5JBTA

Mesotrypsin in complex with cleaved amyloid precursor like protein 2 inhibitor (aplp2)
Total Genus 59
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
59
sequence length
224
structure length
224
Chain Sequence
IVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTAPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDAGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords PRSS3 protein
publication title An Acrobatic Substrate Metamorphosis Reveals a Requirement for Substrate Conformational Dynamics in Trypsin Proteolysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 59
structure length 224
sequence length 224
ec nomenclature ec 3.4.21.4: Trypsin.
pdb deposition date 2016-04-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00089 Trypsin Trypsin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5jbtA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 5jbtA02
4JK5A 2UWPA 2ZU2A 4OS6A 4YLUA 4CRDA 1AY6H 4O9VA 4ABJA 1QTFA 1AUJA 2WPMS 1BBRH 2IN2A 1SGIB 5EQRA 4AG2A 5JB8S 2PHBA 2THFB 4NIYA 3TNTA 1K2I1 1NO9H 1A4WH 1BMMH 4TPYA 1IQFA 1GBTA 3EE0B 3O8CA 1O34A 4WMEA 1TPOA 1L2EA 2QY0B 1GJAB 5C1YA 1P12E 1JWTA 4BOHA 8GCHF 4UEHH 5FPSA 4I7YH 1AFQC 3GY7A 1V2MT 3LH1A 2FODA 1S84A 3A85A 1GBIA 1EAUA 2OC8A 2KAIB 2VGCB 5DP9A 1AWFH 4CR9A 3TU7H 1O0DH 4CH8B 2ZNKH 4ZMAH 1EX3A 1TX7A 5EXLA 3P8OA 4MPWA 1AUTC 1BBRE 5C2ZA 1SL3A 3UNRA 4Z0KA 2ZGJA 1HV7A 1S85A 3KCGH 4WH8A 3R0FA 2SGPE 1XUFA 2ZG0H 5A2MH 4B2BA 2BY9X 4K60A 4E7RG 1DLKB 1C1PA 5IDKA 2ZPRA 4Y8ZA 7LPRA 3QK1A 3MNSA 1C5RA 3ATIA 4B75A 1OYTH 2O8MA 2XW9A 1QCPA 2STBE 4XFQA 1DY9A 1F2SE 1W3CA 4TY7A 4K1TA 3CP7A 2AGEX 3V3MA 1WQVH 2QF0A 4FVDA 5F03A 3FZZA 1TOMH 2XBXA 2BQWB 1THSH 2SGDE 2BD7A 2P8OC 3M7UA 1Y5AT 3A81A 2ZFTA 2ZDKA 1CBWC 1U6QA 2D2DA 1BDAA 5GCHG 4BTIB 3GDSA 1OKXA 3RU4T 1C2FA 3O8BA 2ZECA 3T5FH 1GG6B 1V2RT 2Q6GA 2AH4X 3LU9B 1RS0A 2VWNA 2ZDMA 1TBQH 1ETRH 1RTKA 1QIXB 1UO6A 4ABIA 1C1RA 3PWCA 1MU6B 2Z9GA 1H9IE 1TMBH 1B5GH 2Z94A 2FLRH 2P3TB 5C20A 1J16A 2CHAB 5I46H 6ESTA 1MKXH 1LMWB 2HRVA 3ZZAA 4YTAA 2FM2A 3TGJE 1D3DB 2Q6DA 1GMDG 5EOKA 5ESTE 4ISOA 1GBBA 4NA8A 1BRAA 4XBBA 4XSKU 1OX1A 4INLA 3KQBA 1V6DA 1SG8B 4MLFB 2AGIX 1D3QB 1Z8IB 2PFEA 3A82A 3VFEA 1ZMJA 2FOEA 1NS3A 1SGQE 2C3SA 1P09A 4HZHA 5LH8A 3V0XA 4DT7B 3A8BA 1FN8A 4LZ4B 3AW0A 1AFQB 2OINA 4NZQA 3GCHC 2PSYA 4ESTE 1GJBB 3GY5A 1Y59T 1OP0A 2OC0A 3UY9A 4FUDA 2C8WB 3TH2H 5L6NH 2IPHA 2BY7X 2ZHDA 3C1KA 2VVUA 1NC6A 2EC9H 2FOFA 1XVOA 1B7XB 5LPEA 1WYKA 4THNH 1V2ST 1O35A 4H4FA 4FU9A 1V2VT 3GY4A 1WOFA 2BVRH 5HM9A 1D3TB 1ZSLA 4D7GA 2FIRH 3SO3A 1MAYA 4WMFA 2P95A 1ABJH 1GI2A 2ANMH 1GL1A 1GBLA 5DKMA 1BJVA 1TYNA 1V2KT 3QZRA 3RMNH 1C2JA 3SU0A 1TGSZ 2QXIA 3DA9B 3U1IB 3A8AA 1N6YA 3U8OH 3RXQA 1NT1A 2H2ZA 4BAKB 2P8OB 1ZLRA 1ZPZA 1EZSC 2ZGCA 1CBWB 1G3DA 2UWOA 3EA9A 1UVOA 1C5PA 3SHCH 4WY3A 1SSXA 1P3EA 2GKVE 3NXPA 2OQUA 2W3IA 4Y7BA 1BJUA 4BTTB 1GI5A 3FZDA 1ZPBA 4K69A 2XRCA 3FVFB 4HI3A 1EP5A 1QRZA 5H4IB 1NTPA 2J38A 2VJ1A 3SNEA 5DPAA 3U9AH 2BLWA 3V13A 1SOZA 1Y5BT 4DIHH 1FDPA 4H42U 2BXUH 3MYWA 3M7QA 1O39A 4I32A 2RDLA 1WUNH 3MI4A 5PTPA 1HXFH 3UREA 1E36B 1MQ6A 2BLOA 1PFXC 1XVMA 1KDQB 4FUGA 3STIA 2VH0A 1V2UT 1QL8A 1Y3WA 2PUXB 2VVCA 4GLYA 3RC6A 3LGUA 1ARCA 1KLIH 1KIGH 1V2TT 3ZVEA 5HMAA 4KELA 2BDYA 3D23A 1D6WA 1AD8H 2SFAA 2QAAA 1K28D 1OWDA 3A8DA 2BTCE 4BXWA 1SHYA 4CRFA 4X6PA 1EB2A 3GCHB 3KIDU 2PV9B 2Q1JA 1Z6EA 4X6OA 1Y5UT 2A4RA 1J8AA 3I78A 1CHGA 1DWEH 2CF9H 4GHQA 4DY7B 4TWWA 4H6SB 4MDSA 2D1JA 1L0ZA 2WPLS 3SUGA 4XBCA 1S81A 1HAHH 2F9UA 3A86A 2TIOA 3ZVDA 1SB1H 1ZHMA 2YNBA 2BD9A 4B76A 3SJ9A 3CS7A 1IQKA 4YM9A 1QQ4A 1SGFG 3PWBA 1DM4B 4A7IB 2B9LA 2PGBB 3SU2A 4DGJA 4UFFH 2SNVA 1FQ3A 3RP2A 3RU4E 3E0PB 4CHAB 1C1OA 1PQ5A 1PQ7A 8GCHG 1FN6A 3SNAA 5C1UA 5EPNA 3E90B 5SGAE 5GCHF 2ANYA 3BIVH 1MCTA 3H5CB 3IITA 2FYQA 4FVBA 1BITA 1H8DH 2TGDA 1QJ6B 1HAOH 1EKBB 4YOJA 1S0QA 1F92A 3ESTA 1LTOA 2GMTC 3TJOA 4DVAU 5DG6A 1GI8B 4ZHMU 1DX5M 4IMQA 4FUHA 1BRBE 1O30A 3GCNA 1AB9C 1N1LA 3FAOA 1GDNA 1SHHB 4LOYH 5ESBA 1GJ6A 4LK4A 4KTUA 1UTNA 3GY8A 2XBWA 3VXEH 3F68H 1F5RA 3MU0A 1ELDE 1A5GH 5FAHA 1GMDF 1OWKA 4UFEH 3RXRA 3RXTA 5F8TA 1LDTT 1W0YH 4ZAEA 2FI4E 4CR5A 3AW1A 1FY5A 3MO6A 1HNEE 3JZ1B 2PR3A 4UFDH 1C9TA 3Q77A 3MTYA 2A5KA 1XMNB 3RLYH 1KXBA 3BTWE 2Z6BD 1KY9A 1O5FH 4LZ1H 3T29A 5FBIA 3R3GB 1KTSB 3JZ2B 5LPFA 3BV9B 5C3NA 1C1NA 3BG4C 4FUEA 4B2CA 2FS9A 1MUEB 3UUZA 1G36A 1LVYA 4ZKRU 1MCVA 1PPEE 3M35A 1HJ8A 1O5EH 2F91A 1UTQA 4Q7XA 4YLQH 5DJ7A 1GVLA 2Y7ZA 1Z1JA 1MBMA 3BEUA 1V3XA 2QXJA 4X2WA 2YNAA 4NFFA 2DUCA 1T8LA 1Z8RA 3LPRA 3EA8A 1C5NH 1TPPA 2AYWA 1MKWH 5A8ZA 2J9NA 3RMMH 4CH2B 1HAZB 1TNHA 1ZTKA 2D8WA 1MMJN 2PTNA 4Y10E 5JDUB 2ZDLA 1LVMA 2BD8A 4O03A 4RKJB 1M9UA 4FUCA 1UK3A 4A5TS 5A8XA 4I33A 3KQEA 4U2WA 4X6MA 1HDTH 3S9CA 1DPOA 3CENA 1P04A 1QA0A 1AZ8A 3SOSA 2BQ6B 3E6PH 2ZHQH 2XC0A 3VGCB 1SC8U 2ZFRH 4B2AA 1O2LA 2AERH 3VEQB 3ATKA 3RXKA 5EGMA 1F0UA 1C2DA 1YPKH 1UJ1A 2PGQB 2SNWA 2BX3A 5TCAA 1HJAC 1GI6A 1GVZA 3U98H 1S82A 3RXGA 1GJ5H 1YPEH 4Y0ZE 1T8MA 1O3CA 1GGDB 4NA9H 1GMHG 3HK6B 1SQAA 1GWAA 2C8YB 3ZV9A 3E16B 3V12A 3T27A 1J14A 3NK8A 3MU8A 2C93B 3TPIZ 1HAPH 2AGGX 2Y5FA 4YT7H 1GL0E 2ZGHA 1NFUA 4RKOB 2TGPZ 1OSSA 3BIUH 1ZRBA 4A1VA 2P3FH 1FPHH 1NY22 2FWWA 3ZVFA 1Z8GA 1AIXH 1O2KA 4J2YB 1QB6A 1KXFA 3B8JA 5F8XA 1HRTH 3E3TA 1GBMA 1A61H 1GJ8B 3T2NA 3P8GA 2AEIH 3K9XB 4ZKNU 3UNQA 1UCYK 3PLBA 2V6NA 1CHOF 2VU8E 3UR6A 1G37A 2HNTF 2G81E 3RXVA 1W14U 2ANKH 2A7HA 1C5TA 4KGAA 1G2LA 3RXOA 2ANWA 2HOBA 2ZFPH 3V7TA 1C2LA 2QYIA 3RM2H 2WV4A 2BD5A 1IQIA 3LKWA 1YF4A 4BTUB 1AVXA 3UFAA 5JYIA 1O2XA 4ISHH 4JZEH 1P2QA 1T4UH 3BTDE 1YPGH 5JBBS 1C9PA 1C2KA 1C2GA 2HWLB 3LJOA 2ZKSA 3ZZ7A 3HATH 1EQ9A 2BY8X 4ZHLU 1DWBH 2XWAA 1O5AB 1SMFE 1ELEE 1XKAC 1YPMH 1WBGB 2J95A 2P94A 1EZUC 3Q3XA 1BTZA 5A8YA 3GY3A 1G2MA 4RSPA 3FFGA 1NU9A 3RMOH 9LPRA 3RXDA 2R2MB 1B0FA 2ZTZA 2V3HH 5L30H 2BX4A 1EAXA 4MTBA 1MTNC 1QRXA 1DANH 1J15A 1O3HA 1P10A 2NU0E 2W7UA 2GVFA 1C1SA 6CHAC 1ABIH 2BB4A 4JYUH 4K2YA 5AF9H 3QLPH 1OYQA 4M7GA 4NZLA 3LJJA 1RFNA 1ORFA 2VVVA 4H6TA 3SBKA 2FX6A 1PPGE 2O8UA 2FESH 1XXDA 3S9AA 3AASA 5J4QA 1F0TA 2J92A 1ELAA 1DVAH 4IBLH 4E7NA 1GBJA 1C5WB 1GJCB 1LHDH 1F0RA 1TE0A 3A7XA 3LH3A 5GXPA 4WF8A 6LPRA 1O2PA 1SFQB 1MTUA 3G01A 1PYTC 1FJSA 1DUAA 1HJAB 4IN1A 1T4VH 1C1UH 1BIOA 1NRRH 2ODPA 2HPPH 2ODQA 4JMYA 2BDHA 3A89A 1SLUB 1ZSJA 3K2UA 1ZTLA 2UUJB 3SU6A 1RIWB 3M37A 3S69A 3PLPA 3ZZ3A 1A0LA 5EG4A 1GCTC 3SZNA 3LIWA 1IQLA 5EXNA 3ODDA 1KDQA 1YM0A 2FOHA 5AFZH 2R3UA 2GT8A 3M7TA 1BTPA 2ZU5A 2ZFFH 3T26A 5CHAC 1RGQA 1NPMA 1QY6A 1Y3VA 2I6SA 4ISNA 9ESTA 2Z7FE 2ZU4A 3BTHE 3GYMA 3W94A 1TPSA 3WY8A 1Y8TA 1GHVH 1UTOA 4K1EA 1JRSA 4AFQA 2PWXA 1Z6JH 2ZFQH 3QO6A 3RXAA 5G4BA 1O2GH 3GY6A 3SJKA 2H9EH 2R0LA 3TIUA 5J4SA 1PQAA 2OBOA 2VWMA 2OXSA 3W95A 1N8OC 2F83A 1O37A 3FANA 1LPKB 3GOVB 1ELBA 1LPGB 3T25A 1W11U 4X0WU 1DOJA 4X2XA 1SQTA 1O3DA 1O5DH 1BUIA 2F9BH 1O5BB 1NRQH 3LGTA 3PTNA 3UTUH 4TY6A 1AKSA 1AVGH 2EI7A 1O3LA 1C1TA 5HM2A 1S6HA 1Z7KA 2V0BA 3K6YA 5HYOA 2WPIS 2Y82A 2BD2A 1HAVA 1FIWA 1SBWA 1P8VC 4CBOA 4AN7A 3GDVA 1TA6A 2PKAA 1O2WA 2G51A 3Q3YA 3P95A 3HPTB 1DS2E 1E38B 2NU2E 1TNIA 4JZDH 3GCTG 2QGRA 3EGKH 5EXMA 2RA0A 1ZGVA 4Y76A 3ATLA 4U30A 1W10U 4KTCA 5DP8A 2A2XH 1SOTA 1HAXB 5A0AE 2R0KA 3S9BA 2DE9A 1T8OA 1O32A 1AE5A 1ANEA 1OWIA 3M3SA 1S83A 1O2YA 2M5TA 4FU7A 5E0JA 3L6PA 2AS9A 2JH0D 3TJVA 1VR1H 2F9OA 2A4QA 4IN2A 3UOUA 3EA7A 2PKSC 2NU3E 4K8YA 3VPKA 1NRPH 1QRWA 3NCLA 4NGAH 2VIWA 2AIPA 4B1TA 1YLDA 3UQVA 4JYTA 1FNIA 1O3EA 3A7ZA 3RUOA 1W8BH 1GI1A 3LDXH 1DITH 3ZZ5A 1GMHF 5EW2H 1P2KA 2AFQB 7ESTE 3QTVH 2IOTA 2WV5A 1K1MA 2Z9IA 1AE8H 3ZZ6A 1HFDA 1L4DA 1F7ZA 2D26C 3ZVGA 3M36A 5C1XA 3SV2H 1QNJA 1YCPM 3MO9A 2CXVA 1N6XA 1GCTB 1P9SA 3KGPA 4MNWA 4DIIH 1KXCA 2ZCHP 1T32A 4NIXA 5I25A 1G3BA 2SGQE 1DWDH 1LHEH 1XUKA 2WUBA 3QWCH 1A3BH 1P9UA 4TYDA 2OCVB 2GT7A 3PM3A 3UWJH 2WPKS 4MVNA 2ZWLH 4JZIA 2AMQA 2HNTE 1PPBH 4GCHG 3RXUA 3RU4D 2OTVA 1S5SA 1K1PA 3LGIA 4OS1A 4DCDA 4I8JA 1EOLA 1O36A 1IAUA 2VIVA 2GX4A 2BOHB 2GCTC 1EPTC 3MH6A 1XUGA 1EJNA 1JIMA 2A32A 2QXGA 3QUMP 4DJZB 3U1JB 3HGNA 2R3YA 4B74A 2BD3A 2XNIA 3OY5U 3LGWA 5IYTA 1O33A 3ZZDA 1WTGH 1V2WT 2G4UA 1SLWB 1JMOH 1MTSA 1TGBA 1BB0B 5C67A 1HJ9A 3OTJE 1TX6A 3OU0A 1LHFH 1VCPA 2TBSA 4X1QU 3P8NA 1QBOA 3LGVA 1GI7B 1A7SA 4TPIZ 3LC5A 1BTUA 5A0BA 4O97A 4IMZA 4UD9H 2Y5GA 1C2MA 1TNKA 5JB9S 4OGXA 3B23B 5EU8A 1FIZA 1P06A 2JH6D 2XXLA 1O2SA 2OLGA 1O3NA 5DGJA 1YP9A 3QX5H 2R2WU 1JBUH 1SGTA 1BTXA 1INCA 1VGCC 2B5TB 2ZCLP 1C1QA 3VB4A 1YCPK 1CO7E 1OWHA 1BHXB 3ZZ9A 1WAYB 3E8LA 3RXHA 1X7AC 1P03A 1CHOG 1C5LH 1C5ZB 2BVSH 4E06H 1CE5A 2A7JA 2B8OH 1TBZH 1W2KH 1WQSA 2CMYA 1YPLH 4YZUA 4O3UA 2VIOA 2QIQA 1IQEA 5K7RA 2UUYA 4CRBA 1C4U2 1MQ5A 1AKSB 2QXHA 1A46H 1GI3A 5DP6A 1YPJH 4UFGH 1ZMLA 4WMDA 1HAVB 2ZU1A 3MU1A 3PMJA 3LT3A 2ULLA 2BHGA 2Q6FA 4RN6A 2PKAB 1K1OA 1GVKB 2OC1A 3PROA 2GCHG 3ODFA 2O9QA 3KNXA 3N7OA 4FUIA 4AORA 1UTKA 1LHCH 4FUBA 1MTWA 3VB6A 4X8TH 3TH3H 4HGCA 1SGPE 4NFEA 1THRH 4MNXA 5T6FA 3E0NB 1YC0A 1ZHPA 2F9PA 2H5CA 2FDAA 1GBFA 3TH4H 1WU1A 1C4Y2 1K1IA 4SGAE 2ZTYA 5EQSA 3F9GA 3RLWH 1V2OT 1TNLA 2HPQH 1BRUP 2GV7A 3RXBA 3IWMA 1O2VA 1O3GA 4A92A 1EPTB 1XUJA 4GHTA 1J9CH 1PQ8A 2ZGXH 3FP7E 2RA3A 2ZQ2A 4WXIA 1BTYA 1YLCA 1OP2A 4YOIA 2JETC 1EAIA 1HYLA 2C90B 3QN7A 4ZXXH 1OPHB 4F4OC 3BTME 5GDSH 2QN5T 1ZJDA 1FAKH 4IW4E 4Y0YE 5DK1A 5FHTA 3BTFE 4NA7A 2XBVA 1PPZA 4BAMB 2ZPQA 1DLEA 3Q76A 1O2NA 3DD2H 1H9LB 3T62A 2FOBA 1XUHA 2G5VA 1C5SA 2B0FA 3GCTF 3KN2A 5C5OA 4F49A 1O5GH 4ZXYH 2DE8A 1QJ7B 3BSQA 3E1XB 1QR3E 4D8NA 1P2OA 1G30B 3Q3KA 1PPFE 1VGCB 1C2IA 4NIVA 4K5ZA 3L33A 5T6GA 1VJAU 3DUXH 3S0NA 1SPJA 4INHA 1C5MD 2V3OH 1UVUH 1TPAE 2F3CE 4BXSA 3URDA 3MH4A 2J4IA 4WH6A 5B6OA 1E35B 1Y3UA 4VGCC 1AQ7A 1EXFA 3U8TH 1H1BA 1FV9A 2ODYB 2VWLA 3SJIA 4JYVH 1WTHD 2A5IA 2G8TA 4WJG2 4CRAA 1P0SH 1AI8H 4SGBE 2OUAA 2ZEBA 1C5VA 1RJXB 2G00A 5GJ4B 1AHTH 1QL7A 1RXPA 4NIWA 4NCYA 2FO9A 1JIRA 1G32B 2GDDA 3AAVA 4X8SH 4NSVA 3TITA 1B0EA 4NG9H 1C4V2 2CJIA 1GBKA 3ZZ8A 3SU1A 1XUIA 3SW2B 1SGYE 2QCYA 3TJUA 1L1NA 1NRSH 2A1DB 2FOGA 2BM2A 1ZOMA 4K3JA 4B71A 5DP4A 3SV6A 3QTOH 4GCHF 4Q7ZA 1O2UA 1DE7H 4ZROA 3RXSA 2ZF0H 1TRYA 3RXPA 2A5AA 1BCUH 3STJA 3RXIA 3SU4A 1QURH 3KHVA 1C1MA 4GAWA 1DY8A 1DICA 2ZTXA 1AFEH 3D65E 3K6ZA 3L3TA 3TJNA 2ZIQH 1TA2A 1AMHA 3A7TA 2VH6A 1LQDB 1UTJA 2GMTB 3NUMA 1NFXA 1UK2A 1P2MA 2GP9B 1UTPA 2VGCC 3BTTE 4GVUA 1Z71A 3NWUA 1MD8A 3RMLH 1YPHC 3LOXA 1O3IA 4A1TA 5EODA 1AB9B 2O8TA 4FUJA 2H9TH 3Q00A 4A6LA 1NFYA 1CSOE 2BY6X 1AGJA 2BLVA 1D3PB 1KXDA 4Y71A 1FAXA 1VITG 2PUQH 1LHGH 3MHWU 2BXTH 3UIRA 1W7GH 2R9PA 3SN8A 2XCFA 3ZZCA 3O8DA 3PTBA 3OY6U 1BMAA 2PTCE 3VXFH 1C2HA 4R8TB 3GICB 3GYLB 4UONA 2GZ8A 3FP6E 1UCYE 1BT7A 5HGGA 1QB1A 3LC3A 1O3BA 1QQUA 4ISIH 4OGYA 5DO4H 3HK3B 8KME2 2WINI 4ABBA 3PB1E 3MH7A 4X1PU 2ZHEH 3M5NA 1HGTH 1YPHE 3BG4B 1L4ZA 1CVWH 4UE7H 2CGAA 3PV4A 1HBTH 4JZ1A 1ELVA 1QBVH 3MMGA 4DG4A 4XBDA 1TGTA 3SNDA 3P8FA 3A80A 2A45B 1O2IA 1ESBA 4GPGA 1ELTA 1GHAG 1TMTH 2WPHS 1GG6C 2Y80A 1C5XB 1PYTD 2TGAA 2ZO3H 3HKJB 3GISB 2ZGBH 3VB5A 4Z6AH 1ELCA 3T28A 3TK5A 1S6FA 3F9FA 1CT0E 1KXEA 1BTHH 2ZC9H 1DWCH 1SLXB 1ZTJA 5BRRE 1ZJKA 2Z3DA 4QT8C 3SGBE 3AAUA 1K1JA 2GCHF 2Y5HA 1K22H 1TQ0B 3MNXA 5FCRA 1O2QA 1OOKB 3MU4A 4FUFA 1SQOA 4YOGA 2RCEA 2BD4A 2CHAC 1CGHA 3PMHB 3PMAB 2XCNA 3A83A 3GCOA 4ISLA 1TGCA 4ZKOU 4MNVA 3FP8E 4YESB 2P16A 1O38A 2XBYA 2EEKA 3M5MA 3SV8A 2BDAA 5FX5A 1P05A 2XC5A 1KXAA 1TRMA 2FXRA 4IC6A 3B9FH 5JBTA 1D4PB 3RXEA 5E2OA 1BMNH 5AHGH 1GI4A 2GGVB 4WWYA 5K0HA 5ABWA 1QL9A 3RXCA 3KL6A 1ELFA 1UTMA 4BNRA 4DURA 3ELAH 3UQOA 1LVBA 1XKBC 4XE4A 2A4OA 2BZ6H 4AG1A 1ZHRA 2A31A 2BDBA 1MH0A 1OS8A 3SI4H 2FZZA 1DUEA 7KMEH 1AZZA 3QZQA 3ZZ4A 3TLOA 1GJ9B 2FTLE 2ZP0H 4AGJA 3KQDA 1HAGE 8LPRA 1ZR0A 4IS5A 1BRCE 2SGEE 5LPRA 3LONA 2ZDNA 2O8WA 1BBRK 1SGDE 2PLXA 2WUCA 1CGJE 4U01A 3AVZA 1V2LT 2VINA 1WSSH 1DSTA 3VB7A 2QF3A 1HXEH 5L2YH 4JZFH 1HIAA 2BDGA 1J17T 1CU1A 1K9OE 2EI6A 4ASHA 4DW2U 1SFIA 1W13U 5A09A 1VCQA 1EB1H 4ABGA 3UOPA 1OWEA 2ASUB 2ZQ1A 3CS0A 1GMCF 3U69H 3PMBB 4I8LA 2ZDVH 1YGCH 4AYVB 2ZHFH 1TNGA 3TK9A 1TAWA 3ZZBA 1EOJA 4NSYA 3BTEE 1AN1E 2H6MA 3BN9A 3PYHA 3P17H 3BF6H 2WYJA 2W7SA 4WXVA 2STAE 2VIDA 3P92A 5F8ZA 1DDJA 1K21H 3M61U 4Y79A 3RDZA 1BTWA 1SGEE 5FBEA 1EZQA 1ANBA 3HGPA 3M5LA 1FXYA 1P02A 4K8BA 2BVXH 4ABHA 4BAQB 2NWNA 3SJ8A 3ZVBA 3ZVCA 1P2IA 1TIOA 1LKBA 4D9QA 1IOEA 3NZIA 2VIPA 1IQNA 1F5KU 1VCWA 1EZXC 1O2JA 4I8KA 3TVJB 2BQ7B 1A5HA 2QC2A 4CRGA 1W0ZU 2OD3B 4HTCH 4FU8A 2EI8A 4BAOB 1NRNH 2H1UA 5ETXA 1FPCH 3MWIU 2BMGB 2WYGA 4OS4A 1THPB 1ACBE 1ELGA 3P70B 3S7KB 1TALA 1SGFA 4Y8XA 3O8RA 1IQHA 3MNCA 4ZKSU 3SORA 1ETTH 4ABDA 1ESTA 1W7XH 4AFZA 2QV1A 1H4WA 3KF2A 1MTNB 4O3TA 2ZA5A 2C8XB 1P2JA 2ZU3A 1T7CA 2K1QA 2HALA 4AOQA 6CHAB 1HUTH 3SUDA 1AVWA 5GIBA 1QBNA 2H5DA 4X8VH 1A0HB 1Q2WA 4A1XA 1CA0C 1TNJA 4MPUA 3A87A 1T8NA 2FS8A 1EPTA 4K1SA 2HNTC 1GJ7B 2AIQA 2FI3E 3LGYA 1E0FD 1FY3A 1TABE 4YO9A 2BY5X 3SNCA 1GHXH 4I8HA 2CF8H 1D6RA 1O3MA 1QGFA 3VB3A 3A7WA 2CV3A 1GI0A 1HLTH 1VITF 1MKXK 2UUFB 3SV7A 1O3KA 4OS5A 3SU5A 5E8EH 4X2YA 1HPGA 1K1LA 1SLVB 4NWKA 5LGOA 1FUJA 1ZPCA 1LVOA 2BDCA 1SGCA 1MTVA 2HVXA 1GHBG 2OP9A 1NN6A 1QA7A 1BMLA 1JRTA 2J2UA 5CHAB 3RC5A 1LO6A 1EJAA 3EAJA 2XWBI 5JBAS 2Y6TA 1PPHE 3F9EA 4CHAC 4Y8YA 4ZHAA 1GCDA 4Y7AA 2ZCKP 1O31A 3H7TA 5DP3A 1YCPH 2SGAA 2FX4A 3A8CA 1P01A 1DT2A 2GTBA 4IGDA 3U8RH 1GHAF 1NM6A 1SR5C 1QFKH 3SGAE 5EPYA 1EUFA 4E05H 1N8OB 4MG3A 1CQQA 1JXPA 6GCHG 1O2HA 1A2CH 2BLQA 1EJMA 1DSUA 2FEQH 4I31A 5L2ZH 1DXWA 1C5OH 1CA8B 1PJPA 1G3EA 2ESTE 1JOUB 2WPJS 1O3JA 3I29A 1YYY1 1V2QT 5E0GA 2Y7XA 7GCHF 1TMUH 2W5EA 1LKAA 1ZZZA 2EA3A 3BEFB 2H9HA 1Z8JB 5AFYH 1FY8E 1LPZB 3SV9A 2FMJA 1KYNA 2OC7A 3SHAH 2Z9LA 2UUKB 2YOLA 2W3KA 1GBAA 4JK6A 1HIAB 3QGNB 3DHKH 3BTQE 3BTKE 1RRKA 2Z3EA 1PPCE 4U32A 4CBNA 3ZV8A 3D49H 1CT4E 1WCZA 2FOAA 4Y11E 3BG8A 1Q31A 2TPIZ 1L1JA 1YBWA 4MQAA 3SU3A 4AYYB 4MPVA 2TRMA 1UK4A 1FMGA 1GJ4H 3RXMA 2XC4A 2A7CA 2F9NA 1GDUA 2IJOB 1KLJH 2Z9KA 1C1VH 2J34A 1WV7H 4AB9A 3A7VA 3HKIB 4TWYA 4ZH8A 2PKSB 1Y3XA 1CA0B 4Y6DA 5JBCS 1KSNA 2NU1E 3M5OA 2GV6A 1S0RA 2F9VA 1TBRH 2HGTH 1NROH 2P59A 1O3PB 1NESE 2PSXA 5FPTA 4CRCA 2VWOA 3ATMA 5A0CA 1O2ZA 4GUXA 2ZFSA 1Z1IA 1MZAA 1VJ9U 4DOQA 1NZQH 1P11E 4X1RU 4KTSA 3RXFA 2CN0H 4AB8A 3H7OA 2LNCA 2ALPA 2P93A 1P57B 1FONA 1A3EH 5BPEA 3ZYDA 5E0HA 1EP6A 5JPMH 4UDWH 2ZPSA 4AX9H 4R0IA 3ZYEA 4AFUA 1GHYH 4D7FA 1FZZA 1GBEA 3BEIB 3GDUA 1P2NA 3RC4A 1IQGA 1QB9A 5EQQA 2UWLA 1UHBA 2C4FH 5GPIB 2VIQA 4Q2KA 5FX6A 1H8IH 1SGNE 3RXJA 1GI9B 2GCTB 1LCYA 1SVPA 1H9HE 1Y3YA 1RD3B 1NU7B 3SJOA 3VGCC 1ID5H 1GBDA 1C2EA 3DFLA 1D9IA 3EQ0H 1XM1A 1RTLA 2G52A 3OSYA 1QJ1B 3GY2A 1O3FA 2B7DH 4MPXA 3SUEA 1AO5A 1UMAH 3DFJA 3MH5A 3UR9A 1A0JA 2J94A 2OBQA 2AMDA 1C5UA 2GDEH 2GD4B 1K1NA 1GGDC 3DT0H 1O5CB 3S7HB 5EW1H 3M3TA 3K65B 5FPYA 3TK6A 1TB6H 1NFWA 1VITH 5T3HA 1O2MA 2XTTB 1OXGA 2BOKA 3UNSA 1A1RA 3OX7U 3IG6B 1TGNA 3F6UH 3KQCA 5T6DA 1IHSH 4MNYA 4CREA 4PROA 2BYAX 3SQHE 1TLDA 2AMPA 1BOQA 1GMCG 2ILNA 3ITIA 3ZVAA 4ABFA 1O2OA 3BTGE 1UVTH 4B73A 2TGTA 3URCA 3MU5A 2C8ZB 2SGFE 1SI5H 2Y81A 3EDXB 4D9RA 8ESTE 1BQYA 1GHZA 3RXLA 1UTLM 2JKHA 1O3AA 2ZI2H 1LQEA 2VNTA 4HFPB 1ANCA 1CT2E 3TNSA 1T31A 2I6QA 2XYAA 1C1WH 1TOCB 2FOMB 2FLBH 2KAIA 1UVPA 4YT6H 3ATWA 1O3OA 3PO1C 3PLKA 3I77A 4OS2A 5FCKA 1G9IE 2P3UB 4KKDA 2OQ5A 3TGIE 1GPZA 1FI8A 4AFSA 1EAWA 3A84A 3NKKA 1KTTB 3F9HA 3A7YA 1ZRKA 1F5LA 2VB0A 5FXLA 1V2PT 2ZHWH 1FY1A 3C27B 1GHWH 1GHBF 1AWHB 2LPRA 4AZ2B 3QGJA 1G3CA 4WVPE 3SNBA 3MO3A 5GWZA 4LXBH 4J1YA 1C5QA 1EATA 1IQMA 3NPSA 2FOCA 1MBQA 1MU8B 5DP7A 3D62A 2W26A 2A2QH 5E2PA 1E37B 2G55A 4GSOA 3SI3H 1XX9A 1AU8A 1ANDA 2ZDAH 2V35A 1P3CA 1KLTA 1ETSH 1W12U 1DXPA 3A88A 1IQJA 2A4GA 2BDIA 1UCYH 1OWJA 3SQEE 1TONA 1MAXA 2Z3CA 4XOJA 5F6MA 1FY4A 1ZYOA 6GCHF 3TGKE 4D76A 5HXFA 3OYPA 1XXFA 2HLCA 2BZAA 2FPZA 2FP7B 4ABEA 2FTMA 3M3VA 2PW8H 1ZGIA 3EYDA 4ABAA 2JETB 4XDEA 1GDQA 1O2RA 1QHRB 5TCCA 1TFXA 1MZDA 1TX8A 1ZSKA 5AVDA 1MKWK 2GZ7A 2ALVA 2GZ9A 1ARBA 3RM0H 1HCGA 3MFJA 2JH5D 1RIWC 3P6ZB 1O2TA 1YKTA 1F0SA 1RTFB 2ZZUH 4JCNA 2Z9JA 1HB0B 2FI5E 1E34B 1FLEE 4IC5A 1BHXF 1SGRE 4X1NU 4ZUHA 1MD7A 1UHBB 2A0QB 2G4TA 2RG3A 5CE1A 3UPEA 4X6NA 1A5IA 1C5YB 4Q80A 2NU4E 5CMXH 4FXGH 5C5NA 1CGIE 1HAIH 1GJDB 1TRNA 4AGKA 1L1GA 1ESAA 1IHTH 1ZMNA 3MNBA 1V2JT 1GBCA 1TQ7B 5TJXA 1TWXB 1BA8B 1GBHA 1DFPA 3F1SB 4KP0A 2FYRA 3ENSB 4VGCB 5DP5A 3KEEA 4X8UH 4BANB 4OS7A 3MOCA 2O8LA 4NWLA 1V2NT 3SGQE 1UVSH 4INKA 2QA9E 1BZXE 4X1SU 3UWIA 1HAYB 2G5NA 3SUFA 1Q3XA 3QDZB 1OP8A 3PO1B 3E91A 4I8GA 4BAHB 7GCHG 1VZQH 1EASA 4Q7YA 4X2VA
chains in the Genus database with same CATH superfamily
3PV5A 4RT0A 4JK5A 2UWPA 2ZU2A 4OS6A 4YLUA 2F4LA 4CRDA 1AY6H 4O9VA 4ABJA 1QTFA 1AUJA 2WPMS 1BBRH 2IN2A 1SGIB 5EQRA 4AG2A 5JB8S 2PHBA 2THFB 4NIYA 3TNTA 1K2I1 1NBMD 1NO9H 1A4WH 1BMMH 4TPYA 1IQFA 1GBTA 3EE0B 3O8CA 1O34A 4WMEA 1TPOA 1L2EA 2QY0B 1GJAB 5C1YA 1P12E 1JWTA 4BOHA 8GCHF 4UEHH 5FPSA 4I7YH 1AFQC 3GY7A 1V2MT 3LH1A 2YMSD 2FODA 1S84A 2KCPA 3A85A 1GBIA 1EAUA 2OC8A 2KAIB 2LP6A 2VGCB 5DP9A 1AWFH 4CR9A 1YLNA 3TU7H 1O0DH 4CH8B 2ZNKH 4ZMAH 1EX3A 1TX7A 5EXLA 3P8OA 4MPWA 1AUTC 1BBRE 4XRNA 5C2ZA 4HG6A 1SL3A 3UNRA 4Z0KA 2ZGJA 1HV7A 1S85A 3KCGH 4WH8A 3R0FA 2SGPE 1XUFA 2ZG0H 5A2MH 1H8HD 4B2BA 2BY9X 4K60A 4E7RG 1DLKB 1C1PA 2GJGA 5IDKA 2ZPRA 4Y8ZA 7LPRA 3QK1A 3MNSA 1C5RA 3ATIA 4B75A 1OYTH 2O8MA 2XW9A 1QCPA 2STBE 1COWD 4XFQA 1DY9A 1F2SE 1W3CA 4TY7A 4K1TA 3CP7A 2AGEX 3V3MA 1WQVH 2QF0A 4FVDA 5F03A 3FZZA 1TOMH 2XBXA 2BQWB 1THSH 2SGDE 2BD7A 2P8OC 3M7UA 1Y5AT 3A81A 2ZFTA 2ZDKA 1CBWC 1U6QA 2D2DA 1BDAA 5GCHG 4BTIB 3GDSA 1OKXA 3RU4T 1C2FA 3O8BA 2ZECA 3T5FH 1GG6B 2CK3D 1V2RT 2QF4A 2Q6GA 2AH4X 3LU9B 1RS0A 2VWNA 2ZDMA 1TBQH 1ETRH 1RTKA 1QIXB 1UO6A 4ABIA 4P00A 1C1RA 3PWCA 1MU6B 2Z9GA 1H9IE 1TMBH 1B5GH 2Z94A 2FLRH 2P3TB 5C20A 1J16A 2CHAB 5I46H 6ESTA 2WPDD 1MKXH 1LMWB 2HRVA 3ZZAA 4YTAA 2FM2A 3TGJE 1D3DB 3U28C 2Q6DA 1GMDG 5EOKA 5ESTE 4ISOA 1GBBA 4NA8A 3EE7A 1BRAA 4XBBA 4XSKU 1OX1A 4INLA 5KEDA 3KQBA 1V6DA 1SG8B 4MLFB 2AGIX 1D3QB 1Z8IB 2PFEA 3A82A 1SKYE 3VFEA 1ZMJA 2FOEA 1NS3A 1SGQE 2C3SA 1P09A 4HZHA 5LH8A 3V0XA 4DT7B 3A8BA 1FN8A 4LZ4B 3AW0A 1AFQB 2OINA 4NZQA 3GCHC 2PSYA 4ESTE 2J5UA 1GJBB 3GY5A 1Y59T 1OP0A 2OC0A 3UY9A 4FUDA 2C8WB 3TH2H 5L6NH 2IPHA 2BY7X 2ZHDA 3C1KA 2RDEA 2VVUA 1NC6A 2EC9H 2FOFA 1XVOA 1B7XB 5LPEA 1WYKA 4THNH 1V2ST 5KECA 1O35A 4H4FA 4FU9A 1V2VT 3GY4A 1WOFA 2BVRH 5HM9A 1D3TB 1ZSLA 4D7GA 2FIRH 3SO3A 1MAYA 4WMFA 3OFND 2P95A 1ABJH 1W0KD 1GI2A 2ANMH 1GL1A 1GBLA 5DKMA 1S6LA 1BJVA 3WWBA 1TYNA 1V2KT 3QZRA 3RMNH 1C2JA 3SU0A 1TGSZ 2QXIA 3DA9B 3U1IB 3A8AA 1N6YA 3U8OH 3UB0A 3RXQA 1NT1A 2H2ZA 4BAKB 2P8OB 2YMSB 1ZLRA 1ZPZA 1EZSC 2ZGCA 1CBWB 1G3DA 2UWOA 3EA9A 5EIYA 1KMHB 1UVOA 1C5PA 3SHCH 4WY3A 1SSXA 1P3EA 2GKVE 3NXPA 2OQUA 2W3IA 4Y7BA 1BJUA 1W0JD 4BTTB 1GI5A 3FZDA 1ZPBA 4K69A 2XRCA 3FVFB 4HI3A 1EP5A 1QRZA 5H4IB 1NTPA 2J38A 2VJ1A 3SNEA 5DPAA 3U9AH 2BLWA 3V13A 1SOZA 1Y5BT 5EJ1A 4DIHH 1FDPA 4H42U 2BXUH 3MYWA 3KYFA 3M7QA 1O39A 4I32A 2RDLA 1WUNH 3MI4A 5PTPA 1HXFH 3UREA 1E36B 1MQ6A 2BLOA 1PFXC 1XVMA 1KDQB 4FUGA 3STIA 2VH0A 1V2UT 1QL8A 1Y3WA 2PUXB 2VVCA 4GLYA 3RC6A 3LGUA 1K0HA 1ARCA 1KLIH 1KIGH 1V2TT 3ZVEA 5HMAA 4KELA 2BDYA 3D23A 1D6WA 1AD8H 2SFAA 2QAAA 1K28D 3PRDA 1OWDA 3A8DA 2BTCE 4BXWA 1SHYA 4CRFA 4X6PA 1EB2A 3GCHB 3KIDU 5IK2D 4RI0A 2PV9B 2Q1JA 1Z6EA 4X6OA 1Y5UT 2A4RA 1J8AA 3I78A 1CHGA 1DWEH 2CF9H 4GHQA 4DY7B 4TWWA 4H6SB 3FO8D 4MDSA 2D1JA 1L0ZA 2WPLS 3SUGA 4XBCA 1S81A 1HAHH 2F9UA 3A86A 2TIOA 3ZVDA 1SB1H 1ZHMA 2YNBA 2BD9A 4B76A 3SJ9A 5EJZA 3CS7A 1IQKA 4YM9A 1QQ4A 1SGFG 3PWBA 4AC9A 1DM4B 4A7IB 2B9LA 2PGBB 3SU2A 4DGJA 4UFFH 2SNVA 1FQ3A 3RP2A 3RU4E 5DN6D 3E0PB 4CHAB 1C1OA 1PQ5A 1PQ7A 8GCHG 1FN6A 3SNAA 5C1UA 5EPNA 1H8ED 3E90B 5SGAE 5GCHF 2ANYA 3BIVH 4M9FA 1MCTA 1BMFD 3H5CB 3IITA 2FYQA 4FVBA 1BITA 1H8DH 2TGDA 1QJ6B 1HAOH 1EKBB 4YOJA 1S0QA 1F92A 3ESTA 1LTOA 2GMTC 3TJOA 4DVAU 5DG6A 1GI8B 4ZHMU 1DX5M 4IMQA 4FUHA 1BRBE 1O30A 3GCNA 1AB9C 1N1LA 3FAOA 1GDNA 1SHHB 4LOYH 5ESBA 1GJ6A 4LK4A 4KTUA 1UTNA 3GY8A 2XBWA 3VXEH 3F68H 1F5RA 3MU0A 1ELDE 1A5GH 5FAHA 1GMDF 1OWKA 4UFEH 3RXRA 3RXTA 5F8TA 1LDTT 1W0YH 4ZAEA 2FI4E 4CR5A 3AW1A 1FY5A 3MO6A 4FETA 1HNEE 3JZ1B 2PR3A 4UFDH 1C9TA 3Q77A 3MTYA 2A5KA 3DSGA 1XMNB 3RLYH 1KXBA 3BTWE 2Z6BD 1KY9A 1O5FH 4LZ1H 3T29A 4B6FA 5FBIA 3R3GB 1KTSB 3JZ2B 5LPFA 3BV9B 5C3NA 1C1NA 3BG4C 4FUEA 4B2CA 2FS9A 1MUEB 3UUZA 1G36A 1LVYA 4ZKRU 3F0PA 1MCVA 1PPEE 3M35A 1HJ8A 1O5EH 2F91A 1UTQA 4Q7XA 4YLQH 5DJ7A 1GVLA 2Y7ZA 1Z1JA 1MBMA 5HIYA 3BEUA 1V3XA 2QXJA 4X2WA 2WV9A 2YNAA 4NFFA 2DUCA 1T8LA 1Z8RA 3LPRA 3EA8A 1C5NH 1TPPA 2AYWA 1MKWH 5A8ZA 2J9NA 3RMMH 2LELA 4CH2B 1HAZB 5F53A 1TNHA 1ZTKA 2D8WA 1MMJN 2PTNA 4Y10E 5JDUB 2ZDLA 1LVMA 2BD8A 4O03A 4RKJB 1M9UA 4FUCA 1UK3A 4A5TS 5A8XA 4I33A 3KQEA 4U2WA 4X6MA 1HDTH 3S9CA 1DPOA 3CENA 1P04A 1QA0A 1AZ8A 3SOSA 2BQ6B 3E6PH 2ZHQH 5HKKD 2XC0A 3VGCB 1UW7A 1SC8U 2ZFRH 4B2AA 2KCAA 1O2LA 2AERH 3VEQB 3ATKA 3RXKA 5EGMA 1F0UA 1C2DA 1YPKH 1UJ1A 2PGQB 2SNWA 2BX3A 5TCAA 1HJAC 1GI6A 1GVZA 3U98H 1S82A 3RXGA 1GJ5H 1YPEH 4Y0ZE 1T8MA 1O3CA 1GGDB 4NA9H 1GMHG 2J98A 3HK6B 1SQAA 1GWAA 2C8YB 3ZV9A 3E16B 3V12A 3T27A 1J14A 3NK8A 3MU8A 2C93B 3TPIZ 1HAPH 2AGGX 2M2AA 2Y5FA 4YT7H 1GL0E 2ZGHA 1NFUA 5C0UA 4RKOB 2TGPZ 1OSSA 3BIUH 1ZRBA 3DCLA 4A1VA 2P3FH 1FPHH 1NY22 5FL7D 2FWWA 3ZVFA 1SQRA 1Z8GA 1AIXH 1O2KA 4J2YB 1QB6A 1KXFA 3B8JA 5F8XA 1HRTH 3E3TA 1GBMA 1A61H 1GJ8B 1E79D 3N7DA 4XD7D 3T2NA 3P8GA 2AEIH 3K9XB 4ZKNU 3UNQA 1UCYK 3PLBA 2V6NA 1CHOF 5DSFA 2VU8E 3UR6A 1G37A 2HNTF 2G81E 4B6EA 3RXVA 1W14U 2ANKH 2A7HA 1C5TA 4KGAA 2KZ4A 1G2LA 3RXOA 3N99A 2ANWA 2HOBA 2ZFPH 3V7TA 1C2LA 2QYIA 3RM2H 2WV4A 2BD5A 1IQIA 3LKWA 1YF4A 4BTUB 1AVXA 3UFAA 5JYIA 1O2XA 4ISHH 4JZEH 1P2QA 1T4UH 3BTDE 5CDFE 1YPGH 5JBBS 1C9PA 1C2KA 1C2GA 2HWLB 3LJOA 2ZKSA 3ZZ7A 3HATH 1EQ9A 2BY8X 4ZHLU 1DWBH 2KCOA 2XWAA 1O5AB 2JJ2D 1SMFE 1ELEE 1XKAC 1YPMH 1WBGB 2J95A 2P94A 1EZUC 3Q3XA 1BTZA 5A8YA 3GY3A 1G2MA 4RSPA 3FFGA 1NU9A 2F43B 3RMOH 9LPRA 3RXDA 2R2MB 1B0FA 2ZTZA 2V3HH 5L30H 2BX4A 1EAXA 4MTBA 1MTNC 1QRXA 1DANH 1J15A 1O3HA 1P10A 2NU0E 2W7UA 2GVFA 1C1SA 6CHAC 1ABIH 2BB4A 4JYUH 4K2YA 5AF9H 3QLPH 1OYQA 4M7GA 4NZLA 3LJJA 1RFNA 1ORFA 2VVVA 4H6TA 3SBKA 2FX6A 1PPGE 2O8UA 2FESH 1XXDA 3S9AA 3AASA 5J4QA 1F0TA 2J92A 2JJ1D 1ELAA 1DVAH 4IBLH 4E7NA 1GBJA 1C5WB 1GJCB 1LHDH 1F0RA 1TE0A 3F2HA 3A7XA 3LH3A 5GXPA 4WF8A 6LPRA 1O2PA 1SFQB 1MTUA 3G01A 1PYTC 1FJSA 1DUAA 1HJAB 4IN1A 1T4VH 1C1UH 1BIOA 1NRRH 2ODPA 2HPPH 2ODQA 4JMYA 2BDHA 3A89A 1SLUB 1ZSJA 3K2UA 1ZTLA 2UUJB 3SU6A 1RIWB 3M37A 3S69A 3F2GA 3PLPA 3ZZ3A 1A0LA 5EG4A 1GCTC 3SZNA 3LIWA 1IQLA 5EXNA 3NRLA 3ODDA 1KDQA 1YM0A 2FOHA 5AFZH 2R3UA 2GT8A 3M7TA 1BTPA 2ZU5A 2ZFFH 3T26A 5CHAC 1RGQA 1NPMA 1QY6A 1Y3VA 2I6SA 4ISNA 9ESTA 2Z7FE 1FX0B 2ZU4A 3BTHE 3GYMA 3W94A 1TPSA 3WY8A 1Y8TA 1GHVH 1UTOA 4K1EA 1JRSA 4AFQA 4ACBA 2PWXA 1Z6JH 2ZFQH 3QO6A 3RXAA 5G4BA 1O2GH 3GY6A 3SJKA 2H9EH 2R0LA 3TIUA 5J4SA 1PQAA 2OBOA 2VWMA 2OXSA 3W95A 1N8OC 2F83A 4I86A 1O37A 3FANA 3FOAA 1LPKB 3GOVB 1ELBA 1LPGB 3T25A 1W11U 4X0WU 1DOJA 4X2XA 1SQTA 1O3DA 1O5DH 1BUIA 2F9BH 1O5BB 1NRQH 2J98B 3LGTA 3PTNA 3UTUH 4TY6A 1AKSA 1AVGH 2EI7A 1O3LA 1C1TA 5HM2A 1S6HA 1Z7KA 2V0BA 3K6YA 5HYOA 2VBCA 2WPIS 2Y82A 2BD2A 1HAVA 1FIWA 1SBWA 1P8VC 4CBOA 4AN7A 3GDVA 1TA6A 2PKAA 1O2WA 2G51A 3Q3YA 3P95A 3HPTB 1DS2E 1E38B 2NU2E 1TNIA 5C17A 4JZDH 3GCTG 2QGRA 3EGKH 5EXMA 2RA0A 1ZGVA 4Y76A 2L74A 3ATLA 4U30A 1W10U 4KTCA 5DP8A 2A2XH 2KR7A 1SOTA 1HAXB 5A0AE 2R0KA 3S9BA 2DE9A 1T8OA 1O32A 1AE5A 1ANEA 1OWIA 3M3SA 1S83A 1O2YA 2M5TA 4FU7A 5E0JA 3L6PA 2AS9A 2JH0D 3TJVA 3WWFA 1VR1H 2F9OA 2A4QA 4IN2A 3UOUA 3EA7A 2PKSC 2NU3E 4K8YA 3VPKA 1NRPH 1QRWA 3NCLA 4NGAH 2VIWA 2AIPA 4B1TA 1YLDA 3UQVA 4JYTA 1FNIA 1O3EA 3A7ZA 3RUOA 1W8BH 1GI1A 3LDXH 1DITH 3ZZ5A 1GMHF 5EW2H 1P2KA 2AFQB 7ESTE 3QTVH 2IOTA 2WV5A 1K1MA 2Z9IA 1AE8H 3ZZ6A 1HFDA 1L4DA 1F7ZA 2D26C 3ZVGA 3M36A 5C1XA 3SV2H 1QNJA 1YCPM 3MO9A 2CXVA 1N6XA 1GCTB 1P9SA 3KGPA 4MNWA 4DIIH 1KXCA 2ZCHP 1T32A 4NIXA 5I25A 1G3BA 2SGQE 1DWDH 1LHEH 1XUKA 2WUBA 3QWCH 5HIZA 1A3BH 1P9UA 4TYDA 2OCVB 2GT7A 3PM3A 3UWJH 2WPKS 4MVNA 2ZWLH 4JZIA 2AMQA 2HNTE 1PPBH 4GCHG 3RXUA 3RU4D 2OTVA 1S5SA 1K1PA 3LGIA 4OS1A 4DCDA 4I8JA 1EOLA 1O36A 1IAUA 2VIVA 2GX4A 2BOHB 2GCTC 1EPTC 3MH6A 1XUGA 1EJNA 1JIMA 2A32A 2QXGA 3QUMP 4DJZB 3U1JB 3HGNA 2R3YA 4B74A 2BD3A 2XNIA 3OY5U 3WW7A 3LGWA 5IYTA 1O33A 3ZZDA 1WTGH 1V2WT 2G4UA 1SLWB 1JMOH 1MTSA 1TGBA 1BB0B 5C67A 1HJ9A 3OTJE 1TX6A 3OU0A 1LHFH 1VCPA 2TBSA 4X1QU 3P8NA 1QBOA 3LGVA 1GI7B 1A7SA 4TPIZ 2QE7D 3LC5A 1BTUA 5A0BA 4O97A 4IMZA 4UD9H 2Y5GA 1C2MA 2L6OA 1TNKA 5JB9S 4OGXA 3B23B 5EU8A 1FIZA 1P06A 2JH6D 2XXLA 1O2SA 2OLGA 1O3NA 5DGJA 1YP9A 3QX5H 2R2WU 1JBUH 2IPQX 1SGTA 1BTXA 1INCA 1VGCC 2B5TB 2ZCLP 2WZQA 1C1QA 3VB4A 1YCPK 1CO7E 1OWHA 1BHXB 4OM9A 3ZZ9A 1WAYB 2K0QA 3E8LA 4P02A 3RXHA 1X7AC 1P03A 1CHOG 1C5LH 1C5ZB 2BVSH 4E06H 1CE5A 2HVYB 3MQKC 2A7JA 2B8OH 2XNDD 1TBZH 1W2KH 1WQSA 2CMYA 1YPLH 4YZUA 4O3UA 2VIOA 2QIQA 1IQEA 5K7RA 2UUYA 4CRBA 1C4U2 1MQ5A 1AKSB 2QXHA 1A46H 1GI3A 5DP6A 1YPJH 4UFGH 1ZMLA 4WMDA 1HAVB 2ZU1A 3MU1A 3PMJA 3LT3A 2ULLA 2BHGA 5EJLA 2Q6FA 4RN6A 2PKAB 1K1OA 1GVKB 2OC1A 3PROA 2GCHG 3ODFA 2O9QA 3KNXA 3N7OA 4FUIA 4AORA 1UTKA 1LHCH 4FUBA 4DT4A 1MTWA 3VB6A 4X8TH 3TH3H 4HGCA 1SGPE 4NFEA 1THRH 4MNXA 5T6FA 3E0NB 1YC0A 1ZHPA 2F9PA 2H5CA 2FDAA 1GBFA 3TH4H 1WU1A 1C4Y2 1K1IA 4SGAE 2ZTYA 5EQSA 3F9GA 1YY3A 3PV2A 3RLWH 1V2OT 1TNLA 2HPQH 1BRUP 2GV7A 2K8IA 3RXBA 3IWMA 1O2VA 1O3GA 4A92A 1EPTB 1XUJA 4GHTA 1J9CH 1PQ8A 2ZGXH 3FP7E 2RA3A 2ZQ2A 3OEHD 4WXIA 1BTYA 1YLCA 1OP2A 4YOIA 2JETC 1EAIA 1HYLA 2C90B 3QN7A 3OTPA 4ZXXH 1OPHB 4F4OC 3BTME 5GDSH 2QN5T 1ZJDA 1FAKH 1OHHD 4IW4E 4Y0YE 5DK1A 5FHTA 3BTFE 4NA7A 2XBVA 1PPZA 4BAMB 2ZPQA 1DLEA 3Q76A 1O2NA 3DD2H 1H9LB 2OK5A 2RFKC 3T62A 2FOBA 5B6LA 1XUHA 2G5VA 5T1VA 1C5SA 2B0FA 3GCTF 3KN2A 5C5OA 4F49A 1O5GH 4ZXYH 2DE8A 1QJ7B 3BSQA 3E1XB 1QR3E 4D8NA 1P2OA 1G30B 3Q3KA 1PPFE 1VGCB 1C2IA 4NIVA 4K5ZA 3L33A 5T6GA 1VJAU 3DUXH 3S0NA 1SPJA 4INHA 1C5MD 3N7EA 2V3OH 1UVUH 1TPAE 3SZEA 2F3CE 4BXSA 3URDA 3MH4A 2J4IA 4WH6A 2J97A 5B6OA 1E35B 1Y3UA 4VGCC 1AQ7A 1EXFA 3U8TH 1H1BA 1FV9A 2ODYB 2VWLA 3SJIA 4JYVH 1WTHD 2A5IA 2G8TA 4WJG2 4CRAA 1P0SH 1AI8H 4SGBE 2OUAA 2ZEBA 1C5VA 1RJXB 2G00A 5GJ4B 1AHTH 1QL7A 2EQNA 1YWUA 1RXPA 4Z1MD 4NIWA 4NCYA 2FO9A 1JIRA 1G32B 2GDDA 2KX4A 3AAVA 4X8SH 4NSVA 3TITA 1B0EA 4NG9H 1C4V2 2CJIA 1GBKA 3FKSD 3ZZ8A 3SU1A 1XUIA 3SW2B 5C0TA 1SGYE 2QCYA 3TJUA 1L1NA 1NRSH 2A1DB 2FOGA 1WXRA 2BM2A 2KM0A 1ZOMA 4K3JA 4B71A 5DP4A 3SV6A 3QTOH 4GCHF 4Q7ZA 1O2UA 1DE7H 4ZROA 3RXSA 2ZF0H 1TRYA 3RXPA 2A5AA 1BCUH 3STJA 3RXIA 3SU4A 1QURH 3KHVA 1C1MA 4GAWA 1DY8A 1DICA 2ZTXA 1AFEH 3D65E 3K6ZA 3L3TA 3TJNA 2ZIQH 1TA2A 1AMHA 3A7TA 2VH6A 1LQDB 1UTJA 2GMTB 3NUMA 1NFXA 1UK2A 1P2MA 2GP9B 1UTPA 2VGCC 3BTTE 4GVUA 1Z71A 3NWUA 1MD8A 3RMLH 1YPHC 3LOXA 1O3IA 4A1TA 5EODA 1AB9B 2O8TA 4FUJA 2H9TH 3Q00A 4A6LA 1NFYA 1CSOE 2BY6X 1AGJA 3H09A 4F48B 2BLVA 1D3PB 1KXDA 4Y71A 1FAXA 1VITG 2PUQH 1LHGH 3MHWU 2BXTH 3GS9A 3UIRA 1W7GH 2R9PA 3SN8A 2XCFA 3ZZCA 3O8DA 3PTBA 3OY6U 1BMAA 2PTCE 3VXFH 1C2HA 4R8TB 3GICB 3GYLB 4UONA 2GZ8A 3FP6E 1UCYE 1BT7A 5HGGA 1QB1A 3LC3A 1O3BA 1QQUA 4ISIH 4OGYA 5DO4H 3HK3B 8KME2 2WINI 4ABBA 3PB1E 3MH7A 4X1PU 2ZHEH 3M5NA 1HGTH 1YPHE 3BG4B 1L4ZA 1CVWH 4UE7H 2CGAA 3PV4A 1HBTH 4JZ1A 1ELVA 1QBVH 3MMGA 4DG4A 4XBDA 1TGTA 3SNDA 3P8FA 3A80A 2A45B 1O2IA 1ESBA 4GPGA 1ELTA 1GHAG 1TMTH 2WPHS 1GG6C 2Y80A 1C5XB 1PYTD 2TGAA 2ZO3H 3HKJB 3GISB 2ZGBH 3VB5A 4Z6AH 1ELCA 3T28A 3TK5A 1S6FA 3F9FA 1CT0E 1KXEA 1BTHH 2ZC9H 1DWCH 1SLXB 1ZTJA 2HLDD 5BRRE 1ZJKA 2Z3DA 4QT8C 3SGBE 3AAUA 1K1JA 2GCHF 2Y5HA 1K22H 1TQ0B 3MNXA 5FCRA 1O2QA 1OOKB 3MU4A 4FUFA 1SQOA 4YOGA 2RCEA 2BD4A 3OE7D 2CHAC 1CGHA 3PMHB 3PMAB 2XCNA 3A83A 3GCOA 4ISLA 1TGCA 4ZKOU 4MNVA 3FP8E 4YESB 2P16A 2W6ID 1O38A 2XBYA 2EEKA 3M5MA 3SV8A 2BDAA 5FX5A 1P05A 2XC5A 1KXAA 1TRMA 2FXRA 4IC6A 3B9FH 5JBTA 3F2FA 1D4PB 3RXEA 5E2OA 1BMNH 5AHGH 1GI4A 2GGVB 4WWYA 5K0HA 5ABWA 1QL9A 3RXCA 3KL6A 1ELFA 1UTMA 4BNRA 4ASUD 4DURA 3ELAH 3KYGA 3UQOA 1LVBA 1XKBC 4XE4A 2A4OA 2BZ6H 4AG1A 3F3BA 1ZHRA 2A31A 2BDBA 1MH0A 1OS8A 3SI4H 2FZZA 1DUEA 7KMEH 1AZZA 3QZQA 3ZZ4A 3TLOA 1GJ9B 2FTLE 2ZP0H 4AGJA 3KQDA 1HAGE 8LPRA 1ZR0A 4IS5A 1BRCE 2SGEE 5LPRA 3LONA 2ZDNA 2O8WA 1BBRK 1SGDE 2PLXA 2WUCA 1CGJE 4U01A 3AVZA 1V2LT 2VINA 1WSSH 1DSTA 3VB7A 2QF3A 1HXEH 5L2YH 1EFRD 4JZFH 1HIAA 2BDGA 1J17T 1CU1A 1K9OE 1QZ8A 2EI6A 4ASHA 4DW2U 1SFIA 1W13U 5A09A 1VCQA 1EB1H 3UAIC 4ABGA 3UOPA 1OWEA 2ASUB 2ZQ1A 3CS0A 1GMCF 3U69H 3PMBB 4I8LA 2ZDVH 1YGCH 4AYVB 2ZHFH 1TNGA 3TK9A 1TAWA 3SYJA 1EOJA 4NSYA 3ZZBA 3BTEE 1AN1E 2H6MA 3BN9A 2YMSC 3PYHA 3P17H 3BF6H 2WYJA 2W7SA 4WXVA 2STAE 2VIDA 3P92A 5F8ZA 1DDJA 1E1QD 1K21H 3M61U 4Y79A 3RDZA 1BTWA 1SGEE 5FBEA 1EZQA 1ANBA 3HGPA 3M5LA 1FXYA 4ACAA 1P02A 4K8BA 2BVXH 4ABHA 4BAQB 2NWNA 3SJ8A 3ZVBA 3ZVCA 1P2IA 1TIOA 1LKBA 4D9QA 1IOEA 3NZIA 2VIPA 1IQNA 1F5KU 1VCWA 2V3MA 1EZXC 1O2JA 4I8KA 1NBME 3TVJB 2BQ7B 1A5HA 2QC2A 4CRGA 1W0ZU 2OD3B 4HTCH 4FU8A 2EI8A 4BAOB 1NRNH 2JIZD 4TSFD 2H1UA 1VKYA 5ETXA 1FPCH 3MWIU 2BMGB 2W6JD 2WYGA 4OS4A 1THPB 1ACBE 1ELGA 3P70B 2KCYA 3S7KB 1TALA 1SGFA 4Y8XA 3O8RA 1IQHA 3MNCA 4ZKSU 3SORA 1ETTH 4ABDA 1ESTA 1W7XH 4AFZA 2QV1A 1H4WA 3KF2A 1MTNB 4O3TA 2ZA5A 2C8XB 1P2JA 2ZU3A 1T7CA 2K1QA 2HALA 4AOQA 6CHAB 1HUTH 3SUDA 1AVWA 5GIBA 1QBNA 2H5DA 5GNDA 4X8VH 5CHBA 1A0HB 1Q2WA 4A1XA 1CA0C 1TNJA 4MPUA 3A87A 1T8NA 2FS8A 1EPTA 4K1SA 2HNTC 1GJ7B 4Q63A 2AIQA 2FI3E 3LGYA 1E0FD 1FY3A 1TABE 4YO9A 2BY5X 3SNCA 3W1EA 1GHXH 4I8HA 2CF8H 1D6RA 1O3MA 1QGFA 3VB3A 3A7WA 2CV3A 1GI0A 1HLTH 1VITF 1MKXK 2UUFB 2AHME 3SV7A 1O3KA 3PRBA 4OS5A 3SU5A 2IJD1 5E8EH 4X2YA 1HPGA 1K1LA 1SLVB 3AK5A 4NWKA 5LGOA 1FUJA 1ZPCA 1LVOA 2BDCA 1SGCA 1MTVA 2HVXA 1GHBG 2XOKD 2OP9A 3CNRA 1NN6A 1QA7A 1BMLA 1JRTA 2J2UA 5CHAB 3RC5A 1LO6A 1EJAA 3EAJA 2XWBI 5JBAS 2Y6TA 1PPHE 3F9EA 4CHAC 4Y8YA 4ZHAA 1GCDA 4Y7AA 2ZCKP 1O31A 3H7TA 5DP3A 1YCPH 2SGAA 2FX4A 3A8CA 1P01A 1DT2A 2GTBA 4IGDA 3U8RH 1GHAF 1NM6A 1SR5C 1QFKH 3SGAE 5EPYA 1EUFA 4E05H 1N8OB 4MG3A 1CQQA 1E1RD 1JXPA 1O2HA 1A2CH 2BLQA 1EJMA 1DSUA 2FEQH 4I31A 6GCHG 5L2ZH 1C5OH 3ZIAD 1CA8B 1PJPA 1DXWA 1G3EA 2ESTE 1JOUB 2WPJS 1O3JA 3I29A 1YYY1 1V2QT 5E0GA 2Y7XA 5KGOA 7GCHF 1TMUH 2W5EA 1LKAA 1ZZZA 2EA3A 3VG8A 3BEFB 2H9HA 1Z8JB 5AFYH 1FY8E 1LPZB 3SV9A 2FMJA 1KYNA 2OC7A 3SHAH 2Z9LA 2UUKB 2YOLA 2W3KA 1GBAA 4JK6A 1HIAB 3QGNB 3DHKH 3BTQE 3BTKE 1RRKA 2Z3EA 1PPCE 4U32A 4CBNA 1WDIA 3ZV8A 3D49H 1CT4E 1WCZA 2FOAA 4Y11E 3BG8A 1Q31A 2TPIZ 1L1JA 1YBWA 4MQAA 3SU3A 4AYYB 4MPVA 2TRMA 1UK4A 1FMGA 1GJ4H 3RXMA 2XC4A 2A7CA 2F9NA 1GDUA 2IJOB 1KLJH 2Z9KA 1C1VH 2J34A 1WV7H 4AB9A 3A7VA 3HKIB 4TWYA 4ZH8A 2PKSB 1Y3XA 1CA0B 3OEED 4Y6DA 5JBCS 1KSNA 2NU1E 3M5OA 2GV6A 1S0RA 2F9VA 1TBRH 2HGTH 1NROH 2P59A 1O3PB 1NESE 2PSXA 5FPTA 4CRCA 3DSPA 2VWOA 3ATMA 5A0CA 1O2ZA 4GUXA 2ZFSA 1Z1IA 1MZAA 1MABB 1VJ9U 4DOQA 1NZQH 1P11E 4X1RU 4KTSA 3RXFA 2PP6A 2CN0H 4AB8A 3H7OA 2LNCA 2ALPA 2P93A 1P57B 1FONA 1A3EH 5BPEA 3ZYDA 5E0HA 2V7QD 1EP6A 4Q4LA 5JPMH 4UDWH 2ZPSA 4AX9H 4R0IA 3ZYEA 3OAAD 1GHYH 4AFUA 4D7FA 1FZZA 1GBEA 3BEIB 3GDUA 4FOUC 1P2NA 3RC4A 1IQGA 1QB9A 5EQQA 2UWLA 1UHBA 2C4FH 5GPIB 2VIQA 4Q2KA 5FX6A 2JDID 2WSSD 1H8IH 1SGNE 3RXJA 1GI9B 2GCTB 1LCYA 1SVPA 1H9HE 1Y3YA 1RD3B 1NU7B 3SJOA 3VGCC 1ID5H 1GBDA 2QF5A 1C2EA 3DFLA 1D9IA 3EQ0H 1XM1A 1RTLA 2G52A 3OSYA 1QJ1B 3GY2A 1O3FA 2B7DH 4MPXA 3SUEA 1AO5A 1UMAH 3DFJA 3MH5A 3UR9A 4F55A 1A0JA 2J94A 2OBQA 2AMDA 1C5UA 2KFWA 2GDEH 2GD4B 1K1NA 1GGDC 3DT0H 1O5CB 3S7HB 5EW1H 3M3TA 3K65B 5FPYA 3KQ5A 3TK6A 1TB6H 1NFWA 1VITH 5T3HA 1O2MA 2XTTB 1OXGA 2BOKA 3UNSA 1A1RA 3OX7U 3IG6B 1TGNA 3F6UH 3KQCA 5T6DA 1IHSH 4MNYA 4YXWD 4CREA 4PROA 2BYAX 3SQHE 1TLDA 2AMPA 1BOQA 5C94A 1GMCG 3F0OA 2ILNA 3ITIA 3ZVAA 4ABFA 1O2OA 3BTGE 1UVTH 4B73A 2TGTA 3URCA 3MU5A 2C8ZB 2SGFE 1SI5H 2Y81A 3EDXB 4D9RA 8ESTE 1BQYA 1GHZA 3RXLA 1UTLM 2JKHA 1O3AA 2ZI2H 1LQEA 2VNTA 4HFPB 1ANCA 1CT2E 3TNSA 1T31A 2I6QA 2XYAA 1C1WH 1TOCB 2FOMB 2FLBH 2KAIA 1UVPA 4YT6H 3ATWA 3FN8A 1O3OA 3PO1C 3PLKA 3I77A 4OS2A 5FCKA 1G9IE 2P3UB 4KKDA 2OQ5A 3TGIE 4RT1A 1GPZA 1FI8A 4AFSA 1EAWA 3A84A 3NKKA 1KTTB 3F9HA 3A7YA 1ZRKA 1F5LA 2VB0A 4TT3D 5FXLA 1V2PT 2ZHWH 1FY1A 3C27B 1GHWH 1GHBF 1AWHB 2LPRA 4AZ2B 3QGJA 1G3CA 4WVPE 3SNBA 3MO3A 5GWZA 4LXBH 4J1YA 1C5QA 1EATA 1IQMA 3NPSA 2FOCA 1MBQA 1MU8B 5DP7A 3D62A 2W26A 2A2QH 5E2PA 1E37B 2G55A 4GSOA 3SI3H 1XX9A 1AU8A 3DSOA 1ANDA 2ZDAH 2V35A 1P3CA 1KLTA 1ETSH 1W12U 1DXPA 3A88A 1IQJA 2A4GA 2BDIA 1UCYH 1OWJA 3SQEE 1TONA 1MAXA 2Z3CA 4XOJA 5F6MA 1FY4A 1ZYOA 6GCHF 3TGKE 4D76A 5HXFA 3OYPA 2WHXA 1XXFA 2HLCA 2BZAA 2FPZA 2FP7B 4ABEA 2FTMA 3M3VA 2PW8H 1ZGIA 3EYDA 4ABAA 2JETB 4XDEA 1GDQA 1O2RA 1QHRB 5TCCA 1TFXA 1MZDA 1TX8A 4ZCNA 2EY4C 1ZSKA 5AVDA 1MKWK 2GZ7A 2ALVA 2GZ9A 1ARBA 3RM0H 1HCGA 3MFJA 2JH5D 1RIWC 3P6ZB 1O2TA 1YKTA 1F0SA 1RTFB 2ZZUH 4JCNA 2Z9JA 1HB0B 2FI5E 1E34B 1FLEE 4IC5A 1BHXF 1SGRE 4X1NU 4ZUHA 1MD7A 1UHBB 2A0QB 2G4TA 2RG3A 5CE1A 3UPEA 4X6NA 1A5IA 1C5YB 4Q80A 2NU4E 5CMXH 4FXGH 5C5NA 1CGIE 1HAIH 1GJDB 1TRNA 4AGKA 1L1GA 1ESAA 1IHTH 1ZMNA 3MNBA 1V2JT 1GBCA 1TQ7B 5TJXA 1TWXB 1BA8B 1GBHA 1DFPA 3F1SB 4KP0A 2FYRA 3ENSB 4VGCB 5DP5A 3KEEA 4X8UH 4BANB 4OS7A 3MOCA 2O8LA 4NWLA 1V2NT 3SGQE 1UVSH 4INKA 2QA9E 1BZXE 4X1SU 3UWIA 1HAYB 2G5NA 3SUFA 1Q3XA 3QDZB 1OP8A 3PO1B 3E91A 4I8GA 4BAHB 7GCHG 1VZQH 1EASA 4Q7YA 4X2VA
chains in the Genus database with same CATH topology
4JK5A 2UWPA 2ZU2A 4OS6A 4YLUA 4CRDA 1AY6H 4O9VA 4ABJA 1QTFA 1AUJA 2WPMS 1BBRH 2IN2A 1SGIB 5EQRA 4AG2A 5JB8S 2PHBA 2THFB 4NIYA 3TNTA 1K2I1 1NO9H 1A4WH 1BMMH 4TPYA 1IQFA 1GBTA 3EE0B 3O8CA 1O34A 4WMEA 1TPOA 1L2EA 2QY0B 1GJAB 5C1YA 1P12E 1JWTA 4BOHA 8GCHF 4UEHH 5FPSA 4I7YH 1AFQC 3GY7A 1V2MT 3LH1A 2FODA 1S84A 3A85A 1GBIA 1EAUA 2OC8A 2KAIB 2VGCB 5DP9A 1AWFH 4CR9A 3TU7H 1O0DH 4CH8B 2ZNKH 4ZMAH 1EX3A 1TX7A 5EXLA 3P8OA 4MPWA 1AUTC 1BBRE 5C2ZA 1SL3A 3UNRA 4Z0KA 2ZGJA 1HV7A 1S85A 3KCGH 4WH8A 3R0FA 2SGPE 1XUFA 2ZG0H 5A2MH 4B2BA 2BY9X 4K60A 4E7RG 1DLKB 1C1PA 5IDKA 2ZPRA 4Y8ZA 7LPRA 3QK1A 3MNSA 1C5RA 3ATIA 4B75A 1OYTH 2O8MA 2XW9A 1QCPA 2STBE 4XFQA 1DY9A 1F2SE 1W3CA 4TY7A 4K1TA 3CP7A 2AGEX 3V3MA 1WQVH 2QF0A 4FVDA 5F03A 3FZZA 1TOMH 2XBXA 2BQWB 1THSH 2SGDE 2BD7A 2P8OC 3M7UA 1Y5AT 3A81A 2ZFTA 2ZDKA 1CBWC 1U6QA 2D2DA 1BDAA 5GCHG 4BTIB 3GDSA 1OKXA 3RU4T 1C2FA 3O8BA 2ZECA 3T5FH 1GG6B 1V2RT 2Q6GA 2AH4X 3LU9B 1RS0A 2VWNA 2ZDMA 1TBQH 1ETRH 1RTKA 1QIXB 1UO6A 4ABIA 1C1RA 3PWCA 1MU6B 2Z9GA 1H9IE 1TMBH 1B5GH 2Z94A 2FLRH 2P3TB 5C20A 1J16A 2CHAB 5I46H 6ESTA 1MKXH 1LMWB 2HRVA 3ZZAA 4YTAA 2FM2A 3TGJE 1D3DB 2Q6DA 1GMDG 5EOKA 5ESTE 4ISOA 1GBBA 4NA8A 1BRAA 4XBBA 4XSKU 1OX1A 4INLA 3KQBA 1V6DA 1SG8B 4MLFB 2AGIX 1D3QB 1Z8IB 2PFEA 3A82A 3VFEA 1ZMJA 2FOEA 1NS3A 1SGQE 2C3SA 1P09A 4HZHA 5LH8A 3V0XA 4DT7B 3A8BA 1FN8A 4LZ4B 3AW0A 1AFQB 2OINA 4NZQA 3GCHC 2PSYA 4ESTE 1GJBB 3GY5A 1Y59T 1OP0A 2OC0A 3UY9A 4FUDA 2C8WB 3TH2H 5L6NH 2IPHA 2BY7X 2ZHDA 3C1KA 2VVUA 1NC6A 2EC9H 2FOFA 1XVOA 1B7XB 5LPEA 1WYKA 4THNH 1V2ST 1O35A 4H4FA 4FU9A 1V2VT 3GY4A 1WOFA 2BVRH 5HM9A 1D3TB 1ZSLA 4D7GA 2FIRH 3SO3A 1MAYA 4WMFA 2P95A 1ABJH 1GI2A 2ANMH 1GL1A 1GBLA 5DKMA 1BJVA 1TYNA 1V2KT 3QZRA 3RMNH 1C2JA 3SU0A 1TGSZ 2QXIA 3DA9B 3U1IB 3A8AA 1N6YA 3U8OH 3RXQA 1NT1A 2H2ZA 4BAKB 2P8OB 1ZLRA 1ZPZA 1EZSC 2ZGCA 1CBWB 1G3DA 2UWOA 3EA9A 1UVOA 1C5PA 3SHCH 4WY3A 1SSXA 1P3EA 2GKVE 3NXPA 2OQUA 2W3IA 4Y7BA 1BJUA 4BTTB 1GI5A 3FZDA 1ZPBA 4K69A 2XRCA 3FVFB 4HI3A 1EP5A 1QRZA 5H4IB 1NTPA 2J38A 2VJ1A 3SNEA 5DPAA 3U9AH 2BLWA 3V13A 1SOZA 1Y5BT 4DIHH 1FDPA 4H42U 2BXUH 3MYWA 3M7QA 1O39A 4I32A 2RDLA 1WUNH 3MI4A 5PTPA 1HXFH 3UREA 1E36B 1MQ6A 2BLOA 1PFXC 1XVMA 1KDQB 4FUGA 3STIA 2VH0A 1V2UT 1QL8A 1Y3WA 2PUXB 2VVCA 4GLYA 3RC6A 3LGUA 1ARCA 1KLIH 1KIGH 1V2TT 3ZVEA 5HMAA 4KELA 2BDYA 3D23A 1D6WA 1AD8H 2SFAA 2QAAA 1K28D 1OWDA 3A8DA 2BTCE 4BXWA 1SHYA 4CRFA 4X6PA 1EB2A 3GCHB 3KIDU 2PV9B 2Q1JA 1Z6EA 4X6OA 1Y5UT 2A4RA 1J8AA 3I78A 1CHGA 1DWEH 2CF9H 4GHQA 4DY7B 4TWWA 4H6SB 4MDSA 2D1JA 1L0ZA 2WPLS 3SUGA 4XBCA 1S81A 1HAHH 2F9UA 3A86A 2TIOA 3ZVDA 1SB1H 1ZHMA 2YNBA 2BD9A 4B76A 3SJ9A 3CS7A 1IQKA 4YM9A 1QQ4A 1SGFG 3PWBA 1DM4B 4A7IB 2B9LA 2PGBB 3SU2A 4DGJA 4UFFH 2SNVA 1FQ3A 3RP2A 3RU4E 3E0PB 4CHAB 1C1OA 1PQ5A 1PQ7A 8GCHG 1FN6A 3SNAA 5C1UA 5EPNA 3E90B 5SGAE 5GCHF 2ANYA 3BIVH 1MCTA 3H5CB 3IITA 2FYQA 4FVBA 1BITA 1H8DH 2TGDA 1QJ6B 1HAOH 1EKBB 4YOJA 1S0QA 1F92A 3ESTA 1LTOA 2GMTC 3TJOA 4DVAU 5DG6A 1GI8B 4ZHMU 1DX5M 4IMQA 4FUHA 1BRBE 1O30A 3GCNA 1AB9C 1N1LA 3FAOA 1GDNA 1SHHB 4LOYH 5ESBA 1GJ6A 4LK4A 4KTUA 1UTNA 3GY8A 2XBWA 3VXEH 3F68H 1F5RA 3MU0A 1ELDE 1A5GH 5FAHA 1GMDF 1OWKA 4UFEH 3RXRA 3RXTA 5F8TA 1LDTT 1W0YH 4ZAEA 2FI4E 4CR5A 3AW1A 1FY5A 3MO6A 1HNEE 3JZ1B 2PR3A 4UFDH 1C9TA 3Q77A 3MTYA 2A5KA 1XMNB 3RLYH 1KXBA 3BTWE 2Z6BD 1KY9A 1O5FH 4LZ1H 3T29A 5FBIA 3R3GB 1KTSB 3JZ2B 5LPFA 3BV9B 5C3NA 1C1NA 3BG4C 4FUEA 4B2CA 2FS9A 1MUEB 3UUZA 1G36A 1LVYA 4ZKRU 1MCVA 1PPEE 3M35A 1HJ8A 1O5EH 2F91A 1UTQA 4Q7XA 4YLQH 5DJ7A 1GVLA 2Y7ZA 1Z1JA 1MBMA 3BEUA 1V3XA 2QXJA 4X2WA 2YNAA 4NFFA 2DUCA 1T8LA 1Z8RA 3LPRA 3EA8A 1C5NH 1TPPA 2AYWA 1MKWH 5A8ZA 2J9NA 3RMMH 4CH2B 1HAZB 1TNHA 1ZTKA 2D8WA 1MMJN 2PTNA 4Y10E 5JDUB 2ZDLA 1LVMA 2BD8A 4O03A 4RKJB 1M9UA 4FUCA 1UK3A 4A5TS 5A8XA 4I33A 3KQEA 4U2WA 4X6MA 1HDTH 3S9CA 1DPOA 3CENA 1P04A 1QA0A 1AZ8A 3SOSA 2BQ6B 3E6PH 2ZHQH 2XC0A 3VGCB 1SC8U 2ZFRH 4B2AA 1O2LA 2AERH 3VEQB 3ATKA 3RXKA 5EGMA 1F0UA 1C2DA 1YPKH 1UJ1A 2PGQB 2SNWA 2BX3A 5TCAA 1HJAC 1GI6A 1GVZA 3U98H 1S82A 3RXGA 1GJ5H 1YPEH 4Y0ZE 1T8MA 1O3CA 1GGDB 4NA9H 1GMHG 3HK6B 1SQAA 1GWAA 2C8YB 3ZV9A 3E16B 3V12A 3T27A 1J14A 3NK8A 3MU8A 2C93B 3TPIZ 1HAPH 2AGGX 2Y5FA 4YT7H 1GL0E 2ZGHA 1NFUA 4RKOB 2TGPZ 1OSSA 3BIUH 1ZRBA 4A1VA 2P3FH 1FPHH 1NY22 2FWWA 3ZVFA 1Z8GA 1AIXH 1O2KA 4J2YB 1QB6A 1KXFA 3B8JA 5F8XA 1HRTH 3E3TA 1GBMA 1A61H 1GJ8B 3T2NA 3P8GA 2AEIH 3K9XB 4ZKNU 3UNQA 1UCYK 3PLBA 2V6NA 1CHOF 2VU8E 3UR6A 1G37A 2HNTF 2G81E 3RXVA 1W14U 2ANKH 2A7HA 1C5TA 4KGAA 1G2LA 3RXOA 2ANWA 2HOBA 2ZFPH 3V7TA 1C2LA 2QYIA 3RM2H 2WV4A 2BD5A 1IQIA 3LKWA 1YF4A 4BTUB 1AVXA 3UFAA 5JYIA 1O2XA 4ISHH 4JZEH 1P2QA 1T4UH 3BTDE 1YPGH 5JBBS 1C9PA 1C2KA 1C2GA 2HWLB 3LJOA 2ZKSA 3ZZ7A 3HATH 1EQ9A 2BY8X 4ZHLU 1DWBH 2XWAA 1O5AB 1SMFE 1ELEE 1XKAC 1YPMH 1WBGB 2J95A 2P94A 1EZUC 3Q3XA 1BTZA 5A8YA 3GY3A 1G2MA 4RSPA 3FFGA 1NU9A 3RMOH 9LPRA 3RXDA 2R2MB 1B0FA 2ZTZA 2V3HH 5L30H 2BX4A 1EAXA 4MTBA 1MTNC 1QRXA 1DANH 1J15A 1O3HA 1P10A 2NU0E 2W7UA 2GVFA 1C1SA 6CHAC 1ABIH 2BB4A 4JYUH 4K2YA 5AF9H 3QLPH 1OYQA 4M7GA 4NZLA 3LJJA 1RFNA 1ORFA 2VVVA 4H6TA 3SBKA 2FX6A 1PPGE 2O8UA 2FESH 1XXDA 3S9AA 3AASA 5J4QA 1F0TA 2J92A 1ELAA 1DVAH 4IBLH 4E7NA 1GBJA 1C5WB 1GJCB 1LHDH 1F0RA 1TE0A 3A7XA 3LH3A 5GXPA 4WF8A 6LPRA 1O2PA 1SFQB 1MTUA 3G01A 1PYTC 1FJSA 1DUAA 1HJAB 4IN1A 1T4VH 1C1UH 1BIOA 1NRRH 2ODPA 2HPPH 2ODQA 4JMYA 2BDHA 3A89A 1SLUB 1ZSJA 3K2UA 1ZTLA 2UUJB 3SU6A 1RIWB 3M37A 3S69A 3PLPA 3ZZ3A 1A0LA 5EG4A 1GCTC 3SZNA 3LIWA 1IQLA 5EXNA 3ODDA 1KDQA 1YM0A 2FOHA 5AFZH 2R3UA 2GT8A 3M7TA 1BTPA 2ZU5A 2ZFFH 3T26A 5CHAC 1RGQA 1NPMA 1QY6A 1Y3VA 2I6SA 4ISNA 9ESTA 2Z7FE 2ZU4A 3BTHE 3GYMA 3W94A 1TPSA 3WY8A 1Y8TA 1GHVH 1UTOA 4K1EA 1JRSA 4AFQA 2PWXA 1Z6JH 2ZFQH 3QO6A 3RXAA 5G4BA 1O2GH 3GY6A 3SJKA 2H9EH 2R0LA 3TIUA 5J4SA 1PQAA 2OBOA 2VWMA 2OXSA 3W95A 1N8OC 2F83A 1O37A 3FANA 1LPKB 3GOVB 1ELBA 1LPGB 3T25A 1W11U 4X0WU 1DOJA 4X2XA 1SQTA 1O3DA 1O5DH 1BUIA 2F9BH 1O5BB 1NRQH 3LGTA 3PTNA 3UTUH 4TY6A 1AKSA 1AVGH 2EI7A 1O3LA 1C1TA 5HM2A 1S6HA 1Z7KA 2V0BA 3K6YA 5HYOA 2WPIS 2Y82A 2BD2A 1HAVA 1FIWA 1SBWA 1P8VC 4CBOA 4AN7A 3GDVA 1TA6A 2PKAA 1O2WA 2G51A 3Q3YA 3P95A 3HPTB 1DS2E 1E38B 2NU2E 1TNIA 4JZDH 3GCTG 2QGRA 3EGKH 5EXMA 2RA0A 1ZGVA 4Y76A 3ATLA 4U30A 1W10U 4KTCA 5DP8A 2A2XH 1SOTA 1HAXB 5A0AE 2R0KA 3S9BA 2DE9A 1T8OA 1O32A 1AE5A 1ANEA 1OWIA 3M3SA 1S83A 1O2YA 2M5TA 4FU7A 5E0JA 3L6PA 2AS9A 2JH0D 3TJVA 1VR1H 2F9OA 2A4QA 4IN2A 3UOUA 3EA7A 2PKSC 2NU3E 4K8YA 3VPKA 1NRPH 1QRWA 3NCLA 4NGAH 2VIWA 2AIPA 4B1TA 1YLDA 3UQVA 4JYTA 1FNIA 1O3EA 3A7ZA 3RUOA 1W8BH 1GI1A 3LDXH 1DITH 3ZZ5A 1GMHF 5EW2H 1P2KA 2AFQB 7ESTE 3QTVH 2IOTA 2WV5A 1K1MA 2Z9IA 1AE8H 3ZZ6A 1HFDA 1L4DA 1F7ZA 2D26C 3ZVGA 3M36A 5C1XA 3SV2H 1QNJA 1YCPM 3MO9A 2CXVA 1N6XA 1GCTB 1P9SA 3KGPA 4MNWA 4DIIH 1KXCA 2ZCHP 1T32A 4NIXA 5I25A 1G3BA 2SGQE 1DWDH 1LHEH 1XUKA 2WUBA 3QWCH 1A3BH 1P9UA 4TYDA 2OCVB 2GT7A 3PM3A 3UWJH 2WPKS 4MVNA 2ZWLH 4JZIA 2AMQA 2HNTE 1PPBH 4GCHG 3RXUA 3RU4D 2OTVA 1S5SA 1K1PA 3LGIA 4OS1A 4DCDA 4I8JA 1EOLA 1O36A 1IAUA 2VIVA 2GX4A 2BOHB 2GCTC 1EPTC 3MH6A 1XUGA 1EJNA 1JIMA 2A32A 2QXGA 3QUMP 4DJZB 3U1JB 3HGNA 2R3YA 4B74A 2BD3A 2XNIA 3OY5U 3LGWA 5IYTA 1O33A 3ZZDA 1WTGH 1V2WT 2G4UA 1SLWB 1JMOH 1MTSA 1TGBA 1BB0B 5C67A 1HJ9A 3OTJE 1TX6A 3OU0A 1LHFH 1VCPA 2TBSA 4X1QU 3P8NA 1QBOA 3LGVA 1GI7B 1A7SA 4TPIZ 3LC5A 1BTUA 5A0BA 4O97A 4IMZA 4UD9H 2Y5GA 1C2MA 1TNKA 5JB9S 4OGXA 3B23B 5EU8A 1FIZA 1P06A 2JH6D 2XXLA 1O2SA 2OLGA 1O3NA 5DGJA 1YP9A 3QX5H 2R2WU 1JBUH 1SGTA 1BTXA 1INCA 1VGCC 2B5TB 2ZCLP 1C1QA 3VB4A 1YCPK 1CO7E 1OWHA 1BHXB 3ZZ9A 1WAYB 3E8LA 3RXHA 1X7AC 1P03A 1CHOG 1C5LH 1C5ZB 2BVSH 4E06H 1CE5A 2A7JA 2B8OH 1TBZH 1W2KH 1WQSA 2CMYA 1YPLH 4YZUA 4O3UA 2VIOA 2QIQA 1IQEA 5K7RA 2UUYA 4CRBA 1C4U2 1MQ5A 1AKSB 2QXHA 1A46H 1GI3A 5DP6A 1YPJH 4UFGH 1ZMLA 4WMDA 1HAVB 2ZU1A 3MU1A 3PMJA 3LT3A 2ULLA 2BHGA 2Q6FA 4RN6A 2PKAB 1K1OA 1GVKB 2OC1A 3PROA 2GCHG 3ODFA 2O9QA 3KNXA 3N7OA 4FUIA 4AORA