DW2U 1T31A 2WPJS 2EA3A 1Z8JB 2Y82A 3UTUH 2F9NA 1C1UH 2XBVA 4IN1A 2C93B 3BTWE 1W12U 2VU8E 4XSKU 4X8SH 1BIOA 2Q6GA 3RXAA 1ETTH 4ABDA 3O8RA 4DCDA 1E34B 1NY22 3M5OA 3TH2H 1W7GH 3TJNA 2OC0A 2ZPSA 4CRGA 3QGNB 1KY9A 3RU4D 3T26A 4ZKNU 3SUFA 3GY2A 1YLCA 1V2TT 1BZXE 4I7YH 4D7GA 4MNWA 3S0NA 5G4BA 1GHBF 3Q3YA 3PWCA 1HAIH 1RTKA 4XBDA 1JXPA 3T28A 4JCNA 3URCA 2ZEBA 1ZRKA 1F5KU 3KQCA 3LJOA 3NZIA 1C4V2 3BG4C 2WPMS 4MLFB 1NFYA 3H7TA 1HAOH 1ZSLA 1P9SA 5CHAB 3GYMA 1IQJA 1OYTH 4ZAEA 3HATH 3DFJA 1DS2E 4K1SA 5T3HA 1DUAA 1GI1A 1C2FA 3GY5A 4CH8B 5FX6A 3VEQB 3A81A 1JIMA 2V3OH 2XRCA 2FP7B 2BD5A 2HRVA 4GCHG 3VB3A 2FOBA 3EQ0H 2VWLA 1ZPBA 3MH6A 1NPMA 1GMHG 1OXGA 1F0TA 1SGDE 2C4FH 1NFXA 5K7RA 1DE7H 3M3TA 1O2IA 5FAHA 3QN7A 1GHAG 3S9BA 1EP6A 3SV8A 3A84A 1XKBC 2C8XB 2IPHA 3GY3A 1AVXA 3A7TA 2W3KA 1C5VA 1CGHA 1M9UA 1L4ZA 4MNYA 1IOEA 1A0JA 1DM4B 1LVBA 1YPEH 3KQBA 3U8RH 1PPFE 5DP9A 2ZF0H 2D1JA 1GBMA 1C5TA 5HMAA 2G4TA 1VCPA 1SHYA 2H5CA 4X6PA 1ELBA 4OS6A 1U6QA 1PQAA 4Q7YA 2A4GA 1DITH 3A8DA 1O5GH 1LQDB 3ATWA 1LKAA 2BDHA 2G55A 2ZU2A 3TNSA 4ABJA 5DJ7A 2QYIA 2FOFA 2UUJB 2YNBA 3M35A 3F9EA 3MWIU 2CV3A 5FPTA 3SV6A 1HIAA 1V6DA 5I46H 1GI7B 2ZC9H 4TWYA 1FIWA 4D76A 3SNEA 4ZXYH 1W3CA 1C5YB 3P95A 4Q7ZA 1H1BA 4K1EA 2PV9B 3NKKA 1G3CA 2AERH 3ATMA 3IG6B 4ABGA 1XVMA 5DPAA 3SV7A 5E2PA 1C2GA 3PMJA 1TABE 1INCA 3GISB 4FUIA 3RXIA 1GBBA 1EJNA 4Y0YE 1DFPA 4U32A 2UWLA 1WQSA 2HOBA 3T62A 1DXWA 3PO1C 5FX5A 2NU1E 5JPMH 1NZQH 5I25A 1SGQE 1SB1H 1Y5UT 2ANKH 1OPHB 3GDUA 1G3EA 2EI8A 2ZNKH 2B5TB 3SGBE 2GCHG 2KAIB 1PPZA 2P3FH 2XTTB 1PPBH 4Y6DA 1FUJA 1F7ZA 1ZSKA 4NG9H 2A2QH 2NU4E 1TNGA 1P05A 1SGFG 1LPZB 3T29A 1UVTH 1S84A 1TGNA 1ID5H 3F1SB 3M7QA 2BVSH 4X2VA 1TX7A 4WMEA 1ZRBA 3SI4H 5F8ZA 1L4DA 2QN5T 1GL0E 3GCTF 1SG8B 1TRMA 1FLEE 3RXJA 2HPQH 5E0JA 5E2OA 4E05H 3Q76A